2OBKA

X-ray structure of the putative se binding protein from pseudomonas fluorescens. northeast structural genomics consortium target plr6.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
84
structure length
84
Chain Sequence
RKPEVIITYCTQCQWLLRAAWLAQELLSTFSDDLGKVSLEPATGGAFRITCDGVQIWERKADGGFPEAKVLKQRVRDQIDPERD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords SelT/selW/selH selenoprotein domain
publication title X-Ray structure of the putative Se binding protein from Pseudomonas fluorescens
rcsb
source organism Pseudomonas fluorescens
total genus 23
structure length 84
sequence length 84
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10262 Rdx Rdx family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2obkA00
3F0IA 4ZXGA 5HFGA 2VL3A 2EIQA 4EUYA 3F4RA 3RPPA 1WWJA 1YY7A 1WOUA 2IMEA 3GFKA 3TJJA 2N5FA 5C00A 1FB6A 2FWFA 1T1VA 2F51A 3UEMA 3Q74A 4BWQA 1O73A 1USBA 2ZCTA 2X8CA 4ID0A 1M99A 5IMDA 5JCGA 5ABRA 1UA5A 4ISDA 4TR1B 5ECPB 5HFIA 2H70A 3BBYA 4RI6A 2HFDA 3H4KA 3UIWA 5LD0A 2C0DA 4BL7A 4XTSA 1E6BA 3PINA 2IL3A 2P31A 11GSA 5ENUA 3F6DA 2I3YA 1KNGA 1ZYEA 4FYCA 2L4CA 4K7IA 1QMVA 1XW6A 5B6MA 2V2GA 3GX8A 5EY6A 3IC4A 4I8BA 2CQ9A 5J5NA 4HDEA 3VURA 5AN1A 4K6XA 4OD7A 1QQ2A 3EU3A 4GWRA 3ZREA 4NHZA 5JCUA 3HVSA 5G30A 3TJKA 1GNWA 1KBNA 3GRXA 2GTUA 4KUNA 1TRWA 2R4VA 1M2AA 1TI1A 1O81A 2VLVA 1FVKA 3Q18A 3C7MA 3EYTA 1XVQA 4MH3A 1TK8B 2C3QA 4OFTA 1Z7RA 1OYJA 4JR6A 5B8BA 1XXUA 2L4QA 4G2EA 4TR3A 1GH2A 4CW9A 3TOTA 3TKSE 2F8AA 1NHYA 1EV9A 4MF6A 4XRAA 4E8HA 1ABAA 3EVIA 1ZCPA 19GSA 2XC2A 1ACVA 2OKAA 1I5GA 1WIKA 1QUWA 2WZ9A 1AQVA 2ES7A 2FWEA 1WMJA 3KGKA 2C3TA 2LJRA 4EDZA 1R26A 4J57E 3JCML 3LSZA 4MA9A 5FT3A 2O8VB 4K8MA 1GUKA 3D4TA 4KE3A 4PQHA 3GMFA 3ZTLA 2LUSA 1U3IA 3ZIJA 4NPBA 3QD9A 1EEMA 2B7KA 4MJBA 5F8BA 1Z5YE 2IFQB 2IN3A 4PUAA 5D9XA 3UJ1A 3GHAA 2H6YA 1JZDA 3CRTA 1ST9A 3LJRA 2FNOA 2V1MA 2H8LA 3D4MA 3LWAA 3FKFA 2YJ7A 1EGRA 1GNEA 9GSSA 13GSA 2B5XA 3TKRA 3GIXA 4PNFA 4I2UA 4MPGA 3TKQA 1TRSA 5D93A 1T4YA 1B9YC 2OADA 1NM3A 4X1UA 4FIWA 1HYUA 2VO4A 2VCXA 5J9CA 4QL9A 4XS6A 1OC3A 2GSSA 2FUG2 3A3TA 3LG6A 3GKMA 2WCIA 4GSTA 5ELGA 1SL1B 1XWBA 3EU4A 3KM6A 1PGTA 4LMWA 3H93A 2YNXA 2B5EA 2OBIA 8GSSA 1M9AA 4POLA 4TVEA 4JRRA 1F9MA 2L5LA 4PQ1A 4TXOB 2WFCA 1BJXA 3N9JA 2GQKA 3D22A 3P90A 5FHIA 2PBJA 2R3XA 1A0FA 4KGIA 1PRXA 2LJAA 3A2VA 1PX6A 5ECHB 16GSA 3EWLA 1G7EA 4XCSA 5IPGA 1AW9A 2VD0A 2QGVA 4D73B 5D8IA 1GUHA 1YKAA 3RHCA 20GSA 3MWHA 1EOGA 2PGTA 4MF7A 4HU7A 5G5EA 2BJXA 5G2ZA 2HSYA 3QMXA 4FO5A 5IMZA 4WR5A 1EGOA 5IMFA 5IQYA 5DCHA 1GSDA 1U88A 2WDUA 4KB3A 1SKSB 4JZQA 3US3A 5DAKA 3FZ4A 5D9TA 2RM6A 3KH9A 2H6ZA 3GKKA 2IJYA 4MF5A 3EMXA 2R6KA 1XVWA 2AB6A 3RBTA 1J9BA 2GSRA 2C4JA 1XZOA 1VRSD 4PNGA 1GSYA 4TOPA 5J41A 2JSYA 3ERGA 1FG4A 1XWGA 3F9UA 2RUEA 2GLRA 5COHA 1SYXA 4KA0A 6GSUA 3IV4A 3RHBA 1GRXA 2KP1A 2XBQA 3APSA 4WR4A 1TJDA 2DC5A 2AUVA 3LXTA 3F6FA 4ZBBA 2A4VA 2H01A 1YQ1A 2DMLA 2FGXA 1J08A 1NSWA 2PVOC 3Q19A 4IELA 1AUCA 3ZLPA 4JE1A 4ECIA 2DIZA 1GULA 4K7NA 1F3BA 4EXJA 3LFLA 5EPFA 3QAGA 2I9HA 6GSSA 3UBKA 4TKYA 2GZYA 2NBSA 3CTGA 1K0MA 3KTBA 1YF1A 1EEJA 3D21A 1URMA 1O7UA 3KMOA 2F9SA 1A24A 3IXRA 4K7OA 4N30A 2J9HA 4LL1B 1R4WA 3A5WA 5AISA 4EL1A 2K8SA 3KCMA 4LL4B 1IYHA 2DBCA 5DALB 3SBCA 2HSHA 2EIRA 3EINA 1GTUA 3MDKA 1PL1A 3IK9A 1G0TA 3QDNA 1TK5B 2B1LA 3G7IA 3E3EA 3VK9A 1AAZA 2FLSA 4IQ1A 2OBKA 3KTLA 3HJPA 2GT6A 2LJKA 2H75A 1PKWA 1X9SB 1PA3A 1W4VA 2R5GA 5HQPA 2RIIA 2LNSA 4KAEA 4MJAA 4IJ3A 4GF0A 4MPFA 1JZOA 1ERVA 1Q4JA 3HJMA 4MZCA 1V9WA 2MMOA 4Q5QA 7GSSA 3ISOA 4I97A 3A2WA 1W89A 1J0FA 2YWMA 1EZKA 1PX7A 5IMVA 3H8QA 3GL3A 2MMAA 3TUEA 3WT1A 2QSIA 3EE2A 4F9ZA 5JWOB 3GSTA 5ECQB 2NTOA 3KH7A 14GSA 3ZYWA 3KJYA 4O92A 1A2MA 2LRTA 4TR0A 4TW5A 3IR4A 1N2AA 3C1RA 4F0BA 3M3MA 1ZL9A 4BVYA 3DRNA 2CAQA 1XW9A 2TIRA 4HOJA 1ZZYA 2D2ZA 1GSFA 4WKWA 3O3TA 1ERTA 3GH9A 5ECIB 4LMVA 1TOFA 2KHPA 1SL0B 3UBLA 1RW1A 3TOUA 4OMVA 1BAYA 3F4TA 4WETA 2HZFA 3L9SA 4EF0A 5DCGA 2IMDA 2M46A 1VF2A 2YZHA 3LXZA 3J7Yk 1M0UA 2AAWA 2VL2C 1PD21 2PUKC 1HNCA 2L5OA 1O85A 3UL3A 2YCDA 1SK2A 2DJ3A 1VGLA 4IW9A 4ZL8A 2CVDA 3PGTA 3BOAA 3W8JA 1FB0A 2Z9SA 1TTZA 1TRUA 4F0CA 3WGXA 3IOSA 3GTUA 2YP6A 2F8FA 4YQUA 4IP6A 4MZWA 3QAVA 1WRYA 2E2GA 2C0EA 1X9WB 1BEDA 2V32A 2H73A 3TRQA 1PN9A 1JZWA 4PX1A 2N5BA 5IO2A 4XS4B 1SJ6A 3FRCA 4JU5A 3ZFBA 2CVKA 3HKRA 1A2LA 4HQZA 2IIYA 1T3BA 3K8NA 4BPYA 1SL2B 1FAAA 1U87A 2JADA 2NDOA 3VI5A 2JZSA 3MSZA 1JLWA 1SK0A 3C8EA 2K6VA 3TKSC 4F03A 5IO0A 2VD1A 1G6WA 1EOHA 2YJHA 1MD3A 2H71A 3VWWA 2B7JA 1NW2A 2YWNA 1Q98A 1GSSA 3J7Yb 1S3AA 1MDKA 2B3SA 2WS2A 1LU4A 3CSHA 4XS1A 3H1NA 3ZL5A 2P0GA 5J4UA 1EP7A 1SYRA 3ZRDA 4IBPA 3QFAC 1OC8A 4MMMA 3ME8A 3ZZXA 2FD3A 1TU8A 5GSSA 5CAXA 4ML6A 1PL2A 2P5QA 4I6XA 3C1SA 1JHBA 4DSSB 2VCZA 1Y25A 1XPVA 2HLSA 3FY7A 2FHEA 2OE3A 2GSTA 1ZMAA 4L5OA 4IGJA 1CQHA 3QR6A 2L57A 3IA1A 3KP8A 1TXXA 2I81A 4ZB9A 4OFNA 5IIZA 1T00A 2VL2A 4EC0A 1XBSA 2C0GA 5ECSA 1YF0A 3F4SA 3VI7A 3PR8A 18GSA 3A2XA 6GSTA 1DUGA 2J23A 4JEDA 3UOMA 4IN0A 2NVLA 3M0FA 2JL4A 2CA8A 1K3LA 1KEBA 1PMTA 2B1KA 2VLUA 1K3YA 5HR0A 2H0HA 4MJCA 4F82A 2MMNA 4YH2A 4F2IA 4WF4A 3ZITA 3VLNA 5IMAA 3ZVJD 5F07A 3IBHA 4DSRA 2V41A 2K8VA 2HZEB 2JU5A 4I2TA 3I6AA 2YN1A 2GS3A 4GXZA 1M2BA 3APOA 2X64A 3GV1A 5B7CA 1JZRA 3L78A 2R2JA 3LORA 5EVOA 4HU9A 4KX4A 3E9JB 2OE0A 1K0BA 1CQGA 2C1YA 1SD9A 4PXOA 4TR1A 2XPDA 1XOBA 1IYIA 4NAXA 4OO5A 2JACA 3S9FA 4AJ6A 2EIOA 4DVCA 2LKUA 4YAPA 4LA1A 2NPBA 2H1AA 4ZBDA 5GZZB 1OC9B 4OCFA 3HZ4A 5ELAA 4ECJA 2WGRA 3TKSA 1ERUA 1K0OA 4MDCA 5KEJA 4IS0A 3AY8A 1DSBA 4L8EA 3IK7A 3CTFA 1SD8A 3ED3A 2CV4A 3N5OA 5G1LA 5ID2A 5L71A 1EP8A 2H1BA 4O7HA 4WBJA 3GYKA 3GX0A 1X0RA 4MCUA 2AYTA 2JSZA 3CYNA 3L9VA 3GURA 3GN3A 1DE1A 3ZFLA 1JFUA 1OAZA 4KH7A 1GSEA 1ILOA 3FHKA 4ILFA 5ECKB 3IRAA 3W6GA 3GNJA 2H30A 1TU7A 2DJ2A 4G19A 4RQRA 1K0AA 1SKRB 3TRPA 3LYPA 2IMIA 2DJJA 5J9BA 3FZ9A 2REMA 2WULA 1GWCA 5IMCA 5DJLA 3SWLA 3V1WA 2V6OA 4NWYA 3HA9A 1K0CA 3DMLA 3QAWA 3LGCA 1B4PA 1MEKA 3GKNA 1VF3A 1THOA 1B4QA 4H86A 2GDRA 4EKZA 4G10A 4OFMA 1YEPA 2ZNMA 5INYA 3RPNA 4IKHA 2CZ2A 3Q6OA 4AF2A 3TJBA 5D96A 2IWTA 5H5SA 3U6VA 4CDOA 1F2EA 2YANA 3GL5A 2BMXA 3M9KA 3D6IA 3HVVA 3WD6A 1UVZA 5CRDA 1Z6MA 3IHQA 2YPMA 4N0ZA 1X5DA 3UVHA 1TK0B 2IFQA 2AJQB 2H72A 4K0GA 3TJGA 3QPMA 1AQXA 5A4UA 5IPHA 3DVXA 2MBTA 5A4VA 4EDYA 4ZB8A 1QXHA 2FCHA 2DLXA 4CHSA 2CX4A 2H0GA 1I9DA 3KMNA 3KEBA 2CAIA 2K18A 1M9BA 2H0IA 3HXSA 4ZL7A 4V2MA 4OCEA 5JWRB 5CRGA 2LRCA 2PN8A 2L6CA 5B6NA 3KD0A 4Q5FA 5AIXA 4BVXA 5DBQA 1A2JA 1XWAA 4JR4A 2PPTA 1Z9HA 5IM9A 1EV4A 4PQIA 4GCIA 4HZ4A 2PU9C 2AHEA 6GSXA 3CSIA 1WP0A 2PVQA 1TW9A 4AJ7A 4XIHA 1O6JA 3RAZA 1N8JA 3NIVA 1AC1A 3F63A 3KP9A 2FA4A 2HXKA 1RK4A 4POKA 1XOAA 3LEFA 2VCVA 3VWVA 2C0FA 4FYUA 4TXOA 3QCPA 5CREA 5ECMB 1C72A 5JCWA 3IE3A 1OVNA 1ML6A 5A4WA 3CMIA 3I9V2 1SJIA 5CO3A 4POMA 3CRUA 5G1KA 3TJFA 4E8EA 1GLPA 4ZBAA 5D9WA 2IMKA 1FW1A 4RUVA 5J3RA 5CP1A 1XW5A 2DJ1A 4BWSA 4NV5A 1BX9A 3DXBA 1K0NA 4I5QA 2C3NA 4PGTA 2XPEA 4N11A 5H5RA 1ZGNA 4NXIA 2JZRA 1R5AA 2VCWA 1Z3EA 1FHEA 1T4ZA 2KOKA 1R7HA 3FZ5A 1XWKA 2G2QA 4FH8A 1U6TA 2HRFA 4KCAA 4MJEA 2X8GA 5DQYA 5GSTA 2I4AA 2HI7A 1GSUA 2PMTA 2WRTA 4IP1A 1SK1A 1MD4A 1B48A 5DQSA 1Z6NA 1SJZA 1UC7A 4ML1A 2A2SA 5GAPD 1S3DA 5DDLA 5KN0A 1FOVA 2O7KA 2QC7A 3NOFA 10GSA 1A8LA 3RDWA 4L0UA 4N10A 2B5YA 5B8AA 2P5RA 2KLXA 1OE7A 2L6DA 3P8WA 1XIYA 3HHVA 2JZTA 4EVMA 4EE0A 3VPQA 1K3OA 4MP4A 3HZ8A 5ECLB 2XHFA 4P3YB 2H6XA 1OKDA 3HVXA 3TCOA 2HRNA 4WEYA 2GZPA 1EWXA 5ECRB 1AIUA 1A23A 2KP2A 3UMAA 1K0DA 5ID2B 5A5KA 17GSA 3DIEA 4TR4A 1A0RP 1WE0A 3OR5A 2R37A 4WXTA 4EO3A 4OO4A 3CSJA 5DALA 5HR1A 3ZMLA 4KDXA 4HS1A 5DAKB 4J2FA 4L0WA 3IAM2 3FEUA 5D9VA 2YOIA 3ME7A 3W8SA 2MBSA 3KXOA 3KZQA 4NHWA 5JWQB 5LCZA 3PH9A 4NMUA 4BA7A 2DJKA 2H66A 2CZ3A 4TXVA 5AIVA 1PKZA 1V2AA 1QGVA 1ZYQB 2RM5A 2B6MA 1PSQA 3WT2A 4AJ8A 4WBRD 4ULXA 1B9XC 3D5JA 3WGEA 2LS5A 3FR3A 2OJLA 3L4NA 4MABA 2M80A 1ON4A 1V40A 2VCTA 2X99A 2GVPA 2E7PA 3E0UA 4J56E 1LJRA 2GGTA 3ERFA 22GSA 2ON5A 3C71A 3DVWA 3EURA 3M8NA 5FWGA 3I43A 3ERWA 2DSAA 6GSYA 4Q5NA 4Z7XA 2C8UA 2CX3A 4HJ2A 5CRHA 2IPAA 3TKPA 1Z7PA 3H79A 1WJKA 3G7JA 3ZMKA 2LEGA 2I1UA 4X0XA 2O87A 3HY2A 1YEXA 1YZXA 2H1DA 1F37A 2GZZA 4QL7A 4GLTA 4O5RA 4V2LA 2H19A 3MAKA 5G5FA 2DMMA 5D73A 1SKWB 1BG5A 3GUSA 3GKXA 4MLYA 5DJMA 3M9JA 4KDYA 3UARA 5CYYA 2OA7A 4POBA 4PURA 4ZL9A 5C04A 1BYEA 1V58A 3M1GA 3ZIVA 1JLVA 1HNBA 1Y6EA 2CVBA 1VF1A 2VM2A 2BTOT 3CBUA 4XHMA 5AGYA 4V1Ag 3HYPA 3HJOA 3NZNA 4ZB6A 4ZIJA 2V6KA 3IDVA 2FWGA 3EC3A 5ECNB 3BJ5A 4GRFA 2A2RA 4HJMA 2E0QA 2YV9A 3LYKA 3F3QA 1MDJA 1YKCA 5HFKA 1U3AA 2MZCA 3D0ZA 4O32A 2LQQA 4DEJA 4FYBA 4ECBA 2VLTA 2HNLA 4TRXA 2VCQA 3VWXA 2ZUPA 3FR6A 1G7OA 3IPZA 2EC4A 4XS4A 3KIJA 1H4OA 3UVTA 4V2NA 4L5LA 2HYXA 1B8XA 1ZOFA 3VPTA 2QKEA 1G6YA 1XFLA 1KTEA 1F6MC 2LTKA 3HD5A 4KNDA 2LNTA 4HEA2 2YWIA 4RI7A 3APQA 4N0VA 3F8UA 4KW6A 4RQXA 2O85A 1X5CA 5IOWA 1QK8A 2MMZA 1TP9A 2VUPA 3QFBC 4K9ZA 2GT5A 1GUMA 3P2AA 4KSMA 2H74A 1LBKA 4HUAA 1S3CA 1GL8A 2GQMA 2GQLA 5EL8A 5KN2A 1A8YA 2FWHA 3MNGA 5CNWA 3O6TA 1T7PB 2VOCA 5G31A 2LV3A 2C80A 4IHUA 2TRXA 2YWOA 1O8WA 1GLQA 3EMPA 4X43A 2XBIA 1THXA 2IMFA 3WYWA 2FY6A 2F3MA 2VL9A 4AGSA 1WPIA 2X8HA 4GSSA 2WB9A 4KCEA 1SU9A 1TDIA 3L0HA 1X9MB 6GSVA 5F06A 2VM1A 3ZVJA 1GP1A 1YDKA 5F05A 4K0NA 4DSSA 3GA4A 5KN3A 2DJ0A 4KSOA 5GAND 4LLRA 1ERWA 1F3AA 3GTUB 2OACA 1HQOA 3UAPA 2AV4A 2KUCA 3BCKA 2H1GA 4YQMA 2ON7A 3G9BA 4HQSA 1FO5A 3FZAA 2TRCP 1X5EA 3QOUA 4HI7A 4MZBA 3CXGA 4DSQA 1OKTA 4MK3A 3GSSA 4V1Ap 3DWVA 3FYGA 4IJIA 3FW2A 3L9UA 2WJUA 3VWUA 2M72A 3FR9A 1GSQA 3O76A 2RLIA 2PERA 3DEXA 1O8XA 4MH2A 4K1FA 1M2DA 1VF4A 3TDGA 1MDIA 2MYGA 5CRWA 4NV2A 5DVBA 2RUFA 4GQFA 2HZEA 3HCZA 1FVJA 1HD2A 2K9FA 1T8EB 4GTUA 4GQCA 3TB2A 4PUFC 2G0FA 1GTBA 3F3RA 3HDCA 4ZILA 3DKSA 1HNAA 4GSNA 3IAS2 1XWCA 2DIYA 3U5RE 4JBBA 3R2QA 2OE1A 2LRNA 4IVFA 1MTCA 2ALBA 5ECOB 4YAVA 1SENA 1AXDA 2HE3A 4HZ2A 4XRDA 4OWYA 2HT9A 2E2MA 1E2YA 1UN2A 2LQOA 4YQVA 1NHOA 3VFIA 2O89A 1QFNA 2CT6A 2PWJA 1OC9A 6GSWA 2YZUA 3LQ7A 3G7YA 1DE2A 3P7XA 1GTIA 3TGZA 3GH6A 5E59A 4ECCA 1GTAA 3TRXA 1DBYA 3I69A 4D73A 5KN1A 2VAFA 2LSTA 4K2DA 1OE8A 1RQMA 2FA8A 2GSQA 4G9HA 1BQ7A 3DYRA 3WGDA 2N5AA 1H75A 1V57A 1XCCA 1TRVA 12GSA 5IOXA 3BD2A 1TI3A 4Q5RA 5HR3A 1PQNA 2H76A 2VIMA 3FK8A 1YJ6A 4TN8A 5F0GA 5LNKe 5E4WA 3DD3A 1R5PA 1M7TA 2YV7A 5H5QA 4ACSA 1AQWA 1TKDB 2L59A 4KDUA 1V98A 5HR2A 4WF5A 4IQAA 4QQ7A 3C73A 3DGQA 3BCIA
chains in the Genus database with same CATH superfamily
3F0IA 4ZXGA 5HFGA 2VL3A 2EIQA 4EUYA 2R0PA 3F4RA 3RPPA 1WWJA 1YY7A 1WOUA 2IMEA 3GFKA 3TJJA 2N5FA 5C00A 1FB6A 2FWFA 1T1VA 2F51A 3UEMA 3Q74A 4BWQA 1O73A 1USBA 4G0KA 2ZCTA 2X8CA 4ID0A 1M99A 5IMDA 5JCGA 5ABRA 1UA5A 4ISDA 4TR1B 5ECPB 5HFIA 2HRKA 2H70A 3BBYA 4RI6A 2HFDA 3H4KA 3UIWA 5LD0A 2C0DA 4BL7A 4XTSA 1E6BA 3PINA 2IL3A 2P31A 11GSA 5ENUA 3F6DA 2I3YA 4A5PA 1KNGA 1ZYEA 4FYCA 2L4CA 2DKIA 4K7IA 1QMVA 1XW6A 5B6MA 2V2GA 3GX8A 5EY6A 3IC4A 4I8BA 2CQ9A 5J5NA 4HDEA 3VURA 5AN1A 4K6XA 4OD7A 1QQ2A 3EU3A 4GWRA 3ZREA 4NHZA 5JCUA 3HVSA 5G30A 3TJKA 2R0GA 1GNWA 1KBNA 3GRXA 2GTUA 4KUNA 1TRWA 2R4VA 1M2AA 1TI1A 1O81A 2VLVA 1FVKA 3Q18A 3C7MA 3EYTA 1XVQA 4MH3A 1TK8B 2C3QA 4OFTA 1Z7RA 1OYJA 4JR6A 5B8BA 1XXUA 2L4QA 4G2EA 4TR3A 1GH2A 4CW9A 3TOTA 3TKSE 2F8AA 1NHYA 1EV9A 4MF6A 4XRAA 4E8HA 1ABAA 3EVIA 1ZCPA 2X4AA 5KOWA 19GSA 2XC2A 1ACVA 2OKAA 1I5GA 1WIKA 1QUWA 2WZ9A 1AQVA 2ES7A 2FWEA 1WMJA 3KGKA 2C3TA 2LJRA 4EDZA 1R26A 4J57E 4PTSA 3JCML 3LSZA 4MA9A 5FT3A 2O8VB 4K8MA 1GUKA 3D4TA 4KE3A 4PQHA 3GMFA 3ZTLA 2LUSA 1U3IA 3ZIJA 4NPBA 3QD9A 1EEMA 2B7KA 4MJBA 5F8BA 1Z5YE 4USSA 2IFQB 2IN3A 4PUAA 5D9XA 3UJ1A 3GHAA 2H6YA 1JZDA 3CRTA 1ST9A 3LJRA 4BIKA 2FNOA 2V1MA 2H8LA 3D4MA 3LWAA 3FKFA 2YJ7A 1EGRA 1GNEA 9GSSA 13GSA 2B5XA 3TKRA 3GIXA 4PNFA 4I2UA 4MPGA 3TKQA 1TRSA 5D93A 1T4YA 1B9YC 2OADA 1NM3A 4X1UA 4FIWA 1HYUA 2VO4A 2VCXA 5J9CA 4QL9A 4BVXB 4XS6A 5KOXA 1OC3A 2GSSA 2FUG2 3A3TA 3LG6A 3GKMA 3HVNA 2WCIA 4GSTA 5ELGA 1SL1B 1XWBA 3EU4A 3KM6A 1PGTA 4LMWA 3H93A 4G0IA 2YNXA 4ICYA 2B5EA 2OBIA 8GSSA 1M9AA 4POLA 4TVEA 4JRRA 1F9MA 2L5LA 4PQ1A 4TXOB 2WFCA 4O5UA 1BJXA 4K5SA 3N9JA 2GQKA 3D22A 3P90A 5FHIA 2PBJA 2R3XA 1A0FA 4KGIA 1PRXA 2LJAA 3A2VA 1PX6A 5ECHB 16GSA 3EWLA 1G7EA 4XCSA 5IPGA 1AW9A 2VD0A 2QGVA 4D73B 5D8IA 1GUHA 1YKAA 3RHCA 20GSA 3MWHA 1EOGA 2PGTA 4MF7A 4O5QA 4HU7A 5G5EA 2BJXA 5G2ZA 2HSYA 3QMXA 4FO5A 2R0CA 5IMZA 4WR5A 1EGOA 5IMFA 5IQYA 5DCHA 1GSDA 1U88A 2WDUA 4KB3A 1SKSB 4JZQA 3US3A 5DAKA 3FZ4A 3KH9A 2RM6A 5D9TA 2H6ZA 3GKKA 2IJYA 4MF5A 3EMXA 2R6KA 1XVWA 2AB6A 3RBTA 3MYDA 1J9BA 2GSRA 2C4JA 1XZOA 1VRSD 4PNGA 1GSYA 4Z2UA 4TOPA 5J41A 2JSYA 4MNNA 3ERGA 1FG4A 1XWGA 3F9UA 2RUEA 2GLRA 5COHA 1SYXA 4KA0A 6GSUA 3IV4A 3RHBA 1GRXA 2KP1A 2XBQA 3APSA 4WR4A 4EIQA 1TJDA 2DC5A 2AUVA 3LXTA 3F6FA 4ZBBA 2A4VA 2H01A 1YQ1A 2DMLA 2FGXA 1J08A 1NSWA 2PVOC 3Q19A 4IELA 1AUCA 3ZLPA 4JE1A 4ECIA 2DIZA 1GULA 4K7NA 1F3BA 4EXJA 3LFLA 5EPFA 3QAGA 2I9HA 6GSSA 3UBKA 4TKYA 2GZYA 2NBSA 3CTGA 1K0MA 3KTBA 1YF1A 4KF9A 1EEJA 3D21A 1URMA 1O7UA 3KMOA 2F9SA 1A24A 3IXRA 4K7OA 4N30A 2J9HA 4LL1B 1R4WA 3A5WA 5AISA 4EL1A 2K8SA 3KCMA 4LL4B 1IYHA 2DBCA 5DALB 3SBCA 2HSHA 2EIRA 3EINA 1GTUA 3MDKA 1PL1A 3IK9A 1G0TA 3QDNA 1TK5B 2B1LA 3G7IA 3E3EA 3PPUA 3VK9A 1AAZA 2FLSA 4IQ1A 2OBKA 3KTLA 3HJPA 2GT6A 2LJKA 2H75A 1PKWA 1X9SB 1PA3A 1W4VA 2R5GA 5HQPA 2RIIA 2LNSA 4KAEA 4MJAA 4IJ3A 4GF0A 4MPFA 1JZOA 1ERVA 1Q4JA 3HJMA 4MZCA 1V9WA 2MMOA 2UZ8A 4Q5QA 7GSSA 3ISOA 4I97A 3A2WA 1W89A 1J0FA 2YWMA 1EZKA 1PX7A 5IMVA 3H8QA 3GL3A 2MMAA 3TUEA 3WT1A 2QSIA 3EE2A 1M3IA 4F9ZA 5JWOB 3GSTA 5ECQB 2NTOA 3KH7A 14GSA 3ZYWA 3KJYA 4O92A 1A2MA 2LRTA 4TR0A 4TW5A 3IR4A 1N2AA 3C1RA 4F0BA 3M3MA 1ZL9A 4BVYA 3DRNA 2CAQA 1XW9A 2TIRA 4HOJA 1ZZYA 2D2ZA 1GSFA 4WKWA 3O3TA 1ERTA 3GH9A 5ECIB 4LMVA 1TOFA 2KHPA 1SL0B 3UBLA 1RW1A 3TOUA 4OMVA 1BAYA 3F4TA 1XG8A 4WETA 2HZFA 3L9SA 4EF0A 5DCGA 2IMDA 2M46A 1VF2A 2YZHA 3LXZA 3J7Yk 1M0UA 2AAWA 2VL2C 1PD21 2PUKC 1HNCA 2L5OA 1O85A 3UL3A 2YCDA 1SK2A 2DJ3A 1VGLA 4IW9A 4ZL8A 2CVDA 3PGTA 3BOAA 3W8JA 1FB0A 2Z9SA 1TTZA 1TRUA 4F0CA 3WGXA 3IOSA 3GTUA 2YP6A 2F8FA 4YQUA 4IP6A 2HRAA 4MZWA 3QAVA 1WRYA 2E2GA 2C0EA 1X9WB 1BEDA 2V32A 2H73A 3TRQA 1PN9A 1JZWA 4PX1A 2N5BA 5IO2A 4XS4B 1SJ6A 3FRCA 4JU5A 3ZFBA 2CVKA 3HKRA 1A2LA 4HQZA 2IIYA 1T3BA 3K8NA 4BPYA 1SL2B 3EPTA 1FAAA 1U87A 2JADA 2NDOA 3VI5A 2JZSA 3MSZA 1JLWA 1SK0A 3C8EA 2K6VA 3TKSC 4F03A 5IO0A 2VD1A 1G6WA 1EOHA 2YJHA 1MD3A 2H71A 3VWWA 2B7JA 1NW2A 2YWNA 1Q98A 1GSSA 3J7Yb 1S3AA 1MDKA 2B3SA 2WS2A 1LU4A 3CSHA 4XS1A 3H1NA 4EIPA 3ZL5A 2P0GA 5J4UA 2X49A 1EP7A 1SYRA 3ZRDA 4IBPA 3QFAC 1OC8A 4MMMA 3ME8A 3ZZXA 2FD3A 3CQFA 1TU8A 5GSSA 5CAXA 4ML6A 1PL2A 2P5QA 4I6XA 3C1SA 1JHBA 4DSSB 2VCZA 1Y25A 1XPVA 2HLSA 3FY7A 2FHEA 2OE3A 2GSTA 3LW9A 1ZMAA 4L5OA 4IGJA 1CQHA 3QR6A 2L57A 3IA1A 3KP8A 1TXXA 2I81A 4ZB9A 4OFNA 5IIZA 1T00A 2VL2A 4EC0A 1XBSA 2C0GA 5ECSA 1YF0A 3F4SA 3VI7A 3PR8A 18GSA 3A2XA 6GSTA 1DUGA 2J23A 4JEDA 3UOMA 4IN0A 2NVLA 3M0FA 2JL4A 2CA8A 1K3LA 1KEBA 1PMTA 2B1KA 2VLUA 1K3YA 5HR0A 2H0HA 4MJCA 4F82A 2MMNA 4YH2A 4F2IA 4WF4A 3ZITA 3VLNA 5IMAA 3ZVJD 5F07A 3IBHA 4DSRA 2V41A 2K8VA 2HZEB 3R3EA 2JU5A 4I2TA 3I6AA 2YN1A 2GS3A 4GXZA 1M2BA 3APOA 2X64A 3GV1A 5B7CA 1JZRA 3L78A 4K5RA 2R2JA 3LORA 5EVOA 4HU9A 4KX4A 3E9JB 2OE0A 1K0BA 1CQGA 2C1YA 1SD9A 4PXOA 4TR1A 2XPDA 1XOBA 1IYIA 4NAXA 4OO5A 2JACA 3S9FA 4AJ6A 2EIOA 4DVCA 2LKUA 4K2XA 4YAPA 4LA1A 2NPBA 2H1AA 2QA1A 4ZBDA 5GZZB 1OC9B 4OCFA 3HZ4A 5ELAA 4ECJA 2WGRA 3TKSA 1ERUA 1K0OA 4MDCA 5KEJA 4IS0A 3AY8A 1DSBA 4L8EA 3IK7A 3CTFA 1SD8A 3ED3A 2CV4A 3N5OA 5G1LA 5ID2A 5L71A 1EP8A 2H1BA 4O7HA 4WBJA 3GYKA 3GX0A 1X0RA 4MCUA 2AYTA 2JSZA 3CYNA 3L9VA 3GURA 3GN3A 1DE1A 3ZFLA 1JFUA 1OAZA 4KH7A 4CY6A 1GSEA 1ILOA 3FHKA 4ILFA 5ECKB 3IRAA 3W6GA 3GNJA 2H30A 1TU7A 2DJ2A 4G19A 4RQRA 1K0AA 1PFOA 3TRPA 1SKRB 3LYPA 2IMIA 5BRTA 2DJJA 5J9BA 3FZ9A 2REMA 2WULA 1GWCA 5IMCA 5DJLA 3SWLA 3V1WA 2V6OA 4NWYA 3HA9A 1K0CA 3DMLA 3QAWA 3LGCA 1B4PA 1MEKA 3GKNA 1VF3A 1THOA 1B4QA 4H86A 2GDRA 4EKZA 4G10A 4OFMA 1YEPA 2ZNMA 5INYA 3RPNA 4IKHA 4YKFA 1S3RA 2CZ2A 3Q6OA 4AF2A 3TJBA 5D96A 2IWTA 5H5SA 3U6VA 4CDOA 1F2EA 2YANA 3GL5A 2BMXA 3M9KA 1ZYNA 3D6IA 3HVVA 3WD6A 1UVZA 5CRDA 1Z6MA 3IHQA 2YPMA 1M3JA 4N0ZA 1X5DA 3UVHA 4BL7B 1TK0B 2IFQA 2AJQB 2H72A 4K0GA 3TJGA 3QPMA 1AQXA 4Z2RA 5A4UA 5IPHA 3DVXA 2MBTA 5A4VA 4EDYA 4ZB8A 1QXHA 2FCHA 2DLXA 4CHSA 2CX4A 2H0GA 1I9DA 3KMNA 3KEBA 2CAIA 2K18A 1M9BA 2H0IA 3HXSA 4ZL7A 4V2MA 4OCEA 5JWRB 5CRGA 2LRCA 2PN8A 2L6CA 5B6NA 3KD0A 4Q5FA 5AIXA 4BVXA 5DBQA 1A2JA 1XWAA 4JR4A 2PPTA 1Z9HA 5IM9A 1EV4A 4PQIA 4GCIA 4HZ4A 2PU9C 2AHEA 6GSXA 3CSIA 1WP0A 2PVQA 1TW9A 4AJ7A 4XIHA 1O6JA 3RAZA 1N8JA 3NIVA 1AC1A 3F63A 3KP9A 2FA4A 2HXKA 1RK4A 4POKA 1XOAA 3LEFA 2VCVA 3VWVA 2C0FA 4FYUA 4TXOA 3QCPA 5CREA 5ECMB 1C72A 5JCWA 3IE3A 1OVNA 1ML6A 5A4WA 3CMIA 3I9V2 1SJIA 5CO3A 4POMA 3CRUA 5G1KA 3TJFA 1FOHA 4E8EA 1GLPA 4ZBAA 5D9WA 2IMKA 1FW1A 4RUVA 5J3RA 5CP1A 1XW5A 2DJ1A 4BWSA 4NV5A 1BX9A 3DXBA 1K0NA 4I5QA 2C3NA 4PGTA 2XPEA 4N11A 5H5RA 1ZGNA 4NXIA 2JZRA 1R5AA 2VCWA 1Z3EA 1FHEA 1T4ZA 2KOKA 1R7HA 3FZ5A 1XWKA 2G2QA 4FH8A 1U6TA 2HRFA 4KCAA 4MJEA 2X8GA 5DQYA 5GSTA 2I4AA 2HI7A 1GSUA 4G0LA 2PMTA 2WRTA 4IP1A 1SK1A 3IC8A 1MD4A 1B48A 5DQSA 1Z6NA 1SJZA 1UC7A 4ML1A 2A2SA 5GAPD 1S3DA 5DDLA 5KN0A 1FOVA 2O7KA 2QC7A 3NOFA 10GSA 1A8LA 3RDWA 4L0UA 4N10A 2B5YA 5B8AA 2P5RA 2KLXA 1OE7A 2L6DA 3P8WA 1XIYA 3HHVA 2QA2A 2JZTA 4EVMA 5BMUA 4EE0A 3VPQA 1K3OA 4MP4A 3HZ8A 5ECLB 2XHFA 4P3YB 2H6XA 1OKDA 3HVXA 3TCOA 2HRNA 4WEYA 2GZPA 4CY8A 1EWXA 5ECRB 1AIUA 1A23A 2KP2A 3UMAA 1K0DA 5ID2B 5A5KA 17GSA 3DIEA 4TR4A 1A0RP 1WE0A 3OR5A 2R37A 4WXTA 4EO3A 4OO4A 3CSJA 5DALA 5HR1A 3ZMLA 4KDXA 4HS1A 5DAKB 4J2FA 4L0WA 3IAM2 2A2PA 3FEUA 5D9VA 2YOIA 3ME7A 3W8SA 2MBSA 3KXOA 3KZQA 4NHWA 5JWQB 5LCZA 3PH9A 4NMUA 4BA7A 2DJKA 2H66A 2CZ3A 4TXVA 5AIVA 1PKZA 1V2AA 1QGVA 1ZYQB 2RM5A 2B6MA 1PSQA 3WT2A 4AJ8A 2A4HA 4WBRD 4ULXA 1B9XC 3D5JA 3WGEA 2LS5A 3FR3A 3IHGA 2OJLA 3L4NA 4MABA 2M80A 1ON4A 1V40A 2VCTA 2X99A 2GVPA 2E7PA 3E0UA 4J56E 1LJRA 2GGTA 3ERFA 22GSA 2ON5A 3C71A 3DVWA 3EURA 3M8NA 5FWGA 3I43A 3ERWA 2DSAA 6GSYA 4Q5NA 4Z7XA 2C8UA 2CX3A 4HJ2A 5CRHA 2IPAA 3TKPA 2DKHA 1Z7PA 3H79A 1WJKA 3G7JA 3ZMKA 2LEGA 2I1UA 4X0XA 2O87A 3HY2A 1YEXA 2HSMA 1YZXA 2H1DA 1F37A 2GZZA 4QL7A 4GLTA 4O5RA 4V2LA 3FMWA 3A5IA 2H19A 3MAKA 5G5FA 2DMMA 5D73A 1SKWB 1BG5A 3GUSA 3GKXA 4MLYA 5DJMA 3M9JA 4KDYA 3UARA 5CYYA 2OA7A 4POBA 4PURA 4ZL9A 5C04A 1BYEA 1V58A 3M1GA 3ZIVA 1JLVA 1HNBA 1Y6EA 2CVBA 1VF1A 2VM2A 2BTOT 3CBUA 4XHMA 5AGYA 4V1Ag 3HYPA 3HJOA 3NZNA 4ZB6A 1ZYPA 4ZIJA 2V6KA 3IDVA 2FWGA 3EC3A 5ECNB 3BJ5A 4GRFA 2A2RA 4HJMA 2E0QA 2YV9A 3LYKA 3F3QA 1MDJA 1YKCA 5HFKA 1U3AA 2MZCA 3D0ZA 4O32A 2LQQA 4DEJA 4FYBA 4ECBA 2VLTA 2HNLA 4TRXA 2VCQA 3VWXA 2ZUPA 3FR6A 1G7OA 3IPZA 2EC4A 4XS4A 3KIJA 1H4OA 3UVTA 4V2NA 4L5LA 2HYXA 1B8XA 1ZOFA 3VPTA 2QKEA 1G6YA 1XFLA 1KTEA 1F6MC 2LTKA 3HD5A 4KNDA 2LNTA 4BVYB 4HEA2 2YWIA 4RI7A 3APQA 4N0VA 3F8UA 4KW6A 4YKGA 4RQXA 2O85A 1X5CA 4FQUA 5IOWA 1QK8A 2MMZA 1TP9A 2VUPA 3QFBC 4K9ZA 2GT5A 1GUMA 3P2AA 4KSMA 2H74A 1LBKA 4HUAA 1S3CA 1GL8A 2GQMA 2GQLA 5EL8A 5KN2A 1A8YA 2FWHA 3MNGA 5CNWA 3O6TA 1T7PB 2VOCA 5G31A 2LV3A 2C80A 4IHUA 2TRXA 2YWOA 1O8WA 1GLQA 3EMPA 4X43A 2XBIA 1THXA 2IMFA 3WYWA 2FY6A 2F3MA 2VL9A 4AGSA 1WPIA 2X8HA 4GSSA 2WB9A 4KCEA 1SU9A 1TDIA 3L0HA 1X9MB 6GSVA 5F06A 2VM1A 3ZVJA 1GP1A 1YDKA 5F05A 4K0NA 4DSSA 3GA4A 5KN3A 2DJ0A 3MIXA 4KSOA 5GAND 4LLRA 1ERWA 1F3AA 3GTUB 2OACA 1HQOA 3UAPA 2AV4A 2KUCA 3BCKA 2H1GA 4YQMA 2ON7A 3G9BA 4HQSA 1FO5A 3FZAA 2TRCP 1X5EA 3QOUA 4HI7A 4MZBA 3CXGA 4DSQA 1OKTA 4MK3A 3GSSA 4V1Ap 3DWVA 3FYGA 4IJIA 3FW2A 3L9UA 2WJUA 3VWUA 2M72A 3FR9A 1GSQA 3O76A 2RLIA 2PERA 3DEXA 4HSCX 1O8XA 4MH2A 4K1FA 1M2DA 1VF4A 3TDGA 1MDIA 2MYGA 5CRWA 4X4JA 4NV2A 5DVBA 2RUFA 4GQFA 2HZEA 3HCZA 1FVJA 1HD2A 2K9FA 1T8EB 4GTUA 4GQCA 3TB2A 4PUFC 2G0FA 1GTBA 3F3RA 3HDCA 4ZILA 3DKSA 1HNAA 4GSNA 3IAS2 1XWCA 2DIYA 3U5RE 4JBBA 3R2QA 2OE1A 2LRNA 4IVFA 1MTCA 2ALBA 5ECOB 4YAVA 1SENA 1AXDA 2HE3A 4HZ2A 4XRDA 4OWYA 2HT9A 2E2MA 1E2YA 1UN2A 2LQOA 4YQVA 1NHOA 3VFIA 2O89A 1QFNA 2CT6A 2PWJA 1OC9A 6GSWA 2YZUA 3LQ7A 3G7YA 1DE2A 3P7XA 1GTIA 3TGZA 3GH6A 5E59A 4ECCA 1GTAA 3TRXA 1DBYA 3I69A 4D73A 5KN1A 2VAFA 2LSTA 4K2DA 1OE8A 4Z2TA 1RQMA 2FA8A 2GSQA 4G9HA 1BQ7A 3DYRA 3WGDA 2N5AA 1H75A 1V57A 1XCCA 1TRVA 12GSA 5IOXA 3BD2A 1TI3A 4Q5RA 5HR3A 1PQNA 2H76A 2VIMA 3FK8A 1YJ6A 4TN8A 5F0GA 5LNKe 5E4WA 3DD3A 1R5PA 1M7TA 2YV7A 5H5QA 4ACSA 1AQWA 1TKDB 2L59A 4KDUA 1PN0A 1V98A 5HR2A 4WF5A 4IQAA 4QQ7A 3C73A 3DGQA 3BCIA
chains in the Genus database with same CATH topology
3F0IA 4ZXGA 5HFGA 2VL3A 2EIQA 4EUYA 2R0PA 3F4RA 3RPPA 1WWJA 1YY7A 1WOUA 2IMEA 3GFKA 3TJJA 2N5FA 5C00A 1FB6A 2FWFA 1T1VA 2F51A 3UEMA 3Q74A 4BWQA 1O73A 1USBA 4G0KA 2ZCTA 2X8CA 4ID0A 1M99A 5IMDA 5JCGA 5ABRA 1UA5A 4ISDA 4TR1B 5ECPB 5HFIA 2HRKA 2H70A 3BBYA 4RI6A 2HFDA 3H4KA 3UIWA 5LD0A 2C0DA 4BL7A 4XTSA 1E6BA 3PINA 2IL3A 2P31A 11GSA 5ENUA 3F6DA 2I3YA 4A5PA 1KNGA 1ZYEA 4FYCA 2L4CA 2DKIA 4K7IA 1QMVA 1XW6A 5B6MA 2V2GA 3GX8A 5EY6A 3IC4A 4I8BA 2CQ9A 5J5NA 4HDEA 3VURA 5AN1A 4K6XA 4OD7A 1QQ2A 3EU3A 4GWRA 3ZREA 4NHZA 5JCUA 3HVSA 5G30A 3TJKA 2R0GA 1GNWA 1KBNA 3GRXA 2GTUA 4KUNA 1TRWA 2R4VA 1M2AA 1TI1A 1O81A 2VLVA 1FVKA 3Q18A 3C7MA 3EYTA 1XVQA 4MH3A 1TK8B 2C3QA 4OFTA 1Z7RA 1OYJA 4JR6A 5B8BA 1XXUA 2L4QA 4G2EA 4TR3A 1GH2A 4CW9A 3TOTA 3TKSE 2F8AA 1NHYA 1EV9A 4MF6A 4XRAA 4E8HA 1ABAA 3EVIA 1ZCPA 2X4AA 5KOWA 19GSA 2XC2A 1ACVA 2OKAA 1I5GA 1WIKA 1QUWA 2WZ9A 1AQVA 2ES7A 2FWEA 1WMJA 3KGKA 2C3TA 2LJRA 4EDZA 1R26A 4J57E 4PTSA 3JCML 3LSZA 4MA9A 5FT3A 2O8VB 4K8MA 1GUKA 3D4TA 4KE3A 4PQHA 3GMFA 3ZTLA 2LUSA 1U3IA 3ZIJA 4NPBA 3QD9A 1EEMA 2B7KA 4MJBA 5F8BA 1Z5YE 4USSA 2IFQB 2IN3A 4PUAA 5D9XA 3UJ1A 3GHAA 2H6YA 1JZDA 3CRTA 1ST9A 3LJRA 2FNOA 2V1MA 2H8LA 3D4MA 3LWAA 3FKFA 2YJ7A 1EGRA 1GNEA 9GSSA 13GSA 2B5XA 3TKRA 3GIXA 4PNFA 4I2UA 4MPGA 3TKQA 1TRSA 5D93A 1T4YA 1B9YC 2OADA 1NM3A 4X1UA 4FIWA 1HYUA 2VO4A 2VCXA 5J9CA 4QL9A 4BVXB 4XS6A 5KOXA 1OC3A 2GSSA 2FUG2 3A3TA 3LG6A 3GKMA 2WCIA 4GSTA 5ELGA 1SL1B 1XWBA 3EU4A 3KM6A 1PGTA 4LMWA 3H93A 4G0IA 2YNXA 4ICYA 2B5EA 2OBIA 8GSSA 1M9AA 4POLA 4TVEA 4JRRA 1F9MA 2L5LA 4PQ1A 4TXOB 2WFCA 4O5UA 1BJXA 4K5SA 3N9JA 2GQKA 3D22A 3P90A 5FHIA 2PBJA 2R3XA 1A0FA 4KGIA 1PRXA 2LJAA 3A2VA 1PX6A 5ECHB 16GSA 3EWLA 1G7EA 4XCSA 5IPGA 1AW9A 2VD0A 2QGVA 4D73B 5D8IA 1GUHA 1YKAA 3RHCA 20GSA 3MWHA 1EOGA 2PGTA 4MF7A 4O5QA 4HU7A 5G5EA 2BJXA 5G2ZA 2HSYA 3QMXA 4FO5A 2R0CA 5IMZA 4WR5A 1EGOA 5IMFA 5IQYA 5DCHA 1GSDA 1U88A 2WDUA 4KB3A 1SKSB 4JZQA 3US3A 5DAKA 3FZ4A 3KH9A 2RM6A 5D9TA 2H6ZA 3GKKA 2IJYA 4MF5A 3EMXA 2R6KA 1XVWA 2AB6A 3RBTA 3MYDA 1J9BA 2GSRA 2C4JA 1XZOA 1VRSD 4PNGA 1GSYA 4Z2UA 4TOPA 5J41A 2JSYA 4MNNA 3ERGA 1FG4A 1XWGA 3F9UA 2RUEA 2GLRA 5COHA 1SYXA 4KA0A 6GSUA 3IV4A 3RHBA 1GRXA 2KP1A 2XBQA 3APSA 4WR4A 4EIQA 1TJDA 2DC5A 2AUVA 3LXTA 3F6FA 4ZBBA 2A4VA 2H01A 1YQ1A 2DMLA 2FGXA 1J08A 1NSWA 2PVOC 3Q19A 4IELA 1AUCA 3ZLPA 4JE1A 4ECIA 2DIZA 1GULA 4K7NA 1F3BA 4EXJA 3LFLA 5EPFA 3QAGA 2I9HA 6GSSA 3UBKA 4TKYA 2GZYA 2NBSA 3CTGA 1K0MA 3KTBA 1YF1A 4KF9A 1EEJA 3D21A 1URMA 1O7UA 3KMOA 2F9SA 1A24A 3IXRA 4K7OA 4N30A 2J9HA 4LL1B 1R4WA 3A5WA 5AISA 4EL1A 2K8SA 3KCMA 4LL4B 1IYHA 2DBCA 5DALB 3SBCA 2HSHA 2EIRA 3EINA 1GTUA 3MDKA 1PL1A 3IK9A 1G0TA 3QDNA 1TK5B 2B1LA 3G7IA 3E3EA 3PPUA 3VK9A 1AAZA 2FLSA 4IQ1A 2OBKA 3KTLA 3HJPA 2GT6A 2LJKA 2H75A 1PKWA 1X9SB 1PA3A 1W4VA 2R5GA 5HQPA 2RIIA 2LNSA 4KAEA 4MJAA 4IJ3A 4GF0A 4MPFA 1JZOA 1ERVA 1Q4JA 3HJMA 4MZCA 1V9WA 2MMOA 2UZ8A 4Q5QA 7GSSA 3ISOA 4I97A 3A2WA 1W89A 1J0FA 2YWMA 1EZKA 1PX7A 5IMVA 3H8QA 3GL3A 2MMAA 3TUEA 3WT1A 2QSIA 3EE2A 4F9ZA 5JWOB 3GSTA 5ECQB 2NTOA 3KH7A 14GSA 3ZYWA 3KJYA 4O92A 1A2MA 2LRTA 4TR0A 4TW5A 3IR4A 1N2AA 3C1RA 4F0BA 3M3MA 1ZL9A 4BVYA 3DRNA 2CAQA 1XW9A 2TIRA 4HOJA 1ZZYA 2D2ZA 1GSFA 4WKWA 3O3TA 1ERTA 3GH9A 5ECIB 4LMVA 1TOFA 2KHPA 1SL0B 3UBLA 1RW1A 3TOUA 4OMVA 1BAYA 3F4TA 4WETA 2HZFA 3L9SA 4EF0A 5DCGA 2IMDA 2M46A 1VF2A 2YZHA 3LXZA 3J7Yk 1M0UA 2AAWA 2VL2C 1PD21 2PUKC 1HNCA 2L5OA 1O85A 3UL3A 2YCDA 1SK2A 2DJ3A 1VGLA 4IW9A 4ZL8A 2CVDA 3PGTA 3BOAA 3W8JA 1FB0A 2Z9SA 1TTZA 1TRUA 4F0CA 3WGXA 3IOSA 3GTUA 2YP6A 2F8FA 4YQUA 4IP6A 2HRAA 4MZWA 3QAVA 1WRYA 2E2GA 2C0EA 1X9WB 1BEDA 2V32A 2H73A 3TRQA 1PN9A 1JZWA 4PX1A 2N5BA 5IO2A 4XS4B 1SJ6A 3FRCA 4JU5A 3ZFBA 2CVKA 3HKRA 1A2LA 4HQZA 2IIYA 1T3BA 3K8NA 4BPYA 1SL2B 3EPTA 1FAAA 1U87A 2JADA 2NDOA 3VI5A 2JZSA 3MSZA 1JLWA 1SK0A 3C8EA 2K6VA 3TKSC 4F03A 5IO0A 2VD1A 1G6WA 1EOHA 2YJHA 1MD3A 2H71A 3VWWA 2B7JA 1NW2A 2YWNA 1Q98A 1GSSA 3J7Yb 1S3AA 1MDKA 2B3SA 2WS2A 1LU4A 3CSHA 4XS1A 3H1NA 4EIPA 3ZL5A 2P0GA 5J4UA 2X49A 1EP7A 1SYRA 3ZRDA 4IBPA 3QFAC 1OC8A 4MMMA 3ME8A 3ZZXA 2FD3A 1TU8A 5GSSA 5CAXA 4ML6A 1PL2A 2P5QA 4I6XA 3C1SA 1JHBA 4DSSB 2VCZA 1Y25A 1XPVA 2HLSA 3FY7A 2FHEA 2OE3A 2GSTA 3LW9A 1ZMAA 4L5OA 4IGJA 1CQHA 3QR6A 2L57A 3IA1A 3KP8A 1TXXA 2I81A 4ZB9A 4OFNA 5IIZA 1T00A 2VL2A 4EC0A 1XBSA 2C0GA 5ECSA 1YF0A 3F4SA 3VI7A 3PR8A 18GSA 3A2XA 6GSTA 1DUGA 2J23A 4JEDA 3UOMA 4IN0A 2NVLA 3M0FA 2JL4A 2CA8A 1K3LA 1KEBA 1PMTA 2B1KA 2VLUA 1K3YA 5HR0A 2H0HA 4MJCA 4F82A 2MMNA 4YH2A 4F2IA 4WF4A 3ZITA 3VLNA 5IMAA 3ZVJD 5F07A 3IBHA 4DSRA 2V41A 2K8VA 2HZEB 3R3EA 2JU5A 4I2TA 3I6AA 2YN1A 2GS3A 4GXZA 1M2BA 3APOA 2X64A 3GV1A 5B7CA 1JZRA 3L78A 4K5RA 2R2JA 3LORA 5EVOA 4HU9A 4KX4A 3E9JB 2OE0A 1K0BA 1CQGA 2C1YA 1SD9A 4PXOA 4TR1A 2XPDA 1XOBA 1IYIA 4NAXA 4OO5A 2JACA 3S9FA 4AJ6A 2EIOA 4DVCA 2LKUA 4K2XA 4YAPA 4LA1A 2NPBA 2H1AA 2QA1A 4ZBDA 5GZZB 1OC9B 4OCFA 3HZ4A 5ELAA 4ECJA 2WGRA 3TKSA 1ERUA 1K0OA 4MDCA 5KEJA 4IS0A 3AY8A 1DSBA 4L8EA 3IK7A 3CTFA 1SD8A 3ED3A 2CV4A 3N5OA 5G1LA 5ID2A 5L71A 1EP8A 2H1BA 4O7HA 4WBJA 3GYKA 3GX0A 1X0RA 4MCUA 2AYTA 2JSZA 3CYNA 3L9VA 3GURA 3GN3A 1DE1A 3ZFLA 1JFUA 1OAZA 4KH7A 4CY6A 1GSEA 1ILOA 3FHKA 4ILFA 5ECKB 3IRAA 3W6GA 3GNJA 2H30A 1TU7A 2DJ2A 4G19A 4RQRA 1K0AA 1SKRB 3TRPA 3LYPA 2IMIA 5BRTA 2DJJA 5J9BA 3FZ9A 2REMA 2WULA 1GWCA 5IMCA 5DJLA 3SWLA 3V1WA 2V6OA 4NWYA 3HA9A 1K0CA 3DMLA 3QAWA 3LGCA 1B4PA 1MEKA 3GKNA 1VF3A 1THOA 1B4QA 4H86A 2GDRA 4EKZA 4G10A 4OFMA 1YEPA 2ZNMA 5INYA 3RPNA 4IKHA 4YKFA 2CZ2A 3Q6OA 4AF2A 3TJBA 5D96A 2IWTA 5H5SA 3U6VA 4CDOA 1F2EA 2YANA 3GL5A 2BMXA 3M9KA 1ZYNA 3D6IA 3HVVA 3WD6A 1UVZA 5CRDA 1Z6MA 3IHQA 2YPMA 4N0ZA 1X5DA 3UVHA 4BL7B 1TK0B 2IFQA 2AJQB 2H72A 4K0GA 3TJGA 3QPMA 1AQXA 4Z2RA 5A4UA 5IPHA 3DVXA 2MBTA 5A4VA 4EDYA 4ZB8A 1QXHA 2FCHA 2DLXA 4CHSA 2CX4A 2H0GA 1I9DA 3KMNA 3KEBA 2CAIA 2K18A 1M9BA 2H0IA 3HXSA 4ZL7A 4V2MA 4OCEA 5JWRB 5CRGA 2LRCA 2PN8A 2L6CA 5B6NA 3KD0A 4Q5FA 5AIXA 4BVXA 5DBQA 1A2JA 1XWAA 4JR4A 2PPTA 1Z9HA 5IM9A 1EV4A 4PQIA 4GCIA 4HZ4A 2PU9C 2AHEA 6GSXA 3CSIA 1WP0A 2PVQA 1TW9A 4AJ7A 4XIHA 1O6JA 3RAZA 1N8JA 3NIVA 1AC1A 3F63A 3KP9A 2FA4A 2HXKA 1RK4A 4POKA 1XOAA 3LEFA 2VCVA 3VWVA 2C0FA 4FYUA 4TXOA 3QCPA 5CREA 5ECMB 1C72A 5JCWA 3IE3A 1OVNA 1ML6A 5A4WA 3CMIA 3I9V2 1SJIA 5CO3A 4POMA 3CRUA 5G1KA 3TJFA 1FOHA 4E8EA 1GLPA 4ZBAA 5D9WA 2IMKA 1FW1A 4RUVA 5J3RA 5CP1A 1XW5A 2DJ1A 4BWSA 4NV5A 1BX9A 3DXBA 1K0NA 4I5QA 2C3NA 4PGTA 2XPEA 4N11A 5H5RA 1ZGNA 4NXIA 2JZRA 1R5AA 2VCWA 1Z3EA 1FHEA 1T4ZA 2KOKA 1R7HA 3FZ5A 1XWKA 2G2QA 4FH8A 1U6TA 2HRFA 4KCAA 4MJEA 2X8GA 5DQYA 5GSTA 2I4AA 2HI7A 1GSUA 4G0LA 2PMTA 2WRTA 4IP1A 1SK1A 3IC8A 1MD4A 1B48A 5DQSA 1Z6NA 1SJZA 1UC7A 4ML1A 2A2SA 5GAPD 1S3DA 5DDLA 5KN0A 1FOVA 2O7KA 2QC7A 3NOFA 10GSA 1A8LA 3RDWA 4L0UA 4N10A 2B5YA 5B8AA 2P5RA 2KLXA 1OE7A 2L6DA 3P8WA 1XIYA 3HHVA 2QA2A 2JZTA 4EVMA 5BMUA 4EE0A 3VPQA 1K3OA 4MP4A 3HZ8A 5ECLB 2XHFA 4P3YB 2H6XA 1OKDA 3HVXA 3TCOA 2HRNA 4WEYA 2GZPA 4CY8A 1EWXA 5ECRB 1AIUA 1A23A 2KP2A 3UMAA 1K0DA 5ID2B 5A5KA 17GSA 3DIEA 4TR4A 1A0RP 1WE0A 3OR5A 2R37A 4WXTA 4EO3A 4OO4A 3CSJA 5DALA 5HR1A 3ZMLA 4KDXA 4HS1A 5DAKB 4J2FA 4L0WA 3IAM2 2A2PA 3FEUA 5D9VA 2YOIA 3ME7A 3W8SA 2MBSA 3KXOA 3KZQA 4NHWA 5JWQB 5LCZA 3PH9A 4NMUA 4BA7A 2DJKA 2H66A 2CZ3A 4TXVA 5AIVA 1PKZA 1V2AA 1QGVA 1ZYQB 2RM5A 2B6MA 1PSQA 3WT2A 4AJ8A 2A4HA 4WBRD 4ULXA 1B9XC 3D5JA 3WGEA 2LS5A 3FR3A 3IHGA 2OJLA 3L4NA 4MABA 2M80A 1ON4A 1V40A 2VCTA 2X99A 2GVPA 2E7PA 3E0UA 4J56E 1LJRA 2GGTA 3ERFA 22GSA 2ON5A 3C71A 3DVWA 3EURA 3M8NA 5FWGA 3I43A 3ERWA 2DSAA 6GSYA 4Q5NA 4Z7XA 2C8UA 2CX3A 4HJ2A 5CRHA 2IPAA 3TKPA 2DKHA 1Z7PA 3H79A 1WJKA 3G7JA 3ZMKA 2LEGA 2I1UA 4X0XA 2O87A 3HY2A 1YEXA 2HSMA 1YZXA 2H1DA 1F37A 2GZZA 4QL7A 4GLTA 4O5RA 4V2LA 3FMWA 3A5IA 2H19A 3MAKA 5G5FA 2DMMA 5D73A 1SKWB 1BG5A 3GUSA 3GKXA 4MLYA 5DJMA 3M9JA 4KDYA 3UARA 5CYYA 2OA7A 4POBA 4PURA 4ZL9A 5C04A 1BYEA 1V58A 3M1GA 3ZIVA 1JLVA 1HNBA 1Y6EA 2CVBA 1VF1A 2VM2A 2BTOT 3CBUA 4XHMA 5AGYA 4V1Ag 3HYPA 3HJOA 3NZNA 4ZB6A 1ZYPA 4ZIJA 2V6KA 3IDVA 2FWGA 3EC3A 5ECNB 3BJ5A 4GRFA 2A2RA 4HJMA 2E0QA 2YV9A 3LYKA 3F3QA 1MDJA 1YKCA 5HFKA 1U3AA 2MZCA 3D0ZA 4O32A 2LQQA 4DEJA 4FYBA 4ECBA 2VLTA 2HNLA 4TRXA 2VCQA 3VWXA 2ZUPA 3FR6A 1G7OA 3IPZA 2EC4A 4XS4A 3KIJA 1H4OA 3UVTA 4V2NA 4L5LA 2HYXA 1B8XA 1ZOFA 3VPTA 2QKEA 1G6YA 1XFLA 1KTEA 1F6MC 2LTKA 3HD5A 4KNDA 2LNTA 4BVYB 4HEA2 2YWIA 4RI7A 3APQA 4N0VA 3F8UA 4KW6A 4YKGA 4RQXA 2O85A 1X5CA 4FQUA 5IOWA 1QK8A 2MMZA 1TP9A 2VUPA 3QFBC 4K9ZA 2GT5A 1GUMA 3P2AA 4KSMA 2H74A 1LBKA 4HUAA 1S3CA 1GL8A 2GQMA 2GQLA 5EL8A 5KN2A 1A8YA 2FWHA 3MNGA 5CNWA 3O6TA 1T7PB 2VOCA 5G31A 2LV3A 2C80A 4IHUA 2TRXA 2YWOA 1O8WA 1GLQA 3EMPA 4X43A 2XBIA 1THXA 2IMFA 3WYWA 2FY6A 2F3MA 2VL9A 4AGSA 1WPIA 2X8HA 4GSSA 2WB9A 4KCEA 1SU9A 1TDIA 3L0HA 1X9MB 6GSVA 5F06A 2VM1A 3ZVJA 1GP1A 1YDKA 5F05A 4K0NA 4DSSA 3GA4A 5KN3A 2DJ0A 3MIXA 4KSOA 5GAND 4LLRA 1ERWA 1F3AA 3GTUB 2OACA 1HQOA 3UAPA 2AV4A 2KUCA 3BCKA 2H1GA 4YQMA 2ON7A 3G9BA 4HQSA 1FO5A 3FZAA 2TRCP 1X5EA 3QOUA 4HI7A 4MZBA 3CXGA 4DSQA 1OKTA 4MK3A 3GSSA 4V1Ap 3DWVA 3FYGA 4IJIA 3FW2A 3L9UA 2WJUA 3VWUA 2M72A 3FR9A 1GSQA 3O76A 2RLIA 2PERA 3DEXA 1O8XA 4MH2A 4K1FA 1M2DA 1VF4A 3TDGA 1MDIA 2MYGA 5CRWA 4X4JA 4NV2A 5DVBA 2RUFA 4GQFA 2HZEA 3HCZA 1FVJA 1HD2A 2K9FA 1T8EB 4GTUA 4GQCA 3TB2A 4PUFC 2G0FA 1GTBA 3F3RA 3HDCA 4ZILA 3DKSA 1HNAA 4GSNA 3IAS2 1XWCA 2DIYA 3U5RE 4JBBA 3R2QA 2OE1A 2LRNA 4IVFA 1MTCA 2ALBA 5ECOB 4YAVA 1SENA 1AXDA 2HE3A 4HZ2A 4XRDA 4OWYA 2HT9A 2E2MA 1E2YA 1UN2A 2LQOA 4YQVA 1NHOA 3VFIA 2O89A 1QFNA 2CT6A 2PWJA 1OC9A 6GSWA 2YZUA 3LQ7A 3G7YA 1DE2A 3P7XA 1GTIA 3TGZA 3GH6A 5E59A 4ECCA 1GTAA 3TRXA 1DBYA 3I69A 4D73A 5KN1A 2VAFA 2LSTA 4K2DA 1OE8A 4Z2TA 1RQMA 2FA8A 2GSQA 4G9HA 1BQ7A 3DYRA 3WGDA 2N5AA 1H75A 1V57A 1XCCA 1TRVA 12GSA 5IOXA 3BD2A 1TI3A 4Q5RA 5HR3A 1PQNA 2H76A 2VIMA 3FK8A 1YJ6A 4TN8A 5F0GA 5LNKe 5E4WA 3DD3A 1R5PA 1M7TA 2YV7A 5H5QA 4ACSA 1AQWA 1TKDB 2L59A 4KDUA 1PN0A 1V98A 5HR2A 4WF5A 4IQAA 4QQ7A 3C73A 3DGQA 3BCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0I A;  4ZXG A;  5HFG A;  2VL3 A;  2EIQ A;  4EUY A;  3F4R A;  3RPP A;  1WWJ A;  1YY7 A;  1WOU A;  2IME A;  3GFK A;  3TJJ A;  2N5F A;  5C00 A;  1FB6 A;  2FWF A;  1T1V A;  2F51 A;  3UEM A;  3Q74 A;  4BWQ A;  1O73 A;  1USB A;  2ZCT A;  2X8C A;  4ID0 A;  1M99 A;  5IMD A;  5JCG A;  5ABR A;  1UA5 A;  4ISD A;  4TR1 B;  5ECP B;  5HFI A;  2H70 A;  3BBY A;  4RI6 A;  2HFD A;  3H4K A;  3UIW A;  5LD0 A;  2C0D A;  4BL7 A;  4XTS A;  1E6B A;  3PIN A;  2IL3 A;  2P31 A;  11GS A;  5ENU A;  3F6D A;  2I3Y A;  1KNG A;  1ZYE A;  4FYC A;  2L4C A;  4K7I A;  1QMV A;  1XW6 A;  5B6M A;  2V2G A;  3GX8 A;  5EY6 A;  3IC4 A;  4I8B A;  2CQ9 A;  5J5N A;  4HDE A;  3VUR A;  5AN1 A;  4K6X A;  4OD7 A;  1QQ2 A;  3EU3 A;  4GWR A;  3ZRE A;  4NHZ A;  5JCU A;  3HVS A;  5G30 A;  3TJK A;  1GNW A;  1KBN A;  3GRX A;  2GTU A;  4KUN A;  1TRW A;  2R4V A;  1M2A A;  1TI1 A;  1O81 A;  2VLV A;  1FVK A;  3Q18 A;  3C7M A;  3EYT A;  1XVQ A;  4MH3 A;  1TK8 B;  2C3Q A;  4OFT A;  1Z7R A;  1OYJ A;  4JR6 A;  5B8B A;  1XXU A;  2L4Q A;  4G2E A;  4TR3 A;  1GH2 A;  4CW9 A;  3TOT A;  3TKS E;  2F8A A;  1NHY A;  1EV9 A;  4MF6 A;  4XRA A;  4E8H A;  1ABA A;  3EVI A;  1ZCP A;  19GS A;  2XC2 A;  1ACV A;  2OKA A;  1I5G A;  1WIK A;  1QUW A;  2WZ9 A;  1AQV A;  2ES7 A;  2FWE A;  1WMJ A;  3KGK A;  2C3T A;  2LJR A;  4EDZ A;  1R26 A;  4J57 E;  3JCM L;  3LSZ A;  4MA9 A;  5FT3 A;  2O8V B;  4K8M A;  1GUK A;  3D4T A;  4KE3 A;  4PQH A;  3GMF A;  3ZTL A;  2LUS A;  1U3I A;  3ZIJ A;  4NPB A;  3QD9 A;  1EEM A;  2B7K A;  4MJB A;  5F8B A;  1Z5Y E;  2IFQ B;  2IN3 A;  4PUA A;  5D9X A;  3UJ1 A;  3GHA A;  2H6Y A;  1JZD A;  3CRT A;  1ST9 A;  3LJR A;  2FNO A;  2V1M A;  2H8L A;  3D4M A;  3LWA A;  3FKF A;  2YJ7 A;  1EGR A;  1GNE A;  9GSS A;  13GS A;  2B5X A;  3TKR A;  3GIX A;  4PNF A;  4I2U A;  4MPG A;  3TKQ A;  1TRS A;  5D93 A;  1T4Y A;  1B9Y C;  2OAD A;  1NM3 A;  4X1U A;  4FIW A;  1HYU A;  2VO4 A;  2VCX A;  5J9C A;  4QL9 A;  4XS6 A;  1OC3 A;  2GSS A;  2FUG 2;  3A3T A;  3LG6 A;  3GKM A;  2WCI A;  4GST A;  5ELG A;  1SL1 B;  1XWB A;  3EU4 A;  3KM6 A;  1PGT A;  4LMW A;  3H93 A;  2YNX A;  2B5E A;  2OBI A;  8GSS A;  1M9A A;  4POL A;  4TVE A;  4JRR A;  1F9M A;  2L5L A;  4PQ1 A;  4TXO B;  2WFC A;  1BJX A;  3N9J A;  2GQK A;  3D22 A;  3P90 A;  5FHI A;  2PBJ A;  2R3X A;  1A0F A;  4KGI A;  1PRX A;  2LJA A;  3A2V A;  1PX6 A;  5ECH B;  16GS A;  3EWL A;  1G7E A;  4XCS A;  5IPG A;  1AW9 A;  2VD0 A;  2QGV A;  4D73 B;  5D8I A;  1GUH A;  1YKA A;  3RHC A;  20GS A;  3MWH A;  1EOG A;  2PGT A;  4MF7 A;  4HU7 A;  5G5E A;  2BJX A;  5G2Z A;  2HSY A;  3QMX A;  4FO5 A;  5IMZ A;  4WR5 A;  1EGO A;  5IMF A;  5IQY A;  5DCH A;  1GSD A;  1U88 A;  2WDU A;  4KB3 A;  1SKS B;  4JZQ A;  3US3 A;  5DAK A;  3FZ4 A;  5D9T A;  2RM6 A;  3KH9 A;  2H6Z A;  3GKK A;  2IJY A;  4MF5 A;  3EMX A;  2R6K A;  1XVW A;  2AB6 A;  3RBT A;  1J9B A;  2GSR A;  2C4J A;  1XZO A;  1VRS D;  4PNG A;  1GSY A;  4TOP A;  5J41 A;  2JSY A;  3ERG A;  1FG4 A;  1XWG A;  3F9U A;  2RUE A;  2GLR A;  5COH A;  1SYX A;  4KA0 A;  6GSU A;  3IV4 A;  3RHB A;  1GRX A;  2KP1 A;  2XBQ A;  3APS A;  4WR4 A;  1TJD A;  2DC5 A;  2AUV A;  3LXT A;  3F6F A;  4ZBB A;  2A4V A;  2H01 A;  1YQ1 A;  2DML A;  2FGX A;  1J08 A;  1NSW A;  2PVO C;  3Q19 A;  4IEL A;  1AUC A;  3ZLP A;  4JE1 A;  4ECI A;  2DIZ A;  1GUL A;  4K7N A;  1F3B A;  4EXJ A;  3LFL A;  5EPF A;  3QAG A;  2I9H A;  6GSS A;  3UBK A;  4TKY A;  2GZY A;  2NBS A;  3CTG A;  1K0M A;  3KTB A;  1YF1 A;  1EEJ A;  3D21 A;  1URM A;  1O7U A;  3KMO A;  2F9S A;  1A24 A;  3IXR A;  4K7O A;  4N30 A;  2J9H A;  4LL1 B;  1R4W A;  3A5W A;  5AIS A;  4EL1 A;  2K8S A;  3KCM A;  4LL4 B;  1IYH A;  2DBC A;  5DAL B;  3SBC A;  2HSH A;  2EIR A;  3EIN A;  1GTU A;  3MDK A;  1PL1 A;  3IK9 A;  1G0T A;  3QDN A;  1TK5 B;  2B1L A;  3G7I A;  3E3E A;  3VK9 A;  1AAZ A;  2FLS A;  4IQ1 A;  2OBK A;  3KTL A;  3HJP A;  2GT6 A;  2LJK A;  2H75 A;  1PKW A;  1X9S B;  1PA3 A;  1W4V A;  2R5G A;  5HQP A;  2RII A;  2LNS A;  4KAE A;  4MJA A;  4IJ3 A;  4GF0 A;  4MPF A;  1JZO A;  1ERV A;  1Q4J A;  3HJM A;  4MZC A;  1V9W A;  2MMO A;  4Q5Q A;  7GSS A;  3ISO A;  4I97 A;  3A2W A;  1W89 A;  1J0F A;  2YWM A;  1EZK A;  1PX7 A;  5IMV A;  3H8Q A;  3GL3 A;  2MMA A;  3TUE A;  3WT1 A;  2QSI A;  3EE2 A;  4F9Z A;  5JWO B;  3GST A;  5ECQ B;  2NTO A;  3KH7 A;  14GS A;  3ZYW A;  3KJY A;  4O92 A;  1A2M A;  2LRT A;  4TR0 A;  4TW5 A;  3IR4 A;  1N2A A;  3C1R A;  4F0B A;  3M3M A;  1ZL9 A;  4BVY A;  3DRN A;  2CAQ A;  1XW9 A;  2TIR A;  4HOJ A;  1ZZY A;  2D2Z A;  1GSF A;  4WKW A;  3O3T A;  1ERT A;  3GH9 A;  5ECI B;  4LMV A;  1TOF A;  2KHP A;  1SL0 B;  3UBL A;  1RW1 A;  3TOU A;  4OMV A;  1BAY A;  3F4T A;  4WET A;  2HZF A;  3L9S A;  4EF0 A;  5DCG A;  2IMD A;  2M46 A;  1VF2 A;  2YZH A;  3LXZ A;  3J7Y k;  1M0U A;  2AAW A;  2VL2 C;  1PD2 1;  2PUK C;  1HNC A;  2L5O A;  1O85 A;  3UL3 A;  2YCD A;  1SK2 A;  2DJ3 A;  1VGL A;  4IW9 A;  4ZL8 A;  2CVD A;  3PGT A;  3BOA A;  3W8J A;  1FB0 A;  2Z9S A;  1TTZ A;  1TRU A;  4F0C A;  3WGX A;  3IOS A;  3GTU A;  2YP6 A;  2F8F A;  4YQU A;  4IP6 A;  4MZW A;  3QAV A;  1WRY A;  2E2G A;  2C0E A;  1X9W B;  1BED A;  2V32 A;  2H73 A;  3TRQ A;  1PN9 A;  1JZW A;  4PX1 A;  2N5B A;  5IO2 A;  4XS4 B;  1SJ6 A;  3FRC A;  4JU5 A;  3ZFB A;  2CVK A;  3HKR A;  1A2L A;  4HQZ A;  2IIY A;  1T3B A;  3K8N A;  4BPY A;  1SL2 B;  1FAA A;  1U87 A;  2JAD A;  2NDO A;  3VI5 A;  2JZS A;  3MSZ A;  1JLW A;  1SK0 A;  3C8E A;  2K6V A;  3TKS C;  4F03 A;  5IO0 A;  2VD1 A;  1G6W A;  1EOH A;  2YJH A;  1MD3 A;  2H71 A;  3VWW A;  2B7J A;  1NW2 A;  2YWN A;  1Q98 A;  1GSS A;  3J7Y b;  1S3A A;  1MDK A;  2B3S A;  2WS2 A;  1LU4 A;  3CSH A;  4XS1 A;  3H1N A;  3ZL5 A;  2P0G A;  5J4U A;  1EP7 A;  1SYR A;  3ZRD A;  4IBP A;  3QFA C;  1OC8 A;  4MMM A;  3ME8 A;  3ZZX A;  2FD3 A;  1TU8 A;  5GSS A;  5CAX A;  4ML6 A;  1PL2 A;  2P5Q A;  4I6X A;  3C1S A;  1JHB A;  4DSS B;  2VCZ A;  1Y25 A;  1XPV A;  2HLS A;  3FY7 A;  2FHE A;  2OE3 A;  2GST A;  1ZMA A;  4L5O A;  4IGJ A;  1CQH A;  3QR6 A;  2L57 A;  3IA1 A;  3KP8 A;  1TXX A;  2I81 A;  4ZB9 A;  4OFN A;  5IIZ A;  1T00 A;  2VL2 A;  4EC0 A;  1XBS A;  2C0G A;  5ECS A;  1YF0 A;  3F4S A;  3VI7 A;  3PR8 A;  18GS A;  3A2X A;  6GST A;  1DUG A;  2J23 A;  4JED A;  3UOM A;  4IN0 A;  2NVL A;  3M0F A;  2JL4 A;  2CA8 A;  1K3L A;  1KEB A;  1PMT A;  2B1K A;  2VLU A;  1K3Y A;  5HR0 A;  2H0H A;  4MJC A;  4F82 A;  2MMN A;  4YH2 A;  4F2I A;  4WF4 A;  3ZIT A;  3VLN A;  5IMA A;  3ZVJ D;  5F07 A;  3IBH A;  4DSR A;  2V41 A;  2K8V A;  2HZE B;  2JU5 A;  4I2T A;  3I6A A;  2YN1 A;  2GS3 A;  4GXZ A;  1M2B A;  3APO A;  2X64 A;  3GV1 A;  5B7C A;  1JZR A;  3L78 A;  2R2J A;  3LOR A;  5EVO A;  4HU9 A;  4KX4 A;  3E9J B;  2OE0 A;  1K0B A;  1CQG A;  2C1Y A;  1SD9 A;  4PXO A;  4TR1 A;  2XPD A;  1XOB A;  1IYI A;  4NAX A;  4OO5 A;  2JAC A;  3S9F A;  4AJ6 A;  2EIO A;  4DVC A;  2LKU A;  4YAP A;  4LA1 A;  2NPB A;  2H1A A;  4ZBD A;  5GZZ B;  1OC9 B;  4OCF A;  3HZ4 A;  5ELA A;  4ECJ A;  2WGR A;  3TKS A;  1ERU A;  1K0O A;  4MDC A;  5KEJ A;  4IS0 A;  3AY8 A;  1DSB A;  4L8E A;  3IK7 A;  3CTF A;  1SD8 A;  3ED3 A;  2CV4 A;  3N5O A;  5G1L A;  5ID2 A;  5L71 A;  1EP8 A;  2H1B A;  4O7H A;  4WBJ A;  3GYK A;  3GX0 A;  1X0R A;  4MCU A;  2AYT A;  2JSZ A;  3CYN A;  3L9V A;  3GUR A;  3GN3 A;  1DE1 A;  3ZFL A;  1JFU A;  1OAZ A;  4KH7 A;  1GSE A;  1ILO A;  3FHK A;  4ILF A;  5ECK B;  3IRA A;  3W6G A;  3GNJ A;  2H30 A;  1TU7 A;  2DJ2 A;  4G19 A;  4RQR A;  1K0A A;  1SKR B;  3TRP A;  3LYP A;  2IMI A;  2DJJ A;  5J9B A;  3FZ9 A;  2REM A;  2WUL A;  1GWC A;  5IMC A;  5DJL A;  3SWL A;  3V1W A;  2V6O A;  4NWY A;  3HA9 A;  1K0C A;  3DML A;  3QAW A;  3LGC A;  1B4P A;  1MEK A;  3GKN A;  1VF3 A;  1THO A;  1B4Q A;  4H86 A;  2GDR A;  4EKZ A;  4G10 A;  4OFM A;  1YEP A;  2ZNM A;  5INY A;  3RPN A;  4IKH A;  2CZ2 A;  3Q6O A;  4AF2 A;  3TJB A;  5D96 A;  2IWT A;  5H5S A;  3U6V A;  4CDO A;  1F2E A;  2YAN A;  3GL5 A;  2BMX A;  3M9K A;  3D6I A;  3HVV A;  3WD6 A;  1UVZ A;  5CRD A;  1Z6M A;  3IHQ A;  2YPM A;  4N0Z A;  1X5D A;  3UVH A;  1TK0 B;  2IFQ A;  2AJQ B;  2H72 A;  4K0G A;  3TJG A;  3QPM A;  1AQX A;  5A4U A;  5IPH A;  3DVX A;  2MBT A;  5A4V A;  4EDY A;  4ZB8 A;  1QXH A;  2FCH A;  2DLX A;  4CHS A;  2CX4 A;  2H0G A;  1I9D A;  3KMN A;  3KEB A;  2CAI A;  2K18 A;  1M9B A;  2H0I A;  3HXS A;  4ZL7 A;  4V2M A;  4OCE A;  5JWR B;  5CRG A;  2LRC A;  2PN8 A;  2L6C A;  5B6N A;  3KD0 A;  4Q5F A;  5AIX A;  4BVX A;  5DBQ A;  1A2J A;  1XWA A;  4JR4 A;  2PPT A;  1Z9H A;  5IM9 A;  1EV4 A;  4PQI A;  4GCI A;  4HZ4 A;  2PU9 C;  2AHE A;  6GSX A;  3CSI A;  1WP0 A;  2PVQ A;  1TW9 A;  4AJ7 A;  4XIH A;  1O6J A;  3RAZ A;  1N8J A;  3NIV A;  1AC1 A;  3F63 A;  3KP9 A;  2FA4 A;  2HXK A;  1RK4 A;  4POK A;  1XOA A;  3LEF A;  2VCV A;  3VWV A;  2C0F A;  4FYU A;  4TXO A;  3QCP A;  5CRE A;  5ECM B;  1C72 A;  5JCW A;  3IE3 A;  1OVN A;  1ML6 A;  5A4W A;  3CMI A;  3I9V 2;  1SJI A;  5CO3 A;  4POM A;  3CRU A;  5G1K A;  3TJF A;  4E8E A;  1GLP A;  4ZBA A;  5D9W A;  2IMK A;  1FW1 A;  4RUV A;  5J3R A;  5CP1 A;  1XW5 A;  2DJ1 A;  4BWS A;  4NV5 A;  1BX9 A;  3DXB A;  1K0N A;  4I5Q A;  2C3N A;  4PGT A;  2XPE A;  4N11 A;  5H5R A;  1ZGN A;  4NXI A;  2JZR A;  1R5A A;  2VCW A;  1Z3E A;  1FHE A;  1T4Z A;  2KOK A;  1R7H A;  3FZ5 A;  1XWK A;  2G2Q A;  4FH8 A;  1U6T A;  2HRF A;  4KCA A;  4MJE A;  2X8G A;  5DQY A;  5GST A;  2I4A A;  2HI7 A;  1GSU A;  2PMT A;  2WRT A;  4IP1 A;  1SK1 A;  1MD4 A;  1B48 A;  5DQS A;  1Z6N A;  1SJZ A;  1UC7 A;  4ML1 A;  2A2S A;  5GAP D;  1S3D A;  5DDL A;  5KN0 A;  1FOV A;  2O7K A;  2QC7 A;  3NOF A;  10GS A;  1A8L A;  3RDW A;  4L0U A;  4N10 A;  2B5Y A;  5B8A A;  2P5R A;  2KLX A;  1OE7 A;  2L6D A;  3P8W A;  1XIY A;  3HHV A;  2JZT A;  4EVM A;  4EE0 A;  3VPQ A;  1K3O A;  4MP4 A;  3HZ8 A;  5ECL B;  2XHF A;  4P3Y B;  2H6X A;  1OKD A;  3HVX A;  3TCO A;  2HRN A;  4WEY A;  2GZP A;  1EWX A;  5ECR B;  1AIU A;  1A23 A;  2KP2 A;  3UMA A;  1K0D A;  5ID2 B;  5A5K A;  17GS A;  3DIE A;  4TR4 A;  1A0R P;  1WE0 A;  3OR5 A;  2R37 A;  4WXT A;  4EO3 A;  4OO4 A;  3CSJ A;  5DAL A;  5HR1 A;  3ZML A;  4KDX A;  4HS1 A;  5DAK B;  4J2F A;  4L0W A;  3IAM 2;  3FEU A;  5D9V A;  2YOI A;  3ME7 A;  3W8S A;  2MBS A;  3KXO A;  3KZQ A;  4NHW A;  5JWQ B;  5LCZ A;  3PH9 A;  4NMU A;  4BA7 A;  2DJK A;  2H66 A;  2CZ3 A;  4TXV A;  5AIV A;  1PKZ A;  1V2A A;  1QGV A;  1ZYQ B;  2RM5 A;  2B6M A;  1PSQ A;  3WT2 A;  4AJ8 A;  4WBR D;  4ULX A;  1B9X C;  3D5J A;  3WGE A;  2LS5 A;  3FR3 A;  2OJL A;  3L4N A;  4MAB A;  2M80 A;  1ON4 A;  1V40 A;  2VCT A;  2X99 A;  2GVP A;  2E7P A;  3E0U A;  4J56 E;  1LJR A;  2GGT A;  3ERF A;  22GS A;  2ON5 A;  3C71 A;  3DVW A;  3EUR A;  3M8N A;  5FWG A;  3I43 A;  3ERW A;  2DSA A;  6GSY A;  4Q5N A;  4Z7X A;  2C8U A;  2CX3 A;  4HJ2 A;  5CRH A;  2IPA A;  3TKP A;  1Z7P A;  3H79 A;  1WJK A;  3G7J A;  3ZMK A;  2LEG A;  2I1U A;  4X0X A;  2O87 A;  3HY2 A;  1YEX A;  1YZX A;  2H1D A;  1F37 A;  2GZZ A;  4QL7 A;  4GLT A;  4O5R A;  4V2L A;  2H19 A;  3MAK A;  5G5F A;  2DMM A;  5D73 A;  1SKW B;  1BG5 A;  3GUS A;  3GKX A;  4MLY A;  5DJM A;  3M9J A;  4KDY A;  3UAR A;  5CYY A;  2OA7 A;  4POB A;  4PUR A;  4ZL9 A;  5C04 A;  1BYE A;  1V58 A;  3M1G A;  3ZIV A;  1JLV A;  1HNB A;  1Y6E A;  2CVB A;  1VF1 A;  2VM2 A;  2BTO T;  3CBU A;  4XHM A;  5AGY A;  4V1A g;  3HYP A;  3HJO A;  3NZN A;  4ZB6 A;  4ZIJ A;  2V6K A;  3IDV A;  2FWG A;  3EC3 A;  5ECN B;  3BJ5 A;  4GRF A;  2A2R A;  4HJM A;  2E0Q A;  2YV9 A;  3LYK A;  3F3Q A;  1MDJ A;  1YKC A;  5HFK A;  1U3A A;  2MZC A;  3D0Z A;  4O32 A;  2LQQ A;  4DEJ A;  4FYB A;  4ECB A;  2VLT A;  2HNL A;  4TRX A;  2VCQ A;  3VWX A;  2ZUP A;  3FR6 A;  1G7O A;  3IPZ A;  2EC4 A;  4XS4 A;  3KIJ A;  1H4O A;  3UVT A;  4V2N A;  4L5L A;  2HYX A;  1B8X A;  1ZOF A;  3VPT A;  2QKE A;  1G6Y A;  1XFL A;  1KTE A;  1F6M C;  2LTK A;  3HD5 A;  4KND A;  2LNT A;  4HEA 2;  2YWI A;  4RI7 A;  3APQ A;  4N0V A;  3F8U A;  4KW6 A;  4RQX A;  2O85 A;  1X5C A;  5IOW A;  1QK8 A;  2MMZ A;  1TP9 A;  2VUP A;  3QFB C;  4K9Z A;  2GT5 A;  1GUM A;  3P2A A;  4KSM A;  2H74 A;  1LBK A;  4HUA A;  1S3C A;  1GL8 A;  2GQM A;  2GQL A;  5EL8 A;  5KN2 A;  1A8Y A;  2FWH A;  3MNG A;  5CNW A;  3O6T A;  1T7P B;  2VOC A;  5G31 A;  2LV3 A;  2C80 A;  4IHU A;  2TRX A;  2YWO A;  1O8W A;  1GLQ A;  3EMP A;  4X43 A;  2XBI A;  1THX A;  2IMF A;  3WYW A;  2FY6 A;  2F3M A;  2VL9 A;  4AGS A;  1WPI A;  2X8H A;  4GSS A;  2WB9 A;  4KCE A;  1SU9 A;  1TDI A;  3L0H A;  1X9M B;  6GSV A;  5F06 A;  2VM1 A;  3ZVJ A;  1GP1 A;  1YDK A;  5F05 A;  4K0N A;  4DSS A;  3GA4 A;  5KN3 A;  2DJ0 A;  4KSO A;  5GAN D;  4LLR A;  1ERW A;  1F3A A;  3GTU B;  2OAC A;  1HQO A;  3UAP A;  2AV4 A;  2KUC A;  3BCK A;  2H1G A;  4YQM A;  2ON7 A;  3G9B A;  4HQS A;  1FO5 A;  3FZA A;  2TRC P;  1X5E A;  3QOU A;  4HI7 A;  4MZB A;  3CXG A;  4DSQ A;  1OKT A;  4MK3 A;  3GSS A;  4V1A p;  3DWV A;  3FYG A;  4IJI A;  3FW2 A;  3L9U A;  2WJU A;  3VWU A;  2M72 A;  3FR9 A;  1GSQ A;  3O76 A;  2RLI A;  2PER A;  3DEX A;  1O8X A;  4MH2 A;  4K1F A;  1M2D A;  1VF4 A;  3TDG A;  1MDI A;  2MYG A;  5CRW A;  4NV2 A;  5DVB A;  2RUF A;  4GQF A;  2HZE A;  3HCZ A;  1FVJ A;  1HD2 A;  2K9F A;  1T8E B;  4GTU A;  4GQC A;  3TB2 A;  4PUF C;  2G0F A;  1GTB A;  3F3R A;  3HDC A;  4ZIL A;  3DKS A;  1HNA A;  4GSN A;  3IAS 2;  1XWC A;  2DIY A;  3U5R E;  4JBB A;  3R2Q A;  2OE1 A;  2LRN A;  4IVF A;  1MTC A;  2ALB A;  5ECO B;  4YAV A;  1SEN A;  1AXD A;  2HE3 A;  4HZ2 A;  4XRD A;  4OWY A;  2HT9 A;  2E2M A;  1E2Y A;  1UN2 A;  2LQO A;  4YQV A;  1NHO A;  3VFI A;  2O89 A;  1QFN A;  2CT6 A;  2PWJ A;  1OC9 A;  6GSW A;  2YZU A;  3LQ7 A;  3G7Y A;  1DE2 A;  3P7X A;  1GTI A;  3TGZ A;  3GH6 A;  5E59 A;  4ECC A;  1GTA A;  3TRX A;  1DBY A;  3I69 A;  4D73 A;  5KN1 A;  2VAF A;  2LST A;  4K2D A;  1OE8 A;  1RQM A;  2FA8 A;  2GSQ A;  4G9H A;  1BQ7 A;  3DYR A;  3WGD A;  2N5A A;  1H75 A;  1V57 A;  1XCC A;  1TRV A;  12GS A;  5IOX A;  3BD2 A;  1TI3 A;  4Q5R A;  5HR3 A;  1PQN A;  2H76 A;  2VIM A;  3FK8 A;  1YJ6 A;  4TN8 A;  5F0G A;  5LNK e;  5E4W A;  3DD3 A;  1R5P A;  1M7T A;  2YV7 A;  5H5Q A;  4ACS A;  1AQW A;  1TKD B;  2L59 A;  4KDU A;  1V98 A;  5HR2 A;  4WF5 A;  4IQA A;  4QQ7 A;  3C73 A;  3DGQ A;  3BCI A; 
#chains in the Genus database with same CATH topology
 3F0I A;  4ZXG A;  5HFG A;  2VL3 A;  2EIQ A;  4EUY A;  2R0P A;  3F4R A;  3RPP A;  1WWJ A;  1YY7 A;  1WOU A;  2IME A;  3GFK A;  3TJJ A;  2N5F A;  5C00 A;  1FB6 A;  2FWF A;  1T1V A;  2F51 A;  3UEM A;  3Q74 A;  4BWQ A;  1O73 A;  1USB A;  4G0K A;  2ZCT A;  2X8C A;  4ID0 A;  1M99 A;  5IMD A;  5JCG A;  5ABR A;  1UA5 A;  4ISD A;  4TR1 B;  5ECP B;  5HFI A;  2HRK A;  2H70 A;  3BBY A;  4RI6 A;  2HFD A;  3H4K A;  3UIW A;  5LD0 A;  2C0D A;  4BL7 A;  4XTS A;  1E6B A;  3PIN A;  2IL3 A;  2P31 A;  11GS A;  5ENU A;  3F6D A;  2I3Y A;  4A5P A;  1KNG A;  1ZYE A;  4FYC A;  2L4C A;  2DKI A;  4K7I A;  1QMV A;  1XW6 A;  5B6M A;  2V2G A;  3GX8 A;  5EY6 A;  3IC4 A;  4I8B A;  2CQ9 A;  5J5N A;  4HDE A;  3VUR A;  5AN1 A;  4K6X A;  4OD7 A;  1QQ2 A;  3EU3 A;  4GWR A;  3ZRE A;  4NHZ A;  5JCU A;  3HVS A;  5G30 A;  3TJK A;  2R0G A;  1GNW A;  1KBN A;  3GRX A;  2GTU A;  4KUN A;  1TRW A;  2R4V A;  1M2A A;  1TI1 A;  1O81 A;  2VLV A;  1FVK A;  3Q18 A;  3C7M A;  3EYT A;  1XVQ A;  4MH3 A;  1TK8 B;  2C3Q A;  4OFT A;  1Z7R A;  1OYJ A;  4JR6 A;  5B8B A;  1XXU A;  2L4Q A;  4G2E A;  4TR3 A;  1GH2 A;  4CW9 A;  3TOT A;  3TKS E;  2F8A A;  1NHY A;  1EV9 A;  4MF6 A;  4XRA A;  4E8H A;  1ABA A;  3EVI A;  1ZCP A;  2X4A A;  5KOW A;  19GS A;  2XC2 A;  1ACV A;  2OKA A;  1I5G A;  1WIK A;  1QUW A;  2WZ9 A;  1AQV A;  2ES7 A;  2FWE A;  1WMJ A;  3KGK A;  2C3T A;  2LJR A;  4EDZ A;  1R26 A;  4J57 E;  4PTS A;  3JCM L;  3LSZ A;  4MA9 A;  5FT3 A;  2O8V B;  4K8M A;  1GUK A;  3D4T A;  4KE3 A;  4PQH A;  3GMF A;  3ZTL A;  2LUS A;  1U3I A;  3ZIJ A;  4NPB A;  3QD9 A;  1EEM A;  2B7K A;  4MJB A;  5F8B A;  1Z5Y E;  4USS A;  2IFQ B;  2IN3 A;  4PUA A;  5D9X A;  3UJ1 A;  3GHA A;  2H6Y A;  1JZD A;  3CRT A;  1ST9 A;  3LJR A;  4BIK A;  2FNO A;  2V1M A;  2H8L A;  3D4M A;  3LWA A;  3FKF A;  2YJ7 A;  1EGR A;  1GNE A;  9GSS A;  13GS A;  2B5X A;  3TKR A;  3GIX A;  4PNF A;  4I2U A;  4MPG A;  3TKQ A;  1TRS A;  5D93 A;  1T4Y A;  1B9Y C;  2OAD A;  1NM3 A;  4X1U A;  4FIW A;  1HYU A;  2VO4 A;  2VCX A;  5J9C A;  4QL9 A;  4BVX B;  4XS6 A;  5KOX A;  1OC3 A;  2GSS A;  2FUG 2;  3A3T A;  3LG6 A;  3GKM A;  3HVN A;  2WCI A;  4GST A;  5ELG A;  1SL1 B;  1XWB A;  3EU4 A;  3KM6 A;  1PGT A;  4LMW A;  3H93 A;  4G0I A;  2YNX A;  4ICY A;  2B5E A;  2OBI A;  8GSS A;  1M9A A;  4POL A;  4TVE A;  4JRR A;  1F9M A;  2L5L A;  4PQ1 A;  4TXO B;  2WFC A;  4O5U A;  1BJX A;  4K5S A;  3N9J A;  2GQK A;  3D22 A;  3P90 A;  5FHI A;  2PBJ A;  2R3X A;  1A0F A;  4KGI A;  1PRX A;  2LJA A;  3A2V A;  1PX6 A;  5ECH B;  16GS A;  3EWL A;  1G7E A;  4XCS A;  5IPG A;  1AW9 A;  2VD0 A;  2QGV A;  4D73 B;  5D8I A;  1GUH A;  1YKA A;  3RHC A;  20GS A;  3MWH A;  1EOG A;  2PGT A;  4MF7 A;  4O5Q A;  4HU7 A;  5G5E A;  2BJX A;  5G2Z A;  2HSY A;  3QMX A;  4FO5 A;  2R0C A;  5IMZ A;  4WR5 A;  1EGO A;  5IMF A;  5IQY A;  5DCH A;  1GSD A;  1U88 A;  2WDU A;  4KB3 A;  1SKS B;  4JZQ A;  3US3 A;  5DAK A;  3FZ4 A;  3KH9 A;  2RM6 A;  5D9T A;  2H6Z A;  3GKK A;  2IJY A;  4MF5 A;  3EMX A;  2R6K A;  1XVW A;  2AB6 A;  3RBT A;  3MYD A;  1J9B A;  2GSR A;  2C4J A;  1XZO A;  1VRS D;  4PNG A;  1GSY A;  4Z2U A;  4TOP A;  5J41 A;  2JSY A;  4MNN A;  3ERG A;  1FG4 A;  1XWG A;  3F9U A;  2RUE A;  2GLR A;  5COH A;  1SYX A;  4KA0 A;  6GSU A;  3IV4 A;  3RHB A;  1GRX A;  2KP1 A;  2XBQ A;  3APS A;  4WR4 A;  4EIQ A;  1TJD A;  2DC5 A;  2AUV A;  3LXT A;  3F6F A;  4ZBB A;  2A4V A;  2H01 A;  1YQ1 A;  2DML A;  2FGX A;  1J08 A;  1NSW A;  2PVO C;  3Q19 A;  4IEL A;  1AUC A;  3ZLP A;  4JE1 A;  4ECI A;  2DIZ A;  1GUL A;  4K7N A;  1F3B A;  4EXJ A;  3LFL A;  5EPF A;  3QAG A;  2I9H A;  6GSS A;  3UBK A;  4TKY A;  2GZY A;  2NBS A;  3CTG A;  1K0M A;  3KTB A;  1YF1 A;  4KF9 A;  1EEJ A;  3D21 A;  1URM A;  1O7U A;  3KMO A;  2F9S A;  1A24 A;  3IXR A;  4K7O A;  4N30 A;  2J9H A;  4LL1 B;  1R4W A;  3A5W A;  5AIS A;  4EL1 A;  2K8S A;  3KCM A;  4LL4 B;  1IYH A;  2DBC A;  5DAL B;  3SBC A;  2HSH A;  2EIR A;  3EIN A;  1GTU A;  3MDK A;  1PL1 A;  3IK9 A;  1G0T A;  3QDN A;  1TK5 B;  2B1L A;  3G7I A;  3E3E A;  3PPU A;  3VK9 A;  1AAZ A;  2FLS A;  4IQ1 A;  2OBK A;  3KTL A;  3HJP A;  2GT6 A;  2LJK A;  2H75 A;  1PKW A;  1X9S B;  1PA3 A;  1W4V A;  2R5G A;  5HQP A;  2RII A;  2LNS A;  4KAE A;  4MJA A;  4IJ3 A;  4GF0 A;  4MPF A;  1JZO A;  1ERV A;  1Q4J A;  3HJM A;  4MZC A;  1V9W A;  2MMO A;  2UZ8 A;  4Q5Q A;  7GSS A;  3ISO A;  4I97 A;  3A2W A;  1W89 A;  1J0F A;  2YWM A;  1EZK A;  1PX7 A;  5IMV A;  3H8Q A;  3GL3 A;  2MMA A;  3TUE A;  3WT1 A;  2QSI A;  3EE2 A;  1M3I A;  4F9Z A;  5JWO B;  3GST A;  5ECQ B;  2NTO A;  3KH7 A;  14GS A;  3ZYW A;  3KJY A;  4O92 A;  1A2M A;  2LRT A;  4TR0 A;  4TW5 A;  3IR4 A;  1N2A A;  3C1R A;  4F0B A;  3M3M A;  1ZL9 A;  4BVY A;  3DRN A;  2CAQ A;  1XW9 A;  2TIR A;  4HOJ A;  1ZZY A;  2D2Z A;  1GSF A;  4WKW A;  3O3T A;  1ERT A;  3GH9 A;  5ECI B;  4LMV A;  1TOF A;  2KHP A;  1SL0 B;  3UBL A;  1RW1 A;  3TOU A;  4OMV A;  1BAY A;  3F4T A;  1XG8 A;  4WET A;  2HZF A;  3L9S A;  4EF0 A;  5DCG A;  2IMD A;  2M46 A;  1VF2 A;  2YZH A;  3LXZ A;  3J7Y k;  1M0U A;  2AAW A;  2VL2 C;  1PD2 1;  2PUK C;  1HNC A;  2L5O A;  1O85 A;  3UL3 A;  2YCD A;  1SK2 A;  2DJ3 A;  1VGL A;  4IW9 A;  4ZL8 A;  2CVD A;  3PGT A;  3BOA A;  3W8J A;  1FB0 A;  2Z9S A;  1TTZ A;  1TRU A;  4F0C A;  3WGX A;  3IOS A;  3GTU A;  2YP6 A;  2F8F A;  4YQU A;  4IP6 A;  2HRA A;  4MZW A;  3QAV A;  1WRY A;  2E2G A;  2C0E A;  1X9W B;  1BED A;  2V32 A;  2H73 A;  3TRQ A;  1PN9 A;  1JZW A;  4PX1 A;  2N5B A;  5IO2 A;  4XS4 B;  1SJ6 A;  3FRC A;  4JU5 A;  3ZFB A;  2CVK A;  3HKR A;  1A2L A;  4HQZ A;  2IIY A;  1T3B A;  3K8N A;  4BPY A;  1SL2 B;  3EPT A;  1FAA A;  1U87 A;  2JAD A;  2NDO A;  3VI5 A;  2JZS A;  3MSZ A;  1JLW A;  1SK0 A;  3C8E A;  2K6V A;  3TKS C;  4F03 A;  5IO0 A;  2VD1 A;  1G6W A;  1EOH A;  2YJH A;  1MD3 A;  2H71 A;  3VWW A;  2B7J A;  1NW2 A;  2YWN A;  1Q98 A;  1GSS A;  3J7Y b;  1S3A A;  1MDK A;  2B3S A;  2WS2 A;  1LU4 A;  3CSH A;  4XS1 A;  3H1N A;  4EIP A;  3ZL5 A;  2P0G A;  5J4U A;  2X49 A;  1EP7 A;  1SYR A;  3ZRD A;  4IBP A;  3QFA C;  1OC8 A;  4MMM A;  3ME8 A;  3ZZX A;  2FD3 A;  3CQF A;  1TU8 A;  5GSS A;  5CAX A;  4ML6 A;  1PL2 A;  2P5Q A;  4I6X A;  3C1S A;  1JHB A;  4DSS B;  2VCZ A;  1Y25 A;  1XPV A;  2HLS A;  3FY7 A;  2FHE A;  2OE3 A;  2GST A;  3LW9 A;  1ZMA A;  4L5O A;  4IGJ A;  1CQH A;  3QR6 A;  2L57 A;  3IA1 A;  3KP8 A;  1TXX A;  2I81 A;  4ZB9 A;  4OFN A;  5IIZ A;  1T00 A;  2VL2 A;  4EC0 A;  1XBS A;  2C0G A;  5ECS A;  1YF0 A;  3F4S A;  3VI7 A;  3PR8 A;  18GS A;  3A2X A;  6GST A;  1DUG A;  2J23 A;  4JED A;  3UOM A;  4IN0 A;  2NVL A;  3M0F A;  2JL4 A;  2CA8 A;  1K3L A;  1KEB A;  1PMT A;  2B1K A;  2VLU A;  1K3Y A;  5HR0 A;  2H0H A;  4MJC A;  4F82 A;  2MMN A;  4YH2 A;  4F2I A;  4WF4 A;  3ZIT A;  3VLN A;  5IMA A;  3ZVJ D;  5F07 A;  3IBH A;  4DSR A;  2V41 A;  2K8V A;  2HZE B;  3R3E A;  2JU5 A;  4I2T A;  3I6A A;  2YN1 A;  2GS3 A;  4GXZ A;  1M2B A;  3APO A;  2X64 A;  3GV1 A;  5B7C A;  1JZR A;  3L78 A;  4K5R A;  2R2J A;  3LOR A;  5EVO A;  4HU9 A;  4KX4 A;  3E9J B;  2OE0 A;  1K0B A;  1CQG A;  2C1Y A;  1SD9 A;  4PXO A;  4TR1 A;  2XPD A;  1XOB A;  1IYI A;  4NAX A;  4OO5 A;  2JAC A;  3S9F A;  4AJ6 A;  2EIO A;  4DVC A;  2LKU A;  4K2X A;  4YAP A;  4LA1 A;  2NPB A;  2H1A A;  2QA1 A;  4ZBD A;  5GZZ B;  1OC9 B;  4OCF A;  3HZ4 A;  5ELA A;  4ECJ A;  2WGR A;  3TKS A;  1ERU A;  1K0O A;  4MDC A;  5KEJ A;  4IS0 A;  3AY8 A;  1DSB A;  4L8E A;  3IK7 A;  3CTF A;  1SD8 A;  3ED3 A;  2CV4 A;  3N5O A;  5G1L A;  5ID2 A;  5L71 A;  1EP8 A;  2H1B A;  4O7H A;  4WBJ A;  3GYK A;  3GX0 A;  1X0R A;  4MCU A;  2AYT A;  2JSZ A;  3CYN A;  3L9V A;  3GUR A;  3GN3 A;  1DE1 A;  3ZFL A;  1JFU A;  1OAZ A;  4KH7 A;  4CY6 A;  1GSE A;  1ILO A;  3FHK A;  4ILF A;  5ECK B;  3IRA A;  3W6G A;  3GNJ A;  2H30 A;  1TU7 A;  2DJ2 A;  4G19 A;  4RQR A;  1K0A A;  1PFO A;  3TRP A;  1SKR B;  3LYP A;  2IMI A;  5BRT A;  2DJJ A;  5J9B A;  3FZ9 A;  2REM A;  2WUL A;  1GWC A;  5IMC A;  5DJL A;  3SWL A;  3V1W A;  2V6O A;  4NWY A;  3HA9 A;  1K0C A;  3DML A;  3QAW A;  3LGC A;  1B4P A;  1MEK A;  3GKN A;  1VF3 A;  1THO A;  1B4Q A;  4H86 A;  2GDR A;  4EKZ A;  4G10 A;  4OFM A;  1YEP A;  2ZNM A;  5INY A;  3RPN A;  4IKH A;  4YKF A;  1S3R A;  2CZ2 A;  3Q6O A;  4AF2 A;  3TJB A;  5D96 A;  2IWT A;  5H5S A;  3U6V A;  4CDO A;  1F2E A;  2YAN A;  3GL5 A;  2BMX A;  3M9K A;  1ZYN A;  3D6I A;  3HVV A;  3WD6 A;  1UVZ A;  5CRD A;  1Z6M A;  3IHQ A;  2YPM A;  1M3J A;  4N0Z A;  1X5D A;  3UVH A;  4BL7 B;  1TK0 B;  2IFQ A;  2AJQ B;  2H72 A;  4K0G A;  3TJG A;  3QPM A;  1AQX A;  4Z2R A;  5A4U A;  5IPH A;  3DVX A;  2MBT A;  5A4V A;  4EDY A;  4ZB8 A;  1QXH A;  2FCH A;  2DLX A;  4CHS A;  2CX4 A;  2H0G A;  1I9D A;  3KMN A;  3KEB A;  2CAI A;  2K18 A;  1M9B A;  2H0I A;  3HXS A;  4ZL7 A;  4V2M A;  4OCE A;  5JWR B;  5CRG A;  2LRC A;  2PN8 A;  2L6C A;  5B6N A;  3KD0 A;  4Q5F A;  5AIX A;  4BVX A;  5DBQ A;  1A2J A;  1XWA A;  4JR4 A;  2PPT A;  1Z9H A;  5IM9 A;  1EV4 A;  4PQI A;  4GCI A;  4HZ4 A;  2PU9 C;  2AHE A;  6GSX A;  3CSI A;  1WP0 A;  2PVQ A;  1TW9 A;  4AJ7 A;  4XIH A;  1O6J A;  3RAZ A;  1N8J A;  3NIV A;  1AC1 A;  3F63 A;  3KP9 A;  2FA4 A;  2HXK A;  1RK4 A;  4POK A;  1XOA A;  3LEF A;  2VCV A;  3VWV A;  2C0F A;  4FYU A;  4TXO A;  3QCP A;  5CRE A;  5ECM B;  1C72 A;  5JCW A;  3IE3 A;  1OVN A;  1ML6 A;  5A4W A;  3CMI A;  3I9V 2;  1SJI A;  5CO3 A;  4POM A;  3CRU A;  5G1K A;  3TJF A;  1FOH A;  4E8E A;  1GLP A;  4ZBA A;  5D9W A;  2IMK A;  1FW1 A;  4RUV A;  5J3R A;  5CP1 A;  1XW5 A;  2DJ1 A;  4BWS A;  4NV5 A;  1BX9 A;  3DXB A;  1K0N A;  4I5Q A;  2C3N A;  4PGT A;  2XPE A;  4N11 A;  5H5R A;  1ZGN A;  4NXI A;  2JZR A;  1R5A A;  2VCW A;  1Z3E A;  1FHE A;  1T4Z A;  2KOK A;  1R7H A;  3FZ5 A;  1XWK A;  2G2Q A;  4FH8 A;  1U6T A;  2HRF A;  4KCA A;  4MJE A;  2X8G A;  5DQY A;  5GST A;  2I4A A;  2HI7 A;  1GSU A;  4G0L A;  2PMT A;  2WRT A;  4IP1 A;  1SK1 A;  3IC8 A;  1MD4 A;  1B48 A;  5DQS A;  1Z6N A;  1SJZ A;  1UC7 A;  4ML1 A;  2A2S A;  5GAP D;  1S3D A;  5DDL A;  5KN0 A;  1FOV A;  2O7K A;  2QC7 A;  3NOF A;  10GS A;  1A8L A;  3RDW A;  4L0U A;  4N10 A;  2B5Y A;  5B8A A;  2P5R A;  2KLX A;  1OE7 A;  2L6D A;  3P8W A;  1XIY A;  3HHV A;  2QA2 A;  2JZT A;  4EVM A;  5BMU A;  4EE0 A;  3VPQ A;  1K3O A;  4MP4 A;  3HZ8 A;  5ECL B;  2XHF A;  4P3Y B;  2H6X A;  1OKD A;  3HVX A;  3TCO A;  2HRN A;  4WEY A;  2GZP A;  4CY8 A;  1EWX A;  5ECR B;  1AIU A;  1A23 A;  2KP2 A;  3UMA A;  1K0D A;  5ID2 B;  5A5K A;  17GS A;  3DIE A;  4TR4 A;  1A0R P;  1WE0 A;  3OR5 A;  2R37 A;  4WXT A;  4EO3 A;  4OO4 A;  3CSJ A;  5DAL A;  5HR1 A;  3ZML A;  4KDX A;  4HS1 A;  5DAK B;  4J2F A;  4L0W A;  3IAM 2;  2A2P A;  3FEU A;  5D9V A;  2YOI A;  3ME7 A;  3W8S A;  2MBS A;  3KXO A;  3KZQ A;  4NHW A;  5JWQ B;  5LCZ A;  3PH9 A;  4NMU A;  4BA7 A;  2DJK A;  2H66 A;  2CZ3 A;  4TXV A;  5AIV A;  1PKZ A;  1V2A A;  1QGV A;  1ZYQ B;  2RM5 A;  2B6M A;  1PSQ A;  3WT2 A;  4AJ8 A;  2A4H A;  4WBR D;  4ULX A;  1B9X C;  3D5J A;  3WGE A;  2LS5 A;  3FR3 A;  3IHG A;  2OJL A;  3L4N A;  4MAB A;  2M80 A;  1ON4 A;  1V40 A;  2VCT A;  2X99 A;  2GVP A;  2E7P A;  3E0U A;  4J56 E;  1LJR A;  2GGT A;  3ERF A;  22GS A;  2ON5 A;  3C71 A;  3DVW A;  3EUR A;  3M8N A;  5FWG A;  3I43 A;  3ERW A;  2DSA A;  6GSY A;  4Q5N A;  4Z7X A;  2C8U A;  2CX3 A;  4HJ2 A;  5CRH A;  2IPA A;  3TKP A;  2DKH A;  1Z7P A;  3H79 A;  1WJK A;  3G7J A;  3ZMK A;  2LEG A;  2I1U A;  4X0X A;  2O87 A;  3HY2 A;  1YEX A;  2HSM A;  1YZX A;  2H1D A;  1F37 A;  2GZZ A;  4QL7 A;  4GLT A;  4O5R A;  4V2L A;  3FMW A;  3A5I A;  2H19 A;  3MAK A;  5G5F A;  2DMM A;  5D73 A;  1SKW B;  1BG5 A;  3GUS A;  3GKX A;  4MLY A;  5DJM A;  3M9J A;  4KDY A;  3UAR A;  5CYY A;  2OA7 A;  4POB A;  4PUR A;  4ZL9 A;  5C04 A;  1BYE A;  1V58 A;  3M1G A;  3ZIV A;  1JLV A;  1HNB A;  1Y6E A;  2CVB A;  1VF1 A;  2VM2 A;  2BTO T;  3CBU A;  4XHM A;  5AGY A;  4V1A g;  3HYP A;  3HJO A;  3NZN A;  4ZB6 A;  1ZYP A;  4ZIJ A;  2V6K A;  3IDV A;  2FWG A;  3EC3 A;  5ECN B;  3BJ5 A;  4GRF A;  2A2R A;  4HJM A;  2E0Q A;  2YV9 A;  3LYK A;  3F3Q A;  1MDJ A;  1YKC A;  5HFK A;  1U3A A;  2MZC A;  3D0Z A;  4O32 A;  2LQQ A;  4DEJ A;  4FYB A;  4ECB A;  2VLT A;  2HNL A;  4TRX A;  2VCQ A;  3VWX A;  2ZUP A;  3FR6 A;  1G7O A;  3IPZ A;  2EC4 A;  4XS4 A;  3KIJ A;  1H4O A;  3UVT A;  4V2N A;  4L5L A;  2HYX A;  1B8X A;  1ZOF A;  3VPT A;  2QKE A;  1G6Y A;  1XFL A;  1KTE A;  1F6M C;  2LTK A;  3HD5 A;  4KND A;  2LNT A;  4BVY B;  4HEA 2;  2YWI A;  4RI7 A;  3APQ A;  4N0V A;  3F8U A;  4KW6 A;  4YKG A;  4RQX A;  2O85 A;  1X5C A;  4FQU A;  5IOW A;  1QK8 A;  2MMZ A;  1TP9 A;  2VUP A;  3QFB C;  4K9Z A;  2GT5 A;  1GUM A;  3P2A A;  4KSM A;  2H74 A;  1LBK A;  4HUA A;  1S3C A;  1GL8 A;  2GQM A;  2GQL A;  5EL8 A;  5KN2 A;  1A8Y A;  2FWH A;  3MNG A;  5CNW A;  3O6T A;  1T7P B;  2VOC A;  5G31 A;  2LV3 A;  2C80 A;  4IHU A;  2TRX A;  2YWO A;  1O8W A;  1GLQ A;  3EMP A;  4X43 A;  2XBI A;  1THX A;  2IMF A;  3WYW A;  2FY6 A;  2F3M A;  2VL9 A;  4AGS A;  1WPI A;  2X8H A;  4GSS A;  2WB9 A;  4KCE A;  1SU9 A;  1TDI A;  3L0H A;  1X9M B;  6GSV A;  5F06 A;  2VM1 A;  3ZVJ A;  1GP1 A;  1YDK A;  5F05 A;  4K0N A;  4DSS A;  3GA4 A;  5KN3 A;  2DJ0 A;  3MIX A;  4KSO A;  5GAN D;  4LLR A;  1ERW A;  1F3A A;  3GTU B;  2OAC A;  1HQO A;  3UAP A;  2AV4 A;  2KUC A;  3BCK A;  2H1G A;  4YQM A;  2ON7 A;  3G9B A;  4HQS A;  1FO5 A;  3FZA A;  2TRC P;  1X5E A;  3QOU A;  4HI7 A;  4MZB A;  3CXG A;  4DSQ A;  1OKT A;  4MK3 A;  3GSS A;  4V1A p;  3DWV A;  3FYG A;  4IJI A;  3FW2 A;  3L9U A;  2WJU A;  3VWU A;  2M72 A;  3FR9 A;  1GSQ A;  3O76 A;  2RLI A;  2PER A;  3DEX A;  4HSC X;  1O8X A;  4MH2 A;  4K1F A;  1M2D A;  1VF4 A;  3TDG A;  1MDI A;  2MYG A;  5CRW A;  4X4J A;  4NV2 A;  5DVB A;  2RUF A;  4GQF A;  2HZE A;  3HCZ A;  1FVJ A;  1HD2 A;  2K9F A;  1T8E B;  4GTU A;  4GQC A;  3TB2 A;  4PUF C;  2G0F A;  1GTB A;  3F3R A;  3HDC A;  4ZIL A;  3DKS A;  1HNA A;  4GSN A;  3IAS 2;  1XWC A;  2DIY A;  3U5R E;  4JBB A;  3R2Q A;  2OE1 A;  2LRN A;  4IVF A;  1MTC A;  2ALB A;  5ECO B;  4YAV A;  1SEN A;  1AXD A;  2HE3 A;  4HZ2 A;  4XRD A;  4OWY A;  2HT9 A;  2E2M A;  1E2Y A;  1UN2 A;  2LQO A;  4YQV A;  1NHO A;  3VFI A;  2O89 A;  1QFN A;  2CT6 A;  2PWJ A;  1OC9 A;  6GSW A;  2YZU A;  3LQ7 A;  3G7Y A;  1DE2 A;  3P7X A;  1GTI A;  3TGZ A;  3GH6 A;  5E59 A;  4ECC A;  1GTA A;  3TRX A;  1DBY A;  3I69 A;  4D73 A;  5KN1 A;  2VAF A;  2LST A;  4K2D A;  1OE8 A;  4Z2T A;  1RQM A;  2FA8 A;  2GSQ A;  4G9H A;  1BQ7 A;  3DYR A;  3WGD A;  2N5A A;  1H75 A;  1V57 A;  1XCC A;  1TRV A;  12GS A;  5IOX A;  3BD2 A;  1TI3 A;  4Q5R A;  5HR3 A;  1PQN A;  2H76 A;  2VIM A;  3FK8 A;  1YJ6 A;  4TN8 A;  5F0G A;  5LNK e;  5E4W A;  3DD3 A;  1R5P A;  1M7T A;  2YV7 A;  5H5Q A;  4ACS A;  1AQW A;  1TKD B;  2L59 A;  4KDU A;  1PN0 A;  1V98 A;  5HR2 A;  4WF5 A;  4IQA A;  4QQ7 A;  3C73 A;  3DGQ A;  3BCI A; 
#chains in the Genus database with same CATH homology
 3F0I A;  4ZXG A;  5HFG A;  2VL3 A;  2EIQ A;  4EUY A;  2R0P A;  3F4R A;  3RPP A;  1WWJ A;  1YY7 A;  1WOU A;  2IME A;  3GFK A;  3TJJ A;  2N5F A;  5C00 A;  1FB6 A;  2FWF A;  1T1V A;  2F51 A;  3UEM A;  3Q74 A;  4BWQ A;  1O73 A;  1USB A;  4G0K A;  2ZCT A;  2X8C A;  4ID0 A;  1M99 A;  5IMD A;  5JCG A;  5ABR A;  1UA5 A;  4ISD A;  4TR1 B;  5ECP B;  5HFI A;  2HRK A;  2H70 A;  3BBY A;  4RI6 A;  2HFD A;  3H4K A;  3UIW A;  5LD0 A;  2C0D A;  4BL7 A;  4XTS A;  1E6B A;  3PIN A;  2IL3 A;  2P31 A;  11GS A;  5ENU A;  3F6D A;  2I3Y A;  4A5P A;  1KNG A;  1ZYE A;  4FYC A;  2L4C A;  2DKI A;  4K7I A;  1QMV A;  1XW6 A;  5B6M A;  2V2G A;  3GX8 A;  5EY6 A;  3IC4 A;  4I8B A;  2CQ9 A;  5J5N A;  4HDE A;  3VUR A;  5AN1 A;  4K6X A;  4OD7 A;  1QQ2 A;  3EU3 A;  4GWR A;  3ZRE A;  4NHZ A;  5JCU A;  3HVS A;  5G30 A;  3TJK A;  2R0G A;  1GNW A;  1KBN A;  3GRX A;  2GTU A;  4KUN A;  1TRW A;  2R4V A;  1M2A A;  1TI1 A;  1O81 A;  2VLV A;  1FVK A;  3Q18 A;  3C7M A;  3EYT A;  1XVQ A;  4MH3 A;  1TK8 B;  2C3Q A;  4OFT A;  1Z7R A;  1OYJ A;  4JR6 A;  5B8B A;  1XXU A;  2L4Q A;  4G2E A;  4TR3 A;  1GH2 A;  4CW9 A;  3TOT A;  3TKS E;  2F8A A;  1NHY A;  1EV9 A;  4MF6 A;  4XRA A;  4E8H A;  1ABA A;  3EVI A;  1ZCP A;  2X4A A;  5KOW A;  19GS A;  2XC2 A;  1ACV A;  2OKA A;  1I5G A;  1WIK A;  1QUW A;  2WZ9 A;  1AQV A;  2ES7 A;  2FWE A;  1WMJ A;  3KGK A;  2C3T A;  2LJR A;  4EDZ A;  1R26 A;  4J57 E;  4PTS A;  3JCM L;  3LSZ A;  4MA9 A;  5FT3 A;  2O8V B;  4K8M A;  1GUK A;  3D4T A;  4KE3 A;  4PQH A;  3GMF A;  3ZTL A;  2LUS A;  1U3I A;  3ZIJ A;  4NPB A;  3QD9 A;  1EEM A;  2B7K A;  4MJB A;  5F8B A;  1Z5Y E;  4USS A;  2IFQ B;  2IN3 A;  4PUA A;  5D9X A;  3UJ1 A;  3GHA A;  2H6Y A;  1JZD A;  3CRT A;  1ST9 A;  3LJR A;  2FNO A;  2V1M A;  2H8L A;  3D4M A;  3LWA A;  3FKF A;  2YJ7 A;  1EGR A;  1GNE A;  9GSS A;  13GS A;  2B5X A;  3TKR A;  3GIX A;  4PNF A;  4I2U A;  4MPG A;  3TKQ A;  1TRS A;  5D93 A;  1T4Y A;  1B9Y C;  2OAD A;  1NM3 A;  4X1U A;  4FIW A;  1HYU A;  2VO4 A;  2VCX A;  5J9C A;  4QL9 A;  4BVX B;  4XS6 A;  5KOX A;  1OC3 A;  2GSS A;  2FUG 2;  3A3T A;  3LG6 A;  3GKM A;  2WCI A;  4GST A;  5ELG A;  1SL1 B;  1XWB A;  3EU4 A;  3KM6 A;  1PGT A;  4LMW A;  3H93 A;  4G0I A;  2YNX A;  4ICY A;  2B5E A;  2OBI A;  8GSS A;  1M9A A;  4POL A;  4TVE A;  4JRR A;  1F9M A;  2L5L A;  4PQ1 A;  4TXO B;  2WFC A;  4O5U A;  1BJX A;  4K5S A;  3N9J A;  2GQK A;  3D22 A;  3P90 A;  5FHI A;  2PBJ A;  2R3X A;  1A0F A;  4KGI A;  1PRX A;  2LJA A;  3A2V A;  1PX6 A;  5ECH B;  16GS A;  3EWL A;  1G7E A;  4XCS A;  5IPG A;  1AW9 A;  2VD0 A;  2QGV A;  4D73 B;  5D8I A;  1GUH A;  1YKA A;  3RHC A;  20GS A;  3MWH A;  1EOG A;  2PGT A;  4MF7 A;  4O5Q A;  4HU7 A;  5G5E A;  2BJX A;  5G2Z A;  2HSY A;  3QMX A;  4FO5 A;  2R0C A;  5IMZ A;  4WR5 A;  1EGO A;  5IMF A;  5IQY A;  5DCH A;  1GSD A;  1U88 A;  2WDU A;  4KB3 A;  1SKS B;  4JZQ A;  3US3 A;  5DAK A;  3FZ4 A;  3KH9 A;  2RM6 A;  5D9T A;  2H6Z A;  3GKK A;  2IJY A;  4MF5 A;  3EMX A;  2R6K A;  1XVW A;  2AB6 A;  3RBT A;  3MYD A;  1J9B A;  2GSR A;  2C4J A;  1XZO A;  1VRS D;  4PNG A;  1GSY A;  4Z2U A;  4TOP A;  5J41 A;  2JSY A;  4MNN A;  3ERG A;  1FG4 A;  1XWG A;  3F9U A;  2RUE A;  2GLR A;  5COH A;  1SYX A;  4KA0 A;  6GSU A;  3IV4 A;  3RHB A;  1GRX A;  2KP1 A;  2XBQ A;  3APS A;  4WR4 A;  4EIQ A;  1TJD A;  2DC5 A;  2AUV A;  3LXT A;  3F6F A;  4ZBB A;  2A4V A;  2H01 A;  1YQ1 A;  2DML A;  2FGX A;  1J08 A;  1NSW A;  2PVO C;  3Q19 A;  4IEL A;  1AUC A;  3ZLP A;  4JE1 A;  4ECI A;  2DIZ A;  1GUL A;  4K7N A;  1F3B A;  4EXJ A;  3LFL A;  5EPF A;  3QAG A;  2I9H A;  6GSS A;  3UBK A;  4TKY A;  2GZY A;  2NBS A;  3CTG A;  1K0M A;  3KTB A;  1YF1 A;  4KF9 A;  1EEJ A;  3D21 A;  1URM A;  1O7U A;  3KMO A;  2F9S A;  1A24 A;  3IXR A;  4K7O A;  4N30 A;  2J9H A;  4LL1 B;  1R4W A;  3A5W A;  5AIS A;  4EL1 A;  2K8S A;  3KCM A;  4LL4 B;  1IYH A;  2DBC A;  5DAL B;  3SBC A;  2HSH A;  2EIR A;  3EIN A;  1GTU A;  3MDK A;  1PL1 A;  3IK9 A;  1G0T A;  3QDN A;  1TK5 B;  2B1L A;  3G7I A;  3E3E A;  3PPU A;  3VK9 A;  1AAZ A;  2FLS A;  4IQ1 A;  2OBK A;  3KTL A;  3HJP A;  2GT6 A;  2LJK A;  2H75 A;  1PKW A;  1X9S B;  1PA3 A;  1W4V A;  2R5G A;  5HQP A;  2RII A;  2LNS A;  4KAE A;  4MJA A;  4IJ3 A;  4GF0 A;  4MPF A;  1JZO A;  1ERV A;  1Q4J A;  3HJM A;  4MZC A;  1V9W A;  2MMO A;  2UZ8 A;  4Q5Q A;  7GSS A;  3ISO A;  4I97 A;  3A2W A;  1W89 A;  1J0F A;  2YWM A;  1EZK A;  1PX7 A;  5IMV A;  3H8Q A;  3GL3 A;  2MMA A;  3TUE A;  3WT1 A;  2QSI A;  3EE2 A;  4F9Z A;  5JWO B;  3GST A;  5ECQ B;  2NTO A;  3KH7 A;  14GS A;  3ZYW A;  3KJY A;  4O92 A;  1A2M A;  2LRT A;  4TR0 A;  4TW5 A;  3IR4 A;  1N2A A;  3C1R A;  4F0B A;  3M3M A;  1ZL9 A;  4BVY A;  3DRN A;  2CAQ A;  1XW9 A;  2TIR A;  4HOJ A;  1ZZY A;  2D2Z A;  1GSF A;  4WKW A;  3O3T A;  1ERT A;  3GH9 A;  5ECI B;  4LMV A;  1TOF A;  2KHP A;  1SL0 B;  3UBL A;  1RW1 A;  3TOU A;  4OMV A;  1BAY A;  3F4T A;  4WET A;  2HZF A;  3L9S A;  4EF0 A;  5DCG A;  2IMD A;  2M46 A;  1VF2 A;  2YZH A;  3LXZ A;  3J7Y k;  1M0U A;  2AAW A;  2VL2 C;  1PD2 1;  2PUK C;  1HNC A;  2L5O A;  1O85 A;  3UL3 A;  2YCD A;  1SK2 A;  2DJ3 A;  1VGL A;  4IW9 A;  4ZL8 A;  2CVD A;  3PGT A;  3BOA A;  3W8J A;  1FB0 A;  2Z9S A;  1TTZ A;  1TRU A;  4F0C A;  3WGX A;  3IOS A;  3GTU A;  2YP6 A;  2F8F A;  4YQU A;  4IP6 A;  2HRA A;  4MZW A;  3QAV A;  1WRY A;  2E2G A;  2C0E A;  1X9W B;  1BED A;  2V32 A;  2H73 A;  3TRQ A;  1PN9 A;  1JZW A;  4PX1 A;  2N5B A;  5IO2 A;  4XS4 B;  1SJ6 A;  3FRC A;  4JU5 A;  3ZFB A;  2CVK A;  3HKR A;  1A2L A;  4HQZ A;  2IIY A;  1T3B A;  3K8N A;  4BPY A;  1SL2 B;  3EPT A;  1FAA A;  1U87 A;  2JAD A;  2NDO A;  3VI5 A;  2JZS A;  3MSZ A;  1JLW A;  1SK0 A;  3C8E A;  2K6V A;  3TKS C;  4F03 A;  5IO0 A;  2VD1 A;  1G6W A;  1EOH A;  2YJH A;  1MD3 A;  2H71 A;  3VWW A;  2B7J A;  1NW2 A;  2YWN A;  1Q98 A;  1GSS A;  3J7Y b;  1S3A A;  1MDK A;  2B3S A;  2WS2 A;  1LU4 A;  3CSH A;  4XS1 A;  3H1N A;  4EIP A;  3ZL5 A;  2P0G A;  5J4U A;  2X49 A;  1EP7 A;  1SYR A;  3ZRD A;  4IBP A;  3QFA C;  1OC8 A;  4MMM A;  3ME8 A;  3ZZX A;  2FD3 A;  1TU8 A;  5GSS A;  5CAX A;  4ML6 A;  1PL2 A;  2P5Q A;  4I6X A;  3C1S A;  1JHB A;  4DSS B;  2VCZ A;  1Y25 A;  1XPV A;  2HLS A;  3FY7 A;  2FHE A;  2OE3 A;  2GST A;  3LW9 A;  1ZMA A;  4L5O A;  4IGJ A;  1CQH A;  3QR6 A;  2L57 A;  3IA1 A;  3KP8 A;  1TXX A;  2I81 A;  4ZB9 A;  4OFN A;  5IIZ A;  1T00 A;  2VL2 A;  4EC0 A;  1XBS A;  2C0G A;  5ECS A;  1YF0 A;  3F4S A;  3VI7 A;  3PR8 A;  18GS A;  3A2X A;  6GST A;  1DUG A;  2J23 A;  4JED A;  3UOM A;  4IN0 A;  2NVL A;  3M0F A;  2JL4 A;  2CA8 A;  1K3L A;  1KEB A;  1PMT A;  2B1K A;  2VLU A;  1K3Y A;  5HR0 A;  2H0H A;  4MJC A;  4F82 A;  2MMN A;  4YH2 A;  4F2I A;  4WF4 A;  3ZIT A;  3VLN A;  5IMA A;  3ZVJ D;  5F07 A;  3IBH A;  4DSR A;  2V41 A;  2K8V A;  2HZE B;  3R3E A;  2JU5 A;  4I2T A;  3I6A A;  2YN1 A;  2GS3 A;  4GXZ A;  1M2B A;  3APO A;  2X64 A;  3GV1 A;  5B7C A;  1JZR A;  3L78 A;  4K5R A;  2R2J A;  3LOR A;  5EVO A;  4HU9 A;  4KX4 A;  3E9J B;  2OE0 A;  1K0B A;  1CQG A;  2C1Y A;  1SD9 A;  4PXO A;  4TR1 A;  2XPD A;  1XOB A;  1IYI A;  4NAX A;  4OO5 A;  2JAC A;  3S9F A;  4AJ6 A;  2EIO A;  4DVC A;  2LKU A;  4K2X A;  4YAP A;  4LA1 A;  2NPB A;  2H1A A;  2QA1 A;  4ZBD A;  5GZZ B;  1OC9 B;  4OCF A;  3HZ4 A;  5ELA A;  4ECJ A;  2WGR A;  3TKS A;  1ERU A;  1K0O A;  4MDC A;  5KEJ A;  4IS0 A;  3AY8 A;  1DSB A;  4L8E A;  3IK7 A;  3CTF A;  1SD8 A;  3ED3 A;  2CV4 A;  3N5O A;  5G1L A;  5ID2 A;  5L71 A;  1EP8 A;  2H1B A;  4O7H A;  4WBJ A;  3GYK A;  3GX0 A;  1X0R A;  4MCU A;  2AYT A;  2JSZ A;  3CYN A;  3L9V A;  3GUR A;  3GN3 A;  1DE1 A;  3ZFL A;  1JFU A;  1OAZ A;  4KH7 A;  4CY6 A;  1GSE A;  1ILO A;  3FHK A;  4ILF A;  5ECK B;  3IRA A;  3W6G A;  3GNJ A;  2H30 A;  1TU7 A;  2DJ2 A;  4G19 A;  4RQR A;  1K0A A;  1SKR B;  3TRP A;  3LYP A;  2IMI A;  5BRT A;  2DJJ A;  5J9B A;  3FZ9 A;  2REM A;  2WUL A;  1GWC A;  5IMC A;  5DJL A;  3SWL A;  3V1W A;  2V6O A;  4NWY A;  3HA9 A;  1K0C A;  3DML A;  3QAW A;  3LGC A;  1B4P A;  1MEK A;  3GKN A;  1VF3 A;  1THO A;  1B4Q A;  4H86 A;  2GDR A;  4EKZ A;  4G10 A;  4OFM A;  1YEP A;  2ZNM A;  5INY A;  3RPN A;  4IKH A;  4YKF A;  2CZ2 A;  3Q6O A;  4AF2 A;  3TJB A;  5D96 A;  2IWT A;  5H5S A;  3U6V A;  4CDO A;  1F2E A;  2YAN A;  3GL5 A;  2BMX A;  3M9K A;  1ZYN A;  3D6I A;  3HVV A;  3WD6 A;  1UVZ A;  5CRD A;  1Z6M A;  3IHQ A;  2YPM A;  4N0Z A;  1X5D A;  3UVH A;  4BL7 B;  1TK0 B;  2IFQ A;  2AJQ B;  2H72 A;  4K0G A;  3TJG A;  3QPM A;  1AQX A;  4Z2R A;  5A4U A;  5IPH A;  3DVX A;  2MBT A;  5A4V A;  4EDY A;  4ZB8 A;  1QXH A;  2FCH A;  2DLX A;  4CHS A;  2CX4 A;  2H0G A;  1I9D A;  3KMN A;  3KEB A;  2CAI A;  2K18 A;  1M9B A;  2H0I A;  3HXS A;  4ZL7 A;  4V2M A;  4OCE A;  5JWR B;  5CRG A;  2LRC A;  2PN8 A;  2L6C A;  5B6N A;  3KD0 A;  4Q5F A;  5AIX A;  4BVX A;  5DBQ A;  1A2J A;  1XWA A;  4JR4 A;  2PPT A;  1Z9H A;  5IM9 A;  1EV4 A;  4PQI A;  4GCI A;  4HZ4 A;  2PU9 C;  2AHE A;  6GSX A;  3CSI A;  1WP0 A;  2PVQ A;  1TW9 A;  4AJ7 A;  4XIH A;  1O6J A;  3RAZ A;  1N8J A;  3NIV A;  1AC1 A;  3F63 A;  3KP9 A;  2FA4 A;  2HXK A;  1RK4 A;  4POK A;  1XOA A;  3LEF A;  2VCV A;  3VWV A;  2C0F A;  4FYU A;  4TXO A;  3QCP A;  5CRE A;  5ECM B;  1C72 A;  5JCW A;  3IE3 A;  1OVN A;  1ML6 A;  5A4W A;  3CMI A;  3I9V 2;  1SJI A;  5CO3 A;  4POM A;  3CRU A;  5G1K A;  3TJF A;  1FOH A;  4E8E A;  1GLP A;  4ZBA A;  5D9W A;  2IMK A;  1FW1 A;  4RUV A;  5J3R A;  5CP1 A;  1XW5 A;  2DJ1 A;  4BWS A;  4NV5 A;  1BX9 A;  3DXB A;  1K0N A;  4I5Q A;  2C3N A;  4PGT A;  2XPE A;  4N11 A;  5H5R A;  1ZGN A;  4NXI A;  2JZR A;  1R5A A;  2VCW A;  1Z3E A;  1FHE A;  1T4Z A;  2KOK A;  1R7H A;  3FZ5 A;  1XWK A;  2G2Q A;  4FH8 A;  1U6T A;  2HRF A;  4KCA A;  4MJE A;  2X8G A;  5DQY A;  5GST A;  2I4A A;  2HI7 A;  1GSU A;  4G0L A;  2PMT A;  2WRT A;  4IP1 A;  1SK1 A;  3IC8 A;  1MD4 A;  1B48 A;  5DQS A;  1Z6N A;  1SJZ A;  1UC7 A;  4ML1 A;  2A2S A;  5GAP D;  1S3D A;  5DDL A;  5KN0 A;  1FOV A;  2O7K A;  2QC7 A;  3NOF A;  10GS A;  1A8L A;  3RDW A;  4L0U A;  4N10 A;  2B5Y A;  5B8A A;  2P5R A;  2KLX A;  1OE7 A;  2L6D A;  3P8W A;  1XIY A;  3HHV A;  2QA2 A;  2JZT A;  4EVM A;  5BMU A;  4EE0 A;  3VPQ A;  1K3O A;  4MP4 A;  3HZ8 A;  5ECL B;  2XHF A;  4P3Y B;  2H6X A;  1OKD A;  3HVX A;  3TCO A;  2HRN A;  4WEY A;  2GZP A;  4CY8 A;  1EWX A;  5ECR B;  1AIU A;  1A23 A;  2KP2 A;  3UMA A;  1K0D A;  5ID2 B;  5A5K A;  17GS A;  3DIE A;  4TR4 A;  1A0R P;  1WE0 A;  3OR5 A;  2R37 A;  4WXT A;  4EO3 A;  4OO4 A;  3CSJ A;  5DAL A;  5HR1 A;  3ZML A;  4KDX A;  4HS1 A;  5DAK B;  4J2F A;  4L0W A;  3IAM 2;  2A2P A;  3FEU A;  5D9V A;  2YOI A;  3ME7 A;  3W8S A;  2MBS A;  3KXO A;  3KZQ A;  4NHW A;  5JWQ B;  5LCZ A;  3PH9 A;  4NMU A;  4BA7 A;  2DJK A;  2H66 A;  2CZ3 A;  4TXV A;  5AIV A;  1PKZ A;  1V2A A;  1QGV A;  1ZYQ B;  2RM5 A;  2B6M A;  1PSQ A;  3WT2 A;  4AJ8 A;  2A4H A;  4WBR D;  4ULX A;  1B9X C;  3D5J A;  3WGE A;  2LS5 A;  3FR3 A;  3IHG A;  2OJL A;  3L4N A;  4MAB A;  2M80 A;  1ON4 A;  1V40 A;  2VCT A;  2X99 A;  2GVP A;  2E7P A;  3E0U A;  4J56 E;  1LJR A;  2GGT A;  3ERF A;  22GS A;  2ON5 A;  3C71 A;  3DVW A;  3EUR A;  3M8N A;  5FWG A;  3I43 A;  3ERW A;  2DSA A;  6GSY A;  4Q5N A;  4Z7X A;  2C8U A;  2CX3 A;  4HJ2 A;  5CRH A;  2IPA A;  3TKP A;  2DKH A;  1Z7P A;  3H79 A;  1WJK A;  3G7J A;  3ZMK A;  2LEG A;  2I1U A;  4X0X A;  2O87 A;  3HY2 A;  1YEX A;  2HSM A;  1YZX A;  2H1D A;  1F37 A;  2GZZ A;  4QL7 A;  4GLT A;  4O5R A;  4V2L A;  3FMW A;  3A5I A;  2H19 A;  3MAK A;  5G5F A;  2DMM A;  5D73 A;  1SKW B;  1BG5 A;  3GUS A;  3GKX A;  4MLY A;  5DJM A;  3M9J A;  4KDY A;  3UAR A;  5CYY A;  2OA7 A;  4POB A;  4PUR A;  4ZL9 A;  5C04 A;  1BYE A;  1V58 A;  3M1G A;  3ZIV A;  1JLV A;  1HNB A;  1Y6E A;  2CVB A;  1VF1 A;  2VM2 A;  2BTO T;  3CBU A;  4XHM A;  5AGY A;  4V1A g;  3HYP A;  3HJO A;  3NZN A;  4ZB6 A;  1ZYP A;  4ZIJ A;  2V6K A;  3IDV A;  2FWG A;  3EC3 A;  5ECN B;  3BJ5 A;  4GRF A;  2A2R A;  4HJM A;  2E0Q A;  2YV9 A;  3LYK A;  3F3Q A;  1MDJ A;  1YKC A;  5HFK A;  1U3A A;  2MZC A;  3D0Z A;  4O32 A;  2LQQ A;  4DEJ A;  4FYB A;  4ECB A;  2VLT A;  2HNL A;  4TRX A;  2VCQ A;  3VWX A;  2ZUP A;  3FR6 A;  1G7O A;  3IPZ A;  2EC4 A;  4XS4 A;  3KIJ A;  1H4O A;  3UVT A;  4V2N A;  4L5L A;  2HYX A;  1B8X A;  1ZOF A;  3VPT A;  2QKE A;  1G6Y A;  1XFL A;  1KTE A;  1F6M C;  2LTK A;  3HD5 A;  4KND A;  2LNT A;  4BVY B;  4HEA 2;  2YWI A;  4RI7 A;  3APQ A;  4N0V A;  3F8U A;  4KW6 A;  4YKG A;  4RQX A;  2O85 A;  1X5C A;  4FQU A;  5IOW A;  1QK8 A;  2MMZ A;  1TP9 A;  2VUP A;  3QFB C;  4K9Z A;  2GT5 A;  1GUM A;  3P2A A;  4KSM A;  2H74 A;  1LBK A;  4HUA A;  1S3C A;  1GL8 A;  2GQM A;  2GQL A;  5EL8 A;  5KN2 A;  1A8Y A;  2FWH A;  3MNG A;  5CNW A;  3O6T A;  1T7P B;  2VOC A;  5G31 A;  2LV3 A;  2C80 A;  4IHU A;  2TRX A;  2YWO A;  1O8W A;  1GLQ A;  3EMP A;  4X43 A;  2XBI A;  1THX A;  2IMF A;  3WYW A;  2FY6 A;  2F3M A;  2VL9 A;  4AGS A;  1WPI A;  2X8H A;  4GSS A;  2WB9 A;  4KCE A;  1SU9 A;  1TDI A;  3L0H A;  1X9M B;  6GSV A;  5F06 A;  2VM1 A;  3ZVJ A;  1GP1 A;  1YDK A;  5F05 A;  4K0N A;  4DSS A;  3GA4 A;  5KN3 A;  2DJ0 A;  3MIX A;  4KSO A;  5GAN D;  4LLR A;  1ERW A;  1F3A A;  3GTU B;  2OAC A;  1HQO A;  3UAP A;  2AV4 A;  2KUC A;  3BCK A;  2H1G A;  4YQM A;  2ON7 A;  3G9B A;  4HQS A;  1FO5 A;  3FZA A;  2TRC P;  1X5E A;  3QOU A;  4HI7 A;  4MZB A;  3CXG A;  4DSQ A;  1OKT A;  4MK3 A;  3GSS A;  4V1A p;  3DWV A;  3FYG A;  4IJI A;  3FW2 A;  3L9U A;  2WJU A;  3VWU A;  2M72 A;  3FR9 A;  1GSQ A;  3O76 A;  2RLI A;  2PER A;  3DEX A;  1O8X A;  4MH2 A;  4K1F A;  1M2D A;  1VF4 A;  3TDG A;  1MDI A;  2MYG A;  5CRW A;  4X4J A;  4NV2 A;  5DVB A;  2RUF A;  4GQF A;  2HZE A;  3HCZ A;  1FVJ A;  1HD2 A;  2K9F A;  1T8E B;  4GTU A;  4GQC A;  3TB2 A;  4PUF C;  2G0F A;  1GTB A;  3F3R A;  3HDC A;  4ZIL A;  3DKS A;  1HNA A;  4GSN A;  3IAS 2;  1XWC A;  2DIY A;  3U5R E;  4JBB A;  3R2Q A;  2OE1 A;  2LRN A;  4IVF A;  1MTC A;  2ALB A;  5ECO B;  4YAV A;  1SEN A;  1AXD A;  2HE3 A;  4HZ2 A;  4XRD A;  4OWY A;  2HT9 A;  2E2M A;  1E2Y A;  1UN2 A;  2LQO A;  4YQV A;  1NHO A;  3VFI A;  2O89 A;  1QFN A;  2CT6 A;  2PWJ A;  1OC9 A;  6GSW A;  2YZU A;  3LQ7 A;  3G7Y A;  1DE2 A;  3P7X A;  1GTI A;  3TGZ A;  3GH6 A;  5E59 A;  4ECC A;  1GTA A;  3TRX A;  1DBY A;  3I69 A;  4D73 A;  5KN1 A;  2VAF A;  2LST A;  4K2D A;  1OE8 A;  4Z2T A;  1RQM A;  2FA8 A;  2GSQ A;  4G9H A;  1BQ7 A;  3DYR A;  3WGD A;  2N5A A;  1H75 A;  1V57 A;  1XCC A;  1TRV A;  12GS A;  5IOX A;  3BD2 A;  1TI3 A;  4Q5R A;  5HR3 A;  1PQN A;  2H76 A;  2VIM A;  3FK8 A;  1YJ6 A;  4TN8 A;  5F0G A;  5LNK e;  5E4W A;  3DD3 A;  1R5P A;  1M7T A;  2YV7 A;  5H5Q A;  4ACS A;  1AQW A;  1TKD B;  2L59 A;  4KDU A;  1PN0 A;  1V98 A;  5HR2 A;  4WF5 A;  4IQA A;  4QQ7 A;  3C73 A;  3DGQ A;  3BCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...