2LJAA

Solution structure of a putative thiol-disulfide oxidoreductase from bacteroides vulgatus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
152
Chain Sequence
MSLRSGNPSAASFSYPDINGKTVSLADLKGKYIYIDVWATWCGPCRGELPALKELEEKYAGKDIHFVSLSCDKNKKAWENMVTKDQLKGIQLHMGTDRTFMDAYLINGIPRFILLDRDGKIISANMTRPSDPKTAEKFNELLGLEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative thiol-disulfide oxidoreductase
publication title Solution Structure of a putative thiol-disulfide oxidoreductase from Bacteroides vulgatus
rcsb
source organism Bacteroides vulgatus
molecule tags Structural genomics, unknown function
total genus 47
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ljaA00
2L57A 1K3LA 1LU4A 1DSBA 4HQZA 1KNGA 3ZRDA 3GUSA 2LSTA 3P2AA 4MF6A 2JZTA 2IMIA 5ECHB 3U5RE 1M0UA 1XWBA 2G0FA 1A0RP 3GKMA 1Z6NA 4X0XA 3C1SA 4K9ZA 3DIEA 3UVHA 2GSRA 4IHUA 4WETA 2MZCA 3C1RA 4DVCA 2R6KA 3D5JA 4HDEA 4POMA 3CSHA 2NTOA 5AIVA 2LQOA 5D9XA 1E2YA 1DE1A 2V6OA 3K8NA 4MP4A 2DJ1A 3H1NA 5DQYA 4NV2A 3Q18A 1XCCA 2CQ9A 3UARA 5CRWA 4Q5NA 1OC9A 5J41A 2AYTA 1K3OA 3ZVJD 3QMXA 2CX3A 1B9XC 3ZIVA 5AIXA 2IMKA 2H70A 1GSYA 2I9HA 5DALA 1BJXA 2LEGA 1XWGA 5GSSA 3M8NA 4FO5A 2CVDA 2L6CA 1AC1A 1SK2A 3LGCA 3FR6A 3TRPA 4EDZA 4AJ8A 1M2AA 5G5FA 3HJOA 4MA9A 2VUPA 3FR9A 3HVXA 4DEJA 5F05A 3QR6A 3GSSA 4JU5A 1TK5B 5CP1A 3RBTA 2H71A 3EINA 2X99A 4TKYA 4FH8A 3AY8A 3BJ5A 1U6TA 1OVNA 1B4QA 1O7UA 3DMLA 3H79A 1YEXA 1JZWA 2BTOT 3A2XA 1E6BA 4F9ZA 5HR1A 2C4JA 5LD0A 1MDJA 4O32A 4L5OA 3HA9A 2VCTA 3IK9A 5JWOB 1SJIA 2MBSA 2H66A 2LV3A 3GKNA 4NHZA 4ECJA 4ECIA 5IMDA 2N5AA 4EKZA 5IMCA 3G7YA 4I2UA 1BAYA 1QXHA 3KXOA 1Q98A 3WGEA 1T3BA 5HR0A 3ZTLA 2H1AA 5KN3A 1LBKA 2EIRA 5IO2A 3FKFA 3F6FA 11GSA 2E0QA 1C72A 1U3AA 1PN9A 2I4AA 4HI7A 1A8LA 6GSSA 1A2JA 4ZB9A 2JZSA 1QFNA 2DC5A 3IRAA 2DMLA 2VLUA 3WT2A 2VAFA 3OR5A 4IW9A 3ZVJA 4PUFC 4MH3A 4EDYA 2YN1A 1SJ6A 1ILOA 3U6VA 2CZ2A 14GSA 4BL7A 5GSTA 2WS2A 3TJKA 4YAPA 3FK8A 1LJRA 2YJHA 1MDKA 4G10A 3O76A 1OAZA 4JRRA 1THXA 2HT9A 2J23A 3TKSA 4F82A 4Q5QA 1K0MA 4WF5A 4WKWA 2WFCA 1CQGA 2PWJA 2CVKA 3RPNA 4RUVA 2YWIA 1F3AA 4ZL8A 1TKDB 3HXSA 1ZYEA 4ZL9A 3LFLA 4CDOA 1SKRB 2I1UA 5DAKB 3I43A 5DQSA 1G7EA 1HYUA 1R26A 3KTBA 2EIQA 1GSQA 3DEXA 2IMFA 3GFKA 2E2MA 5G1KA 2YV7A 1JLVA 2K9FA 1WWJA 1TP9A 2H6ZA 1RW1A 5EVOA 1SL1B 2VO4A 4OD7A 3D21A 1XW9A 3HCZA 3DYRA 3GA4A 6GSYA 2IFQB 4J2FA 5J5NA 1DE2A 2C3TA 3GV1A 4TR4A 2LNSA 5B8BA 1ERTA 3NIVA 2VCWA 5CRHA 1XFLA 1JZOA 1EV9A 3HY2A 4WF4A 3P7XA 2GT6A 3D22A 3WGXA 2BJXA 3FEUA 2PMTA 2H73A 2E7PA 2YPMA 1QGVA 3VURA 5JWRB 2AB6A 3GL5A 4G19A 2L59A 3EMXA 2NBSA 3MWHA 4EF0A 1NM3A 3ZL5A 3N5OA 1RQMA 2C3NA 1PKWA 3ZZXA 1TDIA 1T1VA 5F07A 3IHQA 3IBHA 3HHVA 4KCAA 3FYGA 5KN1A 3CYNA 5LCZA 3EWLA 3GKXA 5DCHA 3KIJA 2O7KA 1WPIA 5DAKA 5IOXA 5J4UA 4XS1A 12GSA 1F2EA 1YY7A 2L5OA 5EL8A 1VF2A 3DXBA 1T8EB 1USBA 2YWMA 1SL2B 5IMFA 1K0NA 2OA7A 4MK3A 1SD8A 3TDGA 3ZMKA 3I69A 1XVWA 4LLRA 18GSA 4TXOB 3G7JA 4KSOA 3I9V2 2IFQA 2VM1A 5DCGA 3D4TA 1TI1A 3L0HA 1TU7A 4K8MA 2GTUA 2RUEA 1TRWA 2C3QA 1KBNA 2YZHA 3RDWA 2LS5A 3VPTA 1AAZA 2AUVA 3IC4A 1Z6MA 4HU9A 1O6JA 3MSZA 3RAZA 1R4WA 4D73B 2REMA 3ZLPA 1GSUA 4JR4A 3TKSC 1QMVA 3VWVA 2XBIA 2C80A 1G6YA 1X5DA 2P31A 3BCKA 2OE3A 3EE2A 2KLXA 2GZYA 5EPFA 4KDUA 1AQWA 1KEBA 4ECCA 1HNAA 3F9UA 3LG6A 3ED3A 1PD21 1GLQA 5CAXA 3QFBC 2NVLA 2IMEA 3A2WA 4MF5A 3F8UA 1O81A 2MYGA 5EY6A 1GRXA 2CZ3A 3GL3A 2H0GA 4ID0A 2L5LA 4WR4A 5G5EA 1MDIA 2GDRA 2YWOA 4TXOA 3LXZA 3LORA 4HU7A 4MZBA 1SD9A 2F9SA 2DJ3A 2H1BA 3GTUB 4NPBA 1K0BA 1V2AA 3IXRA 2H6XA 5J9CA 1VRSD 2V41A 4YQVA 2FGXA 3F3RA 1XOBA 4PX1A 4WR5A 1T00A 5COHA 1W89A 1CQHA 1X0RA 4K7IA 5ECIB 1XXUA 4MMMA 4L0WA 4TOPA 4D73A 4OCFA 3ZITA 4TR1B 1XIYA 1MTCA 4PQHA 1TOFA 5CRGA 1H75A 4YH2A 4PXOA 3TKSE 2R3XA 3TKQA 2A2SA 4BVXA 3TRQA 4F2IA 1XW5A 2ZNMA 2B5EA 1DBYA 1MD3A 4MPFA 3GURA 2H8LA 2GQMA 1TRSA 3US3A 1EGRA 4I97A 4KSMA 5B8AA 3UVTA 2YWNA 2MMNA 2YZUA 4ZB6A 1AW9A 1GTIA 1UC7A 2H0HA 4HZ2A 1WRYA 2XBQA 4OO5A 3BBYA 4MH2A 3C71A 1K0CA 2H6YA 3KTLA 2VCQA 1DUGA 3FHKA 3KEBA 1WJKA 3GTUA 4RI6A 1NSWA 2IWTA 3QDNA 2LRTA 1OC8A 2Z9SA 4HS1A 3APOA 2DJKA 2CVBA 5C00A 1PA3A 2LKUA 1SL0B 2CAIA 2LUSA 2R2JA 5IMZA 3CXGA 2IPAA 4X43A 3QOUA 4ML6A 2HZFA 1XWKA 4IP1A 3NOFA 3DRNA 2OBKA 3FR3A 4TR1A 4HZ4A 4HQSA 4MF7A 4KDYA 4X1UA 5CO3A 4IP6A 2GGTA 3E3EA 4ISDA 1W4VA 5INYA 5CYYA 2B7KA 1FOVA 3NZNA 13GSA 4MJAA 1O85A 5KN0A 2VL2A 2PUKC 1V98A 3GN3A 3IOSA 1A8YA 1X5CA 3GNJA 4XRAA 3TJGA 3VWXA 1GLPA 1N8JA 2H1DA 4FIWA 4I6XA 3VI5A 3UL3A 1GWCA 4ZL7A 3O3TA 2V6KA 4MCUA 2QKEA 3UEMA 1M9AA 5H5QA 4GXZA 3S9FA 4Q5FA 2YNXA 5B6MA 2CT6A 2HYXA 4CW9A 4BPYA 2FD3A 1F9MA 3HZ4A 2GQKA 5ELAA 2LTKA 4RQXA 2EIOA 2I81A 5HFKA 3UAPA 1PGTA 2HRFA 17GSA 2BMXA 4N0ZA 2C8UA 4PUAA 3TKPA 4N30A 4E8EA 1JHBA 4TVEA 3UOMA 3F4RA 1VF4A 1FVKA 1V40A 1EP7A 1K0DA 2PBJA 1MD4A 3W8JA 1AQXA 4IQAA 2IL3A 2EC4A 4K6XA 1PL1A 5IOWA 3H8QA 3P8WA 1B48A 2R5GA 1M2DA 3VI7A 2K8SA 1G7OA 2IMDA 3ZIJA 4AF2A 2MMZA 1X9MB 4JEDA 1BYEA 5HFIA 5ENUA 2OE0A 1ZGNA 2F3MA 2V2GA 3FZAA 4F0BA 2XC2A 1K3YA 2OACA 4AJ6A 3FW2A 2X8CA 3MNGA 1WE0A 5G30A 4WBJA 2CAQA 1GSDA 3FRCA 5E59A 4OFTA 4L5LA 1UN2A 2JADA 2GQLA 3M1GA 8GSSA 4ZBBA 1N2AA 2CA8A 3L78A 2R4VA 1H4OA 1EEMA 3WYWA 3D6IA 4GWRA 4MJCA 2H0IA 3DD3A 2OE1A 2WB9A 1YZXA 4K2DA 1O73A 5ECKB 2C0EA 3FZ9A 3F63A 3TJBA 1ACVA 2LRCA 5DJMA 1SENA 1UVZA 1YEPA 1JLWA 4V1Ap 5ECPB 2F8AA 3F3QA 1SYRA 4TR3A 2OADA 4LL1B 5D96A 2H74A 4KAEA 3DGQA 5IQYA 4QL7A 5G2ZA 2KHPA 3PH9A 1PRXA 5ECNB 5D9TA 3M3MA 3A3TA 4GQFA 2GZZA 3IR4A 3QAVA 1X5EA 1TRUA 4JZQA 2B6MA 3GH6A 5ABRA 4L8EA 3IV4A 1OE8A 4JBBA 1QK8A 2OJLA 2CX4A 2VL2C 1WOUA 3C73A 4EL1A 4WBRD 3VK9A 4FYBA 4J56E 2VD1A 2AV4A 3LEFA 3C8EA 2M46A 2KOKA 4K1FA 2PPTA 1ZL9A 2YANA 2ES7A 1PX7A 3KM6A 1EWXA 2E2GA 3EMPA 4ILFA 4XS6A 5D9VA 1XBSA 4O5RA 2PVQA 4LMWA 5JCGA 2ZCTA 5ECOB 3V1WA 2YOIA 1B9YC 4AJ7A 1YF0A 4I8BA 4F0CA 5ECQB 4ZXGA 4OWYA 2G2QA 4XCSA 3F6DA 2M72A 4OMVA 4PQIA 9GSSA 3CTFA 3FY7A 4IELA 3E0UA 2WCIA 1Y6EA 2KUCA 1GSFA 4POBA 5A4VA 2GLRA 4HUAA 3ZYWA 5H5RA 4IN0A 3L4NA 1PQNA 2HZEB 5ELGA 3ZMLA 3L9VA 3SBCA 4ZILA 4H86A 2LJRA 1M99A 2DMMA 2VD0A 1EP8A 4EO3A 3R2QA 4IVFA 3GH9A 2HE3A 3W8SA 20GSA 1ZCPA 2B1KA 3TCOA 4OFNA 4K7NA 2NDOA 3TOTA 5IMVA 2DIYA 2FWHA 1WMJA 4ULXA 4OO4A 2MBTA 1A2MA 2XHFA 3N9JA 4K7OA 1GTAA 2TIRA 2HNLA 3KP8A 3HVSA 1MEKA 5IIZA 4LMVA 1HQOA 1TU8A 1BG5A 1U88A 2IIYA 3TUEA 1G6WA 2A2RA 5A5KA 4KB3A 3RPPA 1NHOA 1HD2A 4IGJA 3CMIA 1EOHA 3KGKA 4OCEA 4JR6A 5CNWA 2QGVA 4N11A 5G1LA 2PN8A 4GSNA 3GKKA 4POLA 3UMAA 3EU4A 3KH7A 4CHSA 3Q19A 4MZCA 3G9BA 3APSA 5HR2A 5JCUA 5H5SA 2HZEA 2AHEA 4L0UA 4XIHA 2N5BA 2RM6A 2RLIA 5DBQA 1O8XA 1XWAA 5GAND 2B7JA 3RHCA 2VL9A 1V58A 3RHBA 1X9SB 2B3SA 4G9HA 2GSQA 3SWLA 3PR8A 1WIKA 2O85A 3LXTA 4KDXA 5KN2A 1EV4A 4TN8A 2D2ZA 4TR0A 2JL4A 4IJIA 3TJJA 3GX0A 2N5FA 1VGLA 2OBIA 3KCMA 5ECRB 1ZZYA 4I5QA 5LNKe 2B5YA 1OKDA 1J08A 2C0DA 3QCPA 2H76A 3LJRA 3KH9A 2LQQA 4MZWA 4HJ2A 4NAXA 1SK0A 2DBCA 3HD5A 4G2EA 3F4SA 2H75A 2I3YA 3EC3A 4V2NA 5E4WA 4GLTA 2FCHA 2HFDA 4K0NA 1F37A 2OKAA 1F3BA 2JACA 4IBPA 2H01A 1NW2A 2X8HA 2ON7A 2VOCA 3IAS2 6GSTA 5FHIA 2R37A 5F8BA 5JCWA 5D8IA 4ZBDA 1JZDA 3EYTA 2L6DA 3JCML 2FLSA 4KA0A 2HSYA 2FA8A 4NHWA 4N0VA 4YQUA 1AXDA 2A4VA 5L71A 2FA4A 1BEDA 4LL4B 1TI3A 5F0GA 1A2LA 2PVOC 1EOGA 1T4ZA 2PGTA 4XTSA 4NWYA 4GTUA 1GP1A 2F51A 1Z7PA 2WJUA 4TW5A 4ZBAA 1AUCA 3QFAC 4FYCA 3HDCA 2HRNA 2HXKA 4V1Ag 4Z7XA 3UIWA 1TK8B 1J0FA 4DSQA 2H1GA 6GSUA 3LYKA 1EEJA 4AGSA 1ML6A 1M7TA 5DJLA 1G0TA 1R7HA 5DDLA 3GYKA 1GNEA 2VL3A 3KMNA 3C7MA 3P90A 3M9JA 2KP2A 3H4KA 1SJZA 3PGTA 4KX4A 2LJKA 1V57A 2V1MA 3WT1A 4ML1A 4IKHA 1YDKA 5GZZB 2YCDA 6GSVA 2B5XA 5ECMB 2L4CA 2GT5A 5C04A 3QAWA 2JSYA 4HOJA 3HJMA 1K0OA 2CV4A 1YQ1A 1Y25A 4KGIA 4LA1A 1ERVA 1PX6A 4BVYA 1BX9A 3KZQA 3ME7A 5AN1A 1K0AA 4GSSA 4MPGA 5ID2B 3MAKA 3J7Yk 1SU9A 2JSZA 1IYHA 1TJDA 1Z3EA 2TRXA 1GTUA 3CSIA 4EXJA 2DJ0A 3L9UA 4MDCA 1ZOFA 4V2MA 2O89A 1YKAA 3J7Yb 2X64A 3KD0A 2YP6A 5KEJA 2O87A 3A5WA 2WGRA 4N10A 2PU9C 4EVMA 3BD2A 3E9JB 5JWQB 2RM5A 2P5RA 4POKA 2ALBA 5IO0A 1R5PA 4GQCA 1Q4JA 2ON5A 4BA7A 6GSXA 3GHAA 3VLNA 1R5AA 1S3CA 1Z9HA 1XPVA 1GNWA 4NV5A 1V9WA 3HVVA 3Q6OA 1F6MC 2J9HA 2HI7A 2L4QA 5HFGA 4Q5RA 5DVBA 3QAGA 1SYXA 4ZIJA 1KTEA 1TXXA 4P3YB 3LYPA 2H19A 3DVWA 2FWFA 2FWGA 5GAPD 4XHMA 1FO5A 2GS3A 1SK1A 5ID2A 1A23A 3APQA 2AAWA 3D4MA 2ZUPA 2GSTA 4ECBA 1VF3A 4QL9A 1FW1A 1OKTA 4KNDA 2GSSA 5IPGA 1FHEA 3TB2A 4BWQA 4BWSA 1I5GA 3L9SA 3IE3A 1NHYA 2NPBA 2MMAA 1GUMA 4ACSA 1QQ2A 3HJPA 2RUFA 1B8XA 1Z5YE 3VWWA 4WXTA 1XW6A 4PQ1A 1THOA 1SKSB 3ZREA 2DJ2A 2WDUA 4OFMA 2GVPA 4HEA2 1YKCA 2F8FA 1A24A 3FZ4A 3PINA 3CRUA 3CTGA 3FZ5A 2IJYA 2P0GA 4YQMA 4IQ1A 1ERWA 1XVQA 2FHEA 3M0FA 4EC0A 5ECSA 5IMAA 1GUKA 5IPHA 3ERWA 5F06A 4MJEA 1IYIA 2DJJA 3KMOA 2WZ9A 1U87A 2WULA 4NMUA 4MJBA 2M80A 2DIZA 2H30A 2B1LA 1OYJA 4I2TA 4JE1A 3TRXA 5FT3A 3ZFLA 3VPQA 2HSHA 1GTBA 3I6AA 2VLTA 5HR3A 1TRVA 3GRXA 1GH2A 2GZPA 1TTZA 2XPEA 2AJQB 1J9BA 1PKZA 4DSRA 1XZOA 3IA1A 3IDVA 1OC3A 3UJ1A 1WP0A 4XS4B 2MMOA 3CSJA 4RI7A 4NXIA 1JFUA 22GSA 1GL8A 4TXVA 3EVIA 2C0FA 1T4YA 4GF0A 4EUYA 4GCIA 4MLYA 1M2BA 1AQVA 2FY6A 4KUNA 1S3DA 4IS0A 3DVXA 2PERA 4ZB8A 2DSAA 1RK4A 2YV9A 5B7CA 3HZ8A 3TJFA 3HKRA 2VIMA 2LNTA 2VCVA 2QC7A 3ERFA 1ZYQB 1A0FA 19GSA 4HJMA 2O8VB 3WGDA 2RIIA 3IK7A 5B6NA 2HLSA 5A4WA 5AISA 3QPMA 3ME8A 2K8VA 2TRCP 4J57E 2VCZA 3VWUA 3BOAA 4KE3A 5D73A 1UA5A 3M9KA 16GSA 4PURA 10GSA 1SKWB 2K6VA 5J9BA 4F03A 3Q74A 5CREA 5A4UA 1Z7RA 1GULA 3KJYA 1FAAA 4XS4A 3A2VA 1FB0A 1PL2A 2V32A 1XWCA 3HYPA 1U3IA 2K18A 3VFIA 1QUWA 1HNBA 2H72A 3GSTA 1EZKA 3TKRA 2LJAA 3EURA 2IN3A 2QSIA 3KP9A 2WRTA 1URMA 3LSZA 1PSQA 3GX8A 1ST9A 1JZRA 1I9DA 5ECLB 2VM2A 4O92A 4RQRA 2LRNA 2VLVA 4TRXA 5CRDA 3WD6A 4DSSB 3MDKA 1GUHA 3G7IA 1VF1A 3GMFA 1HNCA 3IAM2 5D9WA 2FNOA 4K0GA 4KW6A 1TW9A 1B4PA 3CRTA 1FVJA 4XRDA 1ZMAA 6GSWA 2DLXA 3TGZA 2KP1A 1ABAA 3F0IA 4KCEA 3DWVA 1YJ6A 3O6TA 3UBLA 1T7PB 4GRFA 3IPZA 4PNGA 1S3AA 2VCXA 4V2LA 3UBKA 1GSEA 4PGTA 5AGYA 3ZFBA 1XOAA 4FYUA 3LWAA 2JU5A 1ERUA 2X8GA 3CBUA 3GIXA 2FWEA 4MABA 1BQ7A 2YJ7A 4YAVA 1FB6A 4KH7A 1O8WA 2FUG2 4WEYA 1M9BA 2P5QA 7GSSA 1YF1A 4EE0A 5J3RA 2JZRA 3EU3A 3F4TA 4E8HA 5G31A 2XPDA 1OE7A 1FG4A 5D93A 1GSSA 1X9WB 3LQ7A 3QD9A 1TK0B 2C1YA 5HQPA 2C0GA 1OC9B 3ERGA 5IM9A 3H93A 4DSSA 4GSTA 1EGOA 3DKSA 3ISOA 1PMTA 5FWGA 5DALB 4PNFA 3D0ZA 3W6GA 4QQ7A 3BCIA 1AIUA 3TOUA 4O7HA 1ON4A 4IJ3A
chains in the Genus database with same CATH superfamily
2L57A 1K3LA 1LU4A 1DSBA 4HQZA 1KNGA 3ZRDA 3GUSA 2LSTA 3P2AA 4MF6A 2JZTA 2IMIA 5ECHB 3U5RE 1M0UA 1XWBA 2G0FA 1A0RP 3GKMA 1Z6NA 4X0XA 3IHGA 3C1SA 4K9ZA 3DIEA 3UVHA 2GSRA 4IHUA 4WETA 2MZCA 3C1RA 4DVCA 2R6KA 3D5JA 4HDEA 4POMA 3CSHA 2NTOA 5AIVA 2LQOA 5D9XA 1E2YA 1DE1A 2V6OA 3K8NA 4MP4A 2DJ1A 3H1NA 4HSCX 5DQYA 4NV2A 3Q18A 1XCCA 2QA2A 2CQ9A 3UARA 5CRWA 4Q5NA 1OC9A 4G0LA 5J41A 2AYTA 3IC8A 1K3OA 3ZVJD 3QMXA 2CX3A 1B9XC 3ZIVA 5AIXA 2IMKA 2H70A 1GSYA 2I9HA 5DALA 1BJXA 2LEGA 1XWGA 5GSSA 4X4JA 3M8NA 4Z2RA 4FO5A 2CVDA 2L6CA 1AC1A 1SK2A 3LGCA 3FR6A 3TRPA 4EDZA 4AJ8A 1M2AA 5G5FA 3HJOA 4MA9A 2VUPA 3FR9A 3HVXA 4DEJA 5F05A 3QR6A 3GSSA 4JU5A 1TK5B 5CP1A 3RBTA 2H71A 1ZYPA 3EINA 4BL7B 2X99A 4TKYA 4FH8A 3AY8A 3BJ5A 1U6TA 1OVNA 1B4QA 1O7UA 3DMLA 3H79A 1YEXA 1JZWA 2BTOT 3A2XA 1E6BA 4F9ZA 5HR1A 2C4JA 5LD0A 1MDJA 4O32A 4L5OA 3HA9A 4K5RA 2VCTA 3IK9A 5JWOB 1SJIA 2MBSA 2H66A 2LV3A 3GKNA 4NHZA 4ECJA 4ECIA 5IMDA 2N5AA 4EKZA 5IMCA 3G7YA 4I2UA 1BAYA 1QXHA 3KXOA 3PPUA 1Q98A 3WGEA 1T3BA 5HR0A 3ZTLA 2H1AA 5KN3A 1LBKA 2EIRA 5IO2A 3FKFA 3F6FA 11GSA 2E0QA 1C72A 1U3AA 1PN9A 2I4AA 4HI7A 1A8LA 6GSSA 1A2JA 4ZB9A 2JZSA 1QFNA 2DC5A 3IRAA 2DMLA 2VLUA 3WT2A 2VAFA 3OR5A 4IW9A 3ZVJA 4PUFC 4MH3A 4EDYA 2YN1A 1SJ6A 1ILOA 3U6VA 2CZ2A 14GSA 4BL7A 5GSTA 2WS2A 3TJKA 4YAPA 3FK8A 1LJRA 2YJHA 1MDKA 4G10A 3O76A 1OAZA 4JRRA 1THXA 2HT9A 2J23A 3TKSA 4F82A 4Q5QA 1K0MA 4WF5A 4WKWA 2WFCA 1CQGA 2PWJA 2CVKA 3RPNA 4RUVA 2YWIA 1F3AA 4ZL8A 1TKDB 3HXSA 1ZYEA 4ZL9A 3LFLA 4CDOA 1SKRB 2I1UA 5DAKB 3I43A 5DQSA 1G7EA 1HYUA 1R26A 3KTBA 2EIQA 1GSQA 3DEXA 2IMFA 3GFKA 2E2MA 5G1KA 2YV7A 1JLVA 2K9FA 1WWJA 1TP9A 2H6ZA 1RW1A 5EVOA 1SL1B 2VO4A 4OD7A 3D21A 1XW9A 3HCZA 3DYRA 3GA4A 4O5UA 6GSYA 2IFQB 4J2FA 5J5NA 1DE2A 2C3TA 3GV1A 4Z2TA 4TR4A 2LNSA 5B8BA 1ERTA 3NIVA 4PTSA 2VCWA 5CRHA 1XFLA 1JZOA 1EV9A 3HY2A 4WF4A 3P7XA 2GT6A 3D22A 3WGXA 2BJXA 3FEUA 2PMTA 2H73A 2E7PA 2YPMA 1QGVA 3VURA 5JWRB 2AB6A 3GL5A 4G19A 2L59A 3EMXA 2NBSA 3MWHA 4EF0A 1NM3A 3ZL5A 3N5OA 1RQMA 2C3NA 1PKWA 3ZZXA 1TDIA 1T1VA 5F07A 3IHQA 3IBHA 3HHVA 4KCAA 3FYGA 5KN1A 4EIQA 3CYNA 5LCZA 3EWLA 3GKXA 5DCHA 3KIJA 2O7KA 1WPIA 5DAKA 5IOXA 5J4UA 4XS1A 12GSA 1F2EA 1YY7A 2L5OA 5EL8A 1VF2A 3DXBA 1T8EB 1USBA 2YWMA 1SL2B 5IMFA 1K0NA 2OA7A 4MK3A 1SD8A 3TDGA 3ZMKA 3I69A 1XVWA 4LLRA 18GSA 4TXOB 3G7JA 4KSOA 3I9V2 2IFQA 2VM1A 5DCGA 3D4TA 1TI1A 3L0HA 1TU7A 4K8MA 1FOHA 2GTUA 2RUEA 1TRWA 2C3QA 1KBNA 2YZHA 3RDWA 2LS5A 3VPTA 1AAZA 2AUVA 3IC4A 1Z6MA 4HU9A 1O6JA 3MSZA 3RAZA 1R4WA 4D73B 2REMA 3ZLPA 1GSUA 4JR4A 3TKSC 1QMVA 3VWVA 2XBIA 2C80A 1G6YA 1X5DA 2P31A 3BCKA 2OE3A 3EE2A 2KLXA 2GZYA 4BVXB 5EPFA 4KDUA 1AQWA 1KEBA 4ECCA 1HNAA 3F9UA 3LG6A 3ED3A 1PD21 1GLQA 5CAXA 3QFBC 2NVLA 1M3JA 2IMEA 3A2WA 4MF5A 3F8UA 1O81A 2MYGA 5EY6A 1GRXA 2CZ3A 3GL3A 2H0GA 4ID0A 2L5LA 4WR4A 5G5EA 1MDIA 2GDRA 2YWOA 4TXOA 3LXZA 3LORA 4HU7A 4MZBA 1SD9A 2F9SA 2DJ3A 2H1BA 3GTUB 4NPBA 1K0BA 1V2AA 3IXRA 2H6XA 5J9CA 4YKFA 1VRSD 2V41A 4YQVA 2FGXA 3F3RA 1XOBA 4PX1A 4WR5A 1T00A 5COHA 1W89A 1CQHA 1X0RA 4K7IA 5ECIB 1XXUA 4MMMA 4L0WA 4TOPA 4KF9A 4D73A 4OCFA 3ZITA 4TR1B 1XIYA 1MTCA 4PQHA 1TOFA 1S3RA 5CRGA 1H75A 4YH2A 1ZYNA 4PXOA 3TKSE 2R3XA 3TKQA 2A2SA 4BVXA 3TRQA 4F2IA 1XW5A 2ZNMA 2B5EA 1DBYA 1MD3A 4MPFA 3GURA 2H8LA 2GQMA 1TRSA 3US3A 1EGRA 4I97A 4KSMA 5B8AA 3UVTA 2YWNA 2MMNA 2YZUA 4ZB6A 1AW9A 1GTIA 1UC7A 2H0HA 4HZ2A 3A5IA 1WRYA 2XBQA 4OO5A 3BBYA 4MH2A 3C71A 1K0CA 2H6YA 3KTLA 2VCQA 1DUGA 3FHKA 3KEBA 1WJKA 3GTUA 4RI6A 1NSWA 2IWTA 3QDNA 2LRTA 1OC8A 2Z9SA 4HS1A 3APOA 2DJKA 2CVBA 5C00A 1PA3A 2LKUA 1SL0B 2CAIA 2LUSA 2R2JA 5IMZA 3CXGA 2IPAA 4X43A 3QOUA 4ML6A 2HZFA 1XWKA 4IP1A 3NOFA 3DRNA 2OBKA 3FR3A 4TR1A 4HZ4A 4HQSA 4MF7A 4KDYA 4X1UA 5CO3A 4IP6A 2GGTA 3E3EA 4ISDA 1W4VA 5INYA 5CYYA 2B7KA 1FOVA 3NZNA 13GSA 4MJAA 1O85A 5KN0A 2VL2A 2PUKC 1V98A 3GN3A 3IOSA 1A8YA 1X5CA 3GNJA 4XRAA 3TJGA 1M3IA 3VWXA 1GLPA 1N8JA 2H1DA 4FIWA 4I6XA 3VI5A 3UL3A 1GWCA 4ICYA 4ZL7A 3O3TA 2V6KA 4MCUA 2QKEA 3UEMA 1M9AA 5H5QA 4GXZA 3S9FA 4Q5FA 2YNXA 5B6MA 2CT6A 2HYXA 4CW9A 4BPYA 2FD3A 1F9MA 3HZ4A 2GQKA 5ELAA 2LTKA 4RQXA 2EIOA 2I81A 5HFKA 3UAPA 1PGTA 2HRFA 17GSA 2BMXA 4N0ZA 2C8UA 4PUAA 3TKPA 4N30A 4E8EA 1JHBA 4TVEA 3UOMA 3F4RA 1VF4A 1FVKA 1V40A 1EP7A 1K0DA 2PBJA 1MD4A 3W8JA 1AQXA 4IQAA 2IL3A 2EC4A 4K6XA 1PL1A 5IOWA 3H8QA 3P8WA 1B48A 2R5GA 1M2DA 3VI7A 2K8SA 1G7OA 2IMDA 3ZIJA 4AF2A 2MMZA 1X9MB 4JEDA 1BYEA 5HFIA 5ENUA 2OE0A 1ZGNA 2F3MA 2V2GA 3FZAA 4F0BA 2XC2A 1K3YA 2OACA 4AJ6A 3FW2A 2X8CA 3MNGA 1WE0A 5G30A 4WBJA 2CAQA 1GSDA 3FRCA 5E59A 4OFTA 4CY6A 4L5LA 1UN2A 2JADA 2GQLA 3M1GA 8GSSA 4ZBBA 1N2AA 2CA8A 3L78A 2R4VA 1H4OA 1EEMA 3WYWA 3D6IA 4GWRA 4MJCA 2H0IA 3DD3A 2OE1A 2WB9A 1YZXA 4K2DA 1O73A 5ECKB 2C0EA 3FZ9A 3F63A 3TJBA 1ACVA 2LRCA 5DJMA 1SENA 1UVZA 1YEPA 1JLWA 4V1Ap 5ECPB 2F8AA 3F3QA 1SYRA 4TR3A 2OADA 4LL1B 5D96A 2H74A 4KAEA 3DGQA 5IQYA 4QL7A 5G2ZA 2KHPA 3PH9A 1PRXA 5ECNB 5D9TA 3M3MA 3A3TA 4GQFA 2GZZA 3IR4A 3QAVA 1X5EA 1TRUA 4JZQA 2B6MA 3GH6A 5ABRA 4L8EA 3IV4A 1OE8A 4JBBA 1QK8A 2OJLA 2CX4A 2VL2C 1WOUA 3C73A 4EL1A 4WBRD 3VK9A 4FYBA 4J56E 2VD1A 2AV4A 3LEFA 3C8EA 2M46A 2DKHA 2KOKA 4K1FA 2PPTA 1ZL9A 2YANA 2ES7A 1PX7A 3KM6A 1EWXA 2E2GA 3EMPA 4ILFA 4XS6A 5D9VA 1XBSA 4O5RA 2PVQA 4LMWA 5JCGA 2ZCTA 5ECOB 3V1WA 2YOIA 1B9YC 4AJ7A 1YF0A 4I8BA 4F0CA 5ECQB 3MIXA 4ZXGA 4OWYA 2G2QA 4XCSA 3F6DA 2M72A 4OMVA 4PQIA 9GSSA 3CTFA 3FY7A 4IELA 3E0UA 2WCIA 1Y6EA 2KUCA 1GSFA 4POBA 5A4VA 2GLRA 4HUAA 3ZYWA 5H5RA 4IN0A 3L4NA 1PQNA 2HZEB 5ELGA 3ZMLA 3L9VA 3SBCA 4ZILA 4H86A 2LJRA 1M99A 2DMMA 2VD0A 1EP8A 4EO3A 3R2QA 4IVFA 3GH9A 2HE3A 3W8SA 20GSA 1ZCPA 2B1KA 3TCOA 4OFNA 4K7NA 2NDOA 3TOTA 5IMVA 2DIYA 2FWHA 1WMJA 4ULXA 4OO4A 2MBTA 1A2MA 2XHFA 3N9JA 4K7OA 1GTAA 2TIRA 2HNLA 3KP8A 4EIPA 3HVSA 1MEKA 5IIZA 4LMVA 1HQOA 1TU8A 1BG5A 1U88A 2IIYA 3TUEA 1G6WA 2A2RA 2UZ8A 5A5KA 4KB3A 3RPPA 1NHOA 1HD2A 4IGJA 3CMIA 1EOHA 3KGKA 4OCEA 4JR6A 5CNWA 2QGVA 4N11A 5G1LA 2PN8A 4GSNA 3GKKA 4POLA 3UMAA 3EU4A 3KH7A 4CHSA 3Q19A 4MZCA 3G9BA 3APSA 5HR2A 5JCUA 2A2PA 5H5SA 4FQUA 2HZEA 2AHEA 4L0UA 4XIHA 2N5BA 2RM6A 2RLIA 5DBQA 1O8XA 1XWAA 5GAND 2B7JA 3RHCA 2VL9A 1V58A 4G0KA 3RHBA 1X9SB 2B3SA 1PN0A 4G9HA 2GSQA 3SWLA 3PR8A 1WIKA 2O85A 3LXTA 4KDXA 5KN2A 1EV4A 4TN8A 2D2ZA 4TR0A 2JL4A 4IJIA 3TJJA 3GX0A 2N5FA 1VGLA 2OBIA 3KCMA 5ECRB 1ZZYA 4I5QA 5LNKe 2B5YA 1OKDA 1J08A 2C0DA 3LW9A 3QCPA 2H76A 3LJRA 3KH9A 2LQQA 4MZWA 4HJ2A 4NAXA 1SK0A 2DBCA 3HD5A 4G2EA 3F4SA 2H75A 2I3YA 3EC3A 4V2NA 5E4WA 4GLTA 2FCHA 2HFDA 4K0NA 1F37A 2OKAA 1F3BA 2JACA 4IBPA 2H01A 1NW2A 2X8HA 2ON7A 2VOCA 3IAS2 4BVYB 6GSTA 5FHIA 2R37A 5F8BA 5JCWA 5D8IA 4ZBDA 1JZDA 3EYTA 2L6DA 3JCML 2FLSA 2QA1A 4KA0A 2HSYA 2FA8A 4NHWA 4N0VA 3EPTA 4YQUA 1AXDA 2A4VA 5L71A 2FA4A 1BEDA 4LL4B 1TI3A 5F0GA 1A2LA 2PVOC 1EOGA 1T4ZA 2PGTA 4XTSA 4NWYA 4GTUA 1GP1A 2F51A 1Z7PA 2WJUA 4TW5A 4ZBAA 1AUCA 3QFAC 4FYCA 3HDCA 2HRNA 2HXKA 4V1Ag 4Z7XA 3UIWA 1TK8B 3R3EA 1J0FA 4DSQA 2H1GA 6GSUA 3LYKA 1EEJA 4AGSA 1ML6A 1M7TA 5DJLA 1G0TA 1R7HA 5DDLA 3GYKA 1GNEA 2VL3A 3KMNA 3C7MA 3P90A 3M9JA 2KP2A 3H4KA 1SJZA 3PGTA 4KX4A 2LJKA 1V57A 2V1MA 3WT1A 4ML1A 4IKHA 1YDKA 5GZZB 2YCDA 6GSVA 2B5XA 3CQFA 5ECMB 2L4CA 2GT5A 5C04A 3QAWA 2JSYA 4HOJA 3HJMA 1K0OA 2CV4A 1YQ1A 1Y25A 4KGIA 4LA1A 1ERVA 1PX6A 4BVYA 1BX9A 4K5SA 3KZQA 3ME7A 5AN1A 1K0AA 4GSSA 4MPGA 5ID2B 3MAKA 3J7Yk 1SU9A 2JSZA 1IYHA 1TJDA 1Z3EA 2TRXA 1GTUA 3CSIA 4EXJA 2DJ0A 3L9UA 4MDCA 1ZOFA 4V2MA 2O89A 1YKAA 2X49A 3J7Yb 2X64A 3KD0A 2YP6A 5KEJA 2O87A 3A5WA 2WGRA 4N10A 2PU9C 4EVMA 3BD2A 3E9JB 5JWQB 2RM5A 2P5RA 4POKA 2ALBA 5IO0A 1R5PA 4GQCA 1Q4JA 2ON5A 4BA7A 5BMUA 6GSXA 3GHAA 3VLNA 1R5AA 1S3CA 1Z9HA 1XPVA 1GNWA 4NV5A 4Z2UA 1V9WA 3HVVA 3Q6OA 1F6MC 2J9HA 2HI7A 2L4QA 5HFGA 4Q5RA 5DVBA 3QAGA 1SYXA 4ZIJA 1KTEA 1TXXA 4P3YB 3LYPA 5KOWA 2H19A 3DVWA 2FWFA 2FWGA 5GAPD 4XHMA 1FO5A 2GS3A 1SK1A 5ID2A 1A23A 3APQA 2AAWA 3D4MA 2ZUPA 2GSTA 4ECBA 1VF3A 3FMWA 4QL9A 1PFOA 1FW1A 1OKTA 2R0PA 4KNDA 2GSSA 5IPGA 1FHEA 3TB2A 4BWQA 4BWSA 4YKGA 1I5GA 3L9SA 3IE3A 1NHYA 2NPBA 2MMAA 1GUMA 4ACSA 1QQ2A 3HJPA 2RUFA 1B8XA 1Z5YE 3VWWA 4WXTA 2X4AA 1XW6A 4PQ1A 1THOA 1SKSB 3ZREA 2DJ2A 2WDUA 4OFMA 2GVPA 4HEA2 1YKCA 2F8FA 4BIKA 1A24A 3FZ4A 3PINA 3CRUA 3CTGA 3FZ5A 2IJYA 2P0GA 4YQMA 4IQ1A 1ERWA 1XVQA 2FHEA 3M0FA 4EC0A 5ECSA 2DKIA 5IMAA 1GUKA 5IPHA 2HRKA 3ERWA 5F06A 4MJEA 1IYIA 2DJJA 4O5QA 3KMOA 2WZ9A 1U87A 2WULA 4NMUA 2HSMA 4MJBA 2M80A 2DIZA 2H30A 2B1LA 5BRTA 1OYJA 4I2TA 4JE1A 3TRXA 5FT3A 3ZFLA 3VPQA 2HSHA 1GTBA 3I6AA 2VLTA 5HR3A 1TRVA 3GRXA 1GH2A 2GZPA 2A4HA 1TTZA 2XPEA 2AJQB 1J9BA 1PKZA 4DSRA 1XZOA 3IA1A 3IDVA 1OC3A 3UJ1A 1WP0A 4XS4B 2MMOA 3CSJA 4RI7A 4NXIA 1JFUA 22GSA 1GL8A 4TXVA 3EVIA 2C0FA 1T4YA 4GF0A 4EUYA 4GCIA 4MLYA 1M2BA 1AQVA 2FY6A 4KUNA 1S3DA 4IS0A 3DVXA 2PERA 4ZB8A 2DSAA 1RK4A 2YV9A 5B7CA 4USSA 3HZ8A 3TJFA 3HKRA 2VIMA 2LNTA 2VCVA 2QC7A 3ERFA 1ZYQB 1A0FA 19GSA 1XG8A 3MYDA 4HJMA 2O8VB 3WGDA 2RIIA 3IK7A 5B6NA 2HLSA 5A4WA 5AISA 3QPMA 3ME8A 4A5PA 2K8VA 2TRCP 4J57E 2VCZA 3VWUA 3BOAA 4KE3A 5D73A 1UA5A 3M9KA 16GSA 4PURA 10GSA 3HVNA 1SKWB 2K6VA 5J9BA 4F03A 3Q74A 5CREA 5A4UA 4K2XA 1Z7RA 1GULA 3KJYA 1FAAA 4XS4A 3A2VA 1FB0A 1PL2A 2V32A 1XWCA 3HYPA 1U3IA 2K18A 3VFIA 1QUWA 5KOXA 1HNBA 2H72A 3GSTA 1EZKA 3TKRA 2LJAA 3EURA 2IN3A 2QSIA 3KP9A 2WRTA 1URMA 3LSZA 1PSQA 3GX8A 4CY8A 1ST9A 1JZRA 1I9DA 5ECLB 2VM2A 4O92A 2HRAA 4RQRA 2R0GA 2LRNA 2VLVA 4TRXA 5CRDA 3WD6A 4DSSB 3MDKA 1GUHA 3G7IA 1VF1A 3GMFA 1HNCA 3IAM2 5D9WA 2FNOA 4K0GA 4KW6A 1TW9A 1B4PA 3CRTA 1FVJA 4XRDA 1ZMAA 6GSWA 2DLXA 3TGZA 2KP1A 1ABAA 3F0IA 4KCEA 3DWVA 1YJ6A 3O6TA 3UBLA 1T7PB 4GRFA 3IPZA 4PNGA 1S3AA 2VCXA 4V2LA 3UBKA 1GSEA 4PGTA 5AGYA 3ZFBA 1XOAA 4FYUA 3LWAA 2JU5A 1ERUA 2X8GA 3CBUA 3GIXA 2FWEA 4G0IA 4MABA 1BQ7A 2YJ7A 4YAVA 1FB6A 4KH7A 1O8WA 2FUG2 4WEYA 1M9BA 2P5QA 7GSSA 1YF1A 4EE0A 5J3RA 4MNNA 2JZRA 3EU3A 3F4TA 4E8HA 5G31A 2XPDA 1OE7A 1FG4A 5D93A 1GSSA 1X9WB 3LQ7A 3QD9A 1TK0B 2C1YA 5HQPA 2C0GA 1OC9B 3ERGA 5IM9A 2R0CA 3H93A 4DSSA 4GSTA 1EGOA 3DKSA 3ISOA 1PMTA 5FWGA 5DALB 4PNFA 3D0ZA 3W6GA 4QQ7A 3BCIA 1AIUA 3TOUA 4O7HA 1ON4A 4IJ3A
chains in the Genus database with same CATH topology
2L57A 1K3LA 1LU4A 1DSBA 4HQZA 1KNGA 3ZRDA 3GUSA 2LSTA 3P2AA 4MF6A 2JZTA 2IMIA 5ECHB 3U5RE 1M0UA 1XWBA 2G0FA 1A0RP 3GKMA 1Z6NA 4X0XA 3IHGA 3C1SA 4K9ZA 3DIEA 3UVHA 2GSRA 4IHUA 4WETA 2MZCA 3C1RA 4DVCA 2R6KA 3D5JA 4HDEA 4POMA 3CSHA 2NTOA 5AIVA 2LQOA 5D9XA 1E2YA 1DE1A 2V6OA 3K8NA 4MP4A 2DJ1A 3H1NA 5DQYA 4NV2A 3Q18A 1XCCA 2QA2A 2CQ9A 3UARA 5CRWA 4Q5NA 1OC9A 4G0LA 5J41A 2AYTA 3IC8A 1K3OA 3ZVJD 3QMXA 2CX3A 1B9XC 3ZIVA 5AIXA 2IMKA 2H70A 1GSYA 2I9HA 5DALA 1BJXA 2LEGA 1XWGA 5GSSA 4X4JA 3M8NA 4Z2RA 4FO5A 2CVDA 2L6CA 1AC1A 1SK2A 3LGCA 3FR6A 3TRPA 4EDZA 4AJ8A 1M2AA 5G5FA 3HJOA 4MA9A 2VUPA 3FR9A 3HVXA 4DEJA 5F05A 3QR6A 3GSSA 4JU5A 1TK5B 5CP1A 3RBTA 2H71A 1ZYPA 3EINA 4BL7B 2X99A 4TKYA 4FH8A 3AY8A 3BJ5A 1U6TA 1OVNA 1B4QA 1O7UA 3DMLA 3H79A 1YEXA 1JZWA 2BTOT 3A2XA 1E6BA 4F9ZA 5HR1A 2C4JA 5LD0A 1MDJA 4O32A 4L5OA 3HA9A 4K5RA 2VCTA 3IK9A 5JWOB 1SJIA 2MBSA 2H66A 2LV3A 3GKNA 4NHZA 4ECJA 4ECIA 5IMDA 2N5AA 4EKZA 5IMCA 3G7YA 4I2UA 1BAYA 1QXHA 3KXOA 3PPUA 1Q98A 3WGEA 1T3BA 5HR0A 3ZTLA 2H1AA 5KN3A 1LBKA 2EIRA 5IO2A 3FKFA 3F6FA 11GSA 2E0QA 1C72A 1U3AA 1PN9A 2I4AA 4HI7A 1A8LA 6GSSA 1A2JA 4ZB9A 2JZSA 1QFNA 2DC5A 3IRAA 2DMLA 2VLUA 3WT2A 2VAFA 3OR5A 4IW9A 3ZVJA 4PUFC 4MH3A 4EDYA 2YN1A 1SJ6A 1ILOA 3U6VA 2CZ2A 14GSA 4BL7A 5GSTA 2WS2A 3TJKA 4YAPA 3FK8A 1LJRA 2YJHA 1MDKA 4G10A 3O76A 1OAZA 4JRRA 1THXA 2HT9A 2J23A 3TKSA 4F82A 4Q5QA 1K0MA 4WF5A 4WKWA 2WFCA 1CQGA 2PWJA 2CVKA 3RPNA 4RUVA 2YWIA 1F3AA 4ZL8A 1TKDB 3HXSA 1ZYEA 4ZL9A 3LFLA 4CDOA 1SKRB 2I1UA 5DAKB 3I43A 5DQSA 1G7EA 1HYUA 1R26A 3KTBA 2EIQA 1GSQA 3DEXA 2IMFA 3GFKA 2E2MA 5G1KA 2YV7A 1JLVA 2K9FA 1WWJA 1TP9A 2H6ZA 1RW1A 5EVOA 1SL1B 2VO4A 4OD7A 3D21A 1XW9A 3HCZA 3DYRA 3GA4A 4O5UA 6GSYA 2IFQB 4J2FA 5J5NA 1DE2A 2C3TA 3GV1A 4Z2TA 4TR4A 2LNSA 5B8BA 1ERTA 3NIVA 4PTSA 2VCWA 5CRHA 1XFLA 1JZOA 1EV9A 3HY2A 4WF4A 3P7XA 2GT6A 3D22A 3WGXA 2BJXA 3FEUA 2PMTA 2H73A 2E7PA 2YPMA 1QGVA 3VURA 5JWRB 2AB6A 3GL5A 4G19A 2L59A 3EMXA 2NBSA 3MWHA 4EF0A 1NM3A 3ZL5A 3N5OA 1RQMA 2C3NA 1PKWA 3ZZXA 1TDIA 1T1VA 5F07A 3IHQA 3IBHA 3HHVA 4KCAA 3FYGA 5KN1A 4EIQA 3CYNA 5LCZA 3EWLA 3GKXA 5DCHA 3KIJA 2O7KA 1WPIA 5DAKA 5IOXA 5J4UA 4XS1A 12GSA 1F2EA 1YY7A 2L5OA 5EL8A 1VF2A 3DXBA 1T8EB 1USBA 2YWMA 1SL2B 5IMFA 1K0NA 2OA7A 4MK3A 1SD8A 3TDGA 3ZMKA 3I69A 1XVWA 4LLRA 18GSA 4TXOB 3G7JA 4KSOA 3I9V2 2IFQA 2VM1A 5DCGA 3D4TA 1TI1A 3L0HA 1TU7A 4K8MA 1FOHA 2GTUA 2RUEA 1TRWA 2C3QA 1KBNA 2YZHA 3RDWA 2LS5A 3VPTA 1AAZA 2AUVA 3IC4A 1Z6MA 4HU9A 1O6JA 3MSZA 3RAZA 1R4WA 4D73B 2REMA 3ZLPA 1GSUA 4JR4A 3TKSC 1QMVA 3VWVA 2XBIA 2C80A 1G6YA 1X5DA 2P31A 3BCKA 2OE3A 3EE2A 2KLXA 2GZYA 4BVXB 5EPFA 4KDUA 1AQWA 1KEBA 4ECCA 1HNAA 3F9UA 3LG6A 3ED3A 1PD21 1GLQA 5CAXA 3QFBC 2NVLA 2IMEA 3A2WA 4MF5A 3F8UA 1O81A 2MYGA 5EY6A 1GRXA 2CZ3A 3GL3A 2H0GA 4ID0A 2L5LA 4WR4A 5G5EA 1MDIA 2GDRA 2YWOA 4TXOA 3LXZA 3LORA 4HU7A 4MZBA 1SD9A 2F9SA 2DJ3A 2H1BA 3GTUB 4NPBA 1K0BA 1V2AA 3IXRA 2H6XA 5J9CA 4YKFA 1VRSD 2V41A 4YQVA 2FGXA 3F3RA 1XOBA 4PX1A 4WR5A 1T00A 5COHA 1W89A 1CQHA 1X0RA 4K7IA 5ECIB 1XXUA 4MMMA 4L0WA 4TOPA 4KF9A 4D73A 4OCFA 3ZITA 4TR1B 1XIYA 1MTCA 4PQHA 1TOFA 5CRGA 1H75A 4YH2A 1ZYNA 4PXOA 3TKSE 2R3XA 3TKQA 2A2SA 4BVXA 3TRQA 4F2IA 1XW5A 2ZNMA 2B5EA 1DBYA 1MD3A 4MPFA 3GURA 2H8LA 2GQMA 1TRSA 3US3A 1EGRA 4I97A 4KSMA 5B8AA 3UVTA 2YWNA 2MMNA 2YZUA 4ZB6A 1AW9A 1GTIA 1UC7A 2H0HA 4HZ2A 3A5IA 1WRYA 2XBQA 4OO5A 3BBYA 4MH2A 3C71A 1K0CA 2H6YA 3KTLA 2VCQA 1DUGA 3FHKA 3KEBA 1WJKA 3GTUA 4RI6A 1NSWA 2IWTA 3QDNA 2LRTA 1OC8A 2Z9SA 4HS1A 3APOA 2DJKA 2CVBA 5C00A 1PA3A 2LKUA 1SL0B 2CAIA 2LUSA 2R2JA 5IMZA 3CXGA 2IPAA 4X43A 3QOUA 4ML6A 2HZFA 1XWKA 4IP1A 3NOFA 3DRNA 2OBKA 3FR3A 4TR1A 4HZ4A 4HQSA 4MF7A 4KDYA 4X1UA 5CO3A 4IP6A 2GGTA 3E3EA 4ISDA 1W4VA 5INYA 5CYYA 2B7KA 1FOVA 3NZNA 13GSA 4MJAA 1O85A 5KN0A 2VL2A 2PUKC 1V98A 3GN3A 3IOSA 1A8YA 1X5CA 3GNJA 4XRAA 3TJGA 3VWXA 1GLPA 1N8JA 2H1DA 4FIWA 4I6XA 3VI5A 3UL3A 1GWCA 4ICYA 4ZL7A 3O3TA 2V6KA 4MCUA 2QKEA 3UEMA 1M9AA 5H5QA 4GXZA 3S9FA 4Q5FA 2YNXA 5B6MA 2CT6A 2HYXA 4CW9A 4BPYA 2FD3A 1F9MA 3HZ4A 2GQKA 5ELAA 2LTKA 4RQXA 2EIOA 2I81A 5HFKA 3UAPA 1PGTA 2HRFA 17GSA 2BMXA 4N0ZA 2C8UA 4PUAA 3TKPA 4N30A 4E8EA 1JHBA 4TVEA 3UOMA 3F4RA 1VF4A 1FVKA 1V40A 1EP7A 1K0DA 2PBJA 1MD4A 3W8JA 1AQXA 4IQAA 2IL3A 2EC4A 4K6XA 1PL1A 5IOWA 3H8QA 3P8WA 1B48A 2R5GA 1M2DA 3VI7A 2K8SA 1G7OA 2IMDA 3ZIJA 4AF2A 2MMZA 1X9MB 4JEDA 1BYEA 5HFIA 5ENUA 2OE0A 1ZGNA 2F3MA 2V2GA 3FZAA 4F0BA 2XC2A 1K3YA 2OACA 4AJ6A 3FW2A 2X8CA 3MNGA 1WE0A 5G30A 4WBJA 2CAQA 1GSDA 3FRCA 5E59A 4OFTA 4CY6A 4L5LA 1UN2A 2JADA 2GQLA 3M1GA 8GSSA 4ZBBA 1N2AA 2CA8A 3L78A 2R4VA 1H4OA 1EEMA 3WYWA 3D6IA 4GWRA 4MJCA 2H0IA 3DD3A 2OE1A 2WB9A 1YZXA 4K2DA 1O73A 5ECKB 2C0EA 3FZ9A 3F63A 3TJBA 1ACVA 2LRCA 5DJMA 1SENA 1UVZA 1YEPA 1JLWA 4V1Ap 5ECPB 2F8AA 3F3QA 1SYRA 4TR3A 2OADA 4LL1B 5D96A 2H74A 4KAEA 3DGQA 5IQYA 4QL7A 5G2ZA 2KHPA 3PH9A 1PRXA 5ECNB 5D9TA 3M3MA 3A3TA 4GQFA 2GZZA 3IR4A 3QAVA 1X5EA 1TRUA 4JZQA 2B6MA 3GH6A 5ABRA 4L8EA 3IV4A 1OE8A 4JBBA 1QK8A 2OJLA 2CX4A 2VL2C 1WOUA 3C73A 4EL1A 4WBRD 3VK9A 4FYBA 4J56E 2VD1A 2AV4A 3LEFA 3C8EA 2M46A 2DKHA 2KOKA 4K1FA 2PPTA 1ZL9A 2YANA 2ES7A 1PX7A 3KM6A 1EWXA 2E2GA 3EMPA 4ILFA 4XS6A 5D9VA 1XBSA 4O5RA 2PVQA 4LMWA 5JCGA 2ZCTA 5ECOB 3V1WA 2YOIA 1B9YC 4AJ7A 1YF0A 4I8BA 4F0CA 5ECQB 3MIXA 4ZXGA 4OWYA 2G2QA 4XCSA 3F6DA 2M72A 4OMVA 4PQIA 9GSSA 3CTFA 3FY7A 4IELA 3E0UA 2WCIA 1Y6EA 2KUCA 1GSFA 4POBA 5A4VA 2GLRA 4HUAA 3ZYWA 5H5RA 4IN0A 3L4NA 1PQNA 2HZEB 5ELGA 3ZMLA 3L9VA 3SBCA 4ZILA 4H86A 2LJRA 1M99A 2DMMA 2VD0A 1EP8A 4EO3A 3R2QA 4IVFA 3GH9A 2HE3A 3W8SA 20GSA 1ZCPA 2B1KA 3TCOA 4OFNA 4K7NA 2NDOA 3TOTA 5IMVA 2DIYA 2FWHA 1WMJA 4ULXA 4OO4A 2MBTA 1A2MA 2XHFA 3N9JA 4K7OA 1GTAA 2TIRA 2HNLA 3KP8A 4EIPA 3HVSA 1MEKA 5IIZA 4LMVA 1HQOA 1TU8A 1BG5A 1U88A 2IIYA 3TUEA 1G6WA 2A2RA 2UZ8A 5A5KA 4KB3A 3RPPA 1NHOA 1HD2A 4IGJA 3CMIA 1EOHA 3KGKA 4OCEA 4JR6A 5CNWA 2QGVA 4N11A 5G1LA 2PN8A 4GSNA 3GKKA 4POLA 3UMAA 3EU4A 3KH7A 4CHSA 3Q19A 4MZCA 3G9BA 3APSA 5HR2A 5JCUA 2A2PA 5H5SA 4FQUA 2HZEA 2AHEA 4L0UA 4XIHA 2N5BA 2RM6A 2RLIA 5DBQA 1O8XA 1XWAA 5GAND 2B7JA 3RHCA 2VL9A 1V58A 4G0KA 3RHBA 1X9SB 2B3SA 1PN0A 4G9HA 2GSQA 3SWLA 3PR8A 1WIKA 2O85A 3LXTA 4KDXA 5KN2A 1EV4A 4TN8A 2D2ZA 4TR0A 2JL4A 4IJIA 3TJJA 3GX0A 2N5FA 1VGLA 2OBIA 3KCMA 5ECRB 1ZZYA 4I5QA 5LNKe 2B5YA 1OKDA 1J08A 2C0DA 3LW9A 3QCPA 2H76A 3LJRA 3KH9A 2LQQA 4MZWA 4HJ2A 4NAXA 1SK0A 2DBCA 3HD5A 4G2EA 3F4SA 2H75A 2I3YA 3EC3A 4V2NA 5E4WA 4GLTA 2FCHA 2HFDA 4K0NA 1F37A 2OKAA 1F3BA 2JACA 4IBPA 2H01A 1NW2A 2X8HA 2ON7A 2VOCA 3IAS2 4BVYB 6GSTA 5FHIA 2R37A 5F8BA 5JCWA 5D8IA 4ZBDA 1JZDA 3EYTA 2L6DA 3JCML 2FLSA 2QA1A 4KA0A 2HSYA 2FA8A 4NHWA 4N0VA 3EPTA 4YQUA 1AXDA 2A4VA 5L71A 2FA4A 1BEDA 4LL4B 1TI3A 5F0GA 1A2LA 2PVOC 1EOGA 1T4ZA 2PGTA 4XTSA 4NWYA 4GTUA 1GP1A 2F51A 1Z7PA 2WJUA 4TW5A 4ZBAA 1AUCA 3QFAC 4FYCA 3HDCA 2HRNA 2HXKA 4V1Ag 4Z7XA 3UIWA 1TK8B 3R3EA 1J0FA 4DSQA 2H1GA 6GSUA 3LYKA 1EEJA 4AGSA 1ML6A 1M7TA 5DJLA 1G0TA 1R7HA 5DDLA 3GYKA 1GNEA 2VL3A 3KMNA 3C7MA 3P90A 3M9JA 2KP2A 3H4KA 1SJZA 3PGTA 4KX4A 2LJKA 1V57A 2V1MA 3WT1A 4ML1A 4IKHA 1YDKA 5GZZB 2YCDA 6GSVA 2B5XA 5ECMB 2L4CA 2GT5A 5C04A 3QAWA 2JSYA 4HOJA 3HJMA 1K0OA 2CV4A 1YQ1A 1Y25A 4KGIA 4LA1A 1ERVA 1PX6A 4BVYA 1BX9A 4K5SA 3KZQA 3ME7A 5AN1A 1K0AA 4GSSA 4MPGA 5ID2B 3MAKA 3J7Yk 1SU9A 2JSZA 1IYHA 1TJDA 1Z3EA 2TRXA 1GTUA 3CSIA 4EXJA 2DJ0A 3L9UA 4MDCA 1ZOFA 4V2MA 2O89A 1YKAA 2X49A 3J7Yb 2X64A 3KD0A 2YP6A 5KEJA 2O87A 3A5WA 2WGRA 4N10A 2PU9C 4EVMA 3BD2A 3E9JB 5JWQB 2RM5A 2P5RA 4POKA 2ALBA 5IO0A 1R5PA 4GQCA 1Q4JA 2ON5A 4BA7A 5BMUA 6GSXA 3GHAA 3VLNA 1R5AA 1S3CA 1Z9HA 1XPVA 1GNWA 4NV5A 4Z2UA 1V9WA 3HVVA 3Q6OA 1F6MC 2J9HA 2HI7A 2L4QA 5HFGA 4Q5RA 5DVBA 3QAGA 1SYXA 4ZIJA 1KTEA 1TXXA 4P3YB 3LYPA 5KOWA 2H19A 3DVWA 2FWFA 2FWGA 5GAPD 4XHMA 1FO5A 2GS3A 1SK1A 5ID2A 1A23A 3APQA 2AAWA 3D4MA 2ZUPA 2GSTA 4ECBA 1VF3A 3FMWA 4QL9A 1FW1A 1OKTA 2R0PA 4KNDA 2GSSA 5IPGA 1FHEA 3TB2A 4BWQA 4BWSA 4YKGA 1I5GA 3L9SA 3IE3A 1NHYA 2NPBA 2MMAA 1GUMA 4ACSA 1QQ2A 3HJPA 2RUFA 1B8XA 1Z5YE 3VWWA 4WXTA 2X4AA 1XW6A 4PQ1A 1THOA 1SKSB 3ZREA 2DJ2A 2WDUA 4OFMA 2GVPA 4HEA2 1YKCA 2F8FA 1A24A 3FZ4A 3PINA 3CRUA 3CTGA 3FZ5A 2IJYA 2P0GA 4YQMA 4IQ1A 1ERWA 1XVQA 2FHEA 3M0FA 4EC0A 5ECSA 2DKIA 5IMAA 1GUKA 5IPHA 2HRKA 3ERWA 5F06A 4MJEA 1IYIA 2DJJA 4O5QA 3KMOA 2WZ9A 1U87A 2WULA 4NMUA 2HSMA 4MJBA 2M80A 2DIZA 2H30A 2B1LA 5BRTA 1OYJA 4I2TA 4JE1A 3TRXA 5FT3A 3ZFLA 3VPQA 2HSHA 1GTBA 3I6AA 2VLTA 5HR3A 1TRVA 3GRXA 1GH2A 2GZPA 2A4HA 1TTZA 2XPEA 2AJQB 1J9BA 1PKZA 4DSRA 1XZOA 3IA1A 3IDVA 1OC3A 3UJ1A 1WP0A 4XS4B 2MMOA 3CSJA 4RI7A 4NXIA 1JFUA 22GSA 1GL8A 4TXVA 3EVIA 2C0FA 1T4YA 4GF0A 4EUYA 4GCIA 4MLYA 1M2BA 1AQVA 2FY6A 4KUNA 1S3DA 4IS0A 3DVXA 2PERA 4ZB8A 2DSAA 1RK4A 2YV9A 5B7CA 4USSA 3HZ8A 3TJFA 3HKRA 2VIMA 2LNTA 2VCVA 2QC7A 3ERFA 1ZYQB 1A0FA 19GSA 3MYDA 4HJMA 2O8VB 3WGDA 2RIIA 3IK7A 5B6NA 2HLSA 5A4WA 5AISA 3QPMA 3ME8A 4A5PA 2K8VA 2TRCP 4J57E 2VCZA 3VWUA 3BOAA 4KE3A 5D73A 1UA5A 3M9KA 16GSA 4PURA 10GSA 1SKWB 2K6VA 5J9BA 4F03A 3Q74A 5CREA 5A4UA 4K2XA 1Z7RA 1GULA 3KJYA 1FAAA 4XS4A 3A2VA 1FB0A 1PL2A 2V32A 1XWCA 3HYPA 1U3IA 2K18A 3VFIA 1QUWA 5KOXA 1HNBA 2H72A 3GSTA 1EZKA 3TKRA 2LJAA 3EURA 2IN3A 2QSIA 3KP9A 2WRTA 1URMA 3LSZA 1PSQA 3GX8A 4CY8A 1ST9A 1JZRA 1I9DA 5ECLB 2VM2A 4O92A 2HRAA 4RQRA 2R0GA 2LRNA 2VLVA 4TRXA 5CRDA 3WD6A 4DSSB 3MDKA 1GUHA 3G7IA 1VF1A 3GMFA 1HNCA 3IAM2 5D9WA 2FNOA 4K0GA 4KW6A 1TW9A 1B4PA 3CRTA 1FVJA 4XRDA 1ZMAA 6GSWA 2DLXA 3TGZA 2KP1A 1ABAA 3F0IA 4KCEA 3DWVA 1YJ6A 3O6TA 3UBLA 1T7PB 4GRFA 3IPZA 4PNGA 1S3AA 2VCXA 4V2LA 3UBKA 1GSEA 4PGTA 5AGYA 3ZFBA 1XOAA 4FYUA 3LWAA 2JU5A 1ERUA 2X8GA 3CBUA 3GIXA 2FWEA 4G0IA 4MABA 1BQ7A 2YJ7A 4YAVA 1FB6A 4KH7A 1O8WA 2FUG2 4WEYA 1M9BA 2P5QA 7GSSA 1YF1A 4EE0A 5J3RA 4MNNA 2JZRA 3EU3A 3F4TA 4E8HA 5G31A 2XPDA 1OE7A 1FG4A 5D93A 1GSSA 1X9WB 3LQ7A 3QD9A 1TK0B 2C1YA 5HQPA 2C0GA 1OC9B 3ERGA 5IM9A 2R0CA 3H93A 4DSSA 4GSTA 1EGOA 3DKSA 3ISOA 1PMTA 5FWGA 5DALB 4PNFA 3D0ZA 3W6GA 4QQ7A 3BCIA 1AIUA 3TOUA 4O7HA 1ON4A 4IJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L57 A;  1K3L A;  1LU4 A;  1DSB A;  4HQZ A;  1KNG A;  3ZRD A;  3GUS A;  2LST A;  3P2A A;  4MF6 A;  2JZT A;  2IMI A;  5ECH B;  3U5R E;  1M0U A;  1XWB A;  2G0F A;  1A0R P;  3GKM A;  1Z6N A;  4X0X A;  3C1S A;  4K9Z A;  3DIE A;  3UVH A;  2GSR A;  4IHU A;  4WET A;  2MZC A;  3C1R A;  4DVC A;  2R6K A;  3D5J A;  4HDE A;  4POM A;  3CSH A;  2NTO A;  5AIV A;  2LQO A;  5D9X A;  1E2Y A;  1DE1 A;  2V6O A;  3K8N A;  4MP4 A;  2DJ1 A;  3H1N A;  5DQY A;  4NV2 A;  3Q18 A;  1XCC A;  2CQ9 A;  3UAR A;  5CRW A;  4Q5N A;  1OC9 A;  5J41 A;  2AYT A;  1K3O A;  3ZVJ D;  3QMX A;  2CX3 A;  1B9X C;  3ZIV A;  5AIX A;  2IMK A;  2H70 A;  1GSY A;  2I9H A;  5DAL A;  1BJX A;  2LEG A;  1XWG A;  5GSS A;  3M8N A;  4FO5 A;  2CVD A;  2L6C A;  1AC1 A;  1SK2 A;  3LGC A;  3FR6 A;  3TRP A;  4EDZ A;  4AJ8 A;  1M2A A;  5G5F A;  3HJO A;  4MA9 A;  2VUP A;  3FR9 A;  3HVX A;  4DEJ A;  5F05 A;  3QR6 A;  3GSS A;  4JU5 A;  1TK5 B;  5CP1 A;  3RBT A;  2H71 A;  3EIN A;  2X99 A;  4TKY A;  4FH8 A;  3AY8 A;  3BJ5 A;  1U6T A;  1OVN A;  1B4Q A;  1O7U A;  3DML A;  3H79 A;  1YEX A;  1JZW A;  2BTO T;  3A2X A;  1E6B A;  4F9Z A;  5HR1 A;  2C4J A;  5LD0 A;  1MDJ A;  4O32 A;  4L5O A;  3HA9 A;  2VCT A;  3IK9 A;  5JWO B;  1SJI A;  2MBS A;  2H66 A;  2LV3 A;  3GKN A;  4NHZ A;  4ECJ A;  4ECI A;  5IMD A;  2N5A A;  4EKZ A;  5IMC A;  3G7Y A;  4I2U A;  1BAY A;  1QXH A;  3KXO A;  1Q98 A;  3WGE A;  1T3B A;  5HR0 A;  3ZTL A;  2H1A A;  5KN3 A;  1LBK A;  2EIR A;  5IO2 A;  3FKF A;  3F6F A;  11GS A;  2E0Q A;  1C72 A;  1U3A A;  1PN9 A;  2I4A A;  4HI7 A;  1A8L A;  6GSS A;  1A2J A;  4ZB9 A;  2JZS A;  1QFN A;  2DC5 A;  3IRA A;  2DML A;  2VLU A;  3WT2 A;  2VAF A;  3OR5 A;  4IW9 A;  3ZVJ A;  4PUF C;  4MH3 A;  4EDY A;  2YN1 A;  1SJ6 A;  1ILO A;  3U6V A;  2CZ2 A;  14GS A;  4BL7 A;  5GST A;  2WS2 A;  3TJK A;  4YAP A;  3FK8 A;  1LJR A;  2YJH A;  1MDK A;  4G10 A;  3O76 A;  1OAZ A;  4JRR A;  1THX A;  2HT9 A;  2J23 A;  3TKS A;  4F82 A;  4Q5Q A;  1K0M A;  4WF5 A;  4WKW A;  2WFC A;  1CQG A;  2PWJ A;  2CVK A;  3RPN A;  4RUV A;  2YWI A;  1F3A A;  4ZL8 A;  1TKD B;  3HXS A;  1ZYE A;  4ZL9 A;  3LFL A;  4CDO A;  1SKR B;  2I1U A;  5DAK B;  3I43 A;  5DQS A;  1G7E A;  1HYU A;  1R26 A;  3KTB A;  2EIQ A;  1GSQ A;  3DEX A;  2IMF A;  3GFK A;  2E2M A;  5G1K A;  2YV7 A;  1JLV A;  2K9F A;  1WWJ A;  1TP9 A;  2H6Z A;  1RW1 A;  5EVO A;  1SL1 B;  2VO4 A;  4OD7 A;  3D21 A;  1XW9 A;  3HCZ A;  3DYR A;  3GA4 A;  6GSY A;  2IFQ B;  4J2F A;  5J5N A;  1DE2 A;  2C3T A;  3GV1 A;  4TR4 A;  2LNS A;  5B8B A;  1ERT A;  3NIV A;  2VCW A;  5CRH A;  1XFL A;  1JZO A;  1EV9 A;  3HY2 A;  4WF4 A;  3P7X A;  2GT6 A;  3D22 A;  3WGX A;  2BJX A;  3FEU A;  2PMT A;  2H73 A;  2E7P A;  2YPM A;  1QGV A;  3VUR A;  5JWR B;  2AB6 A;  3GL5 A;  4G19 A;  2L59 A;  3EMX A;  2NBS A;  3MWH A;  4EF0 A;  1NM3 A;  3ZL5 A;  3N5O A;  1RQM A;  2C3N A;  1PKW A;  3ZZX A;  1TDI A;  1T1V A;  5F07 A;  3IHQ A;  3IBH A;  3HHV A;  4KCA A;  3FYG A;  5KN1 A;  3CYN A;  5LCZ A;  3EWL A;  3GKX A;  5DCH A;  3KIJ A;  2O7K A;  1WPI A;  5DAK A;  5IOX A;  5J4U A;  4XS1 A;  12GS A;  1F2E A;  1YY7 A;  2L5O A;  5EL8 A;  1VF2 A;  3DXB A;  1T8E B;  1USB A;  2YWM A;  1SL2 B;  5IMF A;  1K0N A;  2OA7 A;  4MK3 A;  1SD8 A;  3TDG A;  3ZMK A;  3I69 A;  1XVW A;  4LLR A;  18GS A;  4TXO B;  3G7J A;  4KSO A;  3I9V 2;  2IFQ A;  2VM1 A;  5DCG A;  3D4T A;  1TI1 A;  3L0H A;  1TU7 A;  4K8M A;  2GTU A;  2RUE A;  1TRW A;  2C3Q A;  1KBN A;  2YZH A;  3RDW A;  2LS5 A;  3VPT A;  1AAZ A;  2AUV A;  3IC4 A;  1Z6M A;  4HU9 A;  1O6J A;  3MSZ A;  3RAZ A;  1R4W A;  4D73 B;  2REM A;  3ZLP A;  1GSU A;  4JR4 A;  3TKS C;  1QMV A;  3VWV A;  2XBI A;  2C80 A;  1G6Y A;  1X5D A;  2P31 A;  3BCK A;  2OE3 A;  3EE2 A;  2KLX A;  2GZY A;  5EPF A;  4KDU A;  1AQW A;  1KEB A;  4ECC A;  1HNA A;  3F9U A;  3LG6 A;  3ED3 A;  1PD2 1;  1GLQ A;  5CAX A;  3QFB C;  2NVL A;  2IME A;  3A2W A;  4MF5 A;  3F8U A;  1O81 A;  2MYG A;  5EY6 A;  1GRX A;  2CZ3 A;  3GL3 A;  2H0G A;  4ID0 A;  2L5L A;  4WR4 A;  5G5E A;  1MDI A;  2GDR A;  2YWO A;  4TXO A;  3LXZ A;  3LOR A;  4HU7 A;  4MZB A;  1SD9 A;  2F9S A;  2DJ3 A;  2H1B A;  3GTU B;  4NPB A;  1K0B A;  1V2A A;  3IXR A;  2H6X A;  5J9C A;  1VRS D;  2V41 A;  4YQV A;  2FGX A;  3F3R A;  1XOB A;  4PX1 A;  4WR5 A;  1T00 A;  5COH A;  1W89 A;  1CQH A;  1X0R A;  4K7I A;  5ECI B;  1XXU A;  4MMM A;  4L0W A;  4TOP A;  4D73 A;  4OCF A;  3ZIT A;  4TR1 B;  1XIY A;  1MTC A;  4PQH A;  1TOF A;  5CRG A;  1H75 A;  4YH2 A;  4PXO A;  3TKS E;  2R3X A;  3TKQ A;  2A2S A;  4BVX A;  3TRQ A;  4F2I A;  1XW5 A;  2ZNM A;  2B5E A;  1DBY A;  1MD3 A;  4MPF A;  3GUR A;  2H8L A;  2GQM A;  1TRS A;  3US3 A;  1EGR A;  4I97 A;  4KSM A;  5B8A A;  3UVT A;  2YWN A;  2MMN A;  2YZU A;  4ZB6 A;  1AW9 A;  1GTI A;  1UC7 A;  2H0H A;  4HZ2 A;  1WRY A;  2XBQ A;  4OO5 A;  3BBY A;  4MH2 A;  3C71 A;  1K0C A;  2H6Y A;  3KTL A;  2VCQ A;  1DUG A;  3FHK A;  3KEB A;  1WJK A;  3GTU A;  4RI6 A;  1NSW A;  2IWT A;  3QDN A;  2LRT A;  1OC8 A;  2Z9S A;  4HS1 A;  3APO A;  2DJK A;  2CVB A;  5C00 A;  1PA3 A;  2LKU A;  1SL0 B;  2CAI A;  2LUS A;  2R2J A;  5IMZ A;  3CXG A;  2IPA A;  4X43 A;  3QOU A;  4ML6 A;  2HZF A;  1XWK A;  4IP1 A;  3NOF A;  3DRN A;  2OBK A;  3FR3 A;  4TR1 A;  4HZ4 A;  4HQS A;  4MF7 A;  4KDY A;  4X1U A;  5CO3 A;  4IP6 A;  2GGT A;  3E3E A;  4ISD A;  1W4V A;  5INY A;  5CYY A;  2B7K A;  1FOV A;  3NZN A;  13GS A;  4MJA A;  1O85 A;  5KN0 A;  2VL2 A;  2PUK C;  1V98 A;  3GN3 A;  3IOS A;  1A8Y A;  1X5C A;  3GNJ A;  4XRA A;  3TJG A;  3VWX A;  1GLP A;  1N8J A;  2H1D A;  4FIW A;  4I6X A;  3VI5 A;  3UL3 A;  1GWC A;  4ZL7 A;  3O3T A;  2V6K A;  4MCU A;  2QKE A;  3UEM A;  1M9A A;  5H5Q A;  4GXZ A;  3S9F A;  4Q5F A;  2YNX A;  5B6M A;  2CT6 A;  2HYX A;  4CW9 A;  4BPY A;  2FD3 A;  1F9M A;  3HZ4 A;  2GQK A;  5ELA A;  2LTK A;  4RQX A;  2EIO A;  2I81 A;  5HFK A;  3UAP A;  1PGT A;  2HRF A;  17GS A;  2BMX A;  4N0Z A;  2C8U A;  4PUA A;  3TKP A;  4N30 A;  4E8E A;  1JHB A;  4TVE A;  3UOM A;  3F4R A;  1VF4 A;  1FVK A;  1V40 A;  1EP7 A;  1K0D A;  2PBJ A;  1MD4 A;  3W8J A;  1AQX A;  4IQA A;  2IL3 A;  2EC4 A;  4K6X A;  1PL1 A;  5IOW A;  3H8Q A;  3P8W A;  1B48 A;  2R5G A;  1M2D A;  3VI7 A;  2K8S A;  1G7O A;  2IMD A;  3ZIJ A;  4AF2 A;  2MMZ A;  1X9M B;  4JED A;  1BYE A;  5HFI A;  5ENU A;  2OE0 A;  1ZGN A;  2F3M A;  2V2G A;  3FZA A;  4F0B A;  2XC2 A;  1K3Y A;  2OAC A;  4AJ6 A;  3FW2 A;  2X8C A;  3MNG A;  1WE0 A;  5G30 A;  4WBJ A;  2CAQ A;  1GSD A;  3FRC A;  5E59 A;  4OFT A;  4L5L A;  1UN2 A;  2JAD A;  2GQL A;  3M1G A;  8GSS A;  4ZBB A;  1N2A A;  2CA8 A;  3L78 A;  2R4V A;  1H4O A;  1EEM A;  3WYW A;  3D6I A;  4GWR A;  4MJC A;  2H0I A;  3DD3 A;  2OE1 A;  2WB9 A;  1YZX A;  4K2D A;  1O73 A;  5ECK B;  2C0E A;  3FZ9 A;  3F63 A;  3TJB A;  1ACV A;  2LRC A;  5DJM A;  1SEN A;  1UVZ A;  1YEP A;  1JLW A;  4V1A p;  5ECP B;  2F8A A;  3F3Q A;  1SYR A;  4TR3 A;  2OAD A;  4LL1 B;  5D96 A;  2H74 A;  4KAE A;  3DGQ A;  5IQY A;  4QL7 A;  5G2Z A;  2KHP A;  3PH9 A;  1PRX A;  5ECN B;  5D9T A;  3M3M A;  3A3T A;  4GQF A;  2GZZ A;  3IR4 A;  3QAV A;  1X5E A;  1TRU A;  4JZQ A;  2B6M A;  3GH6 A;  5ABR A;  4L8E A;  3IV4 A;  1OE8 A;  4JBB A;  1QK8 A;  2OJL A;  2CX4 A;  2VL2 C;  1WOU A;  3C73 A;  4EL1 A;  4WBR D;  3VK9 A;  4FYB A;  4J56 E;  2VD1 A;  2AV4 A;  3LEF A;  3C8E A;  2M46 A;  2KOK A;  4K1F A;  2PPT A;  1ZL9 A;  2YAN A;  2ES7 A;  1PX7 A;  3KM6 A;  1EWX A;  2E2G A;  3EMP A;  4ILF A;  4XS6 A;  5D9V A;  1XBS A;  4O5R A;  2PVQ A;  4LMW A;  5JCG A;  2ZCT A;  5ECO B;  3V1W A;  2YOI A;  1B9Y C;  4AJ7 A;  1YF0 A;  4I8B A;  4F0C A;  5ECQ B;  4ZXG A;  4OWY A;  2G2Q A;  4XCS A;  3F6D A;  2M72 A;  4OMV A;  4PQI A;  9GSS A;  3CTF A;  3FY7 A;  4IEL A;  3E0U A;  2WCI A;  1Y6E A;  2KUC A;  1GSF A;  4POB A;  5A4V A;  2GLR A;  4HUA A;  3ZYW A;  5H5R A;  4IN0 A;  3L4N A;  1PQN A;  2HZE B;  5ELG A;  3ZML A;  3L9V A;  3SBC A;  4ZIL A;  4H86 A;  2LJR A;  1M99 A;  2DMM A;  2VD0 A;  1EP8 A;  4EO3 A;  3R2Q A;  4IVF A;  3GH9 A;  2HE3 A;  3W8S A;  20GS A;  1ZCP A;  2B1K A;  3TCO A;  4OFN A;  4K7N A;  2NDO A;  3TOT A;  5IMV A;  2DIY A;  2FWH A;  1WMJ A;  4ULX A;  4OO4 A;  2MBT A;  1A2M A;  2XHF A;  3N9J A;  4K7O A;  1GTA A;  2TIR A;  2HNL A;  3KP8 A;  3HVS A;  1MEK A;  5IIZ A;  4LMV A;  1HQO A;  1TU8 A;  1BG5 A;  1U88 A;  2IIY A;  3TUE A;  1G6W A;  2A2R A;  5A5K A;  4KB3 A;  3RPP A;  1NHO A;  1HD2 A;  4IGJ A;  3CMI A;  1EOH A;  3KGK A;  4OCE A;  4JR6 A;  5CNW A;  2QGV A;  4N11 A;  5G1L A;  2PN8 A;  4GSN A;  3GKK A;  4POL A;  3UMA A;  3EU4 A;  3KH7 A;  4CHS A;  3Q19 A;  4MZC A;  3G9B A;  3APS A;  5HR2 A;  5JCU A;  5H5S A;  2HZE A;  2AHE A;  4L0U A;  4XIH A;  2N5B A;  2RM6 A;  2RLI A;  5DBQ A;  1O8X A;  1XWA A;  5GAN D;  2B7J A;  3RHC A;  2VL9 A;  1V58 A;  3RHB A;  1X9S B;  2B3S A;  4G9H A;  2GSQ A;  3SWL A;  3PR8 A;  1WIK A;  2O85 A;  3LXT A;  4KDX A;  5KN2 A;  1EV4 A;  4TN8 A;  2D2Z A;  4TR0 A;  2JL4 A;  4IJI A;  3TJJ A;  3GX0 A;  2N5F A;  1VGL A;  2OBI A;  3KCM A;  5ECR B;  1ZZY A;  4I5Q A;  5LNK e;  2B5Y A;  1OKD A;  1J08 A;  2C0D A;  3QCP A;  2H76 A;  3LJR A;  3KH9 A;  2LQQ A;  4MZW A;  4HJ2 A;  4NAX A;  1SK0 A;  2DBC A;  3HD5 A;  4G2E A;  3F4S A;  2H75 A;  2I3Y A;  3EC3 A;  4V2N A;  5E4W A;  4GLT A;  2FCH A;  2HFD A;  4K0N A;  1F37 A;  2OKA A;  1F3B A;  2JAC A;  4IBP A;  2H01 A;  1NW2 A;  2X8H A;  2ON7 A;  2VOC A;  3IAS 2;  6GST A;  5FHI A;  2R37 A;  5F8B A;  5JCW A;  5D8I A;  4ZBD A;  1JZD A;  3EYT A;  2L6D A;  3JCM L;  2FLS A;  4KA0 A;  2HSY A;  2FA8 A;  4NHW A;  4N0V A;  4YQU A;  1AXD A;  2A4V A;  5L71 A;  2FA4 A;  1BED A;  4LL4 B;  1TI3 A;  5F0G A;  1A2L A;  2PVO C;  1EOG A;  1T4Z A;  2PGT A;  4XTS A;  4NWY A;  4GTU A;  1GP1 A;  2F51 A;  1Z7P A;  2WJU A;  4TW5 A;  4ZBA A;  1AUC A;  3QFA C;  4FYC A;  3HDC A;  2HRN A;  2HXK A;  4V1A g;  4Z7X A;  3UIW A;  1TK8 B;  1J0F A;  4DSQ A;  2H1G A;  6GSU A;  3LYK A;  1EEJ A;  4AGS A;  1ML6 A;  1M7T A;  5DJL A;  1G0T A;  1R7H A;  5DDL A;  3GYK A;  1GNE A;  2VL3 A;  3KMN A;  3C7M A;  3P90 A;  3M9J A;  2KP2 A;  3H4K A;  1SJZ A;  3PGT A;  4KX4 A;  2LJK A;  1V57 A;  2V1M A;  3WT1 A;  4ML1 A;  4IKH A;  1YDK A;  5GZZ B;  2YCD A;  6GSV A;  2B5X A;  5ECM B;  2L4C A;  2GT5 A;  5C04 A;  3QAW A;  2JSY A;  4HOJ A;  3HJM A;  1K0O A;  2CV4 A;  1YQ1 A;  1Y25 A;  4KGI A;  4LA1 A;  1ERV A;  1PX6 A;  4BVY A;  1BX9 A;  3KZQ A;  3ME7 A;  5AN1 A;  1K0A A;  4GSS A;  4MPG A;  5ID2 B;  3MAK A;  3J7Y k;  1SU9 A;  2JSZ A;  1IYH A;  1TJD A;  1Z3E A;  2TRX A;  1GTU A;  3CSI A;  4EXJ A;  2DJ0 A;  3L9U A;  4MDC A;  1ZOF A;  4V2M A;  2O89 A;  1YKA A;  3J7Y b;  2X64 A;  3KD0 A;  2YP6 A;  5KEJ A;  2O87 A;  3A5W A;  2WGR A;  4N10 A;  2PU9 C;  4EVM A;  3BD2 A;  3E9J B;  5JWQ B;  2RM5 A;  2P5R A;  4POK A;  2ALB A;  5IO0 A;  1R5P A;  4GQC A;  1Q4J A;  2ON5 A;  4BA7 A;  6GSX A;  3GHA A;  3VLN A;  1R5A A;  1S3C A;  1Z9H A;  1XPV A;  1GNW A;  4NV5 A;  1V9W A;  3HVV A;  3Q6O A;  1F6M C;  2J9H A;  2HI7 A;  2L4Q A;  5HFG A;  4Q5R A;  5DVB A;  3QAG A;  1SYX A;  4ZIJ A;  1KTE A;  1TXX A;  4P3Y B;  3LYP A;  2H19 A;  3DVW A;  2FWF A;  2FWG A;  5GAP D;  4XHM A;  1FO5 A;  2GS3 A;  1SK1 A;  5ID2 A;  1A23 A;  3APQ A;  2AAW A;  3D4M A;  2ZUP A;  2GST A;  4ECB A;  1VF3 A;  4QL9 A;  1FW1 A;  1OKT A;  4KND A;  2GSS A;  5IPG A;  1FHE A;  3TB2 A;  4BWQ A;  4BWS A;  1I5G A;  3L9S A;  3IE3 A;  1NHY A;  2NPB A;  2MMA A;  1GUM A;  4ACS A;  1QQ2 A;  3HJP A;  2RUF A;  1B8X A;  1Z5Y E;  3VWW A;  4WXT A;  1XW6 A;  4PQ1 A;  1THO A;  1SKS B;  3ZRE A;  2DJ2 A;  2WDU A;  4OFM A;  2GVP A;  4HEA 2;  1YKC A;  2F8F A;  1A24 A;  3FZ4 A;  3PIN A;  3CRU A;  3CTG A;  3FZ5 A;  2IJY A;  2P0G A;  4YQM A;  4IQ1 A;  1ERW A;  1XVQ A;  2FHE A;  3M0F A;  4EC0 A;  5ECS A;  5IMA A;  1GUK A;  5IPH A;  3ERW A;  5F06 A;  4MJE A;  1IYI A;  2DJJ A;  3KMO A;  2WZ9 A;  1U87 A;  2WUL A;  4NMU A;  4MJB A;  2M80 A;  2DIZ A;  2H30 A;  2B1L A;  1OYJ A;  4I2T A;  4JE1 A;  3TRX A;  5FT3 A;  3ZFL A;  3VPQ A;  2HSH A;  1GTB A;  3I6A A;  2VLT A;  5HR3 A;  1TRV A;  3GRX A;  1GH2 A;  2GZP A;  1TTZ A;  2XPE A;  2AJQ B;  1J9B A;  1PKZ A;  4DSR A;  1XZO A;  3IA1 A;  3IDV A;  1OC3 A;  3UJ1 A;  1WP0 A;  4XS4 B;  2MMO A;  3CSJ A;  4RI7 A;  4NXI A;  1JFU A;  22GS A;  1GL8 A;  4TXV A;  3EVI A;  2C0F A;  1T4Y A;  4GF0 A;  4EUY A;  4GCI A;  4MLY A;  1M2B A;  1AQV A;  2FY6 A;  4KUN A;  1S3D A;  4IS0 A;  3DVX A;  2PER A;  4ZB8 A;  2DSA A;  1RK4 A;  2YV9 A;  5B7C A;  3HZ8 A;  3TJF A;  3HKR A;  2VIM A;  2LNT A;  2VCV A;  2QC7 A;  3ERF A;  1ZYQ B;  1A0F A;  19GS A;  4HJM A;  2O8V B;  3WGD A;  2RII A;  3IK7 A;  5B6N A;  2HLS A;  5A4W A;  5AIS A;  3QPM A;  3ME8 A;  2K8V A;  2TRC P;  4J57 E;  2VCZ A;  3VWU A;  3BOA A;  4KE3 A;  5D73 A;  1UA5 A;  3M9K A;  16GS A;  4PUR A;  10GS A;  1SKW B;  2K6V A;  5J9B A;  4F03 A;  3Q74 A;  5CRE A;  5A4U A;  1Z7R A;  1GUL A;  3KJY A;  1FAA A;  4XS4 A;  3A2V A;  1FB0 A;  1PL2 A;  2V32 A;  1XWC A;  3HYP A;  1U3I A;  2K18 A;  3VFI A;  1QUW A;  1HNB A;  2H72 A;  3GST A;  1EZK A;  3TKR A;  2LJA A;  3EUR A;  2IN3 A;  2QSI A;  3KP9 A;  2WRT A;  1URM A;  3LSZ A;  1PSQ A;  3GX8 A;  1ST9 A;  1JZR A;  1I9D A;  5ECL B;  2VM2 A;  4O92 A;  4RQR A;  2LRN A;  2VLV A;  4TRX A;  5CRD A;  3WD6 A;  4DSS B;  3MDK A;  1GUH A;  3G7I A;  1VF1 A;  3GMF A;  1HNC A;  3IAM 2;  5D9W A;  2FNO A;  4K0G A;  4KW6 A;  1TW9 A;  1B4P A;  3CRT A;  1FVJ A;  4XRD A;  1ZMA A;  6GSW A;  2DLX A;  3TGZ A;  2KP1 A;  1ABA A;  3F0I A;  4KCE A;  3DWV A;  1YJ6 A;  3O6T A;  3UBL A;  1T7P B;  4GRF A;  3IPZ A;  4PNG A;  1S3A A;  2VCX A;  4V2L A;  3UBK A;  1GSE A;  4PGT A;  5AGY A;  3ZFB A;  1XOA A;  4FYU A;  3LWA A;  2JU5 A;  1ERU A;  2X8G A;  3CBU A;  3GIX A;  2FWE A;  4MAB A;  1BQ7 A;  2YJ7 A;  4YAV A;  1FB6 A;  4KH7 A;  1O8W A;  2FUG 2;  4WEY A;  1M9B A;  2P5Q A;  7GSS A;  1YF1 A;  4EE0 A;  5J3R A;  2JZR A;  3EU3 A;  3F4T A;  4E8H A;  5G31 A;  2XPD A;  1OE7 A;  1FG4 A;  5D93 A;  1GSS A;  1X9W B;  3LQ7 A;  3QD9 A;  1TK0 B;  2C1Y A;  5HQP A;  2C0G A;  1OC9 B;  3ERG A;  5IM9 A;  3H93 A;  4DSS A;  4GST A;  1EGO A;  3DKS A;  3ISO A;  1PMT A;  5FWG A;  5DAL B;  4PNF A;  3D0Z A;  3W6G A;  4QQ7 A;  3BCI A;  1AIU A;  3TOU A;  4O7H A;  1ON4 A;  4IJ3 A; 
#chains in the Genus database with same CATH topology
 2L57 A;  1K3L A;  1LU4 A;  1DSB A;  4HQZ A;  1KNG A;  3ZRD A;  3GUS A;  2LST A;  3P2A A;  4MF6 A;  2JZT A;  2IMI A;  5ECH B;  3U5R E;  1M0U A;  1XWB A;  2G0F A;  1A0R P;  3GKM A;  1Z6N A;  4X0X A;  3IHG A;  3C1S A;  4K9Z A;  3DIE A;  3UVH A;  2GSR A;  4IHU A;  4WET A;  2MZC A;  3C1R A;  4DVC A;  2R6K A;  3D5J A;  4HDE A;  4POM A;  3CSH A;  2NTO A;  5AIV A;  2LQO A;  5D9X A;  1E2Y A;  1DE1 A;  2V6O A;  3K8N A;  4MP4 A;  2DJ1 A;  3H1N A;  4HSC X;  5DQY A;  4NV2 A;  3Q18 A;  1XCC A;  2QA2 A;  2CQ9 A;  3UAR A;  5CRW A;  4Q5N A;  1OC9 A;  4G0L A;  5J41 A;  2AYT A;  3IC8 A;  1K3O A;  3ZVJ D;  3QMX A;  2CX3 A;  1B9X C;  3ZIV A;  5AIX A;  2IMK A;  2H70 A;  1GSY A;  2I9H A;  5DAL A;  1BJX A;  2LEG A;  1XWG A;  5GSS A;  4X4J A;  3M8N A;  4Z2R A;  4FO5 A;  2CVD A;  2L6C A;  1AC1 A;  1SK2 A;  3LGC A;  3FR6 A;  3TRP A;  4EDZ A;  4AJ8 A;  1M2A A;  5G5F A;  3HJO A;  4MA9 A;  2VUP A;  3FR9 A;  3HVX A;  4DEJ A;  5F05 A;  3QR6 A;  3GSS A;  4JU5 A;  1TK5 B;  5CP1 A;  3RBT A;  2H71 A;  1ZYP A;  3EIN A;  4BL7 B;  2X99 A;  4TKY A;  4FH8 A;  3AY8 A;  3BJ5 A;  1U6T A;  1OVN A;  1B4Q A;  1O7U A;  3DML A;  3H79 A;  1YEX A;  1JZW A;  2BTO T;  3A2X A;  1E6B A;  4F9Z A;  5HR1 A;  2C4J A;  5LD0 A;  1MDJ A;  4O32 A;  4L5O A;  3HA9 A;  4K5R A;  2VCT A;  3IK9 A;  5JWO B;  1SJI A;  2MBS A;  2H66 A;  2LV3 A;  3GKN A;  4NHZ A;  4ECJ A;  4ECI A;  5IMD A;  2N5A A;  4EKZ A;  5IMC A;  3G7Y A;  4I2U A;  1BAY A;  1QXH A;  3KXO A;  3PPU A;  1Q98 A;  3WGE A;  1T3B A;  5HR0 A;  3ZTL A;  2H1A A;  5KN3 A;  1LBK A;  2EIR A;  5IO2 A;  3FKF A;  3F6F A;  11GS A;  2E0Q A;  1C72 A;  1U3A A;  1PN9 A;  2I4A A;  4HI7 A;  1A8L A;  6GSS A;  1A2J A;  4ZB9 A;  2JZS A;  1QFN A;  2DC5 A;  3IRA A;  2DML A;  2VLU A;  3WT2 A;  2VAF A;  3OR5 A;  4IW9 A;  3ZVJ A;  4PUF C;  4MH3 A;  4EDY A;  2YN1 A;  1SJ6 A;  1ILO A;  3U6V A;  2CZ2 A;  14GS A;  4BL7 A;  5GST A;  2WS2 A;  3TJK A;  4YAP A;  3FK8 A;  1LJR A;  2YJH A;  1MDK A;  4G10 A;  3O76 A;  1OAZ A;  4JRR A;  1THX A;  2HT9 A;  2J23 A;  3TKS A;  4F82 A;  4Q5Q A;  1K0M A;  4WF5 A;  4WKW A;  2WFC A;  1CQG A;  2PWJ A;  2CVK A;  3RPN A;  4RUV A;  2YWI A;  1F3A A;  4ZL8 A;  1TKD B;  3HXS A;  1ZYE A;  4ZL9 A;  3LFL A;  4CDO A;  1SKR B;  2I1U A;  5DAK B;  3I43 A;  5DQS A;  1G7E A;  1HYU A;  1R26 A;  3KTB A;  2EIQ A;  1GSQ A;  3DEX A;  2IMF A;  3GFK A;  2E2M A;  5G1K A;  2YV7 A;  1JLV A;  2K9F A;  1WWJ A;  1TP9 A;  2H6Z A;  1RW1 A;  5EVO A;  1SL1 B;  2VO4 A;  4OD7 A;  3D21 A;  1XW9 A;  3HCZ A;  3DYR A;  3GA4 A;  4O5U A;  6GSY A;  2IFQ B;  4J2F A;  5J5N A;  1DE2 A;  2C3T A;  3GV1 A;  4Z2T A;  4TR4 A;  2LNS A;  5B8B A;  1ERT A;  3NIV A;  4PTS A;  2VCW A;  5CRH A;  1XFL A;  1JZO A;  1EV9 A;  3HY2 A;  4WF4 A;  3P7X A;  2GT6 A;  3D22 A;  3WGX A;  2BJX A;  3FEU A;  2PMT A;  2H73 A;  2E7P A;  2YPM A;  1QGV A;  3VUR A;  5JWR B;  2AB6 A;  3GL5 A;  4G19 A;  2L59 A;  3EMX A;  2NBS A;  3MWH A;  4EF0 A;  1NM3 A;  3ZL5 A;  3N5O A;  1RQM A;  2C3N A;  1PKW A;  3ZZX A;  1TDI A;  1T1V A;  5F07 A;  3IHQ A;  3IBH A;  3HHV A;  4KCA A;  3FYG A;  5KN1 A;  4EIQ A;  3CYN A;  5LCZ A;  3EWL A;  3GKX A;  5DCH A;  3KIJ A;  2O7K A;  1WPI A;  5DAK A;  5IOX A;  5J4U A;  4XS1 A;  12GS A;  1F2E A;  1YY7 A;  2L5O A;  5EL8 A;  1VF2 A;  3DXB A;  1T8E B;  1USB A;  2YWM A;  1SL2 B;  5IMF A;  1K0N A;  2OA7 A;  4MK3 A;  1SD8 A;  3TDG A;  3ZMK A;  3I69 A;  1XVW A;  4LLR A;  18GS A;  4TXO B;  3G7J A;  4KSO A;  3I9V 2;  2IFQ A;  2VM1 A;  5DCG A;  3D4T A;  1TI1 A;  3L0H A;  1TU7 A;  4K8M A;  1FOH A;  2GTU A;  2RUE A;  1TRW A;  2C3Q A;  1KBN A;  2YZH A;  3RDW A;  2LS5 A;  3VPT A;  1AAZ A;  2AUV A;  3IC4 A;  1Z6M A;  4HU9 A;  1O6J A;  3MSZ A;  3RAZ A;  1R4W A;  4D73 B;  2REM A;  3ZLP A;  1GSU A;  4JR4 A;  3TKS C;  1QMV A;  3VWV A;  2XBI A;  2C80 A;  1G6Y A;  1X5D A;  2P31 A;  3BCK A;  2OE3 A;  3EE2 A;  2KLX A;  2GZY A;  4BVX B;  5EPF A;  4KDU A;  1AQW A;  1KEB A;  4ECC A;  1HNA A;  3F9U A;  3LG6 A;  3ED3 A;  1PD2 1;  1GLQ A;  5CAX A;  3QFB C;  2NVL A;  1M3J A;  2IME A;  3A2W A;  4MF5 A;  3F8U A;  1O81 A;  2MYG A;  5EY6 A;  1GRX A;  2CZ3 A;  3GL3 A;  2H0G A;  4ID0 A;  2L5L A;  4WR4 A;  5G5E A;  1MDI A;  2GDR A;  2YWO A;  4TXO A;  3LXZ A;  3LOR A;  4HU7 A;  4MZB A;  1SD9 A;  2F9S A;  2DJ3 A;  2H1B A;  3GTU B;  4NPB A;  1K0B A;  1V2A A;  3IXR A;  2H6X A;  5J9C A;  4YKF A;  1VRS D;  2V41 A;  4YQV A;  2FGX A;  3F3R A;  1XOB A;  4PX1 A;  4WR5 A;  1T00 A;  5COH A;  1W89 A;  1CQH A;  1X0R A;  4K7I A;  5ECI B;  1XXU A;  4MMM A;  4L0W A;  4TOP A;  4KF9 A;  4D73 A;  4OCF A;  3ZIT A;  4TR1 B;  1XIY A;  1MTC A;  4PQH A;  1TOF A;  1S3R A;  5CRG A;  1H75 A;  4YH2 A;  1ZYN A;  4PXO A;  3TKS E;  2R3X A;  3TKQ A;  2A2S A;  4BVX A;  3TRQ A;  4F2I A;  1XW5 A;  2ZNM A;  2B5E A;  1DBY A;  1MD3 A;  4MPF A;  3GUR A;  2H8L A;  2GQM A;  1TRS A;  3US3 A;  1EGR A;  4I97 A;  4KSM A;  5B8A A;  3UVT A;  2YWN A;  2MMN A;  2YZU A;  4ZB6 A;  1AW9 A;  1GTI A;  1UC7 A;  2H0H A;  4HZ2 A;  3A5I A;  1WRY A;  2XBQ A;  4OO5 A;  3BBY A;  4MH2 A;  3C71 A;  1K0C A;  2H6Y A;  3KTL A;  2VCQ A;  1DUG A;  3FHK A;  3KEB A;  1WJK A;  3GTU A;  4RI6 A;  1NSW A;  2IWT A;  3QDN A;  2LRT A;  1OC8 A;  2Z9S A;  4HS1 A;  3APO A;  2DJK A;  2CVB A;  5C00 A;  1PA3 A;  2LKU A;  1SL0 B;  2CAI A;  2LUS A;  2R2J A;  5IMZ A;  3CXG A;  2IPA A;  4X43 A;  3QOU A;  4ML6 A;  2HZF A;  1XWK A;  4IP1 A;  3NOF A;  3DRN A;  2OBK A;  3FR3 A;  4TR1 A;  4HZ4 A;  4HQS A;  4MF7 A;  4KDY A;  4X1U A;  5CO3 A;  4IP6 A;  2GGT A;  3E3E A;  4ISD A;  1W4V A;  5INY A;  5CYY A;  2B7K A;  1FOV A;  3NZN A;  13GS A;  4MJA A;  1O85 A;  5KN0 A;  2VL2 A;  2PUK C;  1V98 A;  3GN3 A;  3IOS A;  1A8Y A;  1X5C A;  3GNJ A;  4XRA A;  3TJG A;  1M3I A;  3VWX A;  1GLP A;  1N8J A;  2H1D A;  4FIW A;  4I6X A;  3VI5 A;  3UL3 A;  1GWC A;  4ICY A;  4ZL7 A;  3O3T A;  2V6K A;  4MCU A;  2QKE A;  3UEM A;  1M9A A;  5H5Q A;  4GXZ A;  3S9F A;  4Q5F A;  2YNX A;  5B6M A;  2CT6 A;  2HYX A;  4CW9 A;  4BPY A;  2FD3 A;  1F9M A;  3HZ4 A;  2GQK A;  5ELA A;  2LTK A;  4RQX A;  2EIO A;  2I81 A;  5HFK A;  3UAP A;  1PGT A;  2HRF A;  17GS A;  2BMX A;  4N0Z A;  2C8U A;  4PUA A;  3TKP A;  4N30 A;  4E8E A;  1JHB A;  4TVE A;  3UOM A;  3F4R A;  1VF4 A;  1FVK A;  1V40 A;  1EP7 A;  1K0D A;  2PBJ A;  1MD4 A;  3W8J A;  1AQX A;  4IQA A;  2IL3 A;  2EC4 A;  4K6X A;  1PL1 A;  5IOW A;  3H8Q A;  3P8W A;  1B48 A;  2R5G A;  1M2D A;  3VI7 A;  2K8S A;  1G7O A;  2IMD A;  3ZIJ A;  4AF2 A;  2MMZ A;  1X9M B;  4JED A;  1BYE A;  5HFI A;  5ENU A;  2OE0 A;  1ZGN A;  2F3M A;  2V2G A;  3FZA A;  4F0B A;  2XC2 A;  1K3Y A;  2OAC A;  4AJ6 A;  3FW2 A;  2X8C A;  3MNG A;  1WE0 A;  5G30 A;  4WBJ A;  2CAQ A;  1GSD A;  3FRC A;  5E59 A;  4OFT A;  4CY6 A;  4L5L A;  1UN2 A;  2JAD A;  2GQL A;  3M1G A;  8GSS A;  4ZBB A;  1N2A A;  2CA8 A;  3L78 A;  2R4V A;  1H4O A;  1EEM A;  3WYW A;  3D6I A;  4GWR A;  4MJC A;  2H0I A;  3DD3 A;  2OE1 A;  2WB9 A;  1YZX A;  4K2D A;  1O73 A;  5ECK B;  2C0E A;  3FZ9 A;  3F63 A;  3TJB A;  1ACV A;  2LRC A;  5DJM A;  1SEN A;  1UVZ A;  1YEP A;  1JLW A;  4V1A p;  5ECP B;  2F8A A;  3F3Q A;  1SYR A;  4TR3 A;  2OAD A;  4LL1 B;  5D96 A;  2H74 A;  4KAE A;  3DGQ A;  5IQY A;  4QL7 A;  5G2Z A;  2KHP A;  3PH9 A;  1PRX A;  5ECN B;  5D9T A;  3M3M A;  3A3T A;  4GQF A;  2GZZ A;  3IR4 A;  3QAV A;  1X5E A;  1TRU A;  4JZQ A;  2B6M A;  3GH6 A;  5ABR A;  4L8E A;  3IV4 A;  1OE8 A;  4JBB A;  1QK8 A;  2OJL A;  2CX4 A;  2VL2 C;  1WOU A;  3C73 A;  4EL1 A;  4WBR D;  3VK9 A;  4FYB A;  4J56 E;  2VD1 A;  2AV4 A;  3LEF A;  3C8E A;  2M46 A;  2DKH A;  2KOK A;  4K1F A;  2PPT A;  1ZL9 A;  2YAN A;  2ES7 A;  1PX7 A;  3KM6 A;  1EWX A;  2E2G A;  3EMP A;  4ILF A;  4XS6 A;  5D9V A;  1XBS A;  4O5R A;  2PVQ A;  4LMW A;  5JCG A;  2ZCT A;  5ECO B;  3V1W A;  2YOI A;  1B9Y C;  4AJ7 A;  1YF0 A;  4I8B A;  4F0C A;  5ECQ B;  3MIX A;  4ZXG A;  4OWY A;  2G2Q A;  4XCS A;  3F6D A;  2M72 A;  4OMV A;  4PQI A;  9GSS A;  3CTF A;  3FY7 A;  4IEL A;  3E0U A;  2WCI A;  1Y6E A;  2KUC A;  1GSF A;  4POB A;  5A4V A;  2GLR A;  4HUA A;  3ZYW A;  5H5R A;  4IN0 A;  3L4N A;  1PQN A;  2HZE B;  5ELG A;  3ZML A;  3L9V A;  3SBC A;  4ZIL A;  4H86 A;  2LJR A;  1M99 A;  2DMM A;  2VD0 A;  1EP8 A;  4EO3 A;  3R2Q A;  4IVF A;  3GH9 A;  2HE3 A;  3W8S A;  20GS A;  1ZCP A;  2B1K A;  3TCO A;  4OFN A;  4K7N A;  2NDO A;  3TOT A;  5IMV A;  2DIY A;  2FWH A;  1WMJ A;  4ULX A;  4OO4 A;  2MBT A;  1A2M A;  2XHF A;  3N9J A;  4K7O A;  1GTA A;  2TIR A;  2HNL A;  3KP8 A;  4EIP A;  3HVS A;  1MEK A;  5IIZ A;  4LMV A;  1HQO A;  1TU8 A;  1BG5 A;  1U88 A;  2IIY A;  3TUE A;  1G6W A;  2A2R A;  2UZ8 A;  5A5K A;  4KB3 A;  3RPP A;  1NHO A;  1HD2 A;  4IGJ A;  3CMI A;  1EOH A;  3KGK A;  4OCE A;  4JR6 A;  5CNW A;  2QGV A;  4N11 A;  5G1L A;  2PN8 A;  4GSN A;  3GKK A;  4POL A;  3UMA A;  3EU4 A;  3KH7 A;  4CHS A;  3Q19 A;  4MZC A;  3G9B A;  3APS A;  5HR2 A;  5JCU A;  2A2P A;  5H5S A;  4FQU A;  2HZE A;  2AHE A;  4L0U A;  4XIH A;  2N5B A;  2RM6 A;  2RLI A;  5DBQ A;  1O8X A;  1XWA A;  5GAN D;  2B7J A;  3RHC A;  2VL9 A;  1V58 A;  4G0K A;  3RHB A;  1X9S B;  2B3S A;  1PN0 A;  4G9H A;  2GSQ A;  3SWL A;  3PR8 A;  1WIK A;  2O85 A;  3LXT A;  4KDX A;  5KN2 A;  1EV4 A;  4TN8 A;  2D2Z A;  4TR0 A;  2JL4 A;  4IJI A;  3TJJ A;  3GX0 A;  2N5F A;  1VGL A;  2OBI A;  3KCM A;  5ECR B;  1ZZY A;  4I5Q A;  5LNK e;  2B5Y A;  1OKD A;  1J08 A;  2C0D A;  3LW9 A;  3QCP A;  2H76 A;  3LJR A;  3KH9 A;  2LQQ A;  4MZW A;  4HJ2 A;  4NAX A;  1SK0 A;  2DBC A;  3HD5 A;  4G2E A;  3F4S A;  2H75 A;  2I3Y A;  3EC3 A;  4V2N A;  5E4W A;  4GLT A;  2FCH A;  2HFD A;  4K0N A;  1F37 A;  2OKA A;  1F3B A;  2JAC A;  4IBP A;  2H01 A;  1NW2 A;  2X8H A;  2ON7 A;  2VOC A;  3IAS 2;  4BVY B;  6GST A;  5FHI A;  2R37 A;  5F8B A;  5JCW A;  5D8I A;  4ZBD A;  1JZD A;  3EYT A;  2L6D A;  3JCM L;  2FLS A;  2QA1 A;  4KA0 A;  2HSY A;  2FA8 A;  4NHW A;  4N0V A;  3EPT A;  4YQU A;  1AXD A;  2A4V A;  5L71 A;  2FA4 A;  1BED A;  4LL4 B;  1TI3 A;  5F0G A;  1A2L A;  2PVO C;  1EOG A;  1T4Z A;  2PGT A;  4XTS A;  4NWY A;  4GTU A;  1GP1 A;  2F51 A;  1Z7P A;  2WJU A;  4TW5 A;  4ZBA A;  1AUC A;  3QFA C;  4FYC A;  3HDC A;  2HRN A;  2HXK A;  4V1A g;  4Z7X A;  3UIW A;  1TK8 B;  3R3E A;  1J0F A;  4DSQ A;  2H1G A;  6GSU A;  3LYK A;  1EEJ A;  4AGS A;  1ML6 A;  1M7T A;  5DJL A;  1G0T A;  1R7H A;  5DDL A;  3GYK A;  1GNE A;  2VL3 A;  3KMN A;  3C7M A;  3P90 A;  3M9J A;  2KP2 A;  3H4K A;  1SJZ A;  3PGT A;  4KX4 A;  2LJK A;  1V57 A;  2V1M A;  3WT1 A;  4ML1 A;  4IKH A;  1YDK A;  5GZZ B;  2YCD A;  6GSV A;  2B5X A;  3CQF A;  5ECM B;  2L4C A;  2GT5 A;  5C04 A;  3QAW A;  2JSY A;  4HOJ A;  3HJM A;  1K0O A;  2CV4 A;  1YQ1 A;  1Y25 A;  4KGI A;  4LA1 A;  1ERV A;  1PX6 A;  4BVY A;  1BX9 A;  4K5S A;  3KZQ A;  3ME7 A;  5AN1 A;  1K0A A;  4GSS A;  4MPG A;  5ID2 B;  3MAK A;  3J7Y k;  1SU9 A;  2JSZ A;  1IYH A;  1TJD A;  1Z3E A;  2TRX A;  1GTU A;  3CSI A;  4EXJ A;  2DJ0 A;  3L9U A;  4MDC A;  1ZOF A;  4V2M A;  2O89 A;  1YKA A;  2X49 A;  3J7Y b;  2X64 A;  3KD0 A;  2YP6 A;  5KEJ A;  2O87 A;  3A5W A;  2WGR A;  4N10 A;  2PU9 C;  4EVM A;  3BD2 A;  3E9J B;  5JWQ B;  2RM5 A;  2P5R A;  4POK A;  2ALB A;  5IO0 A;  1R5P A;  4GQC A;  1Q4J A;  2ON5 A;  4BA7 A;  5BMU A;  6GSX A;  3GHA A;  3VLN A;  1R5A A;  1S3C A;  1Z9H A;  1XPV A;  1GNW A;  4NV5 A;  4Z2U A;  1V9W A;  3HVV A;  3Q6O A;  1F6M C;  2J9H A;  2HI7 A;  2L4Q A;  5HFG A;  4Q5R A;  5DVB A;  3QAG A;  1SYX A;  4ZIJ A;  1KTE A;  1TXX A;  4P3Y B;  3LYP A;  5KOW A;  2H19 A;  3DVW A;  2FWF A;  2FWG A;  5GAP D;  4XHM A;  1FO5 A;  2GS3 A;  1SK1 A;  5ID2 A;  1A23 A;  3APQ A;  2AAW A;  3D4M A;  2ZUP A;  2GST A;  4ECB A;  1VF3 A;  3FMW A;  4QL9 A;  1PFO A;  1FW1 A;  1OKT A;  2R0P A;  4KND A;  2GSS A;  5IPG A;  1FHE A;  3TB2 A;  4BWQ A;  4BWS A;  4YKG A;  1I5G A;  3L9S A;  3IE3 A;  1NHY A;  2NPB A;  2MMA A;  1GUM A;  4ACS A;  1QQ2 A;  3HJP A;  2RUF A;  1B8X A;  1Z5Y E;  3VWW A;  4WXT A;  2X4A A;  1XW6 A;  4PQ1 A;  1THO A;  1SKS B;  3ZRE A;  2DJ2 A;  2WDU A;  4OFM A;  2GVP A;  4HEA 2;  1YKC A;  2F8F A;  4BIK A;  1A24 A;  3FZ4 A;  3PIN A;  3CRU A;  3CTG A;  3FZ5 A;  2IJY A;  2P0G A;  4YQM A;  4IQ1 A;  1ERW A;  1XVQ A;  2FHE A;  3M0F A;  4EC0 A;  5ECS A;  2DKI A;  5IMA A;  1GUK A;  5IPH A;  2HRK A;  3ERW A;  5F06 A;  4MJE A;  1IYI A;  2DJJ A;  4O5Q A;  3KMO A;  2WZ9 A;  1U87 A;  2WUL A;  4NMU A;  2HSM A;  4MJB A;  2M80 A;  2DIZ A;  2H30 A;  2B1L A;  5BRT A;  1OYJ A;  4I2T A;  4JE1 A;  3TRX A;  5FT3 A;  3ZFL A;  3VPQ A;  2HSH A;  1GTB A;  3I6A A;  2VLT A;  5HR3 A;  1TRV A;  3GRX A;  1GH2 A;  2GZP A;  2A4H A;  1TTZ A;  2XPE A;  2AJQ B;  1J9B A;  1PKZ A;  4DSR A;  1XZO A;  3IA1 A;  3IDV A;  1OC3 A;  3UJ1 A;  1WP0 A;  4XS4 B;  2MMO A;  3CSJ A;  4RI7 A;  4NXI A;  1JFU A;  22GS A;  1GL8 A;  4TXV A;  3EVI A;  2C0F A;  1T4Y A;  4GF0 A;  4EUY A;  4GCI A;  4MLY A;  1M2B A;  1AQV A;  2FY6 A;  4KUN A;  1S3D A;  4IS0 A;  3DVX A;  2PER A;  4ZB8 A;  2DSA A;  1RK4 A;  2YV9 A;  5B7C A;  4USS A;  3HZ8 A;  3TJF A;  3HKR A;  2VIM A;  2LNT A;  2VCV A;  2QC7 A;  3ERF A;  1ZYQ B;  1A0F A;  19GS A;  1XG8 A;  3MYD A;  4HJM A;  2O8V B;  3WGD A;  2RII A;  3IK7 A;  5B6N A;  2HLS A;  5A4W A;  5AIS A;  3QPM A;  3ME8 A;  4A5P A;  2K8V A;  2TRC P;  4J57 E;  2VCZ A;  3VWU A;  3BOA A;  4KE3 A;  5D73 A;  1UA5 A;  3M9K A;  16GS A;  4PUR A;  10GS A;  3HVN A;  1SKW B;  2K6V A;  5J9B A;  4F03 A;  3Q74 A;  5CRE A;  5A4U A;  4K2X A;  1Z7R A;  1GUL A;  3KJY A;  1FAA A;  4XS4 A;  3A2V A;  1FB0 A;  1PL2 A;  2V32 A;  1XWC A;  3HYP A;  1U3I A;  2K18 A;  3VFI A;  1QUW A;  5KOX A;  1HNB A;  2H72 A;  3GST A;  1EZK A;  3TKR A;  2LJA A;  3EUR A;  2IN3 A;  2QSI A;  3KP9 A;  2WRT A;  1URM A;  3LSZ A;  1PSQ A;  3GX8 A;  4CY8 A;  1ST9 A;  1JZR A;  1I9D A;  5ECL B;  2VM2 A;  4O92 A;  2HRA A;  4RQR A;  2R0G A;  2LRN A;  2VLV A;  4TRX A;  5CRD A;  3WD6 A;  4DSS B;  3MDK A;  1GUH A;  3G7I A;  1VF1 A;  3GMF A;  1HNC A;  3IAM 2;  5D9W A;  2FNO A;  4K0G A;  4KW6 A;  1TW9 A;  1B4P A;  3CRT A;  1FVJ A;  4XRD A;  1ZMA A;  6GSW A;  2DLX A;  3TGZ A;  2KP1 A;  1ABA A;  3F0I A;  4KCE A;  3DWV A;  1YJ6 A;  3O6T A;  3UBL A;  1T7P B;  4GRF A;  3IPZ A;  4PNG A;  1S3A A;  2VCX A;  4V2L A;  3UBK A;  1GSE A;  4PGT A;  5AGY A;  3ZFB A;  1XOA A;  4FYU A;  3LWA A;  2JU5 A;  1ERU A;  2X8G A;  3CBU A;  3GIX A;  2FWE A;  4G0I A;  4MAB A;  1BQ7 A;  2YJ7 A;  4YAV A;  1FB6 A;  4KH7 A;  1O8W A;  2FUG 2;  4WEY A;  1M9B A;  2P5Q A;  7GSS A;  1YF1 A;  4EE0 A;  5J3R A;  4MNN A;  2JZR A;  3EU3 A;  3F4T A;  4E8H A;  5G31 A;  2XPD A;  1OE7 A;  1FG4 A;  5D93 A;  1GSS A;  1X9W B;  3LQ7 A;  3QD9 A;  1TK0 B;  2C1Y A;  5HQP A;  2C0G A;  1OC9 B;  3ERG A;  5IM9 A;  2R0C A;  3H93 A;  4DSS A;  4GST A;  1EGO A;  3DKS A;  3ISO A;  1PMT A;  5FWG A;  5DAL B;  4PNF A;  3D0Z A;  3W6G A;  4QQ7 A;  3BCI A;  1AIU A;  3TOU A;  4O7H A;  1ON4 A;  4IJ3 A; 
#chains in the Genus database with same CATH homology
 2L57 A;  1K3L A;  1LU4 A;  1DSB A;  4HQZ A;  1KNG A;  3ZRD A;  3GUS A;  2LST A;  3P2A A;  4MF6 A;  2JZT A;  2IMI A;  5ECH B;  3U5R E;  1M0U A;  1XWB A;  2G0F A;  1A0R P;  3GKM A;  1Z6N A;  4X0X A;  3IHG A;  3C1S A;  4K9Z A;  3DIE A;  3UVH A;  2GSR A;  4IHU A;  4WET A;  2MZC A;  3C1R A;  4DVC A;  2R6K A;  3D5J A;  4HDE A;  4POM A;  3CSH A;  2NTO A;  5AIV A;  2LQO A;  5D9X A;  1E2Y A;  1DE1 A;  2V6O A;  3K8N A;  4MP4 A;  2DJ1 A;  3H1N A;  5DQY A;  4NV2 A;  3Q18 A;  1XCC A;  2QA2 A;  2CQ9 A;  3UAR A;  5CRW A;  4Q5N A;  1OC9 A;  4G0L A;  5J41 A;  2AYT A;  3IC8 A;  1K3O A;  3ZVJ D;  3QMX A;  2CX3 A;  1B9X C;  3ZIV A;  5AIX A;  2IMK A;  2H70 A;  1GSY A;  2I9H A;  5DAL A;  1BJX A;  2LEG A;  1XWG A;  5GSS A;  4X4J A;  3M8N A;  4Z2R A;  4FO5 A;  2CVD A;  2L6C A;  1AC1 A;  1SK2 A;  3LGC A;  3FR6 A;  3TRP A;  4EDZ A;  4AJ8 A;  1M2A A;  5G5F A;  3HJO A;  4MA9 A;  2VUP A;  3FR9 A;  3HVX A;  4DEJ A;  5F05 A;  3QR6 A;  3GSS A;  4JU5 A;  1TK5 B;  5CP1 A;  3RBT A;  2H71 A;  1ZYP A;  3EIN A;  4BL7 B;  2X99 A;  4TKY A;  4FH8 A;  3AY8 A;  3BJ5 A;  1U6T A;  1OVN A;  1B4Q A;  1O7U A;  3DML A;  3H79 A;  1YEX A;  1JZW A;  2BTO T;  3A2X A;  1E6B A;  4F9Z A;  5HR1 A;  2C4J A;  5LD0 A;  1MDJ A;  4O32 A;  4L5O A;  3HA9 A;  4K5R A;  2VCT A;  3IK9 A;  5JWO B;  1SJI A;  2MBS A;  2H66 A;  2LV3 A;  3GKN A;  4NHZ A;  4ECJ A;  4ECI A;  5IMD A;  2N5A A;  4EKZ A;  5IMC A;  3G7Y A;  4I2U A;  1BAY A;  1QXH A;  3KXO A;  3PPU A;  1Q98 A;  3WGE A;  1T3B A;  5HR0 A;  3ZTL A;  2H1A A;  5KN3 A;  1LBK A;  2EIR A;  5IO2 A;  3FKF A;  3F6F A;  11GS A;  2E0Q A;  1C72 A;  1U3A A;  1PN9 A;  2I4A A;  4HI7 A;  1A8L A;  6GSS A;  1A2J A;  4ZB9 A;  2JZS A;  1QFN A;  2DC5 A;  3IRA A;  2DML A;  2VLU A;  3WT2 A;  2VAF A;  3OR5 A;  4IW9 A;  3ZVJ A;  4PUF C;  4MH3 A;  4EDY A;  2YN1 A;  1SJ6 A;  1ILO A;  3U6V A;  2CZ2 A;  14GS A;  4BL7 A;  5GST A;  2WS2 A;  3TJK A;  4YAP A;  3FK8 A;  1LJR A;  2YJH A;  1MDK A;  4G10 A;  3O76 A;  1OAZ A;  4JRR A;  1THX A;  2HT9 A;  2J23 A;  3TKS A;  4F82 A;  4Q5Q A;  1K0M A;  4WF5 A;  4WKW A;  2WFC A;  1CQG A;  2PWJ A;  2CVK A;  3RPN A;  4RUV A;  2YWI A;  1F3A A;  4ZL8 A;  1TKD B;  3HXS A;  1ZYE A;  4ZL9 A;  3LFL A;  4CDO A;  1SKR B;  2I1U A;  5DAK B;  3I43 A;  5DQS A;  1G7E A;  1HYU A;  1R26 A;  3KTB A;  2EIQ A;  1GSQ A;  3DEX A;  2IMF A;  3GFK A;  2E2M A;  5G1K A;  2YV7 A;  1JLV A;  2K9F A;  1WWJ A;  1TP9 A;  2H6Z A;  1RW1 A;  5EVO A;  1SL1 B;  2VO4 A;  4OD7 A;  3D21 A;  1XW9 A;  3HCZ A;  3DYR A;  3GA4 A;  4O5U A;  6GSY A;  2IFQ B;  4J2F A;  5J5N A;  1DE2 A;  2C3T A;  3GV1 A;  4Z2T A;  4TR4 A;  2LNS A;  5B8B A;  1ERT A;  3NIV A;  4PTS A;  2VCW A;  5CRH A;  1XFL A;  1JZO A;  1EV9 A;  3HY2 A;  4WF4 A;  3P7X A;  2GT6 A;  3D22 A;  3WGX A;  2BJX A;  3FEU A;  2PMT A;  2H73 A;  2E7P A;  2YPM A;  1QGV A;  3VUR A;  5JWR B;  2AB6 A;  3GL5 A;  4G19 A;  2L59 A;  3EMX A;  2NBS A;  3MWH A;  4EF0 A;  1NM3 A;  3ZL5 A;  3N5O A;  1RQM A;  2C3N A;  1PKW A;  3ZZX A;  1TDI A;  1T1V A;  5F07 A;  3IHQ A;  3IBH A;  3HHV A;  4KCA A;  3FYG A;  5KN1 A;  4EIQ A;  3CYN A;  5LCZ A;  3EWL A;  3GKX A;  5DCH A;  3KIJ A;  2O7K A;  1WPI A;  5DAK A;  5IOX A;  5J4U A;  4XS1 A;  12GS A;  1F2E A;  1YY7 A;  2L5O A;  5EL8 A;  1VF2 A;  3DXB A;  1T8E B;  1USB A;  2YWM A;  1SL2 B;  5IMF A;  1K0N A;  2OA7 A;  4MK3 A;  1SD8 A;  3TDG A;  3ZMK A;  3I69 A;  1XVW A;  4LLR A;  18GS A;  4TXO B;  3G7J A;  4KSO A;  3I9V 2;  2IFQ A;  2VM1 A;  5DCG A;  3D4T A;  1TI1 A;  3L0H A;  1TU7 A;  4K8M A;  1FOH A;  2GTU A;  2RUE A;  1TRW A;  2C3Q A;  1KBN A;  2YZH A;  3RDW A;  2LS5 A;  3VPT A;  1AAZ A;  2AUV A;  3IC4 A;  1Z6M A;  4HU9 A;  1O6J A;  3MSZ A;  3RAZ A;  1R4W A;  4D73 B;  2REM A;  3ZLP A;  1GSU A;  4JR4 A;  3TKS C;  1QMV A;  3VWV A;  2XBI A;  2C80 A;  1G6Y A;  1X5D A;  2P31 A;  3BCK A;  2OE3 A;  3EE2 A;  2KLX A;  2GZY A;  4BVX B;  5EPF A;  4KDU A;  1AQW A;  1KEB A;  4ECC A;  1HNA A;  3F9U A;  3LG6 A;  3ED3 A;  1PD2 1;  1GLQ A;  5CAX A;  3QFB C;  2NVL A;  2IME A;  3A2W A;  4MF5 A;  3F8U A;  1O81 A;  2MYG A;  5EY6 A;  1GRX A;  2CZ3 A;  3GL3 A;  2H0G A;  4ID0 A;  2L5L A;  4WR4 A;  5G5E A;  1MDI A;  2GDR A;  2YWO A;  4TXO A;  3LXZ A;  3LOR A;  4HU7 A;  4MZB A;  1SD9 A;  2F9S A;  2DJ3 A;  2H1B A;  3GTU B;  4NPB A;  1K0B A;  1V2A A;  3IXR A;  2H6X A;  5J9C A;  4YKF A;  1VRS D;  2V41 A;  4YQV A;  2FGX A;  3F3R A;  1XOB A;  4PX1 A;  4WR5 A;  1T00 A;  5COH A;  1W89 A;  1CQH A;  1X0R A;  4K7I A;  5ECI B;  1XXU A;  4MMM A;  4L0W A;  4TOP A;  4KF9 A;  4D73 A;  4OCF A;  3ZIT A;  4TR1 B;  1XIY A;  1MTC A;  4PQH A;  1TOF A;  5CRG A;  1H75 A;  4YH2 A;  1ZYN A;  4PXO A;  3TKS E;  2R3X A;  3TKQ A;  2A2S A;  4BVX A;  3TRQ A;  4F2I A;  1XW5 A;  2ZNM A;  2B5E A;  1DBY A;  1MD3 A;  4MPF A;  3GUR A;  2H8L A;  2GQM A;  1TRS A;  3US3 A;  1EGR A;  4I97 A;  4KSM A;  5B8A A;  3UVT A;  2YWN A;  2MMN A;  2YZU A;  4ZB6 A;  1AW9 A;  1GTI A;  1UC7 A;  2H0H A;  4HZ2 A;  3A5I A;  1WRY A;  2XBQ A;  4OO5 A;  3BBY A;  4MH2 A;  3C71 A;  1K0C A;  2H6Y A;  3KTL A;  2VCQ A;  1DUG A;  3FHK A;  3KEB A;  1WJK A;  3GTU A;  4RI6 A;  1NSW A;  2IWT A;  3QDN A;  2LRT A;  1OC8 A;  2Z9S A;  4HS1 A;  3APO A;  2DJK A;  2CVB A;  5C00 A;  1PA3 A;  2LKU A;  1SL0 B;  2CAI A;  2LUS A;  2R2J A;  5IMZ A;  3CXG A;  2IPA A;  4X43 A;  3QOU A;  4ML6 A;  2HZF A;  1XWK A;  4IP1 A;  3NOF A;  3DRN A;  2OBK A;  3FR3 A;  4TR1 A;  4HZ4 A;  4HQS A;  4MF7 A;  4KDY A;  4X1U A;  5CO3 A;  4IP6 A;  2GGT A;  3E3E A;  4ISD A;  1W4V A;  5INY A;  5CYY A;  2B7K A;  1FOV A;  3NZN A;  13GS A;  4MJA A;  1O85 A;  5KN0 A;  2VL2 A;  2PUK C;  1V98 A;  3GN3 A;  3IOS A;  1A8Y A;  1X5C A;  3GNJ A;  4XRA A;  3TJG A;  3VWX A;  1GLP A;  1N8J A;  2H1D A;  4FIW A;  4I6X A;  3VI5 A;  3UL3 A;  1GWC A;  4ICY A;  4ZL7 A;  3O3T A;  2V6K A;  4MCU A;  2QKE A;  3UEM A;  1M9A A;  5H5Q A;  4GXZ A;  3S9F A;  4Q5F A;  2YNX A;  5B6M A;  2CT6 A;  2HYX A;  4CW9 A;  4BPY A;  2FD3 A;  1F9M A;  3HZ4 A;  2GQK A;  5ELA A;  2LTK A;  4RQX A;  2EIO A;  2I81 A;  5HFK A;  3UAP A;  1PGT A;  2HRF A;  17GS A;  2BMX A;  4N0Z A;  2C8U A;  4PUA A;  3TKP A;  4N30 A;  4E8E A;  1JHB A;  4TVE A;  3UOM A;  3F4R A;  1VF4 A;  1FVK A;  1V40 A;  1EP7 A;  1K0D A;  2PBJ A;  1MD4 A;  3W8J A;  1AQX A;  4IQA A;  2IL3 A;  2EC4 A;  4K6X A;  1PL1 A;  5IOW A;  3H8Q A;  3P8W A;  1B48 A;  2R5G A;  1M2D A;  3VI7 A;  2K8S A;  1G7O A;  2IMD A;  3ZIJ A;  4AF2 A;  2MMZ A;  1X9M B;  4JED A;  1BYE A;  5HFI A;  5ENU A;  2OE0 A;  1ZGN A;  2F3M A;  2V2G A;  3FZA A;  4F0B A;  2XC2 A;  1K3Y A;  2OAC A;  4AJ6 A;  3FW2 A;  2X8C A;  3MNG A;  1WE0 A;  5G30 A;  4WBJ A;  2CAQ A;  1GSD A;  3FRC A;  5E59 A;  4OFT A;  4CY6 A;  4L5L A;  1UN2 A;  2JAD A;  2GQL A;  3M1G A;  8GSS A;  4ZBB A;  1N2A A;  2CA8 A;  3L78 A;  2R4V A;  1H4O A;  1EEM A;  3WYW A;  3D6I A;  4GWR A;  4MJC A;  2H0I A;  3DD3 A;  2OE1 A;  2WB9 A;  1YZX A;  4K2D A;  1O73 A;  5ECK B;  2C0E A;  3FZ9 A;  3F63 A;  3TJB A;  1ACV A;  2LRC A;  5DJM A;  1SEN A;  1UVZ A;  1YEP A;  1JLW A;  4V1A p;  5ECP B;  2F8A A;  3F3Q A;  1SYR A;  4TR3 A;  2OAD A;  4LL1 B;  5D96 A;  2H74 A;  4KAE A;  3DGQ A;  5IQY A;  4QL7 A;  5G2Z A;  2KHP A;  3PH9 A;  1PRX A;  5ECN B;  5D9T A;  3M3M A;  3A3T A;  4GQF A;  2GZZ A;  3IR4 A;  3QAV A;  1X5E A;  1TRU A;  4JZQ A;  2B6M A;  3GH6 A;  5ABR A;  4L8E A;  3IV4 A;  1OE8 A;  4JBB A;  1QK8 A;  2OJL A;  2CX4 A;  2VL2 C;  1WOU A;  3C73 A;  4EL1 A;  4WBR D;  3VK9 A;  4FYB A;  4J56 E;  2VD1 A;  2AV4 A;  3LEF A;  3C8E A;  2M46 A;  2DKH A;  2KOK A;  4K1F A;  2PPT A;  1ZL9 A;  2YAN A;  2ES7 A;  1PX7 A;  3KM6 A;  1EWX A;  2E2G A;  3EMP A;  4ILF A;  4XS6 A;  5D9V A;  1XBS A;  4O5R A;  2PVQ A;  4LMW A;  5JCG A;  2ZCT A;  5ECO B;  3V1W A;  2YOI A;  1B9Y C;  4AJ7 A;  1YF0 A;  4I8B A;  4F0C A;  5ECQ B;  3MIX A;  4ZXG A;  4OWY A;  2G2Q A;  4XCS A;  3F6D A;  2M72 A;  4OMV A;  4PQI A;  9GSS A;  3CTF A;  3FY7 A;  4IEL A;  3E0U A;  2WCI A;  1Y6E A;  2KUC A;  1GSF A;  4POB A;  5A4V A;  2GLR A;  4HUA A;  3ZYW A;  5H5R A;  4IN0 A;  3L4N A;  1PQN A;  2HZE B;  5ELG A;  3ZML A;  3L9V A;  3SBC A;  4ZIL A;  4H86 A;  2LJR A;  1M99 A;  2DMM A;  2VD0 A;  1EP8 A;  4EO3 A;  3R2Q A;  4IVF A;  3GH9 A;  2HE3 A;  3W8S A;  20GS A;  1ZCP A;  2B1K A;  3TCO A;  4OFN A;  4K7N A;  2NDO A;  3TOT A;  5IMV A;  2DIY A;  2FWH A;  1WMJ A;  4ULX A;  4OO4 A;  2MBT A;  1A2M A;  2XHF A;  3N9J A;  4K7O A;  1GTA A;  2TIR A;  2HNL A;  3KP8 A;  4EIP A;  3HVS A;  1MEK A;  5IIZ A;  4LMV A;  1HQO A;  1TU8 A;  1BG5 A;  1U88 A;  2IIY A;  3TUE A;  1G6W A;  2A2R A;  2UZ8 A;  5A5K A;  4KB3 A;  3RPP A;  1NHO A;  1HD2 A;  4IGJ A;  3CMI A;  1EOH A;  3KGK A;  4OCE A;  4JR6 A;  5CNW A;  2QGV A;  4N11 A;  5G1L A;  2PN8 A;  4GSN A;  3GKK A;  4POL A;  3UMA A;  3EU4 A;  3KH7 A;  4CHS A;  3Q19 A;  4MZC A;  3G9B A;  3APS A;  5HR2 A;  5JCU A;  2A2P A;  5H5S A;  4FQU A;  2HZE A;  2AHE A;  4L0U A;  4XIH A;  2N5B A;  2RM6 A;  2RLI A;  5DBQ A;  1O8X A;  1XWA A;  5GAN D;  2B7J A;  3RHC A;  2VL9 A;  1V58 A;  4G0K A;  3RHB A;  1X9S B;  2B3S A;  1PN0 A;  4G9H A;  2GSQ A;  3SWL A;  3PR8 A;  1WIK A;  2O85 A;  3LXT A;  4KDX A;  5KN2 A;  1EV4 A;  4TN8 A;  2D2Z A;  4TR0 A;  2JL4 A;  4IJI A;  3TJJ A;  3GX0 A;  2N5F A;  1VGL A;  2OBI A;  3KCM A;  5ECR B;  1ZZY A;  4I5Q A;  5LNK e;  2B5Y A;  1OKD A;  1J08 A;  2C0D A;  3LW9 A;  3QCP A;  2H76 A;  3LJR A;  3KH9 A;  2LQQ A;  4MZW A;  4HJ2 A;  4NAX A;  1SK0 A;  2DBC A;  3HD5 A;  4G2E A;  3F4S A;  2H75 A;  2I3Y A;  3EC3 A;  4V2N A;  5E4W A;  4GLT A;  2FCH A;  2HFD A;  4K0N A;  1F37 A;  2OKA A;  1F3B A;  2JAC A;  4IBP A;  2H01 A;  1NW2 A;  2X8H A;  2ON7 A;  2VOC A;  3IAS 2;  4BVY B;  6GST A;  5FHI A;  2R37 A;  5F8B A;  5JCW A;  5D8I A;  4ZBD A;  1JZD A;  3EYT A;  2L6D A;  3JCM L;  2FLS A;  2QA1 A;  4KA0 A;  2HSY A;  2FA8 A;  4NHW A;  4N0V A;  3EPT A;  4YQU A;  1AXD A;  2A4V A;  5L71 A;  2FA4 A;  1BED A;  4LL4 B;  1TI3 A;  5F0G A;  1A2L A;  2PVO C;  1EOG A;  1T4Z A;  2PGT A;  4XTS A;  4NWY A;  4GTU A;  1GP1 A;  2F51 A;  1Z7P A;  2WJU A;  4TW5 A;  4ZBA A;  1AUC A;  3QFA C;  4FYC A;  3HDC A;  2HRN A;  2HXK A;  4V1A g;  4Z7X A;  3UIW A;  1TK8 B;  3R3E A;  1J0F A;  4DSQ A;  2H1G A;  6GSU A;  3LYK A;  1EEJ A;  4AGS A;  1ML6 A;  1M7T A;  5DJL A;  1G0T A;  1R7H A;  5DDL A;  3GYK A;  1GNE A;  2VL3 A;  3KMN A;  3C7M A;  3P90 A;  3M9J A;  2KP2 A;  3H4K A;  1SJZ A;  3PGT A;  4KX4 A;  2LJK A;  1V57 A;  2V1M A;  3WT1 A;  4ML1 A;  4IKH A;  1YDK A;  5GZZ B;  2YCD A;  6GSV A;  2B5X A;  5ECM B;  2L4C A;  2GT5 A;  5C04 A;  3QAW A;  2JSY A;  4HOJ A;  3HJM A;  1K0O A;  2CV4 A;  1YQ1 A;  1Y25 A;  4KGI A;  4LA1 A;  1ERV A;  1PX6 A;  4BVY A;  1BX9 A;  4K5S A;  3KZQ A;  3ME7 A;  5AN1 A;  1K0A A;  4GSS A;  4MPG A;  5ID2 B;  3MAK A;  3J7Y k;  1SU9 A;  2JSZ A;  1IYH A;  1TJD A;  1Z3E A;  2TRX A;  1GTU A;  3CSI A;  4EXJ A;  2DJ0 A;  3L9U A;  4MDC A;  1ZOF A;  4V2M A;  2O89 A;  1YKA A;  2X49 A;  3J7Y b;  2X64 A;  3KD0 A;  2YP6 A;  5KEJ A;  2O87 A;  3A5W A;  2WGR A;  4N10 A;  2PU9 C;  4EVM A;  3BD2 A;  3E9J B;  5JWQ B;  2RM5 A;  2P5R A;  4POK A;  2ALB A;  5IO0 A;  1R5P A;  4GQC A;  1Q4J A;  2ON5 A;  4BA7 A;  5BMU A;  6GSX A;  3GHA A;  3VLN A;  1R5A A;  1S3C A;  1Z9H A;  1XPV A;  1GNW A;  4NV5 A;  4Z2U A;  1V9W A;  3HVV A;  3Q6O A;  1F6M C;  2J9H A;  2HI7 A;  2L4Q A;  5HFG A;  4Q5R A;  5DVB A;  3QAG A;  1SYX A;  4ZIJ A;  1KTE A;  1TXX A;  4P3Y B;  3LYP A;  5KOW A;  2H19 A;  3DVW A;  2FWF A;  2FWG A;  5GAP D;  4XHM A;  1FO5 A;  2GS3 A;  1SK1 A;  5ID2 A;  1A23 A;  3APQ A;  2AAW A;  3D4M A;  2ZUP A;  2GST A;  4ECB A;  1VF3 A;  3FMW A;  4QL9 A;  1FW1 A;  1OKT A;  2R0P A;  4KND A;  2GSS A;  5IPG A;  1FHE A;  3TB2 A;  4BWQ A;  4BWS A;  4YKG A;  1I5G A;  3L9S A;  3IE3 A;  1NHY A;  2NPB A;  2MMA A;  1GUM A;  4ACS A;  1QQ2 A;  3HJP A;  2RUF A;  1B8X A;  1Z5Y E;  3VWW A;  4WXT A;  2X4A A;  1XW6 A;  4PQ1 A;  1THO A;  1SKS B;  3ZRE A;  2DJ2 A;  2WDU A;  4OFM A;  2GVP A;  4HEA 2;  1YKC A;  2F8F A;  1A24 A;  3FZ4 A;  3PIN A;  3CRU A;  3CTG A;  3FZ5 A;  2IJY A;  2P0G A;  4YQM A;  4IQ1 A;  1ERW A;  1XVQ A;  2FHE A;  3M0F A;  4EC0 A;  5ECS A;  2DKI A;  5IMA A;  1GUK A;  5IPH A;  2HRK A;  3ERW A;  5F06 A;  4MJE A;  1IYI A;  2DJJ A;  4O5Q A;  3KMO A;  2WZ9 A;  1U87 A;  2WUL A;  4NMU A;  2HSM A;  4MJB A;  2M80 A;  2DIZ A;  2H30 A;  2B1L A;  5BRT A;  1OYJ A;  4I2T A;  4JE1 A;  3TRX A;  5FT3 A;  3ZFL A;  3VPQ A;  2HSH A;  1GTB A;  3I6A A;  2VLT A;  5HR3 A;  1TRV A;  3GRX A;  1GH2 A;  2GZP A;  2A4H A;  1TTZ A;  2XPE A;  2AJQ B;  1J9B A;  1PKZ A;  4DSR A;  1XZO A;  3IA1 A;  3IDV A;  1OC3 A;  3UJ1 A;  1WP0 A;  4XS4 B;  2MMO A;  3CSJ A;  4RI7 A;  4NXI A;  1JFU A;  22GS A;  1GL8 A;  4TXV A;  3EVI A;  2C0F A;  1T4Y A;  4GF0 A;  4EUY A;  4GCI A;  4MLY A;  1M2B A;  1AQV A;  2FY6 A;  4KUN A;  1S3D A;  4IS0 A;  3DVX A;  2PER A;  4ZB8 A;  2DSA A;  1RK4 A;  2YV9 A;  5B7C A;  4USS A;  3HZ8 A;  3TJF A;  3HKR A;  2VIM A;  2LNT A;  2VCV A;  2QC7 A;  3ERF A;  1ZYQ B;  1A0F A;  19GS A;  3MYD A;  4HJM A;  2O8V B;  3WGD A;  2RII A;  3IK7 A;  5B6N A;  2HLS A;  5A4W A;  5AIS A;  3QPM A;  3ME8 A;  4A5P A;  2K8V A;  2TRC P;  4J57 E;  2VCZ A;  3VWU A;  3BOA A;  4KE3 A;  5D73 A;  1UA5 A;  3M9K A;  16GS A;  4PUR A;  10GS A;  1SKW B;  2K6V A;  5J9B A;  4F03 A;  3Q74 A;  5CRE A;  5A4U A;  4K2X A;  1Z7R A;  1GUL A;  3KJY A;  1FAA A;  4XS4 A;  3A2V A;  1FB0 A;  1PL2 A;  2V32 A;  1XWC A;  3HYP A;  1U3I A;  2K18 A;  3VFI A;  1QUW A;  5KOX A;  1HNB A;  2H72 A;  3GST A;  1EZK A;  3TKR A;  2LJA A;  3EUR A;  2IN3 A;  2QSI A;  3KP9 A;  2WRT A;  1URM A;  3LSZ A;  1PSQ A;  3GX8 A;  4CY8 A;  1ST9 A;  1JZR A;  1I9D A;  5ECL B;  2VM2 A;  4O92 A;  2HRA A;  4RQR A;  2R0G A;  2LRN A;  2VLV A;  4TRX A;  5CRD A;  3WD6 A;  4DSS B;  3MDK A;  1GUH A;  3G7I A;  1VF1 A;  3GMF A;  1HNC A;  3IAM 2;  5D9W A;  2FNO A;  4K0G A;  4KW6 A;  1TW9 A;  1B4P A;  3CRT A;  1FVJ A;  4XRD A;  1ZMA A;  6GSW A;  2DLX A;  3TGZ A;  2KP1 A;  1ABA A;  3F0I A;  4KCE A;  3DWV A;  1YJ6 A;  3O6T A;  3UBL A;  1T7P B;  4GRF A;  3IPZ A;  4PNG A;  1S3A A;  2VCX A;  4V2L A;  3UBK A;  1GSE A;  4PGT A;  5AGY A;  3ZFB A;  1XOA A;  4FYU A;  3LWA A;  2JU5 A;  1ERU A;  2X8G A;  3CBU A;  3GIX A;  2FWE A;  4G0I A;  4MAB A;  1BQ7 A;  2YJ7 A;  4YAV A;  1FB6 A;  4KH7 A;  1O8W A;  2FUG 2;  4WEY A;  1M9B A;  2P5Q A;  7GSS A;  1YF1 A;  4EE0 A;  5J3R A;  4MNN A;  2JZR A;  3EU3 A;  3F4T A;  4E8H A;  5G31 A;  2XPD A;  1OE7 A;  1FG4 A;  5D93 A;  1GSS A;  1X9W B;  3LQ7 A;  3QD9 A;  1TK0 B;  2C1Y A;  5HQP A;  2C0G A;  1OC9 B;  3ERG A;  5IM9 A;  2R0C A;  3H93 A;  4DSS A;  4GST A;  1EGO A;  3DKS A;  3ISO A;  1PMT A;  5FWG A;  5DAL B;  4PNF A;  3D0Z A;  3W6G A;  4QQ7 A;  3BCI A;  1AIU A;  3TOU A;  4O7H A;  1ON4 A;  4IJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...