2LJAA

Solution structure of a putative thiol-disulfide oxidoreductase from bacteroides vulgatus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
152
Chain Sequence
b'MSLRSGNPSAASFSYPDINGKTVSLADLKGKYIYIDVWATWCGPCRGELPALKELEEKYAGKDIHFVSLSCDKNKKAWENMVTKDQLKGIQLHMGTDRTFMDAYLINGIPRFILLDRDGKIISANMTRPSDPKTAEKFNELLGLEGHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative thiol-disulfide oxidoreductase
publication title Solution Structure of a putative thiol-disulfide oxidoreductase from Bacteroides vulgatus
rcsb
source organism Bacteroides vulgatus
molecule tags Structural genomics, unknown function
total genus 47
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ljaA00
1YQ1A 4WR5A 2KOKA 3D4TA 3ZREA 2BTOT 3RAZA 2CAIA 3EVIA 4EL1A 4YAPA 4EC0A 2GSSA 1QFNA 1GSQA 3MNGA 3TB2A 5D96A 1TK0B 1XVWA 4F0CA 4GWRA 5A4UA 4IBPA 1GNWA 2GQKA 3GX0A 10GSA 5D8IA 2VO4A 3UL3A 4KA0A 4DSSB 4KH7A 2LNSA 4LL4B 2LRTA 3TJGA 4OCEA 12GSA 2FY6A 5DALA 5G31A 2C80A 4MA9A 3M8NA 3UARA 4POBA 2B5EA 1QMVA 1GSDA 1OC9B 3FK8A 3KJYA 1XWGA 3KH7A 3ZVJD 3PINA 1ML6A 2AB6A 1MDJA 4JR4A 1PD21 3HHVA 1B8XA 4O7HA 1TK8B 1F3BA 1F9MA 1XFLA 2GLRA 4GTUA 4IGJA 4MJBA 3W8JA 4BL7A 1XPVA 4NPBA 5ECKB 4RUVA 4KGIA 1U88A 1T3BA 5LNKe 2RIIA 3VFIA 4KSMA 1B9XC 2XPDA 1NW2A 4NXIA 1YF0A 5KN0A 2LSTA 4HU9A 2H73A 3EYTA 1FOVA 4GCIA 1E6BA 3IK9A 2L5LA 3G9BA 4WBRD 5G1KA 2YOIA 2C3NA 3FZAA 1NM3A 2HE3A 1WOUA 2JZTA 4F2IA 4NV5A 3I9V2 1DBYA 3IC4A 4K1FA 4XCSA 1OYJA 3LWAA 4AJ7A 5J41A 1QQ2A 4MF7A 1GLQA 4RI6A 1FB0A 3EMXA 2E7PA 2GQMA 2F8AA 3VWXA 3KP9A 4DSRA 3IA1A 1PX6A 4K6XA 3HKRA 2K9FA 3RPPA 1WP0A 3ZIJA 5ABRA 2O89A 5JWOB 1SJIA 3GHAA 2K6VA 1GL8A 1XCCA 5DQSA 2WDUA 3F6FA 4ZBDA 2LKUA 1WIKA 2FHEA 1T1VA 3VPQA 3GH9A 4HZ4A 2HXKA 4KE3A 5FHIA 1JHBA 1VF1A 2YP6A 3GSSA 3HY2A 2VCQA 4K2DA 4EE0A 4EVMA 2CZ3A 5CRWA 1MD3A 4OO5A 1FVKA 3A5WA 3GYKA 4ZL7A 1GLPA 2CAQA 1J0FA 2H1DA 1T00A 3GSTA 5CP1A 5H5RA 3F63A 2PN8A 4KB3A 2HSYA 1YDKA 5IPGA 1K0AA 1YY7A 5EY6A 3D6IA 4KAEA 3J7Yb 2ON5A 4J57E 2CA8A 1TP9A 1NSWA 3W6GA 2YNXA 5B6NA 4BWQA 3GN3A 3NIVA 4ACSA 2N5AA 1ABAA 5J5NA 2K8SA 2WS2A 3QCPA 3HVVA 4YAVA 4RI7A 4Z7XA 4WR4A 1PN9A 1F2EA 4XS1A 4YQMA 2ALBA 3QR6A 1T7PB 2CX3A 1EEMA 3UVHA 3TKPA 1SK0A 5ECRB 3TCOA 1Q98A 4LLRA 1G7OA 5B6MA 5F0GA 2RLIA 3FR3A 2JU5A 3PR8A 2CZ2A 3TKQA 2HRNA 1Q4JA 3FY7A 3FW2A 2MZCA 5IMDA 5CREA 1EZKA 2PVOC 3Q19A 3VK9A 3IDVA 2VAFA 4ZL9A 1GSFA 1X9SB 4HQZA 2HYXA 1K3OA 3DWVA 3QDNA 2IWTA 1LU4A 1ACVA 3UMAA 5IMVA 4MF6A 1SL2B 3F4SA 1EOGA 3UEMA 4MMMA 4TR4A 2L4QA 4HJMA 3EE2A 2GSRA 1AW9A 2G0FA 2H1GA 2G2QA 2V2GA 4Q5FA 3PH9A 4Q5NA 3HZ8A 5F07A 3BBYA 1ZCPA 3EURA 3O76A 1QGVA 2GVPA 1TRSA 1R7HA 4BA7A 4O32A 2LTKA 4HJ2A 3G7IA 3GRXA 2H76A 2C8UA 2PU9C 1F3AA 1NHOA 4N10A 4TR3A 1AQXA 4TN8A 3C1RA 3L78A 14GSA 2FNOA 3IHQA 2OE1A 5JCWA 1XW5A 2CVKA 3GFKA 4HI7A 1GUMA 3EWLA 1YKAA 4TVEA 3IPZA 2IMIA 3CSJA 5ECNB 1DSBA 2DC5A 3MAKA 2B7KA 3GX8A 4WBJA 2ON7A 3QAGA 2O8VB 3S9FA 1FW1A 1X9WB 3FR9A 3KTLA 2AJQB 3WGXA 2FCHA 1S3DA 4LMWA 4JBBA 5AIXA 5CAXA 1J9BA 5CRDA 1OC3A 3D5JA 2NTOA 2A4VA 1CQGA 2XBIA 4RQRA 3DRNA 1EV4A 3KP8A 1BG5A 3ME7A 5C04A 4D73B 2REMA 4CW9A 2DIZA 4LMVA 2C3QA 3UVTA 3VLNA 2NDOA 1SKRB 1BAYA 1O6JA 3Q6OA 4N30A 6GSYA 4PNFA 1QUWA 2DJKA 4EUYA 4ECIA 2L59A 4K7NA 1PKZA 3F3QA 3LG6A 2A2RA 5G1LA 1VF2A 1TDIA 4EDZA 1V40A 3VURA 1Y25A 3QAWA 4G9HA 2FA4A 2M80A 2MMAA 1JZOA 3BJ5A 5D73A 4K0GA 5KN2A 2LEGA 1GTAA 4ZL8A 3N5OA 3KZQA 2R37A 1OKDA 4TOPA 2GS3A 5IOWA 2O87A 2WFCA 3P7XA 1PKWA 4WKWA 2PGTA 3EINA 1A2MA 1A2JA 4XS4A 1GSSA 1MDKA 4O92A 3TDGA 2DJ0A 1PSQA 4KSOA 2GDRA 4PNGA 2H6XA 5G30A 4OMVA 2LRNA 1LBKA 2NVLA 5DQYA 2EC4A 3LEFA 5IMFA 1DE1A 1XOBA 2V6OA 5DJMA 5IMAA 4ISDA 3H8QA 2KUCA 2PBJA 2RM6A 3CYNA 2HZEA 4JU5A 1XXUA 4BPYA 1X9MB 2L4CA 2OBIA 3VWWA 5KN1A 1GUKA 2IMKA 3OR5A 4NV2A 5CRHA 3L9UA 1GTIA 4KDUA 4OO4A 1RK4A 2H71A 5KN3A 2YZUA 3TOUA 3IK7A 5GAND 1YZXA 4YH2A 4K8MA 1I9DA 2C0FA 3QOUA 1EGRA 4J2FA 5LCZA 2DBCA 3HXSA 4DVCA 1KTEA 1VF4A 2J23A 3LYKA 1WMJA 2IMDA 3GKMA 1V9WA 1B48A 5ENUA 1HQOA 4PQIA 3BCKA 4HUAA 3IE3A 2H19A 3FEUA 2H01A 1SJZA 3CMIA 3GTUB 3MSZA 5DBQA 1X0RA 4CHSA 2HZEB 1XWBA 17GSA 2MMOA 3J7Yk 4I2TA 2OE0A 2H0GA 2IFQA 4L0UA 1M0UA 1ERTA 2MMZA 1GWCA 2RUFA 5GZZB 2DSAA 4IQAA 2IL3A 2YWMA 2KP2A 3ERGA 19GSA 4JEDA 1XOAA 4MZBA 2B3SA 3QPMA 3ZRDA 5IQYA 1PMTA 2VUPA 3ED3A 3FZ5A 5IPHA 3FYGA 3C7MA 5FT3A 1R5AA 1K0OA 1A2LA 1V57A 2LJAA 5ECPB 3W8SA 5GAPD 2YWNA 5G5EA 3DVXA 2KHPA 3H4KA 4TXVA 4F03A 5ID2A 1O73A 2GSTA 2EIRA 4MJEA 5DJLA 3ZFLA 3I6AA 1TU8A 5DALB 2L57A 1T4YA 1I5GA 1PL2A 5JCUA 2VL9A 1F6MC 3CTFA 1TK5B 1SD8A 5A4VA 5F8BA 4I5QA 2DMMA 6GSUA 3VWVA 2LUSA 1CQHA 2LJKA 2PERA 4GLTA 2B1KA 2N5BA 16GSA 3VI5A 5A4WA 2VIMA 5IOXA 4NHWA 2H72A 4OFTA 1U87A 2C0DA 3UBKA 4G10A 3KMNA 3O6TA 4WF5A 3ERFA 1M7TA 3M3MA 2LJRA 4PXOA 1K0MA 2K18A 4YQVA 1O85A 2CQ9A 1SD9A 4IKHA 3HD5A 3HVXA 2HNLA 3N9JA 2P5RA 3NZNA 3EMPA 4JE1A 3TRPA 4KDYA 5D9WA 1MD4A 1UN2A 5ELAA 5DAKA 5D9VA 5H5QA 5AISA 3TKSE 4KNDA 3TJFA 3ZVJA 1K0BA 5CRGA 4PUFC 4JR6A 4GF0A 4HDEA 2QKEA 1KBNA 3F9UA 3SWLA 3QAVA 3GIXA 1U3IA 1O7UA 1SU9A 3GNJA 3GURA 4F82A 4X0XA 2JL4A 2LRCA 2YV9A 3KD0A 4YQUA 3G7YA 3KMOA 3LXTA 2HZFA 1V58A 1FB6A 4MABA 3WD6A 4XRAA 3TUEA 3ME8A 1URMA 3PGTA 3APOA 1M9BA 2VL3A 3VI7A 2VLVA 3CTGA 3D0ZA 1Z7RA 1B9YC 1WJKA 3DD3A 2OE3A 1WWJA 5B8BA 1AXDA 1SK2A 3KCMA 3TJJA 3DIEA 2LNTA 4OFNA 5IIZA 3DKSA 6GSVA 2CT6A 5EL8A 4IP1A 2L5OA 3I69A 1B4PA 2JSYA 1OAZA 1NHYA 3F4RA 2NBSA 3EU3A 5H5SA 3ZZXA 3GKNA 2F3MA 4V2NA 2IMEA 2TRCP 1ZL9A 2P5QA 5J9CA 2B7JA 2P31A 9GSSA 4E8HA 4ZXGA 3GV1A 4IQ1A 1DUGA 4L5LA 1SYXA 3TKSC 4GXZA 1TRWA 1TW9A 5J9BA 1U3AA 3HYPA 5FWGA 2MYGA 4FH8A 2A2SA 2X8GA 2HRFA 1M2AA 2YWOA 5DCHA 1XW6A 2HLSA 4NMUA 2B5YA 4KCAA 2R5GA 3M1GA 3ZMKA 1GULA 1JZWA 2I3YA 1JZDA 1TI1A 6GSTA 2DMLA 2O85A 4NAXA 2C3TA 1AQVA 2V1MA 2FWFA 2VLUA 1G6WA 1M2BA 3Q74A 2MBTA 2YPMA 2DJJA 1WRYA 1TTZA 1Z6MA 1EOHA 4OCFA 3TGZA 4I2UA 1ERWA 1GSEA 2LS5A 1TRUA 2YV7A 3L4NA 2FWHA 3UBLA 3AY8A 1XWAA 4DSQA 1IYIA 3HZ4A 5HR1A 4FYBA 4CDOA 1OE7A 1O81A 4ID0A 2B6MA 3CBUA 4IHUA 4IW9A 4TR1A 1BQ7A 4N11A 5IO0A 3KTBA 2FA8A 1JZRA 3L9VA 2E2GA 2VL2C 2C0EA 5IO2A 2TRXA 2OJLA 3C73A 1EV9A 3IXRA 4AJ8A 2AUVA 2WRTA 4MJAA 5J4UA 1XW9A 2WULA 4EXJA 3HJPA 1A0RP 1YJ6A 2JZSA 5HFIA 3ZIVA 1A0FA 5JWRB 4XRDA 1JLVA 3BOAA 2KLXA 1H75A 1B4QA 1OKTA 1Z3EA 5D9TA 1SK1A 5A5KA 1YEPA 2H6ZA 4I97A 3P8WA 1QK8A 1YF1A 4TW5A 2I4AA 1F37A 1SJ6A 4TR1B 1OE8A 3A2XA 3ZTLA 4IJIA 4V2LA 2R3XA 3HJOA 3TKSA 1RW1A 1PQNA 3TJKA 3C1SA 3WGEA 2X8HA 5HR3A 4TXOA 4MLYA 3BCIA 3CRTA 4MJCA 5KEJA 1A8YA 2C1YA 2MMNA 3E9JB 3LYPA 2OKAA 4F9ZA 3LXZA 1M99A 4HZ2A 1VRSD 3F8UA 2LV3A 2BMXA 1Z6NA 2H30A 1GRXA 3LFLA 4ZBAA 3P90A 2HI7A 3ZL5A 1AIUA 3KM6A 3RBTA 3UAPA 4K9ZA 4GSTA 4QL7A 2F9SA 1ST9A 1V98A 3FR6A 1R4WA 2CX4A 2ZNMA 3FRCA 3V1WA 1SL0B 3RHCA 5F05A 3F4TA 4HU7A 1GSYA 4OFMA 3FKFA 4J56E 5DDLA 2GSQA 2X8CA 1KEBA 3I43A 5DVBA 3K8NA 1IYHA 1PGTA 2O7KA 2TIRA 2VL2A 2X99A 3FZ9A 3BD2A 4WF4A 2DJ1A 1A8LA 3IV4A 4I6XA 4EKZA 1BX9A 1ZMAA 1RQMA 2VOCA 3RPNA 1OVNA 2YJHA 5D9XA 3IR4A 1BJXA 3Q18A 4QQ7A 4BWSA 5COHA 2QSIA 2FGXA 1PA3A 3VWUA 5AN1A 3DEXA 5B8AA 2WB9A 5GSSA 3DMLA 4AGSA 1TRVA 3WGDA 3C71A 5ECMB 2VCZA 2VCVA 4XS4B 1OC9A 5ELGA 6GSWA 3KEBA 1EP7A 3L9SA 1EP8A 2IMFA 3ZLPA 3P2AA 1VGLA 5E4WA 4V1Ag 3RDWA 1K0DA 1K3YA 3D22A 4L0WA 4MCUA 2OACA 3CRUA 1YKCA 4AJ6A 2H75A 1MTCA 1JLWA 2B5XA 3DYRA 1GSUA 2FWEA 2IIYA 2V6KA 2PWJA 3FHKA 4PQ1A 1TOFA 4FO5A 4FYCA 1HNAA 5CO3A 5B7CA 4V1Ap 2IN3A 4IELA 2GZZA 3A2VA 1C72A 1SYRA 3US3A 4GQFA 4F0BA 3M9JA 4ZB9A 1R5PA 4MF5A 2E0QA 3ZMLA 1W4VA 2FLSA 4O5RA 3WT2A 4P3YB 1ZGNA 2H74A 1FG4A 1EWXA 2D2ZA 5ECSA 1HNCA 3D21A 1AQWA 2CV4A 1S3AA 3WT1A 4KX4A 2XPEA 1K3LA 4G2EA 5EVOA 3JCML 4H86A 4ZILA 2JZRA 3NOFA 1THXA 2AHEA 2IFQB 1Z7PA 2XBQA 3DXBA 2GZPA 3LJRA 5CNWA 4NHZA 4OD7A 1JFUA 5CYYA 1THOA 5ECHB 2EIOA 4KUNA 5G2ZA 4K0NA 4JZQA 3IBHA 1X5DA 1ZYEA 3EC3A 4WEYA 3LSZA 4JRRA 1N8JA 1O8XA 4GQCA 3CXGA 4EF0A 3H1NA 2PPTA 3DVWA 4ML6A 3A3TA 1XBSA 2X64A 2MBSA 4K7IA 3ZITA 4POMA 5F06A 2AYTA 1H4OA 4XTSA 4ECJA 2WZ9A 2YWIA 3EU4A 1AC1A 3ZFBA 2JADA 2F8FA 5ID2B 3GH6A 4IVFA 4MH3A 1TXXA 1GUHA 2P0GA 2C0GA 2H66A 2CVBA 2OBKA 1TKDB 2R2JA 1AUCA 1ZZYA 4N0ZA 3TRQA 2VCTA 5ECOB 2XHFA 1WPIA 2VM2A 1ERUA 5J3RA 2XC2A 2RM5A 3KH9A 5E59A 1T8EB 3DGQA 4PUAA 1R26A 1A24A 1Z5YE 2OADA 3E0UA 4MZCA 3UOMA 2PUKC 3IOSA 5IM9A 1XIYA 1TJDA 1WE0A 4Q5QA 5ECQB 5C00A 1AAZA 2OA7A 1QXHA 1Z9HA 2VM1A 3ZYWA 3CSHA 2GTUA 3UIWA 2JSZA 3LGCA 3UJ1A 1W89A 1GTUA 3GA4A 2ES7A 6GSXA 1FHEA 2R4VA 5DAKB 2PVQA 5IMZA 3CSIA 3FZ4A 2Z9SA 5IMCA 1FO5A 7GSSA 4ZB8A 4I8BA 4PURA 3GL5A 1E2YA 1XWKA 2VLTA 1T4ZA 3H79A 5JCGA 1ON4A 2HFDA 5HR2A 4MK3A 2QC7A 2YANA 1HD2A 4FIWA 3H93A 4IN0A 2HT9A 4ILFA 4KW6A 3D4MA 1LJRA 3QD9A 4BVXA 5L71A 1PX7A 1UVZA 4EDYA 1O8WA 5AGYA 2FUG2 5INYA 3IRAA 5DCGA 4L8EA 2I1UA 4LA1A 4TR0A 18GSA 3HJMA 2LQQA 3F0IA 1U6TA 2GQLA 11GSA 2VD1A 4NWYA 1GTBA 1HYUA 4IS0A 3TRXA 2WJUA 2H1AA 1G7EA 4HS1A 1UC7A 3KGKA 1YEXA 1K0NA 3HCZA 4ZBBA 4DEJA 3GL3A 3U5RE 1A23A 1GP1A 6GSSA 2M72A 3LQ7A 1N2AA 4QL9A 2F51A 1M2DA 4HEA2 4BVYA 2CVDA 5G5FA 4MPGA 3M0FA 2GZYA 4MPFA 1SENA 4V2MA 2DIYA 1SKSB 1ILOA 4IJ3A 3HA9A 2VCXA 5HQPA 2YN1A 2FD3A 4LL1B 2ZCTA 4XHMA 5EPFA 4X43A 4AF2A 8GSSA 1DE2A 3WYWA 5HFGA 1UA5A 3LORA 4KCEA 1ERVA 1USBA 2K8VA 3TOTA 2AV4A 2DLXA 1GNEA 4ECCA 4PX1A 3F6DA 1EEJA 2IJYA 4XIHA 1G0TA 1TU7A 3ISOA 4HOJA 4MP4A 4FYUA 1PL1A 2R6KA 5ECIB 1BEDA 4D73A 3ERWA 2H70A 3TKRA 3TJBA 4X1UA 4ECBA 3O3TA 3MWHA 4TKYA 2IPAA 2VD0A 1EGOA 3L0HA 2GT6A 2H0HA 2V32A 3GKKA 4WXTA 1SL1B 1FVJA 1HNBA 4EO3A 4TRXA 1XVQA 2JACA 5JWQB 3IAM2 1XZOA 5HFKA 3KIJA 4WETA 2WGRA 2E2MA 2ZUPA 2C4JA 13GSA 2DJ3A 2V41A 3E3EA 4PGTA 4GRFA 1Y6EA 1J08A 4POKA 1ZYQB 4ML1A 2GT5A 1OC8A 3MDKA 1K0CA 4RQXA 3GKXA 2YJ7A 2AAWA 1TI3A 3HVSA 2B1LA 4MDCA 3KXOA 2H8LA 1X5CA 3M9KA 4Q5RA 1M9AA 1FAAA 1MDIA 2H6YA 2EIQA 4OWYA 3U6VA 2QGVA 1G6YA 1V2AA 20GSA 4ZB6A 4IP6A 1XWCA 2H0IA 2N5FA 4ZIJA 2VCWA 5ECLB 1GH2A 4GSNA 3QMXA 3G7JA 2J9HA 2BJXA 3SBCA 4PQHA 3APQA 4GSSA 4N0VA 22GSA 2I81A 4XS6A 1S3CA 1X5EA 5HR0A 2RUEA 2KP1A 2NPBA 4TXOB 4G19A 3RHBA 4MH2A 3APSA 4POLA 3GUSA 4KDXA 2PMTA 4E8EA 2M46A 1PRXA 3HDCA 4HQSA 3VPTA 2L6DA 3GMFA 3QFAC 1VF3A 1SKWB 3IAS2 4L5OA 2LQOA 5LD0A 1BYEA 1KNGA 3F3RA 5AIVA 4K7OA 2YZHA 4MZWA 4DSSA 2YCDA 5GSTA 2H1BA 2DJ2A 4ULXA 2I9HA 1ZOFA 2FWGA 2GGTA 5D93A 2L6CA 3QFBC 3R2QA 3A2WA 3C8EA 3GTUA 1MEKA 2WCIA 2HSHA
chains in the Genus database with same CATH superfamily
1YQ1A 4WR5A 2KOKA 3D4TA 3ZREA 2BTOT 3RAZA 2CAIA 3EVIA 4EL1A 4YAPA 4EC0A 2GSSA 1QFNA 1GSQA 3MNGA 3TB2A 5D96A 1TK0B 1XVWA 4F0CA 4GWRA 5A4UA 4IBPA 1GNWA 2GQKA 3GX0A 10GSA 5D8IA 2VO4A 3UL3A 4KA0A 4DSSB 4KH7A 2LNSA 4LL4B 2LRTA 3TJGA 4OCEA 12GSA 2FY6A 5DALA 5G31A 2C80A 4MA9A 3M8NA 3UARA 4POBA 2B5EA 1QMVA 1GSDA 1OC9B 3FK8A 3KJYA 1XWGA 3KH7A 3ZVJD 3PINA 1ML6A 2AB6A 1MDJA 4JR4A 1PD21 3HHVA 1B8XA 4O7HA 1TK8B 1F3BA 1F9MA 1XFLA 2GLRA 4GTUA 4IGJA 4MJBA 3W8JA 4BL7A 1XPVA 4NPBA 5ECKB 4RUVA 4KGIA 1U88A 1T3BA 5LNKe 2RIIA 3VFIA 4KSMA 1B9XC 2XPDA 1NW2A 4NXIA 1YF0A 5KN0A 2LSTA 4HU9A 2H73A 3EYTA 1FOVA 4GCIA 1E6BA 3IK9A 2L5LA 3G9BA 4WBRD 5G1KA 2YOIA 2C3NA 3FZAA 1NM3A 2HE3A 1WOUA 2JZTA 4F2IA 4NV5A 3I9V2 1DBYA 3IC4A 4K1FA 4XCSA 1OYJA 3LWAA 4AJ7A 5J41A 1QQ2A 4MF7A 1GLQA 4RI6A 1FB0A 4Z2RA 3EMXA 2E7PA 2GQMA 2F8AA 3VWXA 3KP9A 4DSRA 3IA1A 1PX6A 4K6XA 3HKRA 2K9FA 3RPPA 1WP0A 3ZIJA 5ABRA 2O89A 5JWOB 1SJIA 3GHAA 2K6VA 1GL8A 1XCCA 5DQSA 2WDUA 3F6FA 4ZBDA 2LKUA 1WIKA 2FHEA 1T1VA 3VPQA 3GH9A 4HZ4A 2HXKA 4KE3A 5FHIA 1JHBA 2HSMA 1VF1A 2YP6A 3GSSA 4K5SA 3HY2A 2VCQA 4K2DA 4EE0A 4EVMA 2CZ3A 5CRWA 1MD3A 4OO5A 1FVKA 3A5WA 5KOWA 3GYKA 4ZL7A 1GLPA 2CAQA 1J0FA 2H1DA 1T00A 3GSTA 5CP1A 5H5RA 3F63A 2PN8A 4KB3A 2HSYA 1YDKA 5IPGA 1K0AA 1YY7A 5EY6A 3D6IA 4KAEA 3J7Yb 2ON5A 4J57E 2CA8A 1TP9A 1NSWA 3IC8A 3W6GA 2YNXA 5B6NA 4CY8A 4BWQA 3GN3A 3NIVA 4ACSA 2N5AA 1ABAA 5J5NA 2K8SA 2WS2A 3QCPA 3HVVA 4YAVA 4RI7A 4Z7XA 4WR4A 1PN9A 1F2EA 4XS1A 4YQMA 2ALBA 3QR6A 1T7PB 2CX3A 1EEMA 3UVHA 3TKPA 1SK0A 5ECRB 3TCOA 1Q98A 4LLRA 1G7OA 5B6MA 5F0GA 2RLIA 3FR3A 2JU5A 3PR8A 2CZ2A 3TKQA 2HRNA 1Q4JA 4EIPA 3FY7A 3FW2A 2MZCA 5IMDA 5CREA 1EZKA 2PVOC 3Q19A 3VK9A 3IDVA 2VAFA 4ZL9A 1GSFA 1X9SB 4HQZA 2HYXA 1K3OA 3DWVA 3QDNA 2IWTA 1LU4A 1ACVA 3UMAA 5IMVA 4MF6A 1SL2B 3MYDA 3F4SA 1EOGA 3UEMA 1ZYPA 4MMMA 4TR4A 2L4QA 4HJMA 3EE2A 2GSRA 1AW9A 2G0FA 2H1GA 2G2QA 2V2GA 4BVXB 4Q5FA 3PH9A 4Q5NA 3HZ8A 5F07A 3BBYA 1ZCPA 3EURA 4MNNA 3O76A 1QGVA 2GVPA 1TRSA 1R7HA 4BA7A 4O32A 1M3IA 2LTKA 4HJ2A 3G7IA 3GRXA 2H76A 2C8UA 2PU9C 1F3AA 1NHOA 4N10A 4TR3A 1FOHA 1AQXA 4TN8A 1PFOA 3C1RA 3L78A 14GSA 4Z2UA 2FNOA 3IHQA 2OE1A 5JCWA 4BVYB 1XW5A 2CVKA 3GFKA 4HI7A 1GUMA 3EWLA 1YKAA 4TVEA 3IPZA 2IMIA 3CSJA 5ECNB 1DSBA 2DC5A 3MAKA 2B7KA 3GX8A 4WBJA 2ON7A 3QAGA 2O8VB 3S9FA 1FW1A 1X9WB 3FR9A 3KTLA 2AJQB 3WGXA 2FCHA 1S3DA 4LMWA 4JBBA 5AIXA 5CAXA 1J9BA 5CRDA 1OC3A 2QA1A 3D5JA 2NTOA 2A4VA 1CQGA 2R0CA 2XBIA 4RQRA 1M3JA 3DRNA 1EV4A 3KP8A 1BG5A 3ME7A 5C04A 4D73B 2REMA 4CW9A 2DIZA 4LMVA 3A5IA 2C3QA 3UVTA 3VLNA 2NDOA 1SKRB 1BAYA 1O6JA 3Q6OA 4N30A 6GSYA 4PNFA 1QUWA 2DJKA 4EUYA 4ECIA 2L59A 4EIQA 4K7NA 1PKZA 3F3QA 3LG6A 2A2RA 5G1LA 1VF2A 1TDIA 4EDZA 1V40A 3VURA 1Y25A 3QAWA 4G9HA 2FA4A 2M80A 2MMAA 1JZOA 3BJ5A 5D73A 4K0GA 5KN2A 2LEGA 1GTAA 3MIXA 4ZL8A 3CQFA 3N5OA 3KZQA 2R37A 1OKDA 4TOPA 2GS3A 5IOWA 2O87A 2UZ8A 2WFCA 3P7XA 1PKWA 4WKWA 2PGTA 3EINA 1A2MA 1A2JA 4XS4A 1GSSA 1MDKA 4O92A 3TDGA 2DJ0A 1PSQA 4KSOA 2GDRA 4PNGA 2H6XA 5G30A 4OMVA 2LRNA 1LBKA 2NVLA 5DQYA 2EC4A 3LEFA 5IMFA 1DE1A 1XOBA 2V6OA 5DJMA 5IMAA 4ISDA 3H8QA 2HRAA 2KUCA 2PBJA 2RM6A 3CYNA 2HZEA 4JU5A 1XXUA 4BPYA 1X9MB 2L4CA 2OBIA 3VWWA 5KN1A 1GUKA 2IMKA 3OR5A 4NV2A 5CRHA 3L9UA 1GTIA 4KDUA 4OO4A 1RK4A 2H71A 5KN3A 2YZUA 3TOUA 3IK7A 5GAND 1YZXA 4YH2A 4K8MA 1I9DA 2C0FA 3QOUA 1EGRA 4J2FA 5LCZA 2DBCA 3HXSA 4DVCA 1KTEA 1VF4A 2J23A 3LYKA 1WMJA 2IMDA 3GKMA 1V9WA 1B48A 5ENUA 1HQOA 4PQIA 3BCKA 4HUAA 3IE3A 2H19A 3FEUA 2H01A 1SJZA 3CMIA 3GTUB 3MSZA 5DBQA 1X0RA 4CHSA 2HZEB 1XWBA 17GSA 2MMOA 3J7Yk 4I2TA 2OE0A 2H0GA 2IFQA 4L0UA 1M0UA 1ERTA 2MMZA 1GWCA 2RUFA 5GZZB 2DSAA 4IQAA 2IL3A 2YWMA 2KP2A 3ERGA 19GSA 4JEDA 1XOAA 4MZBA 2B3SA 3QPMA 3ZRDA 5IQYA 1PMTA 2VUPA 3ED3A 3FZ5A 5IPHA 3FYGA 3C7MA 5FT3A 1R5AA 1K0OA 1A2LA 1V57A 2LJAA 5ECPB 3W8SA 5GAPD 2YWNA 5G5EA 3DVXA 2KHPA 3H4KA 4TXVA 4F03A 5ID2A 1O73A 2GSTA 2EIRA 4MJEA 5DJLA 3ZFLA 3I6AA 1TU8A 5DALB 2L57A 1T4YA 1I5GA 1PL2A 5JCUA 2VL9A 3EPTA 3FMWA 1F6MC 3CTFA 1TK5B 1SD8A 5A4VA 5F8BA 4I5QA 2DMMA 4YKFA 6GSUA 3VWVA 2LUSA 1CQHA 2LJKA 2PERA 4GLTA 2B1KA 2N5BA 16GSA 3VI5A 5A4WA 2VIMA 5IOXA 4NHWA 2H72A 4OFTA 1U87A 2C0DA 4G0IA 3UBKA 4Z2TA 4G10A 3KMNA 3O6TA 4WF5A 3ERFA 1M7TA 3M3MA 2LJRA 4PXOA 1K0MA 2K18A 4YQVA 4BL7B 1O85A 2CQ9A 1SD9A 4IKHA 3HD5A 3HVXA 2HNLA 3N9JA 2P5RA 3NZNA 3EMPA 4JE1A 3TRPA 4KDYA 5D9WA 1MD4A 1UN2A 5ELAA 1XG8A 5DAKA 5D9VA 5H5QA 5AISA 3TKSE 4KNDA 3TJFA 3ZVJA 1K0BA 5CRGA 4PUFC 4JR6A 4GF0A 1ZYNA 4HDEA 2QKEA 1KBNA 3F9UA 3SWLA 3QAVA 3GIXA 1U3IA 1O7UA 1SU9A 3GNJA 3GURA 4F82A 4X0XA 2JL4A 2LRCA 2YV9A 3KD0A 4YQUA 3G7YA 3KMOA 3LXTA 2HZFA 1V58A 1FB6A 4MABA 3WD6A 4XRAA 3TUEA 3ME8A 1URMA 3PGTA 3APOA 1M9BA 2VL3A 3VI7A 2VLVA 3CTGA 3D0ZA 1Z7RA 1B9YC 1WJKA 3DD3A 2OE3A 1WWJA 5B8BA 1AXDA 1SK2A 3KCMA 3TJJA 3DIEA 2LNTA 4OFNA 5IIZA 3DKSA 6GSVA 2CT6A 4G0KA 5EL8A 4IP1A 2L5OA 3I69A 1B4PA 2JSYA 1OAZA 1NHYA 3F4RA 2NBSA 3EU3A 5H5SA 3ZZXA 3GKNA 2F3MA 4V2NA 2IMEA 2TRCP 5BMUA 1ZL9A 2P5QA 4KF9A 2DKHA 2A2PA 5J9CA 2B7JA 2P31A 4USSA 9GSSA 4E8HA 4ZXGA 3GV1A 4IQ1A 1DUGA 4L5LA 1SYXA 3TKSC 4GXZA 1PN0A 1TRWA 1TW9A 5J9BA 4BIKA 1U3AA 3HYPA 5FWGA 2MYGA 4FH8A 2A2SA 2X8GA 4CY6A 2HRFA 1M2AA 2YWOA 5DCHA 1XW6A 2HLSA 4NMUA 2B5YA 4KCAA 2R5GA 3M1GA 3ZMKA 1GULA 1JZWA 2I3YA 1JZDA 1TI1A 6GSTA 2DMLA 2O85A 4NAXA 2C3TA 1AQVA 2V1MA 2FWFA 2VLUA 1G6WA 1M2BA 3Q74A 2MBTA 2YPMA 2DJJA 1WRYA 1TTZA 1Z6MA 1EOHA 4OCFA 3TGZA 4I2UA 1ERWA 1GSEA 2LS5A 4X4JA 1TRUA 2YV7A 3L4NA 2FWHA 3UBLA 3AY8A 1XWAA 4DSQA 1IYIA 3HZ4A 5HR1A 4FYBA 4CDOA 1OE7A 1O81A 4ID0A 2B6MA 3CBUA 4IHUA 4IW9A 4TR1A 1BQ7A 4N11A 5IO0A 3KTBA 2FA8A 1JZRA 3L9VA 2E2GA 2VL2C 2C0EA 5IO2A 2TRXA 2OJLA 3C73A 1EV9A 3IXRA 4A5PA 4AJ8A 2AUVA 2WRTA 4MJAA 5J4UA 1XW9A 2WULA 4EXJA 3HJPA 1A0RP 1YJ6A 2JZSA 5HFIA 3ZIVA 1A0FA 5JWRB 4XRDA 1JLVA 3BOAA 2KLXA 1H75A 1B4QA 1OKTA 1Z3EA 5D9TA 1SK1A 5A5KA 1YEPA 2H6ZA 4I97A 3P8WA 1QK8A 1YF1A 4TW5A 2I4AA 1F37A 1SJ6A 4TR1B 1OE8A 3A2XA 3ZTLA 4IJIA 4V2LA 2R3XA 3HJOA 3TKSA 1RW1A 1PQNA 4K5RA 3TJKA 3C1SA 3WGEA 2X8HA 5HR3A 4TXOA 4MLYA 3BCIA 3CRTA 4MJCA 5KEJA 1A8YA 2C1YA 2MMNA 3E9JB 3LYPA 2OKAA 4F9ZA 3LXZA 1M99A 4HZ2A 1VRSD 3F8UA 2LV3A 2BMXA 1Z6NA 2H30A 1GRXA 3LFLA 4ZBAA 3P90A 2HI7A 3ZL5A 1AIUA 3KM6A 3RBTA 3UAPA 4K9ZA 4HSCX 4GSTA 4QL7A 2F9SA 1ST9A 1V98A 3FR6A 1R4WA 2CX4A 2ZNMA 3FRCA 3V1WA 1SL0B 3RHCA 5F05A 3F4TA 4HU7A 1GSYA 4OFMA 3FKFA 4J56E 5DDLA 2GSQA 2X8CA 1KEBA 3I43A 5DVBA 3K8NA 1IYHA 1PGTA 2O7KA 2TIRA 2VL2A 2X99A 3FZ9A 3BD2A 4WF4A 2DJ1A 1A8LA 3IV4A 4I6XA 4EKZA 1BX9A 1ZMAA 1RQMA 2VOCA 3RPNA 1OVNA 2YJHA 5D9XA 3IR4A 1BJXA 3Q18A 4QQ7A 4BWSA 5COHA 2QSIA 2FGXA 1PA3A 2R0PA 3VWUA 5AN1A 3DEXA 5B8AA 2WB9A 5GSSA 2QA2A 3DMLA 4AGSA 1TRVA 3WGDA 3C71A 2VCZA 2VCVA 5ECMB 4XS4B 1OC9A 5ELGA 4O5QA 6GSWA 3KEBA 1EP7A 3L9SA 1EP8A 2IMFA 3ZLPA 3P2AA 1VGLA 5E4WA 4V1Ag 3RDWA 1K0DA 1K3YA 3D22A 4L0WA 4MCUA 2OACA 3CRUA 4PTSA 1YKCA 4AJ6A 2H75A 1MTCA 1JLWA 2R0GA 2B5XA 3DYRA 1GSUA 2FWEA 2IIYA 2V6KA 2PWJA 3FHKA 4PQ1A 1TOFA 4FO5A 4FYCA 1HNAA 5CO3A 5B7CA 4V1Ap 2IN3A 4IELA 2GZZA 2X49A 1C72A 3A2VA 1SYRA 3US3A 4GQFA 4F0BA 3M9JA 4ZB9A 1R5PA 4MF5A 2E0QA 3ZMLA 1W4VA 2FLSA 4O5RA 3WT2A 4P3YB 1ZGNA 2H74A 1FG4A 1EWXA 2D2ZA 5ECSA 1HNCA 3D21A 1AQWA 2CV4A 1S3AA 3WT1A 4KX4A 2XPEA 1K3LA 4G2EA 5EVOA 3JCML 4H86A 4ZILA 2JZRA 3NOFA 1THXA 2AHEA 2IFQB 1Z7PA 2XBQA 3DXBA 2GZPA 3LJRA 5CNWA 4NHZA 4OD7A 1JFUA 5CYYA 1THOA 5ECHB 2EIOA 4KUNA 5G2ZA 4K0NA 4JZQA 3IBHA 1X5DA 1ZYEA 3EC3A 4WEYA 3LSZA 4JRRA 1N8JA 1O8XA 4GQCA 3CXGA 4EF0A 3H1NA 2PPTA 3DVWA 4ML6A 3A3TA 1XBSA 2X64A 2MBSA 4K7IA 3ZITA 4POMA 5F06A 2AYTA 1H4OA 4XTSA 4ECJA 2WZ9A 2YWIA 3EU4A 1AC1A 3ZFBA 2JADA 2F8FA 5BRTA 5ID2B 3GH6A 4IVFA 4MH3A 1TXXA 1GUHA 2P0GA 2C0GA 2H66A 2CVBA 2OBKA 1TKDB 2R2JA 1AUCA 1ZZYA 4N0ZA 3TRQA 2VCTA 5ECOB 2XHFA 1WPIA 4YKGA 2VM2A 1ERUA 5J3RA 2XC2A 3LW9A 2DKIA 2RM5A 3KH9A 5E59A 1T8EB 3DGQA 4PUAA 1R26A 1A24A 1Z5YE 2OADA 3E0UA 4MZCA 3UOMA 2PUKC 3IOSA 5IM9A 1XIYA 1TJDA 1WE0A 4Q5QA 5ECQB 5C00A 1AAZA 2OA7A 1QXHA 1Z9HA 2VM1A 3ZYWA 3CSHA 2GTUA 3UIWA 2JSZA 3LGCA 3UJ1A 1W89A 1GTUA 3GA4A 2ES7A 6GSXA 1FHEA 2R4VA 3IHGA 5DAKB 2PVQA 5IMZA 3CSIA 3FZ4A 2Z9SA 5IMCA 1FO5A 7GSSA 4ZB8A 4I8BA 4PURA 3GL5A 1E2YA 1XWKA 2VLTA 1T4ZA 3H79A 5JCGA 1ON4A 2HFDA 5HR2A 4MK3A 2QC7A 2YANA 1HD2A 4FIWA 3H93A 4IN0A 2HT9A 4ILFA 4KW6A 3D4MA 1LJRA 3QD9A 4BVXA 5L71A 1PX7A 4O5UA 1UVZA 4EDYA 1O8WA 5AGYA 2FUG2 5INYA 3IRAA 5DCGA 4L8EA 2I1UA 4LA1A 4TR0A 18GSA 3HJMA 2LQQA 3F0IA 1U6TA 2GQLA 11GSA 2VD1A 4NWYA 1GTBA 1HYUA 4IS0A 3TRXA 2WJUA 2H1AA 1G7EA 4ICYA 4HS1A 1UC7A 3KGKA 2HRKA 1YEXA 1K0NA 3HCZA 4ZBBA 4DEJA 3GL3A 3U5RE 1A23A 1GP1A 6GSSA 2M72A 3LQ7A 1N2AA 4QL9A 4FQUA 2F51A 1M2DA 4HEA2 4BVYA 2CVDA 5G5FA 4MPGA 3M0FA 2GZYA 4MPFA 1SENA 4V2MA 2DIYA 1SKSB 1ILOA 4IJ3A 3HA9A 2VCXA 5HQPA 2YN1A 2FD3A 4LL1B 2ZCTA 4XHMA 5EPFA 4X43A 4AF2A 8GSSA 1DE2A 3WYWA 5HFGA 1UA5A 3LORA 4KCEA 1ERVA 1USBA 2K8VA 3TOTA 2AV4A 2DLXA 1GNEA 4ECCA 4PX1A 3F6DA 1EEJA 2IJYA 4XIHA 1G0TA 1TU7A 3ISOA 4HOJA 4MP4A 4FYUA 1PL1A 2R6KA 5ECIB 1BEDA 4D73A 3ERWA 2H70A 3TKRA 3TJBA 4X1UA 4ECBA 3O3TA 3MWHA 4TKYA 2IPAA 2VD0A 1EGOA 3L0HA 2GT6A 2H0HA 2V32A 3GKKA 4WXTA 1SL1B 1FVJA 1HNBA 4EO3A 2A4HA 4TRXA 1XVQA 2JACA 5JWQB 3IAM2 4K2XA 1XZOA 5HFKA 3KIJA 4WETA 2WGRA 2E2MA 2ZUPA 2C4JA 13GSA 2DJ3A 2V41A 3E3EA 4PGTA 4GRFA 1Y6EA 1J08A 4POKA 1ZYQB 4ML1A 2GT5A 1OC8A 3MDKA 1K0CA 4RQXA 3GKXA 2YJ7A 2AAWA 1TI3A 3HVSA 2B1LA 4MDCA 3KXOA 2H8LA 3PPUA 1X5CA 3M9KA 4Q5RA 1M9AA 1FAAA 1MDIA 2H6YA 2EIQA 4OWYA 3U6VA 3HVNA 2QGVA 5KOXA 1G6YA 2X4AA 1V2AA 20GSA 4ZB6A 4IP6A 1XWCA 2H0IA 2N5FA 4ZIJA 2VCWA 5ECLB 1S3RA 1GH2A 4GSNA 3QMXA 3G7JA 2J9HA 4G0LA 2BJXA 3SBCA 4PQHA 3R3EA 3APQA 4GSSA 4N0VA 22GSA 2I81A 4XS6A 1S3CA 1X5EA 5HR0A 2RUEA 2KP1A 2NPBA 4TXOB 4G19A 3RHBA 4MH2A 3APSA 4POLA 3GUSA 4KDXA 2PMTA 4E8EA 2M46A 1PRXA 3HDCA 4HQSA 3VPTA 2L6DA 3GMFA 3QFAC 1VF3A 1SKWB 3IAS2 4L5OA 2LQOA 5LD0A 1BYEA 1KNGA 3F3RA 5AIVA 4K7OA 2YZHA 4MZWA 4DSSA 2YCDA 5GSTA 2H1BA 2DJ2A 4ULXA 2I9HA 1ZOFA 2FWGA 2GGTA 5D93A 2L6CA 3QFBC 3R2QA 3A2WA 3C8EA 3GTUA 1MEKA 2WCIA 2HSHA
chains in the Genus database with same CATH topology
1YQ1A 4WR5A 2KOKA 3D4TA 3ZREA 2BTOT 3RAZA 2CAIA 3EVIA 4EL1A 4YAPA 4EC0A 2GSSA 1QFNA 1GSQA 3MNGA 3TB2A 5D96A 1TK0B 1XVWA 4F0CA 4GWRA 5A4UA 4IBPA 1GNWA 2GQKA 3GX0A 10GSA 5D8IA 2VO4A 3UL3A 4KA0A 4DSSB 4KH7A 2LNSA 4LL4B 2LRTA 3TJGA 4OCEA 12GSA 2FY6A 5DALA 5G31A 2C80A 4MA9A 3M8NA 3UARA 4POBA 2B5EA 1QMVA 1GSDA 1OC9B 3FK8A 3KJYA 1XWGA 3KH7A 3ZVJD 3PINA 1ML6A 2AB6A 1MDJA 4JR4A 1PD21 3HHVA 1B8XA 4O7HA 1TK8B 1F3BA 1F9MA 1XFLA 2GLRA 4GTUA 4IGJA 4MJBA 3W8JA 4BL7A 1XPVA 4NPBA 5ECKB 4RUVA 4KGIA 1U88A 1T3BA 5LNKe 2RIIA 3VFIA 4KSMA 1B9XC 2XPDA 1NW2A 4NXIA 1YF0A 5KN0A 2LSTA 4HU9A 2H73A 3EYTA 1FOVA 4GCIA 1E6BA 3IK9A 2L5LA 3G9BA 4WBRD 5G1KA 2YOIA 2C3NA 3FZAA 1NM3A 2HE3A 1WOUA 2JZTA 4F2IA 4NV5A 3I9V2 1DBYA 3IC4A 4K1FA 4XCSA 1OYJA 3LWAA 4AJ7A 5J41A 1QQ2A 4MF7A 1GLQA 4RI6A 1FB0A 4Z2RA 3EMXA 2E7PA 2GQMA 2F8AA 3VWXA 3KP9A 4DSRA 3IA1A 1PX6A 4K6XA 3HKRA 2K9FA 3RPPA 1WP0A 3ZIJA 5ABRA 2O89A 5JWOB 1SJIA 3GHAA 2K6VA 1GL8A 1XCCA 5DQSA 2WDUA 3F6FA 4ZBDA 2LKUA 1WIKA 2FHEA 1T1VA 3VPQA 3GH9A 4HZ4A 2HXKA 4KE3A 5FHIA 1JHBA 2HSMA 1VF1A 2YP6A 3GSSA 4K5SA 3HY2A 2VCQA 4K2DA 4EE0A 4EVMA 2CZ3A 5CRWA 1MD3A 4OO5A 1FVKA 3A5WA 5KOWA 3GYKA 4ZL7A 1GLPA 2CAQA 1J0FA 2H1DA 1T00A 3GSTA 5CP1A 5H5RA 3F63A 2PN8A 4KB3A 2HSYA 1YDKA 5IPGA 1K0AA 1YY7A 5EY6A 3D6IA 4KAEA 3J7Yb 2ON5A 4J57E 2CA8A 1TP9A 1NSWA 3IC8A 3W6GA 2YNXA 5B6NA 4CY8A 4BWQA 3GN3A 3NIVA 4ACSA 2N5AA 1ABAA 5J5NA 2K8SA 2WS2A 3QCPA 3HVVA 4YAVA 4RI7A 4Z7XA 4WR4A 1PN9A 1F2EA 4XS1A 4YQMA 2ALBA 3QR6A 1T7PB 2CX3A 1EEMA 3UVHA 3TKPA 1SK0A 5ECRB 3TCOA 1Q98A 4LLRA 1G7OA 5B6MA 5F0GA 2RLIA 3FR3A 2JU5A 3PR8A 2CZ2A 3TKQA 2HRNA 1Q4JA 4EIPA 3FY7A 3FW2A 2MZCA 5IMDA 5CREA 1EZKA 2PVOC 3Q19A 3VK9A 3IDVA 2VAFA 4ZL9A 1GSFA 1X9SB 4HQZA 2HYXA 1K3OA 3DWVA 3QDNA 2IWTA 1LU4A 1ACVA 3UMAA 5IMVA 4MF6A 1SL2B 3MYDA 3F4SA 1EOGA 3UEMA 1ZYPA 4MMMA 4TR4A 2L4QA 4HJMA 3EE2A 2GSRA 1AW9A 2G0FA 2H1GA 2G2QA 2V2GA 4BVXB 4Q5FA 3PH9A 4Q5NA 3HZ8A 5F07A 3BBYA 1ZCPA 3EURA 4MNNA 3O76A 1QGVA 2GVPA 1TRSA 1R7HA 4BA7A 4O32A 2LTKA 4HJ2A 3G7IA 3GRXA 2H76A 2C8UA 2PU9C 1F3AA 1NHOA 4N10A 4TR3A 1FOHA 1AQXA 4TN8A 3C1RA 3L78A 14GSA 4Z2UA 2FNOA 3IHQA 2OE1A 5JCWA 4BVYB 1XW5A 2CVKA 3GFKA 4HI7A 1GUMA 3EWLA 1YKAA 4TVEA 3IPZA 2IMIA 3CSJA 5ECNB 1DSBA 2DC5A 3MAKA 2B7KA 3GX8A 4WBJA 2ON7A 3QAGA 2O8VB 3S9FA 1FW1A 1X9WB 3FR9A 3KTLA 2AJQB 3WGXA 2FCHA 1S3DA 4LMWA 4JBBA 5AIXA 5CAXA 1J9BA 5CRDA 1OC3A 2QA1A 3D5JA 2NTOA 2A4VA 1CQGA 2R0CA 2XBIA 4RQRA 3DRNA 1EV4A 3KP8A 1BG5A 3ME7A 5C04A 4D73B 2REMA 4CW9A 2DIZA 4LMVA 3A5IA 2C3QA 3UVTA 3VLNA 2NDOA 1SKRB 1BAYA 1O6JA 3Q6OA 4N30A 6GSYA 4PNFA 1QUWA 2DJKA 4EUYA 4ECIA 2L59A 4EIQA 4K7NA 1PKZA 3F3QA 3LG6A 2A2RA 5G1LA 1VF2A 1TDIA 4EDZA 1V40A 3VURA 1Y25A 3QAWA 4G9HA 2FA4A 2M80A 2MMAA 1JZOA 3BJ5A 5D73A 4K0GA 5KN2A 2LEGA 1GTAA 3MIXA 4ZL8A 3N5OA 3KZQA 2R37A 1OKDA 4TOPA 2GS3A 5IOWA 2O87A 2UZ8A 2WFCA 3P7XA 1PKWA 4WKWA 2PGTA 3EINA 1A2MA 1A2JA 4XS4A 1GSSA 1MDKA 4O92A 3TDGA 2DJ0A 1PSQA 4KSOA 2GDRA 4PNGA 2H6XA 5G30A 4OMVA 2LRNA 1LBKA 2NVLA 5DQYA 2EC4A 3LEFA 5IMFA 1DE1A 1XOBA 2V6OA 5DJMA 5IMAA 4ISDA 3H8QA 2HRAA 2KUCA 2PBJA 2RM6A 3CYNA 2HZEA 4JU5A 1XXUA 4BPYA 1X9MB 2L4CA 2OBIA 3VWWA 5KN1A 1GUKA 2IMKA 3OR5A 4NV2A 5CRHA 3L9UA 1GTIA 4KDUA 4OO4A 1RK4A 2H71A 5KN3A 2YZUA 3TOUA 3IK7A 5GAND 1YZXA 4YH2A 4K8MA 1I9DA 2C0FA 3QOUA 1EGRA 4J2FA 5LCZA 2DBCA 3HXSA 4DVCA 1KTEA 1VF4A 2J23A 3LYKA 1WMJA 2IMDA 3GKMA 1V9WA 1B48A 5ENUA 1HQOA 4PQIA 3BCKA 4HUAA 3IE3A 2H19A 3FEUA 2H01A 1SJZA 3CMIA 3GTUB 3MSZA 5DBQA 1X0RA 4CHSA 2HZEB 1XWBA 17GSA 2MMOA 3J7Yk 4I2TA 2OE0A 2H0GA 2IFQA 4L0UA 1M0UA 1ERTA 2MMZA 1GWCA 2RUFA 5GZZB 2DSAA 4IQAA 2IL3A 2YWMA 2KP2A 3ERGA 19GSA 4JEDA 1XOAA 4MZBA 2B3SA 3QPMA 3ZRDA 5IQYA 1PMTA 2VUPA 3ED3A 3FZ5A 5IPHA 3FYGA 3C7MA 5FT3A 1R5AA 1K0OA 1A2LA 1V57A 2LJAA 5ECPB 3W8SA 5GAPD 2YWNA 5G5EA 3DVXA 2KHPA 3H4KA 4TXVA 4F03A 5ID2A 1O73A 2GSTA 2EIRA 4MJEA 5DJLA 3ZFLA 3I6AA 1TU8A 5DALB 2L57A 1T4YA 1I5GA 1PL2A 5JCUA 2VL9A 3EPTA 3FMWA 1F6MC 3CTFA 1TK5B 1SD8A 5A4VA 5F8BA 4I5QA 2DMMA 4YKFA 6GSUA 3VWVA 2LUSA 1CQHA 2LJKA 2PERA 4GLTA 2B1KA 2N5BA 16GSA 3VI5A 5A4WA 2VIMA 5IOXA 4NHWA 2H72A 4OFTA 1U87A 2C0DA 4G0IA 3UBKA 4Z2TA 4G10A 3KMNA 3O6TA 4WF5A 3ERFA 1M7TA 3M3MA 2LJRA 4PXOA 1K0MA 2K18A 4YQVA 4BL7B 1O85A 2CQ9A 1SD9A 4IKHA 3HD5A 3HVXA 2HNLA 3N9JA 2P5RA 3NZNA 3EMPA 4JE1A 3TRPA 4KDYA 5D9WA 1MD4A 1UN2A 5ELAA 5DAKA 5D9VA 5H5QA 5AISA 3TKSE 4KNDA 3TJFA 3ZVJA 1K0BA 5CRGA 4PUFC 4JR6A 4GF0A 1ZYNA 4HDEA 2QKEA 1KBNA 3F9UA 3SWLA 3QAVA 3GIXA 1U3IA 1O7UA 1SU9A 3GNJA 3GURA 4F82A 4X0XA 2JL4A 2LRCA 2YV9A 3KD0A 4YQUA 3G7YA 3KMOA 3LXTA 2HZFA 1V58A 1FB6A 4MABA 3WD6A 4XRAA 3TUEA 3ME8A 1URMA 3PGTA 3APOA 1M9BA 2VL3A 3VI7A 2VLVA 3CTGA 3D0ZA 1Z7RA 1B9YC 1WJKA 3DD3A 2OE3A 1WWJA 5B8BA 1AXDA 1SK2A 3KCMA 3TJJA 3DIEA 2LNTA 4OFNA 5IIZA 3DKSA 6GSVA 2CT6A 4G0KA 5EL8A 4IP1A 2L5OA 3I69A 1B4PA 2JSYA 1OAZA 1NHYA 3F4RA 2NBSA 3EU3A 5H5SA 3ZZXA 3GKNA 2F3MA 4V2NA 2IMEA 2TRCP 5BMUA 1ZL9A 2P5QA 4KF9A 2DKHA 2A2PA 5J9CA 2B7JA 2P31A 4USSA 9GSSA 4E8HA 4ZXGA 3GV1A 4IQ1A 1DUGA 4L5LA 1SYXA 3TKSC 4GXZA 1PN0A 1TRWA 1TW9A 5J9BA 1U3AA 3HYPA 5FWGA 2MYGA 4FH8A 2A2SA 2X8GA 4CY6A 2HRFA 1M2AA 2YWOA 5DCHA 1XW6A 2HLSA 4NMUA 2B5YA 4KCAA 2R5GA 3M1GA 3ZMKA 1GULA 1JZWA 2I3YA 1JZDA 1TI1A 6GSTA 2DMLA 2O85A 4NAXA 2C3TA 1AQVA 2V1MA 2FWFA 2VLUA 1G6WA 1M2BA 3Q74A 2MBTA 2YPMA 2DJJA 1WRYA 1TTZA 1Z6MA 1EOHA 4OCFA 3TGZA 4I2UA 1ERWA 1GSEA 2LS5A 4X4JA 1TRUA 2YV7A 3L4NA 2FWHA 3UBLA 3AY8A 1XWAA 4DSQA 1IYIA 3HZ4A 5HR1A 4FYBA 4CDOA 1OE7A 1O81A 4ID0A 2B6MA 3CBUA 4IHUA 4IW9A 4TR1A 1BQ7A 4N11A 5IO0A 3KTBA 2FA8A 1JZRA 3L9VA 2E2GA 2VL2C 2C0EA 5IO2A 2TRXA 2OJLA 3C73A 1EV9A 3IXRA 4A5PA 4AJ8A 2AUVA 2WRTA 4MJAA 5J4UA 1XW9A 2WULA 4EXJA 3HJPA 1A0RP 1YJ6A 2JZSA 5HFIA 3ZIVA 1A0FA 5JWRB 4XRDA 1JLVA 3BOAA 2KLXA 1H75A 1B4QA 1OKTA 1Z3EA 5D9TA 1SK1A 5A5KA 1YEPA 2H6ZA 4I97A 3P8WA 1QK8A 1YF1A 4TW5A 2I4AA 1F37A 1SJ6A 4TR1B 1OE8A 3A2XA 3ZTLA 4IJIA 4V2LA 2R3XA 3HJOA 3TKSA 1RW1A 1PQNA 4K5RA 3TJKA 3C1SA 3WGEA 2X8HA 5HR3A 4TXOA 4MLYA 3BCIA 3CRTA 4MJCA 5KEJA 1A8YA 2C1YA 2MMNA 3E9JB 3LYPA 2OKAA 4F9ZA 3LXZA 1M99A 4HZ2A 1VRSD 3F8UA 2LV3A 2BMXA 1Z6NA 2H30A 1GRXA 3LFLA 4ZBAA 3P90A 2HI7A 3ZL5A 1AIUA 3KM6A 3RBTA 3UAPA 4K9ZA 4GSTA 4QL7A 2F9SA 1ST9A 1V98A 3FR6A 1R4WA 2CX4A 2ZNMA 3FRCA 3V1WA 1SL0B 3RHCA 5F05A 3F4TA 4HU7A 1GSYA 4OFMA 3FKFA 4J56E 5DDLA 2GSQA 2X8CA 1KEBA 3I43A 5DVBA 3K8NA 1IYHA 1PGTA 2O7KA 2TIRA 2VL2A 2X99A 3FZ9A 3BD2A 4WF4A 2DJ1A 1A8LA 3IV4A 4I6XA 4EKZA 1BX9A 1ZMAA 1RQMA 2VOCA 3RPNA 1OVNA 2YJHA 5D9XA 3IR4A 1BJXA 3Q18A 4QQ7A 4BWSA 5COHA 2QSIA 2FGXA 1PA3A 2R0PA 3VWUA 5AN1A 3DEXA 5B8AA 2WB9A 5GSSA 2QA2A 3DMLA 4AGSA 1TRVA 3WGDA 3C71A 2VCZA 2VCVA 5ECMB 4XS4B 1OC9A 5ELGA 4O5QA 6GSWA 3KEBA 1EP7A 3L9SA 1EP8A 2IMFA 3ZLPA 3P2AA 1VGLA 5E4WA 4V1Ag 3RDWA 1K0DA 1K3YA 3D22A 4L0WA 4MCUA 2OACA 3CRUA 4PTSA 1YKCA 4AJ6A 2H75A 1MTCA 1JLWA 2R0GA 2B5XA 3DYRA 1GSUA 2FWEA 2IIYA 2V6KA 2PWJA 3FHKA 4PQ1A 1TOFA 4FO5A 4FYCA 1HNAA 5CO3A 5B7CA 4V1Ap 2IN3A 4IELA 2GZZA 2X49A 1C72A 3A2VA 1SYRA 3US3A 4GQFA 4F0BA 3M9JA 4ZB9A 1R5PA 4MF5A 2E0QA 3ZMLA 1W4VA 2FLSA 4O5RA 3WT2A 4P3YB 1ZGNA 2H74A 1FG4A 1EWXA 2D2ZA 5ECSA 1HNCA 3D21A 1AQWA 2CV4A 1S3AA 3WT1A 4KX4A 2XPEA 1K3LA 4G2EA 5EVOA 3JCML 4H86A 4ZILA 2JZRA 3NOFA 1THXA 2AHEA 2IFQB 1Z7PA 2XBQA 3DXBA 2GZPA 3LJRA 5CNWA 4NHZA 4OD7A 1JFUA 5CYYA 1THOA 5ECHB 2EIOA 4KUNA 5G2ZA 4K0NA 4JZQA 3IBHA 1X5DA 1ZYEA 3EC3A 4WEYA 3LSZA 4JRRA 1N8JA 1O8XA 4GQCA 3CXGA 4EF0A 3H1NA 2PPTA 3DVWA 4ML6A 3A3TA 1XBSA 2X64A 2MBSA 4K7IA 3ZITA 4POMA 5F06A 2AYTA 1H4OA 4XTSA 4ECJA 2WZ9A 2YWIA 3EU4A 1AC1A 3ZFBA 2JADA 2F8FA 5BRTA 5ID2B 3GH6A 4IVFA 4MH3A 1TXXA 1GUHA 2P0GA 2C0GA 2H66A 2CVBA 2OBKA 1TKDB 2R2JA 1AUCA 1ZZYA 4N0ZA 3TRQA 2VCTA 5ECOB 2XHFA 1WPIA 4YKGA 2VM2A 1ERUA 5J3RA 2XC2A 3LW9A 2DKIA 2RM5A 3KH9A 5E59A 1T8EB 3DGQA 4PUAA 1R26A 1A24A 1Z5YE 2OADA 3E0UA 4MZCA 3UOMA 2PUKC 3IOSA 5IM9A 1XIYA 1TJDA 1WE0A 4Q5QA 5ECQB 5C00A 1AAZA 2OA7A 1QXHA 1Z9HA 2VM1A 3ZYWA 3CSHA 2GTUA 3UIWA 2JSZA 3LGCA 3UJ1A 1W89A 1GTUA 3GA4A 2ES7A 6GSXA 1FHEA 2R4VA 3IHGA 5DAKB 2PVQA 5IMZA 3CSIA 3FZ4A 2Z9SA 5IMCA 1FO5A 7GSSA 4ZB8A 4I8BA 4PURA 3GL5A 1E2YA 1XWKA 2VLTA 1T4ZA 3H79A 5JCGA 1ON4A 2HFDA 5HR2A 4MK3A 2QC7A 2YANA 1HD2A 4FIWA 3H93A 4IN0A 2HT9A 4ILFA 4KW6A 3D4MA 1LJRA 3QD9A 4BVXA 5L71A 1PX7A 4O5UA 1UVZA 4EDYA 1O8WA 5AGYA 2FUG2 5INYA 3IRAA 5DCGA 4L8EA 2I1UA 4LA1A 4TR0A 18GSA 3HJMA 2LQQA 3F0IA 1U6TA 2GQLA 11GSA 2VD1A 4NWYA 1GTBA 1HYUA 4IS0A 3TRXA 2WJUA 2H1AA 1G7EA 4ICYA 4HS1A 1UC7A 3KGKA 2HRKA 1YEXA 1K0NA 3HCZA 4ZBBA 4DEJA 3GL3A 3U5RE 1A23A 1GP1A 6GSSA 2M72A 3LQ7A 1N2AA 4QL9A 4FQUA 2F51A 1M2DA 4HEA2 4BVYA 2CVDA 5G5FA 4MPGA 3M0FA 2GZYA 4MPFA 1SENA 4V2MA 2DIYA 1SKSB 1ILOA 4IJ3A 3HA9A 2VCXA 5HQPA 2YN1A 2FD3A 4LL1B 2ZCTA 4XHMA 5EPFA 4X43A 4AF2A 8GSSA 1DE2A 3WYWA 5HFGA 1UA5A 3LORA 4KCEA 1ERVA 1USBA 2K8VA 3TOTA 2AV4A 2DLXA 1GNEA 4ECCA 4PX1A 3F6DA 1EEJA 2IJYA 4XIHA 1G0TA 1TU7A 3ISOA 4HOJA 4MP4A 4FYUA 1PL1A 2R6KA 5ECIB 1BEDA 4D73A 3ERWA 2H70A 3TKRA 3TJBA 4X1UA 4ECBA 3O3TA 3MWHA 4TKYA 2IPAA 2VD0A 1EGOA 3L0HA 2GT6A 2H0HA 2V32A 3GKKA 4WXTA 1SL1B 1FVJA 1HNBA 4EO3A 2A4HA 4TRXA 1XVQA 2JACA 5JWQB 3IAM2 4K2XA 1XZOA 5HFKA 3KIJA 4WETA 2WGRA 2E2MA 2ZUPA 2C4JA 13GSA 2DJ3A 2V41A 3E3EA 4PGTA 4GRFA 1Y6EA 1J08A 4POKA 1ZYQB 4ML1A 2GT5A 1OC8A 3MDKA 1K0CA 4RQXA 3GKXA 2YJ7A 2AAWA 1TI3A 3HVSA 2B1LA 4MDCA 3KXOA 2H8LA 3PPUA 1X5CA 3M9KA 4Q5RA 1M9AA 1FAAA 1MDIA 2H6YA 2EIQA 4OWYA 3U6VA 2QGVA 5KOXA 1G6YA 2X4AA 1V2AA 20GSA 4ZB6A 4IP6A 1XWCA 2H0IA 2N5FA 4ZIJA 2VCWA 5ECLB 1GH2A 4GSNA 3QMXA 3G7JA 2J9HA 4G0LA 2BJXA 3SBCA 4PQHA 3R3EA 3APQA 4GSSA 4N0VA 22GSA 2I81A 4XS6A 1S3CA 1X5EA 5HR0A 2RUEA 2KP1A 2NPBA 4TXOB 4G19A 3RHBA 4MH2A 3APSA 4POLA 3GUSA 4KDXA 2PMTA 4E8EA 2M46A 1PRXA 3HDCA 4HQSA 3VPTA 2L6DA 3GMFA 3QFAC 1VF3A 1SKWB 3IAS2 4L5OA 2LQOA 5LD0A 1BYEA 1KNGA 3F3RA 5AIVA 4K7OA 2YZHA 4MZWA 4DSSA 2YCDA 5GSTA 2H1BA 2DJ2A 4ULXA 2I9HA 1ZOFA 2FWGA 2GGTA 5D93A 2L6CA 3QFBC 3R2QA 3A2WA 3C8EA 3GTUA 1MEKA 2WCIA 2HSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ1 A;  4WR5 A;  2KOK A;  3D4T A;  3ZRE A;  2BTO T;  3RAZ A;  2CAI A;  3EVI A;  4EL1 A;  4YAP A;  4EC0 A;  2GSS A;  1QFN A;  1GSQ A;  3MNG A;  3TB2 A;  5D96 A;  1TK0 B;  1XVW A;  4F0C A;  4GWR A;  5A4U A;  4IBP A;  1GNW A;  2GQK A;  3GX0 A;  10GS A;  5D8I A;  2VO4 A;  3UL3 A;  4KA0 A;  4DSS B;  4KH7 A;  2LNS A;  4LL4 B;  2LRT A;  3TJG A;  4OCE A;  12GS A;  2FY6 A;  5DAL A;  5G31 A;  2C80 A;  4MA9 A;  3M8N A;  3UAR A;  4POB A;  2B5E A;  1QMV A;  1GSD A;  1OC9 B;  3FK8 A;  3KJY A;  1XWG A;  3KH7 A;  3ZVJ D;  3PIN A;  1ML6 A;  2AB6 A;  1MDJ A;  4JR4 A;  1PD2 1;  3HHV A;  1B8X A;  4O7H A;  1TK8 B;  1F3B A;  1F9M A;  1XFL A;  2GLR A;  4GTU A;  4IGJ A;  4MJB A;  3W8J A;  4BL7 A;  1XPV A;  4NPB A;  5ECK B;  4RUV A;  4KGI A;  1U88 A;  1T3B A;  5LNK e;  2RII A;  3VFI A;  4KSM A;  1B9X C;  2XPD A;  1NW2 A;  4NXI A;  1YF0 A;  5KN0 A;  2LST A;  4HU9 A;  2H73 A;  3EYT A;  1FOV A;  4GCI A;  1E6B A;  3IK9 A;  2L5L A;  3G9B A;  4WBR D;  5G1K A;  2YOI A;  2C3N A;  3FZA A;  1NM3 A;  2HE3 A;  1WOU A;  2JZT A;  4F2I A;  4NV5 A;  3I9V 2;  1DBY A;  3IC4 A;  4K1F A;  4XCS A;  1OYJ A;  3LWA A;  4AJ7 A;  5J41 A;  1QQ2 A;  4MF7 A;  1GLQ A;  4RI6 A;  1FB0 A;  3EMX A;  2E7P A;  2GQM A;  2F8A A;  3VWX A;  3KP9 A;  4DSR A;  3IA1 A;  1PX6 A;  4K6X A;  3HKR A;  2K9F A;  3RPP A;  1WP0 A;  3ZIJ A;  5ABR A;  2O89 A;  5JWO B;  1SJI A;  3GHA A;  2K6V A;  1GL8 A;  1XCC A;  5DQS A;  2WDU A;  3F6F A;  4ZBD A;  2LKU A;  1WIK A;  2FHE A;  1T1V A;  3VPQ A;  3GH9 A;  4HZ4 A;  2HXK A;  4KE3 A;  5FHI A;  1JHB A;  1VF1 A;  2YP6 A;  3GSS A;  3HY2 A;  2VCQ A;  4K2D A;  4EE0 A;  4EVM A;  2CZ3 A;  5CRW A;  1MD3 A;  4OO5 A;  1FVK A;  3A5W A;  3GYK A;  4ZL7 A;  1GLP A;  2CAQ A;  1J0F A;  2H1D A;  1T00 A;  3GST A;  5CP1 A;  5H5R A;  3F63 A;  2PN8 A;  4KB3 A;  2HSY A;  1YDK A;  5IPG A;  1K0A A;  1YY7 A;  5EY6 A;  3D6I A;  4KAE A;  3J7Y b;  2ON5 A;  4J57 E;  2CA8 A;  1TP9 A;  1NSW A;  3W6G A;  2YNX A;  5B6N A;  4BWQ A;  3GN3 A;  3NIV A;  4ACS A;  2N5A A;  1ABA A;  5J5N A;  2K8S A;  2WS2 A;  3QCP A;  3HVV A;  4YAV A;  4RI7 A;  4Z7X A;  4WR4 A;  1PN9 A;  1F2E A;  4XS1 A;  4YQM A;  2ALB A;  3QR6 A;  1T7P B;  2CX3 A;  1EEM A;  3UVH A;  3TKP A;  1SK0 A;  5ECR B;  3TCO A;  1Q98 A;  4LLR A;  1G7O A;  5B6M A;  5F0G A;  2RLI A;  3FR3 A;  2JU5 A;  3PR8 A;  2CZ2 A;  3TKQ A;  2HRN A;  1Q4J A;  3FY7 A;  3FW2 A;  2MZC A;  5IMD A;  5CRE A;  1EZK A;  2PVO C;  3Q19 A;  3VK9 A;  3IDV A;  2VAF A;  4ZL9 A;  1GSF A;  1X9S B;  4HQZ A;  2HYX A;  1K3O A;  3DWV A;  3QDN A;  2IWT A;  1LU4 A;  1ACV A;  3UMA A;  5IMV A;  4MF6 A;  1SL2 B;  3F4S A;  1EOG A;  3UEM A;  4MMM A;  4TR4 A;  2L4Q A;  4HJM A;  3EE2 A;  2GSR A;  1AW9 A;  2G0F A;  2H1G A;  2G2Q A;  2V2G A;  4Q5F A;  3PH9 A;  4Q5N A;  3HZ8 A;  5F07 A;  3BBY A;  1ZCP A;  3EUR A;  3O76 A;  1QGV A;  2GVP A;  1TRS A;  1R7H A;  4BA7 A;  4O32 A;  2LTK A;  4HJ2 A;  3G7I A;  3GRX A;  2H76 A;  2C8U A;  2PU9 C;  1F3A A;  1NHO A;  4N10 A;  4TR3 A;  1AQX A;  4TN8 A;  3C1R A;  3L78 A;  14GS A;  2FNO A;  3IHQ A;  2OE1 A;  5JCW A;  1XW5 A;  2CVK A;  3GFK A;  4HI7 A;  1GUM A;  3EWL A;  1YKA A;  4TVE A;  3IPZ A;  2IMI A;  3CSJ A;  5ECN B;  1DSB A;  2DC5 A;  3MAK A;  2B7K A;  3GX8 A;  4WBJ A;  2ON7 A;  3QAG A;  2O8V B;  3S9F A;  1FW1 A;  1X9W B;  3FR9 A;  3KTL A;  2AJQ B;  3WGX A;  2FCH A;  1S3D A;  4LMW A;  4JBB A;  5AIX A;  5CAX A;  1J9B A;  5CRD A;  1OC3 A;  3D5J A;  2NTO A;  2A4V A;  1CQG A;  2XBI A;  4RQR A;  3DRN A;  1EV4 A;  3KP8 A;  1BG5 A;  3ME7 A;  5C04 A;  4D73 B;  2REM A;  4CW9 A;  2DIZ A;  4LMV A;  2C3Q A;  3UVT A;  3VLN A;  2NDO A;  1SKR B;  1BAY A;  1O6J A;  3Q6O A;  4N30 A;  6GSY A;  4PNF A;  1QUW A;  2DJK A;  4EUY A;  4ECI A;  2L59 A;  4K7N A;  1PKZ A;  3F3Q A;  3LG6 A;  2A2R A;  5G1L A;  1VF2 A;  1TDI A;  4EDZ A;  1V40 A;  3VUR A;  1Y25 A;  3QAW A;  4G9H A;  2FA4 A;  2M80 A;  2MMA A;  1JZO A;  3BJ5 A;  5D73 A;  4K0G A;  5KN2 A;  2LEG A;  1GTA A;  4ZL8 A;  3N5O A;  3KZQ A;  2R37 A;  1OKD A;  4TOP A;  2GS3 A;  5IOW A;  2O87 A;  2WFC A;  3P7X A;  1PKW A;  4WKW A;  2PGT A;  3EIN A;  1A2M A;  1A2J A;  4XS4 A;  1GSS A;  1MDK A;  4O92 A;  3TDG A;  2DJ0 A;  1PSQ A;  4KSO A;  2GDR A;  4PNG A;  2H6X A;  5G30 A;  4OMV A;  2LRN A;  1LBK A;  2NVL A;  5DQY A;  2EC4 A;  3LEF A;  5IMF A;  1DE1 A;  1XOB A;  2V6O A;  5DJM A;  5IMA A;  4ISD A;  3H8Q A;  2KUC A;  2PBJ A;  2RM6 A;  3CYN A;  2HZE A;  4JU5 A;  1XXU A;  4BPY A;  1X9M B;  2L4C A;  2OBI A;  3VWW A;  5KN1 A;  1GUK A;  2IMK A;  3OR5 A;  4NV2 A;  5CRH A;  3L9U A;  1GTI A;  4KDU A;  4OO4 A;  1RK4 A;  2H71 A;  5KN3 A;  2YZU A;  3TOU A;  3IK7 A;  5GAN D;  1YZX A;  4YH2 A;  4K8M A;  1I9D A;  2C0F A;  3QOU A;  1EGR A;  4J2F A;  5LCZ A;  2DBC A;  3HXS A;  4DVC A;  1KTE A;  1VF4 A;  2J23 A;  3LYK A;  1WMJ A;  2IMD A;  3GKM A;  1V9W A;  1B48 A;  5ENU A;  1HQO A;  4PQI A;  3BCK A;  4HUA A;  3IE3 A;  2H19 A;  3FEU A;  2H01 A;  1SJZ A;  3CMI A;  3GTU B;  3MSZ A;  5DBQ A;  1X0R A;  4CHS A;  2HZE B;  1XWB A;  17GS A;  2MMO A;  3J7Y k;  4I2T A;  2OE0 A;  2H0G A;  2IFQ A;  4L0U A;  1M0U A;  1ERT A;  2MMZ A;  1GWC A;  2RUF A;  5GZZ B;  2DSA A;  4IQA A;  2IL3 A;  2YWM A;  2KP2 A;  3ERG A;  19GS A;  4JED A;  1XOA A;  4MZB A;  2B3S A;  3QPM A;  3ZRD A;  5IQY A;  1PMT A;  2VUP A;  3ED3 A;  3FZ5 A;  5IPH A;  3FYG A;  3C7M A;  5FT3 A;  1R5A A;  1K0O A;  1A2L A;  1V57 A;  2LJA A;  5ECP B;  3W8S A;  5GAP D;  2YWN A;  5G5E A;  3DVX A;  2KHP A;  3H4K A;  4TXV A;  4F03 A;  5ID2 A;  1O73 A;  2GST A;  2EIR A;  4MJE A;  5DJL A;  3ZFL A;  3I6A A;  1TU8 A;  5DAL B;  2L57 A;  1T4Y A;  1I5G A;  1PL2 A;  5JCU A;  2VL9 A;  1F6M C;  3CTF A;  1TK5 B;  1SD8 A;  5A4V A;  5F8B A;  4I5Q A;  2DMM A;  6GSU A;  3VWV A;  2LUS A;  1CQH A;  2LJK A;  2PER A;  4GLT A;  2B1K A;  2N5B A;  16GS A;  3VI5 A;  5A4W A;  2VIM A;  5IOX A;  4NHW A;  2H72 A;  4OFT A;  1U87 A;  2C0D A;  3UBK A;  4G10 A;  3KMN A;  3O6T A;  4WF5 A;  3ERF A;  1M7T A;  3M3M A;  2LJR A;  4PXO A;  1K0M A;  2K18 A;  4YQV A;  1O85 A;  2CQ9 A;  1SD9 A;  4IKH A;  3HD5 A;  3HVX A;  2HNL A;  3N9J A;  2P5R A;  3NZN A;  3EMP A;  4JE1 A;  3TRP A;  4KDY A;  5D9W A;  1MD4 A;  1UN2 A;  5ELA A;  5DAK A;  5D9V A;  5H5Q A;  5AIS A;  3TKS E;  4KND A;  3TJF A;  3ZVJ A;  1K0B A;  5CRG A;  4PUF C;  4JR6 A;  4GF0 A;  4HDE A;  2QKE A;  1KBN A;  3F9U A;  3SWL A;  3QAV A;  3GIX A;  1U3I A;  1O7U A;  1SU9 A;  3GNJ A;  3GUR A;  4F82 A;  4X0X A;  2JL4 A;  2LRC A;  2YV9 A;  3KD0 A;  4YQU A;  3G7Y A;  3KMO A;  3LXT A;  2HZF A;  1V58 A;  1FB6 A;  4MAB A;  3WD6 A;  4XRA A;  3TUE A;  3ME8 A;  1URM A;  3PGT A;  3APO A;  1M9B A;  2VL3 A;  3VI7 A;  2VLV A;  3CTG A;  3D0Z A;  1Z7R A;  1B9Y C;  1WJK A;  3DD3 A;  2OE3 A;  1WWJ A;  5B8B A;  1AXD A;  1SK2 A;  3KCM A;  3TJJ A;  3DIE A;  2LNT A;  4OFN A;  5IIZ A;  3DKS A;  6GSV A;  2CT6 A;  5EL8 A;  4IP1 A;  2L5O A;  3I69 A;  1B4P A;  2JSY A;  1OAZ A;  1NHY A;  3F4R A;  2NBS A;  3EU3 A;  5H5S A;  3ZZX A;  3GKN A;  2F3M A;  4V2N A;  2IME A;  2TRC P;  1ZL9 A;  2P5Q A;  5J9C A;  2B7J A;  2P31 A;  9GSS A;  4E8H A;  4ZXG A;  3GV1 A;  4IQ1 A;  1DUG A;  4L5L A;  1SYX A;  3TKS C;  4GXZ A;  1TRW A;  1TW9 A;  5J9B A;  1U3A A;  3HYP A;  5FWG A;  2MYG A;  4FH8 A;  2A2S A;  2X8G A;  2HRF A;  1M2A A;  2YWO A;  5DCH A;  1XW6 A;  2HLS A;  4NMU A;  2B5Y A;  4KCA A;  2R5G A;  3M1G A;  3ZMK A;  1GUL A;  1JZW A;  2I3Y A;  1JZD A;  1TI1 A;  6GST A;  2DML A;  2O85 A;  4NAX A;  2C3T A;  1AQV A;  2V1M A;  2FWF A;  2VLU A;  1G6W A;  1M2B A;  3Q74 A;  2MBT A;  2YPM A;  2DJJ A;  1WRY A;  1TTZ A;  1Z6M A;  1EOH A;  4OCF A;  3TGZ A;  4I2U A;  1ERW A;  1GSE A;  2LS5 A;  1TRU A;  2YV7 A;  3L4N A;  2FWH A;  3UBL A;  3AY8 A;  1XWA A;  4DSQ A;  1IYI A;  3HZ4 A;  5HR1 A;  4FYB A;  4CDO A;  1OE7 A;  1O81 A;  4ID0 A;  2B6M A;  3CBU A;  4IHU A;  4IW9 A;  4TR1 A;  1BQ7 A;  4N11 A;  5IO0 A;  3KTB A;  2FA8 A;  1JZR A;  3L9V A;  2E2G A;  2VL2 C;  2C0E A;  5IO2 A;  2TRX A;  2OJL A;  3C73 A;  1EV9 A;  3IXR A;  4AJ8 A;  2AUV A;  2WRT A;  4MJA A;  5J4U A;  1XW9 A;  2WUL A;  4EXJ A;  3HJP A;  1A0R P;  1YJ6 A;  2JZS A;  5HFI A;  3ZIV A;  1A0F A;  5JWR B;  4XRD A;  1JLV A;  3BOA A;  2KLX A;  1H75 A;  1B4Q A;  1OKT A;  1Z3E A;  5D9T A;  1SK1 A;  5A5K A;  1YEP A;  2H6Z A;  4I97 A;  3P8W A;  1QK8 A;  1YF1 A;  4TW5 A;  2I4A A;  1F37 A;  1SJ6 A;  4TR1 B;  1OE8 A;  3A2X A;  3ZTL A;  4IJI A;  4V2L A;  2R3X A;  3HJO A;  3TKS A;  1RW1 A;  1PQN A;  3TJK A;  3C1S A;  3WGE A;  2X8H A;  5HR3 A;  4TXO A;  4MLY A;  3BCI A;  3CRT A;  4MJC A;  5KEJ A;  1A8Y A;  2C1Y A;  2MMN A;  3E9J B;  3LYP A;  2OKA A;  4F9Z A;  3LXZ A;  1M99 A;  4HZ2 A;  1VRS D;  3F8U A;  2LV3 A;  2BMX A;  1Z6N A;  2H30 A;  1GRX A;  3LFL A;  4ZBA A;  3P90 A;  2HI7 A;  3ZL5 A;  1AIU A;  3KM6 A;  3RBT A;  3UAP A;  4K9Z A;  4GST A;  4QL7 A;  2F9S A;  1ST9 A;  1V98 A;  3FR6 A;  1R4W A;  2CX4 A;  2ZNM A;  3FRC A;  3V1W A;  1SL0 B;  3RHC A;  5F05 A;  3F4T A;  4HU7 A;  1GSY A;  4OFM A;  3FKF A;  4J56 E;  5DDL A;  2GSQ A;  2X8C A;  1KEB A;  3I43 A;  5DVB A;  3K8N A;  1IYH A;  1PGT A;  2O7K A;  2TIR A;  2VL2 A;  2X99 A;  3FZ9 A;  3BD2 A;  4WF4 A;  2DJ1 A;  1A8L A;  3IV4 A;  4I6X A;  4EKZ A;  1BX9 A;  1ZMA A;  1RQM A;  2VOC A;  3RPN A;  1OVN A;  2YJH A;  5D9X A;  3IR4 A;  1BJX A;  3Q18 A;  4QQ7 A;  4BWS A;  5COH A;  2QSI A;  2FGX A;  1PA3 A;  3VWU A;  5AN1 A;  3DEX A;  5B8A A;  2WB9 A;  5GSS A;  3DML A;  4AGS A;  1TRV A;  3WGD A;  3C71 A;  5ECM B;  2VCZ A;  2VCV A;  4XS4 B;  1OC9 A;  5ELG A;  6GSW A;  3KEB A;  1EP7 A;  3L9S A;  1EP8 A;  2IMF A;  3ZLP A;  3P2A A;  1VGL A;  5E4W A;  4V1A g;  3RDW A;  1K0D A;  1K3Y A;  3D22 A;  4L0W A;  4MCU A;  2OAC A;  3CRU A;  1YKC A;  4AJ6 A;  2H75 A;  1MTC A;  1JLW A;  2B5X A;  3DYR A;  1GSU A;  2FWE A;  2IIY A;  2V6K A;  2PWJ A;  3FHK A;  4PQ1 A;  1TOF A;  4FO5 A;  4FYC A;  1HNA A;  5CO3 A;  5B7C A;  4V1A p;  2IN3 A;  4IEL A;  2GZZ A;  3A2V A;  1C72 A;  1SYR A;  3US3 A;  4GQF A;  4F0B A;  3M9J A;  4ZB9 A;  1R5P A;  4MF5 A;  2E0Q A;  3ZML A;  1W4V A;  2FLS A;  4O5R A;  3WT2 A;  4P3Y B;  1ZGN A;  2H74 A;  1FG4 A;  1EWX A;  2D2Z A;  5ECS A;  1HNC A;  3D21 A;  1AQW A;  2CV4 A;  1S3A A;  3WT1 A;  4KX4 A;  2XPE A;  1K3L A;  4G2E A;  5EVO A;  3JCM L;  4H86 A;  4ZIL A;  2JZR A;  3NOF A;  1THX A;  2AHE A;  2IFQ B;  1Z7P A;  2XBQ A;  3DXB A;  2GZP A;  3LJR A;  5CNW A;  4NHZ A;  4OD7 A;  1JFU A;  5CYY A;  1THO A;  5ECH B;  2EIO A;  4KUN A;  5G2Z A;  4K0N A;  4JZQ A;  3IBH A;  1X5D A;  1ZYE A;  3EC3 A;  4WEY A;  3LSZ A;  4JRR A;  1N8J A;  1O8X A;  4GQC A;  3CXG A;  4EF0 A;  3H1N A;  2PPT A;  3DVW A;  4ML6 A;  3A3T A;  1XBS A;  2X64 A;  2MBS A;  4K7I A;  3ZIT A;  4POM A;  5F06 A;  2AYT A;  1H4O A;  4XTS A;  4ECJ A;  2WZ9 A;  2YWI A;  3EU4 A;  1AC1 A;  3ZFB A;  2JAD A;  2F8F A;  5ID2 B;  3GH6 A;  4IVF A;  4MH3 A;  1TXX A;  1GUH A;  2P0G A;  2C0G A;  2H66 A;  2CVB A;  2OBK A;  1TKD B;  2R2J A;  1AUC A;  1ZZY A;  4N0Z A;  3TRQ A;  2VCT A;  5ECO B;  2XHF A;  1WPI A;  2VM2 A;  1ERU A;  5J3R A;  2XC2 A;  2RM5 A;  3KH9 A;  5E59 A;  1T8E B;  3DGQ A;  4PUA A;  1R26 A;  1A24 A;  1Z5Y E;  2OAD A;  3E0U A;  4MZC A;  3UOM A;  2PUK C;  3IOS A;  5IM9 A;  1XIY A;  1TJD A;  1WE0 A;  4Q5Q A;  5ECQ B;  5C00 A;  1AAZ A;  2OA7 A;  1QXH A;  1Z9H A;  2VM1 A;  3ZYW A;  3CSH A;  2GTU A;  3UIW A;  2JSZ A;  3LGC A;  3UJ1 A;  1W89 A;  1GTU A;  3GA4 A;  2ES7 A;  6GSX A;  1FHE A;  2R4V A;  5DAK B;  2PVQ A;  5IMZ A;  3CSI A;  3FZ4 A;  2Z9S A;  5IMC A;  1FO5 A;  7GSS A;  4ZB8 A;  4I8B A;  4PUR A;  3GL5 A;  1E2Y A;  1XWK A;  2VLT A;  1T4Z A;  3H79 A;  5JCG A;  1ON4 A;  2HFD A;  5HR2 A;  4MK3 A;  2QC7 A;  2YAN A;  1HD2 A;  4FIW A;  3H93 A;  4IN0 A;  2HT9 A;  4ILF A;  4KW6 A;  3D4M A;  1LJR A;  3QD9 A;  4BVX A;  5L71 A;  1PX7 A;  1UVZ A;  4EDY A;  1O8W A;  5AGY A;  2FUG 2;  5INY A;  3IRA A;  5DCG A;  4L8E A;  2I1U A;  4LA1 A;  4TR0 A;  18GS A;  3HJM A;  2LQQ A;  3F0I A;  1U6T A;  2GQL A;  11GS A;  2VD1 A;  4NWY A;  1GTB A;  1HYU A;  4IS0 A;  3TRX A;  2WJU A;  2H1A A;  1G7E A;  4HS1 A;  1UC7 A;  3KGK A;  1YEX A;  1K0N A;  3HCZ A;  4ZBB A;  4DEJ A;  3GL3 A;  3U5R E;  1A23 A;  1GP1 A;  6GSS A;  2M72 A;  3LQ7 A;  1N2A A;  4QL9 A;  2F51 A;  1M2D A;  4HEA 2;  4BVY A;  2CVD A;  5G5F A;  4MPG A;  3M0F A;  2GZY A;  4MPF A;  1SEN A;  4V2M A;  2DIY A;  1SKS B;  1ILO A;  4IJ3 A;  3HA9 A;  2VCX A;  5HQP A;  2YN1 A;  2FD3 A;  4LL1 B;  2ZCT A;  4XHM A;  5EPF A;  4X43 A;  4AF2 A;  8GSS A;  1DE2 A;  3WYW A;  5HFG A;  1UA5 A;  3LOR A;  4KCE A;  1ERV A;  1USB A;  2K8V A;  3TOT A;  2AV4 A;  2DLX A;  1GNE A;  4ECC A;  4PX1 A;  3F6D A;  1EEJ A;  2IJY A;  4XIH A;  1G0T A;  1TU7 A;  3ISO A;  4HOJ A;  4MP4 A;  4FYU A;  1PL1 A;  2R6K A;  5ECI B;  1BED A;  4D73 A;  3ERW A;  2H70 A;  3TKR A;  3TJB A;  4X1U A;  4ECB A;  3O3T A;  3MWH A;  4TKY A;  2IPA A;  2VD0 A;  1EGO A;  3L0H A;  2GT6 A;  2H0H A;  2V32 A;  3GKK A;  4WXT A;  1SL1 B;  1FVJ A;  1HNB A;  4EO3 A;  4TRX A;  1XVQ A;  2JAC A;  5JWQ B;  3IAM 2;  1XZO A;  5HFK A;  3KIJ A;  4WET A;  2WGR A;  2E2M A;  2ZUP A;  2C4J A;  13GS A;  2DJ3 A;  2V41 A;  3E3E A;  4PGT A;  4GRF A;  1Y6E A;  1J08 A;  4POK A;  1ZYQ B;  4ML1 A;  2GT5 A;  1OC8 A;  3MDK A;  1K0C A;  4RQX A;  3GKX A;  2YJ7 A;  2AAW A;  1TI3 A;  3HVS A;  2B1L A;  4MDC A;  3KXO A;  2H8L A;  1X5C A;  3M9K A;  4Q5R A;  1M9A A;  1FAA A;  1MDI A;  2H6Y A;  2EIQ A;  4OWY A;  3U6V A;  2QGV A;  1G6Y A;  1V2A A;  20GS A;  4ZB6 A;  4IP6 A;  1XWC A;  2H0I A;  2N5F A;  4ZIJ A;  2VCW A;  5ECL B;  1GH2 A;  4GSN A;  3QMX A;  3G7J A;  2J9H A;  2BJX A;  3SBC A;  4PQH A;  3APQ A;  4GSS A;  4N0V A;  22GS A;  2I81 A;  4XS6 A;  1S3C A;  1X5E A;  5HR0 A;  2RUE A;  2KP1 A;  2NPB A;  4TXO B;  4G19 A;  3RHB A;  4MH2 A;  3APS A;  4POL A;  3GUS A;  4KDX A;  2PMT A;  4E8E A;  2M46 A;  1PRX A;  3HDC A;  4HQS A;  3VPT A;  2L6D A;  3GMF A;  3QFA C;  1VF3 A;  1SKW B;  3IAS 2;  4L5O A;  2LQO A;  5LD0 A;  1BYE A;  1KNG A;  3F3R A;  5AIV A;  4K7O A;  2YZH A;  4MZW A;  4DSS A;  2YCD A;  5GST A;  2H1B A;  2DJ2 A;  4ULX A;  2I9H A;  1ZOF A;  2FWG A;  2GGT A;  5D93 A;  2L6C A;  3QFB C;  3R2Q A;  3A2W A;  3C8E A;  3GTU A;  1MEK A;  2WCI A;  2HSH A; 
#chains in the Genus database with same CATH topology
 1YQ1 A;  4WR5 A;  2KOK A;  3D4T A;  3ZRE A;  2BTO T;  3RAZ A;  2CAI A;  3EVI A;  4EL1 A;  4YAP A;  4EC0 A;  2GSS A;  1QFN A;  1GSQ A;  3MNG A;  3TB2 A;  5D96 A;  1TK0 B;  1XVW A;  4F0C A;  4GWR A;  5A4U A;  4IBP A;  1GNW A;  2GQK A;  3GX0 A;  10GS A;  5D8I A;  2VO4 A;  3UL3 A;  4KA0 A;  4DSS B;  4KH7 A;  2LNS A;  4LL4 B;  2LRT A;  3TJG A;  4OCE A;  12GS A;  2FY6 A;  5DAL A;  5G31 A;  2C80 A;  4MA9 A;  3M8N A;  3UAR A;  4POB A;  2B5E A;  1QMV A;  1GSD A;  1OC9 B;  3FK8 A;  3KJY A;  1XWG A;  3KH7 A;  3ZVJ D;  3PIN A;  1ML6 A;  2AB6 A;  1MDJ A;  4JR4 A;  1PD2 1;  3HHV A;  1B8X A;  4O7H A;  1TK8 B;  1F3B A;  1F9M A;  1XFL A;  2GLR A;  4GTU A;  4IGJ A;  4MJB A;  3W8J A;  4BL7 A;  1XPV A;  4NPB A;  5ECK B;  4RUV A;  4KGI A;  1U88 A;  1T3B A;  5LNK e;  2RII A;  3VFI A;  4KSM A;  1B9X C;  2XPD A;  1NW2 A;  4NXI A;  1YF0 A;  5KN0 A;  2LST A;  4HU9 A;  2H73 A;  3EYT A;  1FOV A;  4GCI A;  1E6B A;  3IK9 A;  2L5L A;  3G9B A;  4WBR D;  5G1K A;  2YOI A;  2C3N A;  3FZA A;  1NM3 A;  2HE3 A;  1WOU A;  2JZT A;  4F2I A;  4NV5 A;  3I9V 2;  1DBY A;  3IC4 A;  4K1F A;  4XCS A;  1OYJ A;  3LWA A;  4AJ7 A;  5J41 A;  1QQ2 A;  4MF7 A;  1GLQ A;  4RI6 A;  1FB0 A;  4Z2R A;  3EMX A;  2E7P A;  2GQM A;  2F8A A;  3VWX A;  3KP9 A;  4DSR A;  3IA1 A;  1PX6 A;  4K6X A;  3HKR A;  2K9F A;  3RPP A;  1WP0 A;  3ZIJ A;  5ABR A;  2O89 A;  5JWO B;  1SJI A;  3GHA A;  2K6V A;  1GL8 A;  1XCC A;  5DQS A;  2WDU A;  3F6F A;  4ZBD A;  2LKU A;  1WIK A;  2FHE A;  1T1V A;  3VPQ A;  3GH9 A;  4HZ4 A;  2HXK A;  4KE3 A;  5FHI A;  1JHB A;  2HSM A;  1VF1 A;  2YP6 A;  3GSS A;  4K5S A;  3HY2 A;  2VCQ A;  4K2D A;  4EE0 A;  4EVM A;  2CZ3 A;  5CRW A;  1MD3 A;  4OO5 A;  1FVK A;  3A5W A;  5KOW A;  3GYK A;  4ZL7 A;  1GLP A;  2CAQ A;  1J0F A;  2H1D A;  1T00 A;  3GST A;  5CP1 A;  5H5R A;  3F63 A;  2PN8 A;  4KB3 A;  2HSY A;  1YDK A;  5IPG A;  1K0A A;  1YY7 A;  5EY6 A;  3D6I A;  4KAE A;  3J7Y b;  2ON5 A;  4J57 E;  2CA8 A;  1TP9 A;  1NSW A;  3IC8 A;  3W6G A;  2YNX A;  5B6N A;  4CY8 A;  4BWQ A;  3GN3 A;  3NIV A;  4ACS A;  2N5A A;  1ABA A;  5J5N A;  2K8S A;  2WS2 A;  3QCP A;  3HVV A;  4YAV A;  4RI7 A;  4Z7X A;  4WR4 A;  1PN9 A;  1F2E A;  4XS1 A;  4YQM A;  2ALB A;  3QR6 A;  1T7P B;  2CX3 A;  1EEM A;  3UVH A;  3TKP A;  1SK0 A;  5ECR B;  3TCO A;  1Q98 A;  4LLR A;  1G7O A;  5B6M A;  5F0G A;  2RLI A;  3FR3 A;  2JU5 A;  3PR8 A;  2CZ2 A;  3TKQ A;  2HRN A;  1Q4J A;  4EIP A;  3FY7 A;  3FW2 A;  2MZC A;  5IMD A;  5CRE A;  1EZK A;  2PVO C;  3Q19 A;  3VK9 A;  3IDV A;  2VAF A;  4ZL9 A;  1GSF A;  1X9S B;  4HQZ A;  2HYX A;  1K3O A;  3DWV A;  3QDN A;  2IWT A;  1LU4 A;  1ACV A;  3UMA A;  5IMV A;  4MF6 A;  1SL2 B;  3MYD A;  3F4S A;  1EOG A;  3UEM A;  1ZYP A;  4MMM A;  4TR4 A;  2L4Q A;  4HJM A;  3EE2 A;  2GSR A;  1AW9 A;  2G0F A;  2H1G A;  2G2Q A;  2V2G A;  4BVX B;  4Q5F A;  3PH9 A;  4Q5N A;  3HZ8 A;  5F07 A;  3BBY A;  1ZCP A;  3EUR A;  4MNN A;  3O76 A;  1QGV A;  2GVP A;  1TRS A;  1R7H A;  4BA7 A;  4O32 A;  1M3I A;  2LTK A;  4HJ2 A;  3G7I A;  3GRX A;  2H76 A;  2C8U A;  2PU9 C;  1F3A A;  1NHO A;  4N10 A;  4TR3 A;  1FOH A;  1AQX A;  4TN8 A;  1PFO A;  3C1R A;  3L78 A;  14GS A;  4Z2U A;  2FNO A;  3IHQ A;  2OE1 A;  5JCW A;  4BVY B;  1XW5 A;  2CVK A;  3GFK A;  4HI7 A;  1GUM A;  3EWL A;  1YKA A;  4TVE A;  3IPZ A;  2IMI A;  3CSJ A;  5ECN B;  1DSB A;  2DC5 A;  3MAK A;  2B7K A;  3GX8 A;  4WBJ A;  2ON7 A;  3QAG A;  2O8V B;  3S9F A;  1FW1 A;  1X9W B;  3FR9 A;  3KTL A;  2AJQ B;  3WGX A;  2FCH A;  1S3D A;  4LMW A;  4JBB A;  5AIX A;  5CAX A;  1J9B A;  5CRD A;  1OC3 A;  2QA1 A;  3D5J A;  2NTO A;  2A4V A;  1CQG A;  2R0C A;  2XBI A;  4RQR A;  1M3J A;  3DRN A;  1EV4 A;  3KP8 A;  1BG5 A;  3ME7 A;  5C04 A;  4D73 B;  2REM A;  4CW9 A;  2DIZ A;  4LMV A;  3A5I A;  2C3Q A;  3UVT A;  3VLN A;  2NDO A;  1SKR B;  1BAY A;  1O6J A;  3Q6O A;  4N30 A;  6GSY A;  4PNF A;  1QUW A;  2DJK A;  4EUY A;  4ECI A;  2L59 A;  4EIQ A;  4K7N A;  1PKZ A;  3F3Q A;  3LG6 A;  2A2R A;  5G1L A;  1VF2 A;  1TDI A;  4EDZ A;  1V40 A;  3VUR A;  1Y25 A;  3QAW A;  4G9H A;  2FA4 A;  2M80 A;  2MMA A;  1JZO A;  3BJ5 A;  5D73 A;  4K0G A;  5KN2 A;  2LEG A;  1GTA A;  3MIX A;  4ZL8 A;  3CQF A;  3N5O A;  3KZQ A;  2R37 A;  1OKD A;  4TOP A;  2GS3 A;  5IOW A;  2O87 A;  2UZ8 A;  2WFC A;  3P7X A;  1PKW A;  4WKW A;  2PGT A;  3EIN A;  1A2M A;  1A2J A;  4XS4 A;  1GSS A;  1MDK A;  4O92 A;  3TDG A;  2DJ0 A;  1PSQ A;  4KSO A;  2GDR A;  4PNG A;  2H6X A;  5G30 A;  4OMV A;  2LRN A;  1LBK A;  2NVL A;  5DQY A;  2EC4 A;  3LEF A;  5IMF A;  1DE1 A;  1XOB A;  2V6O A;  5DJM A;  5IMA A;  4ISD A;  3H8Q A;  2HRA A;  2KUC A;  2PBJ A;  2RM6 A;  3CYN A;  2HZE A;  4JU5 A;  1XXU A;  4BPY A;  1X9M B;  2L4C A;  2OBI A;  3VWW A;  5KN1 A;  1GUK A;  2IMK A;  3OR5 A;  4NV2 A;  5CRH A;  3L9U A;  1GTI A;  4KDU A;  4OO4 A;  1RK4 A;  2H71 A;  5KN3 A;  2YZU A;  3TOU A;  3IK7 A;  5GAN D;  1YZX A;  4YH2 A;  4K8M A;  1I9D A;  2C0F A;  3QOU A;  1EGR A;  4J2F A;  5LCZ A;  2DBC A;  3HXS A;  4DVC A;  1KTE A;  1VF4 A;  2J23 A;  3LYK A;  1WMJ A;  2IMD A;  3GKM A;  1V9W A;  1B48 A;  5ENU A;  1HQO A;  4PQI A;  3BCK A;  4HUA A;  3IE3 A;  2H19 A;  3FEU A;  2H01 A;  1SJZ A;  3CMI A;  3GTU B;  3MSZ A;  5DBQ A;  1X0R A;  4CHS A;  2HZE B;  1XWB A;  17GS A;  2MMO A;  3J7Y k;  4I2T A;  2OE0 A;  2H0G A;  2IFQ A;  4L0U A;  1M0U A;  1ERT A;  2MMZ A;  1GWC A;  2RUF A;  5GZZ B;  2DSA A;  4IQA A;  2IL3 A;  2YWM A;  2KP2 A;  3ERG A;  19GS A;  4JED A;  1XOA A;  4MZB A;  2B3S A;  3QPM A;  3ZRD A;  5IQY A;  1PMT A;  2VUP A;  3ED3 A;  3FZ5 A;  5IPH A;  3FYG A;  3C7M A;  5FT3 A;  1R5A A;  1K0O A;  1A2L A;  1V57 A;  2LJA A;  5ECP B;  3W8S A;  5GAP D;  2YWN A;  5G5E A;  3DVX A;  2KHP A;  3H4K A;  4TXV A;  4F03 A;  5ID2 A;  1O73 A;  2GST A;  2EIR A;  4MJE A;  5DJL A;  3ZFL A;  3I6A A;  1TU8 A;  5DAL B;  2L57 A;  1T4Y A;  1I5G A;  1PL2 A;  5JCU A;  2VL9 A;  3EPT A;  3FMW A;  1F6M C;  3CTF A;  1TK5 B;  1SD8 A;  5A4V A;  5F8B A;  4I5Q A;  2DMM A;  4YKF A;  6GSU A;  3VWV A;  2LUS A;  1CQH A;  2LJK A;  2PER A;  4GLT A;  2B1K A;  2N5B A;  16GS A;  3VI5 A;  5A4W A;  2VIM A;  5IOX A;  4NHW A;  2H72 A;  4OFT A;  1U87 A;  2C0D A;  4G0I A;  3UBK A;  4Z2T A;  4G10 A;  3KMN A;  3O6T A;  4WF5 A;  3ERF A;  1M7T A;  3M3M A;  2LJR A;  4PXO A;  1K0M A;  2K18 A;  4YQV A;  4BL7 B;  1O85 A;  2CQ9 A;  1SD9 A;  4IKH A;  3HD5 A;  3HVX A;  2HNL A;  3N9J A;  2P5R A;  3NZN A;  3EMP A;  4JE1 A;  3TRP A;  4KDY A;  5D9W A;  1MD4 A;  1UN2 A;  5ELA A;  1XG8 A;  5DAK A;  5D9V A;  5H5Q A;  5AIS A;  3TKS E;  4KND A;  3TJF A;  3ZVJ A;  1K0B A;  5CRG A;  4PUF C;  4JR6 A;  4GF0 A;  1ZYN A;  4HDE A;  2QKE A;  1KBN A;  3F9U A;  3SWL A;  3QAV A;  3GIX A;  1U3I A;  1O7U A;  1SU9 A;  3GNJ A;  3GUR A;  4F82 A;  4X0X A;  2JL4 A;  2LRC A;  2YV9 A;  3KD0 A;  4YQU A;  3G7Y A;  3KMO A;  3LXT A;  2HZF A;  1V58 A;  1FB6 A;  4MAB A;  3WD6 A;  4XRA A;  3TUE A;  3ME8 A;  1URM A;  3PGT A;  3APO A;  1M9B A;  2VL3 A;  3VI7 A;  2VLV A;  3CTG A;  3D0Z A;  1Z7R A;  1B9Y C;  1WJK A;  3DD3 A;  2OE3 A;  1WWJ A;  5B8B A;  1AXD A;  1SK2 A;  3KCM A;  3TJJ A;  3DIE A;  2LNT A;  4OFN A;  5IIZ A;  3DKS A;  6GSV A;  2CT6 A;  4G0K A;  5EL8 A;  4IP1 A;  2L5O A;  3I69 A;  1B4P A;  2JSY A;  1OAZ A;  1NHY A;  3F4R A;  2NBS A;  3EU3 A;  5H5S A;  3ZZX A;  3GKN A;  2F3M A;  4V2N A;  2IME A;  2TRC P;  5BMU A;  1ZL9 A;  2P5Q A;  4KF9 A;  2DKH A;  2A2P A;  5J9C A;  2B7J A;  2P31 A;  4USS A;  9GSS A;  4E8H A;  4ZXG A;  3GV1 A;  4IQ1 A;  1DUG A;  4L5L A;  1SYX A;  3TKS C;  4GXZ A;  1PN0 A;  1TRW A;  1TW9 A;  5J9B A;  4BIK A;  1U3A A;  3HYP A;  5FWG A;  2MYG A;  4FH8 A;  2A2S A;  2X8G A;  4CY6 A;  2HRF A;  1M2A A;  2YWO A;  5DCH A;  1XW6 A;  2HLS A;  4NMU A;  2B5Y A;  4KCA A;  2R5G A;  3M1G A;  3ZMK A;  1GUL A;  1JZW A;  2I3Y A;  1JZD A;  1TI1 A;  6GST A;  2DML A;  2O85 A;  4NAX A;  2C3T A;  1AQV A;  2V1M A;  2FWF A;  2VLU A;  1G6W A;  1M2B A;  3Q74 A;  2MBT A;  2YPM A;  2DJJ A;  1WRY A;  1TTZ A;  1Z6M A;  1EOH A;  4OCF A;  3TGZ A;  4I2U A;  1ERW A;  1GSE A;  2LS5 A;  4X4J A;  1TRU A;  2YV7 A;  3L4N A;  2FWH A;  3UBL A;  3AY8 A;  1XWA A;  4DSQ A;  1IYI A;  3HZ4 A;  5HR1 A;  4FYB A;  4CDO A;  1OE7 A;  1O81 A;  4ID0 A;  2B6M A;  3CBU A;  4IHU A;  4IW9 A;  4TR1 A;  1BQ7 A;  4N11 A;  5IO0 A;  3KTB A;  2FA8 A;  1JZR A;  3L9V A;  2E2G A;  2VL2 C;  2C0E A;  5IO2 A;  2TRX A;  2OJL A;  3C73 A;  1EV9 A;  3IXR A;  4A5P A;  4AJ8 A;  2AUV A;  2WRT A;  4MJA A;  5J4U A;  1XW9 A;  2WUL A;  4EXJ A;  3HJP A;  1A0R P;  1YJ6 A;  2JZS A;  5HFI A;  3ZIV A;  1A0F A;  5JWR B;  4XRD A;  1JLV A;  3BOA A;  2KLX A;  1H75 A;  1B4Q A;  1OKT A;  1Z3E A;  5D9T A;  1SK1 A;  5A5K A;  1YEP A;  2H6Z A;  4I97 A;  3P8W A;  1QK8 A;  1YF1 A;  4TW5 A;  2I4A A;  1F37 A;  1SJ6 A;  4TR1 B;  1OE8 A;  3A2X A;  3ZTL A;  4IJI A;  4V2L A;  2R3X A;  3HJO A;  3TKS A;  1RW1 A;  1PQN A;  4K5R A;  3TJK A;  3C1S A;  3WGE A;  2X8H A;  5HR3 A;  4TXO A;  4MLY A;  3BCI A;  3CRT A;  4MJC A;  5KEJ A;  1A8Y A;  2C1Y A;  2MMN A;  3E9J B;  3LYP A;  2OKA A;  4F9Z A;  3LXZ A;  1M99 A;  4HZ2 A;  1VRS D;  3F8U A;  2LV3 A;  2BMX A;  1Z6N A;  2H30 A;  1GRX A;  3LFL A;  4ZBA A;  3P90 A;  2HI7 A;  3ZL5 A;  1AIU A;  3KM6 A;  3RBT A;  3UAP A;  4K9Z A;  4HSC X;  4GST A;  4QL7 A;  2F9S A;  1ST9 A;  1V98 A;  3FR6 A;  1R4W A;  2CX4 A;  2ZNM A;  3FRC A;  3V1W A;  1SL0 B;  3RHC A;  5F05 A;  3F4T A;  4HU7 A;  1GSY A;  4OFM A;  3FKF A;  4J56 E;  5DDL A;  2GSQ A;  2X8C A;  1KEB A;  3I43 A;  5DVB A;  3K8N A;  1IYH A;  1PGT A;  2O7K A;  2TIR A;  2VL2 A;  2X99 A;  3FZ9 A;  3BD2 A;  4WF4 A;  2DJ1 A;  1A8L A;  3IV4 A;  4I6X A;  4EKZ A;  1BX9 A;  1ZMA A;  1RQM A;  2VOC A;  3RPN A;  1OVN A;  2YJH A;  5D9X A;  3IR4 A;  1BJX A;  3Q18 A;  4QQ7 A;  4BWS A;  5COH A;  2QSI A;  2FGX A;  1PA3 A;  2R0P A;  3VWU A;  5AN1 A;  3DEX A;  5B8A A;  2WB9 A;  5GSS A;  2QA2 A;  3DML A;  4AGS A;  1TRV A;  3WGD A;  3C71 A;  2VCZ A;  2VCV A;  5ECM B;  4XS4 B;  1OC9 A;  5ELG A;  4O5Q A;  6GSW A;  3KEB A;  1EP7 A;  3L9S A;  1EP8 A;  2IMF A;  3ZLP A;  3P2A A;  1VGL A;  5E4W A;  4V1A g;  3RDW A;  1K0D A;  1K3Y A;  3D22 A;  4L0W A;  4MCU A;  2OAC A;  3CRU A;  4PTS A;  1YKC A;  4AJ6 A;  2H75 A;  1MTC A;  1JLW A;  2R0G A;  2B5X A;  3DYR A;  1GSU A;  2FWE A;  2IIY A;  2V6K A;  2PWJ A;  3FHK A;  4PQ1 A;  1TOF A;  4FO5 A;  4FYC A;  1HNA A;  5CO3 A;  5B7C A;  4V1A p;  2IN3 A;  4IEL A;  2GZZ A;  2X49 A;  1C72 A;  3A2V A;  1SYR A;  3US3 A;  4GQF A;  4F0B A;  3M9J A;  4ZB9 A;  1R5P A;  4MF5 A;  2E0Q A;  3ZML A;  1W4V A;  2FLS A;  4O5R A;  3WT2 A;  4P3Y B;  1ZGN A;  2H74 A;  1FG4 A;  1EWX A;  2D2Z A;  5ECS A;  1HNC A;  3D21 A;  1AQW A;  2CV4 A;  1S3A A;  3WT1 A;  4KX4 A;  2XPE A;  1K3L A;  4G2E A;  5EVO A;  3JCM L;  4H86 A;  4ZIL A;  2JZR A;  3NOF A;  1THX A;  2AHE A;  2IFQ B;  1Z7P A;  2XBQ A;  3DXB A;  2GZP A;  3LJR A;  5CNW A;  4NHZ A;  4OD7 A;  1JFU A;  5CYY A;  1THO A;  5ECH B;  2EIO A;  4KUN A;  5G2Z A;  4K0N A;  4JZQ A;  3IBH A;  1X5D A;  1ZYE A;  3EC3 A;  4WEY A;  3LSZ A;  4JRR A;  1N8J A;  1O8X A;  4GQC A;  3CXG A;  4EF0 A;  3H1N A;  2PPT A;  3DVW A;  4ML6 A;  3A3T A;  1XBS A;  2X64 A;  2MBS A;  4K7I A;  3ZIT A;  4POM A;  5F06 A;  2AYT A;  1H4O A;  4XTS A;  4ECJ A;  2WZ9 A;  2YWI A;  3EU4 A;  1AC1 A;  3ZFB A;  2JAD A;  2F8F A;  5BRT A;  5ID2 B;  3GH6 A;  4IVF A;  4MH3 A;  1TXX A;  1GUH A;  2P0G A;  2C0G A;  2H66 A;  2CVB A;  2OBK A;  1TKD B;  2R2J A;  1AUC A;  1ZZY A;  4N0Z A;  3TRQ A;  2VCT A;  5ECO B;  2XHF A;  1WPI A;  4YKG A;  2VM2 A;  1ERU A;  5J3R A;  2XC2 A;  3LW9 A;  2DKI A;  2RM5 A;  3KH9 A;  5E59 A;  1T8E B;  3DGQ A;  4PUA A;  1R26 A;  1A24 A;  1Z5Y E;  2OAD A;  3E0U A;  4MZC A;  3UOM A;  2PUK C;  3IOS A;  5IM9 A;  1XIY A;  1TJD A;  1WE0 A;  4Q5Q A;  5ECQ B;  5C00 A;  1AAZ A;  2OA7 A;  1QXH A;  1Z9H A;  2VM1 A;  3ZYW A;  3CSH A;  2GTU A;  3UIW A;  2JSZ A;  3LGC A;  3UJ1 A;  1W89 A;  1GTU A;  3GA4 A;  2ES7 A;  6GSX A;  1FHE A;  2R4V A;  3IHG A;  5DAK B;  2PVQ A;  5IMZ A;  3CSI A;  3FZ4 A;  2Z9S A;  5IMC A;  1FO5 A;  7GSS A;  4ZB8 A;  4I8B A;  4PUR A;  3GL5 A;  1E2Y A;  1XWK A;  2VLT A;  1T4Z A;  3H79 A;  5JCG A;  1ON4 A;  2HFD A;  5HR2 A;  4MK3 A;  2QC7 A;  2YAN A;  1HD2 A;  4FIW A;  3H93 A;  4IN0 A;  2HT9 A;  4ILF A;  4KW6 A;  3D4M A;  1LJR A;  3QD9 A;  4BVX A;  5L71 A;  1PX7 A;  4O5U A;  1UVZ A;  4EDY A;  1O8W A;  5AGY A;  2FUG 2;  5INY A;  3IRA A;  5DCG A;  4L8E A;  2I1U A;  4LA1 A;  4TR0 A;  18GS A;  3HJM A;  2LQQ A;  3F0I A;  1U6T A;  2GQL A;  11GS A;  2VD1 A;  4NWY A;  1GTB A;  1HYU A;  4IS0 A;  3TRX A;  2WJU A;  2H1A A;  1G7E A;  4ICY A;  4HS1 A;  1UC7 A;  3KGK A;  2HRK A;  1YEX A;  1K0N A;  3HCZ A;  4ZBB A;  4DEJ A;  3GL3 A;  3U5R E;  1A23 A;  1GP1 A;  6GSS A;  2M72 A;  3LQ7 A;  1N2A A;  4QL9 A;  4FQU A;  2F51 A;  1M2D A;  4HEA 2;  4BVY A;  2CVD A;  5G5F A;  4MPG A;  3M0F A;  2GZY A;  4MPF A;  1SEN A;  4V2M A;  2DIY A;  1SKS B;  1ILO A;  4IJ3 A;  3HA9 A;  2VCX A;  5HQP A;  2YN1 A;  2FD3 A;  4LL1 B;  2ZCT A;  4XHM A;  5EPF A;  4X43 A;  4AF2 A;  8GSS A;  1DE2 A;  3WYW A;  5HFG A;  1UA5 A;  3LOR A;  4KCE A;  1ERV A;  1USB A;  2K8V A;  3TOT A;  2AV4 A;  2DLX A;  1GNE A;  4ECC A;  4PX1 A;  3F6D A;  1EEJ A;  2IJY A;  4XIH A;  1G0T A;  1TU7 A;  3ISO A;  4HOJ A;  4MP4 A;  4FYU A;  1PL1 A;  2R6K A;  5ECI B;  1BED A;  4D73 A;  3ERW A;  2H70 A;  3TKR A;  3TJB A;  4X1U A;  4ECB A;  3O3T A;  3MWH A;  4TKY A;  2IPA A;  2VD0 A;  1EGO A;  3L0H A;  2GT6 A;  2H0H A;  2V32 A;  3GKK A;  4WXT A;  1SL1 B;  1FVJ A;  1HNB A;  4EO3 A;  2A4H A;  4TRX A;  1XVQ A;  2JAC A;  5JWQ B;  3IAM 2;  4K2X A;  1XZO A;  5HFK A;  3KIJ A;  4WET A;  2WGR A;  2E2M A;  2ZUP A;  2C4J A;  13GS A;  2DJ3 A;  2V41 A;  3E3E A;  4PGT A;  4GRF A;  1Y6E A;  1J08 A;  4POK A;  1ZYQ B;  4ML1 A;  2GT5 A;  1OC8 A;  3MDK A;  1K0C A;  4RQX A;  3GKX A;  2YJ7 A;  2AAW A;  1TI3 A;  3HVS A;  2B1L A;  4MDC A;  3KXO A;  2H8L A;  3PPU A;  1X5C A;  3M9K A;  4Q5R A;  1M9A A;  1FAA A;  1MDI A;  2H6Y A;  2EIQ A;  4OWY A;  3U6V A;  3HVN A;  2QGV A;  5KOX A;  1G6Y A;  2X4A A;  1V2A A;  20GS A;  4ZB6 A;  4IP6 A;  1XWC A;  2H0I A;  2N5F A;  4ZIJ A;  2VCW A;  5ECL B;  1S3R A;  1GH2 A;  4GSN A;  3QMX A;  3G7J A;  2J9H A;  4G0L A;  2BJX A;  3SBC A;  4PQH A;  3R3E A;  3APQ A;  4GSS A;  4N0V A;  22GS A;  2I81 A;  4XS6 A;  1S3C A;  1X5E A;  5HR0 A;  2RUE A;  2KP1 A;  2NPB A;  4TXO B;  4G19 A;  3RHB A;  4MH2 A;  3APS A;  4POL A;  3GUS A;  4KDX A;  2PMT A;  4E8E A;  2M46 A;  1PRX A;  3HDC A;  4HQS A;  3VPT A;  2L6D A;  3GMF A;  3QFA C;  1VF3 A;  1SKW B;  3IAS 2;  4L5O A;  2LQO A;  5LD0 A;  1BYE A;  1KNG A;  3F3R A;  5AIV A;  4K7O A;  2YZH A;  4MZW A;  4DSS A;  2YCD A;  5GST A;  2H1B A;  2DJ2 A;  4ULX A;  2I9H A;  1ZOF A;  2FWG A;  2GGT A;  5D93 A;  2L6C A;  3QFB C;  3R2Q A;  3A2W A;  3C8E A;  3GTU A;  1MEK A;  2WCI A;  2HSH A; 
#chains in the Genus database with same CATH homology
 1YQ1 A;  4WR5 A;  2KOK A;  3D4T A;  3ZRE A;  2BTO T;  3RAZ A;  2CAI A;  3EVI A;  4EL1 A;  4YAP A;  4EC0 A;  2GSS A;  1QFN A;  1GSQ A;  3MNG A;  3TB2 A;  5D96 A;  1TK0 B;  1XVW A;  4F0C A;  4GWR A;  5A4U A;  4IBP A;  1GNW A;  2GQK A;  3GX0 A;  10GS A;  5D8I A;  2VO4 A;  3UL3 A;  4KA0 A;  4DSS B;  4KH7 A;  2LNS A;  4LL4 B;  2LRT A;  3TJG A;  4OCE A;  12GS A;  2FY6 A;  5DAL A;  5G31 A;  2C80 A;  4MA9 A;  3M8N A;  3UAR A;  4POB A;  2B5E A;  1QMV A;  1GSD A;  1OC9 B;  3FK8 A;  3KJY A;  1XWG A;  3KH7 A;  3ZVJ D;  3PIN A;  1ML6 A;  2AB6 A;  1MDJ A;  4JR4 A;  1PD2 1;  3HHV A;  1B8X A;  4O7H A;  1TK8 B;  1F3B A;  1F9M A;  1XFL A;  2GLR A;  4GTU A;  4IGJ A;  4MJB A;  3W8J A;  4BL7 A;  1XPV A;  4NPB A;  5ECK B;  4RUV A;  4KGI A;  1U88 A;  1T3B A;  5LNK e;  2RII A;  3VFI A;  4KSM A;  1B9X C;  2XPD A;  1NW2 A;  4NXI A;  1YF0 A;  5KN0 A;  2LST A;  4HU9 A;  2H73 A;  3EYT A;  1FOV A;  4GCI A;  1E6B A;  3IK9 A;  2L5L A;  3G9B A;  4WBR D;  5G1K A;  2YOI A;  2C3N A;  3FZA A;  1NM3 A;  2HE3 A;  1WOU A;  2JZT A;  4F2I A;  4NV5 A;  3I9V 2;  1DBY A;  3IC4 A;  4K1F A;  4XCS A;  1OYJ A;  3LWA A;  4AJ7 A;  5J41 A;  1QQ2 A;  4MF7 A;  1GLQ A;  4RI6 A;  1FB0 A;  4Z2R A;  3EMX A;  2E7P A;  2GQM A;  2F8A A;  3VWX A;  3KP9 A;  4DSR A;  3IA1 A;  1PX6 A;  4K6X A;  3HKR A;  2K9F A;  3RPP A;  1WP0 A;  3ZIJ A;  5ABR A;  2O89 A;  5JWO B;  1SJI A;  3GHA A;  2K6V A;  1GL8 A;  1XCC A;  5DQS A;  2WDU A;  3F6F A;  4ZBD A;  2LKU A;  1WIK A;  2FHE A;  1T1V A;  3VPQ A;  3GH9 A;  4HZ4 A;  2HXK A;  4KE3 A;  5FHI A;  1JHB A;  2HSM A;  1VF1 A;  2YP6 A;  3GSS A;  4K5S A;  3HY2 A;  2VCQ A;  4K2D A;  4EE0 A;  4EVM A;  2CZ3 A;  5CRW A;  1MD3 A;  4OO5 A;  1FVK A;  3A5W A;  5KOW A;  3GYK A;  4ZL7 A;  1GLP A;  2CAQ A;  1J0F A;  2H1D A;  1T00 A;  3GST A;  5CP1 A;  5H5R A;  3F63 A;  2PN8 A;  4KB3 A;  2HSY A;  1YDK A;  5IPG A;  1K0A A;  1YY7 A;  5EY6 A;  3D6I A;  4KAE A;  3J7Y b;  2ON5 A;  4J57 E;  2CA8 A;  1TP9 A;  1NSW A;  3IC8 A;  3W6G A;  2YNX A;  5B6N A;  4CY8 A;  4BWQ A;  3GN3 A;  3NIV A;  4ACS A;  2N5A A;  1ABA A;  5J5N A;  2K8S A;  2WS2 A;  3QCP A;  3HVV A;  4YAV A;  4RI7 A;  4Z7X A;  4WR4 A;  1PN9 A;  1F2E A;  4XS1 A;  4YQM A;  2ALB A;  3QR6 A;  1T7P B;  2CX3 A;  1EEM A;  3UVH A;  3TKP A;  1SK0 A;  5ECR B;  3TCO A;  1Q98 A;  4LLR A;  1G7O A;  5B6M A;  5F0G A;  2RLI A;  3FR3 A;  2JU5 A;  3PR8 A;  2CZ2 A;  3TKQ A;  2HRN A;  1Q4J A;  4EIP A;  3FY7 A;  3FW2 A;  2MZC A;  5IMD A;  5CRE A;  1EZK A;  2PVO C;  3Q19 A;  3VK9 A;  3IDV A;  2VAF A;  4ZL9 A;  1GSF A;  1X9S B;  4HQZ A;  2HYX A;  1K3O A;  3DWV A;  3QDN A;  2IWT A;  1LU4 A;  1ACV A;  3UMA A;  5IMV A;  4MF6 A;  1SL2 B;  3MYD A;  3F4S A;  1EOG A;  3UEM A;  1ZYP A;  4MMM A;  4TR4 A;  2L4Q A;  4HJM A;  3EE2 A;  2GSR A;  1AW9 A;  2G0F A;  2H1G A;  2G2Q A;  2V2G A;  4BVX B;  4Q5F A;  3PH9 A;  4Q5N A;  3HZ8 A;  5F07 A;  3BBY A;  1ZCP A;  3EUR A;  4MNN A;  3O76 A;  1QGV A;  2GVP A;  1TRS A;  1R7H A;  4BA7 A;  4O32 A;  2LTK A;  4HJ2 A;  3G7I A;  3GRX A;  2H76 A;  2C8U A;  2PU9 C;  1F3A A;  1NHO A;  4N10 A;  4TR3 A;  1FOH A;  1AQX A;  4TN8 A;  3C1R A;  3L78 A;  14GS A;  4Z2U A;  2FNO A;  3IHQ A;  2OE1 A;  5JCW A;  4BVY B;  1XW5 A;  2CVK A;  3GFK A;  4HI7 A;  1GUM A;  3EWL A;  1YKA A;  4TVE A;  3IPZ A;  2IMI A;  3CSJ A;  5ECN B;  1DSB A;  2DC5 A;  3MAK A;  2B7K A;  3GX8 A;  4WBJ A;  2ON7 A;  3QAG A;  2O8V B;  3S9F A;  1FW1 A;  1X9W B;  3FR9 A;  3KTL A;  2AJQ B;  3WGX A;  2FCH A;  1S3D A;  4LMW A;  4JBB A;  5AIX A;  5CAX A;  1J9B A;  5CRD A;  1OC3 A;  2QA1 A;  3D5J A;  2NTO A;  2A4V A;  1CQG A;  2R0C A;  2XBI A;  4RQR A;  3DRN A;  1EV4 A;  3KP8 A;  1BG5 A;  3ME7 A;  5C04 A;  4D73 B;  2REM A;  4CW9 A;  2DIZ A;  4LMV A;  3A5I A;  2C3Q A;  3UVT A;  3VLN A;  2NDO A;  1SKR B;  1BAY A;  1O6J A;  3Q6O A;  4N30 A;  6GSY A;  4PNF A;  1QUW A;  2DJK A;  4EUY A;  4ECI A;  2L59 A;  4EIQ A;  4K7N A;  1PKZ A;  3F3Q A;  3LG6 A;  2A2R A;  5G1L A;  1VF2 A;  1TDI A;  4EDZ A;  1V40 A;  3VUR A;  1Y25 A;  3QAW A;  4G9H A;  2FA4 A;  2M80 A;  2MMA A;  1JZO A;  3BJ5 A;  5D73 A;  4K0G A;  5KN2 A;  2LEG A;  1GTA A;  3MIX A;  4ZL8 A;  3N5O A;  3KZQ A;  2R37 A;  1OKD A;  4TOP A;  2GS3 A;  5IOW A;  2O87 A;  2UZ8 A;  2WFC A;  3P7X A;  1PKW A;  4WKW A;  2PGT A;  3EIN A;  1A2M A;  1A2J A;  4XS4 A;  1GSS A;  1MDK A;  4O92 A;  3TDG A;  2DJ0 A;  1PSQ A;  4KSO A;  2GDR A;  4PNG A;  2H6X A;  5G30 A;  4OMV A;  2LRN A;  1LBK A;  2NVL A;  5DQY A;  2EC4 A;  3LEF A;  5IMF A;  1DE1 A;  1XOB A;  2V6O A;  5DJM A;  5IMA A;  4ISD A;  3H8Q A;  2HRA A;  2KUC A;  2PBJ A;  2RM6 A;  3CYN A;  2HZE A;  4JU5 A;  1XXU A;  4BPY A;  1X9M B;  2L4C A;  2OBI A;  3VWW A;  5KN1 A;  1GUK A;  2IMK A;  3OR5 A;  4NV2 A;  5CRH A;  3L9U A;  1GTI A;  4KDU A;  4OO4 A;  1RK4 A;  2H71 A;  5KN3 A;  2YZU A;  3TOU A;  3IK7 A;  5GAN D;  1YZX A;  4YH2 A;  4K8M A;  1I9D A;  2C0F A;  3QOU A;  1EGR A;  4J2F A;  5LCZ A;  2DBC A;  3HXS A;  4DVC A;  1KTE A;  1VF4 A;  2J23 A;  3LYK A;  1WMJ A;  2IMD A;  3GKM A;  1V9W A;  1B48 A;  5ENU A;  1HQO A;  4PQI A;  3BCK A;  4HUA A;  3IE3 A;  2H19 A;  3FEU A;  2H01 A;  1SJZ A;  3CMI A;  3GTU B;  3MSZ A;  5DBQ A;  1X0R A;  4CHS A;  2HZE B;  1XWB A;  17GS A;  2MMO A;  3J7Y k;  4I2T A;  2OE0 A;  2H0G A;  2IFQ A;  4L0U A;  1M0U A;  1ERT A;  2MMZ A;  1GWC A;  2RUF A;  5GZZ B;  2DSA A;  4IQA A;  2IL3 A;  2YWM A;  2KP2 A;  3ERG A;  19GS A;  4JED A;  1XOA A;  4MZB A;  2B3S A;  3QPM A;  3ZRD A;  5IQY A;  1PMT A;  2VUP A;  3ED3 A;  3FZ5 A;  5IPH A;  3FYG A;  3C7M A;  5FT3 A;  1R5A A;  1K0O A;  1A2L A;  1V57 A;  2LJA A;  5ECP B;  3W8S A;  5GAP D;  2YWN A;  5G5E A;  3DVX A;  2KHP A;  3H4K A;  4TXV A;  4F03 A;  5ID2 A;  1O73 A;  2GST A;  2EIR A;  4MJE A;  5DJL A;  3ZFL A;  3I6A A;  1TU8 A;  5DAL B;  2L57 A;  1T4Y A;  1I5G A;  1PL2 A;  5JCU A;  2VL9 A;  3EPT A;  3FMW A;  1F6M C;  3CTF A;  1TK5 B;  1SD8 A;  5A4V A;  5F8B A;  4I5Q A;  2DMM A;  4YKF A;  6GSU A;  3VWV A;  2LUS A;  1CQH A;  2LJK A;  2PER A;  4GLT A;  2B1K A;  2N5B A;  16GS A;  3VI5 A;  5A4W A;  2VIM A;  5IOX A;  4NHW A;  2H72 A;  4OFT A;  1U87 A;  2C0D A;  4G0I A;  3UBK A;  4Z2T A;  4G10 A;  3KMN A;  3O6T A;  4WF5 A;  3ERF A;  1M7T A;  3M3M A;  2LJR A;  4PXO A;  1K0M A;  2K18 A;  4YQV A;  4BL7 B;  1O85 A;  2CQ9 A;  1SD9 A;  4IKH A;  3HD5 A;  3HVX A;  2HNL A;  3N9J A;  2P5R A;  3NZN A;  3EMP A;  4JE1 A;  3TRP A;  4KDY A;  5D9W A;  1MD4 A;  1UN2 A;  5ELA A;  5DAK A;  5D9V A;  5H5Q A;  5AIS A;  3TKS E;  4KND A;  3TJF A;  3ZVJ A;  1K0B A;  5CRG A;  4PUF C;  4JR6 A;  4GF0 A;  1ZYN A;  4HDE A;  2QKE A;  1KBN A;  3F9U A;  3SWL A;  3QAV A;  3GIX A;  1U3I A;  1O7U A;  1SU9 A;  3GNJ A;  3GUR A;  4F82 A;  4X0X A;  2JL4 A;  2LRC A;  2YV9 A;  3KD0 A;  4YQU A;  3G7Y A;  3KMO A;  3LXT A;  2HZF A;  1V58 A;  1FB6 A;  4MAB A;  3WD6 A;  4XRA A;  3TUE A;  3ME8 A;  1URM A;  3PGT A;  3APO A;  1M9B A;  2VL3 A;  3VI7 A;  2VLV A;  3CTG A;  3D0Z A;  1Z7R A;  1B9Y C;  1WJK A;  3DD3 A;  2OE3 A;  1WWJ A;  5B8B A;  1AXD A;  1SK2 A;  3KCM A;  3TJJ A;  3DIE A;  2LNT A;  4OFN A;  5IIZ A;  3DKS A;  6GSV A;  2CT6 A;  4G0K A;  5EL8 A;  4IP1 A;  2L5O A;  3I69 A;  1B4P A;  2JSY A;  1OAZ A;  1NHY A;  3F4R A;  2NBS A;  3EU3 A;  5H5S A;  3ZZX A;  3GKN A;  2F3M A;  4V2N A;  2IME A;  2TRC P;  5BMU A;  1ZL9 A;  2P5Q A;  4KF9 A;  2DKH A;  2A2P A;  5J9C A;  2B7J A;  2P31 A;  4USS A;  9GSS A;  4E8H A;  4ZXG A;  3GV1 A;  4IQ1 A;  1DUG A;  4L5L A;  1SYX A;  3TKS C;  4GXZ A;  1PN0 A;  1TRW A;  1TW9 A;  5J9B A;  1U3A A;  3HYP A;  5FWG A;  2MYG A;  4FH8 A;  2A2S A;  2X8G A;  4CY6 A;  2HRF A;  1M2A A;  2YWO A;  5DCH A;  1XW6 A;  2HLS A;  4NMU A;  2B5Y A;  4KCA A;  2R5G A;  3M1G A;  3ZMK A;  1GUL A;  1JZW A;  2I3Y A;  1JZD A;  1TI1 A;  6GST A;  2DML A;  2O85 A;  4NAX A;  2C3T A;  1AQV A;  2V1M A;  2FWF A;  2VLU A;  1G6W A;  1M2B A;  3Q74 A;  2MBT A;  2YPM A;  2DJJ A;  1WRY A;  1TTZ A;  1Z6M A;  1EOH A;  4OCF A;  3TGZ A;  4I2U A;  1ERW A;  1GSE A;  2LS5 A;  4X4J A;  1TRU A;  2YV7 A;  3L4N A;  2FWH A;  3UBL A;  3AY8 A;  1XWA A;  4DSQ A;  1IYI A;  3HZ4 A;  5HR1 A;  4FYB A;  4CDO A;  1OE7 A;  1O81 A;  4ID0 A;  2B6M A;  3CBU A;  4IHU A;  4IW9 A;  4TR1 A;  1BQ7 A;  4N11 A;  5IO0 A;  3KTB A;  2FA8 A;  1JZR A;  3L9V A;  2E2G A;  2VL2 C;  2C0E A;  5IO2 A;  2TRX A;  2OJL A;  3C73 A;  1EV9 A;  3IXR A;  4A5P A;  4AJ8 A;  2AUV A;  2WRT A;  4MJA A;  5J4U A;  1XW9 A;  2WUL A;  4EXJ A;  3HJP A;  1A0R P;  1YJ6 A;  2JZS A;  5HFI A;  3ZIV A;  1A0F A;  5JWR B;  4XRD A;  1JLV A;  3BOA A;  2KLX A;  1H75 A;  1B4Q A;  1OKT A;  1Z3E A;  5D9T A;  1SK1 A;  5A5K A;  1YEP A;  2H6Z A;  4I97 A;  3P8W A;  1QK8 A;  1YF1 A;  4TW5 A;  2I4A A;  1F37 A;  1SJ6 A;  4TR1 B;  1OE8 A;  3A2X A;  3ZTL A;  4IJI A;  4V2L A;  2R3X A;  3HJO A;  3TKS A;  1RW1 A;  1PQN A;  4K5R A;  3TJK A;  3C1S A;  3WGE A;  2X8H A;  5HR3 A;  4TXO A;  4MLY A;  3BCI A;  3CRT A;  4MJC A;  5KEJ A;  1A8Y A;  2C1Y A;  2MMN A;  3E9J B;  3LYP A;  2OKA A;  4F9Z A;  3LXZ A;  1M99 A;  4HZ2 A;  1VRS D;  3F8U A;  2LV3 A;  2BMX A;  1Z6N A;  2H30 A;  1GRX A;  3LFL A;  4ZBA A;  3P90 A;  2HI7 A;  3ZL5 A;  1AIU A;  3KM6 A;  3RBT A;  3UAP A;  4K9Z A;  4GST A;  4QL7 A;  2F9S A;  1ST9 A;  1V98 A;  3FR6 A;  1R4W A;  2CX4 A;  2ZNM A;  3FRC A;  3V1W A;  1SL0 B;  3RHC A;  5F05 A;  3F4T A;  4HU7 A;  1GSY A;  4OFM A;  3FKF A;  4J56 E;  5DDL A;  2GSQ A;  2X8C A;  1KEB A;  3I43 A;  5DVB A;  3K8N A;  1IYH A;  1PGT A;  2O7K A;  2TIR A;  2VL2 A;  2X99 A;  3FZ9 A;  3BD2 A;  4WF4 A;  2DJ1 A;  1A8L A;  3IV4 A;  4I6X A;  4EKZ A;  1BX9 A;  1ZMA A;  1RQM A;  2VOC A;  3RPN A;  1OVN A;  2YJH A;  5D9X A;  3IR4 A;  1BJX A;  3Q18 A;  4QQ7 A;  4BWS A;  5COH A;  2QSI A;  2FGX A;  1PA3 A;  2R0P A;  3VWU A;  5AN1 A;  3DEX A;  5B8A A;  2WB9 A;  5GSS A;  2QA2 A;  3DML A;  4AGS A;  1TRV A;  3WGD A;  3C71 A;  2VCZ A;  2VCV A;  5ECM B;  4XS4 B;  1OC9 A;  5ELG A;  4O5Q A;  6GSW A;  3KEB A;  1EP7 A;  3L9S A;  1EP8 A;  2IMF A;  3ZLP A;  3P2A A;  1VGL A;  5E4W A;  4V1A g;  3RDW A;  1K0D A;  1K3Y A;  3D22 A;  4L0W A;  4MCU A;  2OAC A;  3CRU A;  4PTS A;  1YKC A;  4AJ6 A;  2H75 A;  1MTC A;  1JLW A;  2R0G A;  2B5X A;  3DYR A;  1GSU A;  2FWE A;  2IIY A;  2V6K A;  2PWJ A;  3FHK A;  4PQ1 A;  1TOF A;  4FO5 A;  4FYC A;  1HNA A;  5CO3 A;  5B7C A;  4V1A p;  2IN3 A;  4IEL A;  2GZZ A;  2X49 A;  1C72 A;  3A2V A;  1SYR A;  3US3 A;  4GQF A;  4F0B A;  3M9J A;  4ZB9 A;  1R5P A;  4MF5 A;  2E0Q A;  3ZML A;  1W4V A;  2FLS A;  4O5R A;  3WT2 A;  4P3Y B;  1ZGN A;  2H74 A;  1FG4 A;  1EWX A;  2D2Z A;  5ECS A;  1HNC A;  3D21 A;  1AQW A;  2CV4 A;  1S3A A;  3WT1 A;  4KX4 A;  2XPE A;  1K3L A;  4G2E A;  5EVO A;  3JCM L;  4H86 A;  4ZIL A;  2JZR A;  3NOF A;  1THX A;  2AHE A;  2IFQ B;  1Z7P A;  2XBQ A;  3DXB A;  2GZP A;  3LJR A;  5CNW A;  4NHZ A;  4OD7 A;  1JFU A;  5CYY A;  1THO A;  5ECH B;  2EIO A;  4KUN A;  5G2Z A;  4K0N A;  4JZQ A;  3IBH A;  1X5D A;  1ZYE A;  3EC3 A;  4WEY A;  3LSZ A;  4JRR A;  1N8J A;  1O8X A;  4GQC A;  3CXG A;  4EF0 A;  3H1N A;  2PPT A;  3DVW A;  4ML6 A;  3A3T A;  1XBS A;  2X64 A;  2MBS A;  4K7I A;  3ZIT A;  4POM A;  5F06 A;  2AYT A;  1H4O A;  4XTS A;  4ECJ A;  2WZ9 A;  2YWI A;  3EU4 A;  1AC1 A;  3ZFB A;  2JAD A;  2F8F A;  5BRT A;  5ID2 B;  3GH6 A;  4IVF A;  4MH3 A;  1TXX A;  1GUH A;  2P0G A;  2C0G A;  2H66 A;  2CVB A;  2OBK A;  1TKD B;  2R2J A;  1AUC A;  1ZZY A;  4N0Z A;  3TRQ A;  2VCT A;  5ECO B;  2XHF A;  1WPI A;  4YKG A;  2VM2 A;  1ERU A;  5J3R A;  2XC2 A;  3LW9 A;  2DKI A;  2RM5 A;  3KH9 A;  5E59 A;  1T8E B;  3DGQ A;  4PUA A;  1R26 A;  1A24 A;  1Z5Y E;  2OAD A;  3E0U A;  4MZC A;  3UOM A;  2PUK C;  3IOS A;  5IM9 A;  1XIY A;  1TJD A;  1WE0 A;  4Q5Q A;  5ECQ B;  5C00 A;  1AAZ A;  2OA7 A;  1QXH A;  1Z9H A;  2VM1 A;  3ZYW A;  3CSH A;  2GTU A;  3UIW A;  2JSZ A;  3LGC A;  3UJ1 A;  1W89 A;  1GTU A;  3GA4 A;  2ES7 A;  6GSX A;  1FHE A;  2R4V A;  3IHG A;  5DAK B;  2PVQ A;  5IMZ A;  3CSI A;  3FZ4 A;  2Z9S A;  5IMC A;  1FO5 A;  7GSS A;  4ZB8 A;  4I8B A;  4PUR A;  3GL5 A;  1E2Y A;  1XWK A;  2VLT A;  1T4Z A;  3H79 A;  5JCG A;  1ON4 A;  2HFD A;  5HR2 A;  4MK3 A;  2QC7 A;  2YAN A;  1HD2 A;  4FIW A;  3H93 A;  4IN0 A;  2HT9 A;  4ILF A;  4KW6 A;  3D4M A;  1LJR A;  3QD9 A;  4BVX A;  5L71 A;  1PX7 A;  4O5U A;  1UVZ A;  4EDY A;  1O8W A;  5AGY A;  2FUG 2;  5INY A;  3IRA A;  5DCG A;  4L8E A;  2I1U A;  4LA1 A;  4TR0 A;  18GS A;  3HJM A;  2LQQ A;  3F0I A;  1U6T A;  2GQL A;  11GS A;  2VD1 A;  4NWY A;  1GTB A;  1HYU A;  4IS0 A;  3TRX A;  2WJU A;  2H1A A;  1G7E A;  4ICY A;  4HS1 A;  1UC7 A;  3KGK A;  2HRK A;  1YEX A;  1K0N A;  3HCZ A;  4ZBB A;  4DEJ A;  3GL3 A;  3U5R E;  1A23 A;  1GP1 A;  6GSS A;  2M72 A;  3LQ7 A;  1N2A A;  4QL9 A;  4FQU A;  2F51 A;  1M2D A;  4HEA 2;  4BVY A;  2CVD A;  5G5F A;  4MPG A;  3M0F A;  2GZY A;  4MPF A;  1SEN A;  4V2M A;  2DIY A;  1SKS B;  1ILO A;  4IJ3 A;  3HA9 A;  2VCX A;  5HQP A;  2YN1 A;  2FD3 A;  4LL1 B;  2ZCT A;  4XHM A;  5EPF A;  4X43 A;  4AF2 A;  8GSS A;  1DE2 A;  3WYW A;  5HFG A;  1UA5 A;  3LOR A;  4KCE A;  1ERV A;  1USB A;  2K8V A;  3TOT A;  2AV4 A;  2DLX A;  1GNE A;  4ECC A;  4PX1 A;  3F6D A;  1EEJ A;  2IJY A;  4XIH A;  1G0T A;  1TU7 A;  3ISO A;  4HOJ A;  4MP4 A;  4FYU A;  1PL1 A;  2R6K A;  5ECI B;  1BED A;  4D73 A;  3ERW A;  2H70 A;  3TKR A;  3TJB A;  4X1U A;  4ECB A;  3O3T A;  3MWH A;  4TKY A;  2IPA A;  2VD0 A;  1EGO A;  3L0H A;  2GT6 A;  2H0H A;  2V32 A;  3GKK A;  4WXT A;  1SL1 B;  1FVJ A;  1HNB A;  4EO3 A;  2A4H A;  4TRX A;  1XVQ A;  2JAC A;  5JWQ B;  3IAM 2;  4K2X A;  1XZO A;  5HFK A;  3KIJ A;  4WET A;  2WGR A;  2E2M A;  2ZUP A;  2C4J A;  13GS A;  2DJ3 A;  2V41 A;  3E3E A;  4PGT A;  4GRF A;  1Y6E A;  1J08 A;  4POK A;  1ZYQ B;  4ML1 A;  2GT5 A;  1OC8 A;  3MDK A;  1K0C A;  4RQX A;  3GKX A;  2YJ7 A;  2AAW A;  1TI3 A;  3HVS A;  2B1L A;  4MDC A;  3KXO A;  2H8L A;  3PPU A;  1X5C A;  3M9K A;  4Q5R A;  1M9A A;  1FAA A;  1MDI A;  2H6Y A;  2EIQ A;  4OWY A;  3U6V A;  2QGV A;  5KOX A;  1G6Y A;  2X4A A;  1V2A A;  20GS A;  4ZB6 A;  4IP6 A;  1XWC A;  2H0I A;  2N5F A;  4ZIJ A;  2VCW A;  5ECL B;  1GH2 A;  4GSN A;  3QMX A;  3G7J A;  2J9H A;  4G0L A;  2BJX A;  3SBC A;  4PQH A;  3R3E A;  3APQ A;  4GSS A;  4N0V A;  22GS A;  2I81 A;  4XS6 A;  1S3C A;  1X5E A;  5HR0 A;  2RUE A;  2KP1 A;  2NPB A;  4TXO B;  4G19 A;  3RHB A;  4MH2 A;  3APS A;  4POL A;  3GUS A;  4KDX A;  2PMT A;  4E8E A;  2M46 A;  1PRX A;  3HDC A;  4HQS A;  3VPT A;  2L6D A;  3GMF A;  3QFA C;  1VF3 A;  1SKW B;  3IAS 2;  4L5O A;  2LQO A;  5LD0 A;  1BYE A;  1KNG A;  3F3R A;  5AIV A;  4K7O A;  2YZH A;  4MZW A;  4DSS A;  2YCD A;  5GST A;  2H1B A;  2DJ2 A;  4ULX A;  2I9H A;  1ZOF A;  2FWG A;  2GGT A;  5D93 A;  2L6C A;  3QFB C;  3R2Q A;  3A2W A;  3C8E A;  3GTU A;  1MEK A;  2WCI A;  2HSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...