2LJAA

Solution structure of a putative thiol-disulfide oxidoreductase from bacteroides vulgatus
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
152
structure length
152
Chain Sequence
MSLRSGNPSAASFSYPDINGKTVSLADLKGKYIYIDVWATWCGPCRGELPALKELEEKYAGKDIHFVSLSCDKNKKAWENMVTKDQLKGIQLHMGTDRTFMDAYLINGIPRFILLDRDGKIISANMTRPSDPKTAEKFNELLGLEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative thiol-disulfide oxidoreductase
publication title Solution Structure of a putative thiol-disulfide oxidoreductase from Bacteroides vulgatus
rcsb
source organism Bacteroides vulgatus
total genus 47
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2011-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ljaA00
1YZXA 2L57A 1A2MA 4EUYA 2ZCTA 1GSSA 2PBJA 2R6KA 2PVOC 3DGQA 3M8NA 3WT1A 3EVIA 5AGYA 3I69A 2YNXA 4DSRA 2FLSA 4V1Ag 4N10A 3M3MA 2JZSA 3QMXA 4K6XA 1DUGA 4HZ2A 1F37A 4IGJA 2R5GA 3LSZA 2VUPA 1SU9A 1XCCA 5JWOB 4ECJA 5CAXA 4IELA 4FH8A 4ZBBA 2WRTA 3F4TA 4BVYA 3I43A 1HQOA 2H0IA 1GRXA 3UL3A 3ZYWA 4N0ZA 5HR1A 3DYRA 3GN3A 4ACSA 3WGEA 3QFAC 3CRTA 3IE3A 2E0QA 4XHMA 2C4JA 3ME7A 5FT3A 1AUCA 5IMCA 1M2DA 2CX3A 1K0BA 3ISOA 4ULXA 1GP1A 1M2AA 1M99A 4KGIA 2G2QA 1FVKA 1XXUA 1ERWA 3IAS2 3CRUA 4XCSA 3CSJA 4KA0A 3VPTA 2K18A 5JCGA 2DIYA 1T4ZA 1BG5A 3HZ8A 4YQVA 4QQ7A 3LG6A 2L6DA 1B4QA 1FHEA 1ZZYA 5FHIA 4TR3A 4XTSA 4K7IA 3H1NA 2OA7A 4X0XA 2H71A 1WIKA 1W4VA 3F4RA 4L0UA 2FCHA 3WYWA 4XS6A 2IMEA 6GSWA 4PX1A 3F8UA 4KUNA 4WBRD 4KSMA 2J9HA 3HHVA 3A3TA 1TK8B 3KEBA 3GHAA 5A4VA 2O8VB 1MEKA 1S3DA 1XOBA 4WF5A 1OKDA 4YQUA 3H4KA 4TXVA 4ZL9A 2L5OA 5IMFA 3QAVA 2EC4A 3FRCA 3W6GA 3FYGA 1XWKA 3BCIA 5HFKA 2YPMA 4Q5NA 3F4SA 3RBTA 4GTUA 5KEJA 3RAZA 5B6MA 1N8JA 2A4VA 1FB0A 2LRCA 3IV4A 1JLWA 2GQLA 2NVLA 2BMXA 2WCIA 1O81A 2VCXA 2B5XA 1F2EA 2O87A 1RQMA 2MBTA 4WF4A 2P5RA 4MJEA 4I2UA 1XWBA 3FK8A 4XS1A 4ECIA 3TJKA 1FVJA 1G6YA 1NHOA 1C72A 2WDUA 4MK3A 4AJ6A 1XOAA 4DEJA 2CX4A 2H1AA 2F51A 1K0MA 4CW9A 2LKUA 4OO5A 4O92A 1SK1A 3FR9A 5ECMB 2LS5A 1OAZA 2JACA 3UARA 4BPYA 3KGKA 3L78A 1GH2A 2YANA 3GSTA 2X8GA 2BJXA 2NTOA 1LJRA 2YWMA 2MMOA 3U5RE 1UN2A 3KP8A 3RPNA 2CAQA 17GSA 5CRDA 3LQ7A 4Q5RA 4NHWA 5LD0A 2IMIA 3W8JA 1Z3EA 6GSYA 1GTBA 5D9WA 2L4QA 4ZB9A 2QGVA 3VLNA 3LJRA 3GKNA 1H4OA 4WETA 3QR6A 2OBIA 3DWVA 4ZBDA 5CP1A 1F6MC 3PH9A 3GRXA 3HZ4A 1V57A 3CSHA 4POKA 4KCAA 2AJQB 1R5PA 3P8WA 5ENUA 4PGTA 4ZL8A 2V32A 1Z7PA 1ACVA 4OO4A 3GFKA 1IYHA 3F9UA 2I9HA 1TRWA 1SK0A 2QC7A 3VWUA 3UEMA 3J7Yb 3EU3A 3A2XA 5GSSA 2RUEA 1OC9B 5G30A 5B8BA 1PRXA 1BYEA 4NWYA 1TKDB 3L4NA 1NW2A 1VF3A 2IFQB 3GX0A 6GSXA 2VL9A 3RHBA 2B6MA 2VAFA 3C7MA 5ECIB 1U6TA 5DAKB 1RK4A 3GIXA 4YAPA 3ZITA 2OBKA 20GSA 4GCIA 3M9KA 1DSBA 2HXKA 1A0FA 1RW1A 4IQ1A 2MMAA 1TI3A 1SYRA 3O76A 4HS1A 3LFLA 3E3EA 2AAWA 5F05A 2B1KA 1Z6NA 4LA1A 3BBYA 1ON4A 2PMTA 5C00A 4GQFA 2LJAA 4L8EA 5D8IA 3GL5A 2FWEA 3A2VA 3GMFA 5CRWA 3KJYA 1T1VA 1OC9A 1VRSD 2KLXA 4LL4B 5D9TA 4TR1A 1QXHA 3A2WA 1EV4A 1AXDA 3FZAA 1O8XA 3TGZA 6GSTA 1SL0B 4MH2A 1BQ7A 1N2AA 1Z5YE 2LSTA 1R7HA 5IIZA 3ERWA 2IFQA 4LMVA 3G7IA 1FAAA 2GZYA 3CXGA 4JRRA 5IM9A 1OC3A 1PD21 3O6TA 3BCKA 3QFBC 2JSYA 5ECRB 2LV3A 3HXSA 3VWVA 4MZBA 4K0NA 4EC0A 1TK0B 3EC3A 1ZCPA 1PN9A 1GUKA 1U3IA 2VL3A 4AJ8A 2H01A 1SJ6A 5GZZB 4DVCA 2F8AA 3F3QA 4TR4A 2C0DA 4F0CA 5A5KA 1GSDA 1GTUA 1FW1A 1VGLA 2YP6A 5CRGA 2AB6A 4YQMA 3DMLA 3KMNA 4NV5A 1B48A 1GUMA 3GH6A 3P90A 1ZMAA 2YWNA 2DJ1A 3IK7A 5G1LA 2PUKC 1MTCA 4IHUA 5HFGA 1SKSB 3I6AA 5GAND 1VF1A 1SJZA 2H6YA 2V41A 2YWOA 4OWYA 5AIXA 3TKSA 4EE0A 5IMAA 1GNWA 1BJXA 5JCWA 1X5DA 1EV9A 3TUEA 1EWXA 4RI7A 4WXTA 4K9ZA 2IJYA 1EGOA 3GKKA 4F82A 2L6CA 1M0UA 3P7XA 1A0RP 1YF0A 5F06A 1FO5A 1K3YA 2HZEB 4IBPA 1PX7A 4FYUA 2F8FA 3C1RA 3FY7A 1EGRA 4XS4B 1HNAA 2LTKA 4GRFA 2H19A 3L9SA 2KHPA 4I5QA 3FKFA 1H75A 4XIHA 2VO4A 1BEDA 3IK9A 1AQVA 1XW6A 5ECHB 4L0WA 2RM6A 1K3LA 3IR4A 3AY8A 2KUCA 3ZIVA 1TRVA 3HKRA 4IP1A 2WFCA 5HR2A 2JZRA 3EURA 2KOKA 1PL2A 4PUFC 2HYXA 2EIOA 2RM5A 4IJ3A 2EIQA 1CQGA 1PL1A 4K2DA 1UC7A 3NIVA 1GSEA 4NAXA 3ERFA 4EKZA 2HZEA 3VI7A 2K8VA 4XS4A 3UBKA 5IMDA 5IMVA 2AUVA 4EF0A 1JZRA 1WE0A 4MJCA 3CSIA 1GSQA 5ECNB 4F9ZA 2VLTA 5J9CA 3CMIA 5G2ZA 2DSAA 4F2IA 5IO0A 4N30A 1K0DA 5ELAA 1WJKA 1F3BA 4KE3A 1SL2B 4MF5A 1OKTA 3KTBA 3KP9A 4RUVA 2MMNA 3N9JA 1AC1A 2YZHA 3D22A 5J3RA 4V2LA 1B9XC 1I9DA 3H93A 3M0FA 2HZFA 4MLYA 1Y25A 3IA1A 3Q19A 2R2JA 2GSSA 4OFNA 5A4WA 4EL1A 3HJPA 4LMWA 1NM3A 2A2SA 1YQ1A 2H1BA 2OADA 4OMVA 2LJRA 5IOWA 2DJKA 3BD2A 2VL2C 3LWAA 4NV2A 3WGXA 3TB2A 5HR3A 3TJBA 1EOHA 2TRXA 4POMA 4G19A 3GA4A 4FIWA 1TU7A 2Z9SA 2GLRA 3DXBA 2AYTA 3D0ZA 3PR8A 5G5EA 3DIEA 3ERGA 2JZTA 1HD2A 2YWIA 2H73A 3GH9A 2P0GA 2JU5A 2XC2A 3IBHA 3TKSE 3TKQA 4XRDA 5EVOA 5IO2A 4KDUA 3HVVA 3KXOA 4JEDA 1XBSA 3ZIJA 5EL8A 1A8YA 1ILOA 4ILFA 4IJIA 1O85A 2C0EA 3TRPA 1R4WA 4EDZA 1E2YA 1XW5A 1X5CA 3F6DA 4RQRA 5D9VA 3TJGA 3G9BA 1QQ2A 2CT6A 2GZZA 2YJ7A 3O3TA 1USBA 3IC4A 5DJLA 2OKAA 1E6BA 4I6XA 4MP4A 1S3CA 2MBSA 5CO3A 4YH2A 3F63A 3GKXA 5LCZA 5COHA 4NPBA 1O7UA 4PQIA 2HRFA 4JBBA 3SWLA 3IPZA 3CBUA 2V6OA 5G31A 1J0FA 4ZIJA 3ZLPA 4F03A 6GSUA 1R5AA 2VL2A 3WGDA 2WJUA 2RIIA 4PURA 1XW9A 4AJ7A 3GKMA 2GT5A 4KX4A 2L4CA 1FOVA 5ABRA 5AN1A 4CDOA 2OACA 2H74A 3C73A 2AV4A 2C8UA 1TI1A 1U88A 1Z6MA 2CVDA 3IHQA 1VF2A 4MF6A 2FA8A 5ECQB 4HZ4A 4AF2A 3APSA 2AHEA 4IS0A 1SK2A 3QOUA 2H8LA 4MJBA 3C1SA 5KN0A 4MMMA 1PSQA 3EMXA 6GSVA 2BTOT 3GTUB 4E8EA 3KCMA 4V2MA 1GSUA 4O32A 4AGSA 1M7TA 1SJIA 2RUFA 4L5LA 1M9BA 3TOTA 4K1FA 1PX6A 1GL8A 3RPPA 3ZFBA 3EMPA 3G7JA 1GWCA 4PQHA 4P3YB 5J5NA 3APOA 1T00A 1GSYA 3TKPA 3HJMA 3PGTA 3D4TA 3ZL5A 4D73B 1YKAA 1Q98A 3QD9A 2R4VA 5DDLA 3Q74A 1LBKA 2HE3A 5J41A 3KIJA 4MZWA 1GUHA 2WB9A 1PQNA 2DC5A 5IOXA 1ABAA 5JWQB 4GQCA 1MDKA 3WD6A 1V9WA 1X9WB 2B5EA 1EEJA 3GTUA 1XFLA 2M46A 1YEXA 1O8WA 1PKZA 3VWXA 4DSQA 5DVBA 4HQSA 3UMAA 3DVXA 3HVXA 4PQ1A 1KEBA 4X43A 4ECCA 1WPIA 2FD3A 3LYPA 4ECBA 1GTIA 1TDIA 4TOPA 4WR5A 2VCVA 3MAKA 1FB6A 2KP2A 1A2LA 2QSIA 1OE8A 1WMJA 2O85A 4IN0A 4D73A 3A5WA 4GWRA 1K0NA 1WOUA 5AISA 3IOSA 1SENA 3GNJA 2O89A 2HRNA 5DAKA 3I9V2 1QGVA 1ML6A 2HSYA 3D5JA 3ZMLA 1B4PA 2GDRA 2DIZA 4MDCA 4JR4A 4J57E 3GURA 2K9FA 4WKWA 5CREA 4XRAA 5D93A 1F9MA 2GQMA 3W8SA 4POLA 6GSSA 1EP7A 4QL9A 5DJMA 2KP1A 4E8HA 2H6XA 2H30A 1KNGA 2N5BA 5A4UA 2GVPA 2VCZA 3HCZA 3UVTA 2IMKA 2H6ZA 1UVZA 2N5FA 2H0GA 2JADA 2FWHA 3D4MA 2DJ2A 3UAPA 3NZNA 3UVHA 1XPVA 5ID2B 4HI7A 1T7PB 4IW9A 4KW6A 2C80A 2PPTA 2PVQA 1JHBA 2LEGA 2F9SA 3ME8A 4Q5FA 4ISDA 2HNLA 4JU5A 2XPDA 1EZKA 5H5RA 1V58A 5ECOB 3RHCA 3GV1A 4IP6A 1ST9A 4DSSB 2XPEA 3HVSA 2YCDA 4O7HA 2E7PA 3J7Yk 4BWSA 1YJ6A 1MD3A 1B9YC 1W89A 4EXJA 1TTZA 2E2MA 2B3SA 4KAEA 4OCEA 1ERUA 4I97A 5ID2A 2LRNA 5EY6A 1Z7RA 4EO3A 1MDIA 2ES7A 1DBYA 3GSSA 1U3AA 2WGRA 13GSA 2TIRA 1K0AA 3FW2A 5J9BA 5ECLB 5JWRB 4MZCA 1SL1B 4TR0A 2H70A 4FYCA 2MMZA 4GSTA 2LNTA 1GULA 1XWGA 4QL7A 2CAIA 4ML6A 2M80A 2V6KA 3LORA 3VWWA 1GNEA 4OD7A 3MWHA 2LQOA 2YOIA 1A24A 1R26A 2K8SA 5CYYA 2QKEA 3FHKA 3LXTA 3CTGA 2FNOA 2VOCA 1BAYA 5IPGA 4I2TA 4KDXA 2GGTA 4I8BA 2H72A 2C3TA 2X8CA 4POBA 2NPBA 1TRUA 1X0RA 2L59A 4CHSA 1HNBA 2V2GA 2HFDA 1QK8A 2IIYA 2VD0A 1SD9A 1G7EA 1O6JA 3VK9A 4BWQA 3IRAA 5ECKB 2D2ZA 1PMTA 1XWAA 2PU9C 3QCPA 2PN8A 5IPHA 3ZTLA 4O5RA 1QUWA 3SBCA 3D21A 4MPGA 3DD3A 2DLXA 1K3OA 2YV9A 4HQZA 1AW9A 1CQHA 5HFIA 8GSSA 3VPQA 4IVFA 2I1UA 5E59A 2GQKA 2RLIA 1Q4JA 3VI5A 5B7CA 3DKSA 4MCUA 4PNFA 3DEXA 1TK5B 1YDKA 1T3BA 1JZWA 4K8MA 3KH9A 5H5SA 4JZQA 2G0FA 3LEFA 3G7YA 2NBSA 2LJKA 1OYJA 1KTEA 1U87A 3TRQA 1SYXA 5KN3A 3F6FA 2OE0A 2LRTA 4ML1A 2B5YA 5JCUA 1SKRB 3BOAA 3FZ4A 3FZ5A 2PGTA 1JLVA 18GSA 4WR4A 3H79A 3M1GA 4IQAA 3F0IA 4KH7A 1HNCA 1BX9A 2VCWA 5F8BA 1AQWA 1V40A 2H75A 2N5AA 4ID0A 2PERA 2DMLA 3TRXA 4TW5A 5DQYA 2K6VA 4MABA 3TJJA 3CTFA 4LLRA 2H1GA 2EIRA 3C71A 3GUSA 2WULA 2A2RA 2X64A 3Q6OA 4RQXA 3E9JB 7GSSA 1NHYA 2NDOA 4KDYA 3TJFA 2C1YA 3MSZA 4GXZA 4LL1B 2IMDA 2E2GA 5HR0A 4MJAA 4KCEA 2I4AA 1JFUA 1TW9A 3PINA 2C0FA 4WBJA 4BA7A 1UA5A 3IDVA 3EU4A 2DJ0A 5F0GA 1T4YA 5H5QA 4N11A 4H86A 1MDJA 2LNSA 4N0VA 4ZB6A 3R2QA 5CRHA 2IMFA 2IL3A 4ZB8A 1LU4A 2B7KA 3LGCA 2R37A 3K8NA 1A2JA 5DBQA 4EVMA 4FYBA 2GSRA 1YF1A 4G10A 3US3A 3TCOA 5F07A 1SKWB 2MYGA 1IYIA 2ON5A 2PWJA 4MPFA 2JSZA 2H0HA 2HLSA 2YZUA 1MD4A 5HQPA 4HU7A 1B8XA 2YV7A 4TN8A 9GSSA 1THXA 1M9AA 5L71A 1XWCA 2CV4A 3HD5A 2C0GA 1X5EA 2FGXA 1WP0A 3ZVJD 5ECSA 2ZUPA 2L5LA 3IXRA 2H66A 1K0OA 3OR5A 3UOMA 4L5OA 1PA3A 1YY7A 2X8HA 3DRNA 1AQXA 2F3MA 1PGTA 1ERTA 5IMZA 2VIMA 2IWTA 2I81A 1ERVA 4KNDA 19GSA 1V2AA 4MH3A 2H76A 3L9VA 1EOGA 3QDNA 3UBLA 3ZZXA 3BJ5A 2YJHA 3GYKA 1XVWA 3S9FA 2HSHA 1EEMA 2CVKA 2YN1A 2LUSA 5DQSA 1WRYA 3LXZA 5D96A 3EINA 2J23A 1TOFA 4HJMA 2FHEA 5FWGA 4ZXGA 4HEA2 3U6VA 3F3RA 1G7OA 3QAWA 4HOJA 5B6NA 2WS2A 4JE1A 5D73A 2OE1A 5INYA 1VF4A 3ZMKA 5DCGA 3JCML 4TR1B 3WT2A 2V1MA 2DMMA 3CYNA 2WZ9A 2CZ3A 1OVNA 2ON7A 1J08A 3D6IA 1TP9A 2FA4A 1XVQA 3UJ1A 2O7KA 5KN1A 1JZDA 1DE1A 4Z7XA 1OE7A 4J2FA 3MNGA 4FO5A 2FUG2 4JR6A 2ALBA 2HI7A 3KM6A 1T8EB 2FWGA 5ECPB 3HY2A 4KB3A 3TKSC 4TXOB 4V2NA 2VLUA 3GL3A 2FWFA 2IN3A 1Y6EA 16GSA 4GF0A 2VM1A 1ZGNA 3FR3A 1URMA 4HU9A 4J56E 2FY6A 3LYKA 2GSQA 4OCFA 3HDCA 2MZCA 5E4WA 1SD8A 1Z9HA 3FR6A 12GSA 2M72A 5G5FA 3L0HA 1KBNA 3HA9A 2CQ9A 5C04A 1OC8A 3NOFA 3UIWA 5IQYA 5G1KA 2B7JA 3V1WA 3VURA 1TXXA 2CA8A 4YAVA 1TU8A 3APQA 2VD1A 2XBQA 3HJOA 4WEYA 5GSTA 2GTUA 2TRCP 2REMA 4GSNA 2DBCA 2XHFA 3TKRA 3P2AA 1EP8A 3KMOA 5ELGA 1QMVA 3ZVJA 2VCQA 2GS3A 3EYTA 1WWJA 4TXOA 1GLQA 3M9JA 2OE3A 5GAPD 2P5QA 2VLVA 2ZNMA 4ZILA 3H8QA 5KN2A 4HDEA 2CVBA 1PKWA 4KSOA 1S3AA 1TRSA 3L9UA 2GZPA 3KH7A 1V98A 3E0UA 3ZFLA 4HUAA 1O73A 4K7NA 1YKCA 4MF7A 4X1UA 4TVEA 4OFTA 1GTAA 5B8AA 3ZREA 4GSSA 4NXIA 1HYUA 3IAM2 1AIUA 1ZOFA 14GSA 3QPMA 3Q18A 1I5GA 4Q5QA 3KTLA 5D9XA 2HT9A 4OFMA 1THOA 3QAGA 1DE2A 1FG4A 3FZ9A 3N5OA 5DALB 4NHZA 4HJ2A 4K0GA 1NSWA 4PUAA 4G9HA 3HYPA 2IPAA 4K7OA 2R3XA 4G2EA 3RDWA 2GT6A 10GSA 4MA9A 1XZOA 3EWLA 2OJLA 2B1LA 2LQQA 3KD0A 11GSA 3KZQA 4PNGA 1J9BA 2C3NA 4TKYA 2XBIA 5J4UA 2CZ2A 3MDKA 4NMUA 1M2BA 1ZL9A 3DVWA 2DJ3A 1GLPA 2P31A 1X9MB 1K0CA 4ZBAA 3FEUA 4EDYA 4ZL7A 1X9SB 4V1Ap 1A23A 5CNWA 1AAZA 2DJJA 2H1DA 2C3QA 1ZYEA 1G6WA 3EE2A 4IKHA 1XIYA 3TDGA 4TRXA 5LNKe 2X99A 1ZYQB 4BL7A 2JL4A 22GSA 4DSSA 4F0BA 1YEPA 1GSFA 1TJDA 5AIVA 3ED3A 3VFIA 5DALA 1A8LA 4PXOA 5DCHA 4GLTA 2GSTA 2VM2A 3GX8A 3TOUA 3ZRDA 4RI6A 1G0TA 3C8EA 2VCTA 1F3AA 2I3YA 1JZOA 5EPFA 1QFNA 4BVXA
chains in the Genus database with same CATH superfamily
1YZXA 2L57A 1A2MA 4EUYA 2ZCTA 1GSSA 2PBJA 2R6KA 2PVOC 3DGQA 3M8NA 3WT1A 3EVIA 5AGYA 3I69A 2YNXA 4DSRA 2FLSA 4V1Ag 4N10A 3M3MA 2JZSA 3QMXA 4K6XA 1DUGA 4HZ2A 1F37A 4IGJA 2R5GA 3LSZA 2VUPA 1SU9A 1XCCA 5JWOB 4ECJA 5CAXA 4IELA 4FH8A 4ZBBA 2WRTA 3F4TA 4BVYA 3I43A 1HQOA 2H0IA 1GRXA 3UL3A 3ZYWA 4N0ZA 5HR1A 3DYRA 3GN3A 4ACSA 3WGEA 4G0IA 3QFAC 3CRTA 3IE3A 2E0QA 4XHMA 2C4JA 3ME7A 5FT3A 1AUCA 5IMCA 1M2DA 2CX3A 1K0BA 3ISOA 4ULXA 1GP1A 1M2AA 1M99A 4KGIA 2G2QA 1FVKA 1XXUA 1ERWA 3IAS2 3CRUA 4XCSA 3CSJA 4KA0A 3VPTA 2K18A 5JCGA 2DIYA 1T4ZA 1BG5A 3HZ8A 4YQVA 4QQ7A 3LG6A 2L6DA 1B4QA 1FHEA 1ZZYA 5FHIA 4TR3A 4XTSA 4K7IA 3H1NA 2OA7A 4X0XA 2H71A 1WIKA 4YKGA 3EPTA 1W4VA 3F4RA 4L0UA 2FCHA 3WYWA 4XS6A 2IMEA 6GSWA 4PX1A 3F8UA 4KUNA 4WBRD 4KSMA 2J9HA 3HHVA 3A3TA 1TK8B 3KEBA 3GHAA 5A4VA 2O8VB 2R0CA 1MEKA 1S3DA 1XOBA 4WF5A 1OKDA 4YQUA 3H4KA 4TXVA 4ZL9A 2L5OA 5IMFA 5KOXA 3QAVA 2EC4A 3FRCA 3W6GA 3FYGA 1XWKA 3BCIA 5HFKA 2YPMA 4Q5NA 3F4SA 3RBTA 4GTUA 5KEJA 3RAZA 5B6MA 1N8JA 2A4VA 1FB0A 2LRCA 3IV4A 1JLWA 2GQLA 2NVLA 2BMXA 2WCIA 1O81A 2VCXA 2B5XA 1F2EA 2O87A 1RQMA 2MBTA 4WF4A 2P5RA 1PN0A 4MJEA 4I2UA 4YKFA 1XWBA 3FK8A 4XS1A 4ECIA 1FOHA 3TJKA 1FVJA 1G6YA 1NHOA 1C72A 2WDUA 4MK3A 4AJ6A 1XOAA 4DEJA 2CX4A 2H1AA 2F51A 1K0MA 4CW9A 2LKUA 4OO5A 4O92A 1SK1A 3FR9A 5ECMB 2LS5A 1OAZA 2JACA 3UARA 4BPYA 3KGKA 3L78A 1GH2A 2YANA 3GSTA 2X8GA 2BJXA 2NTOA 1LJRA 2YWMA 2MMOA 3U5RE 1UN2A 3KP8A 3RPNA 2CAQA 17GSA 5CRDA 3LQ7A 4Q5RA 4NHWA 5LD0A 2IMIA 3W8JA 1Z3EA 6GSYA 1GTBA 5D9WA 2L4QA 4ZB9A 2QGVA 3VLNA 3LJRA 3GKNA 1H4OA 4WETA 3QR6A 2OBIA 3DWVA 4ZBDA 5CP1A 1F6MC 3FMWA 3A5IA 3PH9A 3GRXA 3HZ4A 4EIPA 1V57A 3CSHA 4POKA 4KCAA 2AJQB 1R5PA 3P8WA 5ENUA 4PGTA 4ZL8A 2V32A 1Z7PA 4K5SA 1ACVA 4OO4A 3GFKA 1IYHA 3F9UA 2I9HA 4USSA 1TRWA 1SK0A 2QC7A 3VWUA 3UEMA 3J7Yb 3EU3A 3A2XA 5GSSA 4BIKA 2RUEA 1OC9B 5G30A 5B8BA 1PRXA 1BYEA 4NWYA 1TKDB 3L4NA 2HSMA 1NW2A 1VF3A 2IFQB 3GX0A 6GSXA 2VL9A 3RHBA 2B6MA 2VAFA 3C7MA 5ECIB 1U6TA 5DAKB 1RK4A 3GIXA 4YAPA 3ZITA 2OBKA 20GSA 4GCIA 3M9KA 1DSBA 2HXKA 1A0FA 4K5RA 1RW1A 4IQ1A 2MMAA 1TI3A 1SYRA 3O76A 4HS1A 3LFLA 3E3EA 2AAWA 2B1KA 5F05A 1Z6NA 4LA1A 3BBYA 1ON4A 2PMTA 5C00A 4GQFA 2LJAA 4L8EA 5D8IA 3GL5A 2FWEA 3A2VA 5CRWA 3GMFA 3KJYA 1T1VA 1OC9A 1VRSD 2KLXA 4LL4B 5D9TA 4TR1A 1QXHA 3A2WA 1EV4A 1AXDA 3FZAA 1O8XA 3TGZA 6GSTA 1SL0B 4MH2A 1BQ7A 1N2AA 1Z5YE 2LSTA 1R7HA 5IIZA 3ERWA 2IFQA 4LMVA 3G7IA 1FAAA 2GZYA 3CXGA 4JRRA 5IM9A 1OC3A 1PD21 3O6TA 3BCKA 3QFBC 2JSYA 5ECRB 2LV3A 3HXSA 3VWVA 4MZBA 4K0NA 4EC0A 1TK0B 3EC3A 1ZCPA 1PN9A 1GUKA 1U3IA 2VL3A 4AJ8A 2H01A 1SJ6A 5GZZB 4DVCA 2DKHA 2F8AA 3F3QA 4TR4A 2C0DA 4F0CA 5A5KA 1GSDA 1GTUA 1FW1A 1VGLA 2YP6A 5CRGA 2AB6A 3DMLA 3KMNA 4NV5A 4YQMA 1B48A 1GUMA 4HSCX 3GH6A 3P90A 1ZMAA 2YWNA 2DJ1A 3IK7A 5G1LA 2PUKC 1MTCA 4IHUA 5HFGA 1SKSB 3I6AA 5GAND 1VF1A 1SJZA 2H6YA 2V41A 2YWOA 4OWYA 5AIXA 3TKSA 4EE0A 5IMAA 1GNWA 1BJXA 5JCWA 1X5DA 1EV9A 3TUEA 1EWXA 4RI7A 4WXTA 4K9ZA 2IJYA 1EGOA 3GKKA 4O5QA 4F82A 2HRKA 2L6CA 1M0UA 3P7XA 1A0RP 1YF0A 5F06A 1FO5A 1K3YA 4KF9A 2HZEB 4IBPA 1PX7A 4FYUA 2F8FA 3C1RA 3FY7A 1EGRA 4XS4B 1HNAA 2LTKA 5BRTA 4GRFA 2H19A 3L9SA 2KHPA 4I5QA 3FKFA 1H75A 4XIHA 2VO4A 1BEDA 4CY6A 3IK9A 1AQVA 1XW6A 5ECHB 4CY8A 4L0WA 2RM6A 1K3LA 3IR4A 3AY8A 2KUCA 3ZIVA 1TRVA 3HKRA 4IP1A 2WFCA 5HR2A 2JZRA 3EURA 2KOKA 1PL2A 4PUFC 2HYXA 2EIOA 2RM5A 4IJ3A 2EIQA 1CQGA 1PL1A 4K2DA 1UC7A 4ICYA 3NIVA 1GSEA 4NAXA 3ERFA 4EKZA 2HZEA 3VI7A 2K8VA 4XS4A 3UBKA 5IMDA 5IMVA 1ZYPA 2AUVA 4EF0A 3HVNA 1JZRA 1WE0A 4MJCA 3CSIA 1GSQA 5ECNB 4F9ZA 2VLTA 5J9CA 3CMIA 5G2ZA 2DSAA 4F2IA 5IO0A 4N30A 1K0DA 5ELAA 1WJKA 1F3BA 4KE3A 1SL2B 4MF5A 1OKTA 3KTBA 3KP9A 4RUVA 2MMNA 3N9JA 1AC1A 2YZHA 3D22A 5J3RA 4V2LA 1B9XC 1I9DA 3H93A 5KOWA 5BMUA 3M0FA 1M3JA 2HZFA 4MLYA 1Y25A 3IA1A 3Q19A 2R2JA 2GSSA 4OFNA 5A4WA 4EL1A 3HJPA 4LMWA 1NM3A 2A2SA 1YQ1A 2H1BA 2OADA 4OMVA 2LJRA 5IOWA 2DJKA 3BD2A 2VL2C 3LWAA 4NV2A 3WGXA 3TB2A 5HR3A 3TJBA 1EOHA 2TRXA 4POMA 4G19A 3GA4A 4FIWA 1TU7A 2Z9SA 2GLRA 3DXBA 2AYTA 2UZ8A 3D0ZA 3PR8A 5G5EA 3DIEA 3ERGA 2JZTA 1HD2A 2YWIA 2H73A 3GH9A 2P0GA 2JU5A 2XC2A 3IBHA 3TKSE 3TKQA 4XRDA 5EVOA 5IO2A 4KDUA 3HVVA 3KXOA 4JEDA 1XBSA 3ZIJA 5EL8A 1A8YA 1ILOA 4ILFA 4IJIA 1O85A 2C0EA 3TRPA 1R4WA 4EDZA 1E2YA 1XW5A 1PFOA 1X5CA 3F6DA 4RQRA 5D9VA 3TJGA 3G9BA 1QQ2A 2CT6A 2GZZA 2YJ7A 3O3TA 1USBA 3IC4A 5DJLA 2OKAA 1E6BA 4I6XA 4MP4A 1S3CA 2MBSA 5CO3A 4YH2A 3F63A 3GKXA 5LCZA 5COHA 4NPBA 1O7UA 4PQIA 2HRFA 4JBBA 3SWLA 3IPZA 3CBUA 2V6OA 5G31A 1J0FA 4ZIJA 3IHGA 3ZLPA 4F03A 6GSUA 1R5AA 2VL2A 3WGDA 2WJUA 2RIIA 3PPUA 4PURA 1XW9A 4AJ7A 3GKMA 2GT5A 4KX4A 2L4CA 1FOVA 5ABRA 5AN1A 4CDOA 2OACA 2H74A 3C73A 2AV4A 2C8UA 1TI1A 1U88A 1Z6MA 2CVDA 3IHQA 1VF2A 4MF6A 2FA8A 5ECQB 4HZ4A 4AF2A 3APSA 2AHEA 4IS0A 1SK2A 3QOUA 2H8LA 4MJBA 3C1SA 5KN0A 4MMMA 1PSQA 3EMXA 6GSVA 2BTOT 3GTUB 4E8EA 3KCMA 4V2MA 1GSUA 4O32A 4AGSA 1M7TA 1SJIA 2RUFA 4L5LA 1M9BA 3TOTA 4K1FA 1PX6A 1GL8A 3RPPA 3ZFBA 3EMPA 3G7JA 1GWCA 4PQHA 4P3YB 5J5NA 3APOA 1T00A 1GSYA 3TKPA 3HJMA 3PGTA 3D4TA 3ZL5A 4D73B 1YKAA 1Q98A 3QD9A 2R4VA 5DDLA 3Q74A 1LBKA 2HE3A 5J41A 3KIJA 4MZWA 2A2PA 1GUHA 2WB9A 1PQNA 2DC5A 5IOXA 1ABAA 5JWQB 4GQCA 1MDKA 3WD6A 1V9WA 1X9WB 2B5EA 1EEJA 3GTUA 1XFLA 2M46A 1YEXA 1O8WA 1PKZA 3VWXA 4DSQA 5DVBA 4HQSA 3UMAA 3DVXA 3HVXA 4PQ1A 1KEBA 4X43A 4ECCA 1WPIA 2FD3A 3LYPA 4ECBA 1GTIA 1TDIA 4TOPA 4WR5A 2VCVA 3MAKA 1FB6A 2KP2A 1A2LA 2QSIA 1OE8A 1WMJA 2O85A 4IN0A 4D73A 3A5WA 4GWRA 1S3RA 1K0NA 1WOUA 5AISA 3IOSA 1SENA 3GNJA 2O89A 2HRNA 5DAKA 3I9V2 1QGVA 1ML6A 2HSYA 3D5JA 3ZMLA 1B4PA 3CQFA 2GDRA 2DIZA 4MDCA 4JR4A 4J57E 3GURA 2K9FA 4X4JA 4WKWA 5CREA 4XRAA 5D93A 1F9MA 2GQMA 3W8SA 4POLA 6GSSA 1EP7A 4QL9A 5DJMA 2KP1A 4E8HA 2H6XA 2H30A 1KNGA 2N5BA 5A4UA 2GVPA 2VCZA 3HCZA 3UVTA 2IMKA 2H6ZA 1UVZA 2N5FA 2H0GA 3IC8A 2JADA 2FWHA 3D4MA 1M3IA 2DJ2A 3UAPA 3NZNA 3UVHA 1XPVA 5ID2B 4HI7A 1T7PB 4IW9A 4KW6A 2C80A 2PPTA 2PVQA 1JHBA 2LEGA 2F9SA 3ME8A 4Q5FA 4ISDA 2HNLA 4JU5A 2XPDA 1EZKA 5H5RA 1V58A 5ECOB 3RHCA 3GV1A 4IP6A 4Z2RA 1ST9A 4DSSB 2XPEA 3HVSA 2YCDA 3MYDA 4O7HA 2E7PA 3J7Yk 4BWSA 1YJ6A 1MD3A 1B9YC 4BVXB 1W89A 4EXJA 1TTZA 2E2MA 2B3SA 4KAEA 4OCEA 1ERUA 4I97A 5ID2A 2LRNA 5EY6A 1Z7RA 4EO3A 1MDIA 2ES7A 1DBYA 3GSSA 1U3AA 2WGRA 13GSA 2TIRA 2HRAA 1K0AA 3FW2A 5J9BA 5ECLB 5JWRB 4MZCA 1SL1B 4TR0A 2H70A 4FYCA 2MMZA 4GSTA 2LNTA 2R0GA 1GULA 1XWGA 4QL7A 2CAIA 4ML6A 2M80A 2V6KA 3LORA 3VWWA 1GNEA 4OD7A 3MWHA 4EIQA 2LQOA 2YOIA 1A24A 1R26A 2K8SA 5CYYA 2QKEA 3FHKA 3LXTA 3CTGA 2FNOA 2VOCA 1BAYA 5IPGA 4I2TA 4KDXA 2GGTA 4I8BA 2H72A 2C3TA 2X8CA 4POBA 2NPBA 1TRUA 1X0RA 2L59A 4CHSA 1HNBA 2V2GA 2HFDA 1QK8A 2IIYA 2VD0A 1SD9A 1G7EA 1O6JA 3VK9A 4BWQA 3IRAA 5ECKB 2D2ZA 1PMTA 1XWAA 2PU9C 3QCPA 2PN8A 5IPHA 3ZTLA 4O5RA 1QUWA 1XG8A 3SBCA 3D21A 4MPGA 3DD3A 2DLXA 1K3OA 2YV9A 4HQZA 1AW9A 1CQHA 5HFIA 8GSSA 3VPQA 4IVFA 2I1UA 5E59A 2GQKA 2RLIA 1Q4JA 3VI5A 5B7CA 3DKSA 4MCUA 4PNFA 3DEXA 1TK5B 1YDKA 1T3BA 1JZWA 4K8MA 3KH9A 5H5SA 4JZQA 2G0FA 3LEFA 3G7YA 2X4AA 2NBSA 2LJKA 1OYJA 1KTEA 1U87A 3TRQA 1SYXA 2QA1A 4Z2UA 5KN3A 3F6FA 2OE0A 2LRTA 4ML1A 2B5YA 5JCUA 1SKRB 3BOAA 3FZ4A 3FZ5A 2PGTA 1JLVA 18GSA 4WR4A 3H79A 3M1GA 4IQAA 3F0IA 4KH7A 1HNCA 1BX9A 2VCWA 5F8BA 1AQWA 4O5UA 1V40A 2H75A 2N5AA 4ID0A 2PERA 2DMLA 3TRXA 4TW5A 5DQYA 2K6VA 4MABA 4A5PA 3TJJA 3CTFA 4LLRA 2H1GA 3MIXA 2EIRA 3C71A 3GUSA 2WULA 2A2RA 2X64A 3Q6OA 4RQXA 3E9JB 7GSSA 1NHYA 2NDOA 4KDYA 3TJFA 2C1YA 3MSZA 4GXZA 4LL1B 2IMDA 2E2GA 2A4HA 5HR0A 4MJAA 4KCEA 2I4AA 1JFUA 1TW9A 3PINA 2C0FA 4WBJA 4BA7A 1UA5A 3IDVA 3EU4A 2DJ0A 5F0GA 1T4YA 5H5QA 4N11A 4H86A 1MDJA 2LNSA 4N0VA 4ZB6A 3R2QA 5CRHA 2IMFA 2IL3A 4ZB8A 1LU4A 2B7KA 3LGCA 2R37A 3K8NA 1A2JA 5DBQA 4EVMA 4FYBA 2GSRA 1YF1A 4G10A 3US3A 3TCOA 5F07A 1SKWB 2MYGA 2X49A 1IYIA 2ON5A 2PWJA 4MPFA 2JSZA 2H0HA 2HLSA 2YZUA 1MD4A 5HQPA 4HU7A 1B8XA 2YV7A 4TN8A 9GSSA 1THXA 1M9AA 5L71A 1XWCA 2CV4A 3HD5A 2C0GA 1X5EA 2FGXA 1WP0A 3ZVJD 5ECSA 2ZUPA 2L5LA 3IXRA 2H66A 1K0OA 3OR5A 3UOMA 4L5OA 1PA3A 1YY7A 2X8HA 3DRNA 1AQXA 2F3MA 1PGTA 1ERTA 5IMZA 2VIMA 2IWTA 2I81A 1ERVA 4KNDA 19GSA 1V2AA 4MH3A 2H76A 3L9VA 1EOGA 3QDNA 3UBLA 3ZZXA 3BJ5A 2YJHA 3GYKA 1XVWA 3S9FA 2HSHA 1EEMA 2CVKA 2YN1A 2LUSA 5DQSA 1WRYA 3LXZA 5D96A 3EINA 2J23A 1TOFA 4HJMA 2FHEA 5FWGA 4ZXGA 4HEA2 3U6VA 3F3RA 1G7OA 3QAWA 4HOJA 5B6NA 2WS2A 4JE1A 5D73A 2OE1A 2QA2A 5INYA 1VF4A 3ZMKA 5DCGA 3JCML 4TR1B 3WT2A 2V1MA 2DMMA 3CYNA 2WZ9A 2CZ3A 1OVNA 2ON7A 1J08A 3D6IA 1TP9A 2FA4A 1XVQA 3UJ1A 2O7KA 5KN1A 1JZDA 1DE1A 4Z7XA 1OE7A 4J2FA 3MNGA 4FO5A 2FUG2 4JR6A 2ALBA 2HI7A 3KM6A 1T8EB 2FWGA 5ECPB 3HY2A 4KB3A 3TKSC 4TXOB 4V2NA 2VLUA 3GL3A 2FWFA 2IN3A 1Y6EA 16GSA 4GF0A 2VM1A 1ZGNA 3FR3A 1URMA 4HU9A 4J56E 2FY6A 3LYKA 2GSQA 4OCFA 3HDCA 4FQUA 2MZCA 5E4WA 1SD8A 1Z9HA 3FR6A 12GSA 2M72A 5G5FA 3L0HA 1KBNA 3HA9A 4K2XA 2R0PA 2CQ9A 5C04A 1OC8A 3NOFA 3UIWA 5IQYA 5G1KA 2B7JA 3V1WA 3VURA 1TXXA 2CA8A 3LW9A 4YAVA 1TU8A 3APQA 2VD1A 2XBQA 3HJOA 4WEYA 5GSTA 2GTUA 2TRCP 2REMA 4GSNA 2DBCA 2XHFA 3TKRA 3P2AA 1EP8A 3KMOA 5ELGA 4Z2TA 1QMVA 3ZVJA 2VCQA 2GS3A 3EYTA 1WWJA 4TXOA 1GLQA 3M9JA 2OE3A 4G0LA 5GAPD 2P5QA 2VLVA 2ZNMA 4ZILA 3H8QA 5KN2A 4HDEA 4PTSA 2CVBA 1PKWA 4KSOA 1S3AA 1TRSA 3L9UA 2GZPA 3KH7A 1V98A 3E0UA 3ZFLA 4HUAA 1O73A 4K7NA 1YKCA 4MF7A 4X1UA 4TVEA 4OFTA 1GTAA 5B8AA 4G0KA 3ZREA 4GSSA 4NXIA 1HYUA 3IAM2 1AIUA 1ZOFA 14GSA 3QPMA 3Q18A 1I5GA 4Q5QA 3KTLA 5D9XA 1ZYNA 4BL7B 2HT9A 4OFMA 3R3EA 1THOA 3QAGA 1DE2A 1FG4A 2DKIA 3FZ9A 3N5OA 5DALB 4NHZA 4HJ2A 4K0GA 1NSWA 4PUAA 4G9HA 3HYPA 2IPAA 4K7OA 2R3XA 4G2EA 3RDWA 2GT6A 10GSA 4MA9A 1XZOA 3EWLA 2OJLA 2B1LA 2LQQA 3KD0A 11GSA 3KZQA 4PNGA 1J9BA 2C3NA 4TKYA 2XBIA 5J4UA 2CZ2A 3MDKA 4NMUA 1M2BA 1ZL9A 3DVWA 2DJ3A 1GLPA 2P31A 1X9MB 1K0CA 4ZBAA 3FEUA 4EDYA 4ZL7A 1X9SB 4V1Ap 1A23A 5CNWA 1AAZA 2DJJA 2H1DA 2C3QA 1ZYEA 1G6WA 3EE2A 4BVYB 4IKHA 1XIYA 3TDGA 4TRXA 5LNKe 2X99A 1ZYQB 4BL7A 2JL4A 4MNNA 22GSA 4DSSA 4F0BA 1YEPA 1GSFA 1TJDA 5AIVA 3ED3A 3VFIA 5DALA 1A8LA 4PXOA 5DCHA 4GLTA 2GSTA 2VM2A 3GX8A 3TOUA 3ZRDA 4RI6A 1G0TA 3C8EA 2VCTA 1F3AA 2I3YA 1JZOA 5EPFA 1QFNA 4BVXA
chains in the Genus database with same CATH topology
1YZXA 2L57A 1A2MA 4EUYA 2ZCTA 1GSSA 2PBJA 2R6KA 2PVOC 3DGQA 3M8NA 3WT1A 3EVIA 5AGYA 3I69A 2YNXA 4DSRA 2FLSA 4V1Ag 4N10A 3M3MA 2JZSA 3QMXA 4K6XA 1DUGA 4HZ2A 1F37A 4IGJA 2R5GA 3LSZA 2VUPA 1SU9A 1XCCA 5JWOB 4ECJA 5CAXA 4IELA 4FH8A 4ZBBA 2WRTA 3F4TA 4BVYA 3I43A 1HQOA 2H0IA 1GRXA 3UL3A 3ZYWA 4N0ZA 5HR1A 3DYRA 3GN3A 4ACSA 3WGEA 4G0IA 3QFAC 3CRTA 3IE3A 2E0QA 4XHMA 2C4JA 3ME7A 5FT3A 1AUCA 5IMCA 1M2DA 2CX3A 1K0BA 3ISOA 4ULXA 1GP1A 1M2AA 1M99A 4KGIA 2G2QA 1FVKA 1XXUA 1ERWA 3IAS2 3CRUA 4XCSA 3CSJA 4KA0A 3VPTA 2K18A 5JCGA 2DIYA 1T4ZA 1BG5A 3HZ8A 4YQVA 4QQ7A 3LG6A 2L6DA 1B4QA 1FHEA 1ZZYA 5FHIA 4TR3A 4XTSA 4K7IA 3H1NA 2OA7A 4X0XA 2H71A 1WIKA 4YKGA 3EPTA 1W4VA 3F4RA 4L0UA 2FCHA 3WYWA 4XS6A 2IMEA 6GSWA 4PX1A 3F8UA 4KUNA 4WBRD 4KSMA 2J9HA 3HHVA 3A3TA 1TK8B 3KEBA 3GHAA 5A4VA 2O8VB 2R0CA 1MEKA 1S3DA 1XOBA 4WF5A 1OKDA 4YQUA 3H4KA 4TXVA 4ZL9A 2L5OA 5IMFA 5KOXA 3QAVA 2EC4A 3FRCA 3W6GA 3FYGA 1XWKA 3BCIA 5HFKA 2YPMA 4Q5NA 3F4SA 3RBTA 4GTUA 5KEJA 3RAZA 5B6MA 1N8JA 2A4VA 1FB0A 2LRCA 3IV4A 1JLWA 2GQLA 2NVLA 2BMXA 2WCIA 1O81A 2VCXA 2B5XA 1F2EA 2O87A 1RQMA 2MBTA 4WF4A 2P5RA 1PN0A 4MJEA 4I2UA 4YKFA 1XWBA 3FK8A 4XS1A 4ECIA 1FOHA 3TJKA 1FVJA 1G6YA 1NHOA 1C72A 2WDUA 4MK3A 4AJ6A 1XOAA 4DEJA 2CX4A 2H1AA 2F51A 1K0MA 4CW9A 2LKUA 4OO5A 4O92A 1SK1A 3FR9A 5ECMB 2LS5A 1OAZA 2JACA 3UARA 4BPYA 3KGKA 3L78A 1GH2A 2YANA 3GSTA 2X8GA 2BJXA 2NTOA 1LJRA 2YWMA 2MMOA 3U5RE 1UN2A 3KP8A 3RPNA 2CAQA 17GSA 5CRDA 3LQ7A 4Q5RA 4NHWA 5LD0A 2IMIA 3W8JA 1Z3EA 6GSYA 1GTBA 5D9WA 2L4QA 4ZB9A 2QGVA 3VLNA 3LJRA 3GKNA 1H4OA 4WETA 3QR6A 2OBIA 3DWVA 4ZBDA 5CP1A 1F6MC 3FMWA 3A5IA 3PH9A 3GRXA 3HZ4A 4EIPA 1V57A 3CSHA 4POKA 4KCAA 2AJQB 1R5PA 3P8WA 5ENUA 4PGTA 4ZL8A 2V32A 1Z7PA 4K5SA 1ACVA 4OO4A 3GFKA 1IYHA 3F9UA 2I9HA 4USSA 1TRWA 1SK0A 2QC7A 3VWUA 3UEMA 3J7Yb 3EU3A 3A2XA 5GSSA 2RUEA 1OC9B 5G30A 5B8BA 1PRXA 1BYEA 4NWYA 1TKDB 3L4NA 2HSMA 1NW2A 1VF3A 2IFQB 3GX0A 6GSXA 2VL9A 3RHBA 2B6MA 2VAFA 3C7MA 5ECIB 1U6TA 5DAKB 1RK4A 3GIXA 4YAPA 3ZITA 2OBKA 20GSA 4GCIA 3M9KA 1DSBA 2HXKA 1A0FA 4K5RA 1RW1A 4IQ1A 2MMAA 1TI3A 1SYRA 3O76A 4HS1A 3LFLA 3E3EA 2AAWA 2B1KA 5F05A 1Z6NA 4LA1A 3BBYA 1ON4A 2PMTA 5C00A 4GQFA 2LJAA 4L8EA 5D8IA 3GL5A 2FWEA 3A2VA 5CRWA 3GMFA 3KJYA 1T1VA 1OC9A 1VRSD 2KLXA 4LL4B 5D9TA 4TR1A 1QXHA 3A2WA 1EV4A 1AXDA 3FZAA 1O8XA 3TGZA 6GSTA 1SL0B 4MH2A 1BQ7A 1N2AA 1Z5YE 2LSTA 1R7HA 5IIZA 3ERWA 2IFQA 4LMVA 3G7IA 1FAAA 2GZYA 3CXGA 4JRRA 5IM9A 1OC3A 1PD21 3O6TA 3BCKA 3QFBC 2JSYA 5ECRB 2LV3A 3HXSA 3VWVA 4MZBA 4K0NA 4EC0A 1TK0B 3EC3A 1ZCPA 1PN9A 1GUKA 1U3IA 2VL3A 4AJ8A 2H01A 1SJ6A 5GZZB 4DVCA 2DKHA 2F8AA 3F3QA 4TR4A 2C0DA 4F0CA 5A5KA 1GSDA 1GTUA 1FW1A 1VGLA 2YP6A 5CRGA 2AB6A 4YQMA 3DMLA 3KMNA 4NV5A 1B48A 1GUMA 3GH6A 3P90A 1ZMAA 2YWNA 2DJ1A 3IK7A 5G1LA 2PUKC 1MTCA 4IHUA 5HFGA 1SKSB 3I6AA 5GAND 1VF1A 1SJZA 2H6YA 2V41A 2YWOA 4OWYA 5AIXA 3TKSA 4EE0A 5IMAA 1GNWA 1BJXA 5JCWA 1X5DA 1EV9A 3TUEA 1EWXA 4RI7A 4WXTA 4K9ZA 2IJYA 1EGOA 3GKKA 4O5QA 4F82A 2HRKA 2L6CA 1M0UA 3P7XA 1A0RP 1YF0A 5F06A 1FO5A 1K3YA 4KF9A 2HZEB 4IBPA 1PX7A 4FYUA 2F8FA 3C1RA 3FY7A 1EGRA 4XS4B 1HNAA 2LTKA 5BRTA 4GRFA 2H19A 3L9SA 2KHPA 4I5QA 3FKFA 1H75A 4XIHA 2VO4A 1BEDA 4CY6A 3IK9A 1AQVA 1XW6A 5ECHB 4CY8A 4L0WA 2RM6A 1K3LA 3IR4A 3AY8A 2KUCA 3ZIVA 1TRVA 3HKRA 4IP1A 2WFCA 5HR2A 2JZRA 3EURA 2KOKA 1PL2A 4PUFC 2HYXA 2EIOA 2RM5A 4IJ3A 2EIQA 1CQGA 1PL1A 4K2DA 1UC7A 4ICYA 3NIVA 1GSEA 4NAXA 3ERFA 4EKZA 2HZEA 3VI7A 2K8VA 4XS4A 3UBKA 5IMDA 5IMVA 1ZYPA 2AUVA 4EF0A 1JZRA 1WE0A 4MJCA 3CSIA 1GSQA 5ECNB 4F9ZA 2VLTA 5J9CA 3CMIA 5G2ZA 2DSAA 4F2IA 5IO0A 4N30A 1K0DA 5ELAA 1WJKA 1F3BA 4KE3A 1SL2B 4MF5A 1OKTA 3KTBA 3KP9A 4RUVA 2MMNA 3N9JA 1AC1A 2YZHA 3D22A 5J3RA 4V2LA 1B9XC 1I9DA 3H93A 5KOWA 5BMUA 3M0FA 2HZFA 4MLYA 1Y25A 3IA1A 3Q19A 2R2JA 2GSSA 4OFNA 5A4WA 4EL1A 3HJPA 4LMWA 1NM3A 2A2SA 1YQ1A 2H1BA 2OADA 4OMVA 2LJRA 5IOWA 2DJKA 3BD2A 2VL2C 3LWAA 4NV2A 3WGXA 3TB2A 5HR3A 3TJBA 1EOHA 2TRXA 4POMA 4G19A 3GA4A 4FIWA 1TU7A 2Z9SA 2GLRA 3DXBA 2AYTA 2UZ8A 3D0ZA 3PR8A 5G5EA 3DIEA 3ERGA 2JZTA 1HD2A 2YWIA 2H73A 3GH9A 2P0GA 2JU5A 2XC2A 3IBHA 3TKSE 3TKQA 4XRDA 5EVOA 5IO2A 4KDUA 3HVVA 3KXOA 4JEDA 1XBSA 3ZIJA 5EL8A 1A8YA 1ILOA 4ILFA 4IJIA 1O85A 2C0EA 3TRPA 1R4WA 4EDZA 1E2YA 1XW5A 1X5CA 3F6DA 4RQRA 5D9VA 3TJGA 3G9BA 1QQ2A 2CT6A 2GZZA 2YJ7A 3O3TA 1USBA 3IC4A 5DJLA 2OKAA 1E6BA 4I6XA 4MP4A 1S3CA 2MBSA 5CO3A 4YH2A 3F63A 3GKXA 5LCZA 5COHA 4NPBA 1O7UA 4PQIA 2HRFA 4JBBA 3SWLA 3IPZA 3CBUA 2V6OA 5G31A 1J0FA 4ZIJA 3IHGA 3ZLPA 4F03A 6GSUA 1R5AA 2VL2A 3WGDA 2WJUA 2RIIA 3PPUA 4PURA 1XW9A 4AJ7A 3GKMA 2GT5A 4KX4A 2L4CA 1FOVA 5ABRA 5AN1A 4CDOA 2OACA 2H74A 3C73A 2AV4A 2C8UA 1TI1A 1U88A 1Z6MA 2CVDA 3IHQA 1VF2A 4MF6A 2FA8A 5ECQB 4HZ4A 4AF2A 3APSA 2AHEA 4IS0A 1SK2A 3QOUA 2H8LA 4MJBA 3C1SA 5KN0A 4MMMA 1PSQA 3EMXA 6GSVA 2BTOT 3GTUB 4E8EA 3KCMA 4V2MA 1GSUA 4O32A 4AGSA 1M7TA 1SJIA 2RUFA 4L5LA 1M9BA 3TOTA 4K1FA 1PX6A 1GL8A 3RPPA 3ZFBA 3EMPA 3G7JA 1GWCA 4PQHA 4P3YB 5J5NA 3APOA 1T00A 1GSYA 3TKPA 3HJMA 3PGTA 3D4TA 3ZL5A 4D73B 1YKAA 1Q98A 3QD9A 2R4VA 5DDLA 3Q74A 1LBKA 2HE3A 5J41A 3KIJA 4MZWA 2A2PA 1GUHA 2WB9A 1PQNA 2DC5A 5IOXA 1ABAA 5JWQB 4GQCA 1MDKA 3WD6A 1V9WA 1X9WB 2B5EA 1EEJA 3GTUA 1XFLA 2M46A 1YEXA 1O8WA 1PKZA 3VWXA 4DSQA 5DVBA 4HQSA 3UMAA 3DVXA 3HVXA 4PQ1A 1KEBA 4X43A 4ECCA 1WPIA 2FD3A 3LYPA 4ECBA 1GTIA 1TDIA 4TOPA 4WR5A 2VCVA 3MAKA 1FB6A 2KP2A 1A2LA 2QSIA 1OE8A 1WMJA 2O85A 4IN0A 4D73A 3A5WA 4GWRA 1K0NA 1WOUA 5AISA 3IOSA 1SENA 3GNJA 2O89A 2HRNA 5DAKA 3I9V2 1QGVA 1ML6A 2HSYA 3D5JA 3ZMLA 1B4PA 2GDRA 2DIZA 4MDCA 4JR4A 4J57E 3GURA 2K9FA 4X4JA 4WKWA 5CREA 4XRAA 5D93A 1F9MA 2GQMA 3W8SA 4POLA 6GSSA 1EP7A 4QL9A 5DJMA 2KP1A 4E8HA 2H6XA 2H30A 1KNGA 2N5BA 5A4UA 2GVPA 2VCZA 3HCZA 3UVTA 2IMKA 2H6ZA 1UVZA 2N5FA 2H0GA 3IC8A 2JADA 2FWHA 3D4MA 2DJ2A 3UAPA 3NZNA 3UVHA 1XPVA 5ID2B 4HI7A 1T7PB 4IW9A 4KW6A 2C80A 2PPTA 2PVQA 1JHBA 2LEGA 2F9SA 3ME8A 4Q5FA 4ISDA 2HNLA 4JU5A 2XPDA 1EZKA 5H5RA 1V58A 5ECOB 3RHCA 3GV1A 4IP6A 4Z2RA 1ST9A 4DSSB 2XPEA 3HVSA 2YCDA 3MYDA 4O7HA 2E7PA 3J7Yk 4BWSA 1YJ6A 1MD3A 1B9YC 4BVXB 1W89A 4EXJA 1TTZA 2E2MA 2B3SA 4KAEA 4OCEA 1ERUA 4I97A 5ID2A 2LRNA 5EY6A 1Z7RA 4EO3A 1MDIA 2ES7A 1DBYA 3GSSA 1U3AA 2WGRA 13GSA 2TIRA 2HRAA 1K0AA 3FW2A 5J9BA 5ECLB 5JWRB 4MZCA 1SL1B 4TR0A 2H70A 4FYCA 2MMZA 4GSTA 2LNTA 2R0GA 1GULA 1XWGA 4QL7A 2CAIA 4ML6A 2M80A 2V6KA 3LORA 3VWWA 1GNEA 4OD7A 3MWHA 4EIQA 2LQOA 2YOIA 1A24A 1R26A 2K8SA 5CYYA 2QKEA 3FHKA 3LXTA 3CTGA 2FNOA 2VOCA 1BAYA 5IPGA 4I2TA 4KDXA 2GGTA 4I8BA 2H72A 2C3TA 2X8CA 4POBA 2NPBA 1TRUA 1X0RA 2L59A 4CHSA 1HNBA 2V2GA 2HFDA 1QK8A 2IIYA 2VD0A 1SD9A 1G7EA 1O6JA 3VK9A 4BWQA 3IRAA 5ECKB 2D2ZA 1PMTA 1XWAA 2PU9C 3QCPA 2PN8A 5IPHA 3ZTLA 4O5RA 1QUWA 3SBCA 3D21A 4MPGA 3DD3A 2DLXA 1K3OA 2YV9A 4HQZA 1AW9A 1CQHA 5HFIA 8GSSA 3VPQA 4IVFA 2I1UA 5E59A 2GQKA 2RLIA 1Q4JA 3VI5A 5B7CA 3DKSA 4MCUA 4PNFA 3DEXA 1TK5B 1YDKA 1T3BA 1JZWA 4K8MA 3KH9A 5H5SA 4JZQA 2G0FA 3LEFA 3G7YA 2X4AA 2NBSA 2LJKA 1OYJA 1KTEA 1U87A 3TRQA 1SYXA 2QA1A 4Z2UA 5KN3A 3F6FA 2OE0A 2LRTA 4ML1A 2B5YA 5JCUA 1SKRB 3BOAA 3FZ4A 3FZ5A 2PGTA 1JLVA 18GSA 4WR4A 3H79A 3M1GA 4IQAA 3F0IA 4KH7A 1HNCA 1BX9A 2VCWA 5F8BA 1AQWA 4O5UA 1V40A 2H75A 2N5AA 4ID0A 2PERA 2DMLA 3TRXA 4TW5A 5DQYA 2K6VA 4MABA 4A5PA 3TJJA 3CTFA 4LLRA 2H1GA 3MIXA 2EIRA 3C71A 3GUSA 2WULA 2A2RA 2X64A 3Q6OA 4RQXA 3E9JB 7GSSA 1NHYA 2NDOA 4KDYA 3TJFA 2C1YA 3MSZA 4GXZA 4LL1B 2IMDA 2E2GA 2A4HA 5HR0A 4MJAA 4KCEA 2I4AA 1JFUA 1TW9A 3PINA 2C0FA 4WBJA 4BA7A 1UA5A 3IDVA 3EU4A 2DJ0A 5F0GA 1T4YA 5H5QA 4N11A 4H86A 1MDJA 2LNSA 4N0VA 4ZB6A 3R2QA 5CRHA 2IMFA 2IL3A 4ZB8A 1LU4A 2B7KA 3LGCA 2R37A 3K8NA 1A2JA 5DBQA 4EVMA 4FYBA 2GSRA 1YF1A 4G10A 3US3A 3TCOA 5F07A 1SKWB 2MYGA 2X49A 1IYIA 2ON5A 2PWJA 4MPFA 2JSZA 2H0HA 2HLSA 2YZUA 1MD4A 5HQPA 4HU7A 1B8XA 2YV7A 4TN8A 9GSSA 1THXA 1M9AA 5L71A 1XWCA 2CV4A 3HD5A 2C0GA 1X5EA 2FGXA 1WP0A 3ZVJD 5ECSA 2ZUPA 2L5LA 3IXRA 2H66A 1K0OA 3OR5A 3UOMA 4L5OA 1PA3A 1YY7A 2X8HA 3DRNA 1AQXA 2F3MA 1PGTA 1ERTA 5IMZA 2VIMA 2IWTA 2I81A 1ERVA 4KNDA 19GSA 1V2AA 4MH3A 2H76A 3L9VA 1EOGA 3QDNA 3UBLA 3ZZXA 3BJ5A 2YJHA 3GYKA 1XVWA 3S9FA 2HSHA 1EEMA 2CVKA 2YN1A 2LUSA 5DQSA 1WRYA 3LXZA 5D96A 3EINA 2J23A 1TOFA 4HJMA 2FHEA 5FWGA 4ZXGA 4HEA2 3U6VA 3F3RA 1G7OA 3QAWA 4HOJA 5B6NA 2WS2A 4JE1A 5D73A 2OE1A 2QA2A 5INYA 1VF4A 3ZMKA 5DCGA 3JCML 4TR1B 3WT2A 2V1MA 2DMMA 3CYNA 2WZ9A 2CZ3A 1OVNA 2ON7A 1J08A 3D6IA 1TP9A 2FA4A 1XVQA 3UJ1A 2O7KA 5KN1A 1JZDA 1DE1A 4Z7XA 1OE7A 4J2FA 3MNGA 4FO5A 2FUG2 4JR6A 2ALBA 2HI7A 3KM6A 1T8EB 2FWGA 5ECPB 3HY2A 4KB3A 3TKSC 4TXOB 4V2NA 2VLUA 3GL3A 2FWFA 2IN3A 1Y6EA 16GSA 4GF0A 2VM1A 1ZGNA 3FR3A 1URMA 4HU9A 4J56E 2FY6A 3LYKA 2GSQA 4OCFA 3HDCA 4FQUA 2MZCA 5E4WA 1SD8A 1Z9HA 3FR6A 12GSA 2M72A 5G5FA 3L0HA 1KBNA 3HA9A 4K2XA 2R0PA 2CQ9A 5C04A 1OC8A 3NOFA 3UIWA 5IQYA 5G1KA 2B7JA 3V1WA 3VURA 1TXXA 2CA8A 3LW9A 4YAVA 1TU8A 3APQA 2VD1A 2XBQA 3HJOA 4WEYA 5GSTA 2GTUA 2TRCP 2REMA 4GSNA 2DBCA 2XHFA 3TKRA 3P2AA 1EP8A 3KMOA 5ELGA 4Z2TA 1QMVA 3ZVJA 2VCQA 2GS3A 3EYTA 1WWJA 4TXOA 1GLQA 3M9JA 2OE3A 4G0LA 5GAPD 2P5QA 2VLVA 2ZNMA 4ZILA 3H8QA 5KN2A 4HDEA 4PTSA 2CVBA 1PKWA 4KSOA 1S3AA 1TRSA 3L9UA 2GZPA 3KH7A 1V98A 3E0UA 3ZFLA 4HUAA 1O73A 4K7NA 1YKCA 4MF7A 4X1UA 4TVEA 4OFTA 1GTAA 5B8AA 4G0KA 3ZREA 4GSSA 4NXIA 1HYUA 3IAM2 1AIUA 1ZOFA 14GSA 3QPMA 3Q18A 1I5GA 4Q5QA 3KTLA 5D9XA 1ZYNA 4BL7B 2HT9A 4OFMA 3R3EA 1THOA 3QAGA 1DE2A 1FG4A 2DKIA 3FZ9A 3N5OA 5DALB 4NHZA 4HJ2A 4K0GA 1NSWA 4PUAA 4G9HA 3HYPA 2IPAA 4K7OA 2R3XA 4G2EA 3RDWA 2GT6A 10GSA 4MA9A 1XZOA 3EWLA 2OJLA 2B1LA 2LQQA 3KD0A 11GSA 3KZQA 4PNGA 1J9BA 2C3NA 4TKYA 2XBIA 5J4UA 2CZ2A 3MDKA 4NMUA 1M2BA 1ZL9A 3DVWA 2DJ3A 1GLPA 2P31A 1X9MB 1K0CA 4ZBAA 3FEUA 4EDYA 4ZL7A 1X9SB 4V1Ap 1A23A 5CNWA 1AAZA 2DJJA 2H1DA 2C3QA 1ZYEA 1G6WA 3EE2A 4BVYB 4IKHA 1XIYA 3TDGA 4TRXA 5LNKe 2X99A 1ZYQB 4BL7A 2JL4A 4MNNA 22GSA 4DSSA 4F0BA 1YEPA 1GSFA 1TJDA 5AIVA 3ED3A 3VFIA 5DALA 1A8LA 4PXOA 5DCHA 4GLTA 2GSTA 2VM2A 3GX8A 3TOUA 3ZRDA 4RI6A 1G0TA 3C8EA 2VCTA 1F3AA 2I3YA 1JZOA 5EPFA 1QFNA 4BVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YZX A;  2L57 A;  1A2M A;  4EUY A;  2ZCT A;  1GSS A;  2PBJ A;  2R6K A;  2PVO C;  3DGQ A;  3M8N A;  3WT1 A;  3EVI A;  5AGY A;  3I69 A;  2YNX A;  4DSR A;  2FLS A;  4V1A g;  4N10 A;  3M3M A;  2JZS A;  3QMX A;  4K6X A;  1DUG A;  4HZ2 A;  1F37 A;  4IGJ A;  2R5G A;  3LSZ A;  2VUP A;  1SU9 A;  1XCC A;  5JWO B;  4ECJ A;  5CAX A;  4IEL A;  4FH8 A;  4ZBB A;  2WRT A;  3F4T A;  4BVY A;  3I43 A;  1HQO A;  2H0I A;  1GRX A;  3UL3 A;  3ZYW A;  4N0Z A;  5HR1 A;  3DYR A;  3GN3 A;  4ACS A;  3WGE A;  3QFA C;  3CRT A;  3IE3 A;  2E0Q A;  4XHM A;  2C4J A;  3ME7 A;  5FT3 A;  1AUC A;  5IMC A;  1M2D A;  2CX3 A;  1K0B A;  3ISO A;  4ULX A;  1GP1 A;  1M2A A;  1M99 A;  4KGI A;  2G2Q A;  1FVK A;  1XXU A;  1ERW A;  3IAS 2;  3CRU A;  4XCS A;  3CSJ A;  4KA0 A;  3VPT A;  2K18 A;  5JCG A;  2DIY A;  1T4Z A;  1BG5 A;  3HZ8 A;  4YQV A;  4QQ7 A;  3LG6 A;  2L6D A;  1B4Q A;  1FHE A;  1ZZY A;  5FHI A;  4TR3 A;  4XTS A;  4K7I A;  3H1N A;  2OA7 A;  4X0X A;  2H71 A;  1WIK A;  1W4V A;  3F4R A;  4L0U A;  2FCH A;  3WYW A;  4XS6 A;  2IME A;  6GSW A;  4PX1 A;  3F8U A;  4KUN A;  4WBR D;  4KSM A;  2J9H A;  3HHV A;  3A3T A;  1TK8 B;  3KEB A;  3GHA A;  5A4V A;  2O8V B;  1MEK A;  1S3D A;  1XOB A;  4WF5 A;  1OKD A;  4YQU A;  3H4K A;  4TXV A;  4ZL9 A;  2L5O A;  5IMF A;  3QAV A;  2EC4 A;  3FRC A;  3W6G A;  3FYG A;  1XWK A;  3BCI A;  5HFK A;  2YPM A;  4Q5N A;  3F4S A;  3RBT A;  4GTU A;  5KEJ A;  3RAZ A;  5B6M A;  1N8J A;  2A4V A;  1FB0 A;  2LRC A;  3IV4 A;  1JLW A;  2GQL A;  2NVL A;  2BMX A;  2WCI A;  1O81 A;  2VCX A;  2B5X A;  1F2E A;  2O87 A;  1RQM A;  2MBT A;  4WF4 A;  2P5R A;  4MJE A;  4I2U A;  1XWB A;  3FK8 A;  4XS1 A;  4ECI A;  3TJK A;  1FVJ A;  1G6Y A;  1NHO A;  1C72 A;  2WDU A;  4MK3 A;  4AJ6 A;  1XOA A;  4DEJ A;  2CX4 A;  2H1A A;  2F51 A;  1K0M A;  4CW9 A;  2LKU A;  4OO5 A;  4O92 A;  1SK1 A;  3FR9 A;  5ECM B;  2LS5 A;  1OAZ A;  2JAC A;  3UAR A;  4BPY A;  3KGK A;  3L78 A;  1GH2 A;  2YAN A;  3GST A;  2X8G A;  2BJX A;  2NTO A;  1LJR A;  2YWM A;  2MMO A;  3U5R E;  1UN2 A;  3KP8 A;  3RPN A;  2CAQ A;  17GS A;  5CRD A;  3LQ7 A;  4Q5R A;  4NHW A;  5LD0 A;  2IMI A;  3W8J A;  1Z3E A;  6GSY A;  1GTB A;  5D9W A;  2L4Q A;  4ZB9 A;  2QGV A;  3VLN A;  3LJR A;  3GKN A;  1H4O A;  4WET A;  3QR6 A;  2OBI A;  3DWV A;  4ZBD A;  5CP1 A;  1F6M C;  3PH9 A;  3GRX A;  3HZ4 A;  1V57 A;  3CSH A;  4POK A;  4KCA A;  2AJQ B;  1R5P A;  3P8W A;  5ENU A;  4PGT A;  4ZL8 A;  2V32 A;  1Z7P A;  1ACV A;  4OO4 A;  3GFK A;  1IYH A;  3F9U A;  2I9H A;  1TRW A;  1SK0 A;  2QC7 A;  3VWU A;  3UEM A;  3J7Y b;  3EU3 A;  3A2X A;  5GSS A;  2RUE A;  1OC9 B;  5G30 A;  5B8B A;  1PRX A;  1BYE A;  4NWY A;  1TKD B;  3L4N A;  1NW2 A;  1VF3 A;  2IFQ B;  3GX0 A;  6GSX A;  2VL9 A;  3RHB A;  2B6M A;  2VAF A;  3C7M A;  5ECI B;  1U6T A;  5DAK B;  1RK4 A;  3GIX A;  4YAP A;  3ZIT A;  2OBK A;  20GS A;  4GCI A;  3M9K A;  1DSB A;  2HXK A;  1A0F A;  1RW1 A;  4IQ1 A;  2MMA A;  1TI3 A;  1SYR A;  3O76 A;  4HS1 A;  3LFL A;  3E3E A;  2AAW A;  5F05 A;  2B1K A;  1Z6N A;  4LA1 A;  3BBY A;  1ON4 A;  2PMT A;  5C00 A;  4GQF A;  2LJA A;  4L8E A;  5D8I A;  3GL5 A;  2FWE A;  3A2V A;  3GMF A;  5CRW A;  3KJY A;  1T1V A;  1OC9 A;  1VRS D;  2KLX A;  4LL4 B;  5D9T A;  4TR1 A;  1QXH A;  3A2W A;  1EV4 A;  1AXD A;  3FZA A;  1O8X A;  3TGZ A;  6GST A;  1SL0 B;  4MH2 A;  1BQ7 A;  1N2A A;  1Z5Y E;  2LST A;  1R7H A;  5IIZ A;  3ERW A;  2IFQ A;  4LMV A;  3G7I A;  1FAA A;  2GZY A;  3CXG A;  4JRR A;  5IM9 A;  1OC3 A;  1PD2 1;  3O6T A;  3BCK A;  3QFB C;  2JSY A;  5ECR B;  2LV3 A;  3HXS A;  3VWV A;  4MZB A;  4K0N A;  4EC0 A;  1TK0 B;  3EC3 A;  1ZCP A;  1PN9 A;  1GUK A;  1U3I A;  2VL3 A;  4AJ8 A;  2H01 A;  1SJ6 A;  5GZZ B;  4DVC A;  2F8A A;  3F3Q A;  4TR4 A;  2C0D A;  4F0C A;  5A5K A;  1GSD A;  1GTU A;  1FW1 A;  1VGL A;  2YP6 A;  5CRG A;  2AB6 A;  4YQM A;  3DML A;  3KMN A;  4NV5 A;  1B48 A;  1GUM A;  3GH6 A;  3P90 A;  1ZMA A;  2YWN A;  2DJ1 A;  3IK7 A;  5G1L A;  2PUK C;  1MTC A;  4IHU A;  5HFG A;  1SKS B;  3I6A A;  5GAN D;  1VF1 A;  1SJZ A;  2H6Y A;  2V41 A;  2YWO A;  4OWY A;  5AIX A;  3TKS A;  4EE0 A;  5IMA A;  1GNW A;  1BJX A;  5JCW A;  1X5D A;  1EV9 A;  3TUE A;  1EWX A;  4RI7 A;  4WXT A;  4K9Z A;  2IJY A;  1EGO A;  3GKK A;  4F82 A;  2L6C A;  1M0U A;  3P7X A;  1A0R P;  1YF0 A;  5F06 A;  1FO5 A;  1K3Y A;  2HZE B;  4IBP A;  1PX7 A;  4FYU A;  2F8F A;  3C1R A;  3FY7 A;  1EGR A;  4XS4 B;  1HNA A;  2LTK A;  4GRF A;  2H19 A;  3L9S A;  2KHP A;  4I5Q A;  3FKF A;  1H75 A;  4XIH A;  2VO4 A;  1BED A;  3IK9 A;  1AQV A;  1XW6 A;  5ECH B;  4L0W A;  2RM6 A;  1K3L A;  3IR4 A;  3AY8 A;  2KUC A;  3ZIV A;  1TRV A;  3HKR A;  4IP1 A;  2WFC A;  5HR2 A;  2JZR A;  3EUR A;  2KOK A;  1PL2 A;  4PUF C;  2HYX A;  2EIO A;  2RM5 A;  4IJ3 A;  2EIQ A;  1CQG A;  1PL1 A;  4K2D A;  1UC7 A;  3NIV A;  1GSE A;  4NAX A;  3ERF A;  4EKZ A;  2HZE A;  3VI7 A;  2K8V A;  4XS4 A;  3UBK A;  5IMD A;  5IMV A;  2AUV A;  4EF0 A;  1JZR A;  1WE0 A;  4MJC A;  3CSI A;  1GSQ A;  5ECN B;  4F9Z A;  2VLT A;  5J9C A;  3CMI A;  5G2Z A;  2DSA A;  4F2I A;  5IO0 A;  4N30 A;  1K0D A;  5ELA A;  1WJK A;  1F3B A;  4KE3 A;  1SL2 B;  4MF5 A;  1OKT A;  3KTB A;  3KP9 A;  4RUV A;  2MMN A;  3N9J A;  1AC1 A;  2YZH A;  3D22 A;  5J3R A;  4V2L A;  1B9X C;  1I9D A;  3H93 A;  3M0F A;  2HZF A;  4MLY A;  1Y25 A;  3IA1 A;  3Q19 A;  2R2J A;  2GSS A;  4OFN A;  5A4W A;  4EL1 A;  3HJP A;  4LMW A;  1NM3 A;  2A2S A;  1YQ1 A;  2H1B A;  2OAD A;  4OMV A;  2LJR A;  5IOW A;  2DJK A;  3BD2 A;  2VL2 C;  3LWA A;  4NV2 A;  3WGX A;  3TB2 A;  5HR3 A;  3TJB A;  1EOH A;  2TRX A;  4POM A;  4G19 A;  3GA4 A;  4FIW A;  1TU7 A;  2Z9S A;  2GLR A;  3DXB A;  2AYT A;  3D0Z A;  3PR8 A;  5G5E A;  3DIE A;  3ERG A;  2JZT A;  1HD2 A;  2YWI A;  2H73 A;  3GH9 A;  2P0G A;  2JU5 A;  2XC2 A;  3IBH A;  3TKS E;  3TKQ A;  4XRD A;  5EVO A;  5IO2 A;  4KDU A;  3HVV A;  3KXO A;  4JED A;  1XBS A;  3ZIJ A;  5EL8 A;  1A8Y A;  1ILO A;  4ILF A;  4IJI A;  1O85 A;  2C0E A;  3TRP A;  1R4W A;  4EDZ A;  1E2Y A;  1XW5 A;  1X5C A;  3F6D A;  4RQR A;  5D9V A;  3TJG A;  3G9B A;  1QQ2 A;  2CT6 A;  2GZZ A;  2YJ7 A;  3O3T A;  1USB A;  3IC4 A;  5DJL A;  2OKA A;  1E6B A;  4I6X A;  4MP4 A;  1S3C A;  2MBS A;  5CO3 A;  4YH2 A;  3F63 A;  3GKX A;  5LCZ A;  5COH A;  4NPB A;  1O7U A;  4PQI A;  2HRF A;  4JBB A;  3SWL A;  3IPZ A;  3CBU A;  2V6O A;  5G31 A;  1J0F A;  4ZIJ A;  3ZLP A;  4F03 A;  6GSU A;  1R5A A;  2VL2 A;  3WGD A;  2WJU A;  2RII A;  4PUR A;  1XW9 A;  4AJ7 A;  3GKM A;  2GT5 A;  4KX4 A;  2L4C A;  1FOV A;  5ABR A;  5AN1 A;  4CDO A;  2OAC A;  2H74 A;  3C73 A;  2AV4 A;  2C8U A;  1TI1 A;  1U88 A;  1Z6M A;  2CVD A;  3IHQ A;  1VF2 A;  4MF6 A;  2FA8 A;  5ECQ B;  4HZ4 A;  4AF2 A;  3APS A;  2AHE A;  4IS0 A;  1SK2 A;  3QOU A;  2H8L A;  4MJB A;  3C1S A;  5KN0 A;  4MMM A;  1PSQ A;  3EMX A;  6GSV A;  2BTO T;  3GTU B;  4E8E A;  3KCM A;  4V2M A;  1GSU A;  4O32 A;  4AGS A;  1M7T A;  1SJI A;  2RUF A;  4L5L A;  1M9B A;  3TOT A;  4K1F A;  1PX6 A;  1GL8 A;  3RPP A;  3ZFB A;  3EMP A;  3G7J A;  1GWC A;  4PQH A;  4P3Y B;  5J5N A;  3APO A;  1T00 A;  1GSY A;  3TKP A;  3HJM A;  3PGT A;  3D4T A;  3ZL5 A;  4D73 B;  1YKA A;  1Q98 A;  3QD9 A;  2R4V A;  5DDL A;  3Q74 A;  1LBK A;  2HE3 A;  5J41 A;  3KIJ A;  4MZW A;  1GUH A;  2WB9 A;  1PQN A;  2DC5 A;  5IOX A;  1ABA A;  5JWQ B;  4GQC A;  1MDK A;  3WD6 A;  1V9W A;  1X9W B;  2B5E A;  1EEJ A;  3GTU A;  1XFL A;  2M46 A;  1YEX A;  1O8W A;  1PKZ A;  3VWX A;  4DSQ A;  5DVB A;  4HQS A;  3UMA A;  3DVX A;  3HVX A;  4PQ1 A;  1KEB A;  4X43 A;  4ECC A;  1WPI A;  2FD3 A;  3LYP A;  4ECB A;  1GTI A;  1TDI A;  4TOP A;  4WR5 A;  2VCV A;  3MAK A;  1FB6 A;  2KP2 A;  1A2L A;  2QSI A;  1OE8 A;  1WMJ A;  2O85 A;  4IN0 A;  4D73 A;  3A5W A;  4GWR A;  1K0N A;  1WOU A;  5AIS A;  3IOS A;  1SEN A;  3GNJ A;  2O89 A;  2HRN A;  5DAK A;  3I9V 2;  1QGV A;  1ML6 A;  2HSY A;  3D5J A;  3ZML A;  1B4P A;  2GDR A;  2DIZ A;  4MDC A;  4JR4 A;  4J57 E;  3GUR A;  2K9F A;  4WKW A;  5CRE A;  4XRA A;  5D93 A;  1F9M A;  2GQM A;  3W8S A;  4POL A;  6GSS A;  1EP7 A;  4QL9 A;  5DJM A;  2KP1 A;  4E8H A;  2H6X A;  2H30 A;  1KNG A;  2N5B A;  5A4U A;  2GVP A;  2VCZ A;  3HCZ A;  3UVT A;  2IMK A;  2H6Z A;  1UVZ A;  2N5F A;  2H0G A;  2JAD A;  2FWH A;  3D4M A;  2DJ2 A;  3UAP A;  3NZN A;  3UVH A;  1XPV A;  5ID2 B;  4HI7 A;  1T7P B;  4IW9 A;  4KW6 A;  2C80 A;  2PPT A;  2PVQ A;  1JHB A;  2LEG A;  2F9S A;  3ME8 A;  4Q5F A;  4ISD A;  2HNL A;  4JU5 A;  2XPD A;  1EZK A;  5H5R A;  1V58 A;  5ECO B;  3RHC A;  3GV1 A;  4IP6 A;  1ST9 A;  4DSS B;  2XPE A;  3HVS A;  2YCD A;  4O7H A;  2E7P A;  3J7Y k;  4BWS A;  1YJ6 A;  1MD3 A;  1B9Y C;  1W89 A;  4EXJ A;  1TTZ A;  2E2M A;  2B3S A;  4KAE A;  4OCE A;  1ERU A;  4I97 A;  5ID2 A;  2LRN A;  5EY6 A;  1Z7R A;  4EO3 A;  1MDI A;  2ES7 A;  1DBY A;  3GSS A;  1U3A A;  2WGR A;  13GS A;  2TIR A;  1K0A A;  3FW2 A;  5J9B A;  5ECL B;  5JWR B;  4MZC A;  1SL1 B;  4TR0 A;  2H70 A;  4FYC A;  2MMZ A;  4GST A;  2LNT A;  1GUL A;  1XWG A;  4QL7 A;  2CAI A;  4ML6 A;  2M80 A;  2V6K A;  3LOR A;  3VWW A;  1GNE A;  4OD7 A;  3MWH A;  2LQO A;  2YOI A;  1A24 A;  1R26 A;  2K8S A;  5CYY A;  2QKE A;  3FHK A;  3LXT A;  3CTG A;  2FNO A;  2VOC A;  1BAY A;  5IPG A;  4I2T A;  4KDX A;  2GGT A;  4I8B A;  2H72 A;  2C3T A;  2X8C A;  4POB A;  2NPB A;  1TRU A;  1X0R A;  2L59 A;  4CHS A;  1HNB A;  2V2G A;  2HFD A;  1QK8 A;  2IIY A;  2VD0 A;  1SD9 A;  1G7E A;  1O6J A;  3VK9 A;  4BWQ A;  3IRA A;  5ECK B;  2D2Z A;  1PMT A;  1XWA A;  2PU9 C;  3QCP A;  2PN8 A;  5IPH A;  3ZTL A;  4O5R A;  1QUW A;  3SBC A;  3D21 A;  4MPG A;  3DD3 A;  2DLX A;  1K3O A;  2YV9 A;  4HQZ A;  1AW9 A;  1CQH A;  5HFI A;  8GSS A;  3VPQ A;  4IVF A;  2I1U A;  5E59 A;  2GQK A;  2RLI A;  1Q4J A;  3VI5 A;  5B7C A;  3DKS A;  4MCU A;  4PNF A;  3DEX A;  1TK5 B;  1YDK A;  1T3B A;  1JZW A;  4K8M A;  3KH9 A;  5H5S A;  4JZQ A;  2G0F A;  3LEF A;  3G7Y A;  2NBS A;  2LJK A;  1OYJ A;  1KTE A;  1U87 A;  3TRQ A;  1SYX A;  5KN3 A;  3F6F A;  2OE0 A;  2LRT A;  4ML1 A;  2B5Y A;  5JCU A;  1SKR B;  3BOA A;  3FZ4 A;  3FZ5 A;  2PGT A;  1JLV A;  18GS A;  4WR4 A;  3H79 A;  3M1G A;  4IQA A;  3F0I A;  4KH7 A;  1HNC A;  1BX9 A;  2VCW A;  5F8B A;  1AQW A;  1V40 A;  2H75 A;  2N5A A;  4ID0 A;  2PER A;  2DML A;  3TRX A;  4TW5 A;  5DQY A;  2K6V A;  4MAB A;  3TJJ A;  3CTF A;  4LLR A;  2H1G A;  2EIR A;  3C71 A;  3GUS A;  2WUL A;  2A2R A;  2X64 A;  3Q6O A;  4RQX A;  3E9J B;  7GSS A;  1NHY A;  2NDO A;  4KDY A;  3TJF A;  2C1Y A;  3MSZ A;  4GXZ A;  4LL1 B;  2IMD A;  2E2G A;  5HR0 A;  4MJA A;  4KCE A;  2I4A A;  1JFU A;  1TW9 A;  3PIN A;  2C0F A;  4WBJ A;  4BA7 A;  1UA5 A;  3IDV A;  3EU4 A;  2DJ0 A;  5F0G A;  1T4Y A;  5H5Q A;  4N11 A;  4H86 A;  1MDJ A;  2LNS A;  4N0V A;  4ZB6 A;  3R2Q A;  5CRH A;  2IMF A;  2IL3 A;  4ZB8 A;  1LU4 A;  2B7K A;  3LGC A;  2R37 A;  3K8N A;  1A2J A;  5DBQ A;  4EVM A;  4FYB A;  2GSR A;  1YF1 A;  4G10 A;  3US3 A;  3TCO A;  5F07 A;  1SKW B;  2MYG A;  1IYI A;  2ON5 A;  2PWJ A;  4MPF A;  2JSZ A;  2H0H A;  2HLS A;  2YZU A;  1MD4 A;  5HQP A;  4HU7 A;  1B8X A;  2YV7 A;  4TN8 A;  9GSS A;  1THX A;  1M9A A;  5L71 A;  1XWC A;  2CV4 A;  3HD5 A;  2C0G A;  1X5E A;  2FGX A;  1WP0 A;  3ZVJ D;  5ECS A;  2ZUP A;  2L5L A;  3IXR A;  2H66 A;  1K0O A;  3OR5 A;  3UOM A;  4L5O A;  1PA3 A;  1YY7 A;  2X8H A;  3DRN A;  1AQX A;  2F3M A;  1PGT A;  1ERT A;  5IMZ A;  2VIM A;  2IWT A;  2I81 A;  1ERV A;  4KND A;  19GS A;  1V2A A;  4MH3 A;  2H76 A;  3L9V A;  1EOG A;  3QDN A;  3UBL A;  3ZZX A;  3BJ5 A;  2YJH A;  3GYK A;  1XVW A;  3S9F A;  2HSH A;  1EEM A;  2CVK A;  2YN1 A;  2LUS A;  5DQS A;  1WRY A;  3LXZ A;  5D96 A;  3EIN A;  2J23 A;  1TOF A;  4HJM A;  2FHE A;  5FWG A;  4ZXG A;  4HEA 2;  3U6V A;  3F3R A;  1G7O A;  3QAW A;  4HOJ A;  5B6N A;  2WS2 A;  4JE1 A;  5D73 A;  2OE1 A;  5INY A;  1VF4 A;  3ZMK A;  5DCG A;  3JCM L;  4TR1 B;  3WT2 A;  2V1M A;  2DMM A;  3CYN A;  2WZ9 A;  2CZ3 A;  1OVN A;  2ON7 A;  1J08 A;  3D6I A;  1TP9 A;  2FA4 A;  1XVQ A;  3UJ1 A;  2O7K A;  5KN1 A;  1JZD A;  1DE1 A;  4Z7X A;  1OE7 A;  4J2F A;  3MNG A;  4FO5 A;  2FUG 2;  4JR6 A;  2ALB A;  2HI7 A;  3KM6 A;  1T8E B;  2FWG A;  5ECP B;  3HY2 A;  4KB3 A;  3TKS C;  4TXO B;  4V2N A;  2VLU A;  3GL3 A;  2FWF A;  2IN3 A;  1Y6E A;  16GS A;  4GF0 A;  2VM1 A;  1ZGN A;  3FR3 A;  1URM A;  4HU9 A;  4J56 E;  2FY6 A;  3LYK A;  2GSQ A;  4OCF A;  3HDC A;  2MZC A;  5E4W A;  1SD8 A;  1Z9H A;  3FR6 A;  12GS A;  2M72 A;  5G5F A;  3L0H A;  1KBN A;  3HA9 A;  2CQ9 A;  5C04 A;  1OC8 A;  3NOF A;  3UIW A;  5IQY A;  5G1K A;  2B7J A;  3V1W A;  3VUR A;  1TXX A;  2CA8 A;  4YAV A;  1TU8 A;  3APQ A;  2VD1 A;  2XBQ A;  3HJO A;  4WEY A;  5GST A;  2GTU A;  2TRC P;  2REM A;  4GSN A;  2DBC A;  2XHF A;  3TKR A;  3P2A A;  1EP8 A;  3KMO A;  5ELG A;  1QMV A;  3ZVJ A;  2VCQ A;  2GS3 A;  3EYT A;  1WWJ A;  4TXO A;  1GLQ A;  3M9J A;  2OE3 A;  5GAP D;  2P5Q A;  2VLV A;  2ZNM A;  4ZIL A;  3H8Q A;  5KN2 A;  4HDE A;  2CVB A;  1PKW A;  4KSO A;  1S3A A;  1TRS A;  3L9U A;  2GZP A;  3KH7 A;  1V98 A;  3E0U A;  3ZFL A;  4HUA A;  1O73 A;  4K7N A;  1YKC A;  4MF7 A;  4X1U A;  4TVE A;  4OFT A;  1GTA A;  5B8A A;  3ZRE A;  4GSS A;  4NXI A;  1HYU A;  3IAM 2;  1AIU A;  1ZOF A;  14GS A;  3QPM A;  3Q18 A;  1I5G A;  4Q5Q A;  3KTL A;  5D9X A;  2HT9 A;  4OFM A;  1THO A;  3QAG A;  1DE2 A;  1FG4 A;  3FZ9 A;  3N5O A;  5DAL B;  4NHZ A;  4HJ2 A;  4K0G A;  1NSW A;  4PUA A;  4G9H A;  3HYP A;  2IPA A;  4K7O A;  2R3X A;  4G2E A;  3RDW A;  2GT6 A;  10GS A;  4MA9 A;  1XZO A;  3EWL A;  2OJL A;  2B1L A;  2LQQ A;  3KD0 A;  11GS A;  3KZQ A;  4PNG A;  1J9B A;  2C3N A;  4TKY A;  2XBI A;  5J4U A;  2CZ2 A;  3MDK A;  4NMU A;  1M2B A;  1ZL9 A;  3DVW A;  2DJ3 A;  1GLP A;  2P31 A;  1X9M B;  1K0C A;  4ZBA A;  3FEU A;  4EDY A;  4ZL7 A;  1X9S B;  4V1A p;  1A23 A;  5CNW A;  1AAZ A;  2DJJ A;  2H1D A;  2C3Q A;  1ZYE A;  1G6W A;  3EE2 A;  4IKH A;  1XIY A;  3TDG A;  4TRX A;  5LNK e;  2X99 A;  1ZYQ B;  4BL7 A;  2JL4 A;  22GS A;  4DSS A;  4F0B A;  1YEP A;  1GSF A;  1TJD A;  5AIV A;  3ED3 A;  3VFI A;  5DAL A;  1A8L A;  4PXO A;  5DCH A;  4GLT A;  2GST A;  2VM2 A;  3GX8 A;  3TOU A;  3ZRD A;  4RI6 A;  1G0T A;  3C8E A;  2VCT A;  1F3A A;  2I3Y A;  1JZO A;  5EPF A;  1QFN A;  4BVX A; 
#chains in the Genus database with same CATH topology
 1YZX A;  2L57 A;  1A2M A;  4EUY A;  2ZCT A;  1GSS A;  2PBJ A;  2R6K A;  2PVO C;  3DGQ A;  3M8N A;  3WT1 A;  3EVI A;  5AGY A;  3I69 A;  2YNX A;  4DSR A;  2FLS A;  4V1A g;  4N10 A;  3M3M A;  2JZS A;  3QMX A;  4K6X A;  1DUG A;  4HZ2 A;  1F37 A;  4IGJ A;  2R5G A;  3LSZ A;  2VUP A;  1SU9 A;  1XCC A;  5JWO B;  4ECJ A;  5CAX A;  4IEL A;  4FH8 A;  4ZBB A;  2WRT A;  3F4T A;  4BVY A;  3I43 A;  1HQO A;  2H0I A;  1GRX A;  3UL3 A;  3ZYW A;  4N0Z A;  5HR1 A;  3DYR A;  3GN3 A;  4ACS A;  3WGE A;  4G0I A;  3QFA C;  3CRT A;  3IE3 A;  2E0Q A;  4XHM A;  2C4J A;  3ME7 A;  5FT3 A;  1AUC A;  5IMC A;  1M2D A;  2CX3 A;  1K0B A;  3ISO A;  4ULX A;  1GP1 A;  1M2A A;  1M99 A;  4KGI A;  2G2Q A;  1FVK A;  1XXU A;  1ERW A;  3IAS 2;  3CRU A;  4XCS A;  3CSJ A;  4KA0 A;  3VPT A;  2K18 A;  5JCG A;  2DIY A;  1T4Z A;  1BG5 A;  3HZ8 A;  4YQV A;  4QQ7 A;  3LG6 A;  2L6D A;  1B4Q A;  1FHE A;  1ZZY A;  5FHI A;  4TR3 A;  4XTS A;  4K7I A;  3H1N A;  2OA7 A;  4X0X A;  2H71 A;  1WIK A;  4YKG A;  3EPT A;  1W4V A;  3F4R A;  4L0U A;  2FCH A;  3WYW A;  4XS6 A;  2IME A;  6GSW A;  4PX1 A;  3F8U A;  4KUN A;  4WBR D;  4KSM A;  2J9H A;  3HHV A;  3A3T A;  1TK8 B;  3KEB A;  3GHA A;  5A4V A;  2O8V B;  2R0C A;  1MEK A;  1S3D A;  1XOB A;  4WF5 A;  1OKD A;  4YQU A;  3H4K A;  4TXV A;  4ZL9 A;  2L5O A;  5IMF A;  5KOX A;  3QAV A;  2EC4 A;  3FRC A;  3W6G A;  3FYG A;  1XWK A;  3BCI A;  5HFK A;  2YPM A;  4Q5N A;  3F4S A;  3RBT A;  4GTU A;  5KEJ A;  3RAZ A;  5B6M A;  1N8J A;  2A4V A;  1FB0 A;  2LRC A;  3IV4 A;  1JLW A;  2GQL A;  2NVL A;  2BMX A;  2WCI A;  1O81 A;  2VCX A;  2B5X A;  1F2E A;  2O87 A;  1RQM A;  2MBT A;  4WF4 A;  2P5R A;  1PN0 A;  4MJE A;  4I2U A;  4YKF A;  1XWB A;  3FK8 A;  4XS1 A;  4ECI A;  1FOH A;  3TJK A;  1FVJ A;  1G6Y A;  1NHO A;  1C72 A;  2WDU A;  4MK3 A;  4AJ6 A;  1XOA A;  4DEJ A;  2CX4 A;  2H1A A;  2F51 A;  1K0M A;  4CW9 A;  2LKU A;  4OO5 A;  4O92 A;  1SK1 A;  3FR9 A;  5ECM B;  2LS5 A;  1OAZ A;  2JAC A;  3UAR A;  4BPY A;  3KGK A;  3L78 A;  1GH2 A;  2YAN A;  3GST A;  2X8G A;  2BJX A;  2NTO A;  1LJR A;  2YWM A;  2MMO A;  3U5R E;  1UN2 A;  3KP8 A;  3RPN A;  2CAQ A;  17GS A;  5CRD A;  3LQ7 A;  4Q5R A;  4NHW A;  5LD0 A;  2IMI A;  3W8J A;  1Z3E A;  6GSY A;  1GTB A;  5D9W A;  2L4Q A;  4ZB9 A;  2QGV A;  3VLN A;  3LJR A;  3GKN A;  1H4O A;  4WET A;  3QR6 A;  2OBI A;  3DWV A;  4ZBD A;  5CP1 A;  1F6M C;  3FMW A;  3A5I A;  3PH9 A;  3GRX A;  3HZ4 A;  4EIP A;  1V57 A;  3CSH A;  4POK A;  4KCA A;  2AJQ B;  1R5P A;  3P8W A;  5ENU A;  4PGT A;  4ZL8 A;  2V32 A;  1Z7P A;  4K5S A;  1ACV A;  4OO4 A;  3GFK A;  1IYH A;  3F9U A;  2I9H A;  4USS A;  1TRW A;  1SK0 A;  2QC7 A;  3VWU A;  3UEM A;  3J7Y b;  3EU3 A;  3A2X A;  5GSS A;  4BIK A;  2RUE A;  1OC9 B;  5G30 A;  5B8B A;  1PRX A;  1BYE A;  4NWY A;  1TKD B;  3L4N A;  2HSM A;  1NW2 A;  1VF3 A;  2IFQ B;  3GX0 A;  6GSX A;  2VL9 A;  3RHB A;  2B6M A;  2VAF A;  3C7M A;  5ECI B;  1U6T A;  5DAK B;  1RK4 A;  3GIX A;  4YAP A;  3ZIT A;  2OBK A;  20GS A;  4GCI A;  3M9K A;  1DSB A;  2HXK A;  1A0F A;  4K5R A;  1RW1 A;  4IQ1 A;  2MMA A;  1TI3 A;  1SYR A;  3O76 A;  4HS1 A;  3LFL A;  3E3E A;  2AAW A;  2B1K A;  5F05 A;  1Z6N A;  4LA1 A;  3BBY A;  1ON4 A;  2PMT A;  5C00 A;  4GQF A;  2LJA A;  4L8E A;  5D8I A;  3GL5 A;  2FWE A;  3A2V A;  5CRW A;  3GMF A;  3KJY A;  1T1V A;  1OC9 A;  1VRS D;  2KLX A;  4LL4 B;  5D9T A;  4TR1 A;  1QXH A;  3A2W A;  1EV4 A;  1AXD A;  3FZA A;  1O8X A;  3TGZ A;  6GST A;  1SL0 B;  4MH2 A;  1BQ7 A;  1N2A A;  1Z5Y E;  2LST A;  1R7H A;  5IIZ A;  3ERW A;  2IFQ A;  4LMV A;  3G7I A;  1FAA A;  2GZY A;  3CXG A;  4JRR A;  5IM9 A;  1OC3 A;  1PD2 1;  3O6T A;  3BCK A;  3QFB C;  2JSY A;  5ECR B;  2LV3 A;  3HXS A;  3VWV A;  4MZB A;  4K0N A;  4EC0 A;  1TK0 B;  3EC3 A;  1ZCP A;  1PN9 A;  1GUK A;  1U3I A;  2VL3 A;  4AJ8 A;  2H01 A;  1SJ6 A;  5GZZ B;  4DVC A;  2DKH A;  2F8A A;  3F3Q A;  4TR4 A;  2C0D A;  4F0C A;  5A5K A;  1GSD A;  1GTU A;  1FW1 A;  1VGL A;  2YP6 A;  5CRG A;  2AB6 A;  3DML A;  3KMN A;  4NV5 A;  4YQM A;  1B48 A;  1GUM A;  4HSC X;  3GH6 A;  3P90 A;  1ZMA A;  2YWN A;  2DJ1 A;  3IK7 A;  5G1L A;  2PUK C;  1MTC A;  4IHU A;  5HFG A;  1SKS B;  3I6A A;  5GAN D;  1VF1 A;  1SJZ A;  2H6Y A;  2V41 A;  2YWO A;  4OWY A;  5AIX A;  3TKS A;  4EE0 A;  5IMA A;  1GNW A;  1BJX A;  5JCW A;  1X5D A;  1EV9 A;  3TUE A;  1EWX A;  4RI7 A;  4WXT A;  4K9Z A;  2IJY A;  1EGO A;  3GKK A;  4O5Q A;  4F82 A;  2HRK A;  2L6C A;  1M0U A;  3P7X A;  1A0R P;  1YF0 A;  5F06 A;  1FO5 A;  1K3Y A;  4KF9 A;  2HZE B;  4IBP A;  1PX7 A;  4FYU A;  2F8F A;  3C1R A;  3FY7 A;  1EGR A;  4XS4 B;  1HNA A;  2LTK A;  5BRT A;  4GRF A;  2H19 A;  3L9S A;  2KHP A;  4I5Q A;  3FKF A;  1H75 A;  4XIH A;  2VO4 A;  1BED A;  4CY6 A;  3IK9 A;  1AQV A;  1XW6 A;  5ECH B;  4CY8 A;  4L0W A;  2RM6 A;  1K3L A;  3IR4 A;  3AY8 A;  2KUC A;  3ZIV A;  1TRV A;  3HKR A;  4IP1 A;  2WFC A;  5HR2 A;  2JZR A;  3EUR A;  2KOK A;  1PL2 A;  4PUF C;  2HYX A;  2EIO A;  2RM5 A;  4IJ3 A;  2EIQ A;  1CQG A;  1PL1 A;  4K2D A;  1UC7 A;  4ICY A;  3NIV A;  1GSE A;  4NAX A;  3ERF A;  4EKZ A;  2HZE A;  3VI7 A;  2K8V A;  4XS4 A;  3UBK A;  5IMD A;  5IMV A;  1ZYP A;  2AUV A;  4EF0 A;  3HVN A;  1JZR A;  1WE0 A;  4MJC A;  3CSI A;  1GSQ A;  5ECN B;  4F9Z A;  2VLT A;  5J9C A;  3CMI A;  5G2Z A;  2DSA A;  4F2I A;  5IO0 A;  4N30 A;  1K0D A;  5ELA A;  1WJK A;  1F3B A;  4KE3 A;  1SL2 B;  4MF5 A;  1OKT A;  3KTB A;  3KP9 A;  4RUV A;  2MMN A;  3N9J A;  1AC1 A;  2YZH A;  3D22 A;  5J3R A;  4V2L A;  1B9X C;  1I9D A;  3H93 A;  5KOW A;  5BMU A;  3M0F A;  1M3J A;  2HZF A;  4MLY A;  1Y25 A;  3IA1 A;  3Q19 A;  2R2J A;  2GSS A;  4OFN A;  5A4W A;  4EL1 A;  3HJP A;  4LMW A;  1NM3 A;  2A2S A;  1YQ1 A;  2H1B A;  2OAD A;  4OMV A;  2LJR A;  5IOW A;  2DJK A;  3BD2 A;  2VL2 C;  3LWA A;  4NV2 A;  3WGX A;  3TB2 A;  5HR3 A;  3TJB A;  1EOH A;  2TRX A;  4POM A;  4G19 A;  3GA4 A;  4FIW A;  1TU7 A;  2Z9S A;  2GLR A;  3DXB A;  2AYT A;  2UZ8 A;  3D0Z A;  3PR8 A;  5G5E A;  3DIE A;  3ERG A;  2JZT A;  1HD2 A;  2YWI A;  2H73 A;  3GH9 A;  2P0G A;  2JU5 A;  2XC2 A;  3IBH A;  3TKS E;  3TKQ A;  4XRD A;  5EVO A;  5IO2 A;  4KDU A;  3HVV A;  3KXO A;  4JED A;  1XBS A;  3ZIJ A;  5EL8 A;  1A8Y A;  1ILO A;  4ILF A;  4IJI A;  1O85 A;  2C0E A;  3TRP A;  1R4W A;  4EDZ A;  1E2Y A;  1XW5 A;  1PFO A;  1X5C A;  3F6D A;  4RQR A;  5D9V A;  3TJG A;  3G9B A;  1QQ2 A;  2CT6 A;  2GZZ A;  2YJ7 A;  3O3T A;  1USB A;  3IC4 A;  5DJL A;  2OKA A;  1E6B A;  4I6X A;  4MP4 A;  1S3C A;  2MBS A;  5CO3 A;  4YH2 A;  3F63 A;  3GKX A;  5LCZ A;  5COH A;  4NPB A;  1O7U A;  4PQI A;  2HRF A;  4JBB A;  3SWL A;  3IPZ A;  3CBU A;  2V6O A;  5G31 A;  1J0F A;  4ZIJ A;  3IHG A;  3ZLP A;  4F03 A;  6GSU A;  1R5A A;  2VL2 A;  3WGD A;  2WJU A;  2RII A;  3PPU A;  4PUR A;  1XW9 A;  4AJ7 A;  3GKM A;  2GT5 A;  4KX4 A;  2L4C A;  1FOV A;  5ABR A;  5AN1 A;  4CDO A;  2OAC A;  2H74 A;  3C73 A;  2AV4 A;  2C8U A;  1TI1 A;  1U88 A;  1Z6M A;  2CVD A;  3IHQ A;  1VF2 A;  4MF6 A;  2FA8 A;  5ECQ B;  4HZ4 A;  4AF2 A;  3APS A;  2AHE A;  4IS0 A;  1SK2 A;  3QOU A;  2H8L A;  4MJB A;  3C1S A;  5KN0 A;  4MMM A;  1PSQ A;  3EMX A;  6GSV A;  2BTO T;  3GTU B;  4E8E A;  3KCM A;  4V2M A;  1GSU A;  4O32 A;  4AGS A;  1M7T A;  1SJI A;  2RUF A;  4L5L A;  1M9B A;  3TOT A;  4K1F A;  1PX6 A;  1GL8 A;  3RPP A;  3ZFB A;  3EMP A;  3G7J A;  1GWC A;  4PQH A;  4P3Y B;  5J5N A;  3APO A;  1T00 A;  1GSY A;  3TKP A;  3HJM A;  3PGT A;  3D4T A;  3ZL5 A;  4D73 B;  1YKA A;  1Q98 A;  3QD9 A;  2R4V A;  5DDL A;  3Q74 A;  1LBK A;  2HE3 A;  5J41 A;  3KIJ A;  4MZW A;  2A2P A;  1GUH A;  2WB9 A;  1PQN A;  2DC5 A;  5IOX A;  1ABA A;  5JWQ B;  4GQC A;  1MDK A;  3WD6 A;  1V9W A;  1X9W B;  2B5E A;  1EEJ A;  3GTU A;  1XFL A;  2M46 A;  1YEX A;  1O8W A;  1PKZ A;  3VWX A;  4DSQ A;  5DVB A;  4HQS A;  3UMA A;  3DVX A;  3HVX A;  4PQ1 A;  1KEB A;  4X43 A;  4ECC A;  1WPI A;  2FD3 A;  3LYP A;  4ECB A;  1GTI A;  1TDI A;  4TOP A;  4WR5 A;  2VCV A;  3MAK A;  1FB6 A;  2KP2 A;  1A2L A;  2QSI A;  1OE8 A;  1WMJ A;  2O85 A;  4IN0 A;  4D73 A;  3A5W A;  4GWR A;  1S3R A;  1K0N A;  1WOU A;  5AIS A;  3IOS A;  1SEN A;  3GNJ A;  2O89 A;  2HRN A;  5DAK A;  3I9V 2;  1QGV A;  1ML6 A;  2HSY A;  3D5J A;  3ZML A;  1B4P A;  3CQF A;  2GDR A;  2DIZ A;  4MDC A;  4JR4 A;  4J57 E;  3GUR A;  2K9F A;  4X4J A;  4WKW A;  5CRE A;  4XRA A;  5D93 A;  1F9M A;  2GQM A;  3W8S A;  4POL A;  6GSS A;  1EP7 A;  4QL9 A;  5DJM A;  2KP1 A;  4E8H A;  2H6X A;  2H30 A;  1KNG A;  2N5B A;  5A4U A;  2GVP A;  2VCZ A;  3HCZ A;  3UVT A;  2IMK A;  2H6Z A;  1UVZ A;  2N5F A;  2H0G A;  3IC8 A;  2JAD A;  2FWH A;  3D4M A;  1M3I A;  2DJ2 A;  3UAP A;  3NZN A;  3UVH A;  1XPV A;  5ID2 B;  4HI7 A;  1T7P B;  4IW9 A;  4KW6 A;  2C80 A;  2PPT A;  2PVQ A;  1JHB A;  2LEG A;  2F9S A;  3ME8 A;  4Q5F A;  4ISD A;  2HNL A;  4JU5 A;  2XPD A;  1EZK A;  5H5R A;  1V58 A;  5ECO B;  3RHC A;  3GV1 A;  4IP6 A;  4Z2R A;  1ST9 A;  4DSS B;  2XPE A;  3HVS A;  2YCD A;  3MYD A;  4O7H A;  2E7P A;  3J7Y k;  4BWS A;  1YJ6 A;  1MD3 A;  1B9Y C;  4BVX B;  1W89 A;  4EXJ A;  1TTZ A;  2E2M A;  2B3S A;  4KAE A;  4OCE A;  1ERU A;  4I97 A;  5ID2 A;  2LRN A;  5EY6 A;  1Z7R A;  4EO3 A;  1MDI A;  2ES7 A;  1DBY A;  3GSS A;  1U3A A;  2WGR A;  13GS A;  2TIR A;  2HRA A;  1K0A A;  3FW2 A;  5J9B A;  5ECL B;  5JWR B;  4MZC A;  1SL1 B;  4TR0 A;  2H70 A;  4FYC A;  2MMZ A;  4GST A;  2LNT A;  2R0G A;  1GUL A;  1XWG A;  4QL7 A;  2CAI A;  4ML6 A;  2M80 A;  2V6K A;  3LOR A;  3VWW A;  1GNE A;  4OD7 A;  3MWH A;  4EIQ A;  2LQO A;  2YOI A;  1A24 A;  1R26 A;  2K8S A;  5CYY A;  2QKE A;  3FHK A;  3LXT A;  3CTG A;  2FNO A;  2VOC A;  1BAY A;  5IPG A;  4I2T A;  4KDX A;  2GGT A;  4I8B A;  2H72 A;  2C3T A;  2X8C A;  4POB A;  2NPB A;  1TRU A;  1X0R A;  2L59 A;  4CHS A;  1HNB A;  2V2G A;  2HFD A;  1QK8 A;  2IIY A;  2VD0 A;  1SD9 A;  1G7E A;  1O6J A;  3VK9 A;  4BWQ A;  3IRA A;  5ECK B;  2D2Z A;  1PMT A;  1XWA A;  2PU9 C;  3QCP A;  2PN8 A;  5IPH A;  3ZTL A;  4O5R A;  1QUW A;  1XG8 A;  3SBC A;  3D21 A;  4MPG A;  3DD3 A;  2DLX A;  1K3O A;  2YV9 A;  4HQZ A;  1AW9 A;  1CQH A;  5HFI A;  8GSS A;  3VPQ A;  4IVF A;  2I1U A;  5E59 A;  2GQK A;  2RLI A;  1Q4J A;  3VI5 A;  5B7C A;  3DKS A;  4MCU A;  4PNF A;  3DEX A;  1TK5 B;  1YDK A;  1T3B A;  1JZW A;  4K8M A;  3KH9 A;  5H5S A;  4JZQ A;  2G0F A;  3LEF A;  3G7Y A;  2X4A A;  2NBS A;  2LJK A;  1OYJ A;  1KTE A;  1U87 A;  3TRQ A;  1SYX A;  2QA1 A;  4Z2U A;  5KN3 A;  3F6F A;  2OE0 A;  2LRT A;  4ML1 A;  2B5Y A;  5JCU A;  1SKR B;  3BOA A;  3FZ4 A;  3FZ5 A;  2PGT A;  1JLV A;  18GS A;  4WR4 A;  3H79 A;  3M1G A;  4IQA A;  3F0I A;  4KH7 A;  1HNC A;  1BX9 A;  2VCW A;  5F8B A;  1AQW A;  4O5U A;  1V40 A;  2H75 A;  2N5A A;  4ID0 A;  2PER A;  2DML A;  3TRX A;  4TW5 A;  5DQY A;  2K6V A;  4MAB A;  4A5P A;  3TJJ A;  3CTF A;  4LLR A;  2H1G A;  3MIX A;  2EIR A;  3C71 A;  3GUS A;  2WUL A;  2A2R A;  2X64 A;  3Q6O A;  4RQX A;  3E9J B;  7GSS A;  1NHY A;  2NDO A;  4KDY A;  3TJF A;  2C1Y A;  3MSZ A;  4GXZ A;  4LL1 B;  2IMD A;  2E2G A;  2A4H A;  5HR0 A;  4MJA A;  4KCE A;  2I4A A;  1JFU A;  1TW9 A;  3PIN A;  2C0F A;  4WBJ A;  4BA7 A;  1UA5 A;  3IDV A;  3EU4 A;  2DJ0 A;  5F0G A;  1T4Y A;  5H5Q A;  4N11 A;  4H86 A;  1MDJ A;  2LNS A;  4N0V A;  4ZB6 A;  3R2Q A;  5CRH A;  2IMF A;  2IL3 A;  4ZB8 A;  1LU4 A;  2B7K A;  3LGC A;  2R37 A;  3K8N A;  1A2J A;  5DBQ A;  4EVM A;  4FYB A;  2GSR A;  1YF1 A;  4G10 A;  3US3 A;  3TCO A;  5F07 A;  1SKW B;  2MYG A;  2X49 A;  1IYI A;  2ON5 A;  2PWJ A;  4MPF A;  2JSZ A;  2H0H A;  2HLS A;  2YZU A;  1MD4 A;  5HQP A;  4HU7 A;  1B8X A;  2YV7 A;  4TN8 A;  9GSS A;  1THX A;  1M9A A;  5L71 A;  1XWC A;  2CV4 A;  3HD5 A;  2C0G A;  1X5E A;  2FGX A;  1WP0 A;  3ZVJ D;  5ECS A;  2ZUP A;  2L5L A;  3IXR A;  2H66 A;  1K0O A;  3OR5 A;  3UOM A;  4L5O A;  1PA3 A;  1YY7 A;  2X8H A;  3DRN A;  1AQX A;  2F3M A;  1PGT A;  1ERT A;  5IMZ A;  2VIM A;  2IWT A;  2I81 A;  1ERV A;  4KND A;  19GS A;  1V2A A;  4MH3 A;  2H76 A;  3L9V A;  1EOG A;  3QDN A;  3UBL A;  3ZZX A;  3BJ5 A;  2YJH A;  3GYK A;  1XVW A;  3S9F A;  2HSH A;  1EEM A;  2CVK A;  2YN1 A;  2LUS A;  5DQS A;  1WRY A;  3LXZ A;  5D96 A;  3EIN A;  2J23 A;  1TOF A;  4HJM A;  2FHE A;  5FWG A;  4ZXG A;  4HEA 2;  3U6V A;  3F3R A;  1G7O A;  3QAW A;  4HOJ A;  5B6N A;  2WS2 A;  4JE1 A;  5D73 A;  2OE1 A;  2QA2 A;  5INY A;  1VF4 A;  3ZMK A;  5DCG A;  3JCM L;  4TR1 B;  3WT2 A;  2V1M A;  2DMM A;  3CYN A;  2WZ9 A;  2CZ3 A;  1OVN A;  2ON7 A;  1J08 A;  3D6I A;  1TP9 A;  2FA4 A;  1XVQ A;  3UJ1 A;  2O7K A;  5KN1 A;  1JZD A;  1DE1 A;  4Z7X A;  1OE7 A;  4J2F A;  3MNG A;  4FO5 A;  2FUG 2;  4JR6 A;  2ALB A;  2HI7 A;  3KM6 A;  1T8E B;  2FWG A;  5ECP B;  3HY2 A;  4KB3 A;  3TKS C;  4TXO B;  4V2N A;  2VLU A;  3GL3 A;  2FWF A;  2IN3 A;  1Y6E A;  16GS A;  4GF0 A;  2VM1 A;  1ZGN A;  3FR3 A;  1URM A;  4HU9 A;  4J56 E;  2FY6 A;  3LYK A;  2GSQ A;  4OCF A;  3HDC A;  4FQU A;  2MZC A;  5E4W A;  1SD8 A;  1Z9H A;  3FR6 A;  12GS A;  2M72 A;  5G5F A;  3L0H A;  1KBN A;  3HA9 A;  4K2X A;  2R0P A;  2CQ9 A;  5C04 A;  1OC8 A;  3NOF A;  3UIW A;  5IQY A;  5G1K A;  2B7J A;  3V1W A;  3VUR A;  1TXX A;  2CA8 A;  3LW9 A;  4YAV A;  1TU8 A;  3APQ A;  2VD1 A;  2XBQ A;  3HJO A;  4WEY A;  5GST A;  2GTU A;  2TRC P;  2REM A;  4GSN A;  2DBC A;  2XHF A;  3TKR A;  3P2A A;  1EP8 A;  3KMO A;  5ELG A;  4Z2T A;  1QMV A;  3ZVJ A;  2VCQ A;  2GS3 A;  3EYT A;  1WWJ A;  4TXO A;  1GLQ A;  3M9J A;  2OE3 A;  4G0L A;  5GAP D;  2P5Q A;  2VLV A;  2ZNM A;  4ZIL A;  3H8Q A;  5KN2 A;  4HDE A;  4PTS A;  2CVB A;  1PKW A;  4KSO A;  1S3A A;  1TRS A;  3L9U A;  2GZP A;  3KH7 A;  1V98 A;  3E0U A;  3ZFL A;  4HUA A;  1O73 A;  4K7N A;  1YKC A;  4MF7 A;  4X1U A;  4TVE A;  4OFT A;  1GTA A;  5B8A A;  4G0K A;  3ZRE A;  4GSS A;  4NXI A;  1HYU A;  3IAM 2;  1AIU A;  1ZOF A;  14GS A;  3QPM A;  3Q18 A;  1I5G A;  4Q5Q A;  3KTL A;  5D9X A;  1ZYN A;  4BL7 B;  2HT9 A;  4OFM A;  3R3E A;  1THO A;  3QAG A;  1DE2 A;  1FG4 A;  2DKI A;  3FZ9 A;  3N5O A;  5DAL B;  4NHZ A;  4HJ2 A;  4K0G A;  1NSW A;  4PUA A;  4G9H A;  3HYP A;  2IPA A;  4K7O A;  2R3X A;  4G2E A;  3RDW A;  2GT6 A;  10GS A;  4MA9 A;  1XZO A;  3EWL A;  2OJL A;  2B1L A;  2LQQ A;  3KD0 A;  11GS A;  3KZQ A;  4PNG A;  1J9B A;  2C3N A;  4TKY A;  2XBI A;  5J4U A;  2CZ2 A;  3MDK A;  4NMU A;  1M2B A;  1ZL9 A;  3DVW A;  2DJ3 A;  1GLP A;  2P31 A;  1X9M B;  1K0C A;  4ZBA A;  3FEU A;  4EDY A;  4ZL7 A;  1X9S B;  4V1A p;  1A23 A;  5CNW A;  1AAZ A;  2DJJ A;  2H1D A;  2C3Q A;  1ZYE A;  1G6W A;  3EE2 A;  4BVY B;  4IKH A;  1XIY A;  3TDG A;  4TRX A;  5LNK e;  2X99 A;  1ZYQ B;  4BL7 A;  2JL4 A;  4MNN A;  22GS A;  4DSS A;  4F0B A;  1YEP A;  1GSF A;  1TJD A;  5AIV A;  3ED3 A;  3VFI A;  5DAL A;  1A8L A;  4PXO A;  5DCH A;  4GLT A;  2GST A;  2VM2 A;  3GX8 A;  3TOU A;  3ZRD A;  4RI6 A;  1G0T A;  3C8E A;  2VCT A;  1F3A A;  2I3Y A;  1JZO A;  5EPF A;  1QFN A;  4BVX A; 
#chains in the Genus database with same CATH homology
 1YZX A;  2L57 A;  1A2M A;  4EUY A;  2ZCT A;  1GSS A;  2PBJ A;  2R6K A;  2PVO C;  3DGQ A;  3M8N A;  3WT1 A;  3EVI A;  5AGY A;  3I69 A;  2YNX A;  4DSR A;  2FLS A;  4V1A g;  4N10 A;  3M3M A;  2JZS A;  3QMX A;  4K6X A;  1DUG A;  4HZ2 A;  1F37 A;  4IGJ A;  2R5G A;  3LSZ A;  2VUP A;  1SU9 A;  1XCC A;  5JWO B;  4ECJ A;  5CAX A;  4IEL A;  4FH8 A;  4ZBB A;  2WRT A;  3F4T A;  4BVY A;  3I43 A;  1HQO A;  2H0I A;  1GRX A;  3UL3 A;  3ZYW A;  4N0Z A;  5HR1 A;  3DYR A;  3GN3 A;  4ACS A;  3WGE A;  4G0I A;  3QFA C;  3CRT A;  3IE3 A;  2E0Q A;  4XHM A;  2C4J A;  3ME7 A;  5FT3 A;  1AUC A;  5IMC A;  1M2D A;  2CX3 A;  1K0B A;  3ISO A;  4ULX A;  1GP1 A;  1M2A A;  1M99 A;  4KGI A;  2G2Q A;  1FVK A;  1XXU A;  1ERW A;  3IAS 2;  3CRU A;  4XCS A;  3CSJ A;  4KA0 A;  3VPT A;  2K18 A;  5JCG A;  2DIY A;  1T4Z A;  1BG5 A;  3HZ8 A;  4YQV A;  4QQ7 A;  3LG6 A;  2L6D A;  1B4Q A;  1FHE A;  1ZZY A;  5FHI A;  4TR3 A;  4XTS A;  4K7I A;  3H1N A;  2OA7 A;  4X0X A;  2H71 A;  1WIK A;  4YKG A;  3EPT A;  1W4V A;  3F4R A;  4L0U A;  2FCH A;  3WYW A;  4XS6 A;  2IME A;  6GSW A;  4PX1 A;  3F8U A;  4KUN A;  4WBR D;  4KSM A;  2J9H A;  3HHV A;  3A3T A;  1TK8 B;  3KEB A;  3GHA A;  5A4V A;  2O8V B;  2R0C A;  1MEK A;  1S3D A;  1XOB A;  4WF5 A;  1OKD A;  4YQU A;  3H4K A;  4TXV A;  4ZL9 A;  2L5O A;  5IMF A;  5KOX A;  3QAV A;  2EC4 A;  3FRC A;  3W6G A;  3FYG A;  1XWK A;  3BCI A;  5HFK A;  2YPM A;  4Q5N A;  3F4S A;  3RBT A;  4GTU A;  5KEJ A;  3RAZ A;  5B6M A;  1N8J A;  2A4V A;  1FB0 A;  2LRC A;  3IV4 A;  1JLW A;  2GQL A;  2NVL A;  2BMX A;  2WCI A;  1O81 A;  2VCX A;  2B5X A;  1F2E A;  2O87 A;  1RQM A;  2MBT A;  4WF4 A;  2P5R A;  1PN0 A;  4MJE A;  4I2U A;  4YKF A;  1XWB A;  3FK8 A;  4XS1 A;  4ECI A;  1FOH A;  3TJK A;  1FVJ A;  1G6Y A;  1NHO A;  1C72 A;  2WDU A;  4MK3 A;  4AJ6 A;  1XOA A;  4DEJ A;  2CX4 A;  2H1A A;  2F51 A;  1K0M A;  4CW9 A;  2LKU A;  4OO5 A;  4O92 A;  1SK1 A;  3FR9 A;  5ECM B;  2LS5 A;  1OAZ A;  2JAC A;  3UAR A;  4BPY A;  3KGK A;  3L78 A;  1GH2 A;  2YAN A;  3GST A;  2X8G A;  2BJX A;  2NTO A;  1LJR A;  2YWM A;  2MMO A;  3U5R E;  1UN2 A;  3KP8 A;  3RPN A;  2CAQ A;  17GS A;  5CRD A;  3LQ7 A;  4Q5R A;  4NHW A;  5LD0 A;  2IMI A;  3W8J A;  1Z3E A;  6GSY A;  1GTB A;  5D9W A;  2L4Q A;  4ZB9 A;  2QGV A;  3VLN A;  3LJR A;  3GKN A;  1H4O A;  4WET A;  3QR6 A;  2OBI A;  3DWV A;  4ZBD A;  5CP1 A;  1F6M C;  3FMW A;  3A5I A;  3PH9 A;  3GRX A;  3HZ4 A;  4EIP A;  1V57 A;  3CSH A;  4POK A;  4KCA A;  2AJQ B;  1R5P A;  3P8W A;  5ENU A;  4PGT A;  4ZL8 A;  2V32 A;  1Z7P A;  4K5S A;  1ACV A;  4OO4 A;  3GFK A;  1IYH A;  3F9U A;  2I9H A;  4USS A;  1TRW A;  1SK0 A;  2QC7 A;  3VWU A;  3UEM A;  3J7Y b;  3EU3 A;  3A2X A;  5GSS A;  2RUE A;  1OC9 B;  5G30 A;  5B8B A;  1PRX A;  1BYE A;  4NWY A;  1TKD B;  3L4N A;  2HSM A;  1NW2 A;  1VF3 A;  2IFQ B;  3GX0 A;  6GSX A;  2VL9 A;  3RHB A;  2B6M A;  2VAF A;  3C7M A;  5ECI B;  1U6T A;  5DAK B;  1RK4 A;  3GIX A;  4YAP A;  3ZIT A;  2OBK A;  20GS A;  4GCI A;  3M9K A;  1DSB A;  2HXK A;  1A0F A;  4K5R A;  1RW1 A;  4IQ1 A;  2MMA A;  1TI3 A;  1SYR A;  3O76 A;  4HS1 A;  3LFL A;  3E3E A;  2AAW A;  2B1K A;  5F05 A;  1Z6N A;  4LA1 A;  3BBY A;  1ON4 A;  2PMT A;  5C00 A;  4GQF A;  2LJA A;  4L8E A;  5D8I A;  3GL5 A;  2FWE A;  3A2V A;  5CRW A;  3GMF A;  3KJY A;  1T1V A;  1OC9 A;  1VRS D;  2KLX A;  4LL4 B;  5D9T A;  4TR1 A;  1QXH A;  3A2W A;  1EV4 A;  1AXD A;  3FZA A;  1O8X A;  3TGZ A;  6GST A;  1SL0 B;  4MH2 A;  1BQ7 A;  1N2A A;  1Z5Y E;  2LST A;  1R7H A;  5IIZ A;  3ERW A;  2IFQ A;  4LMV A;  3G7I A;  1FAA A;  2GZY A;  3CXG A;  4JRR A;  5IM9 A;  1OC3 A;  1PD2 1;  3O6T A;  3BCK A;  3QFB C;  2JSY A;  5ECR B;  2LV3 A;  3HXS A;  3VWV A;  4MZB A;  4K0N A;  4EC0 A;  1TK0 B;  3EC3 A;  1ZCP A;  1PN9 A;  1GUK A;  1U3I A;  2VL3 A;  4AJ8 A;  2H01 A;  1SJ6 A;  5GZZ B;  4DVC A;  2DKH A;  2F8A A;  3F3Q A;  4TR4 A;  2C0D A;  4F0C A;  5A5K A;  1GSD A;  1GTU A;  1FW1 A;  1VGL A;  2YP6 A;  5CRG A;  2AB6 A;  4YQM A;  3DML A;  3KMN A;  4NV5 A;  1B48 A;  1GUM A;  3GH6 A;  3P90 A;  1ZMA A;  2YWN A;  2DJ1 A;  3IK7 A;  5G1L A;  2PUK C;  1MTC A;  4IHU A;  5HFG A;  1SKS B;  3I6A A;  5GAN D;  1VF1 A;  1SJZ A;  2H6Y A;  2V41 A;  2YWO A;  4OWY A;  5AIX A;  3TKS A;  4EE0 A;  5IMA A;  1GNW A;  1BJX A;  5JCW A;  1X5D A;  1EV9 A;  3TUE A;  1EWX A;  4RI7 A;  4WXT A;  4K9Z A;  2IJY A;  1EGO A;  3GKK A;  4O5Q A;  4F82 A;  2HRK A;  2L6C A;  1M0U A;  3P7X A;  1A0R P;  1YF0 A;  5F06 A;  1FO5 A;  1K3Y A;  4KF9 A;  2HZE B;  4IBP A;  1PX7 A;  4FYU A;  2F8F A;  3C1R A;  3FY7 A;  1EGR A;  4XS4 B;  1HNA A;  2LTK A;  5BRT A;  4GRF A;  2H19 A;  3L9S A;  2KHP A;  4I5Q A;  3FKF A;  1H75 A;  4XIH A;  2VO4 A;  1BED A;  4CY6 A;  3IK9 A;  1AQV A;  1XW6 A;  5ECH B;  4CY8 A;  4L0W A;  2RM6 A;  1K3L A;  3IR4 A;  3AY8 A;  2KUC A;  3ZIV A;  1TRV A;  3HKR A;  4IP1 A;  2WFC A;  5HR2 A;  2JZR A;  3EUR A;  2KOK A;  1PL2 A;  4PUF C;  2HYX A;  2EIO A;  2RM5 A;  4IJ3 A;  2EIQ A;  1CQG A;  1PL1 A;  4K2D A;  1UC7 A;  4ICY A;  3NIV A;  1GSE A;  4NAX A;  3ERF A;  4EKZ A;  2HZE A;  3VI7 A;  2K8V A;  4XS4 A;  3UBK A;  5IMD A;  5IMV A;  1ZYP A;  2AUV A;  4EF0 A;  1JZR A;  1WE0 A;  4MJC A;  3CSI A;  1GSQ A;  5ECN B;  4F9Z A;  2VLT A;  5J9C A;  3CMI A;  5G2Z A;  2DSA A;  4F2I A;  5IO0 A;  4N30 A;  1K0D A;  5ELA A;  1WJK A;  1F3B A;  4KE3 A;  1SL2 B;  4MF5 A;  1OKT A;  3KTB A;  3KP9 A;  4RUV A;  2MMN A;  3N9J A;  1AC1 A;  2YZH A;  3D22 A;  5J3R A;  4V2L A;  1B9X C;  1I9D A;  3H93 A;  5KOW A;  5BMU A;  3M0F A;  2HZF A;  4MLY A;  1Y25 A;  3IA1 A;  3Q19 A;  2R2J A;  2GSS A;  4OFN A;  5A4W A;  4EL1 A;  3HJP A;  4LMW A;  1NM3 A;  2A2S A;  1YQ1 A;  2H1B A;  2OAD A;  4OMV A;  2LJR A;  5IOW A;  2DJK A;  3BD2 A;  2VL2 C;  3LWA A;  4NV2 A;  3WGX A;  3TB2 A;  5HR3 A;  3TJB A;  1EOH A;  2TRX A;  4POM A;  4G19 A;  3GA4 A;  4FIW A;  1TU7 A;  2Z9S A;  2GLR A;  3DXB A;  2AYT A;  2UZ8 A;  3D0Z A;  3PR8 A;  5G5E A;  3DIE A;  3ERG A;  2JZT A;  1HD2 A;  2YWI A;  2H73 A;  3GH9 A;  2P0G A;  2JU5 A;  2XC2 A;  3IBH A;  3TKS E;  3TKQ A;  4XRD A;  5EVO A;  5IO2 A;  4KDU A;  3HVV A;  3KXO A;  4JED A;  1XBS A;  3ZIJ A;  5EL8 A;  1A8Y A;  1ILO A;  4ILF A;  4IJI A;  1O85 A;  2C0E A;  3TRP A;  1R4W A;  4EDZ A;  1E2Y A;  1XW5 A;  1X5C A;  3F6D A;  4RQR A;  5D9V A;  3TJG A;  3G9B A;  1QQ2 A;  2CT6 A;  2GZZ A;  2YJ7 A;  3O3T A;  1USB A;  3IC4 A;  5DJL A;  2OKA A;  1E6B A;  4I6X A;  4MP4 A;  1S3C A;  2MBS A;  5CO3 A;  4YH2 A;  3F63 A;  3GKX A;  5LCZ A;  5COH A;  4NPB A;  1O7U A;  4PQI A;  2HRF A;  4JBB A;  3SWL A;  3IPZ A;  3CBU A;  2V6O A;  5G31 A;  1J0F A;  4ZIJ A;  3IHG A;  3ZLP A;  4F03 A;  6GSU A;  1R5A A;  2VL2 A;  3WGD A;  2WJU A;  2RII A;  3PPU A;  4PUR A;  1XW9 A;  4AJ7 A;  3GKM A;  2GT5 A;  4KX4 A;  2L4C A;  1FOV A;  5ABR A;  5AN1 A;  4CDO A;  2OAC A;  2H74 A;  3C73 A;  2AV4 A;  2C8U A;  1TI1 A;  1U88 A;  1Z6M A;  2CVD A;  3IHQ A;  1VF2 A;  4MF6 A;  2FA8 A;  5ECQ B;  4HZ4 A;  4AF2 A;  3APS A;  2AHE A;  4IS0 A;  1SK2 A;  3QOU A;  2H8L A;  4MJB A;  3C1S A;  5KN0 A;  4MMM A;  1PSQ A;  3EMX A;  6GSV A;  2BTO T;  3GTU B;  4E8E A;  3KCM A;  4V2M A;  1GSU A;  4O32 A;  4AGS A;  1M7T A;  1SJI A;  2RUF A;  4L5L A;  1M9B A;  3TOT A;  4K1F A;  1PX6 A;  1GL8 A;  3RPP A;  3ZFB A;  3EMP A;  3G7J A;  1GWC A;  4PQH A;  4P3Y B;  5J5N A;  3APO A;  1T00 A;  1GSY A;  3TKP A;  3HJM A;  3PGT A;  3D4T A;  3ZL5 A;  4D73 B;  1YKA A;  1Q98 A;  3QD9 A;  2R4V A;  5DDL A;  3Q74 A;  1LBK A;  2HE3 A;  5J41 A;  3KIJ A;  4MZW A;  2A2P A;  1GUH A;  2WB9 A;  1PQN A;  2DC5 A;  5IOX A;  1ABA A;  5JWQ B;  4GQC A;  1MDK A;  3WD6 A;  1V9W A;  1X9W B;  2B5E A;  1EEJ A;  3GTU A;  1XFL A;  2M46 A;  1YEX A;  1O8W A;  1PKZ A;  3VWX A;  4DSQ A;  5DVB A;  4HQS A;  3UMA A;  3DVX A;  3HVX A;  4PQ1 A;  1KEB A;  4X43 A;  4ECC A;  1WPI A;  2FD3 A;  3LYP A;  4ECB A;  1GTI A;  1TDI A;  4TOP A;  4WR5 A;  2VCV A;  3MAK A;  1FB6 A;  2KP2 A;  1A2L A;  2QSI A;  1OE8 A;  1WMJ A;  2O85 A;  4IN0 A;  4D73 A;  3A5W A;  4GWR A;  1K0N A;  1WOU A;  5AIS A;  3IOS A;  1SEN A;  3GNJ A;  2O89 A;  2HRN A;  5DAK A;  3I9V 2;  1QGV A;  1ML6 A;  2HSY A;  3D5J A;  3ZML A;  1B4P A;  2GDR A;  2DIZ A;  4MDC A;  4JR4 A;  4J57 E;  3GUR A;  2K9F A;  4X4J A;  4WKW A;  5CRE A;  4XRA A;  5D93 A;  1F9M A;  2GQM A;  3W8S A;  4POL A;  6GSS A;  1EP7 A;  4QL9 A;  5DJM A;  2KP1 A;  4E8H A;  2H6X A;  2H30 A;  1KNG A;  2N5B A;  5A4U A;  2GVP A;  2VCZ A;  3HCZ A;  3UVT A;  2IMK A;  2H6Z A;  1UVZ A;  2N5F A;  2H0G A;  3IC8 A;  2JAD A;  2FWH A;  3D4M A;  2DJ2 A;  3UAP A;  3NZN A;  3UVH A;  1XPV A;  5ID2 B;  4HI7 A;  1T7P B;  4IW9 A;  4KW6 A;  2C80 A;  2PPT A;  2PVQ A;  1JHB A;  2LEG A;  2F9S A;  3ME8 A;  4Q5F A;  4ISD A;  2HNL A;  4JU5 A;  2XPD A;  1EZK A;  5H5R A;  1V58 A;  5ECO B;  3RHC A;  3GV1 A;  4IP6 A;  4Z2R A;  1ST9 A;  4DSS B;  2XPE A;  3HVS A;  2YCD A;  3MYD A;  4O7H A;  2E7P A;  3J7Y k;  4BWS A;  1YJ6 A;  1MD3 A;  1B9Y C;  4BVX B;  1W89 A;  4EXJ A;  1TTZ A;  2E2M A;  2B3S A;  4KAE A;  4OCE A;  1ERU A;  4I97 A;  5ID2 A;  2LRN A;  5EY6 A;  1Z7R A;  4EO3 A;  1MDI A;  2ES7 A;  1DBY A;  3GSS A;  1U3A A;  2WGR A;  13GS A;  2TIR A;  2HRA A;  1K0A A;  3FW2 A;  5J9B A;  5ECL B;  5JWR B;  4MZC A;  1SL1 B;  4TR0 A;  2H70 A;  4FYC A;  2MMZ A;  4GST A;  2LNT A;  2R0G A;  1GUL A;  1XWG A;  4QL7 A;  2CAI A;  4ML6 A;  2M80 A;  2V6K A;  3LOR A;  3VWW A;  1GNE A;  4OD7 A;  3MWH A;  4EIQ A;  2LQO A;  2YOI A;  1A24 A;  1R26 A;  2K8S A;  5CYY A;  2QKE A;  3FHK A;  3LXT A;  3CTG A;  2FNO A;  2VOC A;  1BAY A;  5IPG A;  4I2T A;  4KDX A;  2GGT A;  4I8B A;  2H72 A;  2C3T A;  2X8C A;  4POB A;  2NPB A;  1TRU A;  1X0R A;  2L59 A;  4CHS A;  1HNB A;  2V2G A;  2HFD A;  1QK8 A;  2IIY A;  2VD0 A;  1SD9 A;  1G7E A;  1O6J A;  3VK9 A;  4BWQ A;  3IRA A;  5ECK B;  2D2Z A;  1PMT A;  1XWA A;  2PU9 C;  3QCP A;  2PN8 A;  5IPH A;  3ZTL A;  4O5R A;  1QUW A;  3SBC A;  3D21 A;  4MPG A;  3DD3 A;  2DLX A;  1K3O A;  2YV9 A;  4HQZ A;  1AW9 A;  1CQH A;  5HFI A;  8GSS A;  3VPQ A;  4IVF A;  2I1U A;  5E59 A;  2GQK A;  2RLI A;  1Q4J A;  3VI5 A;  5B7C A;  3DKS A;  4MCU A;  4PNF A;  3DEX A;  1TK5 B;  1YDK A;  1T3B A;  1JZW A;  4K8M A;  3KH9 A;  5H5S A;  4JZQ A;  2G0F A;  3LEF A;  3G7Y A;  2X4A A;  2NBS A;  2LJK A;  1OYJ A;  1KTE A;  1U87 A;  3TRQ A;  1SYX A;  2QA1 A;  4Z2U A;  5KN3 A;  3F6F A;  2OE0 A;  2LRT A;  4ML1 A;  2B5Y A;  5JCU A;  1SKR B;  3BOA A;  3FZ4 A;  3FZ5 A;  2PGT A;  1JLV A;  18GS A;  4WR4 A;  3H79 A;  3M1G A;  4IQA A;  3F0I A;  4KH7 A;  1HNC A;  1BX9 A;  2VCW A;  5F8B A;  1AQW A;  4O5U A;  1V40 A;  2H75 A;  2N5A A;  4ID0 A;  2PER A;  2DML A;  3TRX A;  4TW5 A;  5DQY A;  2K6V A;  4MAB A;  4A5P A;  3TJJ A;  3CTF A;  4LLR A;  2H1G A;  3MIX A;  2EIR A;  3C71 A;  3GUS A;  2WUL A;  2A2R A;  2X64 A;  3Q6O A;  4RQX A;  3E9J B;  7GSS A;  1NHY A;  2NDO A;  4KDY A;  3TJF A;  2C1Y A;  3MSZ A;  4GXZ A;  4LL1 B;  2IMD A;  2E2G A;  2A4H A;  5HR0 A;  4MJA A;  4KCE A;  2I4A A;  1JFU A;  1TW9 A;  3PIN A;  2C0F A;  4WBJ A;  4BA7 A;  1UA5 A;  3IDV A;  3EU4 A;  2DJ0 A;  5F0G A;  1T4Y A;  5H5Q A;  4N11 A;  4H86 A;  1MDJ A;  2LNS A;  4N0V A;  4ZB6 A;  3R2Q A;  5CRH A;  2IMF A;  2IL3 A;  4ZB8 A;  1LU4 A;  2B7K A;  3LGC A;  2R37 A;  3K8N A;  1A2J A;  5DBQ A;  4EVM A;  4FYB A;  2GSR A;  1YF1 A;  4G10 A;  3US3 A;  3TCO A;  5F07 A;  1SKW B;  2MYG A;  2X49 A;  1IYI A;  2ON5 A;  2PWJ A;  4MPF A;  2JSZ A;  2H0H A;  2HLS A;  2YZU A;  1MD4 A;  5HQP A;  4HU7 A;  1B8X A;  2YV7 A;  4TN8 A;  9GSS A;  1THX A;  1M9A A;  5L71 A;  1XWC A;  2CV4 A;  3HD5 A;  2C0G A;  1X5E A;  2FGX A;  1WP0 A;  3ZVJ D;  5ECS A;  2ZUP A;  2L5L A;  3IXR A;  2H66 A;  1K0O A;  3OR5 A;  3UOM A;  4L5O A;  1PA3 A;  1YY7 A;  2X8H A;  3DRN A;  1AQX A;  2F3M A;  1PGT A;  1ERT A;  5IMZ A;  2VIM A;  2IWT A;  2I81 A;  1ERV A;  4KND A;  19GS A;  1V2A A;  4MH3 A;  2H76 A;  3L9V A;  1EOG A;  3QDN A;  3UBL A;  3ZZX A;  3BJ5 A;  2YJH A;  3GYK A;  1XVW A;  3S9F A;  2HSH A;  1EEM A;  2CVK A;  2YN1 A;  2LUS A;  5DQS A;  1WRY A;  3LXZ A;  5D96 A;  3EIN A;  2J23 A;  1TOF A;  4HJM A;  2FHE A;  5FWG A;  4ZXG A;  4HEA 2;  3U6V A;  3F3R A;  1G7O A;  3QAW A;  4HOJ A;  5B6N A;  2WS2 A;  4JE1 A;  5D73 A;  2OE1 A;  2QA2 A;  5INY A;  1VF4 A;  3ZMK A;  5DCG A;  3JCM L;  4TR1 B;  3WT2 A;  2V1M A;  2DMM A;  3CYN A;  2WZ9 A;  2CZ3 A;  1OVN A;  2ON7 A;  1J08 A;  3D6I A;  1TP9 A;  2FA4 A;  1XVQ A;  3UJ1 A;  2O7K A;  5KN1 A;  1JZD A;  1DE1 A;  4Z7X A;  1OE7 A;  4J2F A;  3MNG A;  4FO5 A;  2FUG 2;  4JR6 A;  2ALB A;  2HI7 A;  3KM6 A;  1T8E B;  2FWG A;  5ECP B;  3HY2 A;  4KB3 A;  3TKS C;  4TXO B;  4V2N A;  2VLU A;  3GL3 A;  2FWF A;  2IN3 A;  1Y6E A;  16GS A;  4GF0 A;  2VM1 A;  1ZGN A;  3FR3 A;  1URM A;  4HU9 A;  4J56 E;  2FY6 A;  3LYK A;  2GSQ A;  4OCF A;  3HDC A;  4FQU A;  2MZC A;  5E4W A;  1SD8 A;  1Z9H A;  3FR6 A;  12GS A;  2M72 A;  5G5F A;  3L0H A;  1KBN A;  3HA9 A;  4K2X A;  2R0P A;  2CQ9 A;  5C04 A;  1OC8 A;  3NOF A;  3UIW A;  5IQY A;  5G1K A;  2B7J A;  3V1W A;  3VUR A;  1TXX A;  2CA8 A;  3LW9 A;  4YAV A;  1TU8 A;  3APQ A;  2VD1 A;  2XBQ A;  3HJO A;  4WEY A;  5GST A;  2GTU A;  2TRC P;  2REM A;  4GSN A;  2DBC A;  2XHF A;  3TKR A;  3P2A A;  1EP8 A;  3KMO A;  5ELG A;  4Z2T A;  1QMV A;  3ZVJ A;  2VCQ A;  2GS3 A;  3EYT A;  1WWJ A;  4TXO A;  1GLQ A;  3M9J A;  2OE3 A;  4G0L A;  5GAP D;  2P5Q A;  2VLV A;  2ZNM A;  4ZIL A;  3H8Q A;  5KN2 A;  4HDE A;  4PTS A;  2CVB A;  1PKW A;  4KSO A;  1S3A A;  1TRS A;  3L9U A;  2GZP A;  3KH7 A;  1V98 A;  3E0U A;  3ZFL A;  4HUA A;  1O73 A;  4K7N A;  1YKC A;  4MF7 A;  4X1U A;  4TVE A;  4OFT A;  1GTA A;  5B8A A;  4G0K A;  3ZRE A;  4GSS A;  4NXI A;  1HYU A;  3IAM 2;  1AIU A;  1ZOF A;  14GS A;  3QPM A;  3Q18 A;  1I5G A;  4Q5Q A;  3KTL A;  5D9X A;  1ZYN A;  4BL7 B;  2HT9 A;  4OFM A;  3R3E A;  1THO A;  3QAG A;  1DE2 A;  1FG4 A;  2DKI A;  3FZ9 A;  3N5O A;  5DAL B;  4NHZ A;  4HJ2 A;  4K0G A;  1NSW A;  4PUA A;  4G9H A;  3HYP A;  2IPA A;  4K7O A;  2R3X A;  4G2E A;  3RDW A;  2GT6 A;  10GS A;  4MA9 A;  1XZO A;  3EWL A;  2OJL A;  2B1L A;  2LQQ A;  3KD0 A;  11GS A;  3KZQ A;  4PNG A;  1J9B A;  2C3N A;  4TKY A;  2XBI A;  5J4U A;  2CZ2 A;  3MDK A;  4NMU A;  1M2B A;  1ZL9 A;  3DVW A;  2DJ3 A;  1GLP A;  2P31 A;  1X9M B;  1K0C A;  4ZBA A;  3FEU A;  4EDY A;  4ZL7 A;  1X9S B;  4V1A p;  1A23 A;  5CNW A;  1AAZ A;  2DJJ A;  2H1D A;  2C3Q A;  1ZYE A;  1G6W A;  3EE2 A;  4BVY B;  4IKH A;  1XIY A;  3TDG A;  4TRX A;  5LNK e;  2X99 A;  1ZYQ B;  4BL7 A;  2JL4 A;  4MNN A;  22GS A;  4DSS A;  4F0B A;  1YEP A;  1GSF A;  1TJD A;  5AIV A;  3ED3 A;  3VFI A;  5DAL A;  1A8L A;  4PXO A;  5DCH A;  4GLT A;  2GST A;  2VM2 A;  3GX8 A;  3TOU A;  3ZRD A;  4RI6 A;  1G0T A;  3C8E A;  2VCT A;  1F3A A;  2I3Y A;  1JZO A;  5EPF A;  1QFN A;  4BVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...