1TRVA

The high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN
publication title The high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Electron transport
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1994-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1trvA00
4OFMA 2EIRA 2RM5A 4RI7A 2HYXA 11GSA 1AQVA 1ERTA 2C0FA 4H86A 5HQPA 3HJPA 5HR3A 4IGJA 4ZL9A 3RHCA 4MJEA 4XIHA 2LUSA 1NSWA 4TR3A 20GSA 3VWUA 2HLSA 2H6XA 2DJJA 2L57A 1JHBA 3C7MA 1VF2A 3HXSA 2F9SA 3D5JA 3WD6A 1SKWB 3IK7A 4NAXA 5ECHB 2VCQA 1Z7PA 2AHEA 1FAAA 2H1GA 3EE2A 3E0UA 4Q5NA 3KD0A 3A2XA 4K0NA 3WGDA 3DEXA 5C04A 2VUPA 3ZRDA 1GSDA 3KIJA 1YKAA 2JSZA 1ERUA 4MF6A 4IJIA 2O85A 2L5OA 3IXRA 4KB3A 1K3YA 4LLRA 2OKAA 2AYTA 4IP6A 3ZFLA 3RDWA 4YQVA 1PMTA 4KGIA 2H70A 4OWYA 4MJBA 1ML6A 1MD4A 5J9BA 1T8EB 2H0HA 4WBRD 4WXTA 3VPTA 5GSSA 3F6FA 3IRAA 2HSYA 2E7PA 2WFCA 2IMEA 3DXBA 3PH9A 5D93A 1FG4A 8GSSA 1Z7RA 1QK8A 2I81A 3RPPA 1O81A 2V41A 3SWLA 5D9WA 1MDKA 4OFNA 4BVYA 1FB6A 4IP1A 2JADA 1TJDA 1ZL9A 2PGTA 1BYEA 3TOTA 1U6TA 5CAXA 3GNJA 1CQHA 3I69A 1DBYA 3GKXA 2IWTA 2DJKA 4WF4A 1U87A 2GTUA 1X5DA 1XWKA 2LS5A 2VL2C 5D73A 4L5OA 2H01A 1EV4A 1B4QA 3C71A 5DVBA 2IMIA 4FYCA 2YV9A 2RUFA 3TJJA 4IS0A 12GSA 3O76A 4F0CA 2DJ0A 1FW1A 2O87A 4LMVA 4GLTA 4MPGA 1DE2A 4N30A 4WR5A 5D8IA 2CVDA 1V40A 3G9BA 1XVWA 1MDIA 1K0MA 5JCWA 1EWXA 1Z3EA 4K2DA 1TI1A 3FR9A 2J9HA 2XBIA 3WYWA 5JWRB 2B5EA 4NMUA 3W8JA 2EIOA 4XHMA 3V1WA 4E8HA 1O85A 5IM9A 4V1Ag 4BPYA 1GTBA 1BQ7A 3F9UA 2VM2A 1XZOA 2LJKA 1ZOFA 3HZ8A 2RM6A 2VL3A 4WKWA 1DE1A 3HVSA 1HNAA 1YZXA 4NHWA 14GSA 1EGRA 4ZBDA 2YCDA 1Y25A 3GKKA 1K0BA 1QMVA 2C0DA 2MMOA 1SK0A 5AIXA 1XPVA 1JZOA 4ID0A 1WP0A 2YWIA 1RW1A 4NV5A 4TR0A 2ON5A 4P3YB 1R5AA 5IMFA 1ZYEA 3HJMA 2GT5A 2YZHA 1A8LA 4HOJA 1PGTA 2C3TA 4GWRA 3ME8A 4JU5A 1T4YA 4GXZA 3F8UA 1SD9A 2PVQA 2L4QA 1XXUA 2QGVA 4ILFA 2VCXA 3FZ5A 3R2QA 2PERA 3LGCA 2C80A 1JZRA 1XW9A 3SBCA 3F6DA 2MZCA 3J7Yk 2DJ3A 2VD0A 2B5XA 2LQOA 2L6CA 1X9WB 4EE0A 4HEA2 2JL4A 1T00A 1F9MA 4K6XA 1TK8B 2IMKA 2GQKA 2HRFA 4HZ2A 1U3AA 4I6XA 1SU9A 4WEYA 4I2TA 5KN2A 1TP9A 3FKFA 2XPDA 5G5FA 5HFIA 3FEUA 3LORA 3UMAA 3ZITA 1BAYA 2FWEA 3O3TA 1TRVA 5ECQB 5DAKB 3IA1A 1VF3A 3L0HA 2B3SA 3AY8A 5DQSA 3QMXA 2CT6A 2VL2A 3J7Yb 5G2ZA 2C3NA 3FZ9A 3UAPA 4OFTA 1ACVA 1A0RP 1YEPA 3ZMLA 1X5CA 2IIYA 3GX8A 2K8SA 3NOFA 1PA3A 3A3TA 1G0TA 3EC3A 3F0IA 4YAVA 1M7TA 1QXHA 3ZIJA 2MBSA 1AUCA 2YOIA 2H0GA 5G5EA 5DQYA 3TKPA 1O8XA 2AV4A 3UVTA 5ID2B 1CQGA 2YANA 2OE3A 3GUSA 1TW9A 4QQ7A 1R5PA 1LBKA 3I43A 1PKWA 5D9XA 2FA4A 1OE7A 4ZBBA 3HVXA 4J56E 6GSSA 3APQA 4JE1A 1M9AA 4TVEA 5J5NA 3VLNA 1A2LA 2OADA 4IBPA 2N5AA 2F8FA 3ISOA 2NVLA 5HR0A 1PSQA 4EDYA 4GQFA 5G1LA 4TR4A 2VCWA 2GVPA 1XOAA 4CHSA 1GP1A 3A5WA 4D73B 3G7JA 4XRAA 1FHEA 5DCGA 2H75A 4AJ6A 1QQ2A 1MTCA 2IJYA 2M72A 3FZAA 2HNLA 1PD21 4PQHA 1GRXA 2K9FA 5H5SA 1Q98A 1GWCA 1F2EA 4YAPA 2P31A 3US3A 1OC9B 1THXA 1XWAA 4MDCA 2CZ2A 3HY2A 1USBA 3GRXA 3A2WA 2GSSA 2H66A 3RHBA 5KN1A 2FCHA 3EU3A 4ZL7A 1O73A 4RQRA 4PURA 2YWMA 2GZYA 3GV1A 3L4NA 2VCVA 4MP4A 4D73A 3GURA 6GSXA 1UC7A 1B8XA 3IC4A 3C73A 1X9SB 5ECLB 2D2ZA 2C4JA 1AXDA 5IO2A 1N2AA 2DJ2A 2I1UA 4KCEA 4V2MA 3D4MA 2EIQA 4RUVA 2A4VA 1Q4JA 5EL8A 2L6DA 1S3DA 2Z9SA 4ECBA 5KEJA 1Z6NA 1WPIA 2R4VA 3GL5A 2XC2A 3VWVA 4WR4A 1SENA 5EPFA 4LL1B 1YDKA 3TJKA 2WZ9A 1NW2A 5IMDA 5ABRA 4PQ1A 4ZB6A 4XCSA 5FHIA 5A4VA 1YY7A 2C0EA 2B1KA 6GSWA 3HD5A 2HT9A 1O6JA 3IAS2 1IYIA 2VAFA 5IIZA 5GSTA 2P5QA 1XWBA 2VCZA 2H73A 5IOXA 1GL8A 2FGXA 2XHFA 1UVZA 4K7NA 4WETA 3H8QA 5ECMB 1W4VA 1GH2A 3IPZA 3CSHA 1VRSD 3FR6A 1IYHA 3WGXA 3GL3A 1ERWA 5LD0A 3VPQA 4HQSA 2PN8A 4MCUA 1MD3A 5ECNB 1YKCA 1GSUA 2O7KA 1C72A 3EYTA 5D96A 2HSHA 4IVFA 1X9MB 1H4OA 5H5QA 4KSMA 4TKYA 1URMA 2GQMA 3HDCA 4JBBA 5F0GA 1K0CA 4F2IA 3HZ4A 4HJMA 2VL9A 4NWYA 2B7JA 1ILOA 3TOUA 4PQIA 3G7YA 2V32A 3M8NA 2FWFA 3CRUA 3Q6OA 5J3RA 5C00A 4PNGA 4PGTA 4O7HA 3L9SA 4NHZA 2RLIA 3TKQA 1TXXA 3HVVA 4ECCA 4QL7A 2TRXA 3TRXA 3KH9A 3KGKA 3KTLA 3CTGA 4IKHA 4MA9A 1K3LA 4Q5FA 3TRPA 2X64A 3KTBA 2KUCA 1KNGA 2MYGA 3VFIA 2PU9C 3U6VA 5ECKB 5HFKA 3DIEA 3GN3A 4G2EA 4HS1A 1N8JA 3D4TA 5COHA 3ZVJD 2GZZA 4WBJA 4ML6A 2GT6A 1OAZA 4MF5A 2OBKA 4YQUA 2YWNA 3RPNA 4OO5A 2VM1A 5F06A 2JZSA 4BL7A 5GAPD 2HE3A 1V57A 4K8MA 4NPBA 1EGOA 4GRFA 4KE3A 3FYGA 2HXKA 9GSSA 1M0UA 6GSTA 4MF7A 1GUMA 3IOSA 3QAVA 3BCKA 2L59A 2GQLA 3TB2A 2MMAA 3EWLA 1XCCA 1GSFA 2AAWA 4PNFA 1XWGA 2I4AA 4RI6A 1SJ6A 2DC5A 1WOUA 1V9WA 2RUEA 1T1VA 1HQOA 4TXOB 5IMCA 1GSSA 2H74A 2ZNMA 3GH9A 4KX4A 3ZVJA 2JACA 1SKRB 4ECJA 3GH6A 2JZTA 3HYPA 4FIWA 1TK0B 1YF1A 1YEXA 3TKRA 1ZCPA 2REMA 2CV4A 3Q19A 1B9XC 4TRXA 4K9ZA 2DBCA 3DRNA 3ZFBA 1K0AA 2C0GA 3KMOA 4DSQA 4POMA 4KDUA 1YQ1A 2H1AA 5DALB 3GYKA 1VGLA 1PN9A 4PUFC 5E59A 4ZIJA 16GSA 2O89A 3P7XA 3IV4A 5FWGA 1B9YC 1S3CA 4HU9A 1XOBA 4NXIA 3LEFA 1ABAA 3MWHA 3QFBC 2PVOC 3I6AA 4XS4B 5D9VA 2FHEA 4Q5RA 1VF4A 4JRRA 5CYYA 4I8BA 2YZUA 4AJ7A 1M9BA 5DALA 2X8CA 3BJ5A 5AGYA 2H6YA 4E8EA 5DDLA 1Y6EA 1PX6A 1WRYA 4IQAA 4PUAA 3F4RA 2NTOA 2FWGA 2IFQB 3QFAC 3NIVA 2H19A 1QGVA 4IJ3A 2MMNA 2NPBA 4XS6A 3TGZA 1QUWA 1U88A 1F3AA 3F3RA 3GKNA 2L5LA 4POBA 4L8EA 3ZMKA 5IPGA 3QAGA 4EVMA 1XBSA 4MLYA 1GNEA 1AIUA 3HCZA 3EMPA 1ST9A 1MEKA 3LYKA 1AQXA 1XIYA 5IMVA 1S3AA 3APSA 1JZWA 2AJQB 3UBKA 6GSYA 2CAIA 1GLPA 3PINA 1BX9A 5G1KA 2P5RA 3M9KA 5INYA 1ZGNA 4KSOA 3KZQA 1FB0A 4DEJA 1TRWA 1E2YA 4EF0A 2O8VB 19GSA 1OE8A 3C1SA 3G7IA 2H30A 3HJOA 1T4ZA 4EXJA 1U3IA 17GSA 2JSYA 18GSA 3EINA 1GULA 3H79A 4RQXA 2A2SA 4F9ZA 1FVKA 1VF1A 2IPAA 1O7UA 4HDEA 4K0GA 2G0FA 3ERFA 3A2VA 3CBUA 4TOPA 5DAKA 4MZWA 4L5LA 5ENUA 4ZB8A 1M2DA 2VD1A 5LCZA 3WGEA 3P8WA 2GSQA 4ZL8A 3PGTA 4OD7A 4TR1B 2LRTA 1M2AA 2FA8A 1ON4A 3WT2A 4EKZA 2H71A 1PL2A 4MZCA 1ZZYA 3MNGA 4ZXGA 2H72A 4PX1A 1HYUA 1A2MA 3HA9A 1SK2A 5E4WA 1GSEA 3LQ7A 3IDVA 2MBTA 2VO4A 3ZREA 1JLVA 2B6MA 2YPMA 1K0NA 3CSIA 1J08A 5DCHA 2QKEA 4TR1A 5ID2A 4KA0A 3LXZA 1KTEA 2EC4A 3IAM2 1EEMA 5FT3A 2X8HA 4FO5A 1TRSA 3N5OA 1SD8A 3BOAA 3DVWA 5LNKe 2LTKA 1XFLA 1WJKA 3KXOA 3C8EA 4OCFA 5KN3A 1PKZA 2XBQA 4JEDA 5CRDA 5JWQB 3ERWA 4EO3A 4MH2A 1JZDA 1GUHA 5CNWA 1QFNA 3BBYA 1GNWA 5F07A 2WJUA 2CAQA 3M0FA 3M1GA 5F05A 1NM3A 1I9DA 22GSA 2VLUA 5L71A 2H76A 4G10A 4Q5QA 6GSUA 4EC0A 2WCIA 1OC9A 4WF5A 2E0QA 1F6MC 2DIYA 1PRXA 2KP2A 3FK8A 2YP6A 5J4UA 3Q18A 2GLRA 1TU8A 2OE1A 4IELA 3VWXA 1JLWA 1LJRA 3H4KA 4N0VA 4IW9A 2M80A 1DSBA 2PUKC 4TXVA 1SL2B 5IO0A 3TJBA 4O92A 2WB9A 5F8BA 2XPEA 3PR8A 4G9HA 1K3OA 3KP9A 3TUEA 3IE3A 1WIKA 5A4WA 1M99A 1A24A 1WWJA 2FUG2 2LV3A 2GSRA 2LJRA 5ECRB 1G6WA 2VOCA 4MMMA 4KDXA 1NHYA 1HNCA 4G19A 1PQNA 1X5EA 4IHUA 4HUAA 2IL3A 1WE0A 3K8NA 1AC1A 3D0ZA 1G7OA 3UL3A 2L4CA 1ZMAA 4GQCA 3GTUB 2LQQA 3GX0A 2NBSA 4ISDA 4EDZA 4MPFA 3UBLA 2KHPA 5IMAA 4GSTA 2LNTA 2BJXA 2G2QA 2R3XA 3KJYA 4X43A 2CX3A 3FZ4A 2MMZA 3H93A 4FH8A 1Z6MA 3U5RE 5G30A 5KN0A 2RIIA 5CO3A 4O5RA 1TU7A 4KUNA 1EOHA 3GTUA 7GSSA 2HRNA 3ZLPA 2QSIA 3OR5A 2I9HA 3DGQA 1RK4A 4GSSA 1DUGA 5JCGA 2V6OA 3ZL5A 3GMFA 2FNOA 3M9JA 1M2BA 3UOMA 3APOA 2OBIA 3GHAA 5B6NA 4XS1A 2F51A 4ULXA 4ZILA 2LRCA 4L0UA 2C3QA 2WULA 1EP8A 2FLSA 2CA8A 3QDNA 3TKSC 2YN1A 2F3MA 1V2AA 4LL4B 3HKRA 5DJMA 3QCPA 2ZCTA 1R26A 3NZNA 1Z5YE 2GSTA 1G7EA 2ES7A 1I5GA 2GZPA 5DBQA 3LXTA 1R7HA 2LEGA 1THOA 4PXOA 2K18A 3BCIA 3BD2A 5B8BA 4V2NA 3Q74A 2LRNA 3QAWA 4I5QA 2YNXA 4KDYA 3TCOA 2H1DA 2HI7A 3LFLA 3N9JA 2PBJA 2A2RA 2FWHA 3TKSE 5J41A 3FW2A 2LJAA 3DWVA 2YV7A 1EP7A 2KLXA 3DD3A 3KH7A 4DSSB 1SK1A 5AISA 4FYBA 3ED3A 5ECSA 2LKUA 2AB6A 2PPTA 3EU4A 1SYXA 5G31A 1V98A 5IPHA 3QR6A 4NV2A 3CRTA 1KEBA 2VIMA 1TK5B 5JWOB 5EVOA 3O6TA 3ZTLA 2H0IA 3QD9A 3LYPA 1HNBA 1EEJA 3M3MA 1BG5A 3GKMA 1FO5A 5A5KA 1X0RA 3GA4A 5CP1A 1SJZA 2H1BA 4DSSA 3QPMA 2ALBA 1SL1B 5IOWA 5AN1A 2VLTA 1AQWA 4TXOA 1OKTA 3EMXA 2BMXA 3RAZA 1OC3A 2KP1A 3UJ1A 2DJ1A 4TW5A 2IN3A 3HHVA 4KAEA 5EY6A 3LG6A 4GTUA 1B48A 5GZZB 3KCMA 2JU5A 2DIZA 3I9V2 5IQYA 1TKDB 1UN2A 1YJ6A 5A4UA 3CSJA 1F3BA 3L9VA 2VLVA 3IBHA 4J2FA 5ECIB 3IHQA 1AAZA 2C8UA 5J9CA 1BJXA 1A0FA 3LSZA 2CVKA 3MAKA 4K7OA 3KM6A 2M46A 2K8VA 2CX4A 1XW6A 4X0XA 5IMZA 4BWQA 4GSNA 3L78A 2C1YA 5CRGA 2J23A 5B6MA 4FYUA 4K1FA 3F4TA 2WDUA 4CW9A 1G6YA 1BEDA 1OYJA 2IMFA 5HR2A 2WS2A 5GAND 1ZYQB 4XS4A 3CXGA 2TIRA 4AGSA 1NHOA 4L0WA 4KH7A 2WRTA 2E2GA 4MK3A 4POKA 1O8WA 2WGRA 4KW6A 2ON7A 2V6KA 2HFDA 4JR4A 2F8AA 1OC8A 2R6KA 3TKSA 2GS3A 3D22A 3F4SA 3ZZXA 3FY7A 2GGTA 3LWAA 2B5YA 3JCML 2AUVA 4XRDA 3GIXA 4I97A 13GSA 2YJHA 4QL9A 4HI7A 5HFGA 3L9UA 2B1LA 2B7KA 1FVJA 2NDOA 3TDGA 2IFQA 1K0OA 2HZEB 2P0GA 4Z7XA 4F82A 3CYNA 1RQMA 3FR3A 4ECIA 1JFUA 3D21A 3GFKA 3VI5A 4IN0A 1PL1A 3GSTA 4ACSA 4POLA 3UVHA 2JZRA 3TJFA 3W6GA 4F03A 2PWJA 3FHKA 4MJCA 4LA1A 2HZEA 3UARA 1XVQA 1AW9A 1F37A 2I3YA 4N10A 1R4WA 2KOKA 5ELGA 2IMDA 3E3EA 2CVBA 4N11A 2V1MA 3UEMA 1J0FA 2YJ7A 5H5RA 1FOVA 4MABA 1EV9A 1J9BA 3LJRA 2N5BA 5CRHA 1E6BA 3EURA 1GSQA 1YF0A 2YWOA 3EVIA 2TRCP 2DMMA 4V2LA 4BWSA 1OKDA 4YQMA 4X1UA 1W89A 3S9FA 3VWWA 5ECPB 2E2MA 5AIVA 2ZUPA 1K0DA 2BTOT 4KCAA 2X99A 2DSAA 1TRUA 1SJIA 4HZ4A 1SYRA 3UIWA 4BVXA 1PX7A 10GSA 4EL1A 4HJ2A 5HR1A 2R2JA 2CQ9A 2V2GA 2HZFA 2QC7A 3FRCA 2K6VA 4N0ZA 3DYRA 1UA5A 5ELAA 4ZBAA 4LMWA 1TDIA 4MZBA 3ME7A 2DLXA 3TRQA 3RBTA 4ML1A 2R37A 3CMIA 5CRWA 4GCIA 4HU7A 2DMLA 2OE0A 1LU4A 4AF2A 3DMLA 4I2UA 5JCUA 1V58A 2VCTA 2FY6A 3WT1A 4V1Ap 3DVXA 1GTIA 2N5FA 2CZ3A 2OA7A 3KP8A 4O32A 3F3QA 3VK9A 3MSZA 1KBNA 4XTSA 1A2JA 4KNDA 4CDOA 4DSRA 3IR4A 4JZQA 1EOGA 1B4PA 1XWCA 5DJLA 1OVNA 4OO4A 3ERGA 2R5GA 2PMTA 3QOUA 4IQ1A 3CTFA 5ECOB 5B7CA 3ZYWA 3VURA 2OACA 4OCEA 2OJLA 2GDRA 1XW5A 3D6IA 1WMJA 6GSVA 4MJAA 1GTUA 4K7IA 1SL0B 4MH3A 4DVCA 4GF0A 1ERVA 1A23A 1TTZA 2FD3A 3MDKA 1H75A 3IK9A 4OMVA 3KEBA 1GSYA 1T3BA 1EZKA 1SKSB 3ZIVA 4J57E 1GTAA 5CREA 4JR6A 3H1NA 1MDJA 3DKSA 3E9JB 2X8GA 1T7PB 1GLQA 4TN8A 4BA7A 1Z9HA 2LSTA 1TOFA 1GUKA 4EUYA 4ZB9A 1A8YA 3C1RA 2H8LA 1TI3A 2LNSA 3GSSA 2H6ZA 3TJGA 3P90A 3KMNA 5B8AA 3W8SA 4F0BA 4HQZA 4YH2A 1HD2A 3P2AA 3F63A 5D9TA 4AJ8A 3VI7A
chains in the Genus database with same CATH superfamily
4OFMA 2EIRA 2R0CA 2RM5A 4RI7A 2HYXA 11GSA 1AQVA 1ERTA 2C0FA 4H86A 5HQPA 3HJPA 5HR3A 4IGJA 4ZL9A 3RHCA 4MJEA 4XIHA 2LUSA 1NSWA 4TR3A 20GSA 3VWUA 2HLSA 2H6XA 2DJJA 2L57A 1JHBA 3C7MA 1VF2A 3HXSA 2F9SA 3D5JA 3WD6A 1SKWB 3IK7A 4NAXA 5ECHB 2VCQA 1Z7PA 2AHEA 4KF9A 1FAAA 2H1GA 3EE2A 3E0UA 4Q5NA 3KD0A 3A2XA 4K0NA 3WGDA 3DEXA 5C04A 2VUPA 3ZRDA 1GSDA 3KIJA 1YKAA 2JSZA 1ERUA 4MF6A 4IJIA 2O85A 2L5OA 3IXRA 4CY6A 4KB3A 1K3YA 4LLRA 2OKAA 2AYTA 4A5PA 4IP6A 3ZFLA 3RDWA 4YQVA 1PMTA 4KGIA 2H70A 4OWYA 4BVYB 4MJBA 1ML6A 1MD4A 5J9BA 1T8EB 2H0HA 4WBRD 4G0KA 4WXTA 3VPTA 5GSSA 3F6FA 3IRAA 2HSYA 2E7PA 2WFCA 2IMEA 3DXBA 4MNNA 3PH9A 5D93A 1FG4A 8GSSA 1Z7RA 1QK8A 2I81A 3RPPA 1O81A 2V41A 3SWLA 5D9WA 1MDKA 4OFNA 4BVYA 1FB6A 4IP1A 4BIKA 2JADA 1TJDA 1ZL9A 2PGTA 3LW9A 1BYEA 3TOTA 1U6TA 5CAXA 3GNJA 1CQHA 3I69A 1DBYA 3GKXA 2IWTA 2DJKA 4WF4A 1U87A 2GTUA 1X5DA 1XWKA 2LS5A 2VL2C 5D73A 4L5OA 2H01A 1EV4A 1B4QA 3C71A 5DVBA 2IMIA 4FYCA 4HSCX 2YV9A 2RUFA 3TJJA 4IS0A 12GSA 3O76A 4F0CA 2DJ0A 1FW1A 2O87A 4LMVA 4GLTA 4MPGA 4K5SA 1DE2A 4N30A 4WR5A 5D8IA 2CVDA 1V40A 3G9BA 1XVWA 1MDIA 1K0MA 5JCWA 1EWXA 1Z3EA 4K2DA 1TI1A 3FR9A 2J9HA 2XBIA 3WYWA 5JWRB 2B5EA 4NMUA 3W8JA 2EIOA 4XHMA 3V1WA 4E8HA 1O85A 5IM9A 4V1Ag 4BPYA 1GTBA 1BQ7A 2A2PA 3F9UA 2VM2A 1XZOA 2LJKA 1ZOFA 3HZ8A 2RM6A 2VL3A 4WKWA 1DE1A 3HVSA 1HNAA 1YZXA 4NHWA 14GSA 1EGRA 4ZBDA 2YCDA 1Y25A 4G0IA 3GKKA 1K0BA 1QMVA 2C0DA 2MMOA 1SK0A 5AIXA 1XPVA 1JZOA 4ID0A 1WP0A 2YWIA 3IC8A 1RW1A 4NV5A 4TR0A 2ON5A 4P3YB 4CY8A 1R5AA 4K5RA 5IMFA 1ZYEA 3HJMA 2GT5A 2YZHA 1A8LA 4HOJA 1PGTA 2C3TA 4GWRA 4Z2RA 4FQUA 3ME8A 4JU5A 1T4YA 4GXZA 3F8UA 1SD9A 2PVQA 2X49A 2L4QA 1XXUA 2QGVA 4ILFA 2VCXA 3FZ5A 3R2QA 2PERA 3LGCA 2C80A 1JZRA 1XW9A 3SBCA 3F6DA 2MZCA 3J7Yk 2DJ3A 2VD0A 2B5XA 2LQOA 2L6CA 1X9WB 4EE0A 4HEA2 2JL4A 1T00A 1F9MA 4K6XA 1TK8B 2IMKA 4ICYA 2GQKA 2HRFA 4HZ2A 1U3AA 4I6XA 1SU9A 4WEYA 4I2TA 5KN2A 1TP9A 3FKFA 2XPDA 5G5FA 5HFIA 3FEUA 3LORA 4Z2TA 3UMAA 3ZITA 1BAYA 2FWEA 3O3TA 1TRVA 5ECQB 5DAKB 3IA1A 1VF3A 3L0HA 2B3SA 3AY8A 5DQSA 3QMXA 2CT6A 2VL2A 3J7Yb 5G2ZA 2C3NA 3FZ9A 3UAPA 4OFTA 1ACVA 1A0RP 1YEPA 3ZMLA 1X5CA 2IIYA 3GX8A 2K8SA 5BRTA 3NOFA 1PA3A 3A3TA 1G0TA 3EC3A 3F0IA 4YAVA 1M7TA 1QXHA 3ZIJA 2MBSA 1AUCA 2YOIA 2H0GA 5G5EA 5DQYA 3TKPA 1O8XA 2AV4A 3UVTA 5ID2B 1CQGA 2YANA 2OE3A 3GUSA 1TW9A 4QQ7A 1R5PA 1LBKA 3I43A 1PKWA 5D9XA 2FA4A 1OE7A 4ZBBA 3HVXA 4J56E 6GSSA 3APQA 1XG8A 4JE1A 1M9AA 4TVEA 5J5NA 3VLNA 1A2LA 2OADA 4IBPA 2N5AA 2F8FA 3ISOA 2NVLA 5HR0A 1PSQA 4EDYA 4GQFA 5G1LA 4TR4A 2VCWA 2GVPA 1XOAA 4CHSA 1GP1A 3A5WA 4D73B 3G7JA 4XRAA 1FHEA 5DCGA 2H75A 4AJ6A 1QQ2A 1MTCA 2IJYA 2M72A 3FZAA 2HNLA 1PD21 4PQHA 1GRXA 2K9FA 5H5SA 1Q98A 1GWCA 1F2EA 4YAPA 2P31A 3US3A 1OC9B 1THXA 1XWAA 4MDCA 2CZ2A 3HY2A 1USBA 3GRXA 3A2WA 2GSSA 2H66A 3RHBA 5KN1A 2FCHA 3EU3A 4ZL7A 1O73A 4RQRA 4PURA 2YWMA 2GZYA 3GV1A 3PPUA 3L4NA 2VCVA 4MP4A 4D73A 3GURA 6GSXA 1UC7A 1B8XA 3IC4A 3C73A 1X9SB 5ECLB 2D2ZA 2C4JA 1AXDA 5IO2A 1N2AA 2DJ2A 2I1UA 4KCEA 4V2MA 3D4MA 2EIQA 4RUVA 2A4VA 1Q4JA 5EL8A 2L6DA 5KOXA 1S3DA 2Z9SA 4ECBA 5KEJA 1Z6NA 1WPIA 2R4VA 3GL5A 2XC2A 3VWVA 4WR4A 1SENA 5EPFA 4LL1B 1YDKA 3TJKA 2WZ9A 1NW2A 2QA2A 5IMDA 5ABRA 4PQ1A 4ZB6A 4XCSA 5FHIA 5A4VA 1YY7A 2C0EA 2B1KA 6GSWA 3HD5A 2HT9A 1O6JA 3IAS2 1IYIA 2VAFA 5IIZA 5GSTA 2P5QA 1XWBA 2VCZA 2H73A 5IOXA 1GL8A 2FGXA 2XHFA 1UVZA 4K7NA 4WETA 3H8QA 5ECMB 1W4VA 1GH2A 3IPZA 3CSHA 1VRSD 3FR6A 1IYHA 3WGXA 3GL3A 1ERWA 5LD0A 3MIXA 3VPQA 4HQSA 2PN8A 4MCUA 1MD3A 5ECNB 1YKCA 1GSUA 2O7KA 1C72A 3EYTA 5D96A 2HSHA 4IVFA 1X9MB 1H4OA 2A4HA 5H5QA 4KSMA 4TKYA 1URMA 2GQMA 3HDCA 4JBBA 5F0GA 3FMWA 1K0CA 4F2IA 3HZ4A 4HJMA 2VL9A 4NWYA 2B7JA 1ILOA 3TOUA 4PQIA 3G7YA 2V32A 3M8NA 2FWFA 3CRUA 3Q6OA 5J3RA 5C00A 4PNGA 4PGTA 4O7HA 3L9SA 4PTSA 3R3EA 4NHZA 2RLIA 3TKQA 1TXXA 3HVVA 4ECCA 4QL7A 2TRXA 3TRXA 3KH9A 1S3RA 3KGKA 3KTLA 3CTGA 4IKHA 4MA9A 1K3LA 4Q5FA 3TRPA 2X64A 4BL7B 3KTBA 2KUCA 1KNGA 2MYGA 3VFIA 2PU9C 3U6VA 5ECKB 5HFKA 3DIEA 3GN3A 4G2EA 4HS1A 4EIQA 1N8JA 3D4TA 5COHA 3ZVJD 2GZZA 4WBJA 4ML6A 2GT6A 1OAZA 4MF5A 2OBKA 4YQUA 2YWNA 3RPNA 4OO5A 2VM1A 5F06A 2JZSA 4K2XA 4BL7A 5GAPD 2HE3A 1V57A 4K8MA 4NPBA 1EGOA 4GRFA 4KE3A 3FYGA 2HXKA 9GSSA 1M0UA 6GSTA 2UZ8A 4MF7A 1GUMA 3IOSA 3QAVA 3BCKA 2L59A 2GQLA 3TB2A 2MMAA 3EWLA 1XCCA 1GSFA 2AAWA 4PNFA 1XWGA 2I4AA 4RI6A 1SJ6A 2DC5A 1WOUA 1V9WA 2RUEA 1T1VA 1HQOA 4TXOB 5IMCA 1GSSA 2H74A 2ZNMA 3GH9A 4KX4A 3ZVJA 2JACA 1SKRB 4ECJA 3GH6A 2JZTA 3HYPA 4FIWA 1TK0B 1YF1A 1YEXA 3TKRA 1ZCPA 2REMA 2CV4A 1ZYPA 3Q19A 1B9XC 2DKIA 4TRXA 4K9ZA 2DBCA 3DRNA 3ZFBA 4G0LA 1K0AA 2C0GA 3MYDA 3KMOA 4DSQA 4POMA 4KDUA 1YQ1A 2H1AA 5DALB 3GYKA 1VGLA 1PN9A 4PUFC 5E59A 4ZIJA 16GSA 2O89A 3P7XA 3IV4A 5FWGA 1B9YC 1S3CA 4HU9A 1XOBA 4NXIA 3LEFA 1ABAA 3MWHA 3QFBC 2PVOC 3I6AA 4XS4B 5D9VA 2FHEA 4Q5RA 1VF4A 4JRRA 4X4JA 5CYYA 4I8BA 2YZUA 4AJ7A 1M9BA 5DALA 2X8CA 3BJ5A 5AGYA 2H6YA 4E8EA 5DDLA 1Y6EA 1PX6A 1WRYA 4IQAA 4PUAA 3F4RA 2NTOA 2FWGA 2IFQB 3QFAC 3NIVA 2H19A 1QGVA 4IJ3A 2MMNA 2NPBA 1FOHA 4XS6A 3TGZA 1QUWA 1U88A 1F3AA 3F3RA 3GKNA 2L5LA 4POBA 4L8EA 3ZMKA 5IPGA 3QAGA 4EVMA 1XBSA 4MLYA 1GNEA 1AIUA 3HCZA 3EMPA 1ST9A 1MEKA 3LYKA 1AQXA 1XIYA 5IMVA 1S3AA 3APSA 1JZWA 2AJQB 3UBKA 6GSYA 2CAIA 1GLPA 3PINA 1BX9A 5G1KA 2P5RA 3M9KA 5INYA 1ZGNA 4KSOA 3KZQA 1FB0A 4DEJA 1TRWA 1E2YA 4EF0A 2O8VB 19GSA 1OE8A 3C1SA 1M3IA 3G7IA 2H30A 3HJOA 1T4ZA 4EXJA 1U3IA 17GSA 2JSYA 18GSA 3EINA 1GULA 3H79A 4RQXA 2A2SA 4F9ZA 1FVKA 1VF1A 2IPAA 1O7UA 4HDEA 4K0GA 2G0FA 4BVXB 3ERFA 3A2VA 3CBUA 4TOPA 5DAKA 4MZWA 4L5LA 5ENUA 4ZB8A 1M2DA 2VD1A 5LCZA 3WGEA 3P8WA 2GSQA 4ZL8A 3PGTA 4OD7A 4TR1B 2LRTA 1M2AA 2FA8A 1ON4A 3WT2A 4EKZA 2H71A 1PL2A 4MZCA 1ZZYA 3MNGA 4ZXGA 2H72A 4PX1A 1HYUA 1A2MA 3HA9A 1SK2A 5E4WA 5KOWA 1GSEA 3LQ7A 3IDVA 2MBTA 2VO4A 3ZREA 1JLVA 2B6MA 2YPMA 1K0NA 3CSIA 1J08A 5DCHA 2QKEA 4TR1A 5ID2A 4KA0A 3LXZA 1KTEA 2EC4A 3IAM2 1EEMA 5FT3A 2X8HA 4FO5A 1TRSA 3N5OA 1SD8A 3BOAA 3HVNA 3DVWA 5LNKe 2LTKA 1XFLA 1WJKA 3KXOA 3C8EA 4OCFA 5KN3A 1PKZA 2XBQA 4JEDA 5CRDA 5JWQB 3ERWA 4EO3A 4MH2A 1JZDA 1GUHA 5CNWA 1QFNA 3BBYA 1GNWA 5F07A 2WJUA 2CAQA 3M0FA 3M1GA 5F05A 1NM3A 1I9DA 22GSA 2VLUA 5L71A 2H76A 4G10A 4Q5QA 6GSUA 4EC0A 2WCIA 1OC9A 4WF5A 2E0QA 1F6MC 4Z2UA 2DIYA 1PRXA 2KP2A 3FK8A 2YP6A 2HRKA 5J4UA 3Q18A 2GLRA 1TU8A 2OE1A 4IELA 3VWXA 1JLWA 1LJRA 3H4KA 4N0VA 4IW9A 2M80A 1DSBA 2PUKC 4TXVA 1SL2B 5IO0A 3TJBA 4O92A 1PFOA 2WB9A 5F8BA 2XPEA 3PR8A 4G9HA 1K3OA 3KP9A 3TUEA 3IE3A 3CQFA 1WIKA 5A4WA 1M99A 1A24A 1WWJA 2FUG2 2LV3A 2GSRA 2LJRA 4O5QA 5ECRB 1G6WA 2VOCA 4MMMA 4KDXA 1NHYA 1HNCA 4G19A 1PQNA 1X5EA 4IHUA 4HUAA 2IL3A 1WE0A 3K8NA 1AC1A 3D0ZA 1G7OA 3UL3A 2L4CA 1ZMAA 4GQCA 3GTUB 2LQQA 3GX0A 2NBSA 4ISDA 4EDZA 4MPFA 3UBLA 2KHPA 5IMAA 4GSTA 2LNTA 2BJXA 2G2QA 2R3XA 3KJYA 4X43A 2CX3A 3FZ4A 2MMZA 3H93A 4FH8A 1Z6MA 3U5RE 5G30A 5KN0A 2RIIA 5CO3A 4O5RA 1TU7A 4KUNA 5BMUA 1EOHA 3GTUA 7GSSA 2HRNA 3ZLPA 2QSIA 3OR5A 2I9HA 3DGQA 1RK4A 4GSSA 1DUGA 5JCGA 2V6OA 3ZL5A 3GMFA 2FNOA 3M9JA 1M2BA 3UOMA 3APOA 2OBIA 3GHAA 5B6NA 4XS1A 2F51A 4ULXA 4ZILA 2LRCA 4L0UA 2C3QA 2WULA 1EP8A 2FLSA 2CA8A 3QDNA 3TKSC 2YN1A 2F3MA 1V2AA 4LL4B 3HKRA 5DJMA 3QCPA 2ZCTA 1R26A 3NZNA 1Z5YE 2GSTA 1G7EA 2ES7A 1I5GA 2GZPA 5DBQA 3LXTA 1R7HA 3EPTA 2LEGA 1PN0A 1THOA 4PXOA 2K18A 3BCIA 3IHGA 3BD2A 5B8BA 4V2NA 3Q74A 2LRNA 3QAWA 4I5QA 2YNXA 4KDYA 3TCOA 2H1DA 2HI7A 3LFLA 3N9JA 2PBJA 2A2RA 2FWHA 3TKSE 5J41A 3FW2A 2LJAA 3DWVA 2YV7A 1EP7A 2KLXA 3DD3A 3KH7A 4DSSB 1SK1A 5AISA 4FYBA 3ED3A 5ECSA 2LKUA 2AB6A 2PPTA 1M3JA 3EU4A 1SYXA 5G31A 1V98A 5IPHA 3QR6A 4NV2A 3CRTA 1KEBA 2VIMA 1TK5B 5JWOB 5EVOA 3O6TA 3ZTLA 2H0IA 3QD9A 3LYPA 1HNBA 1EEJA 3M3MA 1BG5A 3GKMA 1FO5A 5A5KA 1X0RA 3GA4A 5CP1A 1SJZA 2H1BA 4DSSA 3QPMA 2ALBA 1SL1B 5IOWA 5AN1A 2VLTA 1AQWA 4TXOA 1OKTA 3EMXA 2BMXA 3RAZA 1OC3A 2KP1A 3UJ1A 2DJ1A 4TW5A 2IN3A 2X4AA 3HHVA 4KAEA 5EY6A 3LG6A 4GTUA 1B48A 5GZZB 3KCMA 2JU5A 2DIZA 3I9V2 4O5UA 5IQYA 1TKDB 1UN2A 1YJ6A 5A4UA 3CSJA 1F3BA 3L9VA 2VLVA 3IBHA 4J2FA 5ECIB 3IHQA 1AAZA 2C8UA 5J9CA 1BJXA 1A0FA 3LSZA 2CVKA 3MAKA 4K7OA 3KM6A 2M46A 2K8VA 4USSA 2CX4A 1XW6A 4X0XA 5IMZA 4BWQA 4GSNA 3L78A 2C1YA 5CRGA 2J23A 5B6MA 4FYUA 4K1FA 3F4TA 2WDUA 4CW9A 1G6YA 1BEDA 1OYJA 2IMFA 5HR2A 2WS2A 5GAND 1ZYQB 4XS4A 3CXGA 2TIRA 4AGSA 1NHOA 4L0WA 4KH7A 2WRTA 2E2GA 4MK3A 4POKA 1O8WA 2WGRA 4KW6A 2ON7A 2V6KA 2HFDA 4JR4A 2F8AA 1OC8A 2R6KA 3TKSA 2GS3A 3D22A 3F4SA 3ZZXA 3FY7A 2GGTA 3LWAA 2B5YA 3JCML 2AUVA 4XRDA 4YKFA 3GIXA 4I97A 13GSA 2YJHA 4QL9A 4HI7A 5HFGA 3L9UA 2B1LA 2B7KA 1FVJA 2NDOA 3TDGA 2IFQA 1K0OA 2HZEB 2P0GA 4Z7XA 4F82A 3CYNA 1RQMA 3FR3A 4ECIA 1JFUA 3D21A 3GFKA 3VI5A 4IN0A 1PL1A 3GSTA 4ACSA 4POLA 3UVHA 2JZRA 3TJFA 3W6GA 4F03A 2PWJA 3FHKA 2DKHA 4MJCA 4LA1A 2HZEA 3UARA 1ZYNA 1XVQA 1AW9A 1F37A 2I3YA 2HRAA 4N10A 1R4WA 2KOKA 5ELGA 2IMDA 3E3EA 2CVBA 4N11A 2V1MA 3UEMA 1J0FA 2YJ7A 5H5RA 1FOVA 4MABA 1EV9A 1J9BA 3LJRA 2N5BA 5CRHA 1E6BA 3EURA 1GSQA 1YF0A 2YWOA 3EVIA 2TRCP 2DMMA 4V2LA 4BWSA 1OKDA 4YQMA 4X1UA 1W89A 3S9FA 3VWWA 5ECPB 2E2MA 5AIVA 2ZUPA 1K0DA 2BTOT 4KCAA 2X99A 2DSAA 1TRUA 1SJIA 4HZ4A 1SYRA 3UIWA 4BVXA 1PX7A 4EIPA 10GSA 4EL1A 4HJ2A 5HR1A 2R2JA 2CQ9A 2V2GA 2HZFA 2QC7A 3FRCA 2K6VA 4N0ZA 3DYRA 1UA5A 5ELAA 4ZBAA 4LMWA 1TDIA 4MZBA 3ME7A 2DLXA 3TRQA 3RBTA 4ML1A 2R37A 3CMIA 5CRWA 4GCIA 4HU7A 2DMLA 2OE0A 1LU4A 4AF2A 2R0GA 3DMLA 4I2UA 5JCUA 1V58A 2VCTA 2FY6A 3WT1A 4V1Ap 3DVXA 1GTIA 2N5FA 2QA1A 2CZ3A 2OA7A 3KP8A 4O32A 3F3QA 3VK9A 3MSZA 4YKGA 1KBNA 4XTSA 1A2JA 4KNDA 4CDOA 4DSRA 3IR4A 4JZQA 1EOGA 1B4PA 1XWCA 5DJLA 1OVNA 4OO4A 3ERGA 2R5GA 2PMTA 3QOUA 4IQ1A 3CTFA 5ECOB 5B7CA 3ZYWA 3VURA 2OACA 4OCEA 2OJLA 2GDRA 1XW5A 3D6IA 1WMJA 6GSVA 4MJAA 1GTUA 4K7IA 1SL0B 4MH3A 4DVCA 4GF0A 1ERVA 1A23A 1TTZA 2FD3A 3MDKA 2R0PA 1H75A 3IK9A 4OMVA 3KEBA 1GSYA 1T3BA 1EZKA 1SKSB 3ZIVA 4J57E 2HSMA 1GTAA 5CREA 3A5IA 4JR6A 3H1NA 1MDJA 3DKSA 3E9JB 2X8GA 1T7PB 1GLQA 4TN8A 4BA7A 1Z9HA 2LSTA 1TOFA 1GUKA 4EUYA 4ZB9A 1A8YA 3C1RA 2H8LA 1TI3A 2LNSA 3GSSA 2H6ZA 3TJGA 3P90A 3KMNA 5B8AA 3W8SA 4F0BA 4HQZA 4YH2A 1HD2A 3P2AA 3F63A 5D9TA 4AJ8A 3VI7A
chains in the Genus database with same CATH topology
4OFMA 2EIRA 2R0CA 2RM5A 4RI7A 2HYXA 11GSA 1AQVA 1ERTA 2C0FA 4H86A 5HQPA 3HJPA 5HR3A 4IGJA 4ZL9A 3RHCA 4MJEA 4XIHA 2LUSA 1NSWA 4TR3A 20GSA 3VWUA 2HLSA 2H6XA 2DJJA 2L57A 1JHBA 3C7MA 1VF2A 3HXSA 2F9SA 3D5JA 3WD6A 1SKWB 3IK7A 4NAXA 5ECHB 2VCQA 1Z7PA 2AHEA 4KF9A 1FAAA 2H1GA 3EE2A 3E0UA 4Q5NA 3KD0A 3A2XA 4K0NA 3WGDA 3DEXA 5C04A 2VUPA 3ZRDA 1GSDA 3KIJA 1YKAA 2JSZA 1ERUA 4MF6A 4IJIA 2O85A 2L5OA 3IXRA 4CY6A 4KB3A 1K3YA 4LLRA 2OKAA 2AYTA 4A5PA 4IP6A 3ZFLA 3RDWA 4YQVA 1PMTA 4KGIA 2H70A 4OWYA 4BVYB 4MJBA 1ML6A 1MD4A 5J9BA 1T8EB 2H0HA 4WBRD 4G0KA 4WXTA 3VPTA 5GSSA 3F6FA 3IRAA 2HSYA 2E7PA 2WFCA 2IMEA 3DXBA 4MNNA 3PH9A 5D93A 1FG4A 8GSSA 1Z7RA 1QK8A 2I81A 3RPPA 1O81A 2V41A 3SWLA 5D9WA 1MDKA 4OFNA 4BVYA 1FB6A 4IP1A 2JADA 1TJDA 1ZL9A 2PGTA 3LW9A 1BYEA 3TOTA 1U6TA 5CAXA 3GNJA 1CQHA 3I69A 1DBYA 3GKXA 2IWTA 2DJKA 4WF4A 1U87A 2GTUA 1X5DA 1XWKA 2LS5A 2VL2C 5D73A 4L5OA 2H01A 1EV4A 1B4QA 3C71A 5DVBA 2IMIA 4FYCA 2YV9A 2RUFA 3TJJA 4IS0A 12GSA 3O76A 4F0CA 2DJ0A 1FW1A 2O87A 4LMVA 4GLTA 4MPGA 4K5SA 1DE2A 4N30A 4WR5A 5D8IA 2CVDA 1V40A 3G9BA 1XVWA 1MDIA 1K0MA 5JCWA 1EWXA 1Z3EA 4K2DA 1TI1A 3FR9A 2J9HA 2XBIA 3WYWA 5JWRB 2B5EA 4NMUA 3W8JA 2EIOA 4XHMA 3V1WA 4E8HA 1O85A 5IM9A 4V1Ag 4BPYA 1GTBA 1BQ7A 2A2PA 3F9UA 2VM2A 1XZOA 2LJKA 1ZOFA 3HZ8A 2RM6A 2VL3A 4WKWA 1DE1A 3HVSA 1HNAA 1YZXA 4NHWA 14GSA 1EGRA 4ZBDA 2YCDA 1Y25A 4G0IA 3GKKA 1K0BA 1QMVA 2C0DA 2MMOA 1SK0A 5AIXA 1XPVA 1JZOA 4ID0A 1WP0A 2YWIA 3IC8A 1RW1A 4NV5A 4TR0A 2ON5A 4P3YB 4CY8A 1R5AA 4K5RA 5IMFA 1ZYEA 3HJMA 2GT5A 2YZHA 1A8LA 4HOJA 1PGTA 2C3TA 4GWRA 4Z2RA 4FQUA 3ME8A 4JU5A 1T4YA 4GXZA 3F8UA 1SD9A 2PVQA 2X49A 2L4QA 1XXUA 2QGVA 4ILFA 2VCXA 3FZ5A 3R2QA 2PERA 3LGCA 2C80A 1JZRA 1XW9A 3SBCA 3F6DA 2MZCA 3J7Yk 2DJ3A 2VD0A 2B5XA 2LQOA 2L6CA 1X9WB 4EE0A 4HEA2 2JL4A 1T00A 1F9MA 4K6XA 1TK8B 2IMKA 4ICYA 2GQKA 2HRFA 4HZ2A 1U3AA 4I6XA 1SU9A 4WEYA 4I2TA 5KN2A 1TP9A 3FKFA 2XPDA 5G5FA 5HFIA 3FEUA 3LORA 4Z2TA 3UMAA 3ZITA 1BAYA 2FWEA 3O3TA 1TRVA 5ECQB 5DAKB 3IA1A 1VF3A 3L0HA 2B3SA 3AY8A 5DQSA 3QMXA 2CT6A 2VL2A 3J7Yb 5G2ZA 2C3NA 3FZ9A 3UAPA 4OFTA 1ACVA 1A0RP 1YEPA 3ZMLA 1X5CA 2IIYA 3GX8A 2K8SA 5BRTA 3NOFA 1PA3A 3A3TA 1G0TA 3EC3A 3F0IA 4YAVA 1M7TA 1QXHA 3ZIJA 2MBSA 1AUCA 2YOIA 2H0GA 5G5EA 5DQYA 3TKPA 1O8XA 2AV4A 3UVTA 5ID2B 1CQGA 2YANA 2OE3A 3GUSA 1TW9A 4QQ7A 1R5PA 1LBKA 3I43A 1PKWA 5D9XA 2FA4A 1OE7A 4ZBBA 3HVXA 4J56E 6GSSA 3APQA 4JE1A 1M9AA 4TVEA 5J5NA 3VLNA 1A2LA 2OADA 4IBPA 2N5AA 2F8FA 3ISOA 2NVLA 5HR0A 1PSQA 4EDYA 4GQFA 5G1LA 4TR4A 2VCWA 2GVPA 1XOAA 4CHSA 1GP1A 3A5WA 4D73B 3G7JA 4XRAA 1FHEA 5DCGA 2H75A 4AJ6A 1QQ2A 1MTCA 2IJYA 2M72A 3FZAA 2HNLA 1PD21 4PQHA 1GRXA 2K9FA 5H5SA 1Q98A 1GWCA 1F2EA 4YAPA 2P31A 3US3A 1OC9B 1THXA 1XWAA 4MDCA 2CZ2A 3HY2A 1USBA 3GRXA 3A2WA 2GSSA 2H66A 3RHBA 5KN1A 2FCHA 3EU3A 4ZL7A 1O73A 4RQRA 4PURA 2YWMA 2GZYA 3GV1A 3PPUA 3L4NA 2VCVA 4MP4A 4D73A 3GURA 6GSXA 1UC7A 1B8XA 3IC4A 3C73A 1X9SB 5ECLB 2D2ZA 2C4JA 1AXDA 5IO2A 1N2AA 2DJ2A 2I1UA 4KCEA 4V2MA 3D4MA 2EIQA 4RUVA 2A4VA 1Q4JA 5EL8A 2L6DA 5KOXA 1S3DA 2Z9SA 4ECBA 5KEJA 1Z6NA 1WPIA 2R4VA 3GL5A 2XC2A 3VWVA 4WR4A 1SENA 5EPFA 4LL1B 1YDKA 3TJKA 2WZ9A 1NW2A 2QA2A 5IMDA 5ABRA 4PQ1A 4ZB6A 4XCSA 5FHIA 5A4VA 1YY7A 2C0EA 2B1KA 6GSWA 3HD5A 2HT9A 1O6JA 3IAS2 1IYIA 2VAFA 5IIZA 5GSTA 2P5QA 1XWBA 2VCZA 2H73A 5IOXA 1GL8A 2FGXA 2XHFA 1UVZA 4K7NA 4WETA 3H8QA 5ECMB 1W4VA 1GH2A 3IPZA 3CSHA 1VRSD 3FR6A 1IYHA 3WGXA 3GL3A 1ERWA 5LD0A 3MIXA 3VPQA 4HQSA 2PN8A 4MCUA 1MD3A 5ECNB 1YKCA 1GSUA 2O7KA 1C72A 3EYTA 5D96A 2HSHA 4IVFA 1X9MB 1H4OA 2A4HA 5H5QA 4KSMA 4TKYA 1URMA 2GQMA 3HDCA 4JBBA 5F0GA 3FMWA 1K0CA 4F2IA 3HZ4A 4HJMA 2VL9A 4NWYA 2B7JA 1ILOA 3TOUA 4PQIA 3G7YA 2V32A 3M8NA 2FWFA 3CRUA 3Q6OA 5J3RA 5C00A 4PNGA 4PGTA 4O7HA 3L9SA 4PTSA 3R3EA 4NHZA 2RLIA 3TKQA 1TXXA 3HVVA 4ECCA 4QL7A 2TRXA 3TRXA 3KH9A 3KGKA 3KTLA 3CTGA 4IKHA 4MA9A 1K3LA 4Q5FA 3TRPA 2X64A 4BL7B 3KTBA 2KUCA 1KNGA 2MYGA 3VFIA 2PU9C 3U6VA 5ECKB 5HFKA 3DIEA 3GN3A 4G2EA 4HS1A 4EIQA 1N8JA 3D4TA 5COHA 3ZVJD 2GZZA 4WBJA 4ML6A 2GT6A 1OAZA 4MF5A 2OBKA 4YQUA 2YWNA 3RPNA 4OO5A 2VM1A 5F06A 2JZSA 4K2XA 4BL7A 5GAPD 2HE3A 1V57A 4K8MA 4NPBA 1EGOA 4GRFA 4KE3A 3FYGA 2HXKA 9GSSA 1M0UA 6GSTA 2UZ8A 4MF7A 1GUMA 3IOSA 3QAVA 3BCKA 2L59A 2GQLA 3TB2A 2MMAA 3EWLA 1XCCA 1GSFA 2AAWA 4PNFA 1XWGA 2I4AA 4RI6A 1SJ6A 2DC5A 1WOUA 1V9WA 2RUEA 1T1VA 1HQOA 4TXOB 5IMCA 1GSSA 2H74A 2ZNMA 3GH9A 4KX4A 3ZVJA 2JACA 1SKRB 4ECJA 3GH6A 2JZTA 3HYPA 4FIWA 1TK0B 1YF1A 1YEXA 3TKRA 1ZCPA 2REMA 2CV4A 1ZYPA 3Q19A 1B9XC 2DKIA 4TRXA 4K9ZA 2DBCA 3DRNA 3ZFBA 4G0LA 1K0AA 2C0GA 3MYDA 3KMOA 4DSQA 4POMA 4KDUA 1YQ1A 2H1AA 5DALB 3GYKA 1VGLA 1PN9A 4PUFC 5E59A 4ZIJA 16GSA 2O89A 3P7XA 3IV4A 5FWGA 1B9YC 1S3CA 4HU9A 1XOBA 4NXIA 3LEFA 1ABAA 3MWHA 3QFBC 2PVOC 3I6AA 4XS4B 5D9VA 2FHEA 4Q5RA 1VF4A 4JRRA 4X4JA 5CYYA 4I8BA 2YZUA 4AJ7A 1M9BA 5DALA 2X8CA 3BJ5A 5AGYA 2H6YA 4E8EA 5DDLA 1Y6EA 1PX6A 1WRYA 4IQAA 4PUAA 3F4RA 2NTOA 2FWGA 2IFQB 3QFAC 3NIVA 2H19A 1QGVA 4IJ3A 2MMNA 2NPBA 1FOHA 4XS6A 3TGZA 1QUWA 1U88A 1F3AA 3F3RA 3GKNA 2L5LA 4POBA 4L8EA 3ZMKA 5IPGA 3QAGA 4EVMA 1XBSA 4MLYA 1GNEA 1AIUA 3HCZA 3EMPA 1ST9A 1MEKA 3LYKA 1AQXA 1XIYA 5IMVA 1S3AA 3APSA 1JZWA 2AJQB 3UBKA 6GSYA 2CAIA 1GLPA 3PINA 1BX9A 5G1KA 2P5RA 3M9KA 5INYA 1ZGNA 4KSOA 3KZQA 1FB0A 4DEJA 1TRWA 1E2YA 4EF0A 2O8VB 19GSA 1OE8A 3C1SA 3G7IA 2H30A 3HJOA 1T4ZA 4EXJA 1U3IA 17GSA 2JSYA 18GSA 3EINA 1GULA 3H79A 4RQXA 2A2SA 4F9ZA 1FVKA 1VF1A 2IPAA 1O7UA 4HDEA 4K0GA 2G0FA 4BVXB 3ERFA 3A2VA 3CBUA 4TOPA 5DAKA 4MZWA 4L5LA 5ENUA 4ZB8A 1M2DA 2VD1A 5LCZA 3WGEA 3P8WA 2GSQA 4ZL8A 3PGTA 4OD7A 4TR1B 2LRTA 1M2AA 2FA8A 1ON4A 3WT2A 4EKZA 2H71A 1PL2A 4MZCA 1ZZYA 3MNGA 4ZXGA 2H72A 4PX1A 1HYUA 1A2MA 3HA9A 1SK2A 5E4WA 5KOWA 1GSEA 3LQ7A 3IDVA 2MBTA 2VO4A 3ZREA 1JLVA 2B6MA 2YPMA 1K0NA 3CSIA 1J08A 5DCHA 2QKEA 4TR1A 5ID2A 4KA0A 3LXZA 1KTEA 2EC4A 3IAM2 1EEMA 5FT3A 2X8HA 4FO5A 1TRSA 3N5OA 1SD8A 3BOAA 3DVWA 5LNKe 2LTKA 1XFLA 1WJKA 3KXOA 3C8EA 4OCFA 5KN3A 1PKZA 2XBQA 4JEDA 5CRDA 5JWQB 3ERWA 4EO3A 4MH2A 1JZDA 1GUHA 5CNWA 1QFNA 3BBYA 1GNWA 5F07A 2WJUA 2CAQA 3M0FA 3M1GA 5F05A 1NM3A 1I9DA 22GSA 2VLUA 5L71A 2H76A 4G10A 4Q5QA 6GSUA 4EC0A 2WCIA 1OC9A 4WF5A 2E0QA 1F6MC 4Z2UA 2DIYA 1PRXA 2KP2A 3FK8A 2YP6A 2HRKA 5J4UA 3Q18A 2GLRA 1TU8A 2OE1A 4IELA 3VWXA 1JLWA 1LJRA 3H4KA 4N0VA 4IW9A 2M80A 1DSBA 2PUKC 4TXVA 1SL2B 5IO0A 3TJBA 4O92A 2WB9A 5F8BA 2XPEA 3PR8A 4G9HA 1K3OA 3KP9A 3TUEA 3IE3A 1WIKA 5A4WA 1M99A 1A24A 1WWJA 2FUG2 2LV3A 2GSRA 2LJRA 4O5QA 5ECRB 1G6WA 2VOCA 4MMMA 4KDXA 1NHYA 1HNCA 4G19A 1PQNA 1X5EA 4IHUA 4HUAA 2IL3A 1WE0A 3K8NA 1AC1A 3D0ZA 1G7OA 3UL3A 2L4CA 1ZMAA 4GQCA 3GTUB 2LQQA 3GX0A 2NBSA 4ISDA 4EDZA 4MPFA 3UBLA 2KHPA 5IMAA 4GSTA 2LNTA 2BJXA 2G2QA 2R3XA 3KJYA 4X43A 2CX3A 3FZ4A 2MMZA 3H93A 4FH8A 1Z6MA 3U5RE 5G30A 5KN0A 2RIIA 5CO3A 4O5RA 1TU7A 4KUNA 5BMUA 1EOHA 3GTUA 7GSSA 2HRNA 3ZLPA 2QSIA 3OR5A 2I9HA 3DGQA 1RK4A 4GSSA 1DUGA 5JCGA 2V6OA 3ZL5A 3GMFA 2FNOA 3M9JA 1M2BA 3UOMA 3APOA 2OBIA 3GHAA 5B6NA 4XS1A 2F51A 4ULXA 4ZILA 2LRCA 4L0UA 2C3QA 2WULA 1EP8A 2FLSA 2CA8A 3QDNA 3TKSC 2YN1A 2F3MA 1V2AA 4LL4B 3HKRA 5DJMA 3QCPA 2ZCTA 1R26A 3NZNA 1Z5YE 2GSTA 1G7EA 2ES7A 1I5GA 2GZPA 5DBQA 3LXTA 1R7HA 3EPTA 2LEGA 1PN0A 1THOA 4PXOA 2K18A 3BCIA 3IHGA 3BD2A 5B8BA 4V2NA 3Q74A 2LRNA 3QAWA 4I5QA 2YNXA 4KDYA 3TCOA 2H1DA 2HI7A 3LFLA 3N9JA 2PBJA 2A2RA 2FWHA 3TKSE 5J41A 3FW2A 2LJAA 3DWVA 2YV7A 1EP7A 2KLXA 3DD3A 3KH7A 4DSSB 1SK1A 5AISA 4FYBA 3ED3A 5ECSA 2LKUA 2AB6A 2PPTA 3EU4A 1SYXA 5G31A 1V98A 5IPHA 3QR6A 4NV2A 3CRTA 1KEBA 2VIMA 1TK5B 5JWOB 5EVOA 3O6TA 3ZTLA 2H0IA 3QD9A 3LYPA 1HNBA 1EEJA 3M3MA 1BG5A 3GKMA 1FO5A 5A5KA 1X0RA 3GA4A 5CP1A 1SJZA 2H1BA 4DSSA 3QPMA 2ALBA 1SL1B 5IOWA 5AN1A 2VLTA 1AQWA 4TXOA 1OKTA 3EMXA 2BMXA 3RAZA 1OC3A 2KP1A 3UJ1A 2DJ1A 4TW5A 2IN3A 2X4AA 3HHVA 4KAEA 5EY6A 3LG6A 4GTUA 1B48A 5GZZB 3KCMA 2JU5A 2DIZA 3I9V2 4O5UA 5IQYA 1TKDB 1UN2A 1YJ6A 5A4UA 3CSJA 1F3BA 3L9VA 2VLVA 3IBHA 4J2FA 5ECIB 3IHQA 1AAZA 2C8UA 5J9CA 1BJXA 1A0FA 3LSZA 2CVKA 3MAKA 4K7OA 3KM6A 2M46A 2K8VA 4USSA 2CX4A 1XW6A 4X0XA 5IMZA 4BWQA 4GSNA 3L78A 2C1YA 5CRGA 2J23A 5B6MA 4FYUA 4K1FA 3F4TA 2WDUA 4CW9A 1G6YA 1BEDA 1OYJA 2IMFA 5HR2A 2WS2A 5GAND 1ZYQB 4XS4A 3CXGA 2TIRA 4AGSA 1NHOA 4L0WA 4KH7A 2WRTA 2E2GA 4MK3A 4POKA 1O8WA 2WGRA 4KW6A 2ON7A 2V6KA 2HFDA 4JR4A 2F8AA 1OC8A 2R6KA 3TKSA 2GS3A 3D22A 3F4SA 3ZZXA 3FY7A 2GGTA 3LWAA 2B5YA 3JCML 2AUVA 4XRDA 4YKFA 3GIXA 4I97A 13GSA 2YJHA 4QL9A 4HI7A 5HFGA 3L9UA 2B1LA 2B7KA 1FVJA 2NDOA 3TDGA 2IFQA 1K0OA 2HZEB 2P0GA 4Z7XA 4F82A 3CYNA 1RQMA 3FR3A 4ECIA 1JFUA 3D21A 3GFKA 3VI5A 4IN0A 1PL1A 3GSTA 4ACSA 4POLA 3UVHA 2JZRA 3TJFA 3W6GA 4F03A 2PWJA 3FHKA 2DKHA 4MJCA 4LA1A 2HZEA 3UARA 1ZYNA 1XVQA 1AW9A 1F37A 2I3YA 2HRAA 4N10A 1R4WA 2KOKA 5ELGA 2IMDA 3E3EA 2CVBA 4N11A 2V1MA 3UEMA 1J0FA 2YJ7A 5H5RA 1FOVA 4MABA 1EV9A 1J9BA 3LJRA 2N5BA 5CRHA 1E6BA 3EURA 1GSQA 1YF0A 2YWOA 3EVIA 2TRCP 2DMMA 4V2LA 4BWSA 1OKDA 4YQMA 4X1UA 1W89A 3S9FA 3VWWA 5ECPB 2E2MA 5AIVA 2ZUPA 1K0DA 2BTOT 4KCAA 2X99A 2DSAA 1TRUA 1SJIA 4HZ4A 1SYRA 3UIWA 4BVXA 1PX7A 4EIPA 10GSA 4EL1A 4HJ2A 5HR1A 2R2JA 2CQ9A 2V2GA 2HZFA 2QC7A 3FRCA 2K6VA 4N0ZA 3DYRA 1UA5A 5ELAA 4ZBAA 4LMWA 1TDIA 4MZBA 3ME7A 2DLXA 3TRQA 3RBTA 4ML1A 2R37A 3CMIA 5CRWA 4GCIA 4HU7A 2DMLA 2OE0A 1LU4A 4AF2A 2R0GA 3DMLA 4I2UA 5JCUA 1V58A 2VCTA 2FY6A 3WT1A 4V1Ap 3DVXA 1GTIA 2N5FA 2QA1A 2CZ3A 2OA7A 3KP8A 4O32A 3F3QA 3VK9A 3MSZA 4YKGA 1KBNA 4XTSA 1A2JA 4KNDA 4CDOA 4DSRA 3IR4A 4JZQA 1EOGA 1B4PA 1XWCA 5DJLA 1OVNA 4OO4A 3ERGA 2R5GA 2PMTA 3QOUA 4IQ1A 3CTFA 5ECOB 5B7CA 3ZYWA 3VURA 2OACA 4OCEA 2OJLA 2GDRA 1XW5A 3D6IA 1WMJA 6GSVA 4MJAA 1GTUA 4K7IA 1SL0B 4MH3A 4DVCA 4GF0A 1ERVA 1A23A 1TTZA 2FD3A 3MDKA 2R0PA 1H75A 3IK9A 4OMVA 3KEBA 1GSYA 1T3BA 1EZKA 1SKSB 3ZIVA 4J57E 2HSMA 1GTAA 5CREA 3A5IA 4JR6A 3H1NA 1MDJA 3DKSA 3E9JB 2X8GA 1T7PB 1GLQA 4TN8A 4BA7A 1Z9HA 2LSTA 1TOFA 1GUKA 4EUYA 4ZB9A 1A8YA 3C1RA 2H8LA 1TI3A 2LNSA 3GSSA 2H6ZA 3TJGA 3P90A 3KMNA 5B8AA 3W8SA 4F0BA 4HQZA 4YH2A 1HD2A 3P2AA 3F63A 5D9TA 4AJ8A 3VI7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OFM A;  2EIR A;  2RM5 A;  4RI7 A;  2HYX A;  11GS A;  1AQV A;  1ERT A;  2C0F A;  4H86 A;  5HQP A;  3HJP A;  5HR3 A;  4IGJ A;  4ZL9 A;  3RHC A;  4MJE A;  4XIH A;  2LUS A;  1NSW A;  4TR3 A;  20GS A;  3VWU A;  2HLS A;  2H6X A;  2DJJ A;  2L57 A;  1JHB A;  3C7M A;  1VF2 A;  3HXS A;  2F9S A;  3D5J A;  3WD6 A;  1SKW B;  3IK7 A;  4NAX A;  5ECH B;  2VCQ A;  1Z7P A;  2AHE A;  1FAA A;  2H1G A;  3EE2 A;  3E0U A;  4Q5N A;  3KD0 A;  3A2X A;  4K0N A;  3WGD A;  3DEX A;  5C04 A;  2VUP A;  3ZRD A;  1GSD A;  3KIJ A;  1YKA A;  2JSZ A;  1ERU A;  4MF6 A;  4IJI A;  2O85 A;  2L5O A;  3IXR A;  4KB3 A;  1K3Y A;  4LLR A;  2OKA A;  2AYT A;  4IP6 A;  3ZFL A;  3RDW A;  4YQV A;  1PMT A;  4KGI A;  2H70 A;  4OWY A;  4MJB A;  1ML6 A;  1MD4 A;  5J9B A;  1T8E B;  2H0H A;  4WBR D;  4WXT A;  3VPT A;  5GSS A;  3F6F A;  3IRA A;  2HSY A;  2E7P A;  2WFC A;  2IME A;  3DXB A;  3PH9 A;  5D93 A;  1FG4 A;  8GSS A;  1Z7R A;  1QK8 A;  2I81 A;  3RPP A;  1O81 A;  2V41 A;  3SWL A;  5D9W A;  1MDK A;  4OFN A;  4BVY A;  1FB6 A;  4IP1 A;  2JAD A;  1TJD A;  1ZL9 A;  2PGT A;  1BYE A;  3TOT A;  1U6T A;  5CAX A;  3GNJ A;  1CQH A;  3I69 A;  1DBY A;  3GKX A;  2IWT A;  2DJK A;  4WF4 A;  1U87 A;  2GTU A;  1X5D A;  1XWK A;  2LS5 A;  2VL2 C;  5D73 A;  4L5O A;  2H01 A;  1EV4 A;  1B4Q A;  3C71 A;  5DVB A;  2IMI A;  4FYC A;  2YV9 A;  2RUF A;  3TJJ A;  4IS0 A;  12GS A;  3O76 A;  4F0C A;  2DJ0 A;  1FW1 A;  2O87 A;  4LMV A;  4GLT A;  4MPG A;  1DE2 A;  4N30 A;  4WR5 A;  5D8I A;  2CVD A;  1V40 A;  3G9B A;  1XVW A;  1MDI A;  1K0M A;  5JCW A;  1EWX A;  1Z3E A;  4K2D A;  1TI1 A;  3FR9 A;  2J9H A;  2XBI A;  3WYW A;  5JWR B;  2B5E A;  4NMU A;  3W8J A;  2EIO A;  4XHM A;  3V1W A;  4E8H A;  1O85 A;  5IM9 A;  4V1A g;  4BPY A;  1GTB A;  1BQ7 A;  3F9U A;  2VM2 A;  1XZO A;  2LJK A;  1ZOF A;  3HZ8 A;  2RM6 A;  2VL3 A;  4WKW A;  1DE1 A;  3HVS A;  1HNA A;  1YZX A;  4NHW A;  14GS A;  1EGR A;  4ZBD A;  2YCD A;  1Y25 A;  3GKK A;  1K0B A;  1QMV A;  2C0D A;  2MMO A;  1SK0 A;  5AIX A;  1XPV A;  1JZO A;  4ID0 A;  1WP0 A;  2YWI A;  1RW1 A;  4NV5 A;  4TR0 A;  2ON5 A;  4P3Y B;  1R5A A;  5IMF A;  1ZYE A;  3HJM A;  2GT5 A;  2YZH A;  1A8L A;  4HOJ A;  1PGT A;  2C3T A;  4GWR A;  3ME8 A;  4JU5 A;  1T4Y A;  4GXZ A;  3F8U A;  1SD9 A;  2PVQ A;  2L4Q A;  1XXU A;  2QGV A;  4ILF A;  2VCX A;  3FZ5 A;  3R2Q A;  2PER A;  3LGC A;  2C80 A;  1JZR A;  1XW9 A;  3SBC A;  3F6D A;  2MZC A;  3J7Y k;  2DJ3 A;  2VD0 A;  2B5X A;  2LQO A;  2L6C A;  1X9W B;  4EE0 A;  4HEA 2;  2JL4 A;  1T00 A;  1F9M A;  4K6X A;  1TK8 B;  2IMK A;  2GQK A;  2HRF A;  4HZ2 A;  1U3A A;  4I6X A;  1SU9 A;  4WEY A;  4I2T A;  5KN2 A;  1TP9 A;  3FKF A;  2XPD A;  5G5F A;  5HFI A;  3FEU A;  3LOR A;  3UMA A;  3ZIT A;  1BAY A;  2FWE A;  3O3T A;  1TRV A;  5ECQ B;  5DAK B;  3IA1 A;  1VF3 A;  3L0H A;  2B3S A;  3AY8 A;  5DQS A;  3QMX A;  2CT6 A;  2VL2 A;  3J7Y b;  5G2Z A;  2C3N A;  3FZ9 A;  3UAP A;  4OFT A;  1ACV A;  1A0R P;  1YEP A;  3ZML A;  1X5C A;  2IIY A;  3GX8 A;  2K8S A;  3NOF A;  1PA3 A;  3A3T A;  1G0T A;  3EC3 A;  3F0I A;  4YAV A;  1M7T A;  1QXH A;  3ZIJ A;  2MBS A;  1AUC A;  2YOI A;  2H0G A;  5G5E A;  5DQY A;  3TKP A;  1O8X A;  2AV4 A;  3UVT A;  5ID2 B;  1CQG A;  2YAN A;  2OE3 A;  3GUS A;  1TW9 A;  4QQ7 A;  1R5P A;  1LBK A;  3I43 A;  1PKW A;  5D9X A;  2FA4 A;  1OE7 A;  4ZBB A;  3HVX A;  4J56 E;  6GSS A;  3APQ A;  4JE1 A;  1M9A A;  4TVE A;  5J5N A;  3VLN A;  1A2L A;  2OAD A;  4IBP A;  2N5A A;  2F8F A;  3ISO A;  2NVL A;  5HR0 A;  1PSQ A;  4EDY A;  4GQF A;  5G1L A;  4TR4 A;  2VCW A;  2GVP A;  1XOA A;  4CHS A;  1GP1 A;  3A5W A;  4D73 B;  3G7J A;  4XRA A;  1FHE A;  5DCG A;  2H75 A;  4AJ6 A;  1QQ2 A;  1MTC A;  2IJY A;  2M72 A;  3FZA A;  2HNL A;  1PD2 1;  4PQH A;  1GRX A;  2K9F A;  5H5S A;  1Q98 A;  1GWC A;  1F2E A;  4YAP A;  2P31 A;  3US3 A;  1OC9 B;  1THX A;  1XWA A;  4MDC A;  2CZ2 A;  3HY2 A;  1USB A;  3GRX A;  3A2W A;  2GSS A;  2H66 A;  3RHB A;  5KN1 A;  2FCH A;  3EU3 A;  4ZL7 A;  1O73 A;  4RQR A;  4PUR A;  2YWM A;  2GZY A;  3GV1 A;  3L4N A;  2VCV A;  4MP4 A;  4D73 A;  3GUR A;  6GSX A;  1UC7 A;  1B8X A;  3IC4 A;  3C73 A;  1X9S B;  5ECL B;  2D2Z A;  2C4J A;  1AXD A;  5IO2 A;  1N2A A;  2DJ2 A;  2I1U A;  4KCE A;  4V2M A;  3D4M A;  2EIQ A;  4RUV A;  2A4V A;  1Q4J A;  5EL8 A;  2L6D A;  1S3D A;  2Z9S A;  4ECB A;  5KEJ A;  1Z6N A;  1WPI A;  2R4V A;  3GL5 A;  2XC2 A;  3VWV A;  4WR4 A;  1SEN A;  5EPF A;  4LL1 B;  1YDK A;  3TJK A;  2WZ9 A;  1NW2 A;  5IMD A;  5ABR A;  4PQ1 A;  4ZB6 A;  4XCS A;  5FHI A;  5A4V A;  1YY7 A;  2C0E A;  2B1K A;  6GSW A;  3HD5 A;  2HT9 A;  1O6J A;  3IAS 2;  1IYI A;  2VAF A;  5IIZ A;  5GST A;  2P5Q A;  1XWB A;  2VCZ A;  2H73 A;  5IOX A;  1GL8 A;  2FGX A;  2XHF A;  1UVZ A;  4K7N A;  4WET A;  3H8Q A;  5ECM B;  1W4V A;  1GH2 A;  3IPZ A;  3CSH A;  1VRS D;  3FR6 A;  1IYH A;  3WGX A;  3GL3 A;  1ERW A;  5LD0 A;  3VPQ A;  4HQS A;  2PN8 A;  4MCU A;  1MD3 A;  5ECN B;  1YKC A;  1GSU A;  2O7K A;  1C72 A;  3EYT A;  5D96 A;  2HSH A;  4IVF A;  1X9M B;  1H4O A;  5H5Q A;  4KSM A;  4TKY A;  1URM A;  2GQM A;  3HDC A;  4JBB A;  5F0G A;  1K0C A;  4F2I A;  3HZ4 A;  4HJM A;  2VL9 A;  4NWY A;  2B7J A;  1ILO A;  3TOU A;  4PQI A;  3G7Y A;  2V32 A;  3M8N A;  2FWF A;  3CRU A;  3Q6O A;  5J3R A;  5C00 A;  4PNG A;  4PGT A;  4O7H A;  3L9S A;  4NHZ A;  2RLI A;  3TKQ A;  1TXX A;  3HVV A;  4ECC A;  4QL7 A;  2TRX A;  3TRX A;  3KH9 A;  3KGK A;  3KTL A;  3CTG A;  4IKH A;  4MA9 A;  1K3L A;  4Q5F A;  3TRP A;  2X64 A;  3KTB A;  2KUC A;  1KNG A;  2MYG A;  3VFI A;  2PU9 C;  3U6V A;  5ECK B;  5HFK A;  3DIE A;  3GN3 A;  4G2E A;  4HS1 A;  1N8J A;  3D4T A;  5COH A;  3ZVJ D;  2GZZ A;  4WBJ A;  4ML6 A;  2GT6 A;  1OAZ A;  4MF5 A;  2OBK A;  4YQU A;  2YWN A;  3RPN A;  4OO5 A;  2VM1 A;  5F06 A;  2JZS A;  4BL7 A;  5GAP D;  2HE3 A;  1V57 A;  4K8M A;  4NPB A;  1EGO A;  4GRF A;  4KE3 A;  3FYG A;  2HXK A;  9GSS A;  1M0U A;  6GST A;  4MF7 A;  1GUM A;  3IOS A;  3QAV A;  3BCK A;  2L59 A;  2GQL A;  3TB2 A;  2MMA A;  3EWL A;  1XCC A;  1GSF A;  2AAW A;  4PNF A;  1XWG A;  2I4A A;  4RI6 A;  1SJ6 A;  2DC5 A;  1WOU A;  1V9W A;  2RUE A;  1T1V A;  1HQO A;  4TXO B;  5IMC A;  1GSS A;  2H74 A;  2ZNM A;  3GH9 A;  4KX4 A;  3ZVJ A;  2JAC A;  1SKR B;  4ECJ A;  3GH6 A;  2JZT A;  3HYP A;  4FIW A;  1TK0 B;  1YF1 A;  1YEX A;  3TKR A;  1ZCP A;  2REM A;  2CV4 A;  3Q19 A;  1B9X C;  4TRX A;  4K9Z A;  2DBC A;  3DRN A;  3ZFB A;  1K0A A;  2C0G A;  3KMO A;  4DSQ A;  4POM A;  4KDU A;  1YQ1 A;  2H1A A;  5DAL B;  3GYK A;  1VGL A;  1PN9 A;  4PUF C;  5E59 A;  4ZIJ A;  16GS A;  2O89 A;  3P7X A;  3IV4 A;  5FWG A;  1B9Y C;  1S3C A;  4HU9 A;  1XOB A;  4NXI A;  3LEF A;  1ABA A;  3MWH A;  3QFB C;  2PVO C;  3I6A A;  4XS4 B;  5D9V A;  2FHE A;  4Q5R A;  1VF4 A;  4JRR A;  5CYY A;  4I8B A;  2YZU A;  4AJ7 A;  1M9B A;  5DAL A;  2X8C A;  3BJ5 A;  5AGY A;  2H6Y A;  4E8E A;  5DDL A;  1Y6E A;  1PX6 A;  1WRY A;  4IQA A;  4PUA A;  3F4R A;  2NTO A;  2FWG A;  2IFQ B;  3QFA C;  3NIV A;  2H19 A;  1QGV A;  4IJ3 A;  2MMN A;  2NPB A;  4XS6 A;  3TGZ A;  1QUW A;  1U88 A;  1F3A A;  3F3R A;  3GKN A;  2L5L A;  4POB A;  4L8E A;  3ZMK A;  5IPG A;  3QAG A;  4EVM A;  1XBS A;  4MLY A;  1GNE A;  1AIU A;  3HCZ A;  3EMP A;  1ST9 A;  1MEK A;  3LYK A;  1AQX A;  1XIY A;  5IMV A;  1S3A A;  3APS A;  1JZW A;  2AJQ B;  3UBK A;  6GSY A;  2CAI A;  1GLP A;  3PIN A;  1BX9 A;  5G1K A;  2P5R A;  3M9K A;  5INY A;  1ZGN A;  4KSO A;  3KZQ A;  1FB0 A;  4DEJ A;  1TRW A;  1E2Y A;  4EF0 A;  2O8V B;  19GS A;  1OE8 A;  3C1S A;  3G7I A;  2H30 A;  3HJO A;  1T4Z A;  4EXJ A;  1U3I A;  17GS A;  2JSY A;  18GS A;  3EIN A;  1GUL A;  3H79 A;  4RQX A;  2A2S A;  4F9Z A;  1FVK A;  1VF1 A;  2IPA A;  1O7U A;  4HDE A;  4K0G A;  2G0F A;  3ERF A;  3A2V A;  3CBU A;  4TOP A;  5DAK A;  4MZW A;  4L5L A;  5ENU A;  4ZB8 A;  1M2D A;  2VD1 A;  5LCZ A;  3WGE A;  3P8W A;  2GSQ A;  4ZL8 A;  3PGT A;  4OD7 A;  4TR1 B;  2LRT A;  1M2A A;  2FA8 A;  1ON4 A;  3WT2 A;  4EKZ A;  2H71 A;  1PL2 A;  4MZC A;  1ZZY A;  3MNG A;  4ZXG A;  2H72 A;  4PX1 A;  1HYU A;  1A2M A;  3HA9 A;  1SK2 A;  5E4W A;  1GSE A;  3LQ7 A;  3IDV A;  2MBT A;  2VO4 A;  3ZRE A;  1JLV A;  2B6M A;  2YPM A;  1K0N A;  3CSI A;  1J08 A;  5DCH A;  2QKE A;  4TR1 A;  5ID2 A;  4KA0 A;  3LXZ A;  1KTE A;  2EC4 A;  3IAM 2;  1EEM A;  5FT3 A;  2X8H A;  4FO5 A;  1TRS A;  3N5O A;  1SD8 A;  3BOA A;  3DVW A;  5LNK e;  2LTK A;  1XFL A;  1WJK A;  3KXO A;  3C8E A;  4OCF A;  5KN3 A;  1PKZ A;  2XBQ A;  4JED A;  5CRD A;  5JWQ B;  3ERW A;  4EO3 A;  4MH2 A;  1JZD A;  1GUH A;  5CNW A;  1QFN A;  3BBY A;  1GNW A;  5F07 A;  2WJU A;  2CAQ A;  3M0F A;  3M1G A;  5F05 A;  1NM3 A;  1I9D A;  22GS A;  2VLU A;  5L71 A;  2H76 A;  4G10 A;  4Q5Q A;  6GSU A;  4EC0 A;  2WCI A;  1OC9 A;  4WF5 A;  2E0Q A;  1F6M C;  2DIY A;  1PRX A;  2KP2 A;  3FK8 A;  2YP6 A;  5J4U A;  3Q18 A;  2GLR A;  1TU8 A;  2OE1 A;  4IEL A;  3VWX A;  1JLW A;  1LJR A;  3H4K A;  4N0V A;  4IW9 A;  2M80 A;  1DSB A;  2PUK C;  4TXV A;  1SL2 B;  5IO0 A;  3TJB A;  4O92 A;  2WB9 A;  5F8B A;  2XPE A;  3PR8 A;  4G9H A;  1K3O A;  3KP9 A;  3TUE A;  3IE3 A;  1WIK A;  5A4W A;  1M99 A;  1A24 A;  1WWJ A;  2FUG 2;  2LV3 A;  2GSR A;  2LJR A;  5ECR B;  1G6W A;  2VOC A;  4MMM A;  4KDX A;  1NHY A;  1HNC A;  4G19 A;  1PQN A;  1X5E A;  4IHU A;  4HUA A;  2IL3 A;  1WE0 A;  3K8N A;  1AC1 A;  3D0Z A;  1G7O A;  3UL3 A;  2L4C A;  1ZMA A;  4GQC A;  3GTU B;  2LQQ A;  3GX0 A;  2NBS A;  4ISD A;  4EDZ A;  4MPF A;  3UBL A;  2KHP A;  5IMA A;  4GST A;  2LNT A;  2BJX A;  2G2Q A;  2R3X A;  3KJY A;  4X43 A;  2CX3 A;  3FZ4 A;  2MMZ A;  3H93 A;  4FH8 A;  1Z6M A;  3U5R E;  5G30 A;  5KN0 A;  2RII A;  5CO3 A;  4O5R A;  1TU7 A;  4KUN A;  1EOH A;  3GTU A;  7GSS A;  2HRN A;  3ZLP A;  2QSI A;  3OR5 A;  2I9H A;  3DGQ A;  1RK4 A;  4GSS A;  1DUG A;  5JCG A;  2V6O A;  3ZL5 A;  3GMF A;  2FNO A;  3M9J A;  1M2B A;  3UOM A;  3APO A;  2OBI A;  3GHA A;  5B6N A;  4XS1 A;  2F51 A;  4ULX A;  4ZIL A;  2LRC A;  4L0U A;  2C3Q A;  2WUL A;  1EP8 A;  2FLS A;  2CA8 A;  3QDN A;  3TKS C;  2YN1 A;  2F3M A;  1V2A A;  4LL4 B;  3HKR A;  5DJM A;  3QCP A;  2ZCT A;  1R26 A;  3NZN A;  1Z5Y E;  2GST A;  1G7E A;  2ES7 A;  1I5G A;  2GZP A;  5DBQ A;  3LXT A;  1R7H A;  2LEG A;  1THO A;  4PXO A;  2K18 A;  3BCI A;  3BD2 A;  5B8B A;  4V2N A;  3Q74 A;  2LRN A;  3QAW A;  4I5Q A;  2YNX A;  4KDY A;  3TCO A;  2H1D A;  2HI7 A;  3LFL A;  3N9J A;  2PBJ A;  2A2R A;  2FWH A;  3TKS E;  5J41 A;  3FW2 A;  2LJA A;  3DWV A;  2YV7 A;  1EP7 A;  2KLX A;  3DD3 A;  3KH7 A;  4DSS B;  1SK1 A;  5AIS A;  4FYB A;  3ED3 A;  5ECS A;  2LKU A;  2AB6 A;  2PPT A;  3EU4 A;  1SYX A;  5G31 A;  1V98 A;  5IPH A;  3QR6 A;  4NV2 A;  3CRT A;  1KEB A;  2VIM A;  1TK5 B;  5JWO B;  5EVO A;  3O6T A;  3ZTL A;  2H0I A;  3QD9 A;  3LYP A;  1HNB A;  1EEJ A;  3M3M A;  1BG5 A;  3GKM A;  1FO5 A;  5A5K A;  1X0R A;  3GA4 A;  5CP1 A;  1SJZ A;  2H1B A;  4DSS A;  3QPM A;  2ALB A;  1SL1 B;  5IOW A;  5AN1 A;  2VLT A;  1AQW A;  4TXO A;  1OKT A;  3EMX A;  2BMX A;  3RAZ A;  1OC3 A;  2KP1 A;  3UJ1 A;  2DJ1 A;  4TW5 A;  2IN3 A;  3HHV A;  4KAE A;  5EY6 A;  3LG6 A;  4GTU A;  1B48 A;  5GZZ B;  3KCM A;  2JU5 A;  2DIZ A;  3I9V 2;  5IQY A;  1TKD B;  1UN2 A;  1YJ6 A;  5A4U A;  3CSJ A;  1F3B A;  3L9V A;  2VLV A;  3IBH A;  4J2F A;  5ECI B;  3IHQ A;  1AAZ A;  2C8U A;  5J9C A;  1BJX A;  1A0F A;  3LSZ A;  2CVK A;  3MAK A;  4K7O A;  3KM6 A;  2M46 A;  2K8V A;  2CX4 A;  1XW6 A;  4X0X A;  5IMZ A;  4BWQ A;  4GSN A;  3L78 A;  2C1Y A;  5CRG A;  2J23 A;  5B6M A;  4FYU A;  4K1F A;  3F4T A;  2WDU A;  4CW9 A;  1G6Y A;  1BED A;  1OYJ A;  2IMF A;  5HR2 A;  2WS2 A;  5GAN D;  1ZYQ B;  4XS4 A;  3CXG A;  2TIR A;  4AGS A;  1NHO A;  4L0W A;  4KH7 A;  2WRT A;  2E2G A;  4MK3 A;  4POK A;  1O8W A;  2WGR A;  4KW6 A;  2ON7 A;  2V6K A;  2HFD A;  4JR4 A;  2F8A A;  1OC8 A;  2R6K A;  3TKS A;  2GS3 A;  3D22 A;  3F4S A;  3ZZX A;  3FY7 A;  2GGT A;  3LWA A;  2B5Y A;  3JCM L;  2AUV A;  4XRD A;  3GIX A;  4I97 A;  13GS A;  2YJH A;  4QL9 A;  4HI7 A;  5HFG A;  3L9U A;  2B1L A;  2B7K A;  1FVJ A;  2NDO A;  3TDG A;  2IFQ A;  1K0O A;  2HZE B;  2P0G A;  4Z7X A;  4F82 A;  3CYN A;  1RQM A;  3FR3 A;  4ECI A;  1JFU A;  3D21 A;  3GFK A;  3VI5 A;  4IN0 A;  1PL1 A;  3GST A;  4ACS A;  4POL A;  3UVH A;  2JZR A;  3TJF A;  3W6G A;  4F03 A;  2PWJ A;  3FHK A;  4MJC A;  4LA1 A;  2HZE A;  3UAR A;  1XVQ A;  1AW9 A;  1F37 A;  2I3Y A;  4N10 A;  1R4W A;  2KOK A;  5ELG A;  2IMD A;  3E3E A;  2CVB A;  4N11 A;  2V1M A;  3UEM A;  1J0F A;  2YJ7 A;  5H5R A;  1FOV A;  4MAB A;  1EV9 A;  1J9B A;  3LJR A;  2N5B A;  5CRH A;  1E6B A;  3EUR A;  1GSQ A;  1YF0 A;  2YWO A;  3EVI A;  2TRC P;  2DMM A;  4V2L A;  4BWS A;  1OKD A;  4YQM A;  4X1U A;  1W89 A;  3S9F A;  3VWW A;  5ECP B;  2E2M A;  5AIV A;  2ZUP A;  1K0D A;  2BTO T;  4KCA A;  2X99 A;  2DSA A;  1TRU A;  1SJI A;  4HZ4 A;  1SYR A;  3UIW A;  4BVX A;  1PX7 A;  10GS A;  4EL1 A;  4HJ2 A;  5HR1 A;  2R2J A;  2CQ9 A;  2V2G A;  2HZF A;  2QC7 A;  3FRC A;  2K6V A;  4N0Z A;  3DYR A;  1UA5 A;  5ELA A;  4ZBA A;  4LMW A;  1TDI A;  4MZB A;  3ME7 A;  2DLX A;  3TRQ A;  3RBT A;  4ML1 A;  2R37 A;  3CMI A;  5CRW A;  4GCI A;  4HU7 A;  2DML A;  2OE0 A;  1LU4 A;  4AF2 A;  3DML A;  4I2U A;  5JCU A;  1V58 A;  2VCT A;  2FY6 A;  3WT1 A;  4V1A p;  3DVX A;  1GTI A;  2N5F A;  2CZ3 A;  2OA7 A;  3KP8 A;  4O32 A;  3F3Q A;  3VK9 A;  3MSZ A;  1KBN A;  4XTS A;  1A2J A;  4KND A;  4CDO A;  4DSR A;  3IR4 A;  4JZQ A;  1EOG A;  1B4P A;  1XWC A;  5DJL A;  1OVN A;  4OO4 A;  3ERG A;  2R5G A;  2PMT A;  3QOU A;  4IQ1 A;  3CTF A;  5ECO B;  5B7C A;  3ZYW A;  3VUR A;  2OAC A;  4OCE A;  2OJL A;  2GDR A;  1XW5 A;  3D6I A;  1WMJ A;  6GSV A;  4MJA A;  1GTU A;  4K7I A;  1SL0 B;  4MH3 A;  4DVC A;  4GF0 A;  1ERV A;  1A23 A;  1TTZ A;  2FD3 A;  3MDK A;  1H75 A;  3IK9 A;  4OMV A;  3KEB A;  1GSY A;  1T3B A;  1EZK A;  1SKS B;  3ZIV A;  4J57 E;  1GTA A;  5CRE A;  4JR6 A;  3H1N A;  1MDJ A;  3DKS A;  3E9J B;  2X8G A;  1T7P B;  1GLQ A;  4TN8 A;  4BA7 A;  1Z9H A;  2LST A;  1TOF A;  1GUK A;  4EUY A;  4ZB9 A;  1A8Y A;  3C1R A;  2H8L A;  1TI3 A;  2LNS A;  3GSS A;  2H6Z A;  3TJG A;  3P90 A;  3KMN A;  5B8A A;  3W8S A;  4F0B A;  4HQZ A;  4YH2 A;  1HD2 A;  3P2A A;  3F63 A;  5D9T A;  4AJ8 A;  3VI7 A; 
#chains in the Genus database with same CATH topology
 4OFM A;  2EIR A;  2R0C A;  2RM5 A;  4RI7 A;  2HYX A;  11GS A;  1AQV A;  1ERT A;  2C0F A;  4H86 A;  5HQP A;  3HJP A;  5HR3 A;  4IGJ A;  4ZL9 A;  3RHC A;  4MJE A;  4XIH A;  2LUS A;  1NSW A;  4TR3 A;  20GS A;  3VWU A;  2HLS A;  2H6X A;  2DJJ A;  2L57 A;  1JHB A;  3C7M A;  1VF2 A;  3HXS A;  2F9S A;  3D5J A;  3WD6 A;  1SKW B;  3IK7 A;  4NAX A;  5ECH B;  2VCQ A;  1Z7P A;  2AHE A;  4KF9 A;  1FAA A;  2H1G A;  3EE2 A;  3E0U A;  4Q5N A;  3KD0 A;  3A2X A;  4K0N A;  3WGD A;  3DEX A;  5C04 A;  2VUP A;  3ZRD A;  1GSD A;  3KIJ A;  1YKA A;  2JSZ A;  1ERU A;  4MF6 A;  4IJI A;  2O85 A;  2L5O A;  3IXR A;  4CY6 A;  4KB3 A;  1K3Y A;  4LLR A;  2OKA A;  2AYT A;  4A5P A;  4IP6 A;  3ZFL A;  3RDW A;  4YQV A;  1PMT A;  4KGI A;  2H70 A;  4OWY A;  4BVY B;  4MJB A;  1ML6 A;  1MD4 A;  5J9B A;  1T8E B;  2H0H A;  4WBR D;  4G0K A;  4WXT A;  3VPT A;  5GSS A;  3F6F A;  3IRA A;  2HSY A;  2E7P A;  2WFC A;  2IME A;  3DXB A;  4MNN A;  3PH9 A;  5D93 A;  1FG4 A;  8GSS A;  1Z7R A;  1QK8 A;  2I81 A;  3RPP A;  1O81 A;  2V41 A;  3SWL A;  5D9W A;  1MDK A;  4OFN A;  4BVY A;  1FB6 A;  4IP1 A;  4BIK A;  2JAD A;  1TJD A;  1ZL9 A;  2PGT A;  3LW9 A;  1BYE A;  3TOT A;  1U6T A;  5CAX A;  3GNJ A;  1CQH A;  3I69 A;  1DBY A;  3GKX A;  2IWT A;  2DJK A;  4WF4 A;  1U87 A;  2GTU A;  1X5D A;  1XWK A;  2LS5 A;  2VL2 C;  5D73 A;  4L5O A;  2H01 A;  1EV4 A;  1B4Q A;  3C71 A;  5DVB A;  2IMI A;  4FYC A;  4HSC X;  2YV9 A;  2RUF A;  3TJJ A;  4IS0 A;  12GS A;  3O76 A;  4F0C A;  2DJ0 A;  1FW1 A;  2O87 A;  4LMV A;  4GLT A;  4MPG A;  4K5S A;  1DE2 A;  4N30 A;  4WR5 A;  5D8I A;  2CVD A;  1V40 A;  3G9B A;  1XVW A;  1MDI A;  1K0M A;  5JCW A;  1EWX A;  1Z3E A;  4K2D A;  1TI1 A;  3FR9 A;  2J9H A;  2XBI A;  3WYW A;  5JWR B;  2B5E A;  4NMU A;  3W8J A;  2EIO A;  4XHM A;  3V1W A;  4E8H A;  1O85 A;  5IM9 A;  4V1A g;  4BPY A;  1GTB A;  1BQ7 A;  2A2P A;  3F9U A;  2VM2 A;  1XZO A;  2LJK A;  1ZOF A;  3HZ8 A;  2RM6 A;  2VL3 A;  4WKW A;  1DE1 A;  3HVS A;  1HNA A;  1YZX A;  4NHW A;  14GS A;  1EGR A;  4ZBD A;  2YCD A;  1Y25 A;  4G0I A;  3GKK A;  1K0B A;  1QMV A;  2C0D A;  2MMO A;  1SK0 A;  5AIX A;  1XPV A;  1JZO A;  4ID0 A;  1WP0 A;  2YWI A;  3IC8 A;  1RW1 A;  4NV5 A;  4TR0 A;  2ON5 A;  4P3Y B;  4CY8 A;  1R5A A;  4K5R A;  5IMF A;  1ZYE A;  3HJM A;  2GT5 A;  2YZH A;  1A8L A;  4HOJ A;  1PGT A;  2C3T A;  4GWR A;  4Z2R A;  4FQU A;  3ME8 A;  4JU5 A;  1T4Y A;  4GXZ A;  3F8U A;  1SD9 A;  2PVQ A;  2X49 A;  2L4Q A;  1XXU A;  2QGV A;  4ILF A;  2VCX A;  3FZ5 A;  3R2Q A;  2PER A;  3LGC A;  2C80 A;  1JZR A;  1XW9 A;  3SBC A;  3F6D A;  2MZC A;  3J7Y k;  2DJ3 A;  2VD0 A;  2B5X A;  2LQO A;  2L6C A;  1X9W B;  4EE0 A;  4HEA 2;  2JL4 A;  1T00 A;  1F9M A;  4K6X A;  1TK8 B;  2IMK A;  4ICY A;  2GQK A;  2HRF A;  4HZ2 A;  1U3A A;  4I6X A;  1SU9 A;  4WEY A;  4I2T A;  5KN2 A;  1TP9 A;  3FKF A;  2XPD A;  5G5F A;  5HFI A;  3FEU A;  3LOR A;  4Z2T A;  3UMA A;  3ZIT A;  1BAY A;  2FWE A;  3O3T A;  1TRV A;  5ECQ B;  5DAK B;  3IA1 A;  1VF3 A;  3L0H A;  2B3S A;  3AY8 A;  5DQS A;  3QMX A;  2CT6 A;  2VL2 A;  3J7Y b;  5G2Z A;  2C3N A;  3FZ9 A;  3UAP A;  4OFT A;  1ACV A;  1A0R P;  1YEP A;  3ZML A;  1X5C A;  2IIY A;  3GX8 A;  2K8S A;  5BRT A;  3NOF A;  1PA3 A;  3A3T A;  1G0T A;  3EC3 A;  3F0I A;  4YAV A;  1M7T A;  1QXH A;  3ZIJ A;  2MBS A;  1AUC A;  2YOI A;  2H0G A;  5G5E A;  5DQY A;  3TKP A;  1O8X A;  2AV4 A;  3UVT A;  5ID2 B;  1CQG A;  2YAN A;  2OE3 A;  3GUS A;  1TW9 A;  4QQ7 A;  1R5P A;  1LBK A;  3I43 A;  1PKW A;  5D9X A;  2FA4 A;  1OE7 A;  4ZBB A;  3HVX A;  4J56 E;  6GSS A;  3APQ A;  1XG8 A;  4JE1 A;  1M9A A;  4TVE A;  5J5N A;  3VLN A;  1A2L A;  2OAD A;  4IBP A;  2N5A A;  2F8F A;  3ISO A;  2NVL A;  5HR0 A;  1PSQ A;  4EDY A;  4GQF A;  5G1L A;  4TR4 A;  2VCW A;  2GVP A;  1XOA A;  4CHS A;  1GP1 A;  3A5W A;  4D73 B;  3G7J A;  4XRA A;  1FHE A;  5DCG A;  2H75 A;  4AJ6 A;  1QQ2 A;  1MTC A;  2IJY A;  2M72 A;  3FZA A;  2HNL A;  1PD2 1;  4PQH A;  1GRX A;  2K9F A;  5H5S A;  1Q98 A;  1GWC A;  1F2E A;  4YAP A;  2P31 A;  3US3 A;  1OC9 B;  1THX A;  1XWA A;  4MDC A;  2CZ2 A;  3HY2 A;  1USB A;  3GRX A;  3A2W A;  2GSS A;  2H66 A;  3RHB A;  5KN1 A;  2FCH A;  3EU3 A;  4ZL7 A;  1O73 A;  4RQR A;  4PUR A;  2YWM A;  2GZY A;  3GV1 A;  3PPU A;  3L4N A;  2VCV A;  4MP4 A;  4D73 A;  3GUR A;  6GSX A;  1UC7 A;  1B8X A;  3IC4 A;  3C73 A;  1X9S B;  5ECL B;  2D2Z A;  2C4J A;  1AXD A;  5IO2 A;  1N2A A;  2DJ2 A;  2I1U A;  4KCE A;  4V2M A;  3D4M A;  2EIQ A;  4RUV A;  2A4V A;  1Q4J A;  5EL8 A;  2L6D A;  5KOX A;  1S3D A;  2Z9S A;  4ECB A;  5KEJ A;  1Z6N A;  1WPI A;  2R4V A;  3GL5 A;  2XC2 A;  3VWV A;  4WR4 A;  1SEN A;  5EPF A;  4LL1 B;  1YDK A;  3TJK A;  2WZ9 A;  1NW2 A;  2QA2 A;  5IMD A;  5ABR A;  4PQ1 A;  4ZB6 A;  4XCS A;  5FHI A;  5A4V A;  1YY7 A;  2C0E A;  2B1K A;  6GSW A;  3HD5 A;  2HT9 A;  1O6J A;  3IAS 2;  1IYI A;  2VAF A;  5IIZ A;  5GST A;  2P5Q A;  1XWB A;  2VCZ A;  2H73 A;  5IOX A;  1GL8 A;  2FGX A;  2XHF A;  1UVZ A;  4K7N A;  4WET A;  3H8Q A;  5ECM B;  1W4V A;  1GH2 A;  3IPZ A;  3CSH A;  1VRS D;  3FR6 A;  1IYH A;  3WGX A;  3GL3 A;  1ERW A;  5LD0 A;  3MIX A;  3VPQ A;  4HQS A;  2PN8 A;  4MCU A;  1MD3 A;  5ECN B;  1YKC A;  1GSU A;  2O7K A;  1C72 A;  3EYT A;  5D96 A;  2HSH A;  4IVF A;  1X9M B;  1H4O A;  2A4H A;  5H5Q A;  4KSM A;  4TKY A;  1URM A;  2GQM A;  3HDC A;  4JBB A;  5F0G A;  3FMW A;  1K0C A;  4F2I A;  3HZ4 A;  4HJM A;  2VL9 A;  4NWY A;  2B7J A;  1ILO A;  3TOU A;  4PQI A;  3G7Y A;  2V32 A;  3M8N A;  2FWF A;  3CRU A;  3Q6O A;  5J3R A;  5C00 A;  4PNG A;  4PGT A;  4O7H A;  3L9S A;  4PTS A;  3R3E A;  4NHZ A;  2RLI A;  3TKQ A;  1TXX A;  3HVV A;  4ECC A;  4QL7 A;  2TRX A;  3TRX A;  3KH9 A;  1S3R A;  3KGK A;  3KTL A;  3CTG A;  4IKH A;  4MA9 A;  1K3L A;  4Q5F A;  3TRP A;  2X64 A;  4BL7 B;  3KTB A;  2KUC A;  1KNG A;  2MYG A;  3VFI A;  2PU9 C;  3U6V A;  5ECK B;  5HFK A;  3DIE A;  3GN3 A;  4G2E A;  4HS1 A;  4EIQ A;  1N8J A;  3D4T A;  5COH A;  3ZVJ D;  2GZZ A;  4WBJ A;  4ML6 A;  2GT6 A;  1OAZ A;  4MF5 A;  2OBK A;  4YQU A;  2YWN A;  3RPN A;  4OO5 A;  2VM1 A;  5F06 A;  2JZS A;  4K2X A;  4BL7 A;  5GAP D;  2HE3 A;  1V57 A;  4K8M A;  4NPB A;  1EGO A;  4GRF A;  4KE3 A;  3FYG A;  2HXK A;  9GSS A;  1M0U A;  6GST A;  2UZ8 A;  4MF7 A;  1GUM A;  3IOS A;  3QAV A;  3BCK A;  2L59 A;  2GQL A;  3TB2 A;  2MMA A;  3EWL A;  1XCC A;  1GSF A;  2AAW A;  4PNF A;  1XWG A;  2I4A A;  4RI6 A;  1SJ6 A;  2DC5 A;  1WOU A;  1V9W A;  2RUE A;  1T1V A;  1HQO A;  4TXO B;  5IMC A;  1GSS A;  2H74 A;  2ZNM A;  3GH9 A;  4KX4 A;  3ZVJ A;  2JAC A;  1SKR B;  4ECJ A;  3GH6 A;  2JZT A;  3HYP A;  4FIW A;  1TK0 B;  1YF1 A;  1YEX A;  3TKR A;  1ZCP A;  2REM A;  2CV4 A;  1ZYP A;  3Q19 A;  1B9X C;  2DKI A;  4TRX A;  4K9Z A;  2DBC A;  3DRN A;  3ZFB A;  4G0L A;  1K0A A;  2C0G A;  3MYD A;  3KMO A;  4DSQ A;  4POM A;  4KDU A;  1YQ1 A;  2H1A A;  5DAL B;  3GYK A;  1VGL A;  1PN9 A;  4PUF C;  5E59 A;  4ZIJ A;  16GS A;  2O89 A;  3P7X A;  3IV4 A;  5FWG A;  1B9Y C;  1S3C A;  4HU9 A;  1XOB A;  4NXI A;  3LEF A;  1ABA A;  3MWH A;  3QFB C;  2PVO C;  3I6A A;  4XS4 B;  5D9V A;  2FHE A;  4Q5R A;  1VF4 A;  4JRR A;  4X4J A;  5CYY A;  4I8B A;  2YZU A;  4AJ7 A;  1M9B A;  5DAL A;  2X8C A;  3BJ5 A;  5AGY A;  2H6Y A;  4E8E A;  5DDL A;  1Y6E A;  1PX6 A;  1WRY A;  4IQA A;  4PUA A;  3F4R A;  2NTO A;  2FWG A;  2IFQ B;  3QFA C;  3NIV A;  2H19 A;  1QGV A;  4IJ3 A;  2MMN A;  2NPB A;  1FOH A;  4XS6 A;  3TGZ A;  1QUW A;  1U88 A;  1F3A A;  3F3R A;  3GKN A;  2L5L A;  4POB A;  4L8E A;  3ZMK A;  5IPG A;  3QAG A;  4EVM A;  1XBS A;  4MLY A;  1GNE A;  1AIU A;  3HCZ A;  3EMP A;  1ST9 A;  1MEK A;  3LYK A;  1AQX A;  1XIY A;  5IMV A;  1S3A A;  3APS A;  1JZW A;  2AJQ B;  3UBK A;  6GSY A;  2CAI A;  1GLP A;  3PIN A;  1BX9 A;  5G1K A;  2P5R A;  3M9K A;  5INY A;  1ZGN A;  4KSO A;  3KZQ A;  1FB0 A;  4DEJ A;  1TRW A;  1E2Y A;  4EF0 A;  2O8V B;  19GS A;  1OE8 A;  3C1S A;  1M3I A;  3G7I A;  2H30 A;  3HJO A;  1T4Z A;  4EXJ A;  1U3I A;  17GS A;  2JSY A;  18GS A;  3EIN A;  1GUL A;  3H79 A;  4RQX A;  2A2S A;  4F9Z A;  1FVK A;  1VF1 A;  2IPA A;  1O7U A;  4HDE A;  4K0G A;  2G0F A;  4BVX B;  3ERF A;  3A2V A;  3CBU A;  4TOP A;  5DAK A;  4MZW A;  4L5L A;  5ENU A;  4ZB8 A;  1M2D A;  2VD1 A;  5LCZ A;  3WGE A;  3P8W A;  2GSQ A;  4ZL8 A;  3PGT A;  4OD7 A;  4TR1 B;  2LRT A;  1M2A A;  2FA8 A;  1ON4 A;  3WT2 A;  4EKZ A;  2H71 A;  1PL2 A;  4MZC A;  1ZZY A;  3MNG A;  4ZXG A;  2H72 A;  4PX1 A;  1HYU A;  1A2M A;  3HA9 A;  1SK2 A;  5E4W A;  5KOW A;  1GSE A;  3LQ7 A;  3IDV A;  2MBT A;  2VO4 A;  3ZRE A;  1JLV A;  2B6M A;  2YPM A;  1K0N A;  3CSI A;  1J08 A;  5DCH A;  2QKE A;  4TR1 A;  5ID2 A;  4KA0 A;  3LXZ A;  1KTE A;  2EC4 A;  3IAM 2;  1EEM A;  5FT3 A;  2X8H A;  4FO5 A;  1TRS A;  3N5O A;  1SD8 A;  3BOA A;  3HVN A;  3DVW A;  5LNK e;  2LTK A;  1XFL A;  1WJK A;  3KXO A;  3C8E A;  4OCF A;  5KN3 A;  1PKZ A;  2XBQ A;  4JED A;  5CRD A;  5JWQ B;  3ERW A;  4EO3 A;  4MH2 A;  1JZD A;  1GUH A;  5CNW A;  1QFN A;  3BBY A;  1GNW A;  5F07 A;  2WJU A;  2CAQ A;  3M0F A;  3M1G A;  5F05 A;  1NM3 A;  1I9D A;  22GS A;  2VLU A;  5L71 A;  2H76 A;  4G10 A;  4Q5Q A;  6GSU A;  4EC0 A;  2WCI A;  1OC9 A;  4WF5 A;  2E0Q A;  1F6M C;  4Z2U A;  2DIY A;  1PRX A;  2KP2 A;  3FK8 A;  2YP6 A;  2HRK A;  5J4U A;  3Q18 A;  2GLR A;  1TU8 A;  2OE1 A;  4IEL A;  3VWX A;  1JLW A;  1LJR A;  3H4K A;  4N0V A;  4IW9 A;  2M80 A;  1DSB A;  2PUK C;  4TXV A;  1SL2 B;  5IO0 A;  3TJB A;  4O92 A;  1PFO A;  2WB9 A;  5F8B A;  2XPE A;  3PR8 A;  4G9H A;  1K3O A;  3KP9 A;  3TUE A;  3IE3 A;  3CQF A;  1WIK A;  5A4W A;  1M99 A;  1A24 A;  1WWJ A;  2FUG 2;  2LV3 A;  2GSR A;  2LJR A;  4O5Q A;  5ECR B;  1G6W A;  2VOC A;  4MMM A;  4KDX A;  1NHY A;  1HNC A;  4G19 A;  1PQN A;  1X5E A;  4IHU A;  4HUA A;  2IL3 A;  1WE0 A;  3K8N A;  1AC1 A;  3D0Z A;  1G7O A;  3UL3 A;  2L4C A;  1ZMA A;  4GQC A;  3GTU B;  2LQQ A;  3GX0 A;  2NBS A;  4ISD A;  4EDZ A;  4MPF A;  3UBL A;  2KHP A;  5IMA A;  4GST A;  2LNT A;  2BJX A;  2G2Q A;  2R3X A;  3KJY A;  4X43 A;  2CX3 A;  3FZ4 A;  2MMZ A;  3H93 A;  4FH8 A;  1Z6M A;  3U5R E;  5G30 A;  5KN0 A;  2RII A;  5CO3 A;  4O5R A;  1TU7 A;  4KUN A;  5BMU A;  1EOH A;  3GTU A;  7GSS A;  2HRN A;  3ZLP A;  2QSI A;  3OR5 A;  2I9H A;  3DGQ A;  1RK4 A;  4GSS A;  1DUG A;  5JCG A;  2V6O A;  3ZL5 A;  3GMF A;  2FNO A;  3M9J A;  1M2B A;  3UOM A;  3APO A;  2OBI A;  3GHA A;  5B6N A;  4XS1 A;  2F51 A;  4ULX A;  4ZIL A;  2LRC A;  4L0U A;  2C3Q A;  2WUL A;  1EP8 A;  2FLS A;  2CA8 A;  3QDN A;  3TKS C;  2YN1 A;  2F3M A;  1V2A A;  4LL4 B;  3HKR A;  5DJM A;  3QCP A;  2ZCT A;  1R26 A;  3NZN A;  1Z5Y E;  2GST A;  1G7E A;  2ES7 A;  1I5G A;  2GZP A;  5DBQ A;  3LXT A;  1R7H A;  3EPT A;  2LEG A;  1PN0 A;  1THO A;  4PXO A;  2K18 A;  3BCI A;  3IHG A;  3BD2 A;  5B8B A;  4V2N A;  3Q74 A;  2LRN A;  3QAW A;  4I5Q A;  2YNX A;  4KDY A;  3TCO A;  2H1D A;  2HI7 A;  3LFL A;  3N9J A;  2PBJ A;  2A2R A;  2FWH A;  3TKS E;  5J41 A;  3FW2 A;  2LJA A;  3DWV A;  2YV7 A;  1EP7 A;  2KLX A;  3DD3 A;  3KH7 A;  4DSS B;  1SK1 A;  5AIS A;  4FYB A;  3ED3 A;  5ECS A;  2LKU A;  2AB6 A;  2PPT A;  1M3J A;  3EU4 A;  1SYX A;  5G31 A;  1V98 A;  5IPH A;  3QR6 A;  4NV2 A;  3CRT A;  1KEB A;  2VIM A;  1TK5 B;  5JWO B;  5EVO A;  3O6T A;  3ZTL A;  2H0I A;  3QD9 A;  3LYP A;  1HNB A;  1EEJ A;  3M3M A;  1BG5 A;  3GKM A;  1FO5 A;  5A5K A;  1X0R A;  3GA4 A;  5CP1 A;  1SJZ A;  2H1B A;  4DSS A;  3QPM A;  2ALB A;  1SL1 B;  5IOW A;  5AN1 A;  2VLT A;  1AQW A;  4TXO A;  1OKT A;  3EMX A;  2BMX A;  3RAZ A;  1OC3 A;  2KP1 A;  3UJ1 A;  2DJ1 A;  4TW5 A;  2IN3 A;  2X4A A;  3HHV A;  4KAE A;  5EY6 A;  3LG6 A;  4GTU A;  1B48 A;  5GZZ B;  3KCM A;  2JU5 A;  2DIZ A;  3I9V 2;  4O5U A;  5IQY A;  1TKD B;  1UN2 A;  1YJ6 A;  5A4U A;  3CSJ A;  1F3B A;  3L9V A;  2VLV A;  3IBH A;  4J2F A;  5ECI B;  3IHQ A;  1AAZ A;  2C8U A;  5J9C A;  1BJX A;  1A0F A;  3LSZ A;  2CVK A;  3MAK A;  4K7O A;  3KM6 A;  2M46 A;  2K8V A;  4USS A;  2CX4 A;  1XW6 A;  4X0X A;  5IMZ A;  4BWQ A;  4GSN A;  3L78 A;  2C1Y A;  5CRG A;  2J23 A;  5B6M A;  4FYU A;  4K1F A;  3F4T A;  2WDU A;  4CW9 A;  1G6Y A;  1BED A;  1OYJ A;  2IMF A;  5HR2 A;  2WS2 A;  5GAN D;  1ZYQ B;  4XS4 A;  3CXG A;  2TIR A;  4AGS A;  1NHO A;  4L0W A;  4KH7 A;  2WRT A;  2E2G A;  4MK3 A;  4POK A;  1O8W A;  2WGR A;  4KW6 A;  2ON7 A;  2V6K A;  2HFD A;  4JR4 A;  2F8A A;  1OC8 A;  2R6K A;  3TKS A;  2GS3 A;  3D22 A;  3F4S A;  3ZZX A;  3FY7 A;  2GGT A;  3LWA A;  2B5Y A;  3JCM L;  2AUV A;  4XRD A;  4YKF A;  3GIX A;  4I97 A;  13GS A;  2YJH A;  4QL9 A;  4HI7 A;  5HFG A;  3L9U A;  2B1L A;  2B7K A;  1FVJ A;  2NDO A;  3TDG A;  2IFQ A;  1K0O A;  2HZE B;  2P0G A;  4Z7X A;  4F82 A;  3CYN A;  1RQM A;  3FR3 A;  4ECI A;  1JFU A;  3D21 A;  3GFK A;  3VI5 A;  4IN0 A;  1PL1 A;  3GST A;  4ACS A;  4POL A;  3UVH A;  2JZR A;  3TJF A;  3W6G A;  4F03 A;  2PWJ A;  3FHK A;  2DKH A;  4MJC A;  4LA1 A;  2HZE A;  3UAR A;  1ZYN A;  1XVQ A;  1AW9 A;  1F37 A;  2I3Y A;  2HRA A;  4N10 A;  1R4W A;  2KOK A;  5ELG A;  2IMD A;  3E3E A;  2CVB A;  4N11 A;  2V1M A;  3UEM A;  1J0F A;  2YJ7 A;  5H5R A;  1FOV A;  4MAB A;  1EV9 A;  1J9B A;  3LJR A;  2N5B A;  5CRH A;  1E6B A;  3EUR A;  1GSQ A;  1YF0 A;  2YWO A;  3EVI A;  2TRC P;  2DMM A;  4V2L A;  4BWS A;  1OKD A;  4YQM A;  4X1U A;  1W89 A;  3S9F A;  3VWW A;  5ECP B;  2E2M A;  5AIV A;  2ZUP A;  1K0D A;  2BTO T;  4KCA A;  2X99 A;  2DSA A;  1TRU A;  1SJI A;  4HZ4 A;  1SYR A;  3UIW A;  4BVX A;  1PX7 A;  4EIP A;  10GS A;  4EL1 A;  4HJ2 A;  5HR1 A;  2R2J A;  2CQ9 A;  2V2G A;  2HZF A;  2QC7 A;  3FRC A;  2K6V A;  4N0Z A;  3DYR A;  1UA5 A;  5ELA A;  4ZBA A;  4LMW A;  1TDI A;  4MZB A;  3ME7 A;  2DLX A;  3TRQ A;  3RBT A;  4ML1 A;  2R37 A;  3CMI A;  5CRW A;  4GCI A;  4HU7 A;  2DML A;  2OE0 A;  1LU4 A;  4AF2 A;  2R0G A;  3DML A;  4I2U A;  5JCU A;  1V58 A;  2VCT A;  2FY6 A;  3WT1 A;  4V1A p;  3DVX A;  1GTI A;  2N5F A;  2QA1 A;  2CZ3 A;  2OA7 A;  3KP8 A;  4O32 A;  3F3Q A;  3VK9 A;  3MSZ A;  4YKG A;  1KBN A;  4XTS A;  1A2J A;  4KND A;  4CDO A;  4DSR A;  3IR4 A;  4JZQ A;  1EOG A;  1B4P A;  1XWC A;  5DJL A;  1OVN A;  4OO4 A;  3ERG A;  2R5G A;  2PMT A;  3QOU A;  4IQ1 A;  3CTF A;  5ECO B;  5B7C A;  3ZYW A;  3VUR A;  2OAC A;  4OCE A;  2OJL A;  2GDR A;  1XW5 A;  3D6I A;  1WMJ A;  6GSV A;  4MJA A;  1GTU A;  4K7I A;  1SL0 B;  4MH3 A;  4DVC A;  4GF0 A;  1ERV A;  1A23 A;  1TTZ A;  2FD3 A;  3MDK A;  2R0P A;  1H75 A;  3IK9 A;  4OMV A;  3KEB A;  1GSY A;  1T3B A;  1EZK A;  1SKS B;  3ZIV A;  4J57 E;  2HSM A;  1GTA A;  5CRE A;  3A5I A;  4JR6 A;  3H1N A;  1MDJ A;  3DKS A;  3E9J B;  2X8G A;  1T7P B;  1GLQ A;  4TN8 A;  4BA7 A;  1Z9H A;  2LST A;  1TOF A;  1GUK A;  4EUY A;  4ZB9 A;  1A8Y A;  3C1R A;  2H8L A;  1TI3 A;  2LNS A;  3GSS A;  2H6Z A;  3TJG A;  3P90 A;  3KMN A;  5B8A A;  3W8S A;  4F0B A;  4HQZ A;  4YH2 A;  1HD2 A;  3P2A A;  3F63 A;  5D9T A;  4AJ8 A;  3VI7 A; 
#chains in the Genus database with same CATH homology
 4OFM A;  2EIR A;  2R0C A;  2RM5 A;  4RI7 A;  2HYX A;  11GS A;  1AQV A;  1ERT A;  2C0F A;  4H86 A;  5HQP A;  3HJP A;  5HR3 A;  4IGJ A;  4ZL9 A;  3RHC A;  4MJE A;  4XIH A;  2LUS A;  1NSW A;  4TR3 A;  20GS A;  3VWU A;  2HLS A;  2H6X A;  2DJJ A;  2L57 A;  1JHB A;  3C7M A;  1VF2 A;  3HXS A;  2F9S A;  3D5J A;  3WD6 A;  1SKW B;  3IK7 A;  4NAX A;  5ECH B;  2VCQ A;  1Z7P A;  2AHE A;  4KF9 A;  1FAA A;  2H1G A;  3EE2 A;  3E0U A;  4Q5N A;  3KD0 A;  3A2X A;  4K0N A;  3WGD A;  3DEX A;  5C04 A;  2VUP A;  3ZRD A;  1GSD A;  3KIJ A;  1YKA A;  2JSZ A;  1ERU A;  4MF6 A;  4IJI A;  2O85 A;  2L5O A;  3IXR A;  4CY6 A;  4KB3 A;  1K3Y A;  4LLR A;  2OKA A;  2AYT A;  4A5P A;  4IP6 A;  3ZFL A;  3RDW A;  4YQV A;  1PMT A;  4KGI A;  2H70 A;  4OWY A;  4BVY B;  4MJB A;  1ML6 A;  1MD4 A;  5J9B A;  1T8E B;  2H0H A;  4WBR D;  4G0K A;  4WXT A;  3VPT A;  5GSS A;  3F6F A;  3IRA A;  2HSY A;  2E7P A;  2WFC A;  2IME A;  3DXB A;  4MNN A;  3PH9 A;  5D93 A;  1FG4 A;  8GSS A;  1Z7R A;  1QK8 A;  2I81 A;  3RPP A;  1O81 A;  2V41 A;  3SWL A;  5D9W A;  1MDK A;  4OFN A;  4BVY A;  1FB6 A;  4IP1 A;  2JAD A;  1TJD A;  1ZL9 A;  2PGT A;  3LW9 A;  1BYE A;  3TOT A;  1U6T A;  5CAX A;  3GNJ A;  1CQH A;  3I69 A;  1DBY A;  3GKX A;  2IWT A;  2DJK A;  4WF4 A;  1U87 A;  2GTU A;  1X5D A;  1XWK A;  2LS5 A;  2VL2 C;  5D73 A;  4L5O A;  2H01 A;  1EV4 A;  1B4Q A;  3C71 A;  5DVB A;  2IMI A;  4FYC A;  2YV9 A;  2RUF A;  3TJJ A;  4IS0 A;  12GS A;  3O76 A;  4F0C A;  2DJ0 A;  1FW1 A;  2O87 A;  4LMV A;  4GLT A;  4MPG A;  4K5S A;  1DE2 A;  4N30 A;  4WR5 A;  5D8I A;  2CVD A;  1V40 A;  3G9B A;  1XVW A;  1MDI A;  1K0M A;  5JCW A;  1EWX A;  1Z3E A;  4K2D A;  1TI1 A;  3FR9 A;  2J9H A;  2XBI A;  3WYW A;  5JWR B;  2B5E A;  4NMU A;  3W8J A;  2EIO A;  4XHM A;  3V1W A;  4E8H A;  1O85 A;  5IM9 A;  4V1A g;  4BPY A;  1GTB A;  1BQ7 A;  2A2P A;  3F9U A;  2VM2 A;  1XZO A;  2LJK A;  1ZOF A;  3HZ8 A;  2RM6 A;  2VL3 A;  4WKW A;  1DE1 A;  3HVS A;  1HNA A;  1YZX A;  4NHW A;  14GS A;  1EGR A;  4ZBD A;  2YCD A;  1Y25 A;  4G0I A;  3GKK A;  1K0B A;  1QMV A;  2C0D A;  2MMO A;  1SK0 A;  5AIX A;  1XPV A;  1JZO A;  4ID0 A;  1WP0 A;  2YWI A;  3IC8 A;  1RW1 A;  4NV5 A;  4TR0 A;  2ON5 A;  4P3Y B;  4CY8 A;  1R5A A;  4K5R A;  5IMF A;  1ZYE A;  3HJM A;  2GT5 A;  2YZH A;  1A8L A;  4HOJ A;  1PGT A;  2C3T A;  4GWR A;  4Z2R A;  4FQU A;  3ME8 A;  4JU5 A;  1T4Y A;  4GXZ A;  3F8U A;  1SD9 A;  2PVQ A;  2X49 A;  2L4Q A;  1XXU A;  2QGV A;  4ILF A;  2VCX A;  3FZ5 A;  3R2Q A;  2PER A;  3LGC A;  2C80 A;  1JZR A;  1XW9 A;  3SBC A;  3F6D A;  2MZC A;  3J7Y k;  2DJ3 A;  2VD0 A;  2B5X A;  2LQO A;  2L6C A;  1X9W B;  4EE0 A;  4HEA 2;  2JL4 A;  1T00 A;  1F9M A;  4K6X A;  1TK8 B;  2IMK A;  4ICY A;  2GQK A;  2HRF A;  4HZ2 A;  1U3A A;  4I6X A;  1SU9 A;  4WEY A;  4I2T A;  5KN2 A;  1TP9 A;  3FKF A;  2XPD A;  5G5F A;  5HFI A;  3FEU A;  3LOR A;  4Z2T A;  3UMA A;  3ZIT A;  1BAY A;  2FWE A;  3O3T A;  1TRV A;  5ECQ B;  5DAK B;  3IA1 A;  1VF3 A;  3L0H A;  2B3S A;  3AY8 A;  5DQS A;  3QMX A;  2CT6 A;  2VL2 A;  3J7Y b;  5G2Z A;  2C3N A;  3FZ9 A;  3UAP A;  4OFT A;  1ACV A;  1A0R P;  1YEP A;  3ZML A;  1X5C A;  2IIY A;  3GX8 A;  2K8S A;  5BRT A;  3NOF A;  1PA3 A;  3A3T A;  1G0T A;  3EC3 A;  3F0I A;  4YAV A;  1M7T A;  1QXH A;  3ZIJ A;  2MBS A;  1AUC A;  2YOI A;  2H0G A;  5G5E A;  5DQY A;  3TKP A;  1O8X A;  2AV4 A;  3UVT A;  5ID2 B;  1CQG A;  2YAN A;  2OE3 A;  3GUS A;  1TW9 A;  4QQ7 A;  1R5P A;  1LBK A;  3I43 A;  1PKW A;  5D9X A;  2FA4 A;  1OE7 A;  4ZBB A;  3HVX A;  4J56 E;  6GSS A;  3APQ A;  4JE1 A;  1M9A A;  4TVE A;  5J5N A;  3VLN A;  1A2L A;  2OAD A;  4IBP A;  2N5A A;  2F8F A;  3ISO A;  2NVL A;  5HR0 A;  1PSQ A;  4EDY A;  4GQF A;  5G1L A;  4TR4 A;  2VCW A;  2GVP A;  1XOA A;  4CHS A;  1GP1 A;  3A5W A;  4D73 B;  3G7J A;  4XRA A;  1FHE A;  5DCG A;  2H75 A;  4AJ6 A;  1QQ2 A;  1MTC A;  2IJY A;  2M72 A;  3FZA A;  2HNL A;  1PD2 1;  4PQH A;  1GRX A;  2K9F A;  5H5S A;  1Q98 A;  1GWC A;  1F2E A;  4YAP A;  2P31 A;  3US3 A;  1OC9 B;  1THX A;  1XWA A;  4MDC A;  2CZ2 A;  3HY2 A;  1USB A;  3GRX A;  3A2W A;  2GSS A;  2H66 A;  3RHB A;  5KN1 A;  2FCH A;  3EU3 A;  4ZL7 A;  1O73 A;  4RQR A;  4PUR A;  2YWM A;  2GZY A;  3GV1 A;  3PPU A;  3L4N A;  2VCV A;  4MP4 A;  4D73 A;  3GUR A;  6GSX A;  1UC7 A;  1B8X A;  3IC4 A;  3C73 A;  1X9S B;  5ECL B;  2D2Z A;  2C4J A;  1AXD A;  5IO2 A;  1N2A A;  2DJ2 A;  2I1U A;  4KCE A;  4V2M A;  3D4M A;  2EIQ A;  4RUV A;  2A4V A;  1Q4J A;  5EL8 A;  2L6D A;  5KOX A;  1S3D A;  2Z9S A;  4ECB A;  5KEJ A;  1Z6N A;  1WPI A;  2R4V A;  3GL5 A;  2XC2 A;  3VWV A;  4WR4 A;  1SEN A;  5EPF A;  4LL1 B;  1YDK A;  3TJK A;  2WZ9 A;  1NW2 A;  2QA2 A;  5IMD A;  5ABR A;  4PQ1 A;  4ZB6 A;  4XCS A;  5FHI A;  5A4V A;  1YY7 A;  2C0E A;  2B1K A;  6GSW A;  3HD5 A;  2HT9 A;  1O6J A;  3IAS 2;  1IYI A;  2VAF A;  5IIZ A;  5GST A;  2P5Q A;  1XWB A;  2VCZ A;  2H73 A;  5IOX A;  1GL8 A;  2FGX A;  2XHF A;  1UVZ A;  4K7N A;  4WET A;  3H8Q A;  5ECM B;  1W4V A;  1GH2 A;  3IPZ A;  3CSH A;  1VRS D;  3FR6 A;  1IYH A;  3WGX A;  3GL3 A;  1ERW A;  5LD0 A;  3MIX A;  3VPQ A;  4HQS A;  2PN8 A;  4MCU A;  1MD3 A;  5ECN B;  1YKC A;  1GSU A;  2O7K A;  1C72 A;  3EYT A;  5D96 A;  2HSH A;  4IVF A;  1X9M B;  1H4O A;  2A4H A;  5H5Q A;  4KSM A;  4TKY A;  1URM A;  2GQM A;  3HDC A;  4JBB A;  5F0G A;  3FMW A;  1K0C A;  4F2I A;  3HZ4 A;  4HJM A;  2VL9 A;  4NWY A;  2B7J A;  1ILO A;  3TOU A;  4PQI A;  3G7Y A;  2V32 A;  3M8N A;  2FWF A;  3CRU A;  3Q6O A;  5J3R A;  5C00 A;  4PNG A;  4PGT A;  4O7H A;  3L9S A;  4PTS A;  3R3E A;  4NHZ A;  2RLI A;  3TKQ A;  1TXX A;  3HVV A;  4ECC A;  4QL7 A;  2TRX A;  3TRX A;  3KH9 A;  3KGK A;  3KTL A;  3CTG A;  4IKH A;  4MA9 A;  1K3L A;  4Q5F A;  3TRP A;  2X64 A;  4BL7 B;  3KTB A;  2KUC A;  1KNG A;  2MYG A;  3VFI A;  2PU9 C;  3U6V A;  5ECK B;  5HFK A;  3DIE A;  3GN3 A;  4G2E A;  4HS1 A;  4EIQ A;  1N8J A;  3D4T A;  5COH A;  3ZVJ D;  2GZZ A;  4WBJ A;  4ML6 A;  2GT6 A;  1OAZ A;  4MF5 A;  2OBK A;  4YQU A;  2YWN A;  3RPN A;  4OO5 A;  2VM1 A;  5F06 A;  2JZS A;  4K2X A;  4BL7 A;  5GAP D;  2HE3 A;  1V57 A;  4K8M A;  4NPB A;  1EGO A;  4GRF A;  4KE3 A;  3FYG A;  2HXK A;  9GSS A;  1M0U A;  6GST A;  2UZ8 A;  4MF7 A;  1GUM A;  3IOS A;  3QAV A;  3BCK A;  2L59 A;  2GQL A;  3TB2 A;  2MMA A;  3EWL A;  1XCC A;  1GSF A;  2AAW A;  4PNF A;  1XWG A;  2I4A A;  4RI6 A;  1SJ6 A;  2DC5 A;  1WOU A;  1V9W A;  2RUE A;  1T1V A;  1HQO A;  4TXO B;  5IMC A;  1GSS A;  2H74 A;  2ZNM A;  3GH9 A;  4KX4 A;  3ZVJ A;  2JAC A;  1SKR B;  4ECJ A;  3GH6 A;  2JZT A;  3HYP A;  4FIW A;  1TK0 B;  1YF1 A;  1YEX A;  3TKR A;  1ZCP A;  2REM A;  2CV4 A;  1ZYP A;  3Q19 A;  1B9X C;  2DKI A;  4TRX A;  4K9Z A;  2DBC A;  3DRN A;  3ZFB A;  4G0L A;  1K0A A;  2C0G A;  3MYD A;  3KMO A;  4DSQ A;  4POM A;  4KDU A;  1YQ1 A;  2H1A A;  5DAL B;  3GYK A;  1VGL A;  1PN9 A;  4PUF C;  5E59 A;  4ZIJ A;  16GS A;  2O89 A;  3P7X A;  3IV4 A;  5FWG A;  1B9Y C;  1S3C A;  4HU9 A;  1XOB A;  4NXI A;  3LEF A;  1ABA A;  3MWH A;  3QFB C;  2PVO C;  3I6A A;  4XS4 B;  5D9V A;  2FHE A;  4Q5R A;  1VF4 A;  4JRR A;  4X4J A;  5CYY A;  4I8B A;  2YZU A;  4AJ7 A;  1M9B A;  5DAL A;  2X8C A;  3BJ5 A;  5AGY A;  2H6Y A;  4E8E A;  5DDL A;  1Y6E A;  1PX6 A;  1WRY A;  4IQA A;  4PUA A;  3F4R A;  2NTO A;  2FWG A;  2IFQ B;  3QFA C;  3NIV A;  2H19 A;  1QGV A;  4IJ3 A;  2MMN A;  2NPB A;  1FOH A;  4XS6 A;  3TGZ A;  1QUW A;  1U88 A;  1F3A A;  3F3R A;  3GKN A;  2L5L A;  4POB A;  4L8E A;  3ZMK A;  5IPG A;  3QAG A;  4EVM A;  1XBS A;  4MLY A;  1GNE A;  1AIU A;  3HCZ A;  3EMP A;  1ST9 A;  1MEK A;  3LYK A;  1AQX A;  1XIY A;  5IMV A;  1S3A A;  3APS A;  1JZW A;  2AJQ B;  3UBK A;  6GSY A;  2CAI A;  1GLP A;  3PIN A;  1BX9 A;  5G1K A;  2P5R A;  3M9K A;  5INY A;  1ZGN A;  4KSO A;  3KZQ A;  1FB0 A;  4DEJ A;  1TRW A;  1E2Y A;  4EF0 A;  2O8V B;  19GS A;  1OE8 A;  3C1S A;  3G7I A;  2H30 A;  3HJO A;  1T4Z A;  4EXJ A;  1U3I A;  17GS A;  2JSY A;  18GS A;  3EIN A;  1GUL A;  3H79 A;  4RQX A;  2A2S A;  4F9Z A;  1FVK A;  1VF1 A;  2IPA A;  1O7U A;  4HDE A;  4K0G A;  2G0F A;  4BVX B;  3ERF A;  3A2V A;  3CBU A;  4TOP A;  5DAK A;  4MZW A;  4L5L A;  5ENU A;  4ZB8 A;  1M2D A;  2VD1 A;  5LCZ A;  3WGE A;  3P8W A;  2GSQ A;  4ZL8 A;  3PGT A;  4OD7 A;  4TR1 B;  2LRT A;  1M2A A;  2FA8 A;  1ON4 A;  3WT2 A;  4EKZ A;  2H71 A;  1PL2 A;  4MZC A;  1ZZY A;  3MNG A;  4ZXG A;  2H72 A;  4PX1 A;  1HYU A;  1A2M A;  3HA9 A;  1SK2 A;  5E4W A;  5KOW A;  1GSE A;  3LQ7 A;  3IDV A;  2MBT A;  2VO4 A;  3ZRE A;  1JLV A;  2B6M A;  2YPM A;  1K0N A;  3CSI A;  1J08 A;  5DCH A;  2QKE A;  4TR1 A;  5ID2 A;  4KA0 A;  3LXZ A;  1KTE A;  2EC4 A;  3IAM 2;  1EEM A;  5FT3 A;  2X8H A;  4FO5 A;  1TRS A;  3N5O A;  1SD8 A;  3BOA A;  3DVW A;  5LNK e;  2LTK A;  1XFL A;  1WJK A;  3KXO A;  3C8E A;  4OCF A;  5KN3 A;  1PKZ A;  2XBQ A;  4JED A;  5CRD A;  5JWQ B;  3ERW A;  4EO3 A;  4MH2 A;  1JZD A;  1GUH A;  5CNW A;  1QFN A;  3BBY A;  1GNW A;  5F07 A;  2WJU A;  2CAQ A;  3M0F A;  3M1G A;  5F05 A;  1NM3 A;  1I9D A;  22GS A;  2VLU A;  5L71 A;  2H76 A;  4G10 A;  4Q5Q A;  6GSU A;  4EC0 A;  2WCI A;  1OC9 A;  4WF5 A;  2E0Q A;  1F6M C;  4Z2U A;  2DIY A;  1PRX A;  2KP2 A;  3FK8 A;  2YP6 A;  2HRK A;  5J4U A;  3Q18 A;  2GLR A;  1TU8 A;  2OE1 A;  4IEL A;  3VWX A;  1JLW A;  1LJR A;  3H4K A;  4N0V A;  4IW9 A;  2M80 A;  1DSB A;  2PUK C;  4TXV A;  1SL2 B;  5IO0 A;  3TJB A;  4O92 A;  2WB9 A;  5F8B A;  2XPE A;  3PR8 A;  4G9H A;  1K3O A;  3KP9 A;  3TUE A;  3IE3 A;  1WIK A;  5A4W A;  1M99 A;  1A24 A;  1WWJ A;  2FUG 2;  2LV3 A;  2GSR A;  2LJR A;  4O5Q A;  5ECR B;  1G6W A;  2VOC A;  4MMM A;  4KDX A;  1NHY A;  1HNC A;  4G19 A;  1PQN A;  1X5E A;  4IHU A;  4HUA A;  2IL3 A;  1WE0 A;  3K8N A;  1AC1 A;  3D0Z A;  1G7O A;  3UL3 A;  2L4C A;  1ZMA A;  4GQC A;  3GTU B;  2LQQ A;  3GX0 A;  2NBS A;  4ISD A;  4EDZ A;  4MPF A;  3UBL A;  2KHP A;  5IMA A;  4GST A;  2LNT A;  2BJX A;  2G2Q A;  2R3X A;  3KJY A;  4X43 A;  2CX3 A;  3FZ4 A;  2MMZ A;  3H93 A;  4FH8 A;  1Z6M A;  3U5R E;  5G30 A;  5KN0 A;  2RII A;  5CO3 A;  4O5R A;  1TU7 A;  4KUN A;  5BMU A;  1EOH A;  3GTU A;  7GSS A;  2HRN A;  3ZLP A;  2QSI A;  3OR5 A;  2I9H A;  3DGQ A;  1RK4 A;  4GSS A;  1DUG A;  5JCG A;  2V6O A;  3ZL5 A;  3GMF A;  2FNO A;  3M9J A;  1M2B A;  3UOM A;  3APO A;  2OBI A;  3GHA A;  5B6N A;  4XS1 A;  2F51 A;  4ULX A;  4ZIL A;  2LRC A;  4L0U A;  2C3Q A;  2WUL A;  1EP8 A;  2FLS A;  2CA8 A;  3QDN A;  3TKS C;  2YN1 A;  2F3M A;  1V2A A;  4LL4 B;  3HKR A;  5DJM A;  3QCP A;  2ZCT A;  1R26 A;  3NZN A;  1Z5Y E;  2GST A;  1G7E A;  2ES7 A;  1I5G A;  2GZP A;  5DBQ A;  3LXT A;  1R7H A;  3EPT A;  2LEG A;  1PN0 A;  1THO A;  4PXO A;  2K18 A;  3BCI A;  3IHG A;  3BD2 A;  5B8B A;  4V2N A;  3Q74 A;  2LRN A;  3QAW A;  4I5Q A;  2YNX A;  4KDY A;  3TCO A;  2H1D A;  2HI7 A;  3LFL A;  3N9J A;  2PBJ A;  2A2R A;  2FWH A;  3TKS E;  5J41 A;  3FW2 A;  2LJA A;  3DWV A;  2YV7 A;  1EP7 A;  2KLX A;  3DD3 A;  3KH7 A;  4DSS B;  1SK1 A;  5AIS A;  4FYB A;  3ED3 A;  5ECS A;  2LKU A;  2AB6 A;  2PPT A;  3EU4 A;  1SYX A;  5G31 A;  1V98 A;  5IPH A;  3QR6 A;  4NV2 A;  3CRT A;  1KEB A;  2VIM A;  1TK5 B;  5JWO B;  5EVO A;  3O6T A;  3ZTL A;  2H0I A;  3QD9 A;  3LYP A;  1HNB A;  1EEJ A;  3M3M A;  1BG5 A;  3GKM A;  1FO5 A;  5A5K A;  1X0R A;  3GA4 A;  5CP1 A;  1SJZ A;  2H1B A;  4DSS A;  3QPM A;  2ALB A;  1SL1 B;  5IOW A;  5AN1 A;  2VLT A;  1AQW A;  4TXO A;  1OKT A;  3EMX A;  2BMX A;  3RAZ A;  1OC3 A;  2KP1 A;  3UJ1 A;  2DJ1 A;  4TW5 A;  2IN3 A;  2X4A A;  3HHV A;  4KAE A;  5EY6 A;  3LG6 A;  4GTU A;  1B48 A;  5GZZ B;  3KCM A;  2JU5 A;  2DIZ A;  3I9V 2;  4O5U A;  5IQY A;  1TKD B;  1UN2 A;  1YJ6 A;  5A4U A;  3CSJ A;  1F3B A;  3L9V A;  2VLV A;  3IBH A;  4J2F A;  5ECI B;  3IHQ A;  1AAZ A;  2C8U A;  5J9C A;  1BJX A;  1A0F A;  3LSZ A;  2CVK A;  3MAK A;  4K7O A;  3KM6 A;  2M46 A;  2K8V A;  4USS A;  2CX4 A;  1XW6 A;  4X0X A;  5IMZ A;  4BWQ A;  4GSN A;  3L78 A;  2C1Y A;  5CRG A;  2J23 A;  5B6M A;  4FYU A;  4K1F A;  3F4T A;  2WDU A;  4CW9 A;  1G6Y A;  1BED A;  1OYJ A;  2IMF A;  5HR2 A;  2WS2 A;  5GAN D;  1ZYQ B;  4XS4 A;  3CXG A;  2TIR A;  4AGS A;  1NHO A;  4L0W A;  4KH7 A;  2WRT A;  2E2G A;  4MK3 A;  4POK A;  1O8W A;  2WGR A;  4KW6 A;  2ON7 A;  2V6K A;  2HFD A;  4JR4 A;  2F8A A;  1OC8 A;  2R6K A;  3TKS A;  2GS3 A;  3D22 A;  3F4S A;  3ZZX A;  3FY7 A;  2GGT A;  3LWA A;  2B5Y A;  3JCM L;  2AUV A;  4XRD A;  4YKF A;  3GIX A;  4I97 A;  13GS A;  2YJH A;  4QL9 A;  4HI7 A;  5HFG A;  3L9U A;  2B1L A;  2B7K A;  1FVJ A;  2NDO A;  3TDG A;  2IFQ A;  1K0O A;  2HZE B;  2P0G A;  4Z7X A;  4F82 A;  3CYN A;  1RQM A;  3FR3 A;  4ECI A;  1JFU A;  3D21 A;  3GFK A;  3VI5 A;  4IN0 A;  1PL1 A;  3GST A;  4ACS A;  4POL A;  3UVH A;  2JZR A;  3TJF A;  3W6G A;  4F03 A;  2PWJ A;  3FHK A;  2DKH A;  4MJC A;  4LA1 A;  2HZE A;  3UAR A;  1ZYN A;  1XVQ A;  1AW9 A;  1F37 A;  2I3Y A;  2HRA A;  4N10 A;  1R4W A;  2KOK A;  5ELG A;  2IMD A;  3E3E A;  2CVB A;  4N11 A;  2V1M A;  3UEM A;  1J0F A;  2YJ7 A;  5H5R A;  1FOV A;  4MAB A;  1EV9 A;  1J9B A;  3LJR A;  2N5B A;  5CRH A;  1E6B A;  3EUR A;  1GSQ A;  1YF0 A;  2YWO A;  3EVI A;  2TRC P;  2DMM A;  4V2L A;  4BWS A;  1OKD A;  4YQM A;  4X1U A;  1W89 A;  3S9F A;  3VWW A;  5ECP B;  2E2M A;  5AIV A;  2ZUP A;  1K0D A;  2BTO T;  4KCA A;  2X99 A;  2DSA A;  1TRU A;  1SJI A;  4HZ4 A;  1SYR A;  3UIW A;  4BVX A;  1PX7 A;  4EIP A;  10GS A;  4EL1 A;  4HJ2 A;  5HR1 A;  2R2J A;  2CQ9 A;  2V2G A;  2HZF A;  2QC7 A;  3FRC A;  2K6V A;  4N0Z A;  3DYR A;  1UA5 A;  5ELA A;  4ZBA A;  4LMW A;  1TDI A;  4MZB A;  3ME7 A;  2DLX A;  3TRQ A;  3RBT A;  4ML1 A;  2R37 A;  3CMI A;  5CRW A;  4GCI A;  4HU7 A;  2DML A;  2OE0 A;  1LU4 A;  4AF2 A;  2R0G A;  3DML A;  4I2U A;  5JCU A;  1V58 A;  2VCT A;  2FY6 A;  3WT1 A;  4V1A p;  3DVX A;  1GTI A;  2N5F A;  2QA1 A;  2CZ3 A;  2OA7 A;  3KP8 A;  4O32 A;  3F3Q A;  3VK9 A;  3MSZ A;  4YKG A;  1KBN A;  4XTS A;  1A2J A;  4KND A;  4CDO A;  4DSR A;  3IR4 A;  4JZQ A;  1EOG A;  1B4P A;  1XWC A;  5DJL A;  1OVN A;  4OO4 A;  3ERG A;  2R5G A;  2PMT A;  3QOU A;  4IQ1 A;  3CTF A;  5ECO B;  5B7C A;  3ZYW A;  3VUR A;  2OAC A;  4OCE A;  2OJL A;  2GDR A;  1XW5 A;  3D6I A;  1WMJ A;  6GSV A;  4MJA A;  1GTU A;  4K7I A;  1SL0 B;  4MH3 A;  4DVC A;  4GF0 A;  1ERV A;  1A23 A;  1TTZ A;  2FD3 A;  3MDK A;  2R0P A;  1H75 A;  3IK9 A;  4OMV A;  3KEB A;  1GSY A;  1T3B A;  1EZK A;  1SKS B;  3ZIV A;  4J57 E;  2HSM A;  1GTA A;  5CRE A;  3A5I A;  4JR6 A;  3H1N A;  1MDJ A;  3DKS A;  3E9J B;  2X8G A;  1T7P B;  1GLQ A;  4TN8 A;  4BA7 A;  1Z9H A;  2LST A;  1TOF A;  1GUK A;  4EUY A;  4ZB9 A;  1A8Y A;  3C1R A;  2H8L A;  1TI3 A;  2LNS A;  3GSS A;  2H6Z A;  3TJG A;  3P90 A;  3KMN A;  5B8A A;  3W8S A;  4F0B A;  4HQZ A;  4YH2 A;  1HD2 A;  3P2A A;  3F63 A;  5D9T A;  4AJ8 A;  3VI7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...