1TRVA

The high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords THIOREDOXIN
publication title The high-resolution three-dimensional solution structures of the oxidized and reduced states of human thioredoxin.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1994-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1trvA00
2PBJA 5LD0A 1WWJA 2GQKA 3CTGA 4NV5A 3GIXA 5CYYA 4OFMA 3IC4A 4KDXA 4POMA 3FK8A 4K7IA 4KE3A 4L5OA 2EIRA 2CAIA 2GZYA 7GSSA 1K0MA 1BX9A 4TN8A 4X43A 4LL1B 4TXOA 5D93A 4F03A 5LNKe 3KCMA 3RHBA 5IMCA 5JWOB 1MDKA 4YAVA 3BBYA 2L5OA 1PRXA 2OE3A 2I3YA 2VM2A 5IM9A 1HYUA 4GQCA 4ACSA 4Q5FA 2GQLA 1PL1A 3ZL5A 5IQYA 1V2AA 1DE2A 3EMPA 1EP7A 2X8HA 3IRAA 4I5QA 4KCEA 4MZBA 2JSZA 3TB2A 3F8UA 4Q5QA 1K3LA 4TW5A 3LGCA 2M46A 3ZTLA 4GRFA 3FY7A 4LA1A 4NV2A 5HQPA 3GURA 3FR3A 3QAWA 4ECIA 6GSSA 2QGVA 3F4SA 4E8EA 1SJZA 4GXZA 4EE0A 1KBNA 4MP4A 4IW9A 2VL3A 2CV4A 1Z6NA 4ZB9A 2CZ2A 3FZ9A 4Q5RA 3FYGA 1ZYEA 1ACVA 1GSDA 2DJ0A 3S9FA 2OBIA 1MDIA 2FA8A 5ECIB 3HVSA 4WBJA 4BVYA 1OC9B 1JLVA 4JZQA 4K0GA 2B7KA 4RI6A 5ECQB 3F0IA 5ENUA 3DYRA 2FWGA 3P7XA 5ECLB 5IMDA 1X5DA 2G0FA 1NM3A 1XZOA 5CRHA 2O87A 2PMTA 3Q6OA 2P5RA 4Q5NA 1OYJA 1A2MA 4PUAA 3WGDA 1SJ6A 16GSA 4J2FA 3TJBA 1F3BA 2YV7A 1F6MC 1PMTA 3L9SA 4ZL7A 2E2MA 3RHCA 5F0GA 2IMDA 4MJBA 2KOKA 1YQ1A 2JZTA 5ECRB 2PU9C 4X1UA 1G6YA 2B5EA 1MD3A 4L5LA 3C7MA 2XPEA 2FUG2 1F3AA 4TR1B 1X0RA 1KTEA 4MJAA 2P31A 1G7EA 6GSYA 2HSYA 1K0CA 2WRTA 3AY8A 4LL4B 2PWJA 1THXA 2N5AA 5B6MA 3ZIVA 3O3TA 5IMVA 1AQXA 1UN2A 5G2ZA 5AN1A 2XBQA 3DWVA 1JZWA 3F4TA 4ZILA 3CTFA 3UAPA 3ZMLA 4GF0A 3GTUB 5ECHB 4TRXA 3IK9A 5ECMB 3QFAC 4YQUA 2AJQB 1ABAA 4HUAA 4F9ZA 1GP1A 2XHFA 3G7JA 3ZRDA 1FO5A 3DRNA 3BCIA 2GGTA 2F9SA 3KH7A 2IJYA 4BVXA 1W4VA 3HJMA 5CNWA 4ZBDA 4HOJA 3EVIA 2YCDA 1O8WA 2B6MA 1JFUA 4NMUA 5CRDA 1ERVA 2B3SA 2AAWA 3MWHA 3BJ5A 4NHZA 1JZOA 1JZDA 3D22A 3GRXA 1Z6MA 4GSSA 5B6NA 1HNBA 5CP1A 2IWTA 4EC0A 3LJRA 4KDYA 2PUKC 4HDEA 4POKA 1O6JA 1QFNA 3LFLA 3KMOA 4BL7A 2R5GA 1K3OA 1PA3A 4EDYA 3F4RA 3LYPA 1YEPA 3TRPA 1K0NA 3GUSA 4IQ1A 2LNTA 1GULA 1EOHA 3KGKA 1ST9A 2NTOA 1JHBA 4J57E 5DAKA 4P3YB 2JADA 3KP9A 1I5GA 1EGRA 2YZUA 2LRCA 20GSA 3ME7A 4IS0A 4WXTA 2RUEA 3C73A 2B1LA 2PGTA 1EV4A 4JRRA 3ERFA 5DQYA 1AAZA 2FD3A 2C8UA 2YWMA 3CSJA 2DJ3A 1TK8B 2WDUA 2B7JA 1URMA 5IMAA 3IR4A 3WT1A 2VM1A 2GSSA 5AGYA 4BPYA 1LJRA 4JBBA 4MCUA 2L57A 1O73A 1ON4A 3DVXA 4XS1A 1WOUA 1V57A 4OFNA 3TDGA 3ED3A 5DJLA 4WKWA 4OCEA 1SENA 2FWEA 1HNCA 1V40A 3QAGA 4QL9A 2IN3A 6GSUA 3I6AA 2VCVA 2OACA 1GSEA 1GRXA 3LSZA 4KDUA 2FWFA 4ECCA 2AV4A 4V1Ap 5KN2A 1BAYA 4WBRD 3ZVJD 3R2QA 1NSWA 5ECNB 2KP1A 3I9V2 4TOPA 14GSA 5FWGA 4L8EA 3KD0A 4XS6A 3RPNA 3E0UA 1M9BA 3IDVA 4TR1A 4PGTA 2ALBA 1Z7PA 4WR5A 3ZLPA 1FW1A 3GFKA 2L59A 4MK3A 4POLA 3G7IA 1A8LA 4K9ZA 5FT3A 1GL8A 4IN0A 1EV9A 2Z9SA 4G9HA 4CDOA 5D9WA 2B5YA 3UBKA 1J0FA 2CQ9A 3TJFA 3HVXA 3KJYA 2OKAA 3IPZA 1LU4A 3TGZA 1B4PA 3VWVA 3GV1A 3ZYWA 3QFBC 3IBHA 2LV3A 1X9WB 2N5FA 3C1RA 4TR3A 3DXBA 1PSQA 4GTUA 3E3EA 5GSTA 3VI7A 3IAM2 4EUYA 1GSFA 1PN9A 3DMLA 4JU5A 4KAEA 1T8EB 3EC3A 1QGVA 1RW1A 4PXOA 5A4WA 3JCML 1GUMA 2H6YA 1GSQA 2FNOA 3IOSA 2VUPA 2VO4A 1F9MA 4F0CA 2I1UA 1RK4A 2X99A 3VPTA 3FZ5A 3IHQA 1N8JA 4OMVA 2JL4A 5EVOA 1XW5A 3A2XA 4IP6A 2V32A 1SK0A 3ZMKA 3HKRA 1R5AA 4DVCA 4J56E 3GKKA 4MLYA 2YN1A 4O7HA 3VWWA 1ZZYA 5KN3A 4MF6A 2N5BA 4JR6A 4YQMA 4MJCA 1GNEA 1JLWA 4AJ6A 4DSSB 3P8WA 3ZIJA 2H01A 1WP0A 2DLXA 5IPGA 3GH9A 1NHOA 3SBCA 1DE1A 2FY6A 1GTIA 4FYCA 2OJLA 3QAVA 5JWRB 2FA4A 2HSHA 2RUFA 5D96A 3ZITA 2MBTA 1ZOFA 3ZZXA 2C0DA 4IP1A 5GAPD 1SYRA 2C0GA 2C1YA 3D21A 5G5FA 2MMNA 2F8AA 1YF0A 2F51A 4CHSA 2L6DA 1F37A 4KW6A 1UA5A 4ECBA 3HCZA 4HZ4A 4ZB8A 3TKQA 1XOAA 2NDOA 1DUGA 6GSVA 3D4MA 2J9HA 2FCHA 1UVZA 2DJKA 1AW9A 1WJKA 2C0EA 1U88A 1CQHA 1VRSD 3QDNA 2I4AA 4HEA2 3HD5A 4V2LA 3VWUA 1LBKA 3WYWA 4HQZA 3M1GA 3DVWA 5A4VA 3UEMA 2ZCTA 2ZUPA 1GWCA 1TKDB 1U3IA 3GL3A 2A2RA 5ECPB 3ZFLA 3GHAA 1K3YA 4N11A 2R6KA 5EL8A 5C04A 5AISA 4O32A 1YDKA 2FHEA 2X8CA 3ERGA 1MTCA 4EL1A 2F3MA 1OC8A 2A2SA 1SL1B 4LMWA 1GH2A 5A5KA 2B5XA 4MF5A 1K0DA 2H73A 2YJ7A 1SL2B 1N2AA 1GUHA 4I2TA 1SJIA 2CVKA 2MYGA 3Q74A 5JWQB 1Z5YE 2M72A 2E0QA 2RLIA 2GZPA 2LEGA 3M8NA 6GSWA 1A23A 1XXUA 2H8LA 2HRFA 1YF1A 4MZCA 2HZEA 3APSA 2L5LA 3TKSE 3RAZA 5FHIA 2EIOA 2K8SA 2WB9A 2GT6A 3G9BA 4K2DA 1PGTA 3C8EA 1J08A 3VFIA 4ECJA 2WCIA 4OCFA 1GLPA 2H1GA 2H0IA 3ZREA 3IXRA 4ZBAA 1GNWA 1WE0A 3C1SA 3FW2A 1AUCA 1TDIA 5IMFA 2OE1A 1WMJA 1CQGA 3M9JA 2C4JA 3GYKA 2TRXA 1G6WA 1J9BA 4QQ7A 2KHPA 2WULA 2IFQB 2TIRA 3LEFA 2K8VA 5G1KA 1AC1A 4L0UA 2PVOC 3H4KA 5HFIA 1FG4A 1TRSA 3NZNA 5LCZA 2C3TA 1SD8A 1E2YA 3CBUA 3P90A 3KM6A 3VK9A 1S3AA 1Z9HA 2LJAA 3APQA 3KMNA 1W89A 3W8JA 4FIWA 3KZQA 2VOCA 2F8FA 2VLTA 3LQ7A 1XWGA 2DIZA 2GSTA 2KUCA 2V2GA 3RDWA 3F3QA 1TOFA 4N0ZA 2O85A 2WFCA 1FAAA 5D73A 1FB6A 4IQAA 1XW6A 2C80A 4TR4A 2YWNA 4KSOA 2HE3A 4X0XA 3VWXA 3IAS2 3HZ8A 5D9VA 1TRUA 5IPHA 1FVJA 1ERWA 2K6VA 1TXXA 2CA8A 1EEMA 1XWBA 5ID2B 1A0RP 2BTOT 3EE2A 5EPFA 1SK2A 3W6GA 5H5SA 4EF0A 2LQQA 2CT6A 1IYHA 1XVQA 3MDKA 1R7HA 3MNGA 3UVHA 3L78A 2P5QA 3FZ4A 3J7Yb 5H5RA 1PX6A 4BWSA 4HU9A 5IO0A 4EDZA 2YZHA 3PINA 3FKFA 5J4UA 3FRCA 3EURA 3U6VA 3C71A 1TRWA 4XS4B 12GSA 4LMVA 4GSNA 2A4VA 1T00A 3WGEA 3F63A 5F07A 4D73B 1SL0B 1IYIA 4G19A 5HR0A 3VI5A 2JZSA 1ERTA 2LS5A 3TKSA 1Q98A 1SU9A 4DSQA 4N30A 1Z3EA 2LJKA 3D0ZA 1I9DA 1YY7A 3I69A 3TKSC 3BCKA 4YQVA 4PQIA 2OA7A 3CYNA 2MMZA 5DQSA 5E4WA 2WJUA 4L0WA 2GVPA 2QC7A 4NWYA 5B7CA 3GSTA 4V2NA 1GUKA 3U5RE 3HY2A 4KB3A 3EMXA 2DSAA 2VLVA 4IGJA 1ZCPA 3N5OA 4QL7A 2HZFA 3IA1A 5IOWA 1K0AA 1GTAA 4HS1A 4YAPA 2MZCA 3DEXA 3E9JB 1K0OA 1U6TA 4I2UA 2IMIA 3UBLA 1SKSB 4I6XA 3LXTA 1USBA 1ZYQB 3CSHA 4N10A 2H1AA 4I97A 2RM6A 4GWRA 3TOUA 3D5JA 1YKCA 1C72A 2CAQA 2CZ3A 2V6KA 3IV4A 1O85A 2P0GA 4AGSA 3BOAA 1OC9A 4H86A 1R26A 2QKEA 2BMXA 3A5WA 1XVWA 3K8NA 1OC3A 22GSA 3GMFA 3IE3A 2R2JA 4ZL8A 2GQMA 3L9VA 3GL5A 1X5EA 1MEKA 2HFDA 4WF4A 5E59A 1AQWA 5D9TA 3APOA 2H74A 4V2MA 2O7KA 8GSSA 1M7TA 1PL2A 4YH2A 4MABA 3FEUA 1Y6EA 1V98A 3KIJA 5ABRA 3D4TA 1VGLA 2G2QA 2HRNA 1SKRB 3CRTA 1S3DA 2REMA 4TXVA 2WGRA 4GQFA 4FO5A 1FVKA 1XWKA 5L71A 1ZMAA 1PX7A 2V41A 4BWQA 1TU8A 13GSA 3ZVJA 17GSA 4G10A 19GSA 4K0NA 1T7PB 4OD7A 3D6IA 4JR4A 5J3RA 1ZGNA 1XFLA 2R3XA 2H71A 1OAZA 2DJ2A 1T4YA 2JACA 3FHKA 3GKMA 3GTUA 1OE7A 4HQSA 3ISOA 3GSSA 2VIMA 4F82A 1KNGA 1A24A 2HNLA 3DGQA 4O92A 1PKZA 4GCIA 4AJ7A 1B4QA 5KN1A 1B9YC 3LWAA 4NXIA 3SWLA 4KGIA 1QUWA 2K9FA 5JCWA 3UVTA 5DVBA 3QR6A 4FH8A 18GSA 4I8BA 4EXJA 1KEBA 4ID0A 2VCQA 3F6FA 3QOUA 1VF3A 4PURA 2GSQA 2GTUA 5DBQA 2GLRA 4D73A 6GSTA 1DBYA 1UC7A 5EY6A 5ECKB 2WS2A 5A4UA 2H0GA 5CREA 3HXSA 4LLRA 2GDRA 2V6OA 3H1NA 2K18A 1TK0B 4ZBBA 3ERWA 10GSA 2X64A 1A0FA 3GA4A 3UMAA 1XPVA 1XWCA 1QXHA 4ZXGA 3LORA 2V1MA 5HFGA 2LSTA 4HJ2A 4MMMA 4F0BA 4MZWA 3IK7A 1WPIA 4MA9A 3VPQA 4WR4A 5HR2A 4EVMA 3TUEA 5ECOB 1OVNA 1HD2A 4EKZA 2H76A 4RI7A 1HNAA 3CRUA 2JZRA 4XTSA 4NAXA 4WETA 2JSYA 2VL2A 3WGXA 1R4WA 1GSSA 2DC5A 2VL2C 3OR5A 3A2WA 3QPMA 1EEJA 5CRGA 1PD21 1EOGA 4IVFA 2LRTA 1EWXA 3J7Yk 2LJRA 3L4NA 4IELA 2DJJA 3US3A 2LNSA 3TKRA 5INYA 2KP2A 3PR8A 3QD9A 3TJGA 5KEJA 1VF4A 1GTBA 2FGXA 1ZL9A 2VAFA 3UARA 2YP6A 4BA7A 4HJMA 3TJJA 4ML1A 1BEDA 2AB6A 1A8YA 1PKWA 3MAKA 4XIHA 9GSSA 5G31A 4MF7A 4POBA 6GSXA 1TTZA 5COHA 1X9MB 2DMMA 2RM5A 3DD3A 2LQOA 5JCUA 3LXZA 5DCGA 4ML6A 3F6DA 1YEXA 2H1DA 2LUSA 4KSMA 5J9CA 2HYXA 4RQRA 2NVLA 2DMLA 3KXOA 1GSUA 1QK8A 1QMVA 1FOVA 1M2DA 3I43A 5DAKB 5ECSA 1V58A 1AQVA 1O8XA 3KP8A 1A2LA 4PNFA 3WT2A 1BYEA 2L4CA 11GSA 1Q4JA 2XPDA 2H19A 3TKPA 1SKWB 4JEDA 2CX3A 5CRWA 1B48A 5J5NA 5J41A 3EINA 4KNDA 1O7UA 5B8AA 4PQHA 3TRQA 2EC4A 2TRCP 2PVQA 2E7PA 1M2BA 3ME8A 4XCSA 2VL9A 2JU5A 4V1Ag 3KTLA 3GH6A 1YKAA 3HA9A 2IMKA 2VLUA 4Z7XA 4MH3A 1GTUA 3L9UA 5J9BA 2BJXA 3RPPA 2DBCA 1U3AA 3DIEA 4HZ2A 3CXGA 1B8XA 1VF1A 4TVEA 5DCHA 2IIYA 2YANA 3L0HA 2H72A 3KTBA 2OE0A 5HFKA 3HZ4A 3GX8A 1VF2A 2B1KA 1XIYA 2KLXA 3WD6A 4MH2A 3GKXA 1AIUA 5F8BA 1SK1A 3RBTA 5DALB 3PGTA 5ELAA 3HDCA 2H1BA 3FR9A 1FHEA 1TJDA 3UL3A 5H5QA 4DSSA 3F3RA 1MD4A 1OKDA 3G7YA 2C3QA 3KH9A 4MDCA 5AIXA 1WRYA 4ULXA 2H6XA 1BQ7A 3FZAA 1XWAA 2QSIA 2YNXA 3NIVA 3LG6A 3FR6A 3LYKA 1XBSA 4XRAA 2E2GA 4FYUA 4OWYA 3MSZA 2IMEA 5GSSA 2MBSA 4KX4A 4NPBA 2VD0A 4KH7A 4OFTA 2C3NA 1AXDA 2MMOA 3EYTA 4AF2A 4K6XA 5HR1A 1Z7RA 2HXKA 4K7OA 3HHVA 2M80A 1E6BA 3HYPA 1F2EA 1XW9A 1YJ6A 1RQMA 4PX1A 4DSRA 3PH9A 3M0FA 3A3TA 4AJ8A 2D2ZA 4E8HA 4RUVA 2H0HA 4GSTA 1HQOA 1XOBA 3O6TA 4KA0A 2GT5A 1ILOA 3GN3A 2XC2A 3DKSA 2DIYA 4MPFA 4EO3A 1TU7A 5CO3A 1NW2A 1V9WA 5IOXA 1WIKA 1OKTA 3F9UA 3EWLA 3GX0A 5GAND 2IMFA 1T1VA 3Q19A 2CVBA 3TOTA 3W8SA 5HR3A 2CVDA 2L6CA 3A2VA 2LRNA 1G0TA 2H66A 2ES7A 1T3BA 2GZZA 5DDLA 4TR0A 2I81A 5JCGA 4HU7A 5CAXA 4OO5A 2PPTA 2DJ1A 1TW9A 4WF5A 3UIWA 2YOIA 2ZNMA 2I9HA 1R5PA 1TI1A 1BG5A 3P2AA 1M2AA 2HI7A 4IBPA 3VURA 5DJMA 2FLSA 3GKNA 2AYTA 3VLNA 3UJ1A 5F05A 1ML6A 1BJXA 3NOFA 4TXOB 2OADA 4N0VA 3H93A 2L4QA 2XBIA 2VCZA 1A2JA 5G1LA 1ERUA 2C0FA 4FYBA 2H75A 1XCCA 2J23A 4ZL9A 2IFQA 1X5CA 5GZZB 2YV9A 4O5RA 4IHUA 2MMAA 5G30A 2VCXA 3TJKA 5KN0A 2EIQA 3GNJA 3M3MA 5C00A 2H30A 4OO4A 1OE8A 4XRDA 2PN8A 4KUNA 2VCTA 4HI7A 4RQXA 1TRVA 5G5EA 4PUFC 3ZFBA 3M9KA 5DALA 4MJEA 1H4OA 4XHMA 4PNGA 4CW9A 4ILFA 5AIVA 4IJIA 2VD1A 2YWOA 1O81A 2YJHA 3EU3A 1K0BA 3QMXA 2LTKA 5IMZA 4WEYA 4TKYA 2WZ9A 3KEBA 2OBKA 2FWHA 2RIIA 1GSYA 3UOMA 5IO2A 1M0UA 2HZEB 1EGOA 5D8IA 1H75A 1M99A 1S3CA 2GSRA 3TCOA 2VCWA 1FB0A 1EP8A 3V1WA 5ID2A 3EU4A 1TP9A 2HLSA 3HJOA 1G7OA 2NPBA 4DEJA 4K8MA 1Y25A 1NHYA 1YZXA 1GLQA 2IPAA 3CMIA 2CX4A 5ELGA 2PERA 1QQ2A 1SYXA 3H79A 4XS4A 1T4ZA 1EZKA 2R37A 1X9SB 2IL3A 2H6ZA 2R4VA 1THOA 3CSIA 2GS3A 2LKUA 2YWIA 1U87A 3TRXA 2X8GA 1TI3A 3N9JA 1B9XC 4IJ3A 2AUVA 1MDJA 4K7NA 3Q18A 2O8VB 4G2EA 3BD2A 2YPMA 4ISDA 3HJPA 4ZIJA 5F06A 3O76A 2HT9A 4IKHA 4F2IA 2AHEA 2H70A 5D9XA 2ON7A 2O89A 2ON5A 2NBSA 1JZRA 1DSBA 4NHWA 4PQ1A 1TK5B 5B8BA 1PQNA 1M9AA 4MPGA 4GLTA 4K1FA 5IIZA 4KCAA 4JE1A 3HVVA 4ZB6A 3H8QA 3QCPA 1SD9A
chains in the Genus database with same CATH superfamily
2PBJA 5LD0A 1WWJA 2GQKA 3CTGA 4NV5A 3GIXA 5CYYA 4OFMA 3IC4A 4KDXA 4POMA 3FK8A 4K7IA 4X4JA 4KE3A 4L5OA 2EIRA 2CAIA 2GZYA 7GSSA 1K0MA 1BX9A 4TN8A 4X43A 4LL1B 4TXOA 5D93A 4F03A 5LNKe 3KCMA 3RHBA 5IMCA 3A5IA 5JWOB 1MDKA 4YAVA 3BBYA 2L5OA 1PRXA 2OE3A 2HRKA 2I3YA 2VM2A 5IM9A 1HYUA 3IHGA 4GQCA 4ACSA 4Q5FA 2GQLA 1PL1A 3ZL5A 5IQYA 1V2AA 1DE2A 3EMPA 1EP7A 2X8HA 3IRAA 4I5QA 4KCEA 4MZBA 2JSZA 3TB2A 3F8UA 4Q5QA 1K3LA 4TW5A 3LGCA 2M46A 3ZTLA 4GRFA 3FY7A 4LA1A 4NV2A 5HQPA 3GURA 3FR3A 3QAWA 4ECIA 6GSSA 2QGVA 3F4SA 4E8EA 1SJZA 4GXZA 4EE0A 1KBNA 4MP4A 4IW9A 2VL3A 2CV4A 1Z6NA 4ZB9A 2CZ2A 3FZ9A 4Q5RA 3FYGA 1ZYEA 4A5PA 1ACVA 1GSDA 2DJ0A 3S9FA 2OBIA 1MDIA 2FA8A 5ECIB 3HVSA 4WBJA 4BVYA 1OC9B 1JLVA 4JZQA 4K0GA 2B7KA 4RI6A 5ECQB 3F0IA 5ENUA 3DYRA 2FWGA 3P7XA 4G0IA 5ECLB 5IMDA 1X5DA 2G0FA 1NM3A 1XZOA 5CRHA 2O87A 2PMTA 3Q6OA 2P5RA 4Q5NA 1OYJA 1A2MA 4PUAA 3WGDA 1SJ6A 16GSA 4J2FA 3TJBA 1F3BA 2YV7A 1F6MC 1PMTA 3L9SA 4MNNA 4ZL7A 2E2MA 3RHCA 5F0GA 2IMDA 4MJBA 2KOKA 1YQ1A 2DKHA 2JZTA 4BIKA 5ECRB 2PU9C 4X1UA 1G6YA 2B5EA 1MD3A 4L5LA 3C7MA 2XPEA 2FUG2 1F3AA 4TR1B 1X0RA 1KTEA 4MJAA 2P31A 3MYDA 1G7EA 6GSYA 2HSYA 1K0CA 2WRTA 3AY8A 4LL4B 2PWJA 1THXA 2N5AA 5B6MA 3ZIVA 3O3TA 5IMVA 1AQXA 1UN2A 5G2ZA 5AN1A 2XBQA 4CY8A 3DWVA 1JZWA 3F4TA 4ZILA 3CTFA 3UAPA 3ZMLA 4GF0A 3GTUB 5ECHB 4TRXA 3IK9A 5ECMB 3QFAC 4YQUA 2AJQB 1ABAA 3LW9A 4HUAA 4F9ZA 1GP1A 2XHFA 3G7JA 3ZRDA 1FO5A 3DRNA 3BCIA 5BRTA 2GGTA 2F9SA 3KH7A 2IJYA 4BVXA 1W4VA 3HJMA 5CNWA 4ZBDA 4HOJA 3EVIA 2YCDA 1O8WA 2B6MA 1JFUA 4NMUA 5CRDA 1ERVA 2B3SA 2AAWA 3MWHA 3BJ5A 4NHZA 1JZOA 1JZDA 3D22A 3GRXA 1Z6MA 4GSSA 5B6NA 1HNBA 5CP1A 2IWTA 4EC0A 3LJRA 4KDYA 2PUKC 2DKIA 4HDEA 4POKA 1O6JA 1QFNA 3LFLA 3KMOA 4BL7A 2R5GA 1K3OA 1PA3A 4EDYA 3F4RA 4K5SA 3LYPA 1YEPA 3TRPA 1K0NA 3GUSA 4IQ1A 2LNTA 1GULA 1EOHA 3KGKA 1ST9A 2NTOA 1JHBA 4J57E 5DAKA 4P3YB 2JADA 3KP9A 1I5GA 1EGRA 2YZUA 2LRCA 20GSA 3ME7A 4IS0A 4WXTA 2RUEA 3C73A 2B1LA 2PGTA 1EV4A 4JRRA 3ERFA 5DQYA 1AAZA 2FD3A 2C8UA 2YWMA 3CSJA 2DJ3A 1XG8A 1TK8B 2WDUA 2B7JA 1URMA 5IMAA 4O5QA 3IR4A 3WT1A 2VM1A 2GSSA 5AGYA 4BPYA 1LJRA 4JBBA 4MCUA 2L57A 1O73A 1ON4A 3DVXA 4XS1A 1WOUA 1V57A 4OFNA 3TDGA 3ED3A 5DJLA 4WKWA 4OCEA 1SENA 2FWEA 1HNCA 1V40A 3QAGA 4QL9A 2IN3A 6GSUA 3I6AA 2VCVA 2OACA 1GSEA 1GRXA 3LSZA 4KDUA 2FWFA 4ECCA 2AV4A 4V1Ap 5KN2A 1BAYA 4WBRD 3ZVJD 3R2QA 1NSWA 5ECNB 2KP1A 3I9V2 4TOPA 14GSA 5FWGA 4L8EA 3KD0A 4XS6A 3RPNA 3E0UA 1M9BA 3IDVA 4TR1A 4PGTA 2ALBA 1Z7PA 4WR5A 2R0PA 3ZLPA 1FW1A 3GFKA 2L59A 4MK3A 4POLA 3G7IA 4YKGA 1A8LA 4K9ZA 5FT3A 1GL8A 4IN0A 1EV9A 2Z9SA 4G9HA 4CDOA 5D9WA 2B5YA 2A2PA 3UBKA 1J0FA 2CQ9A 3TJFA 3HVXA 3KJYA 2OKAA 3IPZA 1LU4A 3TGZA 1B4PA 3CQFA 3VWVA 3GV1A 3ZYWA 3QFBC 3IBHA 2LV3A 1X9WB 2N5FA 4EIQA 3C1RA 4TR3A 3DXBA 1PSQA 4GTUA 2X4AA 3E3EA 5GSTA 3VI7A 3IAM2 4EUYA 1GSFA 1PN9A 3DMLA 4JU5A 4KAEA 1T8EB 3EC3A 1QGVA 1RW1A 4PXOA 5A4WA 3JCML 1GUMA 2H6YA 1GSQA 3MIXA 2FNOA 3IOSA 2VUPA 2VO4A 1F9MA 4F0CA 2I1UA 1RK4A 2X99A 3VPTA 3FZ5A 3IHQA 5KOXA 1N8JA 4OMVA 2JL4A 5EVOA 1XW5A 3A2XA 4IP6A 2V32A 4Z2RA 1SK0A 3ZMKA 3HKRA 1R5AA 4DVCA 4J56E 3GKKA 4MLYA 2YN1A 4O7HA 3VWWA 1ZZYA 5KN3A 4MF6A 2N5BA 4JR6A 4YQMA 4MJCA 1GNEA 1JLWA 4AJ6A 4DSSB 3P8WA 3ZIJA 2H01A 1WP0A 2DLXA 5IPGA 3GH9A 1NHOA 3SBCA 1DE1A 2FY6A 1GTIA 4FYCA 2OJLA 3QAVA 5JWRB 2FA4A 2HSHA 2RUFA 5D96A 3ZITA 2MBTA 1ZOFA 3ZZXA 2C0DA 4IP1A 5GAPD 1SYRA 2C0GA 2C1YA 3D21A 5G5FA 2MMNA 2F8AA 1YF0A 2F51A 4CHSA 2L6DA 1F37A 4KW6A 1UA5A 4ECBA 3HCZA 4HZ4A 4ZB8A 3TKQA 1XOAA 1M3JA 2NDOA 1DUGA 6GSVA 3D4MA 2J9HA 2FCHA 1UVZA 2DJKA 1AW9A 1WJKA 2C0EA 1U88A 1CQHA 1VRSD 3QDNA 3EPTA 2I4AA 4HEA2 3HD5A 4V2LA 3VWUA 1LBKA 3WYWA 4HQZA 3M1GA 3DVWA 5A4VA 3UEMA 2ZCTA 2ZUPA 1GWCA 1TKDB 1U3IA 2A4HA 3GL3A 2A2RA 5ECPB 3ZFLA 3GHAA 1K3YA 4N11A 2X49A 2R6KA 5EL8A 5C04A 5AISA 2HRAA 4O32A 1YDKA 2FHEA 2X8CA 3ERGA 1MTCA 4EL1A 2F3MA 1OC8A 2A2SA 4Z2TA 1SL1B 4LMWA 1GH2A 5A5KA 2B5XA 4MF5A 1K0DA 2H73A 2YJ7A 1SL2B 1N2AA 1GUHA 4I2TA 3PPUA 1SJIA 2CVKA 2MYGA 3Q74A 5JWQB 1Z5YE 2M72A 2E0QA 2RLIA 2GZPA 2LEGA 3M8NA 6GSWA 1A23A 1XXUA 2H8LA 2HRFA 1YF1A 2R0CA 4MZCA 2HZEA 3APSA 4Z2UA 2L5LA 3TKSE 3RAZA 5FHIA 2EIOA 2K8SA 2WB9A 2GT6A 3G9BA 4K2DA 1PGTA 3C8EA 1J08A 3VFIA 4ECJA 2WCIA 1FOHA 4OCFA 1GLPA 2H1GA 2H0IA 3ZREA 3IXRA 4ZBAA 1GNWA 1WE0A 3C1SA 3FW2A 1AUCA 1TDIA 5IMFA 2OE1A 1WMJA 1CQGA 3M9JA 2C4JA 3GYKA 2TRXA 1G6WA 1J9BA 4QQ7A 2KHPA 2WULA 2IFQB 2TIRA 3LEFA 2K8VA 5G1KA 1AC1A 4L0UA 2PVOC 3H4KA 5HFIA 1FG4A 1TRSA 3NZNA 5LCZA 2C3TA 1SD8A 1E2YA 3CBUA 3P90A 3KM6A 3VK9A 1S3AA 1Z9HA 2LJAA 3APQA 3KMNA 1W89A 3W8JA 4FIWA 3KZQA 2VOCA 2F8FA 2VLTA 3LQ7A 1XWGA 2DIZA 2GSTA 1ZYPA 2KUCA 2V2GA 3RDWA 3F3QA 1TOFA 4N0ZA 2O85A 2WFCA 1FAAA 5D73A 1FB6A 4IQAA 1XW6A 2C80A 4TR4A 2YWNA 4KSOA 2HE3A 4PTSA 4X0XA 3VWXA 3IAS2 3HZ8A 5D9VA 1TRUA 5IPHA 1FVJA 1ERWA 2K6VA 1TXXA 2CA8A 1EEMA 1XWBA 5ID2B 1A0RP 2BTOT 3EE2A 5EPFA 1SK2A 3W6GA 5H5SA 4EF0A 2LQQA 2CT6A 1IYHA 1XVQA 3MDKA 1R7HA 3MNGA 3UVHA 3L78A 2P5QA 3FZ4A 3J7Yb 5H5RA 1PX6A 4BWSA 4HU9A 5IO0A 4USSA 4EDZA 2YZHA 3PINA 3FKFA 5J4UA 3FRCA 3EURA 3U6VA 3C71A 1TRWA 4XS4B 12GSA 4LMVA 4GSNA 2A4VA 1T00A 3WGEA 3F63A 5F07A 4D73B 1SL0B 1IYIA 4G19A 5HR0A 3VI5A 2JZSA 1ERTA 4G0KA 2LS5A 3TKSA 1Q98A 1SU9A 4DSQA 4N30A 1Z3EA 2LJKA 3D0ZA 1I9DA 1YY7A 3I69A 3TKSC 3BCKA 4YQVA 4PQIA 2OA7A 3HVNA 3CYNA 2MMZA 5DQSA 5E4WA 2WJUA 4L0WA 2GVPA 2QC7A 4NWYA 5B7CA 3GSTA 4V2NA 1GUKA 3U5RE 4FQUA 3HY2A 4KB3A 5BMUA 3EMXA 2DSAA 2VLVA 4IGJA 1ZCPA 3N5OA 4QL7A 2HZFA 3IA1A 5IOWA 1K0AA 1GTAA 4HS1A 4YAPA 2MZCA 3DEXA 3E9JB 1K0OA 1U6TA 4I2UA 2IMIA 3UBLA 1SKSB 4I6XA 3LXTA 1USBA 1ZYQB 3CSHA 4N10A 2H1AA 4ICYA 4I97A 2RM6A 4GWRA 3TOUA 3D5JA 1YKCA 1C72A 1S3RA 2CAQA 2CZ3A 2V6KA 3IV4A 1O85A 2P0GA 4AGSA 3BOAA 1OC9A 4H86A 1R26A 2QKEA 2BMXA 3A5WA 1XVWA 3K8NA 1OC3A 22GSA 3GMFA 3IE3A 2R2JA 4ZL8A 2GQMA 3L9VA 3GL5A 1X5EA 1MEKA 2HFDA 4WF4A 5E59A 2QA1A 1AQWA 5D9TA 3APOA 5KOWA 2H74A 4V2MA 2O7KA 8GSSA 1M7TA 1PL2A 4YH2A 4MABA 3FEUA 1Y6EA 1V98A 3KIJA 5ABRA 3D4TA 1VGLA 2G2QA 2HRNA 1SKRB 3CRTA 1S3DA 2REMA 4TXVA 2WGRA 4GQFA 4FO5A 1FVKA 1XWKA 5L71A 1ZMAA 1PX7A 2V41A 4BWQA 1TU8A 13GSA 3ZVJA 17GSA 4G10A 19GSA 4K0NA 1T7PB 4OD7A 3D6IA 4JR4A 5J3RA 1ZGNA 1XFLA 2R3XA 2H71A 1OAZA 2DJ2A 1T4YA 2JACA 3FHKA 3GKMA 3GTUA 1OE7A 4HQSA 3ISOA 3GSSA 2VIMA 4F82A 1KNGA 1A24A 2HNLA 3DGQA 4O92A 4BVYB 1PKZA 4GCIA 4AJ7A 1B4QA 5KN1A 1B9YC 3LWAA 4NXIA 3SWLA 4KGIA 1QUWA 2K9FA 5JCWA 3UVTA 5DVBA 3QR6A 3R3EA 4FH8A 18GSA 4I8BA 3FMWA 4EXJA 4HSCX 1KEBA 4ID0A 2VCQA 3F6FA 3QOUA 1VF3A 4PURA 2GSQA 2GTUA 5DBQA 2GLRA 4D73A 6GSTA 1DBYA 1UC7A 5EY6A 5ECKB 2WS2A 5A4UA 2H0GA 5CREA 3HXSA 4LLRA 2GDRA 2V6OA 3H1NA 2K18A 1TK0B 4ZBBA 3ERWA 10GSA 2X64A 1A0FA 3GA4A 3UMAA 1XPVA 1XWCA 1QXHA 4ZXGA 3LORA 2V1MA 5HFGA 2LSTA 4HJ2A 4MMMA 4F0BA 4MZWA 3IK7A 1WPIA 4MA9A 3VPQA 4WR4A 5HR2A 4EVMA 3TUEA 5ECOB 1OVNA 1HD2A 4EKZA 2H76A 4RI7A 1HNAA 3CRUA 2JZRA 4XTSA 4NAXA 4WETA 2JSYA 2VL2A 3WGXA 1R4WA 1GSSA 2DC5A 2VL2C 3OR5A 3A2WA 3QPMA 1EEJA 5CRGA 1PD21 4BVXB 1EOGA 4IVFA 2LRTA 1EWXA 1PN0A 3J7Yk 2LJRA 3L4NA 4IELA 2DJJA 3US3A 2LNSA 3TKRA 5INYA 2KP2A 3PR8A 3QD9A 3TJGA 5KEJA 1VF4A 1ZYNA 1GTBA 2FGXA 1ZL9A 2VAFA 3UARA 2YP6A 4BA7A 4HJMA 3TJJA 4ML1A 1BEDA 2AB6A 1A8YA 1PKWA 3MAKA 4XIHA 4BL7B 9GSSA 5G31A 4MF7A 4POBA 1PFOA 6GSXA 4KF9A 1TTZA 5COHA 1X9MB 2DMMA 2RM5A 3DD3A 2LQOA 5JCUA 3LXZA 5DCGA 4ML6A 3F6DA 1YEXA 2H1DA 2LUSA 4KSMA 5J9CA 2HYXA 4RQRA 2NVLA 2DMLA 3KXOA 1GSUA 1QK8A 1QMVA 1FOVA 1M2DA 3I43A 5DAKB 5ECSA 1V58A 1AQVA 1O8XA 3KP8A 1A2LA 4PNFA 3WT2A 1BYEA 2L4CA 11GSA 1Q4JA 2XPDA 2H19A 3TKPA 1SKWB 4JEDA 2CX3A 5CRWA 1B48A 5J5NA 5J41A 3EINA 4KNDA 1O7UA 5B8AA 4PQHA 3TRQA 2EC4A 4K2XA 2TRCP 2PVQA 2E7PA 1M2BA 4G0LA 3ME8A 4XCSA 2VL9A 2JU5A 4V1Ag 3KTLA 2HSMA 3GH6A 1YKAA 3HA9A 2IMKA 2VLUA 4Z7XA 4MH3A 1GTUA 3L9UA 5J9BA 2BJXA 3RPPA 2DBCA 1U3AA 3DIEA 4HZ2A 3CXGA 1B8XA 1VF1A 4TVEA 5DCHA 2IIYA 2YANA 3L0HA 2H72A 3KTBA 2OE0A 5HFKA 3HZ4A 3GX8A 1VF2A 2B1KA 1XIYA 2KLXA 3WD6A 4MH2A 3GKXA 1AIUA 5F8BA 1SK1A 3RBTA 5DALB 3PGTA 5ELAA 3HDCA 2H1BA 3FR9A 1FHEA 1TJDA 3UL3A 5H5QA 4DSSA 3F3RA 3IC8A 1MD4A 1OKDA 3G7YA 2C3QA 3KH9A 4MDCA 5AIXA 1WRYA 4ULXA 2H6XA 1BQ7A 3FZAA 1XWAA 2QSIA 2YNXA 3NIVA 3LG6A 3FR6A 3LYKA 1XBSA 4XRAA 2E2GA 4FYUA 4OWYA 3MSZA 2IMEA 5GSSA 2MBSA 4KX4A 4NPBA 2VD0A 4KH7A 4OFTA 2C3NA 1AXDA 2MMOA 3EYTA 4AF2A 4K6XA 5HR1A 1Z7RA 2HXKA 4K7OA 3HHVA 2M80A 1E6BA 3HYPA 1F2EA 1XW9A 1YJ6A 1RQMA 4PX1A 4DSRA 3PH9A 3M0FA 4EIPA 3A3TA 4AJ8A 2QA2A 2D2ZA 4E8HA 4RUVA 2H0HA 4GSTA 1HQOA 1XOBA 3O6TA 4KA0A 2GT5A 1ILOA 3GN3A 2XC2A 3DKSA 2DIYA 4MPFA 4EO3A 1TU7A 5CO3A 1NW2A 1V9WA 5IOXA 1WIKA 1OKTA 3F9UA 3EWLA 3GX0A 5GAND 2IMFA 1T1VA 3Q19A 2CVBA 3TOTA 3W8SA 5HR3A 2CVDA 2L6CA 3A2VA 2LRNA 1G0TA 2H66A 2ES7A 1T3BA 2GZZA 5DDLA 4TR0A 2I81A 5JCGA 4HU7A 5CAXA 4OO5A 2PPTA 2DJ1A 1TW9A 4WF5A 3UIWA 2YOIA 2ZNMA 2I9HA 1R5PA 1TI1A 1BG5A 3P2AA 1M2AA 2HI7A 4IBPA 3VURA 5DJMA 2FLSA 3GKNA 2AYTA 3VLNA 3UJ1A 5F05A 1ML6A 1BJXA 3NOFA 4TXOB 2OADA 4N0VA 3H93A 2L4QA 2XBIA 2VCZA 1A2JA 5G1LA 1ERUA 2C0FA 4FYBA 2H75A 1XCCA 2J23A 4ZL9A 2IFQA 1X5CA 5GZZB 2YV9A 4CY6A 4O5RA 4IHUA 2MMAA 5G30A 2VCXA 3TJKA 5KN0A 2EIQA 3GNJA 3M3MA 5C00A 2R0GA 2H30A 4OO4A 1OE8A 4XRDA 2PN8A 4KUNA 2VCTA 4HI7A 4RQXA 1TRVA 5G5EA 4PUFC 3ZFBA 3M9KA 5DALA 4MJEA 1H4OA 4XHMA 4PNGA 4CW9A 4K5RA 4ILFA 5AIVA 4IJIA 2VD1A 4O5UA 2YWOA 1O81A 2YJHA 3EU3A 1K0BA 3QMXA 2LTKA 5IMZA 4WEYA 4TKYA 2WZ9A 3KEBA 2OBKA 2FWHA 2RIIA 1GSYA 3UOMA 5IO2A 1M0UA 2HZEB 1EGOA 5D8IA 1H75A 1M99A 1S3CA 2GSRA 3TCOA 2VCWA 1FB0A 1EP8A 3V1WA 5ID2A 3EU4A 1TP9A 2HLSA 3HJOA 1G7OA 2NPBA 4DEJA 4K8MA 1Y25A 1NHYA 1YZXA 1GLQA 2IPAA 3CMIA 2CX4A 5ELGA 2UZ8A 2PERA 1QQ2A 1SYXA 3H79A 4XS4A 1T4ZA 1EZKA 2R37A 1X9SB 2IL3A 2H6ZA 2R4VA 1THOA 3CSIA 2GS3A 2LKUA 2YWIA 1U87A 3TRXA 2X8GA 1TI3A 3N9JA 1B9XC 4IJ3A 2AUVA 1MDJA 4K7NA 3Q18A 2O8VB 4G2EA 3BD2A 4YKFA 1M3IA 2YPMA 4ISDA 3HJPA 4ZIJA 5F06A 3O76A 2HT9A 4IKHA 4F2IA 2AHEA 2H70A 5D9XA 2ON7A 2O89A 2ON5A 2NBSA 1JZRA 1DSBA 4NHWA 4PQ1A 1TK5B 5B8BA 1PQNA 1M9AA 4MPGA 4GLTA 4K1FA 5IIZA 4KCAA 4JE1A 3HVVA 4ZB6A 3H8QA 3QCPA 1SD9A
chains in the Genus database with same CATH topology
2PBJA 5LD0A 1WWJA 2GQKA 3CTGA 4NV5A 3GIXA 5CYYA 4OFMA 3IC4A 4KDXA 4POMA 3FK8A 4K7IA 4X4JA 4KE3A 4L5OA 2EIRA 2CAIA 2GZYA 7GSSA 1K0MA 1BX9A 4TN8A 4X43A 4LL1B 4TXOA 5D93A 4F03A 5LNKe 3KCMA 3RHBA 5IMCA 3A5IA 5JWOB 1MDKA 4YAVA 3BBYA 2L5OA 1PRXA 2OE3A 2HRKA 2I3YA 2VM2A 5IM9A 1HYUA 3IHGA 4GQCA 4ACSA 4Q5FA 2GQLA 1PL1A 3ZL5A 5IQYA 1V2AA 1DE2A 3EMPA 1EP7A 2X8HA 3IRAA 4I5QA 4KCEA 4MZBA 2JSZA 3TB2A 3F8UA 4Q5QA 1K3LA 4TW5A 3LGCA 2M46A 3ZTLA 4GRFA 3FY7A 4LA1A 4NV2A 5HQPA 3GURA 3FR3A 3QAWA 4ECIA 6GSSA 2QGVA 3F4SA 4E8EA 1SJZA 4GXZA 4EE0A 1KBNA 4MP4A 4IW9A 2VL3A 2CV4A 1Z6NA 4ZB9A 2CZ2A 3FZ9A 4Q5RA 3FYGA 1ZYEA 4A5PA 1ACVA 1GSDA 2DJ0A 3S9FA 2OBIA 1MDIA 2FA8A 5ECIB 3HVSA 4WBJA 4BVYA 1OC9B 1JLVA 4JZQA 4K0GA 2B7KA 4RI6A 5ECQB 3F0IA 5ENUA 3DYRA 2FWGA 3P7XA 4G0IA 5ECLB 5IMDA 1X5DA 2G0FA 1NM3A 1XZOA 5CRHA 2O87A 2PMTA 3Q6OA 2P5RA 4Q5NA 1OYJA 1A2MA 4PUAA 3WGDA 1SJ6A 16GSA 4J2FA 3TJBA 1F3BA 2YV7A 1F6MC 1PMTA 3L9SA 4MNNA 4ZL7A 2E2MA 3RHCA 5F0GA 2IMDA 4MJBA 2KOKA 1YQ1A 2DKHA 2JZTA 5ECRB 2PU9C 4X1UA 1G6YA 2B5EA 1MD3A 4L5LA 3C7MA 2XPEA 2FUG2 1F3AA 4TR1B 1X0RA 1KTEA 4MJAA 2P31A 3MYDA 1G7EA 6GSYA 2HSYA 1K0CA 2WRTA 3AY8A 4LL4B 2PWJA 1THXA 2N5AA 5B6MA 3ZIVA 3O3TA 5IMVA 1AQXA 1UN2A 5G2ZA 5AN1A 2XBQA 4CY8A 3DWVA 1JZWA 3F4TA 4ZILA 3CTFA 3UAPA 3ZMLA 4GF0A 3GTUB 5ECHB 4TRXA 3IK9A 5ECMB 3QFAC 4YQUA 2AJQB 1ABAA 3LW9A 4HUAA 4F9ZA 1GP1A 2XHFA 3G7JA 3ZRDA 1FO5A 3DRNA 3BCIA 5BRTA 2GGTA 2F9SA 3KH7A 2IJYA 4BVXA 1W4VA 3HJMA 5CNWA 4ZBDA 4HOJA 3EVIA 2YCDA 1O8WA 2B6MA 1JFUA 4NMUA 5CRDA 1ERVA 2B3SA 2AAWA 3MWHA 3BJ5A 4NHZA 1JZOA 1JZDA 3D22A 3GRXA 1Z6MA 4GSSA 5B6NA 1HNBA 5CP1A 2IWTA 4EC0A 3LJRA 4KDYA 2PUKC 2DKIA 4HDEA 4POKA 1O6JA 1QFNA 3LFLA 3KMOA 4BL7A 2R5GA 1K3OA 1PA3A 4EDYA 3F4RA 4K5SA 3LYPA 1YEPA 3TRPA 1K0NA 3GUSA 4IQ1A 2LNTA 1GULA 1EOHA 3KGKA 1ST9A 2NTOA 1JHBA 4J57E 5DAKA 4P3YB 2JADA 3KP9A 1I5GA 1EGRA 2YZUA 2LRCA 20GSA 3ME7A 4IS0A 4WXTA 2RUEA 3C73A 2B1LA 2PGTA 1EV4A 4JRRA 3ERFA 5DQYA 1AAZA 2FD3A 2C8UA 2YWMA 3CSJA 2DJ3A 1TK8B 2WDUA 2B7JA 1URMA 5IMAA 4O5QA 3IR4A 3WT1A 2VM1A 2GSSA 5AGYA 4BPYA 1LJRA 4JBBA 4MCUA 2L57A 1O73A 1ON4A 3DVXA 4XS1A 1WOUA 1V57A 4OFNA 3TDGA 3ED3A 5DJLA 4WKWA 4OCEA 1SENA 2FWEA 1HNCA 1V40A 3QAGA 4QL9A 2IN3A 6GSUA 3I6AA 2VCVA 2OACA 1GSEA 1GRXA 3LSZA 4KDUA 2FWFA 4ECCA 2AV4A 4V1Ap 5KN2A 1BAYA 4WBRD 3ZVJD 3R2QA 1NSWA 5ECNB 2KP1A 3I9V2 4TOPA 14GSA 5FWGA 4L8EA 3KD0A 4XS6A 3RPNA 3E0UA 1M9BA 3IDVA 4TR1A 4PGTA 2ALBA 1Z7PA 4WR5A 2R0PA 3ZLPA 1FW1A 3GFKA 2L59A 4MK3A 4POLA 3G7IA 4YKGA 1A8LA 4K9ZA 5FT3A 1GL8A 4IN0A 1EV9A 2Z9SA 4G9HA 4CDOA 5D9WA 2B5YA 2A2PA 3UBKA 1J0FA 2CQ9A 3TJFA 3HVXA 3KJYA 2OKAA 3IPZA 1LU4A 3TGZA 1B4PA 3VWVA 3GV1A 3ZYWA 3QFBC 3IBHA 2LV3A 1X9WB 2N5FA 4EIQA 3C1RA 4TR3A 3DXBA 1PSQA 4GTUA 2X4AA 3E3EA 5GSTA 3VI7A 3IAM2 4EUYA 1GSFA 1PN9A 3DMLA 4JU5A 4KAEA 1T8EB 3EC3A 1QGVA 1RW1A 4PXOA 5A4WA 3JCML 1GUMA 2H6YA 1GSQA 3MIXA 2FNOA 3IOSA 2VUPA 2VO4A 1F9MA 4F0CA 2I1UA 1RK4A 2X99A 3VPTA 3FZ5A 3IHQA 5KOXA 1N8JA 4OMVA 2JL4A 5EVOA 1XW5A 3A2XA 4IP6A 2V32A 4Z2RA 1SK0A 3ZMKA 3HKRA 1R5AA 4DVCA 4J56E 3GKKA 4MLYA 2YN1A 4O7HA 3VWWA 1ZZYA 5KN3A 4MF6A 2N5BA 4JR6A 4YQMA 4MJCA 1GNEA 1JLWA 4AJ6A 4DSSB 3P8WA 3ZIJA 2H01A 1WP0A 2DLXA 5IPGA 3GH9A 1NHOA 3SBCA 1DE1A 2FY6A 1GTIA 4FYCA 2OJLA 3QAVA 5JWRB 2FA4A 2HSHA 2RUFA 5D96A 3ZITA 2MBTA 1ZOFA 3ZZXA 2C0DA 4IP1A 5GAPD 1SYRA 2C0GA 2C1YA 3D21A 5G5FA 2MMNA 2F8AA 1YF0A 2F51A 4CHSA 2L6DA 1F37A 4KW6A 1UA5A 4ECBA 3HCZA 4HZ4A 4ZB8A 3TKQA 1XOAA 2NDOA 1DUGA 6GSVA 3D4MA 2J9HA 2FCHA 1UVZA 2DJKA 1AW9A 1WJKA 2C0EA 1U88A 1CQHA 1VRSD 3QDNA 3EPTA 2I4AA 4HEA2 3HD5A 4V2LA 3VWUA 1LBKA 3WYWA 4HQZA 3M1GA 3DVWA 5A4VA 3UEMA 2ZCTA 2ZUPA 1GWCA 1TKDB 1U3IA 2A4HA 3GL3A 2A2RA 5ECPB 3ZFLA 3GHAA 1K3YA 4N11A 2X49A 2R6KA 5EL8A 5C04A 5AISA 2HRAA 4O32A 1YDKA 2FHEA 2X8CA 3ERGA 1MTCA 4EL1A 2F3MA 1OC8A 2A2SA 4Z2TA 1SL1B 4LMWA 1GH2A 5A5KA 2B5XA 4MF5A 1K0DA 2H73A 2YJ7A 1SL2B 1N2AA 1GUHA 4I2TA 3PPUA 1SJIA 2CVKA 2MYGA 3Q74A 5JWQB 1Z5YE 2M72A 2E0QA 2RLIA 2GZPA 2LEGA 3M8NA 6GSWA 1A23A 1XXUA 2H8LA 2HRFA 1YF1A 2R0CA 4MZCA 2HZEA 3APSA 4Z2UA 2L5LA 3TKSE 3RAZA 5FHIA 2EIOA 2K8SA 2WB9A 2GT6A 3G9BA 4K2DA 1PGTA 3C8EA 1J08A 3VFIA 4ECJA 2WCIA 1FOHA 4OCFA 1GLPA 2H1GA 2H0IA 3ZREA 3IXRA 4ZBAA 1GNWA 1WE0A 3C1SA 3FW2A 1AUCA 1TDIA 5IMFA 2OE1A 1WMJA 1CQGA 3M9JA 2C4JA 3GYKA 2TRXA 1G6WA 1J9BA 4QQ7A 2KHPA 2WULA 2IFQB 2TIRA 3LEFA 2K8VA 5G1KA 1AC1A 4L0UA 2PVOC 3H4KA 5HFIA 1FG4A 1TRSA 3NZNA 5LCZA 2C3TA 1SD8A 1E2YA 3CBUA 3P90A 3KM6A 3VK9A 1S3AA 1Z9HA 2LJAA 3APQA 3KMNA 1W89A 3W8JA 4FIWA 3KZQA 2VOCA 2F8FA 2VLTA 3LQ7A 1XWGA 2DIZA 2GSTA 1ZYPA 2KUCA 2V2GA 3RDWA 3F3QA 1TOFA 4N0ZA 2O85A 2WFCA 1FAAA 5D73A 1FB6A 4IQAA 1XW6A 2C80A 4TR4A 2YWNA 4KSOA 2HE3A 4PTSA 4X0XA 3VWXA 3IAS2 3HZ8A 5D9VA 1TRUA 5IPHA 1FVJA 1ERWA 2K6VA 1TXXA 2CA8A 1EEMA 1XWBA 5ID2B 1A0RP 2BTOT 3EE2A 5EPFA 1SK2A 3W6GA 5H5SA 4EF0A 2LQQA 2CT6A 1IYHA 1XVQA 3MDKA 1R7HA 3MNGA 3UVHA 3L78A 2P5QA 3FZ4A 3J7Yb 5H5RA 1PX6A 4BWSA 4HU9A 5IO0A 4USSA 4EDZA 2YZHA 3PINA 3FKFA 5J4UA 3FRCA 3EURA 3U6VA 3C71A 1TRWA 4XS4B 12GSA 4LMVA 4GSNA 2A4VA 1T00A 3WGEA 3F63A 5F07A 4D73B 1SL0B 1IYIA 4G19A 5HR0A 3VI5A 2JZSA 1ERTA 4G0KA 2LS5A 3TKSA 1Q98A 1SU9A 4DSQA 4N30A 1Z3EA 2LJKA 3D0ZA 1I9DA 1YY7A 3I69A 3TKSC 3BCKA 4YQVA 4PQIA 2OA7A 3CYNA 2MMZA 5DQSA 5E4WA 2WJUA 4L0WA 2GVPA 2QC7A 4NWYA 5B7CA 3GSTA 4V2NA 1GUKA 3U5RE 4FQUA 3HY2A 4KB3A 5BMUA 3EMXA 2DSAA 2VLVA 4IGJA 1ZCPA 3N5OA 4QL7A 2HZFA 3IA1A 5IOWA 1K0AA 1GTAA 4HS1A 4YAPA 2MZCA 3DEXA 3E9JB 1K0OA 1U6TA 4I2UA 2IMIA 3UBLA 1SKSB 4I6XA 3LXTA 1USBA 1ZYQB 3CSHA 4N10A 2H1AA 4ICYA 4I97A 2RM6A 4GWRA 3TOUA 3D5JA 1YKCA 1C72A 2CAQA 2CZ3A 2V6KA 3IV4A 1O85A 2P0GA 4AGSA 3BOAA 1OC9A 4H86A 1R26A 2QKEA 2BMXA 3A5WA 1XVWA 3K8NA 1OC3A 22GSA 3GMFA 3IE3A 2R2JA 4ZL8A 2GQMA 3L9VA 3GL5A 1X5EA 1MEKA 2HFDA 4WF4A 5E59A 2QA1A 1AQWA 5D9TA 3APOA 5KOWA 2H74A 4V2MA 2O7KA 8GSSA 1M7TA 1PL2A 4YH2A 4MABA 3FEUA 1Y6EA 1V98A 3KIJA 5ABRA 3D4TA 1VGLA 2G2QA 2HRNA 1SKRB 3CRTA 1S3DA 2REMA 4TXVA 2WGRA 4GQFA 4FO5A 1FVKA 1XWKA 5L71A 1ZMAA 1PX7A 2V41A 4BWQA 1TU8A 13GSA 3ZVJA 17GSA 4G10A 19GSA 4K0NA 1T7PB 4OD7A 3D6IA 4JR4A 5J3RA 1ZGNA 1XFLA 2R3XA 2H71A 1OAZA 2DJ2A 1T4YA 2JACA 3FHKA 3GKMA 3GTUA 1OE7A 4HQSA 3ISOA 3GSSA 2VIMA 4F82A 1KNGA 1A24A 2HNLA 3DGQA 4O92A 4BVYB 1PKZA 4GCIA 4AJ7A 1B4QA 5KN1A 1B9YC 3LWAA 4NXIA 3SWLA 4KGIA 1QUWA 2K9FA 5JCWA 3UVTA 5DVBA 3QR6A 3R3EA 4FH8A 18GSA 4I8BA 3FMWA 4EXJA 1KEBA 4ID0A 2VCQA 3F6FA 3QOUA 1VF3A 4PURA 2GSQA 2GTUA 5DBQA 2GLRA 4D73A 6GSTA 1DBYA 1UC7A 5EY6A 5ECKB 2WS2A 5A4UA 2H0GA 5CREA 3HXSA 4LLRA 2GDRA 2V6OA 3H1NA 2K18A 1TK0B 4ZBBA 3ERWA 10GSA 2X64A 1A0FA 3GA4A 3UMAA 1XPVA 1XWCA 1QXHA 4ZXGA 3LORA 2V1MA 5HFGA 2LSTA 4HJ2A 4MMMA 4F0BA 4MZWA 3IK7A 1WPIA 4MA9A 3VPQA 4WR4A 5HR2A 4EVMA 3TUEA 5ECOB 1OVNA 1HD2A 4EKZA 2H76A 4RI7A 1HNAA 3CRUA 2JZRA 4XTSA 4NAXA 4WETA 2JSYA 2VL2A 3WGXA 1R4WA 1GSSA 2DC5A 2VL2C 3OR5A 3A2WA 3QPMA 1EEJA 5CRGA 1PD21 4BVXB 1EOGA 4IVFA 2LRTA 1EWXA 1PN0A 3J7Yk 2LJRA 3L4NA 4IELA 2DJJA 3US3A 2LNSA 3TKRA 5INYA 2KP2A 3PR8A 3QD9A 3TJGA 5KEJA 1VF4A 1ZYNA 1GTBA 2FGXA 1ZL9A 2VAFA 3UARA 2YP6A 4BA7A 4HJMA 3TJJA 4ML1A 1BEDA 2AB6A 1A8YA 1PKWA 3MAKA 4XIHA 4BL7B 9GSSA 5G31A 4MF7A 4POBA 6GSXA 4KF9A 1TTZA 5COHA 1X9MB 2DMMA 2RM5A 3DD3A 2LQOA 5JCUA 3LXZA 5DCGA 4ML6A 3F6DA 1YEXA 2H1DA 2LUSA 4KSMA 5J9CA 2HYXA 4RQRA 2NVLA 2DMLA 3KXOA 1GSUA 1QK8A 1QMVA 1FOVA 1M2DA 3I43A 5DAKB 5ECSA 1V58A 1AQVA 1O8XA 3KP8A 1A2LA 4PNFA 3WT2A 1BYEA 2L4CA 11GSA 1Q4JA 2XPDA 2H19A 3TKPA 1SKWB 4JEDA 2CX3A 5CRWA 1B48A 5J5NA 5J41A 3EINA 4KNDA 1O7UA 5B8AA 4PQHA 3TRQA 2EC4A 4K2XA 2TRCP 2PVQA 2E7PA 1M2BA 4G0LA 3ME8A 4XCSA 2VL9A 2JU5A 4V1Ag 3KTLA 2HSMA 3GH6A 1YKAA 3HA9A 2IMKA 2VLUA 4Z7XA 4MH3A 1GTUA 3L9UA 5J9BA 2BJXA 3RPPA 2DBCA 1U3AA 3DIEA 4HZ2A 3CXGA 1B8XA 1VF1A 4TVEA 5DCHA 2IIYA 2YANA 3L0HA 2H72A 3KTBA 2OE0A 5HFKA 3HZ4A 3GX8A 1VF2A 2B1KA 1XIYA 2KLXA 3WD6A 4MH2A 3GKXA 1AIUA 5F8BA 1SK1A 3RBTA 5DALB 3PGTA 5ELAA 3HDCA 2H1BA 3FR9A 1FHEA 1TJDA 3UL3A 5H5QA 4DSSA 3F3RA 3IC8A 1MD4A 1OKDA 3G7YA 2C3QA 3KH9A 4MDCA 5AIXA 1WRYA 4ULXA 2H6XA 1BQ7A 3FZAA 1XWAA 2QSIA 2YNXA 3NIVA 3LG6A 3FR6A 3LYKA 1XBSA 4XRAA 2E2GA 4FYUA 4OWYA 3MSZA 2IMEA 5GSSA 2MBSA 4KX4A 4NPBA 2VD0A 4KH7A 4OFTA 2C3NA 1AXDA 2MMOA 3EYTA 4AF2A 4K6XA 5HR1A 1Z7RA 2HXKA 4K7OA 3HHVA 2M80A 1E6BA 3HYPA 1F2EA 1XW9A 1YJ6A 1RQMA 4PX1A 4DSRA 3PH9A 3M0FA 4EIPA 3A3TA 4AJ8A 2QA2A 2D2ZA 4E8HA 4RUVA 2H0HA 4GSTA 1HQOA 1XOBA 3O6TA 4KA0A 2GT5A 1ILOA 3GN3A 2XC2A 3DKSA 2DIYA 4MPFA 4EO3A 1TU7A 5CO3A 1NW2A 1V9WA 5IOXA 1WIKA 1OKTA 3F9UA 3EWLA 3GX0A 5GAND 2IMFA 1T1VA 3Q19A 2CVBA 3TOTA 3W8SA 5HR3A 2CVDA 2L6CA 3A2VA 2LRNA 1G0TA 2H66A 2ES7A 1T3BA 2GZZA 5DDLA 4TR0A 2I81A 5JCGA 4HU7A 5CAXA 4OO5A 2PPTA 2DJ1A 1TW9A 4WF5A 3UIWA 2YOIA 2ZNMA 2I9HA 1R5PA 1TI1A 1BG5A 3P2AA 1M2AA 2HI7A 4IBPA 3VURA 5DJMA 2FLSA 3GKNA 2AYTA 3VLNA 3UJ1A 5F05A 1ML6A 1BJXA 3NOFA 4TXOB 2OADA 4N0VA 3H93A 2L4QA 2XBIA 2VCZA 1A2JA 5G1LA 1ERUA 2C0FA 4FYBA 2H75A 1XCCA 2J23A 4ZL9A 2IFQA 1X5CA 5GZZB 2YV9A 4CY6A 4O5RA 4IHUA 2MMAA 5G30A 2VCXA 3TJKA 5KN0A 2EIQA 3GNJA 3M3MA 5C00A 2R0GA 2H30A 4OO4A 1OE8A 4XRDA 2PN8A 4KUNA 2VCTA 4HI7A 4RQXA 1TRVA 5G5EA 4PUFC 3ZFBA 3M9KA 5DALA 4MJEA 1H4OA 4XHMA 4PNGA 4CW9A 4K5RA 4ILFA 5AIVA 4IJIA 2VD1A 4O5UA 2YWOA 1O81A 2YJHA 3EU3A 1K0BA 3QMXA 2LTKA 5IMZA 4WEYA 4TKYA 2WZ9A 3KEBA 2OBKA 2FWHA 2RIIA 1GSYA 3UOMA 5IO2A 1M0UA 2HZEB 1EGOA 5D8IA 1H75A 1M99A 1S3CA 2GSRA 3TCOA 2VCWA 1FB0A 1EP8A 3V1WA 5ID2A 3EU4A 1TP9A 2HLSA 3HJOA 1G7OA 2NPBA 4DEJA 4K8MA 1Y25A 1NHYA 1YZXA 1GLQA 2IPAA 3CMIA 2CX4A 5ELGA 2UZ8A 2PERA 1QQ2A 1SYXA 3H79A 4XS4A 1T4ZA 1EZKA 2R37A 1X9SB 2IL3A 2H6ZA 2R4VA 1THOA 3CSIA 2GS3A 2LKUA 2YWIA 1U87A 3TRXA 2X8GA 1TI3A 3N9JA 1B9XC 4IJ3A 2AUVA 1MDJA 4K7NA 3Q18A 2O8VB 4G2EA 3BD2A 4YKFA 2YPMA 4ISDA 3HJPA 4ZIJA 5F06A 3O76A 2HT9A 4IKHA 4F2IA 2AHEA 2H70A 5D9XA 2ON7A 2O89A 2ON5A 2NBSA 1JZRA 1DSBA 4NHWA 4PQ1A 1TK5B 5B8BA 1PQNA 1M9AA 4MPGA 4GLTA 4K1FA 5IIZA 4KCAA 4JE1A 3HVVA 4ZB6A 3H8QA 3QCPA 1SD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBJ A;  5LD0 A;  1WWJ A;  2GQK A;  3CTG A;  4NV5 A;  3GIX A;  5CYY A;  4OFM A;  3IC4 A;  4KDX A;  4POM A;  3FK8 A;  4K7I A;  4KE3 A;  4L5O A;  2EIR A;  2CAI A;  2GZY A;  7GSS A;  1K0M A;  1BX9 A;  4TN8 A;  4X43 A;  4LL1 B;  4TXO A;  5D93 A;  4F03 A;  5LNK e;  3KCM A;  3RHB A;  5IMC A;  5JWO B;  1MDK A;  4YAV A;  3BBY A;  2L5O A;  1PRX A;  2OE3 A;  2I3Y A;  2VM2 A;  5IM9 A;  1HYU A;  4GQC A;  4ACS A;  4Q5F A;  2GQL A;  1PL1 A;  3ZL5 A;  5IQY A;  1V2A A;  1DE2 A;  3EMP A;  1EP7 A;  2X8H A;  3IRA A;  4I5Q A;  4KCE A;  4MZB A;  2JSZ A;  3TB2 A;  3F8U A;  4Q5Q A;  1K3L A;  4TW5 A;  3LGC A;  2M46 A;  3ZTL A;  4GRF A;  3FY7 A;  4LA1 A;  4NV2 A;  5HQP A;  3GUR A;  3FR3 A;  3QAW A;  4ECI A;  6GSS A;  2QGV A;  3F4S A;  4E8E A;  1SJZ A;  4GXZ A;  4EE0 A;  1KBN A;  4MP4 A;  4IW9 A;  2VL3 A;  2CV4 A;  1Z6N A;  4ZB9 A;  2CZ2 A;  3FZ9 A;  4Q5R A;  3FYG A;  1ZYE A;  1ACV A;  1GSD A;  2DJ0 A;  3S9F A;  2OBI A;  1MDI A;  2FA8 A;  5ECI B;  3HVS A;  4WBJ A;  4BVY A;  1OC9 B;  1JLV A;  4JZQ A;  4K0G A;  2B7K A;  4RI6 A;  5ECQ B;  3F0I A;  5ENU A;  3DYR A;  2FWG A;  3P7X A;  5ECL B;  5IMD A;  1X5D A;  2G0F A;  1NM3 A;  1XZO A;  5CRH A;  2O87 A;  2PMT A;  3Q6O A;  2P5R A;  4Q5N A;  1OYJ A;  1A2M A;  4PUA A;  3WGD A;  1SJ6 A;  16GS A;  4J2F A;  3TJB A;  1F3B A;  2YV7 A;  1F6M C;  1PMT A;  3L9S A;  4ZL7 A;  2E2M A;  3RHC A;  5F0G A;  2IMD A;  4MJB A;  2KOK A;  1YQ1 A;  2JZT A;  5ECR B;  2PU9 C;  4X1U A;  1G6Y A;  2B5E A;  1MD3 A;  4L5L A;  3C7M A;  2XPE A;  2FUG 2;  1F3A A;  4TR1 B;  1X0R A;  1KTE A;  4MJA A;  2P31 A;  1G7E A;  6GSY A;  2HSY A;  1K0C A;  2WRT A;  3AY8 A;  4LL4 B;  2PWJ A;  1THX A;  2N5A A;  5B6M A;  3ZIV A;  3O3T A;  5IMV A;  1AQX A;  1UN2 A;  5G2Z A;  5AN1 A;  2XBQ A;  3DWV A;  1JZW A;  3F4T A;  4ZIL A;  3CTF A;  3UAP A;  3ZML A;  4GF0 A;  3GTU B;  5ECH B;  4TRX A;  3IK9 A;  5ECM B;  3QFA C;  4YQU A;  2AJQ B;  1ABA A;  4HUA A;  4F9Z A;  1GP1 A;  2XHF A;  3G7J A;  3ZRD A;  1FO5 A;  3DRN A;  3BCI A;  2GGT A;  2F9S A;  3KH7 A;  2IJY A;  4BVX A;  1W4V A;  3HJM A;  5CNW A;  4ZBD A;  4HOJ A;  3EVI A;  2YCD A;  1O8W A;  2B6M A;  1JFU A;  4NMU A;  5CRD A;  1ERV A;  2B3S A;  2AAW A;  3MWH A;  3BJ5 A;  4NHZ A;  1JZO A;  1JZD A;  3D22 A;  3GRX A;  1Z6M A;  4GSS A;  5B6N A;  1HNB A;  5CP1 A;  2IWT A;  4EC0 A;  3LJR A;  4KDY A;  2PUK C;  4HDE A;  4POK A;  1O6J A;  1QFN A;  3LFL A;  3KMO A;  4BL7 A;  2R5G A;  1K3O A;  1PA3 A;  4EDY A;  3F4R A;  3LYP A;  1YEP A;  3TRP A;  1K0N A;  3GUS A;  4IQ1 A;  2LNT A;  1GUL A;  1EOH A;  3KGK A;  1ST9 A;  2NTO A;  1JHB A;  4J57 E;  5DAK A;  4P3Y B;  2JAD A;  3KP9 A;  1I5G A;  1EGR A;  2YZU A;  2LRC A;  20GS A;  3ME7 A;  4IS0 A;  4WXT A;  2RUE A;  3C73 A;  2B1L A;  2PGT A;  1EV4 A;  4JRR A;  3ERF A;  5DQY A;  1AAZ A;  2FD3 A;  2C8U A;  2YWM A;  3CSJ A;  2DJ3 A;  1TK8 B;  2WDU A;  2B7J A;  1URM A;  5IMA A;  3IR4 A;  3WT1 A;  2VM1 A;  2GSS A;  5AGY A;  4BPY A;  1LJR A;  4JBB A;  4MCU A;  2L57 A;  1O73 A;  1ON4 A;  3DVX A;  4XS1 A;  1WOU A;  1V57 A;  4OFN A;  3TDG A;  3ED3 A;  5DJL A;  4WKW A;  4OCE A;  1SEN A;  2FWE A;  1HNC A;  1V40 A;  3QAG A;  4QL9 A;  2IN3 A;  6GSU A;  3I6A A;  2VCV A;  2OAC A;  1GSE A;  1GRX A;  3LSZ A;  4KDU A;  2FWF A;  4ECC A;  2AV4 A;  4V1A p;  5KN2 A;  1BAY A;  4WBR D;  3ZVJ D;  3R2Q A;  1NSW A;  5ECN B;  2KP1 A;  3I9V 2;  4TOP A;  14GS A;  5FWG A;  4L8E A;  3KD0 A;  4XS6 A;  3RPN A;  3E0U A;  1M9B A;  3IDV A;  4TR1 A;  4PGT A;  2ALB A;  1Z7P A;  4WR5 A;  3ZLP A;  1FW1 A;  3GFK A;  2L59 A;  4MK3 A;  4POL A;  3G7I A;  1A8L A;  4K9Z A;  5FT3 A;  1GL8 A;  4IN0 A;  1EV9 A;  2Z9S A;  4G9H A;  4CDO A;  5D9W A;  2B5Y A;  3UBK A;  1J0F A;  2CQ9 A;  3TJF A;  3HVX A;  3KJY A;  2OKA A;  3IPZ A;  1LU4 A;  3TGZ A;  1B4P A;  3VWV A;  3GV1 A;  3ZYW A;  3QFB C;  3IBH A;  2LV3 A;  1X9W B;  2N5F A;  3C1R A;  4TR3 A;  3DXB A;  1PSQ A;  4GTU A;  3E3E A;  5GST A;  3VI7 A;  3IAM 2;  4EUY A;  1GSF A;  1PN9 A;  3DML A;  4JU5 A;  4KAE A;  1T8E B;  3EC3 A;  1QGV A;  1RW1 A;  4PXO A;  5A4W A;  3JCM L;  1GUM A;  2H6Y A;  1GSQ A;  2FNO A;  3IOS A;  2VUP A;  2VO4 A;  1F9M A;  4F0C A;  2I1U A;  1RK4 A;  2X99 A;  3VPT A;  3FZ5 A;  3IHQ A;  1N8J A;  4OMV A;  2JL4 A;  5EVO A;  1XW5 A;  3A2X A;  4IP6 A;  2V32 A;  1SK0 A;  3ZMK A;  3HKR A;  1R5A A;  4DVC A;  4J56 E;  3GKK A;  4MLY A;  2YN1 A;  4O7H A;  3VWW A;  1ZZY A;  5KN3 A;  4MF6 A;  2N5B A;  4JR6 A;  4YQM A;  4MJC A;  1GNE A;  1JLW A;  4AJ6 A;  4DSS B;  3P8W A;  3ZIJ A;  2H01 A;  1WP0 A;  2DLX A;  5IPG A;  3GH9 A;  1NHO A;  3SBC A;  1DE1 A;  2FY6 A;  1GTI A;  4FYC A;  2OJL A;  3QAV A;  5JWR B;  2FA4 A;  2HSH A;  2RUF A;  5D96 A;  3ZIT A;  2MBT A;  1ZOF A;  3ZZX A;  2C0D A;  4IP1 A;  5GAP D;  1SYR A;  2C0G A;  2C1Y A;  3D21 A;  5G5F A;  2MMN A;  2F8A A;  1YF0 A;  2F51 A;  4CHS A;  2L6D A;  1F37 A;  4KW6 A;  1UA5 A;  4ECB A;  3HCZ A;  4HZ4 A;  4ZB8 A;  3TKQ A;  1XOA A;  2NDO A;  1DUG A;  6GSV A;  3D4M A;  2J9H A;  2FCH A;  1UVZ A;  2DJK A;  1AW9 A;  1WJK A;  2C0E A;  1U88 A;  1CQH A;  1VRS D;  3QDN A;  2I4A A;  4HEA 2;  3HD5 A;  4V2L A;  3VWU A;  1LBK A;  3WYW A;  4HQZ A;  3M1G A;  3DVW A;  5A4V A;  3UEM A;  2ZCT A;  2ZUP A;  1GWC A;  1TKD B;  1U3I A;  3GL3 A;  2A2R A;  5ECP B;  3ZFL A;  3GHA A;  1K3Y A;  4N11 A;  2R6K A;  5EL8 A;  5C04 A;  5AIS A;  4O32 A;  1YDK A;  2FHE A;  2X8C A;  3ERG A;  1MTC A;  4EL1 A;  2F3M A;  1OC8 A;  2A2S A;  1SL1 B;  4LMW A;  1GH2 A;  5A5K A;  2B5X A;  4MF5 A;  1K0D A;  2H73 A;  2YJ7 A;  1SL2 B;  1N2A A;  1GUH A;  4I2T A;  1SJI A;  2CVK A;  2MYG A;  3Q74 A;  5JWQ B;  1Z5Y E;  2M72 A;  2E0Q A;  2RLI A;  2GZP A;  2LEG A;  3M8N A;  6GSW A;  1A23 A;  1XXU A;  2H8L A;  2HRF A;  1YF1 A;  4MZC A;  2HZE A;  3APS A;  2L5L A;  3TKS E;  3RAZ A;  5FHI A;  2EIO A;  2K8S A;  2WB9 A;  2GT6 A;  3G9B A;  4K2D A;  1PGT A;  3C8E A;  1J08 A;  3VFI A;  4ECJ A;  2WCI A;  4OCF A;  1GLP A;  2H1G A;  2H0I A;  3ZRE A;  3IXR A;  4ZBA A;  1GNW A;  1WE0 A;  3C1S A;  3FW2 A;  1AUC A;  1TDI A;  5IMF A;  2OE1 A;  1WMJ A;  1CQG A;  3M9J A;  2C4J A;  3GYK A;  2TRX A;  1G6W A;  1J9B A;  4QQ7 A;  2KHP A;  2WUL A;  2IFQ B;  2TIR A;  3LEF A;  2K8V A;  5G1K A;  1AC1 A;  4L0U A;  2PVO C;  3H4K A;  5HFI A;  1FG4 A;  1TRS A;  3NZN A;  5LCZ A;  2C3T A;  1SD8 A;  1E2Y A;  3CBU A;  3P90 A;  3KM6 A;  3VK9 A;  1S3A A;  1Z9H A;  2LJA A;  3APQ A;  3KMN A;  1W89 A;  3W8J A;  4FIW A;  3KZQ A;  2VOC A;  2F8F A;  2VLT A;  3LQ7 A;  1XWG A;  2DIZ A;  2GST A;  2KUC A;  2V2G A;  3RDW A;  3F3Q A;  1TOF A;  4N0Z A;  2O85 A;  2WFC A;  1FAA A;  5D73 A;  1FB6 A;  4IQA A;  1XW6 A;  2C80 A;  4TR4 A;  2YWN A;  4KSO A;  2HE3 A;  4X0X A;  3VWX A;  3IAS 2;  3HZ8 A;  5D9V A;  1TRU A;  5IPH A;  1FVJ A;  1ERW A;  2K6V A;  1TXX A;  2CA8 A;  1EEM A;  1XWB A;  5ID2 B;  1A0R P;  2BTO T;  3EE2 A;  5EPF A;  1SK2 A;  3W6G A;  5H5S A;  4EF0 A;  2LQQ A;  2CT6 A;  1IYH A;  1XVQ A;  3MDK A;  1R7H A;  3MNG A;  3UVH A;  3L78 A;  2P5Q A;  3FZ4 A;  3J7Y b;  5H5R A;  1PX6 A;  4BWS A;  4HU9 A;  5IO0 A;  4EDZ A;  2YZH A;  3PIN A;  3FKF A;  5J4U A;  3FRC A;  3EUR A;  3U6V A;  3C71 A;  1TRW A;  4XS4 B;  12GS A;  4LMV A;  4GSN A;  2A4V A;  1T00 A;  3WGE A;  3F63 A;  5F07 A;  4D73 B;  1SL0 B;  1IYI A;  4G19 A;  5HR0 A;  3VI5 A;  2JZS A;  1ERT A;  2LS5 A;  3TKS A;  1Q98 A;  1SU9 A;  4DSQ A;  4N30 A;  1Z3E A;  2LJK A;  3D0Z A;  1I9D A;  1YY7 A;  3I69 A;  3TKS C;  3BCK A;  4YQV A;  4PQI A;  2OA7 A;  3CYN A;  2MMZ A;  5DQS A;  5E4W A;  2WJU A;  4L0W A;  2GVP A;  2QC7 A;  4NWY A;  5B7C A;  3GST A;  4V2N A;  1GUK A;  3U5R E;  3HY2 A;  4KB3 A;  3EMX A;  2DSA A;  2VLV A;  4IGJ A;  1ZCP A;  3N5O A;  4QL7 A;  2HZF A;  3IA1 A;  5IOW A;  1K0A A;  1GTA A;  4HS1 A;  4YAP A;  2MZC A;  3DEX A;  3E9J B;  1K0O A;  1U6T A;  4I2U A;  2IMI A;  3UBL A;  1SKS B;  4I6X A;  3LXT A;  1USB A;  1ZYQ B;  3CSH A;  4N10 A;  2H1A A;  4I97 A;  2RM6 A;  4GWR A;  3TOU A;  3D5J A;  1YKC A;  1C72 A;  2CAQ A;  2CZ3 A;  2V6K A;  3IV4 A;  1O85 A;  2P0G A;  4AGS A;  3BOA A;  1OC9 A;  4H86 A;  1R26 A;  2QKE A;  2BMX A;  3A5W A;  1XVW A;  3K8N A;  1OC3 A;  22GS A;  3GMF A;  3IE3 A;  2R2J A;  4ZL8 A;  2GQM A;  3L9V A;  3GL5 A;  1X5E A;  1MEK A;  2HFD A;  4WF4 A;  5E59 A;  1AQW A;  5D9T A;  3APO A;  2H74 A;  4V2M A;  2O7K A;  8GSS A;  1M7T A;  1PL2 A;  4YH2 A;  4MAB A;  3FEU A;  1Y6E A;  1V98 A;  3KIJ A;  5ABR A;  3D4T A;  1VGL A;  2G2Q A;  2HRN A;  1SKR B;  3CRT A;  1S3D A;  2REM A;  4TXV A;  2WGR A;  4GQF A;  4FO5 A;  1FVK A;  1XWK A;  5L71 A;  1ZMA A;  1PX7 A;  2V41 A;  4BWQ A;  1TU8 A;  13GS A;  3ZVJ A;  17GS A;  4G10 A;  19GS A;  4K0N A;  1T7P B;  4OD7 A;  3D6I A;  4JR4 A;  5J3R A;  1ZGN A;  1XFL A;  2R3X A;  2H71 A;  1OAZ A;  2DJ2 A;  1T4Y A;  2JAC A;  3FHK A;  3GKM A;  3GTU A;  1OE7 A;  4HQS A;  3ISO A;  3GSS A;  2VIM A;  4F82 A;  1KNG A;  1A24 A;  2HNL A;  3DGQ A;  4O92 A;  1PKZ A;  4GCI A;  4AJ7 A;  1B4Q A;  5KN1 A;  1B9Y C;  3LWA A;  4NXI A;  3SWL A;  4KGI A;  1QUW A;  2K9F A;  5JCW A;  3UVT A;  5DVB A;  3QR6 A;  4FH8 A;  18GS A;  4I8B A;  4EXJ A;  1KEB A;  4ID0 A;  2VCQ A;  3F6F A;  3QOU A;  1VF3 A;  4PUR A;  2GSQ A;  2GTU A;  5DBQ A;  2GLR A;  4D73 A;  6GST A;  1DBY A;  1UC7 A;  5EY6 A;  5ECK B;  2WS2 A;  5A4U A;  2H0G A;  5CRE A;  3HXS A;  4LLR A;  2GDR A;  2V6O A;  3H1N A;  2K18 A;  1TK0 B;  4ZBB A;  3ERW A;  10GS A;  2X64 A;  1A0F A;  3GA4 A;  3UMA A;  1XPV A;  1XWC A;  1QXH A;  4ZXG A;  3LOR A;  2V1M A;  5HFG A;  2LST A;  4HJ2 A;  4MMM A;  4F0B A;  4MZW A;  3IK7 A;  1WPI A;  4MA9 A;  3VPQ A;  4WR4 A;  5HR2 A;  4EVM A;  3TUE A;  5ECO B;  1OVN A;  1HD2 A;  4EKZ A;  2H76 A;  4RI7 A;  1HNA A;  3CRU A;  2JZR A;  4XTS A;  4NAX A;  4WET A;  2JSY A;  2VL2 A;  3WGX A;  1R4W A;  1GSS A;  2DC5 A;  2VL2 C;  3OR5 A;  3A2W A;  3QPM A;  1EEJ A;  5CRG A;  1PD2 1;  1EOG A;  4IVF A;  2LRT A;  1EWX A;  3J7Y k;  2LJR A;  3L4N A;  4IEL A;  2DJJ A;  3US3 A;  2LNS A;  3TKR A;  5INY A;  2KP2 A;  3PR8 A;  3QD9 A;  3TJG A;  5KEJ A;  1VF4 A;  1GTB A;  2FGX A;  1ZL9 A;  2VAF A;  3UAR A;  2YP6 A;  4BA7 A;  4HJM A;  3TJJ A;  4ML1 A;  1BED A;  2AB6 A;  1A8Y A;  1PKW A;  3MAK A;  4XIH A;  9GSS A;  5G31 A;  4MF7 A;  4POB A;  6GSX A;  1TTZ A;  5COH A;  1X9M B;  2DMM A;  2RM5 A;  3DD3 A;  2LQO A;  5JCU A;  3LXZ A;  5DCG A;  4ML6 A;  3F6D A;  1YEX A;  2H1D A;  2LUS A;  4KSM A;  5J9C A;  2HYX A;  4RQR A;  2NVL A;  2DML A;  3KXO A;  1GSU A;  1QK8 A;  1QMV A;  1FOV A;  1M2D A;  3I43 A;  5DAK B;  5ECS A;  1V58 A;  1AQV A;  1O8X A;  3KP8 A;  1A2L A;  4PNF A;  3WT2 A;  1BYE A;  2L4C A;  11GS A;  1Q4J A;  2XPD A;  2H19 A;  3TKP A;  1SKW B;  4JED A;  2CX3 A;  5CRW A;  1B48 A;  5J5N A;  5J41 A;  3EIN A;  4KND A;  1O7U A;  5B8A A;  4PQH A;  3TRQ A;  2EC4 A;  2TRC P;  2PVQ A;  2E7P A;  1M2B A;  3ME8 A;  4XCS A;  2VL9 A;  2JU5 A;  4V1A g;  3KTL A;  3GH6 A;  1YKA A;  3HA9 A;  2IMK A;  2VLU A;  4Z7X A;  4MH3 A;  1GTU A;  3L9U A;  5J9B A;  2BJX A;  3RPP A;  2DBC A;  1U3A A;  3DIE A;  4HZ2 A;  3CXG A;  1B8X A;  1VF1 A;  4TVE A;  5DCH A;  2IIY A;  2YAN A;  3L0H A;  2H72 A;  3KTB A;  2OE0 A;  5HFK A;  3HZ4 A;  3GX8 A;  1VF2 A;  2B1K A;  1XIY A;  2KLX A;  3WD6 A;  4MH2 A;  3GKX A;  1AIU A;  5F8B A;  1SK1 A;  3RBT A;  5DAL B;  3PGT A;  5ELA A;  3HDC A;  2H1B A;  3FR9 A;  1FHE A;  1TJD A;  3UL3 A;  5H5Q A;  4DSS A;  3F3R A;  1MD4 A;  1OKD A;  3G7Y A;  2C3Q A;  3KH9 A;  4MDC A;  5AIX A;  1WRY A;  4ULX A;  2H6X A;  1BQ7 A;  3FZA A;  1XWA A;  2QSI A;  2YNX A;  3NIV A;  3LG6 A;  3FR6 A;  3LYK A;  1XBS A;  4XRA A;  2E2G A;  4FYU A;  4OWY A;  3MSZ A;  2IME A;  5GSS A;  2MBS A;  4KX4 A;  4NPB A;  2VD0 A;  4KH7 A;  4OFT A;  2C3N A;  1AXD A;  2MMO A;  3EYT A;  4AF2 A;  4K6X A;  5HR1 A;  1Z7R A;  2HXK A;  4K7O A;  3HHV A;  2M80 A;  1E6B A;  3HYP A;  1F2E A;  1XW9 A;  1YJ6 A;  1RQM A;  4PX1 A;  4DSR A;  3PH9 A;  3M0F A;  3A3T A;  4AJ8 A;  2D2Z A;  4E8H A;  4RUV A;  2H0H A;  4GST A;  1HQO A;  1XOB A;  3O6T A;  4KA0 A;  2GT5 A;  1ILO A;  3GN3 A;  2XC2 A;  3DKS A;  2DIY A;  4MPF A;  4EO3 A;  1TU7 A;  5CO3 A;  1NW2 A;  1V9W A;  5IOX A;  1WIK A;  1OKT A;  3F9U A;  3EWL A;  3GX0 A;  5GAN D;  2IMF A;  1T1V A;  3Q19 A;  2CVB A;  3TOT A;  3W8S A;  5HR3 A;  2CVD A;  2L6C A;  3A2V A;  2LRN A;  1G0T A;  2H66 A;  2ES7 A;  1T3B A;  2GZZ A;  5DDL A;  4TR0 A;  2I81 A;  5JCG A;  4HU7 A;  5CAX A;  4OO5 A;  2PPT A;  2DJ1 A;  1TW9 A;  4WF5 A;  3UIW A;  2YOI A;  2ZNM A;  2I9H A;  1R5P A;  1TI1 A;  1BG5 A;  3P2A A;  1M2A A;  2HI7 A;  4IBP A;  3VUR A;  5DJM A;  2FLS A;  3GKN A;  2AYT A;  3VLN A;  3UJ1 A;  5F05 A;  1ML6 A;  1BJX A;  3NOF A;  4TXO B;  2OAD A;  4N0V A;  3H93 A;  2L4Q A;  2XBI A;  2VCZ A;  1A2J A;  5G1L A;  1ERU A;  2C0F A;  4FYB A;  2H75 A;  1XCC A;  2J23 A;  4ZL9 A;  2IFQ A;  1X5C A;  5GZZ B;  2YV9 A;  4O5R A;  4IHU A;  2MMA A;  5G30 A;  2VCX A;  3TJK A;  5KN0 A;  2EIQ A;  3GNJ A;  3M3M A;  5C00 A;  2H30 A;  4OO4 A;  1OE8 A;  4XRD A;  2PN8 A;  4KUN A;  2VCT A;  4HI7 A;  4RQX A;  1TRV A;  5G5E A;  4PUF C;  3ZFB A;  3M9K A;  5DAL A;  4MJE A;  1H4O A;  4XHM A;  4PNG A;  4CW9 A;  4ILF A;  5AIV A;  4IJI A;  2VD1 A;  2YWO A;  1O81 A;  2YJH A;  3EU3 A;  1K0B A;  3QMX A;  2LTK A;  5IMZ A;  4WEY A;  4TKY A;  2WZ9 A;  3KEB A;  2OBK A;  2FWH A;  2RII A;  1GSY A;  3UOM A;  5IO2 A;  1M0U A;  2HZE B;  1EGO A;  5D8I A;  1H75 A;  1M99 A;  1S3C A;  2GSR A;  3TCO A;  2VCW A;  1FB0 A;  1EP8 A;  3V1W A;  5ID2 A;  3EU4 A;  1TP9 A;  2HLS A;  3HJO A;  1G7O A;  2NPB A;  4DEJ A;  4K8M A;  1Y25 A;  1NHY A;  1YZX A;  1GLQ A;  2IPA A;  3CMI A;  2CX4 A;  5ELG A;  2PER A;  1QQ2 A;  1SYX A;  3H79 A;  4XS4 A;  1T4Z A;  1EZK A;  2R37 A;  1X9S B;  2IL3 A;  2H6Z A;  2R4V A;  1THO A;  3CSI A;  2GS3 A;  2LKU A;  2YWI A;  1U87 A;  3TRX A;  2X8G A;  1TI3 A;  3N9J A;  1B9X C;  4IJ3 A;  2AUV A;  1MDJ A;  4K7N A;  3Q18 A;  2O8V B;  4G2E A;  3BD2 A;  2YPM A;  4ISD A;  3HJP A;  4ZIJ A;  5F06 A;  3O76 A;  2HT9 A;  4IKH A;  4F2I A;  2AHE A;  2H70 A;  5D9X A;  2ON7 A;  2O89 A;  2ON5 A;  2NBS A;  1JZR A;  1DSB A;  4NHW A;  4PQ1 A;  1TK5 B;  5B8B A;  1PQN A;  1M9A A;  4MPG A;  4GLT A;  4K1F A;  5IIZ A;  4KCA A;  4JE1 A;  3HVV A;  4ZB6 A;  3H8Q A;  3QCP A;  1SD9 A; 
#chains in the Genus database with same CATH topology
 2PBJ A;  5LD0 A;  1WWJ A;  2GQK A;  3CTG A;  4NV5 A;  3GIX A;  5CYY A;  4OFM A;  3IC4 A;  4KDX A;  4POM A;  3FK8 A;  4K7I A;  4X4J A;  4KE3 A;  4L5O A;  2EIR A;  2CAI A;  2GZY A;  7GSS A;  1K0M A;  1BX9 A;  4TN8 A;  4X43 A;  4LL1 B;  4TXO A;  5D93 A;  4F03 A;  5LNK e;  3KCM A;  3RHB A;  5IMC A;  3A5I A;  5JWO B;  1MDK A;  4YAV A;  3BBY A;  2L5O A;  1PRX A;  2OE3 A;  2HRK A;  2I3Y A;  2VM2 A;  5IM9 A;  1HYU A;  3IHG A;  4GQC A;  4ACS A;  4Q5F A;  2GQL A;  1PL1 A;  3ZL5 A;  5IQY A;  1V2A A;  1DE2 A;  3EMP A;  1EP7 A;  2X8H A;  3IRA A;  4I5Q A;  4KCE A;  4MZB A;  2JSZ A;  3TB2 A;  3F8U A;  4Q5Q A;  1K3L A;  4TW5 A;  3LGC A;  2M46 A;  3ZTL A;  4GRF A;  3FY7 A;  4LA1 A;  4NV2 A;  5HQP A;  3GUR A;  3FR3 A;  3QAW A;  4ECI A;  6GSS A;  2QGV A;  3F4S A;  4E8E A;  1SJZ A;  4GXZ A;  4EE0 A;  1KBN A;  4MP4 A;  4IW9 A;  2VL3 A;  2CV4 A;  1Z6N A;  4ZB9 A;  2CZ2 A;  3FZ9 A;  4Q5R A;  3FYG A;  1ZYE A;  4A5P A;  1ACV A;  1GSD A;  2DJ0 A;  3S9F A;  2OBI A;  1MDI A;  2FA8 A;  5ECI B;  3HVS A;  4WBJ A;  4BVY A;  1OC9 B;  1JLV A;  4JZQ A;  4K0G A;  2B7K A;  4RI6 A;  5ECQ B;  3F0I A;  5ENU A;  3DYR A;  2FWG A;  3P7X A;  4G0I A;  5ECL B;  5IMD A;  1X5D A;  2G0F A;  1NM3 A;  1XZO A;  5CRH A;  2O87 A;  2PMT A;  3Q6O A;  2P5R A;  4Q5N A;  1OYJ A;  1A2M A;  4PUA A;  3WGD A;  1SJ6 A;  16GS A;  4J2F A;  3TJB A;  1F3B A;  2YV7 A;  1F6M C;  1PMT A;  3L9S A;  4MNN A;  4ZL7 A;  2E2M A;  3RHC A;  5F0G A;  2IMD A;  4MJB A;  2KOK A;  1YQ1 A;  2DKH A;  2JZT A;  4BIK A;  5ECR B;  2PU9 C;  4X1U A;  1G6Y A;  2B5E A;  1MD3 A;  4L5L A;  3C7M A;  2XPE A;  2FUG 2;  1F3A A;  4TR1 B;  1X0R A;  1KTE A;  4MJA A;  2P31 A;  3MYD A;  1G7E A;  6GSY A;  2HSY A;  1K0C A;  2WRT A;  3AY8 A;  4LL4 B;  2PWJ A;  1THX A;  2N5A A;  5B6M A;  3ZIV A;  3O3T A;  5IMV A;  1AQX A;  1UN2 A;  5G2Z A;  5AN1 A;  2XBQ A;  4CY8 A;  3DWV A;  1JZW A;  3F4T A;  4ZIL A;  3CTF A;  3UAP A;  3ZML A;  4GF0 A;  3GTU B;  5ECH B;  4TRX A;  3IK9 A;  5ECM B;  3QFA C;  4YQU A;  2AJQ B;  1ABA A;  3LW9 A;  4HUA A;  4F9Z A;  1GP1 A;  2XHF A;  3G7J A;  3ZRD A;  1FO5 A;  3DRN A;  3BCI A;  5BRT A;  2GGT A;  2F9S A;  3KH7 A;  2IJY A;  4BVX A;  1W4V A;  3HJM A;  5CNW A;  4ZBD A;  4HOJ A;  3EVI A;  2YCD A;  1O8W A;  2B6M A;  1JFU A;  4NMU A;  5CRD A;  1ERV A;  2B3S A;  2AAW A;  3MWH A;  3BJ5 A;  4NHZ A;  1JZO A;  1JZD A;  3D22 A;  3GRX A;  1Z6M A;  4GSS A;  5B6N A;  1HNB A;  5CP1 A;  2IWT A;  4EC0 A;  3LJR A;  4KDY A;  2PUK C;  2DKI A;  4HDE A;  4POK A;  1O6J A;  1QFN A;  3LFL A;  3KMO A;  4BL7 A;  2R5G A;  1K3O A;  1PA3 A;  4EDY A;  3F4R A;  4K5S A;  3LYP A;  1YEP A;  3TRP A;  1K0N A;  3GUS A;  4IQ1 A;  2LNT A;  1GUL A;  1EOH A;  3KGK A;  1ST9 A;  2NTO A;  1JHB A;  4J57 E;  5DAK A;  4P3Y B;  2JAD A;  3KP9 A;  1I5G A;  1EGR A;  2YZU A;  2LRC A;  20GS A;  3ME7 A;  4IS0 A;  4WXT A;  2RUE A;  3C73 A;  2B1L A;  2PGT A;  1EV4 A;  4JRR A;  3ERF A;  5DQY A;  1AAZ A;  2FD3 A;  2C8U A;  2YWM A;  3CSJ A;  2DJ3 A;  1XG8 A;  1TK8 B;  2WDU A;  2B7J A;  1URM A;  5IMA A;  4O5Q A;  3IR4 A;  3WT1 A;  2VM1 A;  2GSS A;  5AGY A;  4BPY A;  1LJR A;  4JBB A;  4MCU A;  2L57 A;  1O73 A;  1ON4 A;  3DVX A;  4XS1 A;  1WOU A;  1V57 A;  4OFN A;  3TDG A;  3ED3 A;  5DJL A;  4WKW A;  4OCE A;  1SEN A;  2FWE A;  1HNC A;  1V40 A;  3QAG A;  4QL9 A;  2IN3 A;  6GSU A;  3I6A A;  2VCV A;  2OAC A;  1GSE A;  1GRX A;  3LSZ A;  4KDU A;  2FWF A;  4ECC A;  2AV4 A;  4V1A p;  5KN2 A;  1BAY A;  4WBR D;  3ZVJ D;  3R2Q A;  1NSW A;  5ECN B;  2KP1 A;  3I9V 2;  4TOP A;  14GS A;  5FWG A;  4L8E A;  3KD0 A;  4XS6 A;  3RPN A;  3E0U A;  1M9B A;  3IDV A;  4TR1 A;  4PGT A;  2ALB A;  1Z7P A;  4WR5 A;  2R0P A;  3ZLP A;  1FW1 A;  3GFK A;  2L59 A;  4MK3 A;  4POL A;  3G7I A;  4YKG A;  1A8L A;  4K9Z A;  5FT3 A;  1GL8 A;  4IN0 A;  1EV9 A;  2Z9S A;  4G9H A;  4CDO A;  5D9W A;  2B5Y A;  2A2P A;  3UBK A;  1J0F A;  2CQ9 A;  3TJF A;  3HVX A;  3KJY A;  2OKA A;  3IPZ A;  1LU4 A;  3TGZ A;  1B4P A;  3CQF A;  3VWV A;  3GV1 A;  3ZYW A;  3QFB C;  3IBH A;  2LV3 A;  1X9W B;  2N5F A;  4EIQ A;  3C1R A;  4TR3 A;  3DXB A;  1PSQ A;  4GTU A;  2X4A A;  3E3E A;  5GST A;  3VI7 A;  3IAM 2;  4EUY A;  1GSF A;  1PN9 A;  3DML A;  4JU5 A;  4KAE A;  1T8E B;  3EC3 A;  1QGV A;  1RW1 A;  4PXO A;  5A4W A;  3JCM L;  1GUM A;  2H6Y A;  1GSQ A;  3MIX A;  2FNO A;  3IOS A;  2VUP A;  2VO4 A;  1F9M A;  4F0C A;  2I1U A;  1RK4 A;  2X99 A;  3VPT A;  3FZ5 A;  3IHQ A;  5KOX A;  1N8J A;  4OMV A;  2JL4 A;  5EVO A;  1XW5 A;  3A2X A;  4IP6 A;  2V32 A;  4Z2R A;  1SK0 A;  3ZMK A;  3HKR A;  1R5A A;  4DVC A;  4J56 E;  3GKK A;  4MLY A;  2YN1 A;  4O7H A;  3VWW A;  1ZZY A;  5KN3 A;  4MF6 A;  2N5B A;  4JR6 A;  4YQM A;  4MJC A;  1GNE A;  1JLW A;  4AJ6 A;  4DSS B;  3P8W A;  3ZIJ A;  2H01 A;  1WP0 A;  2DLX A;  5IPG A;  3GH9 A;  1NHO A;  3SBC A;  1DE1 A;  2FY6 A;  1GTI A;  4FYC A;  2OJL A;  3QAV A;  5JWR B;  2FA4 A;  2HSH A;  2RUF A;  5D96 A;  3ZIT A;  2MBT A;  1ZOF A;  3ZZX A;  2C0D A;  4IP1 A;  5GAP D;  1SYR A;  2C0G A;  2C1Y A;  3D21 A;  5G5F A;  2MMN A;  2F8A A;  1YF0 A;  2F51 A;  4CHS A;  2L6D A;  1F37 A;  4KW6 A;  1UA5 A;  4ECB A;  3HCZ A;  4HZ4 A;  4ZB8 A;  3TKQ A;  1XOA A;  1M3J A;  2NDO A;  1DUG A;  6GSV A;  3D4M A;  2J9H A;  2FCH A;  1UVZ A;  2DJK A;  1AW9 A;  1WJK A;  2C0E A;  1U88 A;  1CQH A;  1VRS D;  3QDN A;  3EPT A;  2I4A A;  4HEA 2;  3HD5 A;  4V2L A;  3VWU A;  1LBK A;  3WYW A;  4HQZ A;  3M1G A;  3DVW A;  5A4V A;  3UEM A;  2ZCT A;  2ZUP A;  1GWC A;  1TKD B;  1U3I A;  2A4H A;  3GL3 A;  2A2R A;  5ECP B;  3ZFL A;  3GHA A;  1K3Y A;  4N11 A;  2X49 A;  2R6K A;  5EL8 A;  5C04 A;  5AIS A;  2HRA A;  4O32 A;  1YDK A;  2FHE A;  2X8C A;  3ERG A;  1MTC A;  4EL1 A;  2F3M A;  1OC8 A;  2A2S A;  4Z2T A;  1SL1 B;  4LMW A;  1GH2 A;  5A5K A;  2B5X A;  4MF5 A;  1K0D A;  2H73 A;  2YJ7 A;  1SL2 B;  1N2A A;  1GUH A;  4I2T A;  3PPU A;  1SJI A;  2CVK A;  2MYG A;  3Q74 A;  5JWQ B;  1Z5Y E;  2M72 A;  2E0Q A;  2RLI A;  2GZP A;  2LEG A;  3M8N A;  6GSW A;  1A23 A;  1XXU A;  2H8L A;  2HRF A;  1YF1 A;  2R0C A;  4MZC A;  2HZE A;  3APS A;  4Z2U A;  2L5L A;  3TKS E;  3RAZ A;  5FHI A;  2EIO A;  2K8S A;  2WB9 A;  2GT6 A;  3G9B A;  4K2D A;  1PGT A;  3C8E A;  1J08 A;  3VFI A;  4ECJ A;  2WCI A;  1FOH A;  4OCF A;  1GLP A;  2H1G A;  2H0I A;  3ZRE A;  3IXR A;  4ZBA A;  1GNW A;  1WE0 A;  3C1S A;  3FW2 A;  1AUC A;  1TDI A;  5IMF A;  2OE1 A;  1WMJ A;  1CQG A;  3M9J A;  2C4J A;  3GYK A;  2TRX A;  1G6W A;  1J9B A;  4QQ7 A;  2KHP A;  2WUL A;  2IFQ B;  2TIR A;  3LEF A;  2K8V A;  5G1K A;  1AC1 A;  4L0U A;  2PVO C;  3H4K A;  5HFI A;  1FG4 A;  1TRS A;  3NZN A;  5LCZ A;  2C3T A;  1SD8 A;  1E2Y A;  3CBU A;  3P90 A;  3KM6 A;  3VK9 A;  1S3A A;  1Z9H A;  2LJA A;  3APQ A;  3KMN A;  1W89 A;  3W8J A;  4FIW A;  3KZQ A;  2VOC A;  2F8F A;  2VLT A;  3LQ7 A;  1XWG A;  2DIZ A;  2GST A;  1ZYP A;  2KUC A;  2V2G A;  3RDW A;  3F3Q A;  1TOF A;  4N0Z A;  2O85 A;  2WFC A;  1FAA A;  5D73 A;  1FB6 A;  4IQA A;  1XW6 A;  2C80 A;  4TR4 A;  2YWN A;  4KSO A;  2HE3 A;  4PTS A;  4X0X A;  3VWX A;  3IAS 2;  3HZ8 A;  5D9V A;  1TRU A;  5IPH A;  1FVJ A;  1ERW A;  2K6V A;  1TXX A;  2CA8 A;  1EEM A;  1XWB A;  5ID2 B;  1A0R P;  2BTO T;  3EE2 A;  5EPF A;  1SK2 A;  3W6G A;  5H5S A;  4EF0 A;  2LQQ A;  2CT6 A;  1IYH A;  1XVQ A;  3MDK A;  1R7H A;  3MNG A;  3UVH A;  3L78 A;  2P5Q A;  3FZ4 A;  3J7Y b;  5H5R A;  1PX6 A;  4BWS A;  4HU9 A;  5IO0 A;  4USS A;  4EDZ A;  2YZH A;  3PIN A;  3FKF A;  5J4U A;  3FRC A;  3EUR A;  3U6V A;  3C71 A;  1TRW A;  4XS4 B;  12GS A;  4LMV A;  4GSN A;  2A4V A;  1T00 A;  3WGE A;  3F63 A;  5F07 A;  4D73 B;  1SL0 B;  1IYI A;  4G19 A;  5HR0 A;  3VI5 A;  2JZS A;  1ERT A;  4G0K A;  2LS5 A;  3TKS A;  1Q98 A;  1SU9 A;  4DSQ A;  4N30 A;  1Z3E A;  2LJK A;  3D0Z A;  1I9D A;  1YY7 A;  3I69 A;  3TKS C;  3BCK A;  4YQV A;  4PQI A;  2OA7 A;  3HVN A;  3CYN A;  2MMZ A;  5DQS A;  5E4W A;  2WJU A;  4L0W A;  2GVP A;  2QC7 A;  4NWY A;  5B7C A;  3GST A;  4V2N A;  1GUK A;  3U5R E;  4FQU A;  3HY2 A;  4KB3 A;  5BMU A;  3EMX A;  2DSA A;  2VLV A;  4IGJ A;  1ZCP A;  3N5O A;  4QL7 A;  2HZF A;  3IA1 A;  5IOW A;  1K0A A;  1GTA A;  4HS1 A;  4YAP A;  2MZC A;  3DEX A;  3E9J B;  1K0O A;  1U6T A;  4I2U A;  2IMI A;  3UBL A;  1SKS B;  4I6X A;  3LXT A;  1USB A;  1ZYQ B;  3CSH A;  4N10 A;  2H1A A;  4ICY A;  4I97 A;  2RM6 A;  4GWR A;  3TOU A;  3D5J A;  1YKC A;  1C72 A;  1S3R A;  2CAQ A;  2CZ3 A;  2V6K A;  3IV4 A;  1O85 A;  2P0G A;  4AGS A;  3BOA A;  1OC9 A;  4H86 A;  1R26 A;  2QKE A;  2BMX A;  3A5W A;  1XVW A;  3K8N A;  1OC3 A;  22GS A;  3GMF A;  3IE3 A;  2R2J A;  4ZL8 A;  2GQM A;  3L9V A;  3GL5 A;  1X5E A;  1MEK A;  2HFD A;  4WF4 A;  5E59 A;  2QA1 A;  1AQW A;  5D9T A;  3APO A;  5KOW A;  2H74 A;  4V2M A;  2O7K A;  8GSS A;  1M7T A;  1PL2 A;  4YH2 A;  4MAB A;  3FEU A;  1Y6E A;  1V98 A;  3KIJ A;  5ABR A;  3D4T A;  1VGL A;  2G2Q A;  2HRN A;  1SKR B;  3CRT A;  1S3D A;  2REM A;  4TXV A;  2WGR A;  4GQF A;  4FO5 A;  1FVK A;  1XWK A;  5L71 A;  1ZMA A;  1PX7 A;  2V41 A;  4BWQ A;  1TU8 A;  13GS A;  3ZVJ A;  17GS A;  4G10 A;  19GS A;  4K0N A;  1T7P B;  4OD7 A;  3D6I A;  4JR4 A;  5J3R A;  1ZGN A;  1XFL A;  2R3X A;  2H71 A;  1OAZ A;  2DJ2 A;  1T4Y A;  2JAC A;  3FHK A;  3GKM A;  3GTU A;  1OE7 A;  4HQS A;  3ISO A;  3GSS A;  2VIM A;  4F82 A;  1KNG A;  1A24 A;  2HNL A;  3DGQ A;  4O92 A;  4BVY B;  1PKZ A;  4GCI A;  4AJ7 A;  1B4Q A;  5KN1 A;  1B9Y C;  3LWA A;  4NXI A;  3SWL A;  4KGI A;  1QUW A;  2K9F A;  5JCW A;  3UVT A;  5DVB A;  3QR6 A;  3R3E A;  4FH8 A;  18GS A;  4I8B A;  3FMW A;  4EXJ A;  4HSC X;  1KEB A;  4ID0 A;  2VCQ A;  3F6F A;  3QOU A;  1VF3 A;  4PUR A;  2GSQ A;  2GTU A;  5DBQ A;  2GLR A;  4D73 A;  6GST A;  1DBY A;  1UC7 A;  5EY6 A;  5ECK B;  2WS2 A;  5A4U A;  2H0G A;  5CRE A;  3HXS A;  4LLR A;  2GDR A;  2V6O A;  3H1N A;  2K18 A;  1TK0 B;  4ZBB A;  3ERW A;  10GS A;  2X64 A;  1A0F A;  3GA4 A;  3UMA A;  1XPV A;  1XWC A;  1QXH A;  4ZXG A;  3LOR A;  2V1M A;  5HFG A;  2LST A;  4HJ2 A;  4MMM A;  4F0B A;  4MZW A;  3IK7 A;  1WPI A;  4MA9 A;  3VPQ A;  4WR4 A;  5HR2 A;  4EVM A;  3TUE A;  5ECO B;  1OVN A;  1HD2 A;  4EKZ A;  2H76 A;  4RI7 A;  1HNA A;  3CRU A;  2JZR A;  4XTS A;  4NAX A;  4WET A;  2JSY A;  2VL2 A;  3WGX A;  1R4W A;  1GSS A;  2DC5 A;  2VL2 C;  3OR5 A;  3A2W A;  3QPM A;  1EEJ A;  5CRG A;  1PD2 1;  4BVX B;  1EOG A;  4IVF A;  2LRT A;  1EWX A;  1PN0 A;  3J7Y k;  2LJR A;  3L4N A;  4IEL A;  2DJJ A;  3US3 A;  2LNS A;  3TKR A;  5INY A;  2KP2 A;  3PR8 A;  3QD9 A;  3TJG A;  5KEJ A;  1VF4 A;  1ZYN A;  1GTB A;  2FGX A;  1ZL9 A;  2VAF A;  3UAR A;  2YP6 A;  4BA7 A;  4HJM A;  3TJJ A;  4ML1 A;  1BED A;  2AB6 A;  1A8Y A;  1PKW A;  3MAK A;  4XIH A;  4BL7 B;  9GSS A;  5G31 A;  4MF7 A;  4POB A;  1PFO A;  6GSX A;  4KF9 A;  1TTZ A;  5COH A;  1X9M B;  2DMM A;  2RM5 A;  3DD3 A;  2LQO A;  5JCU A;  3LXZ A;  5DCG A;  4ML6 A;  3F6D A;  1YEX A;  2H1D A;  2LUS A;  4KSM A;  5J9C A;  2HYX A;  4RQR A;  2NVL A;  2DML A;  3KXO A;  1GSU A;  1QK8 A;  1QMV A;  1FOV A;  1M2D A;  3I43 A;  5DAK B;  5ECS A;  1V58 A;  1AQV A;  1O8X A;  3KP8 A;  1A2L A;  4PNF A;  3WT2 A;  1BYE A;  2L4C A;  11GS A;  1Q4J A;  2XPD A;  2H19 A;  3TKP A;  1SKW B;  4JED A;  2CX3 A;  5CRW A;  1B48 A;  5J5N A;  5J41 A;  3EIN A;  4KND A;  1O7U A;  5B8A A;  4PQH A;  3TRQ A;  2EC4 A;  4K2X A;  2TRC P;  2PVQ A;  2E7P A;  1M2B A;  4G0L A;  3ME8 A;  4XCS A;  2VL9 A;  2JU5 A;  4V1A g;  3KTL A;  2HSM A;  3GH6 A;  1YKA A;  3HA9 A;  2IMK A;  2VLU A;  4Z7X A;  4MH3 A;  1GTU A;  3L9U A;  5J9B A;  2BJX A;  3RPP A;  2DBC A;  1U3A A;  3DIE A;  4HZ2 A;  3CXG A;  1B8X A;  1VF1 A;  4TVE A;  5DCH A;  2IIY A;  2YAN A;  3L0H A;  2H72 A;  3KTB A;  2OE0 A;  5HFK A;  3HZ4 A;  3GX8 A;  1VF2 A;  2B1K A;  1XIY A;  2KLX A;  3WD6 A;  4MH2 A;  3GKX A;  1AIU A;  5F8B A;  1SK1 A;  3RBT A;  5DAL B;  3PGT A;  5ELA A;  3HDC A;  2H1B A;  3FR9 A;  1FHE A;  1TJD A;  3UL3 A;  5H5Q A;  4DSS A;  3F3R A;  3IC8 A;  1MD4 A;  1OKD A;  3G7Y A;  2C3Q A;  3KH9 A;  4MDC A;  5AIX A;  1WRY A;  4ULX A;  2H6X A;  1BQ7 A;  3FZA A;  1XWA A;  2QSI A;  2YNX A;  3NIV A;  3LG6 A;  3FR6 A;  3LYK A;  1XBS A;  4XRA A;  2E2G A;  4FYU A;  4OWY A;  3MSZ A;  2IME A;  5GSS A;  2MBS A;  4KX4 A;  4NPB A;  2VD0 A;  4KH7 A;  4OFT A;  2C3N A;  1AXD A;  2MMO A;  3EYT A;  4AF2 A;  4K6X A;  5HR1 A;  1Z7R A;  2HXK A;  4K7O A;  3HHV A;  2M80 A;  1E6B A;  3HYP A;  1F2E A;  1XW9 A;  1YJ6 A;  1RQM A;  4PX1 A;  4DSR A;  3PH9 A;  3M0F A;  4EIP A;  3A3T A;  4AJ8 A;  2QA2 A;  2D2Z A;  4E8H A;  4RUV A;  2H0H A;  4GST A;  1HQO A;  1XOB A;  3O6T A;  4KA0 A;  2GT5 A;  1ILO A;  3GN3 A;  2XC2 A;  3DKS A;  2DIY A;  4MPF A;  4EO3 A;  1TU7 A;  5CO3 A;  1NW2 A;  1V9W A;  5IOX A;  1WIK A;  1OKT A;  3F9U A;  3EWL A;  3GX0 A;  5GAN D;  2IMF A;  1T1V A;  3Q19 A;  2CVB A;  3TOT A;  3W8S A;  5HR3 A;  2CVD A;  2L6C A;  3A2V A;  2LRN A;  1G0T A;  2H66 A;  2ES7 A;  1T3B A;  2GZZ A;  5DDL A;  4TR0 A;  2I81 A;  5JCG A;  4HU7 A;  5CAX A;  4OO5 A;  2PPT A;  2DJ1 A;  1TW9 A;  4WF5 A;  3UIW A;  2YOI A;  2ZNM A;  2I9H A;  1R5P A;  1TI1 A;  1BG5 A;  3P2A A;  1M2A A;  2HI7 A;  4IBP A;  3VUR A;  5DJM A;  2FLS A;  3GKN A;  2AYT A;  3VLN A;  3UJ1 A;  5F05 A;  1ML6 A;  1BJX A;  3NOF A;  4TXO B;  2OAD A;  4N0V A;  3H93 A;  2L4Q A;  2XBI A;  2VCZ A;  1A2J A;  5G1L A;  1ERU A;  2C0F A;  4FYB A;  2H75 A;  1XCC A;  2J23 A;  4ZL9 A;  2IFQ A;  1X5C A;  5GZZ B;  2YV9 A;  4CY6 A;  4O5R A;  4IHU A;  2MMA A;  5G30 A;  2VCX A;  3TJK A;  5KN0 A;  2EIQ A;  3GNJ A;  3M3M A;  5C00 A;  2R0G A;  2H30 A;  4OO4 A;  1OE8 A;  4XRD A;  2PN8 A;  4KUN A;  2VCT A;  4HI7 A;  4RQX A;  1TRV A;  5G5E A;  4PUF C;  3ZFB A;  3M9K A;  5DAL A;  4MJE A;  1H4O A;  4XHM A;  4PNG A;  4CW9 A;  4K5R A;  4ILF A;  5AIV A;  4IJI A;  2VD1 A;  4O5U A;  2YWO A;  1O81 A;  2YJH A;  3EU3 A;  1K0B A;  3QMX A;  2LTK A;  5IMZ A;  4WEY A;  4TKY A;  2WZ9 A;  3KEB A;  2OBK A;  2FWH A;  2RII A;  1GSY A;  3UOM A;  5IO2 A;  1M0U A;  2HZE B;  1EGO A;  5D8I A;  1H75 A;  1M99 A;  1S3C A;  2GSR A;  3TCO A;  2VCW A;  1FB0 A;  1EP8 A;  3V1W A;  5ID2 A;  3EU4 A;  1TP9 A;  2HLS A;  3HJO A;  1G7O A;  2NPB A;  4DEJ A;  4K8M A;  1Y25 A;  1NHY A;  1YZX A;  1GLQ A;  2IPA A;  3CMI A;  2CX4 A;  5ELG A;  2UZ8 A;  2PER A;  1QQ2 A;  1SYX A;  3H79 A;  4XS4 A;  1T4Z A;  1EZK A;  2R37 A;  1X9S B;  2IL3 A;  2H6Z A;  2R4V A;  1THO A;  3CSI A;  2GS3 A;  2LKU A;  2YWI A;  1U87 A;  3TRX A;  2X8G A;  1TI3 A;  3N9J A;  1B9X C;  4IJ3 A;  2AUV A;  1MDJ A;  4K7N A;  3Q18 A;  2O8V B;  4G2E A;  3BD2 A;  4YKF A;  1M3I A;  2YPM A;  4ISD A;  3HJP A;  4ZIJ A;  5F06 A;  3O76 A;  2HT9 A;  4IKH A;  4F2I A;  2AHE A;  2H70 A;  5D9X A;  2ON7 A;  2O89 A;  2ON5 A;  2NBS A;  1JZR A;  1DSB A;  4NHW A;  4PQ1 A;  1TK5 B;  5B8B A;  1PQN A;  1M9A A;  4MPG A;  4GLT A;  4K1F A;  5IIZ A;  4KCA A;  4JE1 A;  3HVV A;  4ZB6 A;  3H8Q A;  3QCP A;  1SD9 A; 
#chains in the Genus database with same CATH homology
 2PBJ A;  5LD0 A;  1WWJ A;  2GQK A;  3CTG A;  4NV5 A;  3GIX A;  5CYY A;  4OFM A;  3IC4 A;  4KDX A;  4POM A;  3FK8 A;  4K7I A;  4X4J A;  4KE3 A;  4L5O A;  2EIR A;  2CAI A;  2GZY A;  7GSS A;  1K0M A;  1BX9 A;  4TN8 A;  4X43 A;  4LL1 B;  4TXO A;  5D93 A;  4F03 A;  5LNK e;  3KCM A;  3RHB A;  5IMC A;  3A5I A;  5JWO B;  1MDK A;  4YAV A;  3BBY A;  2L5O A;  1PRX A;  2OE3 A;  2HRK A;  2I3Y A;  2VM2 A;  5IM9 A;  1HYU A;  3IHG A;  4GQC A;  4ACS A;  4Q5F A;  2GQL A;  1PL1 A;  3ZL5 A;  5IQY A;  1V2A A;  1DE2 A;  3EMP A;  1EP7 A;  2X8H A;  3IRA A;  4I5Q A;  4KCE A;  4MZB A;  2JSZ A;  3TB2 A;  3F8U A;  4Q5Q A;  1K3L A;  4TW5 A;  3LGC A;  2M46 A;  3ZTL A;  4GRF A;  3FY7 A;  4LA1 A;  4NV2 A;  5HQP A;  3GUR A;  3FR3 A;  3QAW A;  4ECI A;  6GSS A;  2QGV A;  3F4S A;  4E8E A;  1SJZ A;  4GXZ A;  4EE0 A;  1KBN A;  4MP4 A;  4IW9 A;  2VL3 A;  2CV4 A;  1Z6N A;  4ZB9 A;  2CZ2 A;  3FZ9 A;  4Q5R A;  3FYG A;  1ZYE A;  4A5P A;  1ACV A;  1GSD A;  2DJ0 A;  3S9F A;  2OBI A;  1MDI A;  2FA8 A;  5ECI B;  3HVS A;  4WBJ A;  4BVY A;  1OC9 B;  1JLV A;  4JZQ A;  4K0G A;  2B7K A;  4RI6 A;  5ECQ B;  3F0I A;  5ENU A;  3DYR A;  2FWG A;  3P7X A;  4G0I A;  5ECL B;  5IMD A;  1X5D A;  2G0F A;  1NM3 A;  1XZO A;  5CRH A;  2O87 A;  2PMT A;  3Q6O A;  2P5R A;  4Q5N A;  1OYJ A;  1A2M A;  4PUA A;  3WGD A;  1SJ6 A;  16GS A;  4J2F A;  3TJB A;  1F3B A;  2YV7 A;  1F6M C;  1PMT A;  3L9S A;  4MNN A;  4ZL7 A;  2E2M A;  3RHC A;  5F0G A;  2IMD A;  4MJB A;  2KOK A;  1YQ1 A;  2DKH A;  2JZT A;  5ECR B;  2PU9 C;  4X1U A;  1G6Y A;  2B5E A;  1MD3 A;  4L5L A;  3C7M A;  2XPE A;  2FUG 2;  1F3A A;  4TR1 B;  1X0R A;  1KTE A;  4MJA A;  2P31 A;  3MYD A;  1G7E A;  6GSY A;  2HSY A;  1K0C A;  2WRT A;  3AY8 A;  4LL4 B;  2PWJ A;  1THX A;  2N5A A;  5B6M A;  3ZIV A;  3O3T A;  5IMV A;  1AQX A;  1UN2 A;  5G2Z A;  5AN1 A;  2XBQ A;  4CY8 A;  3DWV A;  1JZW A;  3F4T A;  4ZIL A;  3CTF A;  3UAP A;  3ZML A;  4GF0 A;  3GTU B;  5ECH B;  4TRX A;  3IK9 A;  5ECM B;  3QFA C;  4YQU A;  2AJQ B;  1ABA A;  3LW9 A;  4HUA A;  4F9Z A;  1GP1 A;  2XHF A;  3G7J A;  3ZRD A;  1FO5 A;  3DRN A;  3BCI A;  5BRT A;  2GGT A;  2F9S A;  3KH7 A;  2IJY A;  4BVX A;  1W4V A;  3HJM A;  5CNW A;  4ZBD A;  4HOJ A;  3EVI A;  2YCD A;  1O8W A;  2B6M A;  1JFU A;  4NMU A;  5CRD A;  1ERV A;  2B3S A;  2AAW A;  3MWH A;  3BJ5 A;  4NHZ A;  1JZO A;  1JZD A;  3D22 A;  3GRX A;  1Z6M A;  4GSS A;  5B6N A;  1HNB A;  5CP1 A;  2IWT A;  4EC0 A;  3LJR A;  4KDY A;  2PUK C;  2DKI A;  4HDE A;  4POK A;  1O6J A;  1QFN A;  3LFL A;  3KMO A;  4BL7 A;  2R5G A;  1K3O A;  1PA3 A;  4EDY A;  3F4R A;  4K5S A;  3LYP A;  1YEP A;  3TRP A;  1K0N A;  3GUS A;  4IQ1 A;  2LNT A;  1GUL A;  1EOH A;  3KGK A;  1ST9 A;  2NTO A;  1JHB A;  4J57 E;  5DAK A;  4P3Y B;  2JAD A;  3KP9 A;  1I5G A;  1EGR A;  2YZU A;  2LRC A;  20GS A;  3ME7 A;  4IS0 A;  4WXT A;  2RUE A;  3C73 A;  2B1L A;  2PGT A;  1EV4 A;  4JRR A;  3ERF A;  5DQY A;  1AAZ A;  2FD3 A;  2C8U A;  2YWM A;  3CSJ A;  2DJ3 A;  1TK8 B;  2WDU A;  2B7J A;  1URM A;  5IMA A;  4O5Q A;  3IR4 A;  3WT1 A;  2VM1 A;  2GSS A;  5AGY A;  4BPY A;  1LJR A;  4JBB A;  4MCU A;  2L57 A;  1O73 A;  1ON4 A;  3DVX A;  4XS1 A;  1WOU A;  1V57 A;  4OFN A;  3TDG A;  3ED3 A;  5DJL A;  4WKW A;  4OCE A;  1SEN A;  2FWE A;  1HNC A;  1V40 A;  3QAG A;  4QL9 A;  2IN3 A;  6GSU A;  3I6A A;  2VCV A;  2OAC A;  1GSE A;  1GRX A;  3LSZ A;  4KDU A;  2FWF A;  4ECC A;  2AV4 A;  4V1A p;  5KN2 A;  1BAY A;  4WBR D;  3ZVJ D;  3R2Q A;  1NSW A;  5ECN B;  2KP1 A;  3I9V 2;  4TOP A;  14GS A;  5FWG A;  4L8E A;  3KD0 A;  4XS6 A;  3RPN A;  3E0U A;  1M9B A;  3IDV A;  4TR1 A;  4PGT A;  2ALB A;  1Z7P A;  4WR5 A;  2R0P A;  3ZLP A;  1FW1 A;  3GFK A;  2L59 A;  4MK3 A;  4POL A;  3G7I A;  4YKG A;  1A8L A;  4K9Z A;  5FT3 A;  1GL8 A;  4IN0 A;  1EV9 A;  2Z9S A;  4G9H A;  4CDO A;  5D9W A;  2B5Y A;  2A2P A;  3UBK A;  1J0F A;  2CQ9 A;  3TJF A;  3HVX A;  3KJY A;  2OKA A;  3IPZ A;  1LU4 A;  3TGZ A;  1B4P A;  3VWV A;  3GV1 A;  3ZYW A;  3QFB C;  3IBH A;  2LV3 A;  1X9W B;  2N5F A;  4EIQ A;  3C1R A;  4TR3 A;  3DXB A;  1PSQ A;  4GTU A;  2X4A A;  3E3E A;  5GST A;  3VI7 A;  3IAM 2;  4EUY A;  1GSF A;  1PN9 A;  3DML A;  4JU5 A;  4KAE A;  1T8E B;  3EC3 A;  1QGV A;  1RW1 A;  4PXO A;  5A4W A;  3JCM L;  1GUM A;  2H6Y A;  1GSQ A;  3MIX A;  2FNO A;  3IOS A;  2VUP A;  2VO4 A;  1F9M A;  4F0C A;  2I1U A;  1RK4 A;  2X99 A;  3VPT A;  3FZ5 A;  3IHQ A;  5KOX A;  1N8J A;  4OMV A;  2JL4 A;  5EVO A;  1XW5 A;  3A2X A;  4IP6 A;  2V32 A;  4Z2R A;  1SK0 A;  3ZMK A;  3HKR A;  1R5A A;  4DVC A;  4J56 E;  3GKK A;  4MLY A;  2YN1 A;  4O7H A;  3VWW A;  1ZZY A;  5KN3 A;  4MF6 A;  2N5B A;  4JR6 A;  4YQM A;  4MJC A;  1GNE A;  1JLW A;  4AJ6 A;  4DSS B;  3P8W A;  3ZIJ A;  2H01 A;  1WP0 A;  2DLX A;  5IPG A;  3GH9 A;  1NHO A;  3SBC A;  1DE1 A;  2FY6 A;  1GTI A;  4FYC A;  2OJL A;  3QAV A;  5JWR B;  2FA4 A;  2HSH A;  2RUF A;  5D96 A;  3ZIT A;  2MBT A;  1ZOF A;  3ZZX A;  2C0D A;  4IP1 A;  5GAP D;  1SYR A;  2C0G A;  2C1Y A;  3D21 A;  5G5F A;  2MMN A;  2F8A A;  1YF0 A;  2F51 A;  4CHS A;  2L6D A;  1F37 A;  4KW6 A;  1UA5 A;  4ECB A;  3HCZ A;  4HZ4 A;  4ZB8 A;  3TKQ A;  1XOA A;  2NDO A;  1DUG A;  6GSV A;  3D4M A;  2J9H A;  2FCH A;  1UVZ A;  2DJK A;  1AW9 A;  1WJK A;  2C0E A;  1U88 A;  1CQH A;  1VRS D;  3QDN A;  3EPT A;  2I4A A;  4HEA 2;  3HD5 A;  4V2L A;  3VWU A;  1LBK A;  3WYW A;  4HQZ A;  3M1G A;  3DVW A;  5A4V A;  3UEM A;  2ZCT A;  2ZUP A;  1GWC A;  1TKD B;  1U3I A;  2A4H A;  3GL3 A;  2A2R A;  5ECP B;  3ZFL A;  3GHA A;  1K3Y A;  4N11 A;  2X49 A;  2R6K A;  5EL8 A;  5C04 A;  5AIS A;  2HRA A;  4O32 A;  1YDK A;  2FHE A;  2X8C A;  3ERG A;  1MTC A;  4EL1 A;  2F3M A;  1OC8 A;  2A2S A;  4Z2T A;  1SL1 B;  4LMW A;  1GH2 A;  5A5K A;  2B5X A;  4MF5 A;  1K0D A;  2H73 A;  2YJ7 A;  1SL2 B;  1N2A A;  1GUH A;  4I2T A;  3PPU A;  1SJI A;  2CVK A;  2MYG A;  3Q74 A;  5JWQ B;  1Z5Y E;  2M72 A;  2E0Q A;  2RLI A;  2GZP A;  2LEG A;  3M8N A;  6GSW A;  1A23 A;  1XXU A;  2H8L A;  2HRF A;  1YF1 A;  2R0C A;  4MZC A;  2HZE A;  3APS A;  4Z2U A;  2L5L A;  3TKS E;  3RAZ A;  5FHI A;  2EIO A;  2K8S A;  2WB9 A;  2GT6 A;  3G9B A;  4K2D A;  1PGT A;  3C8E A;  1J08 A;  3VFI A;  4ECJ A;  2WCI A;  1FOH A;  4OCF A;  1GLP A;  2H1G A;  2H0I A;  3ZRE A;  3IXR A;  4ZBA A;  1GNW A;  1WE0 A;  3C1S A;  3FW2 A;  1AUC A;  1TDI A;  5IMF A;  2OE1 A;  1WMJ A;  1CQG A;  3M9J A;  2C4J A;  3GYK A;  2TRX A;  1G6W A;  1J9B A;  4QQ7 A;  2KHP A;  2WUL A;  2IFQ B;  2TIR A;  3LEF A;  2K8V A;  5G1K A;  1AC1 A;  4L0U A;  2PVO C;  3H4K A;  5HFI A;  1FG4 A;  1TRS A;  3NZN A;  5LCZ A;  2C3T A;  1SD8 A;  1E2Y A;  3CBU A;  3P90 A;  3KM6 A;  3VK9 A;  1S3A A;  1Z9H A;  2LJA A;  3APQ A;  3KMN A;  1W89 A;  3W8J A;  4FIW A;  3KZQ A;  2VOC A;  2F8F A;  2VLT A;  3LQ7 A;  1XWG A;  2DIZ A;  2GST A;  1ZYP A;  2KUC A;  2V2G A;  3RDW A;  3F3Q A;  1TOF A;  4N0Z A;  2O85 A;  2WFC A;  1FAA A;  5D73 A;  1FB6 A;  4IQA A;  1XW6 A;  2C80 A;  4TR4 A;  2YWN A;  4KSO A;  2HE3 A;  4PTS A;  4X0X A;  3VWX A;  3IAS 2;  3HZ8 A;  5D9V A;  1TRU A;  5IPH A;  1FVJ A;  1ERW A;  2K6V A;  1TXX A;  2CA8 A;  1EEM A;  1XWB A;  5ID2 B;  1A0R P;  2BTO T;  3EE2 A;  5EPF A;  1SK2 A;  3W6G A;  5H5S A;  4EF0 A;  2LQQ A;  2CT6 A;  1IYH A;  1XVQ A;  3MDK A;  1R7H A;  3MNG A;  3UVH A;  3L78 A;  2P5Q A;  3FZ4 A;  3J7Y b;  5H5R A;  1PX6 A;  4BWS A;  4HU9 A;  5IO0 A;  4USS A;  4EDZ A;  2YZH A;  3PIN A;  3FKF A;  5J4U A;  3FRC A;  3EUR A;  3U6V A;  3C71 A;  1TRW A;  4XS4 B;  12GS A;  4LMV A;  4GSN A;  2A4V A;  1T00 A;  3WGE A;  3F63 A;  5F07 A;  4D73 B;  1SL0 B;  1IYI A;  4G19 A;  5HR0 A;  3VI5 A;  2JZS A;  1ERT A;  4G0K A;  2LS5 A;  3TKS A;  1Q98 A;  1SU9 A;  4DSQ A;  4N30 A;  1Z3E A;  2LJK A;  3D0Z A;  1I9D A;  1YY7 A;  3I69 A;  3TKS C;  3BCK A;  4YQV A;  4PQI A;  2OA7 A;  3CYN A;  2MMZ A;  5DQS A;  5E4W A;  2WJU A;  4L0W A;  2GVP A;  2QC7 A;  4NWY A;  5B7C A;  3GST A;  4V2N A;  1GUK A;  3U5R E;  4FQU A;  3HY2 A;  4KB3 A;  5BMU A;  3EMX A;  2DSA A;  2VLV A;  4IGJ A;  1ZCP A;  3N5O A;  4QL7 A;  2HZF A;  3IA1 A;  5IOW A;  1K0A A;  1GTA A;  4HS1 A;  4YAP A;  2MZC A;  3DEX A;  3E9J B;  1K0O A;  1U6T A;  4I2U A;  2IMI A;  3UBL A;  1SKS B;  4I6X A;  3LXT A;  1USB A;  1ZYQ B;  3CSH A;  4N10 A;  2H1A A;  4ICY A;  4I97 A;  2RM6 A;  4GWR A;  3TOU A;  3D5J A;  1YKC A;  1C72 A;  2CAQ A;  2CZ3 A;  2V6K A;  3IV4 A;  1O85 A;  2P0G A;  4AGS A;  3BOA A;  1OC9 A;  4H86 A;  1R26 A;  2QKE A;  2BMX A;  3A5W A;  1XVW A;  3K8N A;  1OC3 A;  22GS A;  3GMF A;  3IE3 A;  2R2J A;  4ZL8 A;  2GQM A;  3L9V A;  3GL5 A;  1X5E A;  1MEK A;  2HFD A;  4WF4 A;  5E59 A;  2QA1 A;  1AQW A;  5D9T A;  3APO A;  5KOW A;  2H74 A;  4V2M A;  2O7K A;  8GSS A;  1M7T A;  1PL2 A;  4YH2 A;  4MAB A;  3FEU A;  1Y6E A;  1V98 A;  3KIJ A;  5ABR A;  3D4T A;  1VGL A;  2G2Q A;  2HRN A;  1SKR B;  3CRT A;  1S3D A;  2REM A;  4TXV A;  2WGR A;  4GQF A;  4FO5 A;  1FVK A;  1XWK A;  5L71 A;  1ZMA A;  1PX7 A;  2V41 A;  4BWQ A;  1TU8 A;  13GS A;  3ZVJ A;  17GS A;  4G10 A;  19GS A;  4K0N A;  1T7P B;  4OD7 A;  3D6I A;  4JR4 A;  5J3R A;  1ZGN A;  1XFL A;  2R3X A;  2H71 A;  1OAZ A;  2DJ2 A;  1T4Y A;  2JAC A;  3FHK A;  3GKM A;  3GTU A;  1OE7 A;  4HQS A;  3ISO A;  3GSS A;  2VIM A;  4F82 A;  1KNG A;  1A24 A;  2HNL A;  3DGQ A;  4O92 A;  4BVY B;  1PKZ A;  4GCI A;  4AJ7 A;  1B4Q A;  5KN1 A;  1B9Y C;  3LWA A;  4NXI A;  3SWL A;  4KGI A;  1QUW A;  2K9F A;  5JCW A;  3UVT A;  5DVB A;  3QR6 A;  3R3E A;  4FH8 A;  18GS A;  4I8B A;  3FMW A;  4EXJ A;  1KEB A;  4ID0 A;  2VCQ A;  3F6F A;  3QOU A;  1VF3 A;  4PUR A;  2GSQ A;  2GTU A;  5DBQ A;  2GLR A;  4D73 A;  6GST A;  1DBY A;  1UC7 A;  5EY6 A;  5ECK B;  2WS2 A;  5A4U A;  2H0G A;  5CRE A;  3HXS A;  4LLR A;  2GDR A;  2V6O A;  3H1N A;  2K18 A;  1TK0 B;  4ZBB A;  3ERW A;  10GS A;  2X64 A;  1A0F A;  3GA4 A;  3UMA A;  1XPV A;  1XWC A;  1QXH A;  4ZXG A;  3LOR A;  2V1M A;  5HFG A;  2LST A;  4HJ2 A;  4MMM A;  4F0B A;  4MZW A;  3IK7 A;  1WPI A;  4MA9 A;  3VPQ A;  4WR4 A;  5HR2 A;  4EVM A;  3TUE A;  5ECO B;  1OVN A;  1HD2 A;  4EKZ A;  2H76 A;  4RI7 A;  1HNA A;  3CRU A;  2JZR A;  4XTS A;  4NAX A;  4WET A;  2JSY A;  2VL2 A;  3WGX A;  1R4W A;  1GSS A;  2DC5 A;  2VL2 C;  3OR5 A;  3A2W A;  3QPM A;  1EEJ A;  5CRG A;  1PD2 1;  4BVX B;  1EOG A;  4IVF A;  2LRT A;  1EWX A;  1PN0 A;  3J7Y k;  2LJR A;  3L4N A;  4IEL A;  2DJJ A;  3US3 A;  2LNS A;  3TKR A;  5INY A;  2KP2 A;  3PR8 A;  3QD9 A;  3TJG A;  5KEJ A;  1VF4 A;  1ZYN A;  1GTB A;  2FGX A;  1ZL9 A;  2VAF A;  3UAR A;  2YP6 A;  4BA7 A;  4HJM A;  3TJJ A;  4ML1 A;  1BED A;  2AB6 A;  1A8Y A;  1PKW A;  3MAK A;  4XIH A;  4BL7 B;  9GSS A;  5G31 A;  4MF7 A;  4POB A;  6GSX A;  4KF9 A;  1TTZ A;  5COH A;  1X9M B;  2DMM A;  2RM5 A;  3DD3 A;  2LQO A;  5JCU A;  3LXZ A;  5DCG A;  4ML6 A;  3F6D A;  1YEX A;  2H1D A;  2LUS A;  4KSM A;  5J9C A;  2HYX A;  4RQR A;  2NVL A;  2DML A;  3KXO A;  1GSU A;  1QK8 A;  1QMV A;  1FOV A;  1M2D A;  3I43 A;  5DAK B;  5ECS A;  1V58 A;  1AQV A;  1O8X A;  3KP8 A;  1A2L A;  4PNF A;  3WT2 A;  1BYE A;  2L4C A;  11GS A;  1Q4J A;  2XPD A;  2H19 A;  3TKP A;  1SKW B;  4JED A;  2CX3 A;  5CRW A;  1B48 A;  5J5N A;  5J41 A;  3EIN A;  4KND A;  1O7U A;  5B8A A;  4PQH A;  3TRQ A;  2EC4 A;  4K2X A;  2TRC P;  2PVQ A;  2E7P A;  1M2B A;  4G0L A;  3ME8 A;  4XCS A;  2VL9 A;  2JU5 A;  4V1A g;  3KTL A;  2HSM A;  3GH6 A;  1YKA A;  3HA9 A;  2IMK A;  2VLU A;  4Z7X A;  4MH3 A;  1GTU A;  3L9U A;  5J9B A;  2BJX A;  3RPP A;  2DBC A;  1U3A A;  3DIE A;  4HZ2 A;  3CXG A;  1B8X A;  1VF1 A;  4TVE A;  5DCH A;  2IIY A;  2YAN A;  3L0H A;  2H72 A;  3KTB A;  2OE0 A;  5HFK A;  3HZ4 A;  3GX8 A;  1VF2 A;  2B1K A;  1XIY A;  2KLX A;  3WD6 A;  4MH2 A;  3GKX A;  1AIU A;  5F8B A;  1SK1 A;  3RBT A;  5DAL B;  3PGT A;  5ELA A;  3HDC A;  2H1B A;  3FR9 A;  1FHE A;  1TJD A;  3UL3 A;  5H5Q A;  4DSS A;  3F3R A;  3IC8 A;  1MD4 A;  1OKD A;  3G7Y A;  2C3Q A;  3KH9 A;  4MDC A;  5AIX A;  1WRY A;  4ULX A;  2H6X A;  1BQ7 A;  3FZA A;  1XWA A;  2QSI A;  2YNX A;  3NIV A;  3LG6 A;  3FR6 A;  3LYK A;  1XBS A;  4XRA A;  2E2G A;  4FYU A;  4OWY A;  3MSZ A;  2IME A;  5GSS A;  2MBS A;  4KX4 A;  4NPB A;  2VD0 A;  4KH7 A;  4OFT A;  2C3N A;  1AXD A;  2MMO A;  3EYT A;  4AF2 A;  4K6X A;  5HR1 A;  1Z7R A;  2HXK A;  4K7O A;  3HHV A;  2M80 A;  1E6B A;  3HYP A;  1F2E A;  1XW9 A;  1YJ6 A;  1RQM A;  4PX1 A;  4DSR A;  3PH9 A;  3M0F A;  4EIP A;  3A3T A;  4AJ8 A;  2QA2 A;  2D2Z A;  4E8H A;  4RUV A;  2H0H A;  4GST A;  1HQO A;  1XOB A;  3O6T A;  4KA0 A;  2GT5 A;  1ILO A;  3GN3 A;  2XC2 A;  3DKS A;  2DIY A;  4MPF A;  4EO3 A;  1TU7 A;  5CO3 A;  1NW2 A;  1V9W A;  5IOX A;  1WIK A;  1OKT A;  3F9U A;  3EWL A;  3GX0 A;  5GAN D;  2IMF A;  1T1V A;  3Q19 A;  2CVB A;  3TOT A;  3W8S A;  5HR3 A;  2CVD A;  2L6C A;  3A2V A;  2LRN A;  1G0T A;  2H66 A;  2ES7 A;  1T3B A;  2GZZ A;  5DDL A;  4TR0 A;  2I81 A;  5JCG A;  4HU7 A;  5CAX A;  4OO5 A;  2PPT A;  2DJ1 A;  1TW9 A;  4WF5 A;  3UIW A;  2YOI A;  2ZNM A;  2I9H A;  1R5P A;  1TI1 A;  1BG5 A;  3P2A A;  1M2A A;  2HI7 A;  4IBP A;  3VUR A;  5DJM A;  2FLS A;  3GKN A;  2AYT A;  3VLN A;  3UJ1 A;  5F05 A;  1ML6 A;  1BJX A;  3NOF A;  4TXO B;  2OAD A;  4N0V A;  3H93 A;  2L4Q A;  2XBI A;  2VCZ A;  1A2J A;  5G1L A;  1ERU A;  2C0F A;  4FYB A;  2H75 A;  1XCC A;  2J23 A;  4ZL9 A;  2IFQ A;  1X5C A;  5GZZ B;  2YV9 A;  4CY6 A;  4O5R A;  4IHU A;  2MMA A;  5G30 A;  2VCX A;  3TJK A;  5KN0 A;  2EIQ A;  3GNJ A;  3M3M A;  5C00 A;  2R0G A;  2H30 A;  4OO4 A;  1OE8 A;  4XRD A;  2PN8 A;  4KUN A;  2VCT A;  4HI7 A;  4RQX A;  1TRV A;  5G5E A;  4PUF C;  3ZFB A;  3M9K A;  5DAL A;  4MJE A;  1H4O A;  4XHM A;  4PNG A;  4CW9 A;  4K5R A;  4ILF A;  5AIV A;  4IJI A;  2VD1 A;  4O5U A;  2YWO A;  1O81 A;  2YJH A;  3EU3 A;  1K0B A;  3QMX A;  2LTK A;  5IMZ A;  4WEY A;  4TKY A;  2WZ9 A;  3KEB A;  2OBK A;  2FWH A;  2RII A;  1GSY A;  3UOM A;  5IO2 A;  1M0U A;  2HZE B;  1EGO A;  5D8I A;  1H75 A;  1M99 A;  1S3C A;  2GSR A;  3TCO A;  2VCW A;  1FB0 A;  1EP8 A;  3V1W A;  5ID2 A;  3EU4 A;  1TP9 A;  2HLS A;  3HJO A;  1G7O A;  2NPB A;  4DEJ A;  4K8M A;  1Y25 A;  1NHY A;  1YZX A;  1GLQ A;  2IPA A;  3CMI A;  2CX4 A;  5ELG A;  2UZ8 A;  2PER A;  1QQ2 A;  1SYX A;  3H79 A;  4XS4 A;  1T4Z A;  1EZK A;  2R37 A;  1X9S B;  2IL3 A;  2H6Z A;  2R4V A;  1THO A;  3CSI A;  2GS3 A;  2LKU A;  2YWI A;  1U87 A;  3TRX A;  2X8G A;  1TI3 A;  3N9J A;  1B9X C;  4IJ3 A;  2AUV A;  1MDJ A;  4K7N A;  3Q18 A;  2O8V B;  4G2E A;  3BD2 A;  4YKF A;  2YPM A;  4ISD A;  3HJP A;  4ZIJ A;  5F06 A;  3O76 A;  2HT9 A;  4IKH A;  4F2I A;  2AHE A;  2H70 A;  5D9X A;  2ON7 A;  2O89 A;  2ON5 A;  2NBS A;  1JZR A;  1DSB A;  4NHW A;  4PQ1 A;  1TK5 B;  5B8B A;  1PQN A;  1M9A A;  4MPG A;  4GLT A;  4K1F A;  5IIZ A;  4KCA A;  4JE1 A;  3HVV A;  4ZB6 A;  3H8Q A;  3QCP A;  1SD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...