4LLRA

Tryparedoxin peroxidase (txnpx) from trypanosoma cruzi in the reduced state
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
194
structure length
194
Chain Sequence
GDAKLNHPAPDFNETALMPNGTFKKVALTSYKGKWLVLFFYPMDFTFVCPTEICQFSDRVKEFSDIGCEVLACSMDSEYSHLAWTSIERKRGGLGQMNIPILADKTKCIMKSYGVLKEEDGVAYRGLFIIDPKQNLRQITVNDLPVGRDVDEALRLVKAFQFVEKHGEVCPANWKPGDKTMKPDPEKSKEYFGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Tryparedoxin peroxidase
publication title Crystal structure of the TRYPAREDOXIN PEROXIDASE from the human parasite TRYPANOSOMA CRUZI
pubmed doi rcsb
source organism Trypanosoma cruzi
total genus 60
structure length 194
sequence length 194
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4llrA00
2YJ7A 4TN8A 1EV9A 3VPQA 2GT5A 3FW2A 3QDNA 3KP8A 2YP6A 1VF4A 3F4TA 3IPZA 1NM3A 5EY6A 1XW5A 5IMFA 4IQAA 3GYKA 3M1GA 1Q4JA 2L4QA 3GN3A 4J2FA 3HJPA 2O87A 2OE3A 2YCDA 4KX4A 1Y6EA 2R4VA 3QPMA 1OC9B 2B6MA 1TRWA 4CHSA 4TR1A 4NWYA 4K0NA 2FHEA 4O92A 2XBIA 2LTKA 3TKQA 5KN3A 3GKXA 2R5GA 4GWRA 4MF5A 4J57E 4JRRA 2B3SA 2BJXA 1G7OA 1MD3A 3QMXA 3FZAA 5KEJA 4KDYA 1QUWA 3LQ7A 5ECNB 2CVKA 1EOHA 1MDIA 2M72A 3Q18A 4JBBA 3ME7A 3LSZA 1A8LA 5AISA 4V2NA 3KGKA 1FVKA 1J0FA 4K1FA 1XPVA 5HFGA 1X5CA 2VL2C 2VCZA 4IW9A 5ECSA 1JZOA 4L5OA 1TOFA 1SL0B 2RUEA 2I3YA 4KDUA 3FEUA 1SL1B 3ZL5A 2KOKA 2FA8A 1G7EA 1BX9A 3TJGA 1M2BA 3IAS2 5ECOB 4TXOB 2IMIA 1JFUA 5GSTA 4LMWA 5DCHA 5DVBA 2H0HA 2I9HA 5IPHA 2ON5A 2FGXA 4H86A 4XS4A 1Z5YE 4BL7A 1TK0B 2F9SA 3H4KA 4ML1A 2DMMA 4XS6A 4KCEA 2PVOC 3SBCA 1BG5A 1M0UA 3NZNA 3AY8A 5D96A 3TOTA 1WWJA 2VAFA 2DJ3A 1YJ6A 5CP1A 5COHA 3ZIJA 1J9BA 4NAXA 1T7PB 3F3RA 3RAZA 4MJAA 5A4WA 4GCIA 2IMKA 4P3YB 1YF0A 2GT6A 4WXTA 3IK7A 1R4WA 2X64A 3A2XA 3LYPA 1PN9A 3FK8A 1ST9A 4G10A 3FKFA 3LORA 4HZ2A 4EE0A 2L5LA 1GNEA 4PNFA 2H71A 5AIVA 2YZHA 1ZYQB 2NPBA 4Q5NA 3W6GA 2VCQA 2CA8A 4K8MA 1USBA 3JCML 1TI3A 4K7IA 2AV4A 3I6AA 1WMJA 3L4NA 1UN2A 5G1LA 1XWGA 4MCUA 5B6NA 1FVJA 2VCXA 3IK9A 3QOUA 1EP7A 3C73A 1VF3A 3HHVA 2G0FA 6GSWA 1YQ1A 3W8JA 4F0BA 3HJOA 16GSA 2YV9A 2P5RA 2PWJA 1ACVA 3LGCA 1AAZA 1ZCPA 3QAGA 1A23A 2H73A 3L9UA 3TKSC 3IR4A 5LCZA 2H74A 2VO4A 2K8VA 3FHKA 2O8VB 4PGTA 1GTUA 1SJ6A 4YQMA 1JLVA 1OAZA 1AIUA 4MA9A 1K3LA 3DXBA 5ECIB 2VL2A 2V32A 3EYTA 4BWQA 2FNOA 1M9BA 1VF1A 3R2QA 3P2AA 2P5QA 4HDEA 3LXTA 5D8IA 3BCKA 2NBSA 1BQ7A 2L57A 1ZL9A 4DVCA 3MAKA 1GUMA 1AUCA 2AAWA 3ME8A 4NHWA 4V1Ap 4K7NA 5IO2A 2YWIA 1V98A 4AJ7A 3QR6A 3M9JA 3LWAA 4IHUA 5H5SA 3GKKA 3O6TA 4RQRA 3F4RA 4HJ2A 2V1MA 1RW1A 3CTGA 4TR0A 1F3BA 4I2UA 4WF5A 1ERUA 4JR6A 2X8GA 4POLA 2HXKA 3HKRA 4TXOA 2HZEA 1FW1A 3F6FA 4LMVA 5E4WA 5A4UA 2QGVA 3C7MA 4OWYA 4FH8A 2OJLA 3EU4A 1KTEA 2ZNMA 3U5RE 4ZL9A 2VCTA 1PD21 4RI7A 5ECLB 3C1SA 1VRSD 3F6DA 4LL4B 1G6WA 1GTAA 2FWHA 1SKWB 1Z7RA 4O7HA 3LG6A 1J08A 3VFIA 1MDKA 3L0HA 4MH3A 1MTCA 4TR1B 3MNGA 4IELA 2JU5A 4QL7A 3F3QA 3EMXA 2HRNA 3D6IA 2VIMA 1M9AA 3GSSA 1K3YA 5G30A 2DLXA 2M46A 1NHYA 5A4VA 4I8BA 2TRCP 2YPMA 2DJKA 1AC1A 3ZMLA 3DIEA 2CZ3A 1T00A 2WB9A 19GSA 4JEDA 1ERVA 3GKMA 1K0BA 2WCIA 1NHOA 1PA3A 3M3MA 1VF2A 2GSQA 2MMAA 1GUKA 2VUPA 1URMA 1O8XA 1EGRA 4LL1B 5DJLA 5FHIA 3HY2A 4WETA 5ECHB 1O73A 4HU9A 4HS1A 2FLSA 4HQSA 2LRTA 1O85A 3KXOA 2E0QA 3KP9A 1JHBA 2IL3A 2PERA 1K0AA 5HR1A 4F82A 4XS1A 4TR4A 3UMAA 5ABRA 2CT6A 5ELGA 4POMA 1EOGA 1PQNA 1GSEA 1IYHA 2OKAA 3KH9A 1K0DA 4KSMA 1U87A 1GP1A 3EVIA 2A2SA 5L71A 2L59A 3ZTLA 2JZRA 4NMUA 2RIIA 5JWQB 4ECIA 2MMNA 2RLIA 1HNBA 1FO5A 4ECJA 1B8XA 1WP0A 4OO5A 3E0UA 3P7XA 3VI5A 4EC0A 1DBYA 2MMOA 3WGEA 2IJYA 1FB6A 1K0CA 2R3XA 2CX4A 2V41A 2OBIA 1SK0A 2V2GA 1XW6A 5CRGA 4BPYA 1AW9A 3J7Yk 4TW5A 2HLSA 5EVOA 2NVLA 4HJMA 4MZBA 1U6TA 1A24A 4ZBBA 1O7UA 5CRWA 3E3EA 3C71A 3ZFBA 4GTUA 2YJHA 1WIKA 1F3AA 4Q5QA 5DJMA 1ERWA 3OR5A 1T3BA 3LFLA 4MZWA 4NV5A 5EL8A 22GSA 3WT2A 5ECPB 3GURA 4L0UA 1NSWA 4V1Ag 4MK3A 2V6KA 3DD3A 4BVYA 1OC3A 2OE0A 5ECMB 5KN1A 12GSA 3CRTA 1DE2A 1HQOA 2OADA 2YWOA 2WS2A 4G9HA 1DSBA 5H5RA 2PGTA 3DWVA 4KAEA 3VI7A 1H4OA 1B4PA 1W4VA 3CMIA 2C0EA 4KE3A 1Z9HA 5HR2A 1XOAA 4KCAA 1XOBA 3FR3A 5CRDA 1DUGA 4KA0A 3ZRDA 2GTUA 2IN3A 3HZ8A 2MBSA 1ILOA 1K0MA 1E2YA 2F3MA 1GLPA 4XCSA 6GSSA 4FYCA 4E8EA 10GSA 4KSOA 5JWRB 1V58A 2MBTA 1R5AA 3GKNA 4F03A 1XBSA 2B5YA 3V1WA 1SYRA 2QSIA 4JZQA 4MJBA 4Z7XA 4ECCA 3IOSA 2L6DA 2VCVA 2VOCA 5G1KA 1X9SB 3ZVJD 2VD0A 2YWMA 3WGXA 1TKDB 4L5LA 4K2DA 4PUFC 2VL9A 1EGOA 4I97A 2HZEB 2H0GA 4N0ZA 1SENA 1RK4A 1Z6NA 4K0GA 2XBQA 1AQWA 3VWVA 2CX3A 4O32A 4AGSA 4BA7A 2REMA 3N5OA 1H75A 3BBYA 1R5PA 1AQVA 2OACA 3UL3A 1GSFA 3G7JA 1TK5B 2VLTA 2CVDA 1LU4A 1K0OA 1KEBA 3US3A 3L9VA 5GZZB 1PRXA 2O85A 2PVQA 4N30A 3APQA 3GNJA 6GSVA 1MDJA 2A4VA 2IFQA 3CSJA 2DC5A 3K8NA 4ID0A 3HYPA 3HD5A 4DSQA 4X0XA 3ZREA 2K8SA 1TP9A 1XXUA 2N5AA 4OCEA 1PL1A 3TKPA 1U88A 2A2RA 2PU9C 2EC4A 1B9XC 5CREA 3HZ4A 4EF0A 1K0NA 1SKRB 1V9WA 3BOAA 4PUAA 2KLXA 2R37A 4KW6A 4N11A 2GDRA 2B1KA 1QMVA 4KNDA 2XHFA 2C0FA 3GX0A 5AIXA 3EE2A 2C0GA 6GSTA 2YV7A 3IE3A 3ZYWA 5JCGA 5GSSA 4MDCA 2B1LA 1SJIA 3TRXA 2HRFA 5LD0A 4MABA 3D4TA 4EL1A 4KB3A 3D21A 5DDLA 4Q5RA 4WBJA 4JR4A 2LJRA 1Y25A 1WPIA 1PSQA 8GSSA 3DMLA 2WGRA 2AYTA 3ZMKA 2I1UA 3UVHA 1GNWA 2H30A 1GLQA 3FZ5A 20GSA 3LXZA 3I43A 1FOVA 2YNXA 4JE1A 2OBKA 4MF6A 3EWLA 3L78A 1F2EA 1WOUA 3M0FA 4MH2A 1ERTA 1THOA 1PL2A 1SK2A 5B8BA 5ID2A 5J9CA 4RQXA 1V57A 1FAAA 4DSRA 2GZPA 4FYBA 2H1DA 2LS5A 3HVXA 4GSTA 3G9BA 2DJ1A 2LJKA 4ZBDA 2KP1A 4TR3A 3QFBC 4IJ3A 1S3AA 2V6OA 5IIZA 3DYRA 11GSA 1TRSA 3FR9A 3EU3A 3RDWA 1G0TA 3GL3A 2BTOT 1ZMAA 3GUSA 4QQ7A 2JZTA 3FZ9A 1SL2B 2YOIA 1XW9A 2F51A 2J9HA 3GH6A 2F8AA 1PX6A 1JZRA 1SYXA 2HE3A 3CTFA 2H6YA 1G6YA 2VD1A 3H8QA 5ECKB 4QL9A 4HI7A 3TRPA 2IMDA 4KUNA 1WE0A 2JZSA 2LQQA 1EWXA 1TI1A 1EP8A 5INYA 3VWWA 4EVMA 2F8FA 3P90A 3TKSE 4ZB9A 2AHEA 4BVXA 2RM6A 3IA1A 3HJMA 5FWGA 4EDZA 4X1UA 2H19A 3QCPA 5IM9A 1GH2A 4YAVA 2RM5A 2H76A 2L4CA 2H1AA 5IOWA 4OD7A 4EDYA 4MPFA 4J56E 4GSSA 6GSXA 3LEFA 2ES7A 3F0IA 3MWHA 3QD9A 3RHCA 2GQKA 5F0GA 4ILFA 3TGZA 4PQIA 1BYEA 4I6XA 3GV1A 5D9XA 2GLRA 2VCWA 4K7OA 1B9YC 5DALB 2CAIA 2HNLA 3IV4A 2L5OA 3TJBA 5LNKe 1Z7PA 4MP4A 3G7YA 3TKSA 3M8NA 2JL4A 2B5XA 3IC4A 5DAKA 1O6JA 2FA4A 4PQHA 2PUKC 3KTLA 3WGDA 4D73B 3D0ZA 4XRDA 4HEA2 1TXXA 1ZZYA 2LJAA 1N2AA 3PH9A 4POKA 5IMDA 3UAPA 1YF1A 3D22A 4F2IA 3QAVA 5IOXA 3WYWA 5D9WA 4AJ6A 1FHEA 5GAPD 2CQ9A 1PGTA 9GSSA 1ZOFA 5GAND 6GSUA 3EMPA 5KN0A 2TRXA 3ZITA 2PPTA 5G5EA 1S3DA 2PBJA 4N10A 5ECQB 2CAQA 1R7HA 3IDVA 1TTZA 2NDOA 2H6XA 2TIRA 4K6XA 1QK8A 1E6BA 2BMXA 2P31A 2IFQB 3BJ5A 5HR0A 5HR3A 4AF2A 3UARA 1BAYA 1X5EA 3VPTA 1CQGA 1PX7A 2HSYA 1XVWA 1B48A 1XWKA 1THXA 2DIYA 1XVQA 2HFDA 4HQZA 4OFMA 1YEXA 3UBLA 5HFKA 4DSSA 4MJCA 1XFLA 1XCCA 4Q5FA 4HOJA 3VWUA 2E2GA 4I2TA 2LSTA 3EC3A 3P8WA 14GSA 3RBTA 1X9WB 1F9MA 1UA5A 5ENUA 5G2ZA 3KEBA 3RHBA 1TJDA 3KJYA 1Z6MA 2K9FA 3H93A 3FY7A 4XHMA 3KM6A 2LV3A 3ZFLA 5IO0A 4OFTA 5ECRB 5IMZA 1SU9A 1XIYA 3CXGA 2LQOA 2VM2A 1YKCA 5J4UA 2MYGA 4EKZA 4PNGA 3TOUA 1A2MA 1T4ZA 2AJQB 2PN8A 3N9JA 3IAM2 7GSSA 3TJFA 2GS3A 5EPFA 2B7KA 4FIWA 2HZFA 2FUG2 1S3CA 3F4SA 5D73A 4LA1A 3PGTA 1GSSA 1T4YA 2ZUPA 4OFNA 2O7KA 2MZCA 1BEDA 1ZYEA 2EIQA 1F37A 3GRXA 2VLUA 1OVNA 2GSRA 1JZWA 1A0RP 3ERWA 3HDCA 4MMMA 2C0DA 3GIXA 1SD9A 3GX8A 1FG4A 4CDOA 2WULA 2H0IA 3F9UA 4JU5A 1X9MB 3M9KA 4FYUA 2GQMA 2CZ2A 2K18A 4XIHA 2CVBA 5ID2B 5IMAA 3CBUA 3FYGA 3SWLA 2Z9SA 3KMNA 3O3TA 1SD8A 5IPGA 2G2QA 5CO3A 1X5DA 4PX1A 2R2JA 3IBHA 5JWOB 3ZLPA 17GSA 5D9VA 3Q74A 1UVZA 1HYUA 3I9V2 2N5BA 5DALA 2P0GA 5CNWA 4ISDA 4YQUA 1M7TA 1GSDA 3UEMA 2C1YA 3TCOA 4EUYA 3H79A 4D73A 5ELAA 2X8HA 3QFAC 3BCIA 4CW9A 1NW2A 2C4JA 1VGLA 2L6CA 4IN0A 4TXVA 1ML6A 4NV2A 2YN1A 3DVWA 2B5EA 3VWXA 4MF7A 4XRAA 4ACSA 3MSZA 4F0CA 3L9SA 1V2AA 1U3AA 1W89A 5H5QA 5AGYA 1OYJA 3APSA 1QQ2A 2IMEA 3DGQA 3GFKA 4PQ1A 4GQCA 4IVFA 3S9FA 2H1BA 3O76A 2DMLA 2D2ZA 1HNAA 4KGIA 1BJXA 4TRXA 4F9ZA 3GTUB 3U6VA 4OCFA 1GULA 2X99A 2DBCA 2DJ2A 5JCUA 1GTBA 3KCMA 4IS0A 4YH2A 3A3TA 1AXDA 4BWSA 2DSAA 3UIWA 2FCHA 1SJZA 2FD3A 1KBNA 2MMZA 3ED3A 4IP6A 2O89A 2GZZA 5J41A 3D4MA 3UVTA 4IJIA 4YQVA 3E9JB 4ULXA 3GH9A 1GSUA 3KH7A 2DJ0A 2DIZA 3FZ4A 4MPGA 1O81A 1OKTA 2E2MA 5DQYA 3F8UA 5A5KA 5IMVA 5G5FA 1T8EB 1C72A 5C04A 1KNGA 4ML6A 3TKRA 5DAKB 4MZCA 3GHAA 3IRAA 2DJJA 1MEKA 5F06A 3CYNA 3UJ1A 3KD0A 2YWNA 1GWCA 3BD2A 2JSYA 3RPNA 4RI6A 3NIVA 2LEGA 2OA7A 1SKSB 3HXSA 2XC2A 2QC7A 1YKAA 1EEJA 3TDGA 2C3TA 1XWCA 1TDIA 2R6KA 3FR6A 1TU8A 5DQSA 4TVEA 4GSNA 2LNSA 1OE8A 1GUHA 2H1GA 2FY6A 2VM1A 1YY7A 2N5FA 18GSA 1LBKA 2PMTA 5D93A 1TW9A 2C80A 4KH7A 2WFCA 2H70A 3DVXA 4KDXA 4GRFA 3NOFA 3CSHA 2AUVA 3UOMA 5CYYA 4HZ4A 4AJ8A 3HVSA 4WR4A 3UBKA 4FO5A 4ZB6A 5G31A 1Q98A 2IMFA 2C3QA 3F63A 3TB2A 4OO4A 3ZZXA 3ERGA 4X43A 2LNTA 1X0RA 5FT3A 3WT1A 2IWTA 4WR5A 4G19A 4NPBA 3RPPA 6GSYA 4IQ1A 3J7Yb 4I5QA 4TKYA 3CSIA 4DSSB 4EO3A 5F8BA 1K3OA 1OC9A 1UC7A 2NTOA 3WD6A 1EV4A 4XTSA 2ZCTA 2HYXA 1HD2A 2H75A 4O5RA 1XWBA 1LJRA 3Q6OA 1M99A 1ON4A 4PURA 5C00A 5B8AA 4ZILA 3KZQA 3HCZA 4IP1A 3PR8A 2FWFA 1XZOA 1GL8A 2GSSA 4NHZA 2CV4A 1B4QA 1WJKA 3DKSA 4ZL8A 2J23A 3HVVA 2YZUA 3LJRA 1ABAA 1N8JA 4ZL7A 1OKDA 3IXRA 2GZYA 4IKHA 1U3IA 1M2DA 1IYIA 1T1VA 2WJUA 1GTIA 3ERFA 4ZBAA 5J9BA 3GSTA 3MDKA 2GQLA 4ZIJA 3ISOA 4E8HA 2LRNA 5KN2A 2YANA 5CAXA 3H1NA 4L8EA 1TRVA 5IQYA 1I9DA 3A2VA 3GTUA 3Q19A 1V40A 2C8UA 13GSA 2H8LA 2FWGA 1PMTA 3QAWA 1EEMA 2I81A 2VLVA 3CRUA 2GGTA 1QGVA 3I69A 3EINA 3IHQA 4WEYA 4TOPA 2WDUA 2ON7A 2LKUA 4L0WA 1SK1A 3GL5A 3KMOA 2HT9A 2QKEA 4HU7A 2GVPA 1JZDA 4DEJA 3PINA 2EIRA 3A5WA 4G2EA 1A8YA 1GSQA 1I5GA 2KUCA 5J3RA 2OE1A 4POBA 5DBQA 1A0FA 3FRCA 2HI7A 1F6MC 1PKZA 2KHPA 5F07A 1FB0A 4WKWA 1HNCA 2M80A 2X8CA 5HQPA 2JSZA 2HSHA 3HA9A 3VLNA 1A2JA 5D9TA 2LRCA 2JACA 3GMFA 2XPDA 5E59A 3D5JA 3DRNA 1EZKA 1A2LA 5B7CA 3EURA 4WBRD 3APOA 5J5NA 4ZXGA 2K6VA 5DCGA 1DE1A 4MJEA 2LUSA 1PKWA 4GXZA 1YDKA 3W8SA 5AN1A 4WF4A 3TRQA 3TUEA 2WRTA 4XS4B 2JADA 1GSYA 4GLTA 2IIYA 3ZIVA 2I4AA 1QXHA 5F05A 2C3NA 3GA4A 4PXOA 5JCWA 3G7IA 3KIJA 2H01A 1M2AA 2IPAA 2VL3A 3LYKA 2AB6A 1YZXA 4ECBA 2H66A 3KTBA 4GF0A 4LLRA 4NXIA 1RQMA 1JLWA 3A2WA 3VK9A 1YEPA 4EXJA 4V2LA 5HFIA 4K9ZA 3DEXA 1R26A 1OE7A 1AQXA 5CRHA 4N0VA 4ZB8A 1OC8A 3C8EA 5IMCA 4IBPA 4RUVA 1WRYA 4V2MA 2ALBA 2H6ZA 2H72A 2E7PA 1TU7A 2EIOA 1ZGNA 2KP2A 3C1RA 1XWAA 5B6MA 3TJKA 4MLYA 4YAPA 4HUAA 4IGJA 3VURA 3TJJA 1Z3EA 2XPEA 1QFNA 2GSTA 2WZ9A 1MD4A 1GRXA 4GQFA 1CQHA 1TK8B 4OMVA 1TRUA 2FWEA 2RUFA 1O8WA 2B7JA 3ZVJA
chains in the Genus database with same CATH superfamily
2YJ7A 4TN8A 1EV9A 3VPQA 2GT5A 3FW2A 3QDNA 3KP8A 2YP6A 1VF4A 3F4TA 3IPZA 1NM3A 5EY6A 1XW5A 5IMFA 4IQAA 3GYKA 3M1GA 1Q4JA 2L4QA 3GN3A 4J2FA 3HJPA 2O87A 2OE3A 2YCDA 4KX4A 1Y6EA 2R4VA 3QPMA 1OC9B 2B6MA 1TRWA 4CHSA 4TR1A 4NWYA 4K0NA 2FHEA 4O92A 2XBIA 2LTKA 3TKQA 5KN3A 3GKXA 2R5GA 4GWRA 4MF5A 4J57E 4JRRA 2B3SA 2BJXA 1G7OA 1MD3A 3QMXA 3FZAA 5KEJA 4KDYA 1QUWA 3LQ7A 5ECNB 2CVKA 1EOHA 2DKHA 1MDIA 2M72A 3Q18A 4JBBA 3ME7A 5BMUA 3LSZA 1A8LA 5AISA 4V2NA 3KGKA 1FVKA 1J0FA 4K1FA 1XPVA 5HFGA 1X5CA 2VL2C 2VCZA 4IW9A 5ECSA 1JZOA 4L5OA 1TOFA 1SL0B 2RUEA 2I3YA 4KDUA 3FEUA 1SL1B 4FQUA 3ZL5A 2KOKA 2FA8A 1G7EA 1BX9A 3TJGA 1M2BA 3IAS2 5ECOB 4TXOB 2IMIA 1JFUA 5GSTA 4LMWA 5DCHA 5DVBA 2H0HA 2I9HA 5IPHA 2ON5A 2FGXA 4H86A 4XS4A 1Z5YE 4BL7A 1TK0B 2F9SA 3H4KA 4ML1A 3LW9A 2DMMA 4XS6A 4KCEA 2PVOC 3SBCA 1BG5A 1M0UA 3NZNA 3AY8A 5D96A 3TOTA 1WWJA 2VAFA 2DJ3A 1YJ6A 5CP1A 5BRTA 5COHA 3ZIJA 1J9BA 4NAXA 1T7PB 3F3RA 3RAZA 4MJAA 5A4WA 4GCIA 2IMKA 4P3YB 1YF0A 2GT6A 4WXTA 3IK7A 1R4WA 2X64A 3A2XA 3LYPA 1PN9A 3FK8A 1ST9A 4G10A 3FKFA 3LORA 4HZ2A 4EE0A 2L5LA 1GNEA 4PNFA 2H71A 5AIVA 2YZHA 1ZYQB 2NPBA 4Q5NA 1FOHA 3W6GA 2VCQA 2CA8A 4K8MA 1USBA 3JCML 4O5QA 1TI3A 4K7IA 2AV4A 3I6AA 1WMJA 3L4NA 1UN2A 5G1LA 1XWGA 4MCUA 5B6NA 1FVJA 2VCXA 4CY6A 3IK9A 3QOUA 1EP7A 3C73A 5KOXA 1VF3A 3HHVA 2G0FA 6GSWA 1YQ1A 3W8JA 4F0BA 3HJOA 16GSA 2YV9A 2P5RA 2PWJA 1ACVA 3LGCA 1AAZA 1ZCPA 3QAGA 1A23A 2H73A 3L9UA 3TKSC 3IR4A 5LCZA 2H74A 2VO4A 2K8VA 3FHKA 2O8VB 4PGTA 1GTUA 1SJ6A 4YQMA 1JLVA 1OAZA 1AIUA 4MA9A 1K3LA 3DXBA 5ECIB 2VL2A 2V32A 3EYTA 4BWQA 2FNOA 2R0GA 1M9BA 1VF1A 3R2QA 3P2AA 2P5QA 4HDEA 3LXTA 5D8IA 3BCKA 2NBSA 1BQ7A 2L57A 1ZL9A 4DVCA 2HRKA 3MAKA 1GUMA 1AUCA 2AAWA 3ME8A 4NHWA 4V1Ap 4K7NA 4PTSA 5IO2A 2YWIA 1V98A 4AJ7A 3QR6A 3M9JA 3LWAA 4IHUA 5H5SA 3GKKA 3O6TA 4RQRA 3F4RA 4HJ2A 2V1MA 1RW1A 3CTGA 4TR0A 1F3BA 4I2UA 4WF5A 1ERUA 4JR6A 2X8GA 4POLA 2HXKA 2A2PA 3HKRA 4TXOA 2HZEA 1FW1A 3F6FA 4LMVA 4BVYB 5E4WA 5A4UA 2QGVA 3C7MA 4OWYA 4FH8A 2OJLA 3EU4A 1KTEA 2ZNMA 3U5RE 4ZL9A 2VCTA 1PD21 4RI7A 5ECLB 3C1SA 1VRSD 3F6DA 4LL4B 1G6WA 1GTAA 2FWHA 1SKWB 1Z7RA 2R0CA 4O7HA 3LG6A 4KF9A 1J08A 3VFIA 1MDKA 3L0HA 4MH3A 1MTCA 4TR1B 3MNGA 4IELA 2JU5A 4QL7A 3F3QA 3EMXA 2HRNA 3D6IA 2VIMA 1M9AA 3GSSA 1K3YA 5G30A 2DLXA 2M46A 1NHYA 5A4VA 4I8BA 2TRCP 2YPMA 2DJKA 1AC1A 3ZMLA 3DIEA 2CZ3A 1T00A 2WB9A 19GSA 4JEDA 1ERVA 3GKMA 1K0BA 2WCIA 1NHOA 1PA3A 3M3MA 1VF2A 2GSQA 2MMAA 4ICYA 1GUKA 2VUPA 1URMA 1O8XA 1EGRA 4LL1B 5DJLA 5FHIA 3HY2A 4WETA 5ECHB 1O73A 4HU9A 4YKFA 4HS1A 2FLSA 4HQSA 2LRTA 1O85A 3KXOA 2E0QA 3KP9A 1JHBA 2IL3A 2PERA 1K0AA 5HR1A 4F82A 4XS1A 4TR4A 3UMAA 5ABRA 2CT6A 5ELGA 4POMA 1EOGA 1PQNA 1GSEA 1IYHA 2OKAA 3KH9A 1K0DA 4KSMA 1U87A 1GP1A 3EVIA 2A2SA 5L71A 2L59A 1PFOA 3ZTLA 4Z2TA 2JZRA 4NMUA 2RIIA 5JWQB 4ECIA 2MMNA 2RLIA 1HNBA 1FO5A 4ECJA 1B8XA 1WP0A 4OO5A 3E0UA 3P7XA 3VI5A 4EC0A 1DBYA 2MMOA 3WGEA 2IJYA 1FB6A 1K0CA 2R3XA 2CX4A 2V41A 2OBIA 1SK0A 2V2GA 1XW6A 5CRGA 4BPYA 1AW9A 2A4HA 3J7Yk 4TW5A 2HLSA 5EVOA 2NVLA 4HJMA 4MZBA 1U6TA 1A24A 4ZBBA 1O7UA 5CRWA 3E3EA 3C71A 3ZFBA 4GTUA 2YJHA 1WIKA 1F3AA 4Q5QA 5DJMA 1ERWA 3OR5A 1T3BA 3LFLA 4MZWA 4NV5A 5EL8A 22GSA 3WT2A 5ECPB 3GURA 4L0UA 1NSWA 4V1Ag 4MK3A 2V6KA 3DD3A 4BVYA 1OC3A 2OE0A 5ECMB 5KN1A 12GSA 3CRTA 1DE2A 1HQOA 2OADA 2YWOA 2WS2A 4G9HA 1DSBA 5H5RA 2PGTA 3DWVA 4KAEA 3VI7A 1H4OA 1B4PA 1W4VA 3CMIA 2C0EA 4KE3A 1Z9HA 5HR2A 1XOAA 4KCAA 1XOBA 3FR3A 4K5SA 4YKGA 5CRDA 1DUGA 4KA0A 3ZRDA 2GTUA 2IN3A 4Z2RA 3HZ8A 2MBSA 1ILOA 1K0MA 1E2YA 2F3MA 1GLPA 4XCSA 6GSSA 4FYCA 4E8EA 10GSA 4KSOA 5JWRB 1V58A 2MBTA 4MNNA 1R5AA 3GKNA 4F03A 1XBSA 2B5YA 3V1WA 1SYRA 2QSIA 4JZQA 4MJBA 4Z7XA 4ECCA 3IOSA 2L6DA 2VCVA 2VOCA 5G1KA 1X9SB 3ZVJD 2VD0A 2YWMA 3WGXA 4X4JA 1TKDB 4L5LA 4K2DA 4PUFC 2VL9A 1EGOA 4I97A 2HZEB 2H0GA 4N0ZA 1SENA 1RK4A 1Z6NA 4K0GA 2XBQA 1AQWA 3VWVA 2CX3A 4O32A 4AGSA 4BA7A 2REMA 3N5OA 1H75A 3BBYA 1R5PA 1AQVA 2OACA 3UL3A 1GSFA 3G7JA 1TK5B 2VLTA 4BVXB 2CVDA 1LU4A 1K0OA 1KEBA 3US3A 3L9VA 5GZZB 1PRXA 2O85A 2PVQA 4N30A 3APQA 3GNJA 6GSVA 1MDJA 2A4VA 2IFQA 3CSJA 2DC5A 1ZYPA 3K8NA 4ID0A 3FMWA 3HYPA 3HD5A 4DSQA 4X0XA 3ZREA 2K8SA 1TP9A 1XXUA 2N5AA 4OCEA 1PL1A 3TKPA 1U88A 4G0LA 2A2RA 2PU9C 2EC4A 1B9XC 5CREA 3HZ4A 4EF0A 1K0NA 1SKRB 1V9WA 3BOAA 3EPTA 4PUAA 2KLXA 2R37A 4KW6A 4N11A 2GDRA 2B1KA 1QMVA 4KNDA 2XHFA 2C0FA 3GX0A 5AIXA 3EE2A 2C0GA 6GSTA 2YV7A 3IE3A 3ZYWA 5JCGA 5GSSA 4MDCA 2B1LA 1SJIA 3TRXA 2HRFA 5LD0A 4MABA 3D4TA 4EL1A 4KB3A 3D21A 5DDLA 4Q5RA 4WBJA 4JR4A 2LJRA 1Y25A 1WPIA 1PSQA 8GSSA 3DMLA 2WGRA 2AYTA 3ZMKA 1XG8A 2I1UA 3UVHA 1GNWA 2H30A 1GLQA 3FZ5A 20GSA 3LXZA 3I43A 1FOVA 2YNXA 4JE1A 2OBKA 4MF6A 3EWLA 3L78A 1F2EA 2QA2A 1WOUA 3M0FA 4MH2A 1ERTA 1THOA 1PL2A 1SK2A 5B8BA 5ID2A 5J9CA 4RQXA 1V57A 1FAAA 4DSRA 2GZPA 4FYBA 2H1DA 2LS5A 3HVXA 4GSTA 3G9BA 2DJ1A 2LJKA 4ZBDA 2KP1A 3MIXA 4TR3A 3QFBC 4IJ3A 1S3AA 2V6OA 5IIZA 3DYRA 11GSA 1TRSA 3FR9A 3EU3A 3RDWA 4USSA 1G0TA 3GL3A 2BTOT 1ZMAA 3GUSA 4QQ7A 2JZTA 3FZ9A 1SL2B 2YOIA 1XW9A 2F51A 2J9HA 3GH6A 2F8AA 1PX6A 1JZRA 1SYXA 2HE3A 3CTFA 2H6YA 1G6YA 2VD1A 3H8QA 5ECKB 4QL9A 4HI7A 3TRPA 2IMDA 4KUNA 1WE0A 2JZSA 4A5PA 2LQQA 1EWXA 1TI1A 1EP8A 5INYA 3VWWA 4EVMA 2F8FA 2X4AA 3P90A 3TKSE 4ZB9A 2AHEA 4BVXA 2RM6A 3IA1A 3HJMA 5FWGA 4EDZA 4X1UA 2H19A 3QCPA 5IM9A 1GH2A 4YAVA 2RM5A 2H76A 2L4CA 2H1AA 5IOWA 4OD7A 4EDYA 4MPFA 4J56E 4GSSA 6GSXA 4G0IA 3LEFA 2ES7A 3F0IA 3MWHA 4HSCX 3QD9A 3RHCA 2GQKA 5F0GA 4ILFA 3TGZA 4PQIA 1BYEA 4I6XA 3GV1A 5D9XA 2GLRA 2VCWA 5KOWA 4K7OA 1B9YC 5DALB 2CAIA 2HNLA 3IV4A 2L5OA 3TJBA 5LNKe 1Z7PA 4MP4A 3G7YA 3TKSA 3M8NA 2JL4A 2B5XA 3IC4A 5DAKA 1O6JA 2FA4A 4PQHA 2PUKC 3KTLA 3WGDA 4D73B 3D0ZA 4XRDA 4HEA2 1TXXA 1ZZYA 2LJAA 1N2AA 3PH9A 4POKA 5IMDA 3UAPA 2HSMA 1YF1A 3D22A 4F2IA 3QAVA 5IOXA 3WYWA 5D9WA 3R3EA 4AJ6A 1FHEA 5GAPD 2CQ9A 4Z2UA 1PGTA 9GSSA 1ZOFA 5GAND 6GSUA 3EMPA 5KN0A 2TRXA 3ZITA 2PPTA 5G5EA 1S3DA 2PBJA 4N10A 5ECQB 2CAQA 1R7HA 3IDVA 1TTZA 2NDOA 2H6XA 2TIRA 4K6XA 1QK8A 1E6BA 2BMXA 2P31A 2IFQB 3BJ5A 5HR0A 5HR3A 4AF2A 3UARA 1BAYA 1X5EA 3VPTA 1CQGA 1PX7A 2HSYA 1XVWA 1B48A 1XWKA 1THXA 2DIYA 1XVQA 2HFDA 4HQZA 4OFMA 1YEXA 3UBLA 4EIQA 5HFKA 4DSSA 4MJCA 1XFLA 1XCCA 4Q5FA 4HOJA 3VWUA 2E2GA 4I2TA 2LSTA 3EC3A 3P8WA 14GSA 3RBTA 4K2XA 1X9WB 1F9MA 1UA5A 5ENUA 5G2ZA 3KEBA 3RHBA 1TJDA 3KJYA 1Z6MA 2K9FA 3H93A 3FY7A 4XHMA 3KM6A 2LV3A 3ZFLA 5IO0A 4OFTA 5ECRB 5IMZA 1SU9A 1XIYA 3CXGA 2LQOA 2VM2A 1YKCA 5J4UA 2MYGA 4EKZA 4PNGA 3TOUA 1A2MA 1T4ZA 2AJQB 2PN8A 3N9JA 3IAM2 7GSSA 3TJFA 2GS3A 5EPFA 2B7KA 4FIWA 2HZFA 2FUG2 1S3CA 3F4SA 5D73A 4LA1A 3PGTA 1GSSA 1T4YA 2ZUPA 4OFNA 2O7KA 2MZCA 1BEDA 1ZYEA 2EIQA 1F37A 3GRXA 2VLUA 1OVNA 2GSRA 1JZWA 1A0RP 3ERWA 3HDCA 3IC8A 4MMMA 2C0DA 3GIXA 1SD9A 3GX8A 1FG4A 4CDOA 2WULA 2H0IA 3F9UA 4JU5A 1X9MB 3M9KA 4FYUA 2GQMA 2CZ2A 2K18A 4XIHA 2CVBA 5ID2B 5IMAA 3CBUA 3FYGA 3SWLA 2Z9SA 3KMNA 3O3TA 1SD8A 5IPGA 2G2QA 5CO3A 1X5DA 4PX1A 2R2JA 3IBHA 5JWOB 3ZLPA 17GSA 5D9VA 3Q74A 1UVZA 1HYUA 3I9V2 2N5BA 5DALA 2P0GA 5CNWA 4ISDA 4YQUA 1M7TA 1GSDA 3UEMA 2C1YA 3TCOA 4EUYA 3H79A 4D73A 5ELAA 2X8HA 3QFAC 3BCIA 4CW9A 1NW2A 2C4JA 1VGLA 2L6CA 4IN0A 4TXVA 1ML6A 4NV2A 2YN1A 3IHGA 3DVWA 2B5EA 3VWXA 4MF7A 4XRAA 4ACSA 3MSZA 4F0CA 3L9SA 1V2AA 1U3AA 1W89A 5H5QA 5AGYA 1OYJA 3APSA 1QQ2A 2IMEA 3DGQA 3GFKA 4PQ1A 4GQCA 4IVFA 3S9FA 2H1BA 3O76A 2DMLA 2D2ZA 1HNAA 4KGIA 1BJXA 4TRXA 4F9ZA 3GTUB 3PPUA 3U6VA 4OCFA 1GULA 2X99A 2DBCA 2DJ2A 5JCUA 1GTBA 3KCMA 4IS0A 4YH2A 3A3TA 1AXDA 4BWSA 2DSAA 3UIWA 2FCHA 1SJZA 2FD3A 1KBNA 2MMZA 3ED3A 4IP6A 2O89A 2GZZA 5J41A 3D4MA 3UVTA 4IJIA 4YQVA 3A5IA 3E9JB 4ULXA 3GH9A 1GSUA 3KH7A 2DJ0A 2DIZA 3FZ4A 4MPGA 1O81A 1OKTA 3CQFA 2E2MA 4K5RA 5DQYA 3F8UA 5A5KA 5IMVA 5G5FA 1T8EB 1C72A 5C04A 1KNGA 4ML6A 3TKRA 5DAKB 4MZCA 3GHAA 2X49A 3IRAA 2DJJA 1MEKA 5F06A 3CYNA 3UJ1A 3KD0A 1PN0A 2YWNA 1GWCA 3BD2A 2JSYA 3RPNA 4RI6A 3NIVA 1S3RA 2LEGA 2OA7A 1SKSB 3HXSA 2XC2A 2QC7A 1YKAA 1EEJA 3TDGA 2C3TA 1XWCA 1TDIA 2R6KA 3FR6A 1TU8A 5DQSA 4TVEA 4GSNA 2LNSA 1OE8A 1GUHA 2H1GA 2FY6A 2VM1A 1YY7A 2N5FA 18GSA 1LBKA 2PMTA 5D93A 1TW9A 2C80A 4KH7A 2WFCA 2H70A 3DVXA 4KDXA 4GRFA 3NOFA 4BIKA 3CSHA 2AUVA 3UOMA 5CYYA 4HZ4A 4AJ8A 3HVSA 4WR4A 3UBKA 4FO5A 4ZB6A 5G31A 1Q98A 4O5UA 2IMFA 2C3QA 3F63A 3TB2A 4OO4A 3ZZXA 3ERGA 4X43A 2LNTA 1X0RA 5FT3A 3WT1A 2IWTA 4WR5A 4G19A 4NPBA 3RPPA 6GSYA 4IQ1A 3J7Yb 4I5QA 4TKYA 3CSIA 4DSSB 4EO3A 5F8BA 1K3OA 1OC9A 1UC7A 2NTOA 3WD6A 1EV4A 4XTSA 2ZCTA 2HYXA 1HD2A 2H75A 4O5RA 2QA1A 2R0PA 4CY8A 1XWBA 1LJRA 3Q6OA 3HVNA 1M99A 1ON4A 4PURA 5C00A 5B8AA 4ZILA 3KZQA 3HCZA 4IP1A 3PR8A 2FWFA 1XZOA 1GL8A 2GSSA 4NHZA 2CV4A 1B4QA 1WJKA 3DKSA 4ZL8A 2J23A 3HVVA 2YZUA 3LJRA 1ABAA 1N8JA 2HRAA 4ZL7A 1OKDA 3IXRA 2GZYA 4IKHA 1U3IA 1M2DA 1IYIA 1T1VA 2WJUA 1GTIA 3ERFA 4EIPA 4ZBAA 5J9BA 3GSTA 3MDKA 2GQLA 4ZIJA 3ISOA 4E8HA 2LRNA 5KN2A 2YANA 5CAXA 3H1NA 4L8EA 1TRVA 5IQYA 1I9DA 3A2VA 3GTUA 3Q19A 1V40A 2C8UA 13GSA 1M3IA 2H8LA 4G0KA 2FWGA 1PMTA 3QAWA 1EEMA 2I81A 2VLVA 3CRUA 2GGTA 1QGVA 3I69A 3EINA 3IHQA 4WEYA 4TOPA 2WDUA 2ON7A 2LKUA 4L0WA 1SK1A 3GL5A 3KMOA 2HT9A 2QKEA 4HU7A 2GVPA 1JZDA 4DEJA 3PINA 2EIRA 3A5WA 4G2EA 1A8YA 1GSQA 1I5GA 2KUCA 5J3RA 2OE1A 4POBA 5DBQA 1ZYNA 1A0FA 3FRCA 2HI7A 1F6MC 1PKZA 2KHPA 5F07A 1FB0A 4WKWA 1HNCA 2M80A 2X8CA 5HQPA 2JSZA 2HSHA 3HA9A 3VLNA 1A2JA 5D9TA 2LRCA 2JACA 3GMFA 2XPDA 5E59A 3D5JA 3DRNA 1EZKA 1A2LA 5B7CA 3EURA 4WBRD 2UZ8A 3APOA 5J5NA 4ZXGA 2K6VA 5DCGA 1DE1A 4MJEA 2LUSA 1PKWA 4GXZA 1YDKA 3W8SA 5AN1A 4WF4A 3TRQA 3TUEA 2WRTA 4XS4B 2JADA 1GSYA 4BL7B 4GLTA 2IIYA 3ZIVA 2I4AA 1QXHA 5F05A 2C3NA 3GA4A 4PXOA 5JCWA 3G7IA 3KIJA 2H01A 1M2AA 2IPAA 2VL3A 3LYKA 2AB6A 1YZXA 4ECBA 2H66A 3KTBA 4GF0A 4LLRA 4NXIA 1M3JA 1RQMA 1JLWA 3A2WA 3VK9A 3MYDA 1YEPA 2DKIA 4EXJA 4V2LA 5HFIA 4K9ZA 3DEXA 1R26A 1OE7A 1AQXA 5CRHA 4N0VA 4ZB8A 1OC8A 3C8EA 5IMCA 4IBPA 4RUVA 1WRYA 4V2MA 2ALBA 2H6ZA 2H72A 2E7PA 1TU7A 2EIOA 1ZGNA 2KP2A 3C1RA 1XWAA 5B6MA 3TJKA 4MLYA 4YAPA 4HUAA 4IGJA 3VURA 3TJJA 1Z3EA 2XPEA 1QFNA 2GSTA 2WZ9A 1MD4A 1GRXA 4GQFA 1CQHA 1TK8B 4OMVA 1TRUA 2FWEA 2RUFA 1O8WA 2B7JA 3ZVJA
chains in the Genus database with same CATH topology
2YJ7A 4TN8A 1EV9A 3VPQA 2GT5A 3FW2A 3QDNA 3KP8A 2YP6A 1VF4A 3F4TA 3IPZA 1NM3A 5EY6A 1XW5A 5IMFA 4IQAA 3GYKA 3M1GA 1Q4JA 2L4QA 3GN3A 4J2FA 3HJPA 2O87A 2OE3A 2YCDA 4KX4A 1Y6EA 2R4VA 3QPMA 1OC9B 2B6MA 1TRWA 4CHSA 4TR1A 4NWYA 4K0NA 2FHEA 4O92A 2XBIA 2LTKA 3TKQA 5KN3A 3GKXA 2R5GA 4GWRA 4MF5A 4J57E 4JRRA 2B3SA 2BJXA 1G7OA 1MD3A 3QMXA 3FZAA 5KEJA 4KDYA 1QUWA 3LQ7A 5ECNB 2CVKA 1EOHA 2DKHA 1MDIA 2M72A 3Q18A 4JBBA 3ME7A 5BMUA 3LSZA 1A8LA 5AISA 4V2NA 3KGKA 1FVKA 1J0FA 4K1FA 1XPVA 5HFGA 1X5CA 2VL2C 2VCZA 4IW9A 5ECSA 1JZOA 4L5OA 1TOFA 1SL0B 2RUEA 2I3YA 4KDUA 3FEUA 1SL1B 4FQUA 3ZL5A 2KOKA 2FA8A 1G7EA 1BX9A 3TJGA 1M2BA 3IAS2 5ECOB 4TXOB 2IMIA 1JFUA 5GSTA 4LMWA 5DCHA 5DVBA 2H0HA 2I9HA 5IPHA 2ON5A 2FGXA 4H86A 4XS4A 1Z5YE 4BL7A 1TK0B 2F9SA 3H4KA 4ML1A 3LW9A 2DMMA 4XS6A 4KCEA 2PVOC 3SBCA 1BG5A 1M0UA 3NZNA 3AY8A 5D96A 3TOTA 1WWJA 2VAFA 2DJ3A 1YJ6A 5CP1A 5BRTA 5COHA 3ZIJA 1J9BA 4NAXA 1T7PB 3F3RA 3RAZA 4MJAA 5A4WA 4GCIA 2IMKA 4P3YB 1YF0A 2GT6A 4WXTA 3IK7A 1R4WA 2X64A 3A2XA 3LYPA 1PN9A 3FK8A 1ST9A 4G10A 3FKFA 3LORA 4HZ2A 4EE0A 2L5LA 1GNEA 4PNFA 2H71A 5AIVA 2YZHA 1ZYQB 2NPBA 4Q5NA 1FOHA 3W6GA 2VCQA 2CA8A 4K8MA 1USBA 3JCML 4O5QA 1TI3A 4K7IA 2AV4A 3I6AA 1WMJA 3L4NA 1UN2A 5G1LA 1XWGA 4MCUA 5B6NA 1FVJA 2VCXA 4CY6A 3IK9A 3QOUA 1EP7A 3C73A 5KOXA 1VF3A 3HHVA 2G0FA 6GSWA 1YQ1A 3W8JA 4F0BA 3HJOA 16GSA 2YV9A 2P5RA 2PWJA 1ACVA 3LGCA 1AAZA 1ZCPA 3QAGA 1A23A 2H73A 3L9UA 3TKSC 3IR4A 5LCZA 2H74A 2VO4A 2K8VA 3FHKA 2O8VB 4PGTA 1GTUA 1SJ6A 4YQMA 1JLVA 1OAZA 1AIUA 4MA9A 1K3LA 3DXBA 5ECIB 2VL2A 2V32A 3EYTA 4BWQA 2FNOA 2R0GA 1M9BA 1VF1A 3R2QA 3P2AA 2P5QA 4HDEA 3LXTA 5D8IA 3BCKA 2NBSA 1BQ7A 2L57A 1ZL9A 4DVCA 2HRKA 3MAKA 1GUMA 1AUCA 2AAWA 3ME8A 4NHWA 4V1Ap 4K7NA 4PTSA 5IO2A 2YWIA 1V98A 4AJ7A 3QR6A 3M9JA 3LWAA 4IHUA 5H5SA 3GKKA 3O6TA 4RQRA 3F4RA 4HJ2A 2V1MA 1RW1A 3CTGA 4TR0A 1F3BA 4I2UA 4WF5A 1ERUA 4JR6A 2X8GA 4POLA 2HXKA 2A2PA 3HKRA 4TXOA 2HZEA 1FW1A 3F6FA 4LMVA 4BVYB 5E4WA 5A4UA 2QGVA 3C7MA 4OWYA 4FH8A 2OJLA 3EU4A 1KTEA 2ZNMA 3U5RE 4ZL9A 2VCTA 1PD21 4RI7A 5ECLB 3C1SA 1VRSD 3F6DA 4LL4B 1G6WA 1GTAA 2FWHA 1SKWB 1Z7RA 2R0CA 4O7HA 3LG6A 4KF9A 1J08A 3VFIA 1MDKA 3L0HA 4MH3A 1MTCA 4TR1B 3MNGA 4IELA 2JU5A 4QL7A 3F3QA 3EMXA 2HRNA 3D6IA 2VIMA 1M9AA 3GSSA 1K3YA 5G30A 2DLXA 2M46A 1NHYA 5A4VA 4I8BA 2TRCP 2YPMA 2DJKA 1AC1A 3ZMLA 3DIEA 2CZ3A 1T00A 2WB9A 19GSA 4JEDA 1ERVA 3GKMA 1K0BA 2WCIA 1NHOA 1PA3A 3M3MA 1VF2A 2GSQA 2MMAA 4ICYA 1GUKA 2VUPA 1URMA 1O8XA 1EGRA 4LL1B 5DJLA 5FHIA 3HY2A 4WETA 5ECHB 1O73A 4HU9A 4YKFA 4HS1A 2FLSA 4HQSA 2LRTA 1O85A 3KXOA 2E0QA 3KP9A 1JHBA 2IL3A 2PERA 1K0AA 5HR1A 4F82A 4XS1A 4TR4A 3UMAA 5ABRA 2CT6A 5ELGA 4POMA 1EOGA 1PQNA 1GSEA 1IYHA 2OKAA 3KH9A 1K0DA 4KSMA 1U87A 1GP1A 3EVIA 2A2SA 5L71A 2L59A 3ZTLA 4Z2TA 2JZRA 4NMUA 2RIIA 5JWQB 4ECIA 2MMNA 2RLIA 1HNBA 1FO5A 4ECJA 1B8XA 1WP0A 4OO5A 3E0UA 3P7XA 3VI5A 4EC0A 1DBYA 2MMOA 3WGEA 2IJYA 1FB6A 1K0CA 2R3XA 2CX4A 2V41A 2OBIA 1SK0A 2V2GA 1XW6A 5CRGA 4BPYA 1AW9A 2A4HA 3J7Yk 4TW5A 2HLSA 5EVOA 2NVLA 4HJMA 4MZBA 1U6TA 1A24A 4ZBBA 1O7UA 5CRWA 3E3EA 3C71A 3ZFBA 4GTUA 2YJHA 1WIKA 1F3AA 4Q5QA 5DJMA 1ERWA 3OR5A 1T3BA 3LFLA 4MZWA 4NV5A 5EL8A 22GSA 3WT2A 5ECPB 3GURA 4L0UA 1NSWA 4V1Ag 4MK3A 2V6KA 3DD3A 4BVYA 1OC3A 2OE0A 5ECMB 5KN1A 12GSA 3CRTA 1DE2A 1HQOA 2OADA 2YWOA 2WS2A 4G9HA 1DSBA 5H5RA 2PGTA 3DWVA 4KAEA 3VI7A 1H4OA 1B4PA 1W4VA 3CMIA 2C0EA 4KE3A 1Z9HA 5HR2A 1XOAA 4KCAA 1XOBA 3FR3A 4K5SA 4YKGA 5CRDA 1DUGA 4KA0A 3ZRDA 2GTUA 2IN3A 4Z2RA 3HZ8A 2MBSA 1ILOA 1K0MA 1E2YA 2F3MA 1GLPA 4XCSA 6GSSA 4FYCA 4E8EA 10GSA 4KSOA 5JWRB 1V58A 2MBTA 4MNNA 1R5AA 3GKNA 4F03A 1XBSA 2B5YA 3V1WA 1SYRA 2QSIA 4JZQA 4MJBA 4Z7XA 4ECCA 3IOSA 2L6DA 2VCVA 2VOCA 5G1KA 1X9SB 3ZVJD 2VD0A 2YWMA 3WGXA 4X4JA 1TKDB 4L5LA 4K2DA 4PUFC 2VL9A 1EGOA 4I97A 2HZEB 2H0GA 4N0ZA 1SENA 1RK4A 1Z6NA 4K0GA 2XBQA 1AQWA 3VWVA 2CX3A 4O32A 4AGSA 4BA7A 2REMA 3N5OA 1H75A 3BBYA 1R5PA 1AQVA 2OACA 3UL3A 1GSFA 3G7JA 1TK5B 2VLTA 4BVXB 2CVDA 1LU4A 1K0OA 1KEBA 3US3A 3L9VA 5GZZB 1PRXA 2O85A 2PVQA 4N30A 3APQA 3GNJA 6GSVA 1MDJA 2A4VA 2IFQA 3CSJA 2DC5A 1ZYPA 3K8NA 4ID0A 3FMWA 3HYPA 3HD5A 4DSQA 4X0XA 3ZREA 2K8SA 1TP9A 1XXUA 2N5AA 4OCEA 1PL1A 3TKPA 1U88A 4G0LA 2A2RA 2PU9C 2EC4A 1B9XC 5CREA 3HZ4A 4EF0A 1K0NA 1SKRB 1V9WA 3BOAA 3EPTA 4PUAA 2KLXA 2R37A 4KW6A 4N11A 2GDRA 2B1KA 1QMVA 4KNDA 2XHFA 2C0FA 3GX0A 5AIXA 3EE2A 2C0GA 6GSTA 2YV7A 3IE3A 3ZYWA 5JCGA 5GSSA 4MDCA 2B1LA 1SJIA 3TRXA 2HRFA 5LD0A 4MABA 3D4TA 4EL1A 4KB3A 3D21A 5DDLA 4Q5RA 4WBJA 4JR4A 2LJRA 1Y25A 1WPIA 1PSQA 8GSSA 3DMLA 2WGRA 2AYTA 3ZMKA 2I1UA 3UVHA 1GNWA 2H30A 1GLQA 3FZ5A 20GSA 3LXZA 3I43A 1FOVA 2YNXA 4JE1A 2OBKA 4MF6A 3EWLA 3L78A 1F2EA 2QA2A 1WOUA 3M0FA 4MH2A 1ERTA 1THOA 1PL2A 1SK2A 5B8BA 5ID2A 5J9CA 4RQXA 1V57A 1FAAA 4DSRA 2GZPA 4FYBA 2H1DA 2LS5A 3HVXA 4GSTA 3G9BA 2DJ1A 2LJKA 4ZBDA 2KP1A 3MIXA 4TR3A 3QFBC 4IJ3A 1S3AA 2V6OA 5IIZA 3DYRA 11GSA 1TRSA 3FR9A 3EU3A 3RDWA 4USSA 1G0TA 3GL3A 2BTOT 1ZMAA 3GUSA 4QQ7A 2JZTA 3FZ9A 1SL2B 2YOIA 1XW9A 2F51A 2J9HA 3GH6A 2F8AA 1PX6A 1JZRA 1SYXA 2HE3A 3CTFA 2H6YA 1G6YA 2VD1A 3H8QA 5ECKB 4QL9A 4HI7A 3TRPA 2IMDA 4KUNA 1WE0A 2JZSA 4A5PA 2LQQA 1EWXA 1TI1A 1EP8A 5INYA 3VWWA 4EVMA 2F8FA 2X4AA 3P90A 3TKSE 4ZB9A 2AHEA 4BVXA 2RM6A 3IA1A 3HJMA 5FWGA 4EDZA 4X1UA 2H19A 3QCPA 5IM9A 1GH2A 4YAVA 2RM5A 2H76A 2L4CA 2H1AA 5IOWA 4OD7A 4EDYA 4MPFA 4J56E 4GSSA 6GSXA 4G0IA 3LEFA 2ES7A 3F0IA 3MWHA 3QD9A 3RHCA 2GQKA 5F0GA 4ILFA 3TGZA 4PQIA 1BYEA 4I6XA 3GV1A 5D9XA 2GLRA 2VCWA 5KOWA 4K7OA 1B9YC 5DALB 2CAIA 2HNLA 3IV4A 2L5OA 3TJBA 5LNKe 1Z7PA 4MP4A 3G7YA 3TKSA 3M8NA 2JL4A 2B5XA 3IC4A 5DAKA 1O6JA 2FA4A 4PQHA 2PUKC 3KTLA 3WGDA 4D73B 3D0ZA 4XRDA 4HEA2 1TXXA 1ZZYA 2LJAA 1N2AA 3PH9A 4POKA 5IMDA 3UAPA 2HSMA 1YF1A 3D22A 4F2IA 3QAVA 5IOXA 3WYWA 5D9WA 3R3EA 4AJ6A 1FHEA 5GAPD 2CQ9A 4Z2UA 1PGTA 9GSSA 1ZOFA 5GAND 6GSUA 3EMPA 5KN0A 2TRXA 3ZITA 2PPTA 5G5EA 1S3DA 2PBJA 4N10A 5ECQB 2CAQA 1R7HA 3IDVA 1TTZA 2NDOA 2H6XA 2TIRA 4K6XA 1QK8A 1E6BA 2BMXA 2P31A 2IFQB 3BJ5A 5HR0A 5HR3A 4AF2A 3UARA 1BAYA 1X5EA 3VPTA 1CQGA 1PX7A 2HSYA 1XVWA 1B48A 1XWKA 1THXA 2DIYA 1XVQA 2HFDA 4HQZA 4OFMA 1YEXA 3UBLA 4EIQA 5HFKA 4DSSA 4MJCA 1XFLA 1XCCA 4Q5FA 4HOJA 3VWUA 2E2GA 4I2TA 2LSTA 3EC3A 3P8WA 14GSA 3RBTA 4K2XA 1X9WB 1F9MA 1UA5A 5ENUA 5G2ZA 3KEBA 3RHBA 1TJDA 3KJYA 1Z6MA 2K9FA 3H93A 3FY7A 4XHMA 3KM6A 2LV3A 3ZFLA 5IO0A 4OFTA 5ECRB 5IMZA 1SU9A 1XIYA 3CXGA 2LQOA 2VM2A 1YKCA 5J4UA 2MYGA 4EKZA 4PNGA 3TOUA 1A2MA 1T4ZA 2AJQB 2PN8A 3N9JA 3IAM2 7GSSA 3TJFA 2GS3A 5EPFA 2B7KA 4FIWA 2HZFA 2FUG2 1S3CA 3F4SA 5D73A 4LA1A 3PGTA 1GSSA 1T4YA 2ZUPA 4OFNA 2O7KA 2MZCA 1BEDA 1ZYEA 2EIQA 1F37A 3GRXA 2VLUA 1OVNA 2GSRA 1JZWA 1A0RP 3ERWA 3HDCA 3IC8A 4MMMA 2C0DA 3GIXA 1SD9A 3GX8A 1FG4A 4CDOA 2WULA 2H0IA 3F9UA 4JU5A 1X9MB 3M9KA 4FYUA 2GQMA 2CZ2A 2K18A 4XIHA 2CVBA 5ID2B 5IMAA 3CBUA 3FYGA 3SWLA 2Z9SA 3KMNA 3O3TA 1SD8A 5IPGA 2G2QA 5CO3A 1X5DA 4PX1A 2R2JA 3IBHA 5JWOB 3ZLPA 17GSA 5D9VA 3Q74A 1UVZA 1HYUA 3I9V2 2N5BA 5DALA 2P0GA 5CNWA 4ISDA 4YQUA 1M7TA 1GSDA 3UEMA 2C1YA 3TCOA 4EUYA 3H79A 4D73A 5ELAA 2X8HA 3QFAC 3BCIA 4CW9A 1NW2A 2C4JA 1VGLA 2L6CA 4IN0A 4TXVA 1ML6A 4NV2A 2YN1A 3IHGA 3DVWA 2B5EA 3VWXA 4MF7A 4XRAA 4ACSA 3MSZA 4F0CA 3L9SA 1V2AA 1U3AA 1W89A 5H5QA 5AGYA 1OYJA 3APSA 1QQ2A 2IMEA 3DGQA 3GFKA 4PQ1A 4GQCA 4IVFA 3S9FA 2H1BA 3O76A 2DMLA 2D2ZA 1HNAA 4KGIA 1BJXA 4TRXA 4F9ZA 3GTUB 3PPUA 3U6VA 4OCFA 1GULA 2X99A 2DBCA 2DJ2A 5JCUA 1GTBA 3KCMA 4IS0A 4YH2A 3A3TA 1AXDA 4BWSA 2DSAA 3UIWA 2FCHA 1SJZA 2FD3A 1KBNA 2MMZA 3ED3A 4IP6A 2O89A 2GZZA 5J41A 3D4MA 3UVTA 4IJIA 4YQVA 3A5IA 3E9JB 4ULXA 3GH9A 1GSUA 3KH7A 2DJ0A 2DIZA 3FZ4A 4MPGA 1O81A 1OKTA 2E2MA 4K5RA 5DQYA 3F8UA 5A5KA 5IMVA 5G5FA 1T8EB 1C72A 5C04A 1KNGA 4ML6A 3TKRA 5DAKB 4MZCA 3GHAA 2X49A 3IRAA 2DJJA 1MEKA 5F06A 3CYNA 3UJ1A 3KD0A 1PN0A 2YWNA 1GWCA 3BD2A 2JSYA 3RPNA 4RI6A 3NIVA 2LEGA 2OA7A 1SKSB 3HXSA 2XC2A 2QC7A 1YKAA 1EEJA 3TDGA 2C3TA 1XWCA 1TDIA 2R6KA 3FR6A 1TU8A 5DQSA 4TVEA 4GSNA 2LNSA 1OE8A 1GUHA 2H1GA 2FY6A 2VM1A 1YY7A 2N5FA 18GSA 1LBKA 2PMTA 5D93A 1TW9A 2C80A 4KH7A 2WFCA 2H70A 3DVXA 4KDXA 4GRFA 3NOFA 3CSHA 2AUVA 3UOMA 5CYYA 4HZ4A 4AJ8A 3HVSA 4WR4A 3UBKA 4FO5A 4ZB6A 5G31A 1Q98A 4O5UA 2IMFA 2C3QA 3F63A 3TB2A 4OO4A 3ZZXA 3ERGA 4X43A 2LNTA 1X0RA 5FT3A 3WT1A 2IWTA 4WR5A 4G19A 4NPBA 3RPPA 6GSYA 4IQ1A 3J7Yb 4I5QA 4TKYA 3CSIA 4DSSB 4EO3A 5F8BA 1K3OA 1OC9A 1UC7A 2NTOA 3WD6A 1EV4A 4XTSA 2ZCTA 2HYXA 1HD2A 2H75A 4O5RA 2QA1A 2R0PA 4CY8A 1XWBA 1LJRA 3Q6OA 1M99A 1ON4A 4PURA 5C00A 5B8AA 4ZILA 3KZQA 3HCZA 4IP1A 3PR8A 2FWFA 1XZOA 1GL8A 2GSSA 4NHZA 2CV4A 1B4QA 1WJKA 3DKSA 4ZL8A 2J23A 3HVVA 2YZUA 3LJRA 1ABAA 1N8JA 2HRAA 4ZL7A 1OKDA 3IXRA 2GZYA 4IKHA 1U3IA 1M2DA 1IYIA 1T1VA 2WJUA 1GTIA 3ERFA 4EIPA 4ZBAA 5J9BA 3GSTA 3MDKA 2GQLA 4ZIJA 3ISOA 4E8HA 2LRNA 5KN2A 2YANA 5CAXA 3H1NA 4L8EA 1TRVA 5IQYA 1I9DA 3A2VA 3GTUA 3Q19A 1V40A 2C8UA 13GSA 2H8LA 4G0KA 2FWGA 1PMTA 3QAWA 1EEMA 2I81A 2VLVA 3CRUA 2GGTA 1QGVA 3I69A 3EINA 3IHQA 4WEYA 4TOPA 2WDUA 2ON7A 2LKUA 4L0WA 1SK1A 3GL5A 3KMOA 2HT9A 2QKEA 4HU7A 2GVPA 1JZDA 4DEJA 3PINA 2EIRA 3A5WA 4G2EA 1A8YA 1GSQA 1I5GA 2KUCA 5J3RA 2OE1A 4POBA 5DBQA 1ZYNA 1A0FA 3FRCA 2HI7A 1F6MC 1PKZA 2KHPA 5F07A 1FB0A 4WKWA 1HNCA 2M80A 2X8CA 5HQPA 2JSZA 2HSHA 3HA9A 3VLNA 1A2JA 5D9TA 2LRCA 2JACA 3GMFA 2XPDA 5E59A 3D5JA 3DRNA 1EZKA 1A2LA 5B7CA 3EURA 4WBRD 2UZ8A 3APOA 5J5NA 4ZXGA 2K6VA 5DCGA 1DE1A 4MJEA 2LUSA 1PKWA 4GXZA 1YDKA 3W8SA 5AN1A 4WF4A 3TRQA 3TUEA 2WRTA 4XS4B 2JADA 1GSYA 4BL7B 4GLTA 2IIYA 3ZIVA 2I4AA 1QXHA 5F05A 2C3NA 3GA4A 4PXOA 5JCWA 3G7IA 3KIJA 2H01A 1M2AA 2IPAA 2VL3A 3LYKA 2AB6A 1YZXA 4ECBA 2H66A 3KTBA 4GF0A 4LLRA 4NXIA 1RQMA 1JLWA 3A2WA 3VK9A 3MYDA 1YEPA 2DKIA 4EXJA 4V2LA 5HFIA 4K9ZA 3DEXA 1R26A 1OE7A 1AQXA 5CRHA 4N0VA 4ZB8A 1OC8A 3C8EA 5IMCA 4IBPA 4RUVA 1WRYA 4V2MA 2ALBA 2H6ZA 2H72A 2E7PA 1TU7A 2EIOA 1ZGNA 2KP2A 3C1RA 1XWAA 5B6MA 3TJKA 4MLYA 4YAPA 4HUAA 4IGJA 3VURA 3TJJA 1Z3EA 2XPEA 1QFNA 2GSTA 2WZ9A 1MD4A 1GRXA 4GQFA 1CQHA 1TK8B 4OMVA 1TRUA 2FWEA 2RUFA 1O8WA 2B7JA 3ZVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YJ7 A;  4TN8 A;  1EV9 A;  3VPQ A;  2GT5 A;  3FW2 A;  3QDN A;  3KP8 A;  2YP6 A;  1VF4 A;  3F4T A;  3IPZ A;  1NM3 A;  5EY6 A;  1XW5 A;  5IMF A;  4IQA A;  3GYK A;  3M1G A;  1Q4J A;  2L4Q A;  3GN3 A;  4J2F A;  3HJP A;  2O87 A;  2OE3 A;  2YCD A;  4KX4 A;  1Y6E A;  2R4V A;  3QPM A;  1OC9 B;  2B6M A;  1TRW A;  4CHS A;  4TR1 A;  4NWY A;  4K0N A;  2FHE A;  4O92 A;  2XBI A;  2LTK A;  3TKQ A;  5KN3 A;  3GKX A;  2R5G A;  4GWR A;  4MF5 A;  4J57 E;  4JRR A;  2B3S A;  2BJX A;  1G7O A;  1MD3 A;  3QMX A;  3FZA A;  5KEJ A;  4KDY A;  1QUW A;  3LQ7 A;  5ECN B;  2CVK A;  1EOH A;  1MDI A;  2M72 A;  3Q18 A;  4JBB A;  3ME7 A;  3LSZ A;  1A8L A;  5AIS A;  4V2N A;  3KGK A;  1FVK A;  1J0F A;  4K1F A;  1XPV A;  5HFG A;  1X5C A;  2VL2 C;  2VCZ A;  4IW9 A;  5ECS A;  1JZO A;  4L5O A;  1TOF A;  1SL0 B;  2RUE A;  2I3Y A;  4KDU A;  3FEU A;  1SL1 B;  3ZL5 A;  2KOK A;  2FA8 A;  1G7E A;  1BX9 A;  3TJG A;  1M2B A;  3IAS 2;  5ECO B;  4TXO B;  2IMI A;  1JFU A;  5GST A;  4LMW A;  5DCH A;  5DVB A;  2H0H A;  2I9H A;  5IPH A;  2ON5 A;  2FGX A;  4H86 A;  4XS4 A;  1Z5Y E;  4BL7 A;  1TK0 B;  2F9S A;  3H4K A;  4ML1 A;  2DMM A;  4XS6 A;  4KCE A;  2PVO C;  3SBC A;  1BG5 A;  1M0U A;  3NZN A;  3AY8 A;  5D96 A;  3TOT A;  1WWJ A;  2VAF A;  2DJ3 A;  1YJ6 A;  5CP1 A;  5COH A;  3ZIJ A;  1J9B A;  4NAX A;  1T7P B;  3F3R A;  3RAZ A;  4MJA A;  5A4W A;  4GCI A;  2IMK A;  4P3Y B;  1YF0 A;  2GT6 A;  4WXT A;  3IK7 A;  1R4W A;  2X64 A;  3A2X A;  3LYP A;  1PN9 A;  3FK8 A;  1ST9 A;  4G10 A;  3FKF A;  3LOR A;  4HZ2 A;  4EE0 A;  2L5L A;  1GNE A;  4PNF A;  2H71 A;  5AIV A;  2YZH A;  1ZYQ B;  2NPB A;  4Q5N A;  3W6G A;  2VCQ A;  2CA8 A;  4K8M A;  1USB A;  3JCM L;  1TI3 A;  4K7I A;  2AV4 A;  3I6A A;  1WMJ A;  3L4N A;  1UN2 A;  5G1L A;  1XWG A;  4MCU A;  5B6N A;  1FVJ A;  2VCX A;  3IK9 A;  3QOU A;  1EP7 A;  3C73 A;  1VF3 A;  3HHV A;  2G0F A;  6GSW A;  1YQ1 A;  3W8J A;  4F0B A;  3HJO A;  16GS A;  2YV9 A;  2P5R A;  2PWJ A;  1ACV A;  3LGC A;  1AAZ A;  1ZCP A;  3QAG A;  1A23 A;  2H73 A;  3L9U A;  3TKS C;  3IR4 A;  5LCZ A;  2H74 A;  2VO4 A;  2K8V A;  3FHK A;  2O8V B;  4PGT A;  1GTU A;  1SJ6 A;  4YQM A;  1JLV A;  1OAZ A;  1AIU A;  4MA9 A;  1K3L A;  3DXB A;  5ECI B;  2VL2 A;  2V32 A;  3EYT A;  4BWQ A;  2FNO A;  1M9B A;  1VF1 A;  3R2Q A;  3P2A A;  2P5Q A;  4HDE A;  3LXT A;  5D8I A;  3BCK A;  2NBS A;  1BQ7 A;  2L57 A;  1ZL9 A;  4DVC A;  3MAK A;  1GUM A;  1AUC A;  2AAW A;  3ME8 A;  4NHW A;  4V1A p;  4K7N A;  5IO2 A;  2YWI A;  1V98 A;  4AJ7 A;  3QR6 A;  3M9J A;  3LWA A;  4IHU A;  5H5S A;  3GKK A;  3O6T A;  4RQR A;  3F4R A;  4HJ2 A;  2V1M A;  1RW1 A;  3CTG A;  4TR0 A;  1F3B A;  4I2U A;  4WF5 A;  1ERU A;  4JR6 A;  2X8G A;  4POL A;  2HXK A;  3HKR A;  4TXO A;  2HZE A;  1FW1 A;  3F6F A;  4LMV A;  5E4W A;  5A4U A;  2QGV A;  3C7M A;  4OWY A;  4FH8 A;  2OJL A;  3EU4 A;  1KTE A;  2ZNM A;  3U5R E;  4ZL9 A;  2VCT A;  1PD2 1;  4RI7 A;  5ECL B;  3C1S A;  1VRS D;  3F6D A;  4LL4 B;  1G6W A;  1GTA A;  2FWH A;  1SKW B;  1Z7R A;  4O7H A;  3LG6 A;  1J08 A;  3VFI A;  1MDK A;  3L0H A;  4MH3 A;  1MTC A;  4TR1 B;  3MNG A;  4IEL A;  2JU5 A;  4QL7 A;  3F3Q A;  3EMX A;  2HRN A;  3D6I A;  2VIM A;  1M9A A;  3GSS A;  1K3Y A;  5G30 A;  2DLX A;  2M46 A;  1NHY A;  5A4V A;  4I8B A;  2TRC P;  2YPM A;  2DJK A;  1AC1 A;  3ZML A;  3DIE A;  2CZ3 A;  1T00 A;  2WB9 A;  19GS A;  4JED A;  1ERV A;  3GKM A;  1K0B A;  2WCI A;  1NHO A;  1PA3 A;  3M3M A;  1VF2 A;  2GSQ A;  2MMA A;  1GUK A;  2VUP A;  1URM A;  1O8X A;  1EGR A;  4LL1 B;  5DJL A;  5FHI A;  3HY2 A;  4WET A;  5ECH B;  1O73 A;  4HU9 A;  4HS1 A;  2FLS A;  4HQS A;  2LRT A;  1O85 A;  3KXO A;  2E0Q A;  3KP9 A;  1JHB A;  2IL3 A;  2PER A;  1K0A A;  5HR1 A;  4F82 A;  4XS1 A;  4TR4 A;  3UMA A;  5ABR A;  2CT6 A;  5ELG A;  4POM A;  1EOG A;  1PQN A;  1GSE A;  1IYH A;  2OKA A;  3KH9 A;  1K0D A;  4KSM A;  1U87 A;  1GP1 A;  3EVI A;  2A2S A;  5L71 A;  2L59 A;  3ZTL A;  2JZR A;  4NMU A;  2RII A;  5JWQ B;  4ECI A;  2MMN A;  2RLI A;  1HNB A;  1FO5 A;  4ECJ A;  1B8X A;  1WP0 A;  4OO5 A;  3E0U A;  3P7X A;  3VI5 A;  4EC0 A;  1DBY A;  2MMO A;  3WGE A;  2IJY A;  1FB6 A;  1K0C A;  2R3X A;  2CX4 A;  2V41 A;  2OBI A;  1SK0 A;  2V2G A;  1XW6 A;  5CRG A;  4BPY A;  1AW9 A;  3J7Y k;  4TW5 A;  2HLS A;  5EVO A;  2NVL A;  4HJM A;  4MZB A;  1U6T A;  1A24 A;  4ZBB A;  1O7U A;  5CRW A;  3E3E A;  3C71 A;  3ZFB A;  4GTU A;  2YJH A;  1WIK A;  1F3A A;  4Q5Q A;  5DJM A;  1ERW A;  3OR5 A;  1T3B A;  3LFL A;  4MZW A;  4NV5 A;  5EL8 A;  22GS A;  3WT2 A;  5ECP B;  3GUR A;  4L0U A;  1NSW A;  4V1A g;  4MK3 A;  2V6K A;  3DD3 A;  4BVY A;  1OC3 A;  2OE0 A;  5ECM B;  5KN1 A;  12GS A;  3CRT A;  1DE2 A;  1HQO A;  2OAD A;  2YWO A;  2WS2 A;  4G9H A;  1DSB A;  5H5R A;  2PGT A;  3DWV A;  4KAE A;  3VI7 A;  1H4O A;  1B4P A;  1W4V A;  3CMI A;  2C0E A;  4KE3 A;  1Z9H A;  5HR2 A;  1XOA A;  4KCA A;  1XOB A;  3FR3 A;  5CRD A;  1DUG A;  4KA0 A;  3ZRD A;  2GTU A;  2IN3 A;  3HZ8 A;  2MBS A;  1ILO A;  1K0M A;  1E2Y A;  2F3M A;  1GLP A;  4XCS A;  6GSS A;  4FYC A;  4E8E A;  10GS A;  4KSO A;  5JWR B;  1V58 A;  2MBT A;  1R5A A;  3GKN A;  4F03 A;  1XBS A;  2B5Y A;  3V1W A;  1SYR A;  2QSI A;  4JZQ A;  4MJB A;  4Z7X A;  4ECC A;  3IOS A;  2L6D A;  2VCV A;  2VOC A;  5G1K A;  1X9S B;  3ZVJ D;  2VD0 A;  2YWM A;  3WGX A;  1TKD B;  4L5L A;  4K2D A;  4PUF C;  2VL9 A;  1EGO A;  4I97 A;  2HZE B;  2H0G A;  4N0Z A;  1SEN A;  1RK4 A;  1Z6N A;  4K0G A;  2XBQ A;  1AQW A;  3VWV A;  2CX3 A;  4O32 A;  4AGS A;  4BA7 A;  2REM A;  3N5O A;  1H75 A;  3BBY A;  1R5P A;  1AQV A;  2OAC A;  3UL3 A;  1GSF A;  3G7J A;  1TK5 B;  2VLT A;  2CVD A;  1LU4 A;  1K0O A;  1KEB A;  3US3 A;  3L9V A;  5GZZ B;  1PRX A;  2O85 A;  2PVQ A;  4N30 A;  3APQ A;  3GNJ A;  6GSV A;  1MDJ A;  2A4V A;  2IFQ A;  3CSJ A;  2DC5 A;  3K8N A;  4ID0 A;  3HYP A;  3HD5 A;  4DSQ A;  4X0X A;  3ZRE A;  2K8S A;  1TP9 A;  1XXU A;  2N5A A;  4OCE A;  1PL1 A;  3TKP A;  1U88 A;  2A2R A;  2PU9 C;  2EC4 A;  1B9X C;  5CRE A;  3HZ4 A;  4EF0 A;  1K0N A;  1SKR B;  1V9W A;  3BOA A;  4PUA A;  2KLX A;  2R37 A;  4KW6 A;  4N11 A;  2GDR A;  2B1K A;  1QMV A;  4KND A;  2XHF A;  2C0F A;  3GX0 A;  5AIX A;  3EE2 A;  2C0G A;  6GST A;  2YV7 A;  3IE3 A;  3ZYW A;  5JCG A;  5GSS A;  4MDC A;  2B1L A;  1SJI A;  3TRX A;  2HRF A;  5LD0 A;  4MAB A;  3D4T A;  4EL1 A;  4KB3 A;  3D21 A;  5DDL A;  4Q5R A;  4WBJ A;  4JR4 A;  2LJR A;  1Y25 A;  1WPI A;  1PSQ A;  8GSS A;  3DML A;  2WGR A;  2AYT A;  3ZMK A;  2I1U A;  3UVH A;  1GNW A;  2H30 A;  1GLQ A;  3FZ5 A;  20GS A;  3LXZ A;  3I43 A;  1FOV A;  2YNX A;  4JE1 A;  2OBK A;  4MF6 A;  3EWL A;  3L78 A;  1F2E A;  1WOU A;  3M0F A;  4MH2 A;  1ERT A;  1THO A;  1PL2 A;  1SK2 A;  5B8B A;  5ID2 A;  5J9C A;  4RQX A;  1V57 A;  1FAA A;  4DSR A;  2GZP A;  4FYB A;  2H1D A;  2LS5 A;  3HVX A;  4GST A;  3G9B A;  2DJ1 A;  2LJK A;  4ZBD A;  2KP1 A;  4TR3 A;  3QFB C;  4IJ3 A;  1S3A A;  2V6O A;  5IIZ A;  3DYR A;  11GS A;  1TRS A;  3FR9 A;  3EU3 A;  3RDW A;  1G0T A;  3GL3 A;  2BTO T;  1ZMA A;  3GUS A;  4QQ7 A;  2JZT A;  3FZ9 A;  1SL2 B;  2YOI A;  1XW9 A;  2F51 A;  2J9H A;  3GH6 A;  2F8A A;  1PX6 A;  1JZR A;  1SYX A;  2HE3 A;  3CTF A;  2H6Y A;  1G6Y A;  2VD1 A;  3H8Q A;  5ECK B;  4QL9 A;  4HI7 A;  3TRP A;  2IMD A;  4KUN A;  1WE0 A;  2JZS A;  2LQQ A;  1EWX A;  1TI1 A;  1EP8 A;  5INY A;  3VWW A;  4EVM A;  2F8F A;  3P90 A;  3TKS E;  4ZB9 A;  2AHE A;  4BVX A;  2RM6 A;  3IA1 A;  3HJM A;  5FWG A;  4EDZ A;  4X1U A;  2H19 A;  3QCP A;  5IM9 A;  1GH2 A;  4YAV A;  2RM5 A;  2H76 A;  2L4C A;  2H1A A;  5IOW A;  4OD7 A;  4EDY A;  4MPF A;  4J56 E;  4GSS A;  6GSX A;  3LEF A;  2ES7 A;  3F0I A;  3MWH A;  3QD9 A;  3RHC A;  2GQK A;  5F0G A;  4ILF A;  3TGZ A;  4PQI A;  1BYE A;  4I6X A;  3GV1 A;  5D9X A;  2GLR A;  2VCW A;  4K7O A;  1B9Y C;  5DAL B;  2CAI A;  2HNL A;  3IV4 A;  2L5O A;  3TJB A;  5LNK e;  1Z7P A;  4MP4 A;  3G7Y A;  3TKS A;  3M8N A;  2JL4 A;  2B5X A;  3IC4 A;  5DAK A;  1O6J A;  2FA4 A;  4PQH A;  2PUK C;  3KTL A;  3WGD A;  4D73 B;  3D0Z A;  4XRD A;  4HEA 2;  1TXX A;  1ZZY A;  2LJA A;  1N2A A;  3PH9 A;  4POK A;  5IMD A;  3UAP A;  1YF1 A;  3D22 A;  4F2I A;  3QAV A;  5IOX A;  3WYW A;  5D9W A;  4AJ6 A;  1FHE A;  5GAP D;  2CQ9 A;  1PGT A;  9GSS A;  1ZOF A;  5GAN D;  6GSU A;  3EMP A;  5KN0 A;  2TRX A;  3ZIT A;  2PPT A;  5G5E A;  1S3D A;  2PBJ A;  4N10 A;  5ECQ B;  2CAQ A;  1R7H A;  3IDV A;  1TTZ A;  2NDO A;  2H6X A;  2TIR A;  4K6X A;  1QK8 A;  1E6B A;  2BMX A;  2P31 A;  2IFQ B;  3BJ5 A;  5HR0 A;  5HR3 A;  4AF2 A;  3UAR A;  1BAY A;  1X5E A;  3VPT A;  1CQG A;  1PX7 A;  2HSY A;  1XVW A;  1B48 A;  1XWK A;  1THX A;  2DIY A;  1XVQ A;  2HFD A;  4HQZ A;  4OFM A;  1YEX A;  3UBL A;  5HFK A;  4DSS A;  4MJC A;  1XFL A;  1XCC A;  4Q5F A;  4HOJ A;  3VWU A;  2E2G A;  4I2T A;  2LST A;  3EC3 A;  3P8W A;  14GS A;  3RBT A;  1X9W B;  1F9M A;  1UA5 A;  5ENU A;  5G2Z A;  3KEB A;  3RHB A;  1TJD A;  3KJY A;  1Z6M A;  2K9F A;  3H93 A;  3FY7 A;  4XHM A;  3KM6 A;  2LV3 A;  3ZFL A;  5IO0 A;  4OFT A;  5ECR B;  5IMZ A;  1SU9 A;  1XIY A;  3CXG A;  2LQO A;  2VM2 A;  1YKC A;  5J4U A;  2MYG A;  4EKZ A;  4PNG A;  3TOU A;  1A2M A;  1T4Z A;  2AJQ B;  2PN8 A;  3N9J A;  3IAM 2;  7GSS A;  3TJF A;  2GS3 A;  5EPF A;  2B7K A;  4FIW A;  2HZF A;  2FUG 2;  1S3C A;  3F4S A;  5D73 A;  4LA1 A;  3PGT A;  1GSS A;  1T4Y A;  2ZUP A;  4OFN A;  2O7K A;  2MZC A;  1BED A;  1ZYE A;  2EIQ A;  1F37 A;  3GRX A;  2VLU A;  1OVN A;  2GSR A;  1JZW A;  1A0R P;  3ERW A;  3HDC A;  4MMM A;  2C0D A;  3GIX A;  1SD9 A;  3GX8 A;  1FG4 A;  4CDO A;  2WUL A;  2H0I A;  3F9U A;  4JU5 A;  1X9M B;  3M9K A;  4FYU A;  2GQM A;  2CZ2 A;  2K18 A;  4XIH A;  2CVB A;  5ID2 B;  5IMA A;  3CBU A;  3FYG A;  3SWL A;  2Z9S A;  3KMN A;  3O3T A;  1SD8 A;  5IPG A;  2G2Q A;  5CO3 A;  1X5D A;  4PX1 A;  2R2J A;  3IBH A;  5JWO B;  3ZLP A;  17GS A;  5D9V A;  3Q74 A;  1UVZ A;  1HYU A;  3I9V 2;  2N5B A;  5DAL A;  2P0G A;  5CNW A;  4ISD A;  4YQU A;  1M7T A;  1GSD A;  3UEM A;  2C1Y A;  3TCO A;  4EUY A;  3H79 A;  4D73 A;  5ELA A;  2X8H A;  3QFA C;  3BCI A;  4CW9 A;  1NW2 A;  2C4J A;  1VGL A;  2L6C A;  4IN0 A;  4TXV A;  1ML6 A;  4NV2 A;  2YN1 A;  3DVW A;  2B5E A;  3VWX A;  4MF7 A;  4XRA A;  4ACS A;  3MSZ A;  4F0C A;  3L9S A;  1V2A A;  1U3A A;  1W89 A;  5H5Q A;  5AGY A;  1OYJ A;  3APS A;  1QQ2 A;  2IME A;  3DGQ A;  3GFK A;  4PQ1 A;  4GQC A;  4IVF A;  3S9F A;  2H1B A;  3O76 A;  2DML A;  2D2Z A;  1HNA A;  4KGI A;  1BJX A;  4TRX A;  4F9Z A;  3GTU B;  3U6V A;  4OCF A;  1GUL A;  2X99 A;  2DBC A;  2DJ2 A;  5JCU A;  1GTB A;  3KCM A;  4IS0 A;  4YH2 A;  3A3T A;  1AXD A;  4BWS A;  2DSA A;  3UIW A;  2FCH A;  1SJZ A;  2FD3 A;  1KBN A;  2MMZ A;  3ED3 A;  4IP6 A;  2O89 A;  2GZZ A;  5J41 A;  3D4M A;  3UVT A;  4IJI A;  4YQV A;  3E9J B;  4ULX A;  3GH9 A;  1GSU A;  3KH7 A;  2DJ0 A;  2DIZ A;  3FZ4 A;  4MPG A;  1O81 A;  1OKT A;  2E2M A;  5DQY A;  3F8U A;  5A5K A;  5IMV A;  5G5F A;  1T8E B;  1C72 A;  5C04 A;  1KNG A;  4ML6 A;  3TKR A;  5DAK B;  4MZC A;  3GHA A;  3IRA A;  2DJJ A;  1MEK A;  5F06 A;  3CYN A;  3UJ1 A;  3KD0 A;  2YWN A;  1GWC A;  3BD2 A;  2JSY A;  3RPN A;  4RI6 A;  3NIV A;  2LEG A;  2OA7 A;  1SKS B;  3HXS A;  2XC2 A;  2QC7 A;  1YKA A;  1EEJ A;  3TDG A;  2C3T A;  1XWC A;  1TDI A;  2R6K A;  3FR6 A;  1TU8 A;  5DQS A;  4TVE A;  4GSN A;  2LNS A;  1OE8 A;  1GUH A;  2H1G A;  2FY6 A;  2VM1 A;  1YY7 A;  2N5F A;  18GS A;  1LBK A;  2PMT A;  5D93 A;  1TW9 A;  2C80 A;  4KH7 A;  2WFC A;  2H70 A;  3DVX A;  4KDX A;  4GRF A;  3NOF A;  3CSH A;  2AUV A;  3UOM A;  5CYY A;  4HZ4 A;  4AJ8 A;  3HVS A;  4WR4 A;  3UBK A;  4FO5 A;  4ZB6 A;  5G31 A;  1Q98 A;  2IMF A;  2C3Q A;  3F63 A;  3TB2 A;  4OO4 A;  3ZZX A;  3ERG A;  4X43 A;  2LNT A;  1X0R A;  5FT3 A;  3WT1 A;  2IWT A;  4WR5 A;  4G19 A;  4NPB A;  3RPP A;  6GSY A;  4IQ1 A;  3J7Y b;  4I5Q A;  4TKY A;  3CSI A;  4DSS B;  4EO3 A;  5F8B A;  1K3O A;  1OC9 A;  1UC7 A;  2NTO A;  3WD6 A;  1EV4 A;  4XTS A;  2ZCT A;  2HYX A;  1HD2 A;  2H75 A;  4O5R A;  1XWB A;  1LJR A;  3Q6O A;  1M99 A;  1ON4 A;  4PUR A;  5C00 A;  5B8A A;  4ZIL A;  3KZQ A;  3HCZ A;  4IP1 A;  3PR8 A;  2FWF A;  1XZO A;  1GL8 A;  2GSS A;  4NHZ A;  2CV4 A;  1B4Q A;  1WJK A;  3DKS A;  4ZL8 A;  2J23 A;  3HVV A;  2YZU A;  3LJR A;  1ABA A;  1N8J A;  4ZL7 A;  1OKD A;  3IXR A;  2GZY A;  4IKH A;  1U3I A;  1M2D A;  1IYI A;  1T1V A;  2WJU A;  1GTI A;  3ERF A;  4ZBA A;  5J9B A;  3GST A;  3MDK A;  2GQL A;  4ZIJ A;  3ISO A;  4E8H A;  2LRN A;  5KN2 A;  2YAN A;  5CAX A;  3H1N A;  4L8E A;  1TRV A;  5IQY A;  1I9D A;  3A2V A;  3GTU A;  3Q19 A;  1V40 A;  2C8U A;  13GS A;  2H8L A;  2FWG A;  1PMT A;  3QAW A;  1EEM A;  2I81 A;  2VLV A;  3CRU A;  2GGT A;  1QGV A;  3I69 A;  3EIN A;  3IHQ A;  4WEY A;  4TOP A;  2WDU A;  2ON7 A;  2LKU A;  4L0W A;  1SK1 A;  3GL5 A;  3KMO A;  2HT9 A;  2QKE A;  4HU7 A;  2GVP A;  1JZD A;  4DEJ A;  3PIN A;  2EIR A;  3A5W A;  4G2E A;  1A8Y A;  1GSQ A;  1I5G A;  2KUC A;  5J3R A;  2OE1 A;  4POB A;  5DBQ A;  1A0F A;  3FRC A;  2HI7 A;  1F6M C;  1PKZ A;  2KHP A;  5F07 A;  1FB0 A;  4WKW A;  1HNC A;  2M80 A;  2X8C A;  5HQP A;  2JSZ A;  2HSH A;  3HA9 A;  3VLN A;  1A2J A;  5D9T A;  2LRC A;  2JAC A;  3GMF A;  2XPD A;  5E59 A;  3D5J A;  3DRN A;  1EZK A;  1A2L A;  5B7C A;  3EUR A;  4WBR D;  3APO A;  5J5N A;  4ZXG A;  2K6V A;  5DCG A;  1DE1 A;  4MJE A;  2LUS A;  1PKW A;  4GXZ A;  1YDK A;  3W8S A;  5AN1 A;  4WF4 A;  3TRQ A;  3TUE A;  2WRT A;  4XS4 B;  2JAD A;  1GSY A;  4GLT A;  2IIY A;  3ZIV A;  2I4A A;  1QXH A;  5F05 A;  2C3N A;  3GA4 A;  4PXO A;  5JCW A;  3G7I A;  3KIJ A;  2H01 A;  1M2A A;  2IPA A;  2VL3 A;  3LYK A;  2AB6 A;  1YZX A;  4ECB A;  2H66 A;  3KTB A;  4GF0 A;  4LLR A;  4NXI A;  1RQM A;  1JLW A;  3A2W A;  3VK9 A;  1YEP A;  4EXJ A;  4V2L A;  5HFI A;  4K9Z A;  3DEX A;  1R26 A;  1OE7 A;  1AQX A;  5CRH A;  4N0V A;  4ZB8 A;  1OC8 A;  3C8E A;  5IMC A;  4IBP A;  4RUV A;  1WRY A;  4V2M A;  2ALB A;  2H6Z A;  2H72 A;  2E7P A;  1TU7 A;  2EIO A;  1ZGN A;  2KP2 A;  3C1R A;  1XWA A;  5B6M A;  3TJK A;  4MLY A;  4YAP A;  4HUA A;  4IGJ A;  3VUR A;  3TJJ A;  1Z3E A;  2XPE A;  1QFN A;  2GST A;  2WZ9 A;  1MD4 A;  1GRX A;  4GQF A;  1CQH A;  1TK8 B;  4OMV A;  1TRU A;  2FWE A;  2RUF A;  1O8W A;  2B7J A;  3ZVJ A; 
#chains in the Genus database with same CATH topology
 2YJ7 A;  4TN8 A;  1EV9 A;  3VPQ A;  2GT5 A;  3FW2 A;  3QDN A;  3KP8 A;  2YP6 A;  1VF4 A;  3F4T A;  3IPZ A;  1NM3 A;  5EY6 A;  1XW5 A;  5IMF A;  4IQA A;  3GYK A;  3M1G A;  1Q4J A;  2L4Q A;  3GN3 A;  4J2F A;  3HJP A;  2O87 A;  2OE3 A;  2YCD A;  4KX4 A;  1Y6E A;  2R4V A;  3QPM A;  1OC9 B;  2B6M A;  1TRW A;  4CHS A;  4TR1 A;  4NWY A;  4K0N A;  2FHE A;  4O92 A;  2XBI A;  2LTK A;  3TKQ A;  5KN3 A;  3GKX A;  2R5G A;  4GWR A;  4MF5 A;  4J57 E;  4JRR A;  2B3S A;  2BJX A;  1G7O A;  1MD3 A;  3QMX A;  3FZA A;  5KEJ A;  4KDY A;  1QUW A;  3LQ7 A;  5ECN B;  2CVK A;  1EOH A;  2DKH A;  1MDI A;  2M72 A;  3Q18 A;  4JBB A;  3ME7 A;  5BMU A;  3LSZ A;  1A8L A;  5AIS A;  4V2N A;  3KGK A;  1FVK A;  1J0F A;  4K1F A;  1XPV A;  5HFG A;  1X5C A;  2VL2 C;  2VCZ A;  4IW9 A;  5ECS A;  1JZO A;  4L5O A;  1TOF A;  1SL0 B;  2RUE A;  2I3Y A;  4KDU A;  3FEU A;  1SL1 B;  4FQU A;  3ZL5 A;  2KOK A;  2FA8 A;  1G7E A;  1BX9 A;  3TJG A;  1M2B A;  3IAS 2;  5ECO B;  4TXO B;  2IMI A;  1JFU A;  5GST A;  4LMW A;  5DCH A;  5DVB A;  2H0H A;  2I9H A;  5IPH A;  2ON5 A;  2FGX A;  4H86 A;  4XS4 A;  1Z5Y E;  4BL7 A;  1TK0 B;  2F9S A;  3H4K A;  4ML1 A;  3LW9 A;  2DMM A;  4XS6 A;  4KCE A;  2PVO C;  3SBC A;  1BG5 A;  1M0U A;  3NZN A;  3AY8 A;  5D96 A;  3TOT A;  1WWJ A;  2VAF A;  2DJ3 A;  1YJ6 A;  5CP1 A;  5BRT A;  5COH A;  3ZIJ A;  1J9B A;  4NAX A;  1T7P B;  3F3R A;  3RAZ A;  4MJA A;  5A4W A;  4GCI A;  2IMK A;  4P3Y B;  1YF0 A;  2GT6 A;  4WXT A;  3IK7 A;  1R4W A;  2X64 A;  3A2X A;  3LYP A;  1PN9 A;  3FK8 A;  1ST9 A;  4G10 A;  3FKF A;  3LOR A;  4HZ2 A;  4EE0 A;  2L5L A;  1GNE A;  4PNF A;  2H71 A;  5AIV A;  2YZH A;  1ZYQ B;  2NPB A;  4Q5N A;  1FOH A;  3W6G A;  2VCQ A;  2CA8 A;  4K8M A;  1USB A;  3JCM L;  4O5Q A;  1TI3 A;  4K7I A;  2AV4 A;  3I6A A;  1WMJ A;  3L4N A;  1UN2 A;  5G1L A;  1XWG A;  4MCU A;  5B6N A;  1FVJ A;  2VCX A;  4CY6 A;  3IK9 A;  3QOU A;  1EP7 A;  3C73 A;  5KOX A;  1VF3 A;  3HHV A;  2G0F A;  6GSW A;  1YQ1 A;  3W8J A;  4F0B A;  3HJO A;  16GS A;  2YV9 A;  2P5R A;  2PWJ A;  1ACV A;  3LGC A;  1AAZ A;  1ZCP A;  3QAG A;  1A23 A;  2H73 A;  3L9U A;  3TKS C;  3IR4 A;  5LCZ A;  2H74 A;  2VO4 A;  2K8V A;  3FHK A;  2O8V B;  4PGT A;  1GTU A;  1SJ6 A;  4YQM A;  1JLV A;  1OAZ A;  1AIU A;  4MA9 A;  1K3L A;  3DXB A;  5ECI B;  2VL2 A;  2V32 A;  3EYT A;  4BWQ A;  2FNO A;  2R0G A;  1M9B A;  1VF1 A;  3R2Q A;  3P2A A;  2P5Q A;  4HDE A;  3LXT A;  5D8I A;  3BCK A;  2NBS A;  1BQ7 A;  2L57 A;  1ZL9 A;  4DVC A;  2HRK A;  3MAK A;  1GUM A;  1AUC A;  2AAW A;  3ME8 A;  4NHW A;  4V1A p;  4K7N A;  4PTS A;  5IO2 A;  2YWI A;  1V98 A;  4AJ7 A;  3QR6 A;  3M9J A;  3LWA A;  4IHU A;  5H5S A;  3GKK A;  3O6T A;  4RQR A;  3F4R A;  4HJ2 A;  2V1M A;  1RW1 A;  3CTG A;  4TR0 A;  1F3B A;  4I2U A;  4WF5 A;  1ERU A;  4JR6 A;  2X8G A;  4POL A;  2HXK A;  2A2P A;  3HKR A;  4TXO A;  2HZE A;  1FW1 A;  3F6F A;  4LMV A;  4BVY B;  5E4W A;  5A4U A;  2QGV A;  3C7M A;  4OWY A;  4FH8 A;  2OJL A;  3EU4 A;  1KTE A;  2ZNM A;  3U5R E;  4ZL9 A;  2VCT A;  1PD2 1;  4RI7 A;  5ECL B;  3C1S A;  1VRS D;  3F6D A;  4LL4 B;  1G6W A;  1GTA A;  2FWH A;  1SKW B;  1Z7R A;  2R0C A;  4O7H A;  3LG6 A;  4KF9 A;  1J08 A;  3VFI A;  1MDK A;  3L0H A;  4MH3 A;  1MTC A;  4TR1 B;  3MNG A;  4IEL A;  2JU5 A;  4QL7 A;  3F3Q A;  3EMX A;  2HRN A;  3D6I A;  2VIM A;  1M9A A;  3GSS A;  1K3Y A;  5G30 A;  2DLX A;  2M46 A;  1NHY A;  5A4V A;  4I8B A;  2TRC P;  2YPM A;  2DJK A;  1AC1 A;  3ZML A;  3DIE A;  2CZ3 A;  1T00 A;  2WB9 A;  19GS A;  4JED A;  1ERV A;  3GKM A;  1K0B A;  2WCI A;  1NHO A;  1PA3 A;  3M3M A;  1VF2 A;  2GSQ A;  2MMA A;  4ICY A;  1GUK A;  2VUP A;  1URM A;  1O8X A;  1EGR A;  4LL1 B;  5DJL A;  5FHI A;  3HY2 A;  4WET A;  5ECH B;  1O73 A;  4HU9 A;  4YKF A;  4HS1 A;  2FLS A;  4HQS A;  2LRT A;  1O85 A;  3KXO A;  2E0Q A;  3KP9 A;  1JHB A;  2IL3 A;  2PER A;  1K0A A;  5HR1 A;  4F82 A;  4XS1 A;  4TR4 A;  3UMA A;  5ABR A;  2CT6 A;  5ELG A;  4POM A;  1EOG A;  1PQN A;  1GSE A;  1IYH A;  2OKA A;  3KH9 A;  1K0D A;  4KSM A;  1U87 A;  1GP1 A;  3EVI A;  2A2S A;  5L71 A;  2L59 A;  1PFO A;  3ZTL A;  4Z2T A;  2JZR A;  4NMU A;  2RII A;  5JWQ B;  4ECI A;  2MMN A;  2RLI A;  1HNB A;  1FO5 A;  4ECJ A;  1B8X A;  1WP0 A;  4OO5 A;  3E0U A;  3P7X A;  3VI5 A;  4EC0 A;  1DBY A;  2MMO A;  3WGE A;  2IJY A;  1FB6 A;  1K0C A;  2R3X A;  2CX4 A;  2V41 A;  2OBI A;  1SK0 A;  2V2G A;  1XW6 A;  5CRG A;  4BPY A;  1AW9 A;  2A4H A;  3J7Y k;  4TW5 A;  2HLS A;  5EVO A;  2NVL A;  4HJM A;  4MZB A;  1U6T A;  1A24 A;  4ZBB A;  1O7U A;  5CRW A;  3E3E A;  3C71 A;  3ZFB A;  4GTU A;  2YJH A;  1WIK A;  1F3A A;  4Q5Q A;  5DJM A;  1ERW A;  3OR5 A;  1T3B A;  3LFL A;  4MZW A;  4NV5 A;  5EL8 A;  22GS A;  3WT2 A;  5ECP B;  3GUR A;  4L0U A;  1NSW A;  4V1A g;  4MK3 A;  2V6K A;  3DD3 A;  4BVY A;  1OC3 A;  2OE0 A;  5ECM B;  5KN1 A;  12GS A;  3CRT A;  1DE2 A;  1HQO A;  2OAD A;  2YWO A;  2WS2 A;  4G9H A;  1DSB A;  5H5R A;  2PGT A;  3DWV A;  4KAE A;  3VI7 A;  1H4O A;  1B4P A;  1W4V A;  3CMI A;  2C0E A;  4KE3 A;  1Z9H A;  5HR2 A;  1XOA A;  4KCA A;  1XOB A;  3FR3 A;  4K5S A;  4YKG A;  5CRD A;  1DUG A;  4KA0 A;  3ZRD A;  2GTU A;  2IN3 A;  4Z2R A;  3HZ8 A;  2MBS A;  1ILO A;  1K0M A;  1E2Y A;  2F3M A;  1GLP A;  4XCS A;  6GSS A;  4FYC A;  4E8E A;  10GS A;  4KSO A;  5JWR B;  1V58 A;  2MBT A;  4MNN A;  1R5A A;  3GKN A;  4F03 A;  1XBS A;  2B5Y A;  3V1W A;  1SYR A;  2QSI A;  4JZQ A;  4MJB A;  4Z7X A;  4ECC A;  3IOS A;  2L6D A;  2VCV A;  2VOC A;  5G1K A;  1X9S B;  3ZVJ D;  2VD0 A;  2YWM A;  3WGX A;  4X4J A;  1TKD B;  4L5L A;  4K2D A;  4PUF C;  2VL9 A;  1EGO A;  4I97 A;  2HZE B;  2H0G A;  4N0Z A;  1SEN A;  1RK4 A;  1Z6N A;  4K0G A;  2XBQ A;  1AQW A;  3VWV A;  2CX3 A;  4O32 A;  4AGS A;  4BA7 A;  2REM A;  3N5O A;  1H75 A;  3BBY A;  1R5P A;  1AQV A;  2OAC A;  3UL3 A;  1GSF A;  3G7J A;  1TK5 B;  2VLT A;  4BVX B;  2CVD A;  1LU4 A;  1K0O A;  1KEB A;  3US3 A;  3L9V A;  5GZZ B;  1PRX A;  2O85 A;  2PVQ A;  4N30 A;  3APQ A;  3GNJ A;  6GSV A;  1MDJ A;  2A4V A;  2IFQ A;  3CSJ A;  2DC5 A;  1ZYP A;  3K8N A;  4ID0 A;  3FMW A;  3HYP A;  3HD5 A;  4DSQ A;  4X0X A;  3ZRE A;  2K8S A;  1TP9 A;  1XXU A;  2N5A A;  4OCE A;  1PL1 A;  3TKP A;  1U88 A;  4G0L A;  2A2R A;  2PU9 C;  2EC4 A;  1B9X C;  5CRE A;  3HZ4 A;  4EF0 A;  1K0N A;  1SKR B;  1V9W A;  3BOA A;  3EPT A;  4PUA A;  2KLX A;  2R37 A;  4KW6 A;  4N11 A;  2GDR A;  2B1K A;  1QMV A;  4KND A;  2XHF A;  2C0F A;  3GX0 A;  5AIX A;  3EE2 A;  2C0G A;  6GST A;  2YV7 A;  3IE3 A;  3ZYW A;  5JCG A;  5GSS A;  4MDC A;  2B1L A;  1SJI A;  3TRX A;  2HRF A;  5LD0 A;  4MAB A;  3D4T A;  4EL1 A;  4KB3 A;  3D21 A;  5DDL A;  4Q5R A;  4WBJ A;  4JR4 A;  2LJR A;  1Y25 A;  1WPI A;  1PSQ A;  8GSS A;  3DML A;  2WGR A;  2AYT A;  3ZMK A;  1XG8 A;  2I1U A;  3UVH A;  1GNW A;  2H30 A;  1GLQ A;  3FZ5 A;  20GS A;  3LXZ A;  3I43 A;  1FOV A;  2YNX A;  4JE1 A;  2OBK A;  4MF6 A;  3EWL A;  3L78 A;  1F2E A;  2QA2 A;  1WOU A;  3M0F A;  4MH2 A;  1ERT A;  1THO A;  1PL2 A;  1SK2 A;  5B8B A;  5ID2 A;  5J9C A;  4RQX A;  1V57 A;  1FAA A;  4DSR A;  2GZP A;  4FYB A;  2H1D A;  2LS5 A;  3HVX A;  4GST A;  3G9B A;  2DJ1 A;  2LJK A;  4ZBD A;  2KP1 A;  3MIX A;  4TR3 A;  3QFB C;  4IJ3 A;  1S3A A;  2V6O A;  5IIZ A;  3DYR A;  11GS A;  1TRS A;  3FR9 A;  3EU3 A;  3RDW A;  4USS A;  1G0T A;  3GL3 A;  2BTO T;  1ZMA A;  3GUS A;  4QQ7 A;  2JZT A;  3FZ9 A;  1SL2 B;  2YOI A;  1XW9 A;  2F51 A;  2J9H A;  3GH6 A;  2F8A A;  1PX6 A;  1JZR A;  1SYX A;  2HE3 A;  3CTF A;  2H6Y A;  1G6Y A;  2VD1 A;  3H8Q A;  5ECK B;  4QL9 A;  4HI7 A;  3TRP A;  2IMD A;  4KUN A;  1WE0 A;  2JZS A;  4A5P A;  2LQQ A;  1EWX A;  1TI1 A;  1EP8 A;  5INY A;  3VWW A;  4EVM A;  2F8F A;  2X4A A;  3P90 A;  3TKS E;  4ZB9 A;  2AHE A;  4BVX A;  2RM6 A;  3IA1 A;  3HJM A;  5FWG A;  4EDZ A;  4X1U A;  2H19 A;  3QCP A;  5IM9 A;  1GH2 A;  4YAV A;  2RM5 A;  2H76 A;  2L4C A;  2H1A A;  5IOW A;  4OD7 A;  4EDY A;  4MPF A;  4J56 E;  4GSS A;  6GSX A;  4G0I A;  3LEF A;  2ES7 A;  3F0I A;  3MWH A;  4HSC X;  3QD9 A;  3RHC A;  2GQK A;  5F0G A;  4ILF A;  3TGZ A;  4PQI A;  1BYE A;  4I6X A;  3GV1 A;  5D9X A;  2GLR A;  2VCW A;  5KOW A;  4K7O A;  1B9Y C;  5DAL B;  2CAI A;  2HNL A;  3IV4 A;  2L5O A;  3TJB A;  5LNK e;  1Z7P A;  4MP4 A;  3G7Y A;  3TKS A;  3M8N A;  2JL4 A;  2B5X A;  3IC4 A;  5DAK A;  1O6J A;  2FA4 A;  4PQH A;  2PUK C;  3KTL A;  3WGD A;  4D73 B;  3D0Z A;  4XRD A;  4HEA 2;  1TXX A;  1ZZY A;  2LJA A;  1N2A A;  3PH9 A;  4POK A;  5IMD A;  3UAP A;  2HSM A;  1YF1 A;  3D22 A;  4F2I A;  3QAV A;  5IOX A;  3WYW A;  5D9W A;  3R3E A;  4AJ6 A;  1FHE A;  5GAP D;  2CQ9 A;  4Z2U A;  1PGT A;  9GSS A;  1ZOF A;  5GAN D;  6GSU A;  3EMP A;  5KN0 A;  2TRX A;  3ZIT A;  2PPT A;  5G5E A;  1S3D A;  2PBJ A;  4N10 A;  5ECQ B;  2CAQ A;  1R7H A;  3IDV A;  1TTZ A;  2NDO A;  2H6X A;  2TIR A;  4K6X A;  1QK8 A;  1E6B A;  2BMX A;  2P31 A;  2IFQ B;  3BJ5 A;  5HR0 A;  5HR3 A;  4AF2 A;  3UAR A;  1BAY A;  1X5E A;  3VPT A;  1CQG A;  1PX7 A;  2HSY A;  1XVW A;  1B48 A;  1XWK A;  1THX A;  2DIY A;  1XVQ A;  2HFD A;  4HQZ A;  4OFM A;  1YEX A;  3UBL A;  4EIQ A;  5HFK A;  4DSS A;  4MJC A;  1XFL A;  1XCC A;  4Q5F A;  4HOJ A;  3VWU A;  2E2G A;  4I2T A;  2LST A;  3EC3 A;  3P8W A;  14GS A;  3RBT A;  4K2X A;  1X9W B;  1F9M A;  1UA5 A;  5ENU A;  5G2Z A;  3KEB A;  3RHB A;  1TJD A;  3KJY A;  1Z6M A;  2K9F A;  3H93 A;  3FY7 A;  4XHM A;  3KM6 A;  2LV3 A;  3ZFL A;  5IO0 A;  4OFT A;  5ECR B;  5IMZ A;  1SU9 A;  1XIY A;  3CXG A;  2LQO A;  2VM2 A;  1YKC A;  5J4U A;  2MYG A;  4EKZ A;  4PNG A;  3TOU A;  1A2M A;  1T4Z A;  2AJQ B;  2PN8 A;  3N9J A;  3IAM 2;  7GSS A;  3TJF A;  2GS3 A;  5EPF A;  2B7K A;  4FIW A;  2HZF A;  2FUG 2;  1S3C A;  3F4S A;  5D73 A;  4LA1 A;  3PGT A;  1GSS A;  1T4Y A;  2ZUP A;  4OFN A;  2O7K A;  2MZC A;  1BED A;  1ZYE A;  2EIQ A;  1F37 A;  3GRX A;  2VLU A;  1OVN A;  2GSR A;  1JZW A;  1A0R P;  3ERW A;  3HDC A;  3IC8 A;  4MMM A;  2C0D A;  3GIX A;  1SD9 A;  3GX8 A;  1FG4 A;  4CDO A;  2WUL A;  2H0I A;  3F9U A;  4JU5 A;  1X9M B;  3M9K A;  4FYU A;  2GQM A;  2CZ2 A;  2K18 A;  4XIH A;  2CVB A;  5ID2 B;  5IMA A;  3CBU A;  3FYG A;  3SWL A;  2Z9S A;  3KMN A;  3O3T A;  1SD8 A;  5IPG A;  2G2Q A;  5CO3 A;  1X5D A;  4PX1 A;  2R2J A;  3IBH A;  5JWO B;  3ZLP A;  17GS A;  5D9V A;  3Q74 A;  1UVZ A;  1HYU A;  3I9V 2;  2N5B A;  5DAL A;  2P0G A;  5CNW A;  4ISD A;  4YQU A;  1M7T A;  1GSD A;  3UEM A;  2C1Y A;  3TCO A;  4EUY A;  3H79 A;  4D73 A;  5ELA A;  2X8H A;  3QFA C;  3BCI A;  4CW9 A;  1NW2 A;  2C4J A;  1VGL A;  2L6C A;  4IN0 A;  4TXV A;  1ML6 A;  4NV2 A;  2YN1 A;  3IHG A;  3DVW A;  2B5E A;  3VWX A;  4MF7 A;  4XRA A;  4ACS A;  3MSZ A;  4F0C A;  3L9S A;  1V2A A;  1U3A A;  1W89 A;  5H5Q A;  5AGY A;  1OYJ A;  3APS A;  1QQ2 A;  2IME A;  3DGQ A;  3GFK A;  4PQ1 A;  4GQC A;  4IVF A;  3S9F A;  2H1B A;  3O76 A;  2DML A;  2D2Z A;  1HNA A;  4KGI A;  1BJX A;  4TRX A;  4F9Z A;  3GTU B;  3PPU A;  3U6V A;  4OCF A;  1GUL A;  2X99 A;  2DBC A;  2DJ2 A;  5JCU A;  1GTB A;  3KCM A;  4IS0 A;  4YH2 A;  3A3T A;  1AXD A;  4BWS A;  2DSA A;  3UIW A;  2FCH A;  1SJZ A;  2FD3 A;  1KBN A;  2MMZ A;  3ED3 A;  4IP6 A;  2O89 A;  2GZZ A;  5J41 A;  3D4M A;  3UVT A;  4IJI A;  4YQV A;  3A5I A;  3E9J B;  4ULX A;  3GH9 A;  1GSU A;  3KH7 A;  2DJ0 A;  2DIZ A;  3FZ4 A;  4MPG A;  1O81 A;  1OKT A;  3CQF A;  2E2M A;  4K5R A;  5DQY A;  3F8U A;  5A5K A;  5IMV A;  5G5F A;  1T8E B;  1C72 A;  5C04 A;  1KNG A;  4ML6 A;  3TKR A;  5DAK B;  4MZC A;  3GHA A;  2X49 A;  3IRA A;  2DJJ A;  1MEK A;  5F06 A;  3CYN A;  3UJ1 A;  3KD0 A;  1PN0 A;  2YWN A;  1GWC A;  3BD2 A;  2JSY A;  3RPN A;  4RI6 A;  3NIV A;  1S3R A;  2LEG A;  2OA7 A;  1SKS B;  3HXS A;  2XC2 A;  2QC7 A;  1YKA A;  1EEJ A;  3TDG A;  2C3T A;  1XWC A;  1TDI A;  2R6K A;  3FR6 A;  1TU8 A;  5DQS A;  4TVE A;  4GSN A;  2LNS A;  1OE8 A;  1GUH A;  2H1G A;  2FY6 A;  2VM1 A;  1YY7 A;  2N5F A;  18GS A;  1LBK A;  2PMT A;  5D93 A;  1TW9 A;  2C80 A;  4KH7 A;  2WFC A;  2H70 A;  3DVX A;  4KDX A;  4GRF A;  3NOF A;  4BIK A;  3CSH A;  2AUV A;  3UOM A;  5CYY A;  4HZ4 A;  4AJ8 A;  3HVS A;  4WR4 A;  3UBK A;  4FO5 A;  4ZB6 A;  5G31 A;  1Q98 A;  4O5U A;  2IMF A;  2C3Q A;  3F63 A;  3TB2 A;  4OO4 A;  3ZZX A;  3ERG A;  4X43 A;  2LNT A;  1X0R A;  5FT3 A;  3WT1 A;  2IWT A;  4WR5 A;  4G19 A;  4NPB A;  3RPP A;  6GSY A;  4IQ1 A;  3J7Y b;  4I5Q A;  4TKY A;  3CSI A;  4DSS B;  4EO3 A;  5F8B A;  1K3O A;  1OC9 A;  1UC7 A;  2NTO A;  3WD6 A;  1EV4 A;  4XTS A;  2ZCT A;  2HYX A;  1HD2 A;  2H75 A;  4O5R A;  2QA1 A;  2R0P A;  4CY8 A;  1XWB A;  1LJR A;  3Q6O A;  3HVN A;  1M99 A;  1ON4 A;  4PUR A;  5C00 A;  5B8A A;  4ZIL A;  3KZQ A;  3HCZ A;  4IP1 A;  3PR8 A;  2FWF A;  1XZO A;  1GL8 A;  2GSS A;  4NHZ A;  2CV4 A;  1B4Q A;  1WJK A;  3DKS A;  4ZL8 A;  2J23 A;  3HVV A;  2YZU A;  3LJR A;  1ABA A;  1N8J A;  2HRA A;  4ZL7 A;  1OKD A;  3IXR A;  2GZY A;  4IKH A;  1U3I A;  1M2D A;  1IYI A;  1T1V A;  2WJU A;  1GTI A;  3ERF A;  4EIP A;  4ZBA A;  5J9B A;  3GST A;  3MDK A;  2GQL A;  4ZIJ A;  3ISO A;  4E8H A;  2LRN A;  5KN2 A;  2YAN A;  5CAX A;  3H1N A;  4L8E A;  1TRV A;  5IQY A;  1I9D A;  3A2V A;  3GTU A;  3Q19 A;  1V40 A;  2C8U A;  13GS A;  1M3I A;  2H8L A;  4G0K A;  2FWG A;  1PMT A;  3QAW A;  1EEM A;  2I81 A;  2VLV A;  3CRU A;  2GGT A;  1QGV A;  3I69 A;  3EIN A;  3IHQ A;  4WEY A;  4TOP A;  2WDU A;  2ON7 A;  2LKU A;  4L0W A;  1SK1 A;  3GL5 A;  3KMO A;  2HT9 A;  2QKE A;  4HU7 A;  2GVP A;  1JZD A;  4DEJ A;  3PIN A;  2EIR A;  3A5W A;  4G2E A;  1A8Y A;  1GSQ A;  1I5G A;  2KUC A;  5J3R A;  2OE1 A;  4POB A;  5DBQ A;  1ZYN A;  1A0F A;  3FRC A;  2HI7 A;  1F6M C;  1PKZ A;  2KHP A;  5F07 A;  1FB0 A;  4WKW A;  1HNC A;  2M80 A;  2X8C A;  5HQP A;  2JSZ A;  2HSH A;  3HA9 A;  3VLN A;  1A2J A;  5D9T A;  2LRC A;  2JAC A;  3GMF A;  2XPD A;  5E59 A;  3D5J A;  3DRN A;  1EZK A;  1A2L A;  5B7C A;  3EUR A;  4WBR D;  2UZ8 A;  3APO A;  5J5N A;  4ZXG A;  2K6V A;  5DCG A;  1DE1 A;  4MJE A;  2LUS A;  1PKW A;  4GXZ A;  1YDK A;  3W8S A;  5AN1 A;  4WF4 A;  3TRQ A;  3TUE A;  2WRT A;  4XS4 B;  2JAD A;  1GSY A;  4BL7 B;  4GLT A;  2IIY A;  3ZIV A;  2I4A A;  1QXH A;  5F05 A;  2C3N A;  3GA4 A;  4PXO A;  5JCW A;  3G7I A;  3KIJ A;  2H01 A;  1M2A A;  2IPA A;  2VL3 A;  3LYK A;  2AB6 A;  1YZX A;  4ECB A;  2H66 A;  3KTB A;  4GF0 A;  4LLR A;  4NXI A;  1M3J A;  1RQM A;  1JLW A;  3A2W A;  3VK9 A;  3MYD A;  1YEP A;  2DKI A;  4EXJ A;  4V2L A;  5HFI A;  4K9Z A;  3DEX A;  1R26 A;  1OE7 A;  1AQX A;  5CRH A;  4N0V A;  4ZB8 A;  1OC8 A;  3C8E A;  5IMC A;  4IBP A;  4RUV A;  1WRY A;  4V2M A;  2ALB A;  2H6Z A;  2H72 A;  2E7P A;  1TU7 A;  2EIO A;  1ZGN A;  2KP2 A;  3C1R A;  1XWA A;  5B6M A;  3TJK A;  4MLY A;  4YAP A;  4HUA A;  4IGJ A;  3VUR A;  3TJJ A;  1Z3E A;  2XPE A;  1QFN A;  2GST A;  2WZ9 A;  1MD4 A;  1GRX A;  4GQF A;  1CQH A;  1TK8 B;  4OMV A;  1TRU A;  2FWE A;  2RUF A;  1O8W A;  2B7J A;  3ZVJ A; 
#chains in the Genus database with same CATH homology
 2YJ7 A;  4TN8 A;  1EV9 A;  3VPQ A;  2GT5 A;  3FW2 A;  3QDN A;  3KP8 A;  2YP6 A;  1VF4 A;  3F4T A;  3IPZ A;  1NM3 A;  5EY6 A;  1XW5 A;  5IMF A;  4IQA A;  3GYK A;  3M1G A;  1Q4J A;  2L4Q A;  3GN3 A;  4J2F A;  3HJP A;  2O87 A;  2OE3 A;  2YCD A;  4KX4 A;  1Y6E A;  2R4V A;  3QPM A;  1OC9 B;  2B6M A;  1TRW A;  4CHS A;  4TR1 A;  4NWY A;  4K0N A;  2FHE A;  4O92 A;  2XBI A;  2LTK A;  3TKQ A;  5KN3 A;  3GKX A;  2R5G A;  4GWR A;  4MF5 A;  4J57 E;  4JRR A;  2B3S A;  2BJX A;  1G7O A;  1MD3 A;  3QMX A;  3FZA A;  5KEJ A;  4KDY A;  1QUW A;  3LQ7 A;  5ECN B;  2CVK A;  1EOH A;  2DKH A;  1MDI A;  2M72 A;  3Q18 A;  4JBB A;  3ME7 A;  5BMU A;  3LSZ A;  1A8L A;  5AIS A;  4V2N A;  3KGK A;  1FVK A;  1J0F A;  4K1F A;  1XPV A;  5HFG A;  1X5C A;  2VL2 C;  2VCZ A;  4IW9 A;  5ECS A;  1JZO A;  4L5O A;  1TOF A;  1SL0 B;  2RUE A;  2I3Y A;  4KDU A;  3FEU A;  1SL1 B;  4FQU A;  3ZL5 A;  2KOK A;  2FA8 A;  1G7E A;  1BX9 A;  3TJG A;  1M2B A;  3IAS 2;  5ECO B;  4TXO B;  2IMI A;  1JFU A;  5GST A;  4LMW A;  5DCH A;  5DVB A;  2H0H A;  2I9H A;  5IPH A;  2ON5 A;  2FGX A;  4H86 A;  4XS4 A;  1Z5Y E;  4BL7 A;  1TK0 B;  2F9S A;  3H4K A;  4ML1 A;  3LW9 A;  2DMM A;  4XS6 A;  4KCE A;  2PVO C;  3SBC A;  1BG5 A;  1M0U A;  3NZN A;  3AY8 A;  5D96 A;  3TOT A;  1WWJ A;  2VAF A;  2DJ3 A;  1YJ6 A;  5CP1 A;  5BRT A;  5COH A;  3ZIJ A;  1J9B A;  4NAX A;  1T7P B;  3F3R A;  3RAZ A;  4MJA A;  5A4W A;  4GCI A;  2IMK A;  4P3Y B;  1YF0 A;  2GT6 A;  4WXT A;  3IK7 A;  1R4W A;  2X64 A;  3A2X A;  3LYP A;  1PN9 A;  3FK8 A;  1ST9 A;  4G10 A;  3FKF A;  3LOR A;  4HZ2 A;  4EE0 A;  2L5L A;  1GNE A;  4PNF A;  2H71 A;  5AIV A;  2YZH A;  1ZYQ B;  2NPB A;  4Q5N A;  1FOH A;  3W6G A;  2VCQ A;  2CA8 A;  4K8M A;  1USB A;  3JCM L;  4O5Q A;  1TI3 A;  4K7I A;  2AV4 A;  3I6A A;  1WMJ A;  3L4N A;  1UN2 A;  5G1L A;  1XWG A;  4MCU A;  5B6N A;  1FVJ A;  2VCX A;  4CY6 A;  3IK9 A;  3QOU A;  1EP7 A;  3C73 A;  5KOX A;  1VF3 A;  3HHV A;  2G0F A;  6GSW A;  1YQ1 A;  3W8J A;  4F0B A;  3HJO A;  16GS A;  2YV9 A;  2P5R A;  2PWJ A;  1ACV A;  3LGC A;  1AAZ A;  1ZCP A;  3QAG A;  1A23 A;  2H73 A;  3L9U A;  3TKS C;  3IR4 A;  5LCZ A;  2H74 A;  2VO4 A;  2K8V A;  3FHK A;  2O8V B;  4PGT A;  1GTU A;  1SJ6 A;  4YQM A;  1JLV A;  1OAZ A;  1AIU A;  4MA9 A;  1K3L A;  3DXB A;  5ECI B;  2VL2 A;  2V32 A;  3EYT A;  4BWQ A;  2FNO A;  2R0G A;  1M9B A;  1VF1 A;  3R2Q A;  3P2A A;  2P5Q A;  4HDE A;  3LXT A;  5D8I A;  3BCK A;  2NBS A;  1BQ7 A;  2L57 A;  1ZL9 A;  4DVC A;  2HRK A;  3MAK A;  1GUM A;  1AUC A;  2AAW A;  3ME8 A;  4NHW A;  4V1A p;  4K7N A;  4PTS A;  5IO2 A;  2YWI A;  1V98 A;  4AJ7 A;  3QR6 A;  3M9J A;  3LWA A;  4IHU A;  5H5S A;  3GKK A;  3O6T A;  4RQR A;  3F4R A;  4HJ2 A;  2V1M A;  1RW1 A;  3CTG A;  4TR0 A;  1F3B A;  4I2U A;  4WF5 A;  1ERU A;  4JR6 A;  2X8G A;  4POL A;  2HXK A;  2A2P A;  3HKR A;  4TXO A;  2HZE A;  1FW1 A;  3F6F A;  4LMV A;  4BVY B;  5E4W A;  5A4U A;  2QGV A;  3C7M A;  4OWY A;  4FH8 A;  2OJL A;  3EU4 A;  1KTE A;  2ZNM A;  3U5R E;  4ZL9 A;  2VCT A;  1PD2 1;  4RI7 A;  5ECL B;  3C1S A;  1VRS D;  3F6D A;  4LL4 B;  1G6W A;  1GTA A;  2FWH A;  1SKW B;  1Z7R A;  2R0C A;  4O7H A;  3LG6 A;  4KF9 A;  1J08 A;  3VFI A;  1MDK A;  3L0H A;  4MH3 A;  1MTC A;  4TR1 B;  3MNG A;  4IEL A;  2JU5 A;  4QL7 A;  3F3Q A;  3EMX A;  2HRN A;  3D6I A;  2VIM A;  1M9A A;  3GSS A;  1K3Y A;  5G30 A;  2DLX A;  2M46 A;  1NHY A;  5A4V A;  4I8B A;  2TRC P;  2YPM A;  2DJK A;  1AC1 A;  3ZML A;  3DIE A;  2CZ3 A;  1T00 A;  2WB9 A;  19GS A;  4JED A;  1ERV A;  3GKM A;  1K0B A;  2WCI A;  1NHO A;  1PA3 A;  3M3M A;  1VF2 A;  2GSQ A;  2MMA A;  4ICY A;  1GUK A;  2VUP A;  1URM A;  1O8X A;  1EGR A;  4LL1 B;  5DJL A;  5FHI A;  3HY2 A;  4WET A;  5ECH B;  1O73 A;  4HU9 A;  4YKF A;  4HS1 A;  2FLS A;  4HQS A;  2LRT A;  1O85 A;  3KXO A;  2E0Q A;  3KP9 A;  1JHB A;  2IL3 A;  2PER A;  1K0A A;  5HR1 A;  4F82 A;  4XS1 A;  4TR4 A;  3UMA A;  5ABR A;  2CT6 A;  5ELG A;  4POM A;  1EOG A;  1PQN A;  1GSE A;  1IYH A;  2OKA A;  3KH9 A;  1K0D A;  4KSM A;  1U87 A;  1GP1 A;  3EVI A;  2A2S A;  5L71 A;  2L59 A;  3ZTL A;  4Z2T A;  2JZR A;  4NMU A;  2RII A;  5JWQ B;  4ECI A;  2MMN A;  2RLI A;  1HNB A;  1FO5 A;  4ECJ A;  1B8X A;  1WP0 A;  4OO5 A;  3E0U A;  3P7X A;  3VI5 A;  4EC0 A;  1DBY A;  2MMO A;  3WGE A;  2IJY A;  1FB6 A;  1K0C A;  2R3X A;  2CX4 A;  2V41 A;  2OBI A;  1SK0 A;  2V2G A;  1XW6 A;  5CRG A;  4BPY A;  1AW9 A;  2A4H A;  3J7Y k;  4TW5 A;  2HLS A;  5EVO A;  2NVL A;  4HJM A;  4MZB A;  1U6T A;  1A24 A;  4ZBB A;  1O7U A;  5CRW A;  3E3E A;  3C71 A;  3ZFB A;  4GTU A;  2YJH A;  1WIK A;  1F3A A;  4Q5Q A;  5DJM A;  1ERW A;  3OR5 A;  1T3B A;  3LFL A;  4MZW A;  4NV5 A;  5EL8 A;  22GS A;  3WT2 A;  5ECP B;  3GUR A;  4L0U A;  1NSW A;  4V1A g;  4MK3 A;  2V6K A;  3DD3 A;  4BVY A;  1OC3 A;  2OE0 A;  5ECM B;  5KN1 A;  12GS A;  3CRT A;  1DE2 A;  1HQO A;  2OAD A;  2YWO A;  2WS2 A;  4G9H A;  1DSB A;  5H5R A;  2PGT A;  3DWV A;  4KAE A;  3VI7 A;  1H4O A;  1B4P A;  1W4V A;  3CMI A;  2C0E A;  4KE3 A;  1Z9H A;  5HR2 A;  1XOA A;  4KCA A;  1XOB A;  3FR3 A;  4K5S A;  4YKG A;  5CRD A;  1DUG A;  4KA0 A;  3ZRD A;  2GTU A;  2IN3 A;  4Z2R A;  3HZ8 A;  2MBS A;  1ILO A;  1K0M A;  1E2Y A;  2F3M A;  1GLP A;  4XCS A;  6GSS A;  4FYC A;  4E8E A;  10GS A;  4KSO A;  5JWR B;  1V58 A;  2MBT A;  4MNN A;  1R5A A;  3GKN A;  4F03 A;  1XBS A;  2B5Y A;  3V1W A;  1SYR A;  2QSI A;  4JZQ A;  4MJB A;  4Z7X A;  4ECC A;  3IOS A;  2L6D A;  2VCV A;  2VOC A;  5G1K A;  1X9S B;  3ZVJ D;  2VD0 A;  2YWM A;  3WGX A;  4X4J A;  1TKD B;  4L5L A;  4K2D A;  4PUF C;  2VL9 A;  1EGO A;  4I97 A;  2HZE B;  2H0G A;  4N0Z A;  1SEN A;  1RK4 A;  1Z6N A;  4K0G A;  2XBQ A;  1AQW A;  3VWV A;  2CX3 A;  4O32 A;  4AGS A;  4BA7 A;  2REM A;  3N5O A;  1H75 A;  3BBY A;  1R5P A;  1AQV A;  2OAC A;  3UL3 A;  1GSF A;  3G7J A;  1TK5 B;  2VLT A;  4BVX B;  2CVD A;  1LU4 A;  1K0O A;  1KEB A;  3US3 A;  3L9V A;  5GZZ B;  1PRX A;  2O85 A;  2PVQ A;  4N30 A;  3APQ A;  3GNJ A;  6GSV A;  1MDJ A;  2A4V A;  2IFQ A;  3CSJ A;  2DC5 A;  1ZYP A;  3K8N A;  4ID0 A;  3FMW A;  3HYP A;  3HD5 A;  4DSQ A;  4X0X A;  3ZRE A;  2K8S A;  1TP9 A;  1XXU A;  2N5A A;  4OCE A;  1PL1 A;  3TKP A;  1U88 A;  4G0L A;  2A2R A;  2PU9 C;  2EC4 A;  1B9X C;  5CRE A;  3HZ4 A;  4EF0 A;  1K0N A;  1SKR B;  1V9W A;  3BOA A;  3EPT A;  4PUA A;  2KLX A;  2R37 A;  4KW6 A;  4N11 A;  2GDR A;  2B1K A;  1QMV A;  4KND A;  2XHF A;  2C0F A;  3GX0 A;  5AIX A;  3EE2 A;  2C0G A;  6GST A;  2YV7 A;  3IE3 A;  3ZYW A;  5JCG A;  5GSS A;  4MDC A;  2B1L A;  1SJI A;  3TRX A;  2HRF A;  5LD0 A;  4MAB A;  3D4T A;  4EL1 A;  4KB3 A;  3D21 A;  5DDL A;  4Q5R A;  4WBJ A;  4JR4 A;  2LJR A;  1Y25 A;  1WPI A;  1PSQ A;  8GSS A;  3DML A;  2WGR A;  2AYT A;  3ZMK A;  2I1U A;  3UVH A;  1GNW A;  2H30 A;  1GLQ A;  3FZ5 A;  20GS A;  3LXZ A;  3I43 A;  1FOV A;  2YNX A;  4JE1 A;  2OBK A;  4MF6 A;  3EWL A;  3L78 A;  1F2E A;  2QA2 A;  1WOU A;  3M0F A;  4MH2 A;  1ERT A;  1THO A;  1PL2 A;  1SK2 A;  5B8B A;  5ID2 A;  5J9C A;  4RQX A;  1V57 A;  1FAA A;  4DSR A;  2GZP A;  4FYB A;  2H1D A;  2LS5 A;  3HVX A;  4GST A;  3G9B A;  2DJ1 A;  2LJK A;  4ZBD A;  2KP1 A;  3MIX A;  4TR3 A;  3QFB C;  4IJ3 A;  1S3A A;  2V6O A;  5IIZ A;  3DYR A;  11GS A;  1TRS A;  3FR9 A;  3EU3 A;  3RDW A;  4USS A;  1G0T A;  3GL3 A;  2BTO T;  1ZMA A;  3GUS A;  4QQ7 A;  2JZT A;  3FZ9 A;  1SL2 B;  2YOI A;  1XW9 A;  2F51 A;  2J9H A;  3GH6 A;  2F8A A;  1PX6 A;  1JZR A;  1SYX A;  2HE3 A;  3CTF A;  2H6Y A;  1G6Y A;  2VD1 A;  3H8Q A;  5ECK B;  4QL9 A;  4HI7 A;  3TRP A;  2IMD A;  4KUN A;  1WE0 A;  2JZS A;  4A5P A;  2LQQ A;  1EWX A;  1TI1 A;  1EP8 A;  5INY A;  3VWW A;  4EVM A;  2F8F A;  2X4A A;  3P90 A;  3TKS E;  4ZB9 A;  2AHE A;  4BVX A;  2RM6 A;  3IA1 A;  3HJM A;  5FWG A;  4EDZ A;  4X1U A;  2H19 A;  3QCP A;  5IM9 A;  1GH2 A;  4YAV A;  2RM5 A;  2H76 A;  2L4C A;  2H1A A;  5IOW A;  4OD7 A;  4EDY A;  4MPF A;  4J56 E;  4GSS A;  6GSX A;  4G0I A;  3LEF A;  2ES7 A;  3F0I A;  3MWH A;  3QD9 A;  3RHC A;  2GQK A;  5F0G A;  4ILF A;  3TGZ A;  4PQI A;  1BYE A;  4I6X A;  3GV1 A;  5D9X A;  2GLR A;  2VCW A;  5KOW A;  4K7O A;  1B9Y C;  5DAL B;  2CAI A;  2HNL A;  3IV4 A;  2L5O A;  3TJB A;  5LNK e;  1Z7P A;  4MP4 A;  3G7Y A;  3TKS A;  3M8N A;  2JL4 A;  2B5X A;  3IC4 A;  5DAK A;  1O6J A;  2FA4 A;  4PQH A;  2PUK C;  3KTL A;  3WGD A;  4D73 B;  3D0Z A;  4XRD A;  4HEA 2;  1TXX A;  1ZZY A;  2LJA A;  1N2A A;  3PH9 A;  4POK A;  5IMD A;  3UAP A;  2HSM A;  1YF1 A;  3D22 A;  4F2I A;  3QAV A;  5IOX A;  3WYW A;  5D9W A;  3R3E A;  4AJ6 A;  1FHE A;  5GAP D;  2CQ9 A;  4Z2U A;  1PGT A;  9GSS A;  1ZOF A;  5GAN D;  6GSU A;  3EMP A;  5KN0 A;  2TRX A;  3ZIT A;  2PPT A;  5G5E A;  1S3D A;  2PBJ A;  4N10 A;  5ECQ B;  2CAQ A;  1R7H A;  3IDV A;  1TTZ A;  2NDO A;  2H6X A;  2TIR A;  4K6X A;  1QK8 A;  1E6B A;  2BMX A;  2P31 A;  2IFQ B;  3BJ5 A;  5HR0 A;  5HR3 A;  4AF2 A;  3UAR A;  1BAY A;  1X5E A;  3VPT A;  1CQG A;  1PX7 A;  2HSY A;  1XVW A;  1B48 A;  1XWK A;  1THX A;  2DIY A;  1XVQ A;  2HFD A;  4HQZ A;  4OFM A;  1YEX A;  3UBL A;  4EIQ A;  5HFK A;  4DSS A;  4MJC A;  1XFL A;  1XCC A;  4Q5F A;  4HOJ A;  3VWU A;  2E2G A;  4I2T A;  2LST A;  3EC3 A;  3P8W A;  14GS A;  3RBT A;  4K2X A;  1X9W B;  1F9M A;  1UA5 A;  5ENU A;  5G2Z A;  3KEB A;  3RHB A;  1TJD A;  3KJY A;  1Z6M A;  2K9F A;  3H93 A;  3FY7 A;  4XHM A;  3KM6 A;  2LV3 A;  3ZFL A;  5IO0 A;  4OFT A;  5ECR B;  5IMZ A;  1SU9 A;  1XIY A;  3CXG A;  2LQO A;  2VM2 A;  1YKC A;  5J4U A;  2MYG A;  4EKZ A;  4PNG A;  3TOU A;  1A2M A;  1T4Z A;  2AJQ B;  2PN8 A;  3N9J A;  3IAM 2;  7GSS A;  3TJF A;  2GS3 A;  5EPF A;  2B7K A;  4FIW A;  2HZF A;  2FUG 2;  1S3C A;  3F4S A;  5D73 A;  4LA1 A;  3PGT A;  1GSS A;  1T4Y A;  2ZUP A;  4OFN A;  2O7K A;  2MZC A;  1BED A;  1ZYE A;  2EIQ A;  1F37 A;  3GRX A;  2VLU A;  1OVN A;  2GSR A;  1JZW A;  1A0R P;  3ERW A;  3HDC A;  3IC8 A;  4MMM A;  2C0D A;  3GIX A;  1SD9 A;  3GX8 A;  1FG4 A;  4CDO A;  2WUL A;  2H0I A;  3F9U A;  4JU5 A;  1X9M B;  3M9K A;  4FYU A;  2GQM A;  2CZ2 A;  2K18 A;  4XIH A;  2CVB A;  5ID2 B;  5IMA A;  3CBU A;  3FYG A;  3SWL A;  2Z9S A;  3KMN A;  3O3T A;  1SD8 A;  5IPG A;  2G2Q A;  5CO3 A;  1X5D A;  4PX1 A;  2R2J A;  3IBH A;  5JWO B;  3ZLP A;  17GS A;  5D9V A;  3Q74 A;  1UVZ A;  1HYU A;  3I9V 2;  2N5B A;  5DAL A;  2P0G A;  5CNW A;  4ISD A;  4YQU A;  1M7T A;  1GSD A;  3UEM A;  2C1Y A;  3TCO A;  4EUY A;  3H79 A;  4D73 A;  5ELA A;  2X8H A;  3QFA C;  3BCI A;  4CW9 A;  1NW2 A;  2C4J A;  1VGL A;  2L6C A;  4IN0 A;  4TXV A;  1ML6 A;  4NV2 A;  2YN1 A;  3IHG A;  3DVW A;  2B5E A;  3VWX A;  4MF7 A;  4XRA A;  4ACS A;  3MSZ A;  4F0C A;  3L9S A;  1V2A A;  1U3A A;  1W89 A;  5H5Q A;  5AGY A;  1OYJ A;  3APS A;  1QQ2 A;  2IME A;  3DGQ A;  3GFK A;  4PQ1 A;  4GQC A;  4IVF A;  3S9F A;  2H1B A;  3O76 A;  2DML A;  2D2Z A;  1HNA A;  4KGI A;  1BJX A;  4TRX A;  4F9Z A;  3GTU B;  3PPU A;  3U6V A;  4OCF A;  1GUL A;  2X99 A;  2DBC A;  2DJ2 A;  5JCU A;  1GTB A;  3KCM A;  4IS0 A;  4YH2 A;  3A3T A;  1AXD A;  4BWS A;  2DSA A;  3UIW A;  2FCH A;  1SJZ A;  2FD3 A;  1KBN A;  2MMZ A;  3ED3 A;  4IP6 A;  2O89 A;  2GZZ A;  5J41 A;  3D4M A;  3UVT A;  4IJI A;  4YQV A;  3A5I A;  3E9J B;  4ULX A;  3GH9 A;  1GSU A;  3KH7 A;  2DJ0 A;  2DIZ A;  3FZ4 A;  4MPG A;  1O81 A;  1OKT A;  2E2M A;  4K5R A;  5DQY A;  3F8U A;  5A5K A;  5IMV A;  5G5F A;  1T8E B;  1C72 A;  5C04 A;  1KNG A;  4ML6 A;  3TKR A;  5DAK B;  4MZC A;  3GHA A;  2X49 A;  3IRA A;  2DJJ A;  1MEK A;  5F06 A;  3CYN A;  3UJ1 A;  3KD0 A;  1PN0 A;  2YWN A;  1GWC A;  3BD2 A;  2JSY A;  3RPN A;  4RI6 A;  3NIV A;  2LEG A;  2OA7 A;  1SKS B;  3HXS A;  2XC2 A;  2QC7 A;  1YKA A;  1EEJ A;  3TDG A;  2C3T A;  1XWC A;  1TDI A;  2R6K A;  3FR6 A;  1TU8 A;  5DQS A;  4TVE A;  4GSN A;  2LNS A;  1OE8 A;  1GUH A;  2H1G A;  2FY6 A;  2VM1 A;  1YY7 A;  2N5F A;  18GS A;  1LBK A;  2PMT A;  5D93 A;  1TW9 A;  2C80 A;  4KH7 A;  2WFC A;  2H70 A;  3DVX A;  4KDX A;  4GRF A;  3NOF A;  3CSH A;  2AUV A;  3UOM A;  5CYY A;  4HZ4 A;  4AJ8 A;  3HVS A;  4WR4 A;  3UBK A;  4FO5 A;  4ZB6 A;  5G31 A;  1Q98 A;  4O5U A;  2IMF A;  2C3Q A;  3F63 A;  3TB2 A;  4OO4 A;  3ZZX A;  3ERG A;  4X43 A;  2LNT A;  1X0R A;  5FT3 A;  3WT1 A;  2IWT A;  4WR5 A;  4G19 A;  4NPB A;  3RPP A;  6GSY A;  4IQ1 A;  3J7Y b;  4I5Q A;  4TKY A;  3CSI A;  4DSS B;  4EO3 A;  5F8B A;  1K3O A;  1OC9 A;  1UC7 A;  2NTO A;  3WD6 A;  1EV4 A;  4XTS A;  2ZCT A;  2HYX A;  1HD2 A;  2H75 A;  4O5R A;  2QA1 A;  2R0P A;  4CY8 A;  1XWB A;  1LJR A;  3Q6O A;  1M99 A;  1ON4 A;  4PUR A;  5C00 A;  5B8A A;  4ZIL A;  3KZQ A;  3HCZ A;  4IP1 A;  3PR8 A;  2FWF A;  1XZO A;  1GL8 A;  2GSS A;  4NHZ A;  2CV4 A;  1B4Q A;  1WJK A;  3DKS A;  4ZL8 A;  2J23 A;  3HVV A;  2YZU A;  3LJR A;  1ABA A;  1N8J A;  2HRA A;  4ZL7 A;  1OKD A;  3IXR A;  2GZY A;  4IKH A;  1U3I A;  1M2D A;  1IYI A;  1T1V A;  2WJU A;  1GTI A;  3ERF A;  4EIP A;  4ZBA A;  5J9B A;  3GST A;  3MDK A;  2GQL A;  4ZIJ A;  3ISO A;  4E8H A;  2LRN A;  5KN2 A;  2YAN A;  5CAX A;  3H1N A;  4L8E A;  1TRV A;  5IQY A;  1I9D A;  3A2V A;  3GTU A;  3Q19 A;  1V40 A;  2C8U A;  13GS A;  2H8L A;  4G0K A;  2FWG A;  1PMT A;  3QAW A;  1EEM A;  2I81 A;  2VLV A;  3CRU A;  2GGT A;  1QGV A;  3I69 A;  3EIN A;  3IHQ A;  4WEY A;  4TOP A;  2WDU A;  2ON7 A;  2LKU A;  4L0W A;  1SK1 A;  3GL5 A;  3KMO A;  2HT9 A;  2QKE A;  4HU7 A;  2GVP A;  1JZD A;  4DEJ A;  3PIN A;  2EIR A;  3A5W A;  4G2E A;  1A8Y A;  1GSQ A;  1I5G A;  2KUC A;  5J3R A;  2OE1 A;  4POB A;  5DBQ A;  1ZYN A;  1A0F A;  3FRC A;  2HI7 A;  1F6M C;  1PKZ A;  2KHP A;  5F07 A;  1FB0 A;  4WKW A;  1HNC A;  2M80 A;  2X8C A;  5HQP A;  2JSZ A;  2HSH A;  3HA9 A;  3VLN A;  1A2J A;  5D9T A;  2LRC A;  2JAC A;  3GMF A;  2XPD A;  5E59 A;  3D5J A;  3DRN A;  1EZK A;  1A2L A;  5B7C A;  3EUR A;  4WBR D;  2UZ8 A;  3APO A;  5J5N A;  4ZXG A;  2K6V A;  5DCG A;  1DE1 A;  4MJE A;  2LUS A;  1PKW A;  4GXZ A;  1YDK A;  3W8S A;  5AN1 A;  4WF4 A;  3TRQ A;  3TUE A;  2WRT A;  4XS4 B;  2JAD A;  1GSY A;  4BL7 B;  4GLT A;  2IIY A;  3ZIV A;  2I4A A;  1QXH A;  5F05 A;  2C3N A;  3GA4 A;  4PXO A;  5JCW A;  3G7I A;  3KIJ A;  2H01 A;  1M2A A;  2IPA A;  2VL3 A;  3LYK A;  2AB6 A;  1YZX A;  4ECB A;  2H66 A;  3KTB A;  4GF0 A;  4LLR A;  4NXI A;  1RQM A;  1JLW A;  3A2W A;  3VK9 A;  3MYD A;  1YEP A;  2DKI A;  4EXJ A;  4V2L A;  5HFI A;  4K9Z A;  3DEX A;  1R26 A;  1OE7 A;  1AQX A;  5CRH A;  4N0V A;  4ZB8 A;  1OC8 A;  3C8E A;  5IMC A;  4IBP A;  4RUV A;  1WRY A;  4V2M A;  2ALB A;  2H6Z A;  2H72 A;  2E7P A;  1TU7 A;  2EIO A;  1ZGN A;  2KP2 A;  3C1R A;  1XWA A;  5B6M A;  3TJK A;  4MLY A;  4YAP A;  4HUA A;  4IGJ A;  3VUR A;  3TJJ A;  1Z3E A;  2XPE A;  1QFN A;  2GST A;  2WZ9 A;  1MD4 A;  1GRX A;  4GQF A;  1CQH A;  1TK8 B;  4OMV A;  1TRU A;  2FWE A;  2RUF A;  1O8W A;  2B7J A;  3ZVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...