4OO5A

Crystal structure of s-nitrosated human thioredoxin mutant
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
105
structure length
104
Chain Sequence
b'MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDQDVASESEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Crystal Structure of a Thioredoxin Mutant Displays a Dynamic N-terminal Loop Surrounding an S-nitrosation Site
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 39
structure length 104
sequence length 105
ec nomenclature
pdb deposition date 2014-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4oo5A00
4Q5NA 3SBCA 2IJYA 3M9JA 4IQ1A 5IMDA 3FW2A 2VCWA 3VPTA 1QFNA 4JBBA 3N5OA 2YPMA 5F07A 3NOFA 5AIVA 5HR2A 1R26A 5JCGA 1AC1A 2ALBA 1T3BA 2H6XA 3QDNA 2VCVA 4OO4A 2L6DA 2V6KA 4I97A 3ZIJA 2R5GA 4NV2A 1M7TA 2CA8A 4ACSA 3TKSA 5KN1A 4I5QA 4KDYA 4JEDA 4OCEA 3IV4A 1TI1A 4HUAA 2D2ZA 2ON5A 3DIEA 3G7IA 1HYUA 4G2EA 2H1AA 2C0EA 4PQHA 2L59A 3CYNA 2LKUA 3UEMA 4IP6A 2VL3A 2C4JA 5EL8A 1OE8A 2LV3A 3HD5A 2VCZA 4N0ZA 3WYWA 2LRCA 1TRSA 3QR6A 5DQSA 2A2RA 1Z3EA 1QMVA 3RBTA 1EV9A 4MP4A 1X5DA 4IELA 4KW6A 4ID0A 4IW9A 2MMNA 1I5GA 3QAVA 3KTBA 1J08A 3CTGA 3HVVA 3F0IA 3RPPA 2DIZA 4XRAA 5IMZA 1TRWA 1QGVA 2VUPA 3IRAA 2G2QA 4G10A 2H19A 2VD1A 3VWXA 3HZ4A 4WF5A 4HJ2A 5ECIB 4GSTA 1S3DA 2C3TA 1OYJA 4N10A 1VGLA 2NVLA 1JLWA 3E3EA 4V1Ag 1BEDA 1MDIA 1K0AA 2L6CA 1SYRA 6GSWA 3QAWA 2LSTA 4EO3A 1AQVA 2CAIA 4XS1A 3IK9A 1TI3A 2GT5A 2M72A 3TRXA 3F9UA 2WJUA 1A2JA 1URMA 2B3SA 4J57E 5IO2A 4FYBA 3S9FA 3ISOA 1NHYA 2LS5A 1X9SB 2CX3A 2I4AA 1SJZA 2ZNMA 4TR1A 4POKA 5JWOB 1WWJA 2XBIA 1WRYA 3KEBA 3M0FA 4POLA 1G6WA 3CSHA 1VF3A 3L0HA 1AXDA 2H75A 3D4MA 1A0RP 1OAZA 5J41A 3GURA 3Q74A 1GUMA 4O5RA 2IN3A 4DSSA 1O85A 1ZCPA 1G7OA 4AJ6A 1WMJA 3P2AA 4IP1A 1YKCA 3DRNA 1SKSB 2REMA 4MJEA 2PU9C 1JFUA 4MF7A 1B9YC 3F6FA 5CRWA 5COHA 2CZ2A 3F3RA 13GSA 5LNKe 1N2AA 1XCCA 4JR4A 1TP9A 5ELAA 3TJKA 5HFKA 1GNWA 2VO4A 5IMVA 5DQYA 4XTSA 5KN3A 3IC4A 2HT9A 1Z7PA 4Z7XA 9GSSA 3HHVA 1A0FA 2GS3A 4K0GA 1G6YA 2ZUPA 3GSSA 4MZWA 3O3TA 5L71A 3SWLA 1V9WA 2P5RA 4GXZA 2CX4A 3LG6A 3O6TA 1BX9A 1TW9A 4ZBBA 2H30A 4L0UA 1O6JA 3FK8A 5CO3A 4XCSA 4EXJA 4BVYA 1M9BA 1XFLA 4Q5FA 1XVQA 3APQA 4N11A 2RM6A 5JWRB 6GSSA 1BQ7A 4HQSA 2O89A 1SL0B 3ZMKA 2YV7A 3FR6A 3D6IA 3DVWA 3UAPA 2VIMA 2J23A 2VCTA 1QQ2A 5HFGA 5D93A 4KE3A 4TRXA 2H71A 1EOHA 4JRRA 1SK0A 2E2GA 4PURA 2VL9A 4XS4B 3TKRA 3RAZA 4KB3A 5DDLA 3BD2A 4F0BA 5IIZA 3L9SA 2WDUA 3FY7A 1YF0A 2GVPA 5IMAA 2IFQB 1EP7A 2O87A 3VWUA 2VCQA 4WR5A 2L5OA 4KUNA 1UN2A 3ZZXA 1FOVA 4HEA2 1U88A 2V6OA 2Z9SA 2K8SA 3GUSA 4XIHA 5F0GA 5IPHA 1SKWB 1GP1A 2FWGA 3C73A 2WFCA 1T00A 1F37A 3NZNA 5CP1A 1ST9A 3HYPA 3TJFA 1OC3A 5A4UA 2H6ZA 3EWLA 1V98A 1DBYA 1IYIA 1GLQA 4PQIA 3GKKA 1ERUA 4DSRA 4BWSA 3H79A 4YH2A 3KCMA 3G9BA 3MSZA 3DXBA 4FO5A 1JZWA 3GMFA 3H1NA 4GTUA 2VLTA 3KH9A 3W8JA 4J2FA 1ZGNA 1EEMA 1Z5YE 2FNOA 3TDGA 2HZEB 1J9BA 3P7XA 1R5AA 1XZOA 4GQCA 4K0NA 1M9AA 4NWYA 4TR4A 2YWOA 3ZL5A 5DAKA 2N5BA 3LGCA 4TVEA 3APSA 1YQ1A 4HJMA 1E6BA 5DCHA 2CT6A 3ZFLA 3ERGA 3GA4A 5FHIA 1XVWA 5A4WA 3IAM2 4AJ7A 4K6XA 2LRTA 1FB6A 2DLXA 2R4VA 3BBYA 1XXUA 2N5AA 5FWGA 4OFMA 3FYGA 3A5WA 1TRUA 3DGQA 2V2GA 4EE0A 5ECRB 2C0FA 4DSQA 2H8LA 3FR9A 1ZZYA 2A4VA 1PL1A 3IBHA 2FUG2 2FA4A 5F06A 5DALB 1JZRA 2PMTA 3GSTA 1PX7A 3UBKA 3QFBC 2EIQA 1R7HA 2GSQA 1HNCA 2IL3A 5CRDA 6GSVA 1GTBA 1XOAA 3GL5A 2FWEA 3MAKA 4GQFA 3TGZA 5ECMB 3TUEA 3TKSE 1W4VA 2E0QA 1ZYEA 1TK0B 2B1LA 2WGRA 2AV4A 4ZL7A 1O8XA 4ZIJA 3P90A 1XWGA 1AQWA 4TKYA 3D4TA 2YWMA 4PXOA 2JZRA 1SK1A 2ES7A 19GSA 5ID2A 1O81A 1THOA 2LRNA 2DJ3A 2DSAA 3L9UA 4K1FA 1KTEA 1CQGA 3KMOA 3I9V2 2PUKC 20GSA 3WGDA 4XS6A 4H86A 5ABRA 2LJRA 5KEJA 1A2MA 2C3QA 4K7NA 2BTOT 3EMPA 1BG5A 4OD7A 2I81A 1F9MA 2OA7A 1C72A 3ZMLA 6GSYA 3VLNA 4N0VA 4OWYA 4WBJA 3DMLA 2LNTA 1U6TA 1R4WA 2PVOC 1K0DA 4IGJA 1SD8A 4MDCA 2OE1A 3FZ9A 1Y25A 4MLYA 2DJ1A 3KZQA 4MH2A 2DJJA 2AAWA 2K18A 4AF2A 3W8SA 4WKWA 3TRQA 3UVTA 2R3XA 2KP1A 1QXHA 1ZL9A 4L8EA 2FLSA 2IPAA 1SL1B 2P0GA 2YWNA 1G7EA 4MMMA 3GYKA 3D0ZA 5HFIA 1OE7A 5CRGA 2HI7A 3CXGA 2HSHA 3TJJA 2FD3A 4IQAA 4F2IA 4DVCA 2GQMA 2ON7A 2H0GA 1PN9A 1WJKA 1RK4A 3EURA 3OR5A 2H66A 3HCZA 3C8EA 3D22A 4FYUA 3I6AA 1THXA 2HLSA 5DJMA 3EU3A 4KAEA 4EKZA 5ECOB 4IN0A 2LUSA 1K0OA 1ZMAA 1YJ6A 1TU8A 2KUCA 5C00A 4K7IA 1YF1A 5D73A 5CNWA 3LYPA 2VCXA 4PNGA 2WB9A 4BA7A 3GX0A 2LJAA 3NIVA 4BPYA 3GKNA 3EU4A 1RW1A 4IJ3A 2PGTA 4LA1A 2EIRA 2XPEA 4NPBA 1N8JA 1V58A 4PQ1A 3UIWA 2TRXA 2I3YA 1A8LA 4WETA 2YWIA 4Q5QA 4NXIA 1GSQA 4PX1A 1ERTA 5IMFA 4LL1B 2I9HA 4G19A 3KP9A 2WRTA 4JR6A 4HS1A 1LU4A 5J3RA 4CHSA 2OE0A 3GIXA 1SD9A 4KDXA 3AY8A 3VI5A 2TIRA 3RHCA 1K3YA 2PWJA 1XW9A 3HA9A 3G7YA 4KGIA 3ERWA 4OFTA 4YQMA 3U6VA 1KEBA 4EL1A 1SJIA 2OJLA 1MDJA 3EVIA 2F9SA 5GAND 1KNGA 2N5FA 1Y6EA 4ECCA 2H74A 3HVSA 2YV9A 1F6MC 2DMLA 10GSA 4MF5A 5H5SA 1SYXA 3UARA 2FGXA 4FIWA 4NMUA 1V40A 4HZ2A 2HNLA 2GSTA 1ILOA 2JSZA 3A3TA 3KXOA 4RI7A 3WT1A 2IMKA 4RI6A 3GTUB 4MH3A 1OC9B 3DKSA 3UMAA 2B7JA 2FY6A 5IOWA 1K0CA 4D73B 3QMXA 4MJBA 3HJOA 1TK8B 3V1WA 3LFLA 6GSUA 1GNEA 2JU5A 4I8BA 2JL4A 2VL2A 3E0UA 2CAQA 2DJ0A 4V1Ap 2MMAA 3GV1A 3CBUA 3U5RE 5JWQB 1XW6A 2KHPA 2K8VA 1GTIA 5AIXA 2E2MA 4J56E 3BJ5A 2C0GA 3DEXA 5KN2A 2MBSA 3FZAA 3C7MA 1WP0A 1ERWA 12GSA 3ZLPA 3BCIA 2H0IA 1VF4A 1GTAA 2IWTA 5D9XA 3TJGA 3FKFA 1B8XA 1Z6MA 4BL7A 3M3MA 4AGSA 1GTUA 2F51A 1OVNA 4ISDA 2HZFA 3HDCA 2NTOA 3GN3A 1LBKA 1NSWA 2P5QA 4L5OA 3HJMA 1SENA 3GRXA 5G5FA 4YAVA 3UL3A 1UA5A 1EWXA 3TB2A 1GULA 1GL8A 1Q4JA 5A4VA 4ZBAA 2ZCTA 5GAPD 5G31A 2H1BA 1HNBA 1GSYA 1SJ6A 1BAYA 4KH7A 3IK7A 3HZ8A 5J9CA 1JZDA 4EDYA 5DCGA 14GSA 2DMMA 5HQPA 2GGTA 3GX8A 2G0FA 1AIUA 2H01A 3LSZA 2H70A 1MD4A 4HQZA 5IO0A 3M9KA 3IOSA 4ZB8A 4WEYA 2LEGA 2OBKA 4LL4B 3FR3A 4MA9A 5D9VA 1XWKA 5CYYA 4HU7A 3PINA 4MABA 1O73A 4YQUA 4EVMA 2F3MA 3M8NA 5F8BA 8GSSA 1CQHA 2RUEA 5ECNB 2PVQA 4QL7A 1K0BA 2V32A 3DWVA 1K3OA 3WD6A 3IA1A 5DVBA 1FG4A 3O76A 2IMEA 3ZTLA 1MTCA 2V1MA 4LMVA 3UBLA 1YEPA 4V2MA 4TXOB 2B5EA 1T4ZA 3A2WA 5HR0A 2MYGA 5G2ZA 5F05A 4K2DA 5B8BA 1QK8A 3VPQA 2GSRA 1GSDA 1RQMA 1FVKA 3Q18A 4K9ZA 4YAPA 18GSA 5D9WA 2F8AA 2O8VB 1TOFA 2JZTA 5G1KA 1XPVA 1AAZA 3GL3A 1B4QA 2WCIA 2H1DA 4GRFA 1MDKA 2BMXA 5D9TA 1SKRB 2X99A 1ACVA 1S3AA 2H6YA 3QCPA 4OCFA 3P8WA 3HKRA 2YZUA 5B6NA 5E4WA 3TCOA 4I6XA 1GSFA 2FWFA 2IMFA 1TTZA 1HQOA 3PR8A 5GSSA 3KIJA 4XS4A 4ZILA 3H4KA 4FYCA 1LJRA 3L4NA 1T4YA 2GSSA 2JADA 3KMNA 2QSIA 1FVJA 2LNSA 1K0NA 4IJIA 2DBCA 2YJ7A 2IFQA 5GZZB 2E7PA 1A8YA 4KDUA 4ZB9A 5CAXA 4PNFA 2FHEA 4MZCA 11GSA 2GTUA 3L78A 1PL2A 1I9DA 4NHWA 1R5PA 1ON4A 3DVXA 3ME8A 3EC3A 4LLRA 2L4CA 1PRXA 2IIYA 2GZYA 4TXVA 3GKMA 4N30A 3ZRDA 4X0XA 2R6KA 3UVHA 1TKDB 3EYTA 3WGXA 5J4UA 2CVBA 5G30A 5B6MA 1PD21 3ZVJA 2GZZA 4IS0A 1T8EB 2J9HA 2CZ3A 4WXTA 5H5RA 3PGTA 4O7HA 22GSA 1O7UA 1X5EA 1FHEA 3HY2A 4GCIA 2YZHA 4O92A 4TOPA 2VLVA 1X0RA 2HZEA 2VL2C 3A2XA 1HD2A 3Q6OA 2RUFA 2OADA 2YP6A 4ZB6A 3F4RA 4G9HA 1USBA 2GZPA 1EP8A 3KGKA 4POMA 3QD9A 3VURA 4ECIA 4CDOA 2PBJA 5J9BA 1GRXA 1PMTA 3F4TA 3KM6A 6GSTA 4WR4A 2GT6A 3FZ5A 1GSSA 5CREA 4ML1A 1T7PB 2B7KA 3VK9A 3QPMA 2GLRA 1TDIA 5JCWA 4MF6A 3C1SA 5B8AA 5DALA 3LEFA 3A2VA 4WBRD 2K6VA 2KOKA 1EEJA 4TR0A 4NHZA 3LXZA 4FH8A 3US3A 3D5JA 3C71A 2DC5A 1Z9HA 3TKPA 2AB6A 4QL9A 3F3QA 4MJCA 2RIIA 2GDRA 1JZOA 4E8EA 1PGTA 1SK2A 3F6DA 5HR1A 3WT2A 4KA0A 1TJDA 3DD3A 3HJPA 3LQ7A 1Z7RA 1GSEA 2AJQB 2HSYA 5D8IA 1GH2A 1X5CA 1H4OA 3F8UA 5IOXA 2C1YA 3J7Yb 1VF2A 1X9MB 2RM5A 3UJ1A 1GSUA 3GH9A 1DSBA 2C8UA 4ILFA 2OE3A 3TOUA 1XBSA 2HYXA 1YKAA 5LD0A 4HU9A 4O32A 2VM1A 2KLXA 1T1VA 4TR1B 3GKXA 1PQNA 3GH6A 4OFNA 3VWWA 5FT3A 2H76A 2YJHA 5EVOA 4P3YB 2MZCA 3F63A 2YANA 2JACA 1XWCA 6GSXA 3QAGA 4OO5A 1FO5A 1EZKA 2XBQA 1U87A 4BVXA 4DSSB 2PPTA 2H0HA 1F3AA 3FRCA 5IM9A 4ZBDA 5INYA 4E8HA 2X8HA 2TRCP 3KJYA 3GHAA 1SL2B 1WOUA 1PSQA 1XWAA 3ZYWA 3UOMA 3LORA 1MD3A 3LJRA 1MEKA 5EY6A 4MJAA 4F03A 1K3LA 2IMIA 4YQVA 4KCAA 5JCUA 3BCKA 4JU5A 5EPFA 3RHBA 5J5NA 5E59A 5G1LA 1YZXA 3VI7A 3M1GA 1WE0A 2XC2A 3KH7A 4JZQA 1GWCA 5ECQB 5ENUA 3HXSA 2HE3A 1M2DA 2O85A 2C80A 2WS2A 4K7OA 1JHBA 1AUCA 4CW9A 2F8FA 4LMWA 1EGOA 3ERFA 5KN0A 1M99A 5AN1A 3RDWA 1XWBA 4ML6A 2DIYA 2R37A 5ECHB 1FW1A 3DYRA 1DE2A 3CSIA 3KD0A 5H5QA 2OKAA 3TJBA 3KP8A 2R2JA 4IHUA 3GNJA 3IHQA 2LTKA 2NBSA 5LCZA 2PN8A 1TK5B 1A2LA 4HZ4A 1PKZA 2XHFA 4DEJA 2YNXA 5A5KA 2GQKA 1F3BA 3IPZA 1GUHA 2DJKA 2FCHA 4HOJA 4V2LA 4Q5RA 4HDEA 3I69A 5B7CA 1WIKA 2IMDA 5AGYA 1YDKA 5HR3A 4AJ8A 1M0UA 2FWHA 3FEUA 3E9JB 4ZL9A 1GUKA 3N9JA 3CRUA 1YY7A 1XOBA 2JZSA 4TR3A 1TU7A 1PX6A 3GFKA 2PERA 1OKTA 2M46A 1XIYA 4V2NA 2X64A 7GSSA 2L5LA 3IAS2 1EV4A 3WGEA 1V57A 3QOUA 1DE1A 1IYHA 2OACA 4L0WA 2B6MA 1AQXA 2WZ9A 1UC7A 2H73A 2LQOA 2VLUA 1A24A 4GF0A 2I1UA 1B9XC 3Q19A 4IBPA 4IKHA 5GSTA 4TN8A 2QGVA 2P31A 2OBIA 3L9VA 4K8MA 4XHMA 4GWRA 3TKQA 2HRNA 2GQLA 3ME7A 1U3IA 3HVXA 3BOAA 3KTLA 4MPFA 4ULXA 2HFDA 2WULA 1NM3A 1X9WB 3IE3A 4HI7A 4MZBA 2NPBA 4POBA 2O7KA 2LJKA 5DAKB 3GTUA 5ELGA 3J7Yk 1OC9A 1H75A 3APOA 1AW9A 4GSNA 4D73A 2VD0A 2RLIA 3CTFA 1HNAA 3IR4A 4BWQA 1OKDA 3K8NA 1BYEA 1B4PA 1NHOA 5IMCA 2C0DA 3FHKA 5IPGA 1ABAA 4MPGA 3TKSC 4MCUA 1EGRA 3EE2A 1EOGA 1U3AA 2AYTA 4EF0A 4NAXA 2VOCA 2HXKA 4QQ7A 2B5YA 4KCEA 2MMZA 5ECSA 3VWVA 1WPIA 2DJ2A 1SU9A 1BJXA 4GSSA 4KSMA 2X8CA 2AHEA 1FB0A 1PKWA 3D21A 2CVKA 3W6GA 4EDZA 2VAFA 1A23A 4WF4A 2V41A 3EMXA 3FZ4A 4PGTA 4I2TA 4F0CA 4F9ZA 4IVFA 4RQXA 3EINA 5C04A 5G5EA 1NW2A 4ECBA 5ID2B 3ZVJD 4KNDA 3ZIVA 2A2SA 5ECKB 3I43A 1OC8A 4XRDA 2QC7A 2X8GA 1M2AA 4L5LA 3G7JA 1TRVA 2CVDA 1Z6NA 3F4SA 3H93A 1ML6A 2AUVA 5DBQA 1B48A 1GLPA 3ZITA 2MBTA 5CRHA 1ERVA 4PUAA 1XW5A 3IDVA 1O8WA 4I2UA 4NV5A 2L57A 5ECLB 1J0FA 3ZFBA 1KBNA 2YOIA 3JCML 4ECJA 1UVZA 2EC4A 4X43A 4ZXGA 3CSJA 1ZOFA 2EIOA 3ZREA 17GSA 2K9FA 2JSYA 4ZL8A 1M2BA 4TXOA 4F82A 1F2EA 2YN1A 4PUFC 1G0TA 5ECPB 5IQYA 1FAAA 2QKEA 1PA3A 2M80A 2B5XA 3LWAA 3PH9A 2BJXA 3R2QA 1Q98A 3MDKA 4X1UA 3MNGA 2HRFA 1DUGA 4EUYA 4KSOA 1V2AA 3IXRA 3TRPA 4TW5A 1ZYQB 2C3NA 3CRTA 3TOTA 5AISA 2LQQA 2YCDA 3C1RA 3H8QA 2B1KA 5DJLA 2L4QA 2XPDA 16GSA 3LYKA 3LXTA 2FA8A 3QFAC 4JE1A 4EC0A 4OMVA 1VF1A 1S3CA 2KP2A 2CQ9A 4RUVA 3CMIA 5D96A 1W89A 1TXXA 3RPNA 1QUWA 1YEXA 4GLTA 4MK3A 1E2YA 4KX4A 2CV4A 2H1GA 1JLVA 3ED3A 2VM2A 2MMOA 1K0MA 2NDOA 3MWHA 4RQRA 1VRSD 3VFIA 2H72A
chains in the Genus database with same CATH superfamily
4Q5NA 3SBCA 4BVXB 2IJYA 3M9JA 4IQ1A 5IMDA 3FW2A 3MYDA 2VCWA 3VPTA 1QFNA 4JBBA 3N5OA 2YPMA 5F07A 3NOFA 5AIVA 5HR2A 1R26A 5JCGA 1AC1A 2ALBA 1T3BA 2H6XA 3QDNA 2VCVA 4OO4A 2L6DA 2V6KA 4I97A 3ZIJA 2R5GA 4NV2A 1M7TA 2CA8A 4ACSA 3TKSA 5KN1A 4I5QA 4KDYA 4JEDA 4OCEA 3IV4A 1TI1A 4HUAA 2D2ZA 2ON5A 3DIEA 3G7IA 1HYUA 4G2EA 2H1AA 2C0EA 4PQHA 2L59A 3CYNA 2LKUA 3UEMA 4IP6A 2VL3A 2C4JA 5EL8A 1OE8A 2LV3A 3HD5A 2VCZA 4N0ZA 3WYWA 2LRCA 1TRSA 3QR6A 5DQSA 2A2RA 1Z3EA 1QMVA 3RBTA 1EV9A 4MP4A 1X5DA 4IELA 4KW6A 4ID0A 4IW9A 2MMNA 1I5GA 3QAVA 3KTBA 1J08A 3CTGA 3HVVA 3F0IA 3RPPA 2DIZA 4XRAA 5IMZA 1TRWA 1QGVA 2VUPA 3IRAA 2G2QA 1PFOA 4G10A 2H19A 2VD1A 3VWXA 3HZ4A 4WF5A 4HJ2A 5ECIB 4GSTA 1S3DA 2C3TA 1OYJA 4N10A 1VGLA 2NVLA 1JLWA 3E3EA 4V1Ag 1BEDA 1MDIA 1K0AA 2L6CA 1SYRA 6GSWA 3QAWA 2LSTA 4EO3A 1AQVA 2CAIA 4XS1A 5BMUA 3IK9A 1TI3A 2GT5A 2M72A 3TRXA 4Z2UA 3F9UA 2WJUA 1A2JA 1URMA 2B3SA 4J57E 5IO2A 4FYBA 3S9FA 4CY8A 3ISOA 1NHYA 2LS5A 1X9SB 2CX3A 2I4AA 1SJZA 4BL7B 2ZNMA 4TR1A 4POKA 5JWOB 1WWJA 2XBIA 1WRYA 1M3IA 3KEBA 3M0FA 4POLA 2HRKA 1G6WA 3CSHA 1VF3A 3L0HA 1AXDA 2H75A 3D4MA 1A0RP 1OAZA 5J41A 3GURA 3Q74A 1GUMA 4O5RA 2IN3A 4DSSA 1O85A 1ZCPA 1G7OA 4AJ6A 1WMJA 2R0PA 3P2AA 4IP1A 1YKCA 3DRNA 1SKSB 2REMA 4MJEA 2PU9C 1JFUA 4MF7A 1B9YC 3F6FA 5CRWA 5COHA 2CZ2A 3F3RA 13GSA 5LNKe 1N2AA 1XCCA 4JR4A 1TP9A 5ELAA 3TJKA 2X4AA 5HFKA 1GNWA 2VO4A 5IMVA 5DQYA 4XTSA 5KN3A 3IC4A 2HT9A 1Z7PA 4Z7XA 9GSSA 3HHVA 1A0FA 2GS3A 4K0GA 1G6YA 2ZUPA 3GSSA 4MZWA 3O3TA 4USSA 5L71A 3SWLA 1V9WA 2P5RA 2A2PA 4GXZA 2CX4A 3LG6A 3O6TA 1BX9A 2DKHA 1TW9A 4ZBBA 2H30A 4L0UA 1O6JA 3FK8A 5CO3A 4XCSA 4EXJA 4Z2RA 4BVYA 1M9BA 1XFLA 4Q5FA 1XVQA 3APQA 4N11A 2RM6A 5JWRB 6GSSA 1BQ7A 4HQSA 2O89A 1SL0B 3ZMKA 2YV7A 3FR6A 3D6IA 3DVWA 3UAPA 2VIMA 2J23A 2VCTA 1QQ2A 5HFGA 5D93A 4KE3A 4TRXA 2H71A 1EOHA 4JRRA 1SK0A 2E2GA 4PURA 2VL9A 4XS4B 3TKRA 3RAZA 4KB3A 5DDLA 3BD2A 4F0BA 5IIZA 3L9SA 2WDUA 3FY7A 1YF0A 2GVPA 5IMAA 2IFQB 1EP7A 2O87A 3VWUA 2VCQA 4WR5A 2L5OA 4KUNA 1UN2A 3ZZXA 1FOVA 4HEA2 1U88A 2V6OA 2Z9SA 2K8SA 3GUSA 4XIHA 5F0GA 5IPHA 1SKWB 1GP1A 2FWGA 3C73A 2WFCA 1T00A 2QA1A 1F37A 3NZNA 5CP1A 1ST9A 3HYPA 3TJFA 1OC3A 5A4UA 2H6ZA 3EWLA 1V98A 1DBYA 1IYIA 1GLQA 4PQIA 3GKKA 1ERUA 4DSRA 4BWSA 3H79A 4YH2A 3KCMA 3G9BA 3MSZA 3DXBA 4FO5A 1JZWA 3GMFA 3H1NA 4GTUA 2VLTA 3KH9A 3W8JA 4J2FA 1ZGNA 1EEMA 1Z5YE 2FNOA 3TDGA 2HZEB 1J9BA 3MIXA 3P7XA 1R5AA 1XZOA 4GQCA 4K0NA 1M9AA 4NWYA 4TR4A 2YWOA 3ZL5A 5DAKA 2N5BA 3LGCA 4TVEA 3APSA 1YQ1A 1ZYPA 4HJMA 1E6BA 5DCHA 2CT6A 3ZFLA 3ERGA 3GA4A 5FHIA 1XVWA 5A4WA 3IAM2 4AJ7A 4K6XA 3PPUA 2LRTA 1FB6A 2DLXA 2R4VA 3BBYA 1XXUA 2N5AA 5FWGA 4OFMA 3FYGA 3A5WA 1TRUA 3DGQA 2V2GA 4EE0A 5ECRB 2C0FA 4DSQA 2H8LA 3FR9A 1ZZYA 2A4VA 1PL1A 3IBHA 2FUG2 2FA4A 5F06A 5DALB 1JZRA 2PMTA 3GSTA 1PX7A 3UBKA 3QFBC 2EIQA 1R7HA 2GSQA 1HNCA 2IL3A 5CRDA 6GSVA 1GTBA 1XOAA 3GL5A 2FWEA 3MAKA 4GQFA 3TGZA 5ECMB 3TUEA 3TKSE 1W4VA 2E0QA 1ZYEA 1TK0B 2B1LA 2WGRA 2AV4A 4ZL7A 1O8XA 4ZIJA 3P90A 1XWGA 1AQWA 4TKYA 3D4TA 2YWMA 4PXOA 2JZRA 1SK1A 2ES7A 3HVNA 19GSA 5ID2A 4ICYA 1O81A 1THOA 2LRNA 2DJ3A 2DSAA 3L9UA 4K1FA 1KTEA 1CQGA 3KMOA 3I9V2 2PUKC 20GSA 3WGDA 4XS6A 4H86A 5ABRA 2LJRA 5KEJA 1A2MA 2C3QA 4K7NA 2BTOT 3EMPA 1BG5A 4OD7A 2I81A 1F9MA 2OA7A 1C72A 3ZMLA 6GSYA 3VLNA 4N0VA 4OWYA 4WBJA 3DMLA 2LNTA 1U6TA 4O5QA 1R4WA 2PVOC 1K0DA 4IGJA 1SD8A 4MNNA 4MDCA 2OE1A 3FZ9A 1Y25A 4MLYA 2DJ1A 3KZQA 4MH2A 2DJJA 2AAWA 2K18A 4AF2A 3W8SA 4WKWA 3TRQA 3UVTA 2R3XA 2KP1A 1QXHA 1ZL9A 4L8EA 2FLSA 2IPAA 1SL1B 2P0GA 2YWNA 1G7EA 4MMMA 3GYKA 3D0ZA 5HFIA 1OE7A 5CRGA 2HI7A 3CXGA 2HSHA 3TJJA 2FD3A 4IQAA 4F2IA 4DVCA 2GQMA 2ON7A 2H0GA 1PN9A 1WJKA 1RK4A 3EURA 3OR5A 2H66A 3HCZA 3C8EA 3D22A 4FYUA 3I6AA 1THXA 2HLSA 5DJMA 3EU3A 4KAEA 4EKZA 5ECOB 4IN0A 2LUSA 1K0OA 1ZMAA 1YJ6A 1TU8A 2KUCA 5C00A 4K7IA 1YF1A 5D73A 5CNWA 3LYPA 2VCXA 4PNGA 2WB9A 4BA7A 3GX0A 2LJAA 3NIVA 4BPYA 3GKNA 3EU4A 3LW9A 1RW1A 2R0GA 4Z2TA 4IJ3A 2PGTA 4LA1A 2EIRA 2XPEA 4NPBA 1N8JA 1V58A 4PQ1A 3UIWA 2TRXA 2I3YA 1A8LA 4WETA 2YWIA 4Q5QA 1M3JA 4NXIA 1GSQA 4PX1A 1ERTA 5IMFA 4LL1B 2I9HA 4G19A 3KP9A 2WRTA 4JR6A 4HS1A 1LU4A 5J3RA 4CHSA 2OE0A 3GIXA 1SD9A 4KDXA 3AY8A 3VI5A 2TIRA 3RHCA 1K3YA 2PWJA 1XW9A 3HA9A 3G7YA 4KGIA 3ERWA 3IHGA 4OFTA 4K2XA 4YQMA 3U6VA 1KEBA 4EL1A 1SJIA 2OJLA 1MDJA 3EVIA 2F9SA 5GAND 1KNGA 2N5FA 1Y6EA 4ECCA 2H74A 3HVSA 2YV9A 1F6MC 2DMLA 10GSA 4MF5A 5H5SA 1SYXA 3UARA 2FGXA 4FIWA 4NMUA 1V40A 4HZ2A 2HNLA 2GSTA 1ILOA 2JSZA 3A3TA 3KXOA 4RI7A 3WT1A 2IMKA 4RI6A 3GTUB 4MH3A 1OC9B 3DKSA 3UMAA 2B7JA 2FY6A 5IOWA 1K0CA 4D73B 3QMXA 4MJBA 3HJOA 1TK8B 3V1WA 3LFLA 6GSUA 1GNEA 2JU5A 4I8BA 2JL4A 2VL2A 3E0UA 2CAQA 4HSCX 2DJ0A 4V1Ap 4KF9A 2MMAA 3GV1A 3CBUA 3U5RE 5JWQB 1XW6A 2KHPA 2K8VA 1GTIA 5AIXA 2E2MA 4J56E 3BJ5A 2C0GA 3DEXA 5KN2A 2MBSA 3FZAA 3C7MA 1WP0A 1ERWA 12GSA 3ZLPA 3BCIA 2H0IA 4G0LA 1VF4A 1GTAA 2IWTA 5D9XA 3TJGA 3FKFA 1B8XA 1Z6MA 4BL7A 1ZYNA 3M3MA 4AGSA 1GTUA 2F51A 1OVNA 4ISDA 4EIQA 2HZFA 3EPTA 3HDCA 2NTOA 3GN3A 1LBKA 1NSWA 2P5QA 4L5OA 3HJMA 1SENA 3GRXA 5G5FA 4YAVA 3UL3A 1UA5A 1EWXA 3TB2A 1GULA 1GL8A 1Q4JA 5A4VA 4ZBAA 2ZCTA 5GAPD 5G31A 2H1BA 1HNBA 1GSYA 1SJ6A 1BAYA 4KH7A 3IK7A 3HZ8A 5J9CA 1JZDA 4EDYA 5DCGA 14GSA 2DMMA 5HQPA 2GGTA 3GX8A 2HRAA 2G0FA 1AIUA 2H01A 3LSZA 2H70A 1MD4A 4HQZA 5IO0A 3M9KA 3IOSA 4ZB8A 4WEYA 2LEGA 2OBKA 4LL4B 3FR3A 4MA9A 5D9VA 1XWKA 5CYYA 4HU7A 3PINA 4MABA 1O73A 4YQUA 4EVMA 2F3MA 3M8NA 5F8BA 8GSSA 1CQHA 2RUEA 5ECNB 2PVQA 4QL7A 1K0BA 2R0CA 2V32A 3DWVA 1K3OA 3WD6A 3IA1A 5DVBA 1FG4A 3O76A 2IMEA 3ZTLA 1MTCA 2V1MA 4LMVA 3UBLA 1YEPA 4V2MA 4TXOB 2B5EA 1T4ZA 3A2WA 5HR0A 2MYGA 5G2ZA 5F05A 4K2DA 5B8BA 1QK8A 3VPQA 2GSRA 1GSDA 1RQMA 1FVKA 3Q18A 4K9ZA 4YAPA 18GSA 5D9WA 2F8AA 2O8VB 1TOFA 2JZTA 5G1KA 1XPVA 1AAZA 3GL3A 1B4QA 2WCIA 2H1DA 4GRFA 4YKGA 1MDKA 2BMXA 5D9TA 1SKRB 2X99A 1ACVA 1S3AA 2H6YA 3QCPA 4OCFA 3P8WA 3HKRA 2YZUA 5B6NA 5E4WA 3TCOA 4I6XA 3R3EA 1GSFA 2FWFA 2IMFA 1TTZA 1HQOA 3PR8A 5GSSA 3KIJA 4XS4A 4ZILA 3H4KA 4FYCA 1LJRA 3L4NA 1T4YA 2GSSA 2JADA 5KOXA 3KMNA 2QSIA 1FVJA 2LNSA 1K0NA 4IJIA 2DBCA 2YJ7A 2IFQA 5GZZB 2E7PA 4K5SA 1A8YA 4KDUA 4ZB9A 5CAXA 4PNFA 2FHEA 4MZCA 11GSA 2GTUA 3L78A 1PL2A 1I9DA 4NHWA 1R5PA 1ON4A 3DVXA 3ME8A 3EC3A 4LLRA 2L4CA 1PRXA 2IIYA 4O5UA 2GZYA 4TXVA 3GKMA 4N30A 3ZRDA 4A5PA 4X0XA 2R6KA 3UVHA 1TKDB 3EYTA 3WGXA 5J4UA 2CVBA 5G30A 5B6MA 1PD21 3ZVJA 2GZZA 4IS0A 1T8EB 2J9HA 2CZ3A 4WXTA 2X49A 5H5RA 3PGTA 4O7HA 22GSA 1O7UA 1X5EA 3A5IA 1FHEA 3HY2A 4GCIA 2YZHA 4O92A 4TOPA 2VLVA 1X0RA 2HZEA 2VL2C 3A2XA 1HD2A 3Q6OA 2RUFA 2OADA 2YP6A 4ZB6A 3F4RA 4G9HA 1USBA 2GZPA 1EP8A 3KGKA 4POMA 3QD9A 3VURA 4ECIA 4CDOA 2PBJA 5J9BA 1GRXA 1PMTA 3F4TA 3KM6A 6GSTA 4WR4A 2GT6A 3FZ5A 1GSSA 5CREA 4ML1A 1T7PB 2B7KA 3VK9A 3QPMA 2GLRA 1TDIA 5JCWA 4MF6A 3C1SA 5B8AA 5DALA 3LEFA 3A2VA 4WBRD 2K6VA 2KOKA 1EEJA 4TR0A 4NHZA 3LXZA 4FH8A 3US3A 3D5JA 3C71A 2DC5A 1Z9HA 3TKPA 2AB6A 4CY6A 3F3QA 4QL9A 4MJCA 2RIIA 2GDRA 1JZOA 4E8EA 3FMWA 1PGTA 1SK2A 3F6DA 2HSMA 5HR1A 3WT2A 4KA0A 1TJDA 3DD3A 3HJPA 3LQ7A 1Z7RA 1GSEA 2AJQB 2HSYA 5D8IA 1GH2A 1X5CA 1H4OA 3F8UA 5IOXA 2C1YA 3J7Yb 1VF2A 1X9MB 2RM5A 3UJ1A 1GSUA 3GH9A 1DSBA 2C8UA 4ILFA 2OE3A 3TOUA 1XBSA 2HYXA 1YKAA 5LD0A 4HU9A 4O32A 2VM1A 2KLXA 1T1VA 4TR1B 1S3RA 3GKXA 1PQNA 3GH6A 4OFNA 3VWWA 5FT3A 2H76A 2YJHA 5EVOA 4P3YB 2MZCA 3F63A 2YANA 2JACA 1XWCA 6GSXA 3QAGA 4OO5A 1FO5A 5KOWA 1EZKA 2XBQA 1U87A 4BVXA 4DSSB 2PPTA 2H0HA 1F3AA 3FRCA 5IM9A 4ZBDA 5INYA 4E8HA 2X8HA 2TRCP 3KJYA 3GHAA 1SL2B 1WOUA 4EIPA 1PSQA 1XWAA 3ZYWA 3UOMA 3LORA 1MD3A 3LJRA 1MEKA 5EY6A 4MJAA 4F03A 1K3LA 2IMIA 4YQVA 4KCAA 5JCUA 3BCKA 4JU5A 5EPFA 3RHBA 5J5NA 5E59A 5G1LA 1YZXA 3VI7A 3M1GA 1WE0A 2XC2A 3KH7A 4JZQA 1GWCA 5ECQB 5ENUA 3HXSA 2HE3A 1M2DA 2O85A 2C80A 2WS2A 4K7OA 1JHBA 1AUCA 4CW9A 2F8FA 4LMWA 1EGOA 3ERFA 5KN0A 1M99A 5AN1A 3RDWA 1XWBA 4ML6A 2DIYA 2R37A 5ECHB 1FW1A 3DYRA 1DE2A 4BVYB 3CSIA 3KD0A 5H5QA 2OKAA 3TJBA 3KP8A 2R2JA 4IHUA 3GNJA 3IHQA 2LTKA 2NBSA 5LCZA 2PN8A 1TK5B 1A2LA 4HZ4A 1PKZA 2XHFA 4DEJA 2YNXA 5A5KA 2GQKA 1F3BA 3IPZA 1GUHA 2DJKA 2FCHA 4HOJA 4V2LA 4Q5RA 4HDEA 3I69A 5B7CA 1WIKA 2IMDA 5AGYA 1YDKA 5HR3A 4AJ8A 2A4HA 1M0UA 2FWHA 3FEUA 3E9JB 4ZL9A 1GUKA 3N9JA 3CRUA 4X4JA 1YY7A 1XOBA 2JZSA 4TR3A 4YKFA 1TU7A 3IC8A 1PX6A 3GFKA 2PERA 1OKTA 2M46A 1XIYA 4V2NA 2X64A 7GSSA 2L5LA 3IAS2 1EV4A 3WGEA 1V57A 3QOUA 1DE1A 1IYHA 2OACA 4L0WA 2B6MA 1AQXA 2WZ9A 1UC7A 2H73A 2LQOA 2VLUA 1A24A 4GF0A 2I1UA 1B9XC 3Q19A 4IBPA 4IKHA 5GSTA 4TN8A 2DKIA 2QGVA 2P31A 2OBIA 3L9VA 4K8MA 4K5RA 4XHMA 4GWRA 3TKQA 2HRNA 2GQLA 5BRTA 3ME7A 1U3IA 3HVXA 3BOAA 3KTLA 4MPFA 4ULXA 2HFDA 2WULA 1NM3A 1X9WB 3IE3A 4HI7A 4PTSA 4MZBA 2NPBA 4POBA 2O7KA 2LJKA 5DAKB 3GTUA 5ELGA 3J7Yk 3CQFA 1OC9A 1H75A 3APOA 1AW9A 4GSNA 4D73A 2VD0A 2RLIA 3CTFA 1HNAA 4BIKA 3IR4A 4BWQA 1OKDA 3K8NA 1BYEA 1B4PA 1NHOA 5IMCA 2C0DA 3FHKA 5IPGA 1ABAA 4MPGA 3TKSC 4MCUA 1EGRA 3EE2A 1EOGA 1XG8A 1U3AA 2AYTA 4EF0A 4NAXA 2VOCA 2HXKA 4QQ7A 2B5YA 4KCEA 2MMZA 2UZ8A 5ECSA 3VWVA 1WPIA 2DJ2A 1SU9A 1BJXA 4GSSA 4KSMA 1PN0A 2X8CA 2AHEA 1FB0A 1PKWA 3D21A 2CVKA 3W6GA 4EDZA 2VAFA 1A23A 4WF4A 1FOHA 2V41A 3EMXA 3FZ4A 4PGTA 4I2TA 4F0CA 4F9ZA 4IVFA 4RQXA 3EINA 5C04A 5G5EA 1NW2A 4ECBA 5ID2B 3ZVJD 4KNDA 3ZIVA 4G0IA 2A2SA 5ECKB 3I43A 1OC8A 4XRDA 2QC7A 2X8GA 1M2AA 4L5LA 3G7JA 1TRVA 2CVDA 4FQUA 1Z6NA 3F4SA 3H93A 1ML6A 2AUVA 5DBQA 1B48A 1GLPA 2QA2A 3ZITA 2MBTA 5CRHA 1ERVA 4PUAA 1XW5A 3IDVA 1O8WA 4I2UA 4NV5A 2L57A 5ECLB 1J0FA 3ZFBA 1KBNA 2YOIA 3JCML 4ECJA 1UVZA 2EC4A 4X43A 4ZXGA 3CSJA 1ZOFA 2EIOA 3ZREA 17GSA 2K9FA 4G0KA 2JSYA 4ZL8A 1M2BA 4TXOA 4F82A 1F2EA 2YN1A 4PUFC 1G0TA 5ECPB 5IQYA 1FAAA 2QKEA 1PA3A 2M80A 2B5XA 3LWAA 3PH9A 2BJXA 3R2QA 1Q98A 3MDKA 4X1UA 3MNGA 2HRFA 1DUGA 4EUYA 4KSOA 1V2AA 3IXRA 3TRPA 4TW5A 1ZYQB 2C3NA 3CRTA 3TOTA 5AISA 2LQQA 2YCDA 3C1RA 3H8QA 2B1KA 5DJLA 2L4QA 2XPDA 16GSA 3LYKA 3LXTA 2FA8A 3QFAC 4JE1A 4EC0A 4OMVA 1VF1A 1S3CA 2KP2A 2CQ9A 4RUVA 3CMIA 5D96A 1W89A 1TXXA 3RPNA 1QUWA 1YEXA 4GLTA 4MK3A 1E2YA 4KX4A 2CV4A 2H1GA 1JLVA 3ED3A 2VM2A 2MMOA 1K0MA 2NDOA 3MWHA 4RQRA 1VRSD 3VFIA 2H72A
chains in the Genus database with same CATH topology
4Q5NA 3SBCA 4BVXB 2IJYA 3M9JA 4IQ1A 5IMDA 3FW2A 3MYDA 2VCWA 3VPTA 1QFNA 4JBBA 3N5OA 2YPMA 5F07A 3NOFA 5AIVA 5HR2A 1R26A 5JCGA 1AC1A 2ALBA 1T3BA 2H6XA 3QDNA 2VCVA 4OO4A 2L6DA 2V6KA 4I97A 3ZIJA 2R5GA 4NV2A 1M7TA 2CA8A 4ACSA 3TKSA 5KN1A 4I5QA 4KDYA 4JEDA 4OCEA 3IV4A 1TI1A 4HUAA 2D2ZA 2ON5A 3DIEA 3G7IA 1HYUA 4G2EA 2H1AA 2C0EA 4PQHA 2L59A 3CYNA 2LKUA 3UEMA 4IP6A 2VL3A 2C4JA 5EL8A 1OE8A 2LV3A 3HD5A 2VCZA 4N0ZA 3WYWA 2LRCA 1TRSA 3QR6A 5DQSA 2A2RA 1Z3EA 1QMVA 3RBTA 1EV9A 4MP4A 1X5DA 4IELA 4KW6A 4ID0A 4IW9A 2MMNA 1I5GA 3QAVA 3KTBA 1J08A 3CTGA 3HVVA 3F0IA 3RPPA 2DIZA 4XRAA 5IMZA 1TRWA 1QGVA 2VUPA 3IRAA 2G2QA 4G10A 2H19A 2VD1A 3VWXA 3HZ4A 4WF5A 4HJ2A 5ECIB 4GSTA 1S3DA 2C3TA 1OYJA 4N10A 1VGLA 2NVLA 1JLWA 3E3EA 4V1Ag 1BEDA 1MDIA 1K0AA 2L6CA 1SYRA 6GSWA 3QAWA 2LSTA 4EO3A 1AQVA 2CAIA 4XS1A 5BMUA 3IK9A 1TI3A 2GT5A 2M72A 3TRXA 4Z2UA 3F9UA 2WJUA 1A2JA 1URMA 2B3SA 4J57E 5IO2A 4FYBA 3S9FA 4CY8A 3ISOA 1NHYA 2LS5A 1X9SB 2CX3A 2I4AA 1SJZA 4BL7B 2ZNMA 4TR1A 4POKA 5JWOB 1WWJA 2XBIA 1WRYA 3KEBA 3M0FA 4POLA 2HRKA 1G6WA 3CSHA 1VF3A 3L0HA 1AXDA 2H75A 3D4MA 1A0RP 1OAZA 5J41A 3GURA 3Q74A 1GUMA 4O5RA 2IN3A 4DSSA 1O85A 1ZCPA 1G7OA 4AJ6A 1WMJA 2R0PA 3P2AA 4IP1A 1YKCA 3DRNA 1SKSB 2REMA 4MJEA 2PU9C 1JFUA 4MF7A 1B9YC 3F6FA 5CRWA 5COHA 2CZ2A 3F3RA 13GSA 5LNKe 1N2AA 1XCCA 4JR4A 1TP9A 5ELAA 3TJKA 2X4AA 5HFKA 1GNWA 2VO4A 5IMVA 5DQYA 4XTSA 5KN3A 3IC4A 2HT9A 1Z7PA 4Z7XA 9GSSA 3HHVA 1A0FA 2GS3A 4K0GA 1G6YA 2ZUPA 3GSSA 4MZWA 3O3TA 4USSA 5L71A 3SWLA 1V9WA 2P5RA 2A2PA 4GXZA 2CX4A 3LG6A 3O6TA 1BX9A 2DKHA 1TW9A 4ZBBA 2H30A 4L0UA 1O6JA 3FK8A 5CO3A 4XCSA 4EXJA 4Z2RA 4BVYA 1M9BA 1XFLA 4Q5FA 1XVQA 3APQA 4N11A 2RM6A 5JWRB 6GSSA 1BQ7A 4HQSA 2O89A 1SL0B 3ZMKA 2YV7A 3FR6A 3D6IA 3DVWA 3UAPA 2VIMA 2J23A 2VCTA 1QQ2A 5HFGA 5D93A 4KE3A 4TRXA 2H71A 1EOHA 4JRRA 1SK0A 2E2GA 4PURA 2VL9A 4XS4B 3TKRA 3RAZA 4KB3A 5DDLA 3BD2A 4F0BA 5IIZA 3L9SA 2WDUA 3FY7A 1YF0A 2GVPA 5IMAA 2IFQB 1EP7A 2O87A 3VWUA 2VCQA 4WR5A 2L5OA 4KUNA 1UN2A 3ZZXA 1FOVA 4HEA2 1U88A 2V6OA 2Z9SA 2K8SA 3GUSA 4XIHA 5F0GA 5IPHA 1SKWB 1GP1A 2FWGA 3C73A 2WFCA 1T00A 2QA1A 1F37A 3NZNA 5CP1A 1ST9A 3HYPA 3TJFA 1OC3A 5A4UA 2H6ZA 3EWLA 1V98A 1DBYA 1IYIA 1GLQA 4PQIA 3GKKA 1ERUA 4DSRA 4BWSA 3H79A 4YH2A 3KCMA 3G9BA 3MSZA 3DXBA 4FO5A 1JZWA 3GMFA 3H1NA 4GTUA 2VLTA 3KH9A 3W8JA 4J2FA 1ZGNA 1EEMA 1Z5YE 2FNOA 3TDGA 2HZEB 1J9BA 3MIXA 3P7XA 1R5AA 1XZOA 4GQCA 4K0NA 1M9AA 4NWYA 4TR4A 2YWOA 3ZL5A 5DAKA 2N5BA 3LGCA 4TVEA 3APSA 1YQ1A 1ZYPA 4HJMA 1E6BA 5DCHA 2CT6A 3ZFLA 3ERGA 3GA4A 5FHIA 1XVWA 5A4WA 3IAM2 4AJ7A 4K6XA 3PPUA 2LRTA 1FB6A 2DLXA 2R4VA 3BBYA 1XXUA 2N5AA 5FWGA 4OFMA 3FYGA 3A5WA 1TRUA 3DGQA 2V2GA 4EE0A 5ECRB 2C0FA 4DSQA 2H8LA 3FR9A 1ZZYA 2A4VA 1PL1A 3IBHA 2FUG2 2FA4A 5F06A 5DALB 1JZRA 2PMTA 3GSTA 1PX7A 3UBKA 3QFBC 2EIQA 1R7HA 2GSQA 1HNCA 2IL3A 5CRDA 6GSVA 1GTBA 1XOAA 3GL5A 2FWEA 3MAKA 4GQFA 3TGZA 5ECMB 3TUEA 3TKSE 1W4VA 2E0QA 1ZYEA 1TK0B 2B1LA 2WGRA 2AV4A 4ZL7A 1O8XA 4ZIJA 3P90A 1XWGA 1AQWA 4TKYA 3D4TA 2YWMA 4PXOA 2JZRA 1SK1A 2ES7A 19GSA 5ID2A 4ICYA 1O81A 1THOA 2LRNA 2DJ3A 2DSAA 3L9UA 4K1FA 1KTEA 1CQGA 3KMOA 3I9V2 2PUKC 20GSA 3WGDA 4XS6A 4H86A 5ABRA 2LJRA 5KEJA 1A2MA 2C3QA 4K7NA 2BTOT 3EMPA 1BG5A 4OD7A 2I81A 1F9MA 2OA7A 1C72A 3ZMLA 6GSYA 3VLNA 4N0VA 4OWYA 4WBJA 3DMLA 2LNTA 1U6TA 4O5QA 1R4WA 2PVOC 1K0DA 4IGJA 1SD8A 4MNNA 4MDCA 2OE1A 3FZ9A 1Y25A 4MLYA 2DJ1A 3KZQA 4MH2A 2DJJA 2AAWA 2K18A 4AF2A 3W8SA 4WKWA 3TRQA 3UVTA 2R3XA 2KP1A 1QXHA 1ZL9A 4L8EA 2FLSA 2IPAA 1SL1B 2P0GA 2YWNA 1G7EA 4MMMA 3GYKA 3D0ZA 5HFIA 1OE7A 5CRGA 2HI7A 3CXGA 2HSHA 3TJJA 2FD3A 4IQAA 4F2IA 4DVCA 2GQMA 2ON7A 2H0GA 1PN9A 1WJKA 1RK4A 3EURA 3OR5A 2H66A 3HCZA 3C8EA 3D22A 4FYUA 3I6AA 1THXA 2HLSA 5DJMA 3EU3A 4KAEA 4EKZA 5ECOB 4IN0A 2LUSA 1K0OA 1ZMAA 1YJ6A 1TU8A 2KUCA 5C00A 4K7IA 1YF1A 5D73A 5CNWA 3LYPA 2VCXA 4PNGA 2WB9A 4BA7A 3GX0A 2LJAA 3NIVA 4BPYA 3GKNA 3EU4A 3LW9A 1RW1A 2R0GA 4Z2TA 4IJ3A 2PGTA 4LA1A 2EIRA 2XPEA 4NPBA 1N8JA 1V58A 4PQ1A 3UIWA 2TRXA 2I3YA 1A8LA 4WETA 2YWIA 4Q5QA 4NXIA 1GSQA 4PX1A 1ERTA 5IMFA 4LL1B 2I9HA 4G19A 3KP9A 2WRTA 4JR6A 4HS1A 1LU4A 5J3RA 4CHSA 2OE0A 3GIXA 1SD9A 4KDXA 3AY8A 3VI5A 2TIRA 3RHCA 1K3YA 2PWJA 1XW9A 3HA9A 3G7YA 4KGIA 3ERWA 3IHGA 4OFTA 4K2XA 4YQMA 3U6VA 1KEBA 4EL1A 1SJIA 2OJLA 1MDJA 3EVIA 2F9SA 5GAND 1KNGA 2N5FA 1Y6EA 4ECCA 2H74A 3HVSA 2YV9A 1F6MC 2DMLA 10GSA 4MF5A 5H5SA 1SYXA 3UARA 2FGXA 4FIWA 4NMUA 1V40A 4HZ2A 2HNLA 2GSTA 1ILOA 2JSZA 3A3TA 3KXOA 4RI7A 3WT1A 2IMKA 4RI6A 3GTUB 4MH3A 1OC9B 3DKSA 3UMAA 2B7JA 2FY6A 5IOWA 1K0CA 4D73B 3QMXA 4MJBA 3HJOA 1TK8B 3V1WA 3LFLA 6GSUA 1GNEA 2JU5A 4I8BA 2JL4A 2VL2A 3E0UA 2CAQA 2DJ0A 4V1Ap 4KF9A 2MMAA 3GV1A 3CBUA 3U5RE 5JWQB 1XW6A 2KHPA 2K8VA 1GTIA 5AIXA 2E2MA 4J56E 3BJ5A 2C0GA 3DEXA 5KN2A 2MBSA 3FZAA 3C7MA 1WP0A 1ERWA 12GSA 3ZLPA 3BCIA 2H0IA 4G0LA 1VF4A 1GTAA 2IWTA 5D9XA 3TJGA 3FKFA 1B8XA 1Z6MA 4BL7A 1ZYNA 3M3MA 4AGSA 1GTUA 2F51A 1OVNA 4ISDA 4EIQA 2HZFA 3EPTA 3HDCA 2NTOA 3GN3A 1LBKA 1NSWA 2P5QA 4L5OA 3HJMA 1SENA 3GRXA 5G5FA 4YAVA 3UL3A 1UA5A 1EWXA 3TB2A 1GULA 1GL8A 1Q4JA 5A4VA 4ZBAA 2ZCTA 5GAPD 5G31A 2H1BA 1HNBA 1GSYA 1SJ6A 1BAYA 4KH7A 3IK7A 3HZ8A 5J9CA 1JZDA 4EDYA 5DCGA 14GSA 2DMMA 5HQPA 2GGTA 3GX8A 2HRAA 2G0FA 1AIUA 2H01A 3LSZA 2H70A 1MD4A 4HQZA 5IO0A 3M9KA 3IOSA 4ZB8A 4WEYA 2LEGA 2OBKA 4LL4B 3FR3A 4MA9A 5D9VA 1XWKA 5CYYA 4HU7A 3PINA 4MABA 1O73A 4YQUA 4EVMA 2F3MA 3M8NA 5F8BA 8GSSA 1CQHA 2RUEA 5ECNB 2PVQA 4QL7A 1K0BA 2R0CA 2V32A 3DWVA 1K3OA 3WD6A 3IA1A 5DVBA 1FG4A 3O76A 2IMEA 3ZTLA 1MTCA 2V1MA 4LMVA 3UBLA 1YEPA 4V2MA 4TXOB 2B5EA 1T4ZA 3A2WA 5HR0A 2MYGA 5G2ZA 5F05A 4K2DA 5B8BA 1QK8A 3VPQA 2GSRA 1GSDA 1RQMA 1FVKA 3Q18A 4K9ZA 4YAPA 18GSA 5D9WA 2F8AA 2O8VB 1TOFA 2JZTA 5G1KA 1XPVA 1AAZA 3GL3A 1B4QA 2WCIA 2H1DA 4GRFA 4YKGA 1MDKA 2BMXA 5D9TA 1SKRB 2X99A 1ACVA 1S3AA 2H6YA 3QCPA 4OCFA 3P8WA 3HKRA 2YZUA 5B6NA 5E4WA 3TCOA 4I6XA 3R3EA 1GSFA 2FWFA 2IMFA 1TTZA 1HQOA 3PR8A 5GSSA 3KIJA 4XS4A 4ZILA 3H4KA 4FYCA 1LJRA 3L4NA 1T4YA 2GSSA 2JADA 5KOXA 3KMNA 2QSIA 1FVJA 2LNSA 1K0NA 4IJIA 2DBCA 2YJ7A 2IFQA 5GZZB 2E7PA 4K5SA 1A8YA 4KDUA 4ZB9A 5CAXA 4PNFA 2FHEA 4MZCA 11GSA 2GTUA 3L78A 1PL2A 1I9DA 4NHWA 1R5PA 1ON4A 3DVXA 3ME8A 3EC3A 4LLRA 2L4CA 1PRXA 2IIYA 4O5UA 2GZYA 4TXVA 3GKMA 4N30A 3ZRDA 4A5PA 4X0XA 2R6KA 3UVHA 1TKDB 3EYTA 3WGXA 5J4UA 2CVBA 5G30A 5B6MA 1PD21 3ZVJA 2GZZA 4IS0A 1T8EB 2J9HA 2CZ3A 4WXTA 2X49A 5H5RA 3PGTA 4O7HA 22GSA 1O7UA 1X5EA 3A5IA 1FHEA 3HY2A 4GCIA 2YZHA 4O92A 4TOPA 2VLVA 1X0RA 2HZEA 2VL2C 3A2XA 1HD2A 3Q6OA 2RUFA 2OADA 2YP6A 4ZB6A 3F4RA 4G9HA 1USBA 2GZPA 1EP8A 3KGKA 4POMA 3QD9A 3VURA 4ECIA 4CDOA 2PBJA 5J9BA 1GRXA 1PMTA 3F4TA 3KM6A 6GSTA 4WR4A 2GT6A 3FZ5A 1GSSA 5CREA 4ML1A 1T7PB 2B7KA 3VK9A 3QPMA 2GLRA 1TDIA 5JCWA 4MF6A 3C1SA 5B8AA 5DALA 3LEFA 3A2VA 4WBRD 2K6VA 2KOKA 1EEJA 4TR0A 4NHZA 3LXZA 4FH8A 3US3A 3D5JA 3C71A 2DC5A 1Z9HA 3TKPA 2AB6A 4CY6A 3F3QA 4QL9A 4MJCA 2RIIA 2GDRA 1JZOA 4E8EA 3FMWA 1PGTA 1SK2A 3F6DA 2HSMA 5HR1A 3WT2A 4KA0A 1TJDA 3DD3A 3HJPA 3LQ7A 1Z7RA 1GSEA 2AJQB 2HSYA 5D8IA 1GH2A 1X5CA 1H4OA 3F8UA 5IOXA 2C1YA 3J7Yb 1VF2A 1X9MB 2RM5A 3UJ1A 1GSUA 3GH9A 1DSBA 2C8UA 4ILFA 2OE3A 3TOUA 1XBSA 2HYXA 1YKAA 5LD0A 4HU9A 4O32A 2VM1A 2KLXA 1T1VA 4TR1B 3GKXA 1PQNA 3GH6A 4OFNA 3VWWA 5FT3A 2H76A 2YJHA 5EVOA 4P3YB 2MZCA 3F63A 2YANA 2JACA 1XWCA 6GSXA 3QAGA 4OO5A 1FO5A 5KOWA 1EZKA 2XBQA 1U87A 4BVXA 4DSSB 2PPTA 2H0HA 1F3AA 3FRCA 5IM9A 4ZBDA 5INYA 4E8HA 2X8HA 2TRCP 3KJYA 3GHAA 1SL2B 1WOUA 4EIPA 1PSQA 1XWAA 3ZYWA 3UOMA 3LORA 1MD3A 3LJRA 1MEKA 5EY6A 4MJAA 4F03A 1K3LA 2IMIA 4YQVA 4KCAA 5JCUA 3BCKA 4JU5A 5EPFA 3RHBA 5J5NA 5E59A 5G1LA 1YZXA 3VI7A 3M1GA 1WE0A 2XC2A 3KH7A 4JZQA 1GWCA 5ECQB 5ENUA 3HXSA 2HE3A 1M2DA 2O85A 2C80A 2WS2A 4K7OA 1JHBA 1AUCA 4CW9A 2F8FA 4LMWA 1EGOA 3ERFA 5KN0A 1M99A 5AN1A 3RDWA 1XWBA 4ML6A 2DIYA 2R37A 5ECHB 1FW1A 3DYRA 1DE2A 4BVYB 3CSIA 3KD0A 5H5QA 2OKAA 3TJBA 3KP8A 2R2JA 4IHUA 3GNJA 3IHQA 2LTKA 2NBSA 5LCZA 2PN8A 1TK5B 1A2LA 4HZ4A 1PKZA 2XHFA 4DEJA 2YNXA 5A5KA 2GQKA 1F3BA 3IPZA 1GUHA 2DJKA 2FCHA 4HOJA 4V2LA 4Q5RA 4HDEA 3I69A 5B7CA 1WIKA 2IMDA 5AGYA 1YDKA 5HR3A 4AJ8A 2A4HA 1M0UA 2FWHA 3FEUA 3E9JB 4ZL9A 1GUKA 3N9JA 3CRUA 4X4JA 1YY7A 1XOBA 2JZSA 4TR3A 4YKFA 1TU7A 3IC8A 1PX6A 3GFKA 2PERA 1OKTA 2M46A 1XIYA 4V2NA 2X64A 7GSSA 2L5LA 3IAS2 1EV4A 3WGEA 1V57A 3QOUA 1DE1A 1IYHA 2OACA 4L0WA 2B6MA 1AQXA 2WZ9A 1UC7A 2H73A 2LQOA 2VLUA 1A24A 4GF0A 2I1UA 1B9XC 3Q19A 4IBPA 4IKHA 5GSTA 4TN8A 2DKIA 2QGVA 2P31A 2OBIA 3L9VA 4K8MA 4K5RA 4XHMA 4GWRA 3TKQA 2HRNA 2GQLA 5BRTA 3ME7A 1U3IA 3HVXA 3BOAA 3KTLA 4MPFA 4ULXA 2HFDA 2WULA 1NM3A 1X9WB 3IE3A 4HI7A 4PTSA 4MZBA 2NPBA 4POBA 2O7KA 2LJKA 5DAKB 3GTUA 5ELGA 3J7Yk 1OC9A 1H75A 3APOA 1AW9A 4GSNA 4D73A 2VD0A 2RLIA 3CTFA 1HNAA 3IR4A 4BWQA 1OKDA 3K8NA 1BYEA 1B4PA 1NHOA 5IMCA 2C0DA 3FHKA 5IPGA 1ABAA 4MPGA 3TKSC 4MCUA 1EGRA 3EE2A 1EOGA 1U3AA 2AYTA 4EF0A 4NAXA 2VOCA 2HXKA 4QQ7A 2B5YA 4KCEA 2MMZA 2UZ8A 5ECSA 3VWVA 1WPIA 2DJ2A 1SU9A 1BJXA 4GSSA 4KSMA 1PN0A 2X8CA 2AHEA 1FB0A 1PKWA 3D21A 2CVKA 3W6GA 4EDZA 2VAFA 1A23A 4WF4A 1FOHA 2V41A 3EMXA 3FZ4A 4PGTA 4I2TA 4F0CA 4F9ZA 4IVFA 4RQXA 3EINA 5C04A 5G5EA 1NW2A 4ECBA 5ID2B 3ZVJD 4KNDA 3ZIVA 4G0IA 2A2SA 5ECKB 3I43A 1OC8A 4XRDA 2QC7A 2X8GA 1M2AA 4L5LA 3G7JA 1TRVA 2CVDA 4FQUA 1Z6NA 3F4SA 3H93A 1ML6A 2AUVA 5DBQA 1B48A 1GLPA 2QA2A 3ZITA 2MBTA 5CRHA 1ERVA 4PUAA 1XW5A 3IDVA 1O8WA 4I2UA 4NV5A 2L57A 5ECLB 1J0FA 3ZFBA 1KBNA 2YOIA 3JCML 4ECJA 1UVZA 2EC4A 4X43A 4ZXGA 3CSJA 1ZOFA 2EIOA 3ZREA 17GSA 2K9FA 4G0KA 2JSYA 4ZL8A 1M2BA 4TXOA 4F82A 1F2EA 2YN1A 4PUFC 1G0TA 5ECPB 5IQYA 1FAAA 2QKEA 1PA3A 2M80A 2B5XA 3LWAA 3PH9A 2BJXA 3R2QA 1Q98A 3MDKA 4X1UA 3MNGA 2HRFA 1DUGA 4EUYA 4KSOA 1V2AA 3IXRA 3TRPA 4TW5A 1ZYQB 2C3NA 3CRTA 3TOTA 5AISA 2LQQA 2YCDA 3C1RA 3H8QA 2B1KA 5DJLA 2L4QA 2XPDA 16GSA 3LYKA 3LXTA 2FA8A 3QFAC 4JE1A 4EC0A 4OMVA 1VF1A 1S3CA 2KP2A 2CQ9A 4RUVA 3CMIA 5D96A 1W89A 1TXXA 3RPNA 1QUWA 1YEXA 4GLTA 4MK3A 1E2YA 4KX4A 2CV4A 2H1GA 1JLVA 3ED3A 2VM2A 2MMOA 1K0MA 2NDOA 3MWHA 4RQRA 1VRSD 3VFIA 2H72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q5N A;  3SBC A;  2IJY A;  3M9J A;  4IQ1 A;  5IMD A;  3FW2 A;  2VCW A;  3VPT A;  1QFN A;  4JBB A;  3N5O A;  2YPM A;  5F07 A;  3NOF A;  5AIV A;  5HR2 A;  1R26 A;  5JCG A;  1AC1 A;  2ALB A;  1T3B A;  2H6X A;  3QDN A;  2VCV A;  4OO4 A;  2L6D A;  2V6K A;  4I97 A;  3ZIJ A;  2R5G A;  4NV2 A;  1M7T A;  2CA8 A;  4ACS A;  3TKS A;  5KN1 A;  4I5Q A;  4KDY A;  4JED A;  4OCE A;  3IV4 A;  1TI1 A;  4HUA A;  2D2Z A;  2ON5 A;  3DIE A;  3G7I A;  1HYU A;  4G2E A;  2H1A A;  2C0E A;  4PQH A;  2L59 A;  3CYN A;  2LKU A;  3UEM A;  4IP6 A;  2VL3 A;  2C4J A;  5EL8 A;  1OE8 A;  2LV3 A;  3HD5 A;  2VCZ A;  4N0Z A;  3WYW A;  2LRC A;  1TRS A;  3QR6 A;  5DQS A;  2A2R A;  1Z3E A;  1QMV A;  3RBT A;  1EV9 A;  4MP4 A;  1X5D A;  4IEL A;  4KW6 A;  4ID0 A;  4IW9 A;  2MMN A;  1I5G A;  3QAV A;  3KTB A;  1J08 A;  3CTG A;  3HVV A;  3F0I A;  3RPP A;  2DIZ A;  4XRA A;  5IMZ A;  1TRW A;  1QGV A;  2VUP A;  3IRA A;  2G2Q A;  4G10 A;  2H19 A;  2VD1 A;  3VWX A;  3HZ4 A;  4WF5 A;  4HJ2 A;  5ECI B;  4GST A;  1S3D A;  2C3T A;  1OYJ A;  4N10 A;  1VGL A;  2NVL A;  1JLW A;  3E3E A;  4V1A g;  1BED A;  1MDI A;  1K0A A;  2L6C A;  1SYR A;  6GSW A;  3QAW A;  2LST A;  4EO3 A;  1AQV A;  2CAI A;  4XS1 A;  3IK9 A;  1TI3 A;  2GT5 A;  2M72 A;  3TRX A;  3F9U A;  2WJU A;  1A2J A;  1URM A;  2B3S A;  4J57 E;  5IO2 A;  4FYB A;  3S9F A;  3ISO A;  1NHY A;  2LS5 A;  1X9S B;  2CX3 A;  2I4A A;  1SJZ A;  2ZNM A;  4TR1 A;  4POK A;  5JWO B;  1WWJ A;  2XBI A;  1WRY A;  3KEB A;  3M0F A;  4POL A;  1G6W A;  3CSH A;  1VF3 A;  3L0H A;  1AXD A;  2H75 A;  3D4M A;  1A0R P;  1OAZ A;  5J41 A;  3GUR A;  3Q74 A;  1GUM A;  4O5R A;  2IN3 A;  4DSS A;  1O85 A;  1ZCP A;  1G7O A;  4AJ6 A;  1WMJ A;  3P2A A;  4IP1 A;  1YKC A;  3DRN A;  1SKS B;  2REM A;  4MJE A;  2PU9 C;  1JFU A;  4MF7 A;  1B9Y C;  3F6F A;  5CRW A;  5COH A;  2CZ2 A;  3F3R A;  13GS A;  5LNK e;  1N2A A;  1XCC A;  4JR4 A;  1TP9 A;  5ELA A;  3TJK A;  5HFK A;  1GNW A;  2VO4 A;  5IMV A;  5DQY A;  4XTS A;  5KN3 A;  3IC4 A;  2HT9 A;  1Z7P A;  4Z7X A;  9GSS A;  3HHV A;  1A0F A;  2GS3 A;  4K0G A;  1G6Y A;  2ZUP A;  3GSS A;  4MZW A;  3O3T A;  5L71 A;  3SWL A;  1V9W A;  2P5R A;  4GXZ A;  2CX4 A;  3LG6 A;  3O6T A;  1BX9 A;  1TW9 A;  4ZBB A;  2H30 A;  4L0U A;  1O6J A;  3FK8 A;  5CO3 A;  4XCS A;  4EXJ A;  4BVY A;  1M9B A;  1XFL A;  4Q5F A;  1XVQ A;  3APQ A;  4N11 A;  2RM6 A;  5JWR B;  6GSS A;  1BQ7 A;  4HQS A;  2O89 A;  1SL0 B;  3ZMK A;  2YV7 A;  3FR6 A;  3D6I A;  3DVW A;  3UAP A;  2VIM A;  2J23 A;  2VCT A;  1QQ2 A;  5HFG A;  5D93 A;  4KE3 A;  4TRX A;  2H71 A;  1EOH A;  4JRR A;  1SK0 A;  2E2G A;  4PUR A;  2VL9 A;  4XS4 B;  3TKR A;  3RAZ A;  4KB3 A;  5DDL A;  3BD2 A;  4F0B A;  5IIZ A;  3L9S A;  2WDU A;  3FY7 A;  1YF0 A;  2GVP A;  5IMA A;  2IFQ B;  1EP7 A;  2O87 A;  3VWU A;  2VCQ A;  4WR5 A;  2L5O A;  4KUN A;  1UN2 A;  3ZZX A;  1FOV A;  4HEA 2;  1U88 A;  2V6O A;  2Z9S A;  2K8S A;  3GUS A;  4XIH A;  5F0G A;  5IPH A;  1SKW B;  1GP1 A;  2FWG A;  3C73 A;  2WFC A;  1T00 A;  1F37 A;  3NZN A;  5CP1 A;  1ST9 A;  3HYP A;  3TJF A;  1OC3 A;  5A4U A;  2H6Z A;  3EWL A;  1V98 A;  1DBY A;  1IYI A;  1GLQ A;  4PQI A;  3GKK A;  1ERU A;  4DSR A;  4BWS A;  3H79 A;  4YH2 A;  3KCM A;  3G9B A;  3MSZ A;  3DXB A;  4FO5 A;  1JZW A;  3GMF A;  3H1N A;  4GTU A;  2VLT A;  3KH9 A;  3W8J A;  4J2F A;  1ZGN A;  1EEM A;  1Z5Y E;  2FNO A;  3TDG A;  2HZE B;  1J9B A;  3P7X A;  1R5A A;  1XZO A;  4GQC A;  4K0N A;  1M9A A;  4NWY A;  4TR4 A;  2YWO A;  3ZL5 A;  5DAK A;  2N5B A;  3LGC A;  4TVE A;  3APS A;  1YQ1 A;  4HJM A;  1E6B A;  5DCH A;  2CT6 A;  3ZFL A;  3ERG A;  3GA4 A;  5FHI A;  1XVW A;  5A4W A;  3IAM 2;  4AJ7 A;  4K6X A;  2LRT A;  1FB6 A;  2DLX A;  2R4V A;  3BBY A;  1XXU A;  2N5A A;  5FWG A;  4OFM A;  3FYG A;  3A5W A;  1TRU A;  3DGQ A;  2V2G A;  4EE0 A;  5ECR B;  2C0F A;  4DSQ A;  2H8L A;  3FR9 A;  1ZZY A;  2A4V A;  1PL1 A;  3IBH A;  2FUG 2;  2FA4 A;  5F06 A;  5DAL B;  1JZR A;  2PMT A;  3GST A;  1PX7 A;  3UBK A;  3QFB C;  2EIQ A;  1R7H A;  2GSQ A;  1HNC A;  2IL3 A;  5CRD A;  6GSV A;  1GTB A;  1XOA A;  3GL5 A;  2FWE A;  3MAK A;  4GQF A;  3TGZ A;  5ECM B;  3TUE A;  3TKS E;  1W4V A;  2E0Q A;  1ZYE A;  1TK0 B;  2B1L A;  2WGR A;  2AV4 A;  4ZL7 A;  1O8X A;  4ZIJ A;  3P90 A;  1XWG A;  1AQW A;  4TKY A;  3D4T A;  2YWM A;  4PXO A;  2JZR A;  1SK1 A;  2ES7 A;  19GS A;  5ID2 A;  1O81 A;  1THO A;  2LRN A;  2DJ3 A;  2DSA A;  3L9U A;  4K1F A;  1KTE A;  1CQG A;  3KMO A;  3I9V 2;  2PUK C;  20GS A;  3WGD A;  4XS6 A;  4H86 A;  5ABR A;  2LJR A;  5KEJ A;  1A2M A;  2C3Q A;  4K7N A;  2BTO T;  3EMP A;  1BG5 A;  4OD7 A;  2I81 A;  1F9M A;  2OA7 A;  1C72 A;  3ZML A;  6GSY A;  3VLN A;  4N0V A;  4OWY A;  4WBJ A;  3DML A;  2LNT A;  1U6T A;  1R4W A;  2PVO C;  1K0D A;  4IGJ A;  1SD8 A;  4MDC A;  2OE1 A;  3FZ9 A;  1Y25 A;  4MLY A;  2DJ1 A;  3KZQ A;  4MH2 A;  2DJJ A;  2AAW A;  2K18 A;  4AF2 A;  3W8S A;  4WKW A;  3TRQ A;  3UVT A;  2R3X A;  2KP1 A;  1QXH A;  1ZL9 A;  4L8E A;  2FLS A;  2IPA A;  1SL1 B;  2P0G A;  2YWN A;  1G7E A;  4MMM A;  3GYK A;  3D0Z A;  5HFI A;  1OE7 A;  5CRG A;  2HI7 A;  3CXG A;  2HSH A;  3TJJ A;  2FD3 A;  4IQA A;  4F2I A;  4DVC A;  2GQM A;  2ON7 A;  2H0G A;  1PN9 A;  1WJK A;  1RK4 A;  3EUR A;  3OR5 A;  2H66 A;  3HCZ A;  3C8E A;  3D22 A;  4FYU A;  3I6A A;  1THX A;  2HLS A;  5DJM A;  3EU3 A;  4KAE A;  4EKZ A;  5ECO B;  4IN0 A;  2LUS A;  1K0O A;  1ZMA A;  1YJ6 A;  1TU8 A;  2KUC A;  5C00 A;  4K7I A;  1YF1 A;  5D73 A;  5CNW A;  3LYP A;  2VCX A;  4PNG A;  2WB9 A;  4BA7 A;  3GX0 A;  2LJA A;  3NIV A;  4BPY A;  3GKN A;  3EU4 A;  1RW1 A;  4IJ3 A;  2PGT A;  4LA1 A;  2EIR A;  2XPE A;  4NPB A;  1N8J A;  1V58 A;  4PQ1 A;  3UIW A;  2TRX A;  2I3Y A;  1A8L A;  4WET A;  2YWI A;  4Q5Q A;  4NXI A;  1GSQ A;  4PX1 A;  1ERT A;  5IMF A;  4LL1 B;  2I9H A;  4G19 A;  3KP9 A;  2WRT A;  4JR6 A;  4HS1 A;  1LU4 A;  5J3R A;  4CHS A;  2OE0 A;  3GIX A;  1SD9 A;  4KDX A;  3AY8 A;  3VI5 A;  2TIR A;  3RHC A;  1K3Y A;  2PWJ A;  1XW9 A;  3HA9 A;  3G7Y A;  4KGI A;  3ERW A;  4OFT A;  4YQM A;  3U6V A;  1KEB A;  4EL1 A;  1SJI A;  2OJL A;  1MDJ A;  3EVI A;  2F9S A;  5GAN D;  1KNG A;  2N5F A;  1Y6E A;  4ECC A;  2H74 A;  3HVS A;  2YV9 A;  1F6M C;  2DML A;  10GS A;  4MF5 A;  5H5S A;  1SYX A;  3UAR A;  2FGX A;  4FIW A;  4NMU A;  1V40 A;  4HZ2 A;  2HNL A;  2GST A;  1ILO A;  2JSZ A;  3A3T A;  3KXO A;  4RI7 A;  3WT1 A;  2IMK A;  4RI6 A;  3GTU B;  4MH3 A;  1OC9 B;  3DKS A;  3UMA A;  2B7J A;  2FY6 A;  5IOW A;  1K0C A;  4D73 B;  3QMX A;  4MJB A;  3HJO A;  1TK8 B;  3V1W A;  3LFL A;  6GSU A;  1GNE A;  2JU5 A;  4I8B A;  2JL4 A;  2VL2 A;  3E0U A;  2CAQ A;  2DJ0 A;  4V1A p;  2MMA A;  3GV1 A;  3CBU A;  3U5R E;  5JWQ B;  1XW6 A;  2KHP A;  2K8V A;  1GTI A;  5AIX A;  2E2M A;  4J56 E;  3BJ5 A;  2C0G A;  3DEX A;  5KN2 A;  2MBS A;  3FZA A;  3C7M A;  1WP0 A;  1ERW A;  12GS A;  3ZLP A;  3BCI A;  2H0I A;  1VF4 A;  1GTA A;  2IWT A;  5D9X A;  3TJG A;  3FKF A;  1B8X A;  1Z6M A;  4BL7 A;  3M3M A;  4AGS A;  1GTU A;  2F51 A;  1OVN A;  4ISD A;  2HZF A;  3HDC A;  2NTO A;  3GN3 A;  1LBK A;  1NSW A;  2P5Q A;  4L5O A;  3HJM A;  1SEN A;  3GRX A;  5G5F A;  4YAV A;  3UL3 A;  1UA5 A;  1EWX A;  3TB2 A;  1GUL A;  1GL8 A;  1Q4J A;  5A4V A;  4ZBA A;  2ZCT A;  5GAP D;  5G31 A;  2H1B A;  1HNB A;  1GSY A;  1SJ6 A;  1BAY A;  4KH7 A;  3IK7 A;  3HZ8 A;  5J9C A;  1JZD A;  4EDY A;  5DCG A;  14GS A;  2DMM A;  5HQP A;  2GGT A;  3GX8 A;  2G0F A;  1AIU A;  2H01 A;  3LSZ A;  2H70 A;  1MD4 A;  4HQZ A;  5IO0 A;  3M9K A;  3IOS A;  4ZB8 A;  4WEY A;  2LEG A;  2OBK A;  4LL4 B;  3FR3 A;  4MA9 A;  5D9V A;  1XWK A;  5CYY A;  4HU7 A;  3PIN A;  4MAB A;  1O73 A;  4YQU A;  4EVM A;  2F3M A;  3M8N A;  5F8B A;  8GSS A;  1CQH A;  2RUE A;  5ECN B;  2PVQ A;  4QL7 A;  1K0B A;  2V32 A;  3DWV A;  1K3O A;  3WD6 A;  3IA1 A;  5DVB A;  1FG4 A;  3O76 A;  2IME A;  3ZTL A;  1MTC A;  2V1M A;  4LMV A;  3UBL A;  1YEP A;  4V2M A;  4TXO B;  2B5E A;  1T4Z A;  3A2W A;  5HR0 A;  2MYG A;  5G2Z A;  5F05 A;  4K2D A;  5B8B A;  1QK8 A;  3VPQ A;  2GSR A;  1GSD A;  1RQM A;  1FVK A;  3Q18 A;  4K9Z A;  4YAP A;  18GS A;  5D9W A;  2F8A A;  2O8V B;  1TOF A;  2JZT A;  5G1K A;  1XPV A;  1AAZ A;  3GL3 A;  1B4Q A;  2WCI A;  2H1D A;  4GRF A;  1MDK A;  2BMX A;  5D9T A;  1SKR B;  2X99 A;  1ACV A;  1S3A A;  2H6Y A;  3QCP A;  4OCF A;  3P8W A;  3HKR A;  2YZU A;  5B6N A;  5E4W A;  3TCO A;  4I6X A;  1GSF A;  2FWF A;  2IMF A;  1TTZ A;  1HQO A;  3PR8 A;  5GSS A;  3KIJ A;  4XS4 A;  4ZIL A;  3H4K A;  4FYC A;  1LJR A;  3L4N A;  1T4Y A;  2GSS A;  2JAD A;  3KMN A;  2QSI A;  1FVJ A;  2LNS A;  1K0N A;  4IJI A;  2DBC A;  2YJ7 A;  2IFQ A;  5GZZ B;  2E7P A;  1A8Y A;  4KDU A;  4ZB9 A;  5CAX A;  4PNF A;  2FHE A;  4MZC A;  11GS A;  2GTU A;  3L78 A;  1PL2 A;  1I9D A;  4NHW A;  1R5P A;  1ON4 A;  3DVX A;  3ME8 A;  3EC3 A;  4LLR A;  2L4C A;  1PRX A;  2IIY A;  2GZY A;  4TXV A;  3GKM A;  4N30 A;  3ZRD A;  4X0X A;  2R6K A;  3UVH A;  1TKD B;  3EYT A;  3WGX A;  5J4U A;  2CVB A;  5G30 A;  5B6M A;  1PD2 1;  3ZVJ A;  2GZZ A;  4IS0 A;  1T8E B;  2J9H A;  2CZ3 A;  4WXT A;  5H5R A;  3PGT A;  4O7H A;  22GS A;  1O7U A;  1X5E A;  1FHE A;  3HY2 A;  4GCI A;  2YZH A;  4O92 A;  4TOP A;  2VLV A;  1X0R A;  2HZE A;  2VL2 C;  3A2X A;  1HD2 A;  3Q6O A;  2RUF A;  2OAD A;  2YP6 A;  4ZB6 A;  3F4R A;  4G9H A;  1USB A;  2GZP A;  1EP8 A;  3KGK A;  4POM A;  3QD9 A;  3VUR A;  4ECI A;  4CDO A;  2PBJ A;  5J9B A;  1GRX A;  1PMT A;  3F4T A;  3KM6 A;  6GST A;  4WR4 A;  2GT6 A;  3FZ5 A;  1GSS A;  5CRE A;  4ML1 A;  1T7P B;  2B7K A;  3VK9 A;  3QPM A;  2GLR A;  1TDI A;  5JCW A;  4MF6 A;  3C1S A;  5B8A A;  5DAL A;  3LEF A;  3A2V A;  4WBR D;  2K6V A;  2KOK A;  1EEJ A;  4TR0 A;  4NHZ A;  3LXZ A;  4FH8 A;  3US3 A;  3D5J A;  3C71 A;  2DC5 A;  1Z9H A;  3TKP A;  2AB6 A;  4QL9 A;  3F3Q A;  4MJC A;  2RII A;  2GDR A;  1JZO A;  4E8E A;  1PGT A;  1SK2 A;  3F6D A;  5HR1 A;  3WT2 A;  4KA0 A;  1TJD A;  3DD3 A;  3HJP A;  3LQ7 A;  1Z7R A;  1GSE A;  2AJQ B;  2HSY A;  5D8I A;  1GH2 A;  1X5C A;  1H4O A;  3F8U A;  5IOX A;  2C1Y A;  3J7Y b;  1VF2 A;  1X9M B;  2RM5 A;  3UJ1 A;  1GSU A;  3GH9 A;  1DSB A;  2C8U A;  4ILF A;  2OE3 A;  3TOU A;  1XBS A;  2HYX A;  1YKA A;  5LD0 A;  4HU9 A;  4O32 A;  2VM1 A;  2KLX A;  1T1V A;  4TR1 B;  3GKX A;  1PQN A;  3GH6 A;  4OFN A;  3VWW A;  5FT3 A;  2H76 A;  2YJH A;  5EVO A;  4P3Y B;  2MZC A;  3F63 A;  2YAN A;  2JAC A;  1XWC A;  6GSX A;  3QAG A;  4OO5 A;  1FO5 A;  1EZK A;  2XBQ A;  1U87 A;  4BVX A;  4DSS B;  2PPT A;  2H0H A;  1F3A A;  3FRC A;  5IM9 A;  4ZBD A;  5INY A;  4E8H A;  2X8H A;  2TRC P;  3KJY A;  3GHA A;  1SL2 B;  1WOU A;  1PSQ A;  1XWA A;  3ZYW A;  3UOM A;  3LOR A;  1MD3 A;  3LJR A;  1MEK A;  5EY6 A;  4MJA A;  4F03 A;  1K3L A;  2IMI A;  4YQV A;  4KCA A;  5JCU A;  3BCK A;  4JU5 A;  5EPF A;  3RHB A;  5J5N A;  5E59 A;  5G1L A;  1YZX A;  3VI7 A;  3M1G A;  1WE0 A;  2XC2 A;  3KH7 A;  4JZQ A;  1GWC A;  5ECQ B;  5ENU A;  3HXS A;  2HE3 A;  1M2D A;  2O85 A;  2C80 A;  2WS2 A;  4K7O A;  1JHB A;  1AUC A;  4CW9 A;  2F8F A;  4LMW A;  1EGO A;  3ERF A;  5KN0 A;  1M99 A;  5AN1 A;  3RDW A;  1XWB A;  4ML6 A;  2DIY A;  2R37 A;  5ECH B;  1FW1 A;  3DYR A;  1DE2 A;  3CSI A;  3KD0 A;  5H5Q A;  2OKA A;  3TJB A;  3KP8 A;  2R2J A;  4IHU A;  3GNJ A;  3IHQ A;  2LTK A;  2NBS A;  5LCZ A;  2PN8 A;  1TK5 B;  1A2L A;  4HZ4 A;  1PKZ A;  2XHF A;  4DEJ A;  2YNX A;  5A5K A;  2GQK A;  1F3B A;  3IPZ A;  1GUH A;  2DJK A;  2FCH A;  4HOJ A;  4V2L A;  4Q5R A;  4HDE A;  3I69 A;  5B7C A;  1WIK A;  2IMD A;  5AGY A;  1YDK A;  5HR3 A;  4AJ8 A;  1M0U A;  2FWH A;  3FEU A;  3E9J B;  4ZL9 A;  1GUK A;  3N9J A;  3CRU A;  1YY7 A;  1XOB A;  2JZS A;  4TR3 A;  1TU7 A;  1PX6 A;  3GFK A;  2PER A;  1OKT A;  2M46 A;  1XIY A;  4V2N A;  2X64 A;  7GSS A;  2L5L A;  3IAS 2;  1EV4 A;  3WGE A;  1V57 A;  3QOU A;  1DE1 A;  1IYH A;  2OAC A;  4L0W A;  2B6M A;  1AQX A;  2WZ9 A;  1UC7 A;  2H73 A;  2LQO A;  2VLU A;  1A24 A;  4GF0 A;  2I1U A;  1B9X C;  3Q19 A;  4IBP A;  4IKH A;  5GST A;  4TN8 A;  2QGV A;  2P31 A;  2OBI A;  3L9V A;  4K8M A;  4XHM A;  4GWR A;  3TKQ A;  2HRN A;  2GQL A;  3ME7 A;  1U3I A;  3HVX A;  3BOA A;  3KTL A;  4MPF A;  4ULX A;  2HFD A;  2WUL A;  1NM3 A;  1X9W B;  3IE3 A;  4HI7 A;  4MZB A;  2NPB A;  4POB A;  2O7K A;  2LJK A;  5DAK B;  3GTU A;  5ELG A;  3J7Y k;  1OC9 A;  1H75 A;  3APO A;  1AW9 A;  4GSN A;  4D73 A;  2VD0 A;  2RLI A;  3CTF A;  1HNA A;  3IR4 A;  4BWQ A;  1OKD A;  3K8N A;  1BYE A;  1B4P A;  1NHO A;  5IMC A;  2C0D A;  3FHK A;  5IPG A;  1ABA A;  4MPG A;  3TKS C;  4MCU A;  1EGR A;  3EE2 A;  1EOG A;  1U3A A;  2AYT A;  4EF0 A;  4NAX A;  2VOC A;  2HXK A;  4QQ7 A;  2B5Y A;  4KCE A;  2MMZ A;  5ECS A;  3VWV A;  1WPI A;  2DJ2 A;  1SU9 A;  1BJX A;  4GSS A;  4KSM A;  2X8C A;  2AHE A;  1FB0 A;  1PKW A;  3D21 A;  2CVK A;  3W6G A;  4EDZ A;  2VAF A;  1A23 A;  4WF4 A;  2V41 A;  3EMX A;  3FZ4 A;  4PGT A;  4I2T A;  4F0C A;  4F9Z A;  4IVF A;  4RQX A;  3EIN A;  5C04 A;  5G5E A;  1NW2 A;  4ECB A;  5ID2 B;  3ZVJ D;  4KND A;  3ZIV A;  2A2S A;  5ECK B;  3I43 A;  1OC8 A;  4XRD A;  2QC7 A;  2X8G A;  1M2A A;  4L5L A;  3G7J A;  1TRV A;  2CVD A;  1Z6N A;  3F4S A;  3H93 A;  1ML6 A;  2AUV A;  5DBQ A;  1B48 A;  1GLP A;  3ZIT A;  2MBT A;  5CRH A;  1ERV A;  4PUA A;  1XW5 A;  3IDV A;  1O8W A;  4I2U A;  4NV5 A;  2L57 A;  5ECL B;  1J0F A;  3ZFB A;  1KBN A;  2YOI A;  3JCM L;  4ECJ A;  1UVZ A;  2EC4 A;  4X43 A;  4ZXG A;  3CSJ A;  1ZOF A;  2EIO A;  3ZRE A;  17GS A;  2K9F A;  2JSY A;  4ZL8 A;  1M2B A;  4TXO A;  4F82 A;  1F2E A;  2YN1 A;  4PUF C;  1G0T A;  5ECP B;  5IQY A;  1FAA A;  2QKE A;  1PA3 A;  2M80 A;  2B5X A;  3LWA A;  3PH9 A;  2BJX A;  3R2Q A;  1Q98 A;  3MDK A;  4X1U A;  3MNG A;  2HRF A;  1DUG A;  4EUY A;  4KSO A;  1V2A A;  3IXR A;  3TRP A;  4TW5 A;  1ZYQ B;  2C3N A;  3CRT A;  3TOT A;  5AIS A;  2LQQ A;  2YCD A;  3C1R A;  3H8Q A;  2B1K A;  5DJL A;  2L4Q A;  2XPD A;  16GS A;  3LYK A;  3LXT A;  2FA8 A;  3QFA C;  4JE1 A;  4EC0 A;  4OMV A;  1VF1 A;  1S3C A;  2KP2 A;  2CQ9 A;  4RUV A;  3CMI A;  5D96 A;  1W89 A;  1TXX A;  3RPN A;  1QUW A;  1YEX A;  4GLT A;  4MK3 A;  1E2Y A;  4KX4 A;  2CV4 A;  2H1G A;  1JLV A;  3ED3 A;  2VM2 A;  2MMO A;  1K0M A;  2NDO A;  3MWH A;  4RQR A;  1VRS D;  3VFI A;  2H72 A; 
#chains in the Genus database with same CATH topology
 4Q5N A;  3SBC A;  4BVX B;  2IJY A;  3M9J A;  4IQ1 A;  5IMD A;  3FW2 A;  3MYD A;  2VCW A;  3VPT A;  1QFN A;  4JBB A;  3N5O A;  2YPM A;  5F07 A;  3NOF A;  5AIV A;  5HR2 A;  1R26 A;  5JCG A;  1AC1 A;  2ALB A;  1T3B A;  2H6X A;  3QDN A;  2VCV A;  4OO4 A;  2L6D A;  2V6K A;  4I97 A;  3ZIJ A;  2R5G A;  4NV2 A;  1M7T A;  2CA8 A;  4ACS A;  3TKS A;  5KN1 A;  4I5Q A;  4KDY A;  4JED A;  4OCE A;  3IV4 A;  1TI1 A;  4HUA A;  2D2Z A;  2ON5 A;  3DIE A;  3G7I A;  1HYU A;  4G2E A;  2H1A A;  2C0E A;  4PQH A;  2L59 A;  3CYN A;  2LKU A;  3UEM A;  4IP6 A;  2VL3 A;  2C4J A;  5EL8 A;  1OE8 A;  2LV3 A;  3HD5 A;  2VCZ A;  4N0Z A;  3WYW A;  2LRC A;  1TRS A;  3QR6 A;  5DQS A;  2A2R A;  1Z3E A;  1QMV A;  3RBT A;  1EV9 A;  4MP4 A;  1X5D A;  4IEL A;  4KW6 A;  4ID0 A;  4IW9 A;  2MMN A;  1I5G A;  3QAV A;  3KTB A;  1J08 A;  3CTG A;  3HVV A;  3F0I A;  3RPP A;  2DIZ A;  4XRA A;  5IMZ A;  1TRW A;  1QGV A;  2VUP A;  3IRA A;  2G2Q A;  1PFO A;  4G10 A;  2H19 A;  2VD1 A;  3VWX A;  3HZ4 A;  4WF5 A;  4HJ2 A;  5ECI B;  4GST A;  1S3D A;  2C3T A;  1OYJ A;  4N10 A;  1VGL A;  2NVL A;  1JLW A;  3E3E A;  4V1A g;  1BED A;  1MDI A;  1K0A A;  2L6C A;  1SYR A;  6GSW A;  3QAW A;  2LST A;  4EO3 A;  1AQV A;  2CAI A;  4XS1 A;  5BMU A;  3IK9 A;  1TI3 A;  2GT5 A;  2M72 A;  3TRX A;  4Z2U A;  3F9U A;  2WJU A;  1A2J A;  1URM A;  2B3S A;  4J57 E;  5IO2 A;  4FYB A;  3S9F A;  4CY8 A;  3ISO A;  1NHY A;  2LS5 A;  1X9S B;  2CX3 A;  2I4A A;  1SJZ A;  4BL7 B;  2ZNM A;  4TR1 A;  4POK A;  5JWO B;  1WWJ A;  2XBI A;  1WRY A;  1M3I A;  3KEB A;  3M0F A;  4POL A;  2HRK A;  1G6W A;  3CSH A;  1VF3 A;  3L0H A;  1AXD A;  2H75 A;  3D4M A;  1A0R P;  1OAZ A;  5J41 A;  3GUR A;  3Q74 A;  1GUM A;  4O5R A;  2IN3 A;  4DSS A;  1O85 A;  1ZCP A;  1G7O A;  4AJ6 A;  1WMJ A;  2R0P A;  3P2A A;  4IP1 A;  1YKC A;  3DRN A;  1SKS B;  2REM A;  4MJE A;  2PU9 C;  1JFU A;  4MF7 A;  1B9Y C;  3F6F A;  5CRW A;  5COH A;  2CZ2 A;  3F3R A;  13GS A;  5LNK e;  1N2A A;  1XCC A;  4JR4 A;  1TP9 A;  5ELA A;  3TJK A;  2X4A A;  5HFK A;  1GNW A;  2VO4 A;  5IMV A;  5DQY A;  4XTS A;  5KN3 A;  3IC4 A;  2HT9 A;  1Z7P A;  4Z7X A;  9GSS A;  3HHV A;  1A0F A;  2GS3 A;  4K0G A;  1G6Y A;  2ZUP A;  3GSS A;  4MZW A;  3O3T A;  4USS A;  5L71 A;  3SWL A;  1V9W A;  2P5R A;  2A2P A;  4GXZ A;  2CX4 A;  3LG6 A;  3O6T A;  1BX9 A;  2DKH A;  1TW9 A;  4ZBB A;  2H30 A;  4L0U A;  1O6J A;  3FK8 A;  5CO3 A;  4XCS A;  4EXJ A;  4Z2R A;  4BVY A;  1M9B A;  1XFL A;  4Q5F A;  1XVQ A;  3APQ A;  4N11 A;  2RM6 A;  5JWR B;  6GSS A;  1BQ7 A;  4HQS A;  2O89 A;  1SL0 B;  3ZMK A;  2YV7 A;  3FR6 A;  3D6I A;  3DVW A;  3UAP A;  2VIM A;  2J23 A;  2VCT A;  1QQ2 A;  5HFG A;  5D93 A;  4KE3 A;  4TRX A;  2H71 A;  1EOH A;  4JRR A;  1SK0 A;  2E2G A;  4PUR A;  2VL9 A;  4XS4 B;  3TKR A;  3RAZ A;  4KB3 A;  5DDL A;  3BD2 A;  4F0B A;  5IIZ A;  3L9S A;  2WDU A;  3FY7 A;  1YF0 A;  2GVP A;  5IMA A;  2IFQ B;  1EP7 A;  2O87 A;  3VWU A;  2VCQ A;  4WR5 A;  2L5O A;  4KUN A;  1UN2 A;  3ZZX A;  1FOV A;  4HEA 2;  1U88 A;  2V6O A;  2Z9S A;  2K8S A;  3GUS A;  4XIH A;  5F0G A;  5IPH A;  1SKW B;  1GP1 A;  2FWG A;  3C73 A;  2WFC A;  1T00 A;  2QA1 A;  1F37 A;  3NZN A;  5CP1 A;  1ST9 A;  3HYP A;  3TJF A;  1OC3 A;  5A4U A;  2H6Z A;  3EWL A;  1V98 A;  1DBY A;  1IYI A;  1GLQ A;  4PQI A;  3GKK A;  1ERU A;  4DSR A;  4BWS A;  3H79 A;  4YH2 A;  3KCM A;  3G9B A;  3MSZ A;  3DXB A;  4FO5 A;  1JZW A;  3GMF A;  3H1N A;  4GTU A;  2VLT A;  3KH9 A;  3W8J A;  4J2F A;  1ZGN A;  1EEM A;  1Z5Y E;  2FNO A;  3TDG A;  2HZE B;  1J9B A;  3MIX A;  3P7X A;  1R5A A;  1XZO A;  4GQC A;  4K0N A;  1M9A A;  4NWY A;  4TR4 A;  2YWO A;  3ZL5 A;  5DAK A;  2N5B A;  3LGC A;  4TVE A;  3APS A;  1YQ1 A;  1ZYP A;  4HJM A;  1E6B A;  5DCH A;  2CT6 A;  3ZFL A;  3ERG A;  3GA4 A;  5FHI A;  1XVW A;  5A4W A;  3IAM 2;  4AJ7 A;  4K6X A;  3PPU A;  2LRT A;  1FB6 A;  2DLX A;  2R4V A;  3BBY A;  1XXU A;  2N5A A;  5FWG A;  4OFM A;  3FYG A;  3A5W A;  1TRU A;  3DGQ A;  2V2G A;  4EE0 A;  5ECR B;  2C0F A;  4DSQ A;  2H8L A;  3FR9 A;  1ZZY A;  2A4V A;  1PL1 A;  3IBH A;  2FUG 2;  2FA4 A;  5F06 A;  5DAL B;  1JZR A;  2PMT A;  3GST A;  1PX7 A;  3UBK A;  3QFB C;  2EIQ A;  1R7H A;  2GSQ A;  1HNC A;  2IL3 A;  5CRD A;  6GSV A;  1GTB A;  1XOA A;  3GL5 A;  2FWE A;  3MAK A;  4GQF A;  3TGZ A;  5ECM B;  3TUE A;  3TKS E;  1W4V A;  2E0Q A;  1ZYE A;  1TK0 B;  2B1L A;  2WGR A;  2AV4 A;  4ZL7 A;  1O8X A;  4ZIJ A;  3P90 A;  1XWG A;  1AQW A;  4TKY A;  3D4T A;  2YWM A;  4PXO A;  2JZR A;  1SK1 A;  2ES7 A;  3HVN A;  19GS A;  5ID2 A;  4ICY A;  1O81 A;  1THO A;  2LRN A;  2DJ3 A;  2DSA A;  3L9U A;  4K1F A;  1KTE A;  1CQG A;  3KMO A;  3I9V 2;  2PUK C;  20GS A;  3WGD A;  4XS6 A;  4H86 A;  5ABR A;  2LJR A;  5KEJ A;  1A2M A;  2C3Q A;  4K7N A;  2BTO T;  3EMP A;  1BG5 A;  4OD7 A;  2I81 A;  1F9M A;  2OA7 A;  1C72 A;  3ZML A;  6GSY A;  3VLN A;  4N0V A;  4OWY A;  4WBJ A;  3DML A;  2LNT A;  1U6T A;  4O5Q A;  1R4W A;  2PVO C;  1K0D A;  4IGJ A;  1SD8 A;  4MNN A;  4MDC A;  2OE1 A;  3FZ9 A;  1Y25 A;  4MLY A;  2DJ1 A;  3KZQ A;  4MH2 A;  2DJJ A;  2AAW A;  2K18 A;  4AF2 A;  3W8S A;  4WKW A;  3TRQ A;  3UVT A;  2R3X A;  2KP1 A;  1QXH A;  1ZL9 A;  4L8E A;  2FLS A;  2IPA A;  1SL1 B;  2P0G A;  2YWN A;  1G7E A;  4MMM A;  3GYK A;  3D0Z A;  5HFI A;  1OE7 A;  5CRG A;  2HI7 A;  3CXG A;  2HSH A;  3TJJ A;  2FD3 A;  4IQA A;  4F2I A;  4DVC A;  2GQM A;  2ON7 A;  2H0G A;  1PN9 A;  1WJK A;  1RK4 A;  3EUR A;  3OR5 A;  2H66 A;  3HCZ A;  3C8E A;  3D22 A;  4FYU A;  3I6A A;  1THX A;  2HLS A;  5DJM A;  3EU3 A;  4KAE A;  4EKZ A;  5ECO B;  4IN0 A;  2LUS A;  1K0O A;  1ZMA A;  1YJ6 A;  1TU8 A;  2KUC A;  5C00 A;  4K7I A;  1YF1 A;  5D73 A;  5CNW A;  3LYP A;  2VCX A;  4PNG A;  2WB9 A;  4BA7 A;  3GX0 A;  2LJA A;  3NIV A;  4BPY A;  3GKN A;  3EU4 A;  3LW9 A;  1RW1 A;  2R0G A;  4Z2T A;  4IJ3 A;  2PGT A;  4LA1 A;  2EIR A;  2XPE A;  4NPB A;  1N8J A;  1V58 A;  4PQ1 A;  3UIW A;  2TRX A;  2I3Y A;  1A8L A;  4WET A;  2YWI A;  4Q5Q A;  1M3J A;  4NXI A;  1GSQ A;  4PX1 A;  1ERT A;  5IMF A;  4LL1 B;  2I9H A;  4G19 A;  3KP9 A;  2WRT A;  4JR6 A;  4HS1 A;  1LU4 A;  5J3R A;  4CHS A;  2OE0 A;  3GIX A;  1SD9 A;  4KDX A;  3AY8 A;  3VI5 A;  2TIR A;  3RHC A;  1K3Y A;  2PWJ A;  1XW9 A;  3HA9 A;  3G7Y A;  4KGI A;  3ERW A;  3IHG A;  4OFT A;  4K2X A;  4YQM A;  3U6V A;  1KEB A;  4EL1 A;  1SJI A;  2OJL A;  1MDJ A;  3EVI A;  2F9S A;  5GAN D;  1KNG A;  2N5F A;  1Y6E A;  4ECC A;  2H74 A;  3HVS A;  2YV9 A;  1F6M C;  2DML A;  10GS A;  4MF5 A;  5H5S A;  1SYX A;  3UAR A;  2FGX A;  4FIW A;  4NMU A;  1V40 A;  4HZ2 A;  2HNL A;  2GST A;  1ILO A;  2JSZ A;  3A3T A;  3KXO A;  4RI7 A;  3WT1 A;  2IMK A;  4RI6 A;  3GTU B;  4MH3 A;  1OC9 B;  3DKS A;  3UMA A;  2B7J A;  2FY6 A;  5IOW A;  1K0C A;  4D73 B;  3QMX A;  4MJB A;  3HJO A;  1TK8 B;  3V1W A;  3LFL A;  6GSU A;  1GNE A;  2JU5 A;  4I8B A;  2JL4 A;  2VL2 A;  3E0U A;  2CAQ A;  4HSC X;  2DJ0 A;  4V1A p;  4KF9 A;  2MMA A;  3GV1 A;  3CBU A;  3U5R E;  5JWQ B;  1XW6 A;  2KHP A;  2K8V A;  1GTI A;  5AIX A;  2E2M A;  4J56 E;  3BJ5 A;  2C0G A;  3DEX A;  5KN2 A;  2MBS A;  3FZA A;  3C7M A;  1WP0 A;  1ERW A;  12GS A;  3ZLP A;  3BCI A;  2H0I A;  4G0L A;  1VF4 A;  1GTA A;  2IWT A;  5D9X A;  3TJG A;  3FKF A;  1B8X A;  1Z6M A;  4BL7 A;  1ZYN A;  3M3M A;  4AGS A;  1GTU A;  2F51 A;  1OVN A;  4ISD A;  4EIQ A;  2HZF A;  3EPT A;  3HDC A;  2NTO A;  3GN3 A;  1LBK A;  1NSW A;  2P5Q A;  4L5O A;  3HJM A;  1SEN A;  3GRX A;  5G5F A;  4YAV A;  3UL3 A;  1UA5 A;  1EWX A;  3TB2 A;  1GUL A;  1GL8 A;  1Q4J A;  5A4V A;  4ZBA A;  2ZCT A;  5GAP D;  5G31 A;  2H1B A;  1HNB A;  1GSY A;  1SJ6 A;  1BAY A;  4KH7 A;  3IK7 A;  3HZ8 A;  5J9C A;  1JZD A;  4EDY A;  5DCG A;  14GS A;  2DMM A;  5HQP A;  2GGT A;  3GX8 A;  2HRA A;  2G0F A;  1AIU A;  2H01 A;  3LSZ A;  2H70 A;  1MD4 A;  4HQZ A;  5IO0 A;  3M9K A;  3IOS A;  4ZB8 A;  4WEY A;  2LEG A;  2OBK A;  4LL4 B;  3FR3 A;  4MA9 A;  5D9V A;  1XWK A;  5CYY A;  4HU7 A;  3PIN A;  4MAB A;  1O73 A;  4YQU A;  4EVM A;  2F3M A;  3M8N A;  5F8B A;  8GSS A;  1CQH A;  2RUE A;  5ECN B;  2PVQ A;  4QL7 A;  1K0B A;  2R0C A;  2V32 A;  3DWV A;  1K3O A;  3WD6 A;  3IA1 A;  5DVB A;  1FG4 A;  3O76 A;  2IME A;  3ZTL A;  1MTC A;  2V1M A;  4LMV A;  3UBL A;  1YEP A;  4V2M A;  4TXO B;  2B5E A;  1T4Z A;  3A2W A;  5HR0 A;  2MYG A;  5G2Z A;  5F05 A;  4K2D A;  5B8B A;  1QK8 A;  3VPQ A;  2GSR A;  1GSD A;  1RQM A;  1FVK A;  3Q18 A;  4K9Z A;  4YAP A;  18GS A;  5D9W A;  2F8A A;  2O8V B;  1TOF A;  2JZT A;  5G1K A;  1XPV A;  1AAZ A;  3GL3 A;  1B4Q A;  2WCI A;  2H1D A;  4GRF A;  4YKG A;  1MDK A;  2BMX A;  5D9T A;  1SKR B;  2X99 A;  1ACV A;  1S3A A;  2H6Y A;  3QCP A;  4OCF A;  3P8W A;  3HKR A;  2YZU A;  5B6N A;  5E4W A;  3TCO A;  4I6X A;  3R3E A;  1GSF A;  2FWF A;  2IMF A;  1TTZ A;  1HQO A;  3PR8 A;  5GSS A;  3KIJ A;  4XS4 A;  4ZIL A;  3H4K A;  4FYC A;  1LJR A;  3L4N A;  1T4Y A;  2GSS A;  2JAD A;  5KOX A;  3KMN A;  2QSI A;  1FVJ A;  2LNS A;  1K0N A;  4IJI A;  2DBC A;  2YJ7 A;  2IFQ A;  5GZZ B;  2E7P A;  4K5S A;  1A8Y A;  4KDU A;  4ZB9 A;  5CAX A;  4PNF A;  2FHE A;  4MZC A;  11GS A;  2GTU A;  3L78 A;  1PL2 A;  1I9D A;  4NHW A;  1R5P A;  1ON4 A;  3DVX A;  3ME8 A;  3EC3 A;  4LLR A;  2L4C A;  1PRX A;  2IIY A;  4O5U A;  2GZY A;  4TXV A;  3GKM A;  4N30 A;  3ZRD A;  4A5P A;  4X0X A;  2R6K A;  3UVH A;  1TKD B;  3EYT A;  3WGX A;  5J4U A;  2CVB A;  5G30 A;  5B6M A;  1PD2 1;  3ZVJ A;  2GZZ A;  4IS0 A;  1T8E B;  2J9H A;  2CZ3 A;  4WXT A;  2X49 A;  5H5R A;  3PGT A;  4O7H A;  22GS A;  1O7U A;  1X5E A;  3A5I A;  1FHE A;  3HY2 A;  4GCI A;  2YZH A;  4O92 A;  4TOP A;  2VLV A;  1X0R A;  2HZE A;  2VL2 C;  3A2X A;  1HD2 A;  3Q6O A;  2RUF A;  2OAD A;  2YP6 A;  4ZB6 A;  3F4R A;  4G9H A;  1USB A;  2GZP A;  1EP8 A;  3KGK A;  4POM A;  3QD9 A;  3VUR A;  4ECI A;  4CDO A;  2PBJ A;  5J9B A;  1GRX A;  1PMT A;  3F4T A;  3KM6 A;  6GST A;  4WR4 A;  2GT6 A;  3FZ5 A;  1GSS A;  5CRE A;  4ML1 A;  1T7P B;  2B7K A;  3VK9 A;  3QPM A;  2GLR A;  1TDI A;  5JCW A;  4MF6 A;  3C1S A;  5B8A A;  5DAL A;  3LEF A;  3A2V A;  4WBR D;  2K6V A;  2KOK A;  1EEJ A;  4TR0 A;  4NHZ A;  3LXZ A;  4FH8 A;  3US3 A;  3D5J A;  3C71 A;  2DC5 A;  1Z9H A;  3TKP A;  2AB6 A;  4CY6 A;  3F3Q A;  4QL9 A;  4MJC A;  2RII A;  2GDR A;  1JZO A;  4E8E A;  3FMW A;  1PGT A;  1SK2 A;  3F6D A;  2HSM A;  5HR1 A;  3WT2 A;  4KA0 A;  1TJD A;  3DD3 A;  3HJP A;  3LQ7 A;  1Z7R A;  1GSE A;  2AJQ B;  2HSY A;  5D8I A;  1GH2 A;  1X5C A;  1H4O A;  3F8U A;  5IOX A;  2C1Y A;  3J7Y b;  1VF2 A;  1X9M B;  2RM5 A;  3UJ1 A;  1GSU A;  3GH9 A;  1DSB A;  2C8U A;  4ILF A;  2OE3 A;  3TOU A;  1XBS A;  2HYX A;  1YKA A;  5LD0 A;  4HU9 A;  4O32 A;  2VM1 A;  2KLX A;  1T1V A;  4TR1 B;  1S3R A;  3GKX A;  1PQN A;  3GH6 A;  4OFN A;  3VWW A;  5FT3 A;  2H76 A;  2YJH A;  5EVO A;  4P3Y B;  2MZC A;  3F63 A;  2YAN A;  2JAC A;  1XWC A;  6GSX A;  3QAG A;  4OO5 A;  1FO5 A;  5KOW A;  1EZK A;  2XBQ A;  1U87 A;  4BVX A;  4DSS B;  2PPT A;  2H0H A;  1F3A A;  3FRC A;  5IM9 A;  4ZBD A;  5INY A;  4E8H A;  2X8H A;  2TRC P;  3KJY A;  3GHA A;  1SL2 B;  1WOU A;  4EIP A;  1PSQ A;  1XWA A;  3ZYW A;  3UOM A;  3LOR A;  1MD3 A;  3LJR A;  1MEK A;  5EY6 A;  4MJA A;  4F03 A;  1K3L A;  2IMI A;  4YQV A;  4KCA A;  5JCU A;  3BCK A;  4JU5 A;  5EPF A;  3RHB A;  5J5N A;  5E59 A;  5G1L A;  1YZX A;  3VI7 A;  3M1G A;  1WE0 A;  2XC2 A;  3KH7 A;  4JZQ A;  1GWC A;  5ECQ B;  5ENU A;  3HXS A;  2HE3 A;  1M2D A;  2O85 A;  2C80 A;  2WS2 A;  4K7O A;  1JHB A;  1AUC A;  4CW9 A;  2F8F A;  4LMW A;  1EGO A;  3ERF A;  5KN0 A;  1M99 A;  5AN1 A;  3RDW A;  1XWB A;  4ML6 A;  2DIY A;  2R37 A;  5ECH B;  1FW1 A;  3DYR A;  1DE2 A;  4BVY B;  3CSI A;  3KD0 A;  5H5Q A;  2OKA A;  3TJB A;  3KP8 A;  2R2J A;  4IHU A;  3GNJ A;  3IHQ A;  2LTK A;  2NBS A;  5LCZ A;  2PN8 A;  1TK5 B;  1A2L A;  4HZ4 A;  1PKZ A;  2XHF A;  4DEJ A;  2YNX A;  5A5K A;  2GQK A;  1F3B A;  3IPZ A;  1GUH A;  2DJK A;  2FCH A;  4HOJ A;  4V2L A;  4Q5R A;  4HDE A;  3I69 A;  5B7C A;  1WIK A;  2IMD A;  5AGY A;  1YDK A;  5HR3 A;  4AJ8 A;  2A4H A;  1M0U A;  2FWH A;  3FEU A;  3E9J B;  4ZL9 A;  1GUK A;  3N9J A;  3CRU A;  4X4J A;  1YY7 A;  1XOB A;  2JZS A;  4TR3 A;  4YKF A;  1TU7 A;  3IC8 A;  1PX6 A;  3GFK A;  2PER A;  1OKT A;  2M46 A;  1XIY A;  4V2N A;  2X64 A;  7GSS A;  2L5L A;  3IAS 2;  1EV4 A;  3WGE A;  1V57 A;  3QOU A;  1DE1 A;  1IYH A;  2OAC A;  4L0W A;  2B6M A;  1AQX A;  2WZ9 A;  1UC7 A;  2H73 A;  2LQO A;  2VLU A;  1A24 A;  4GF0 A;  2I1U A;  1B9X C;  3Q19 A;  4IBP A;  4IKH A;  5GST A;  4TN8 A;  2DKI A;  2QGV A;  2P31 A;  2OBI A;  3L9V A;  4K8M A;  4K5R A;  4XHM A;  4GWR A;  3TKQ A;  2HRN A;  2GQL A;  5BRT A;  3ME7 A;  1U3I A;  3HVX A;  3BOA A;  3KTL A;  4MPF A;  4ULX A;  2HFD A;  2WUL A;  1NM3 A;  1X9W B;  3IE3 A;  4HI7 A;  4PTS A;  4MZB A;  2NPB A;  4POB A;  2O7K A;  2LJK A;  5DAK B;  3GTU A;  5ELG A;  3J7Y k;  3CQF A;  1OC9 A;  1H75 A;  3APO A;  1AW9 A;  4GSN A;  4D73 A;  2VD0 A;  2RLI A;  3CTF A;  1HNA A;  4BIK A;  3IR4 A;  4BWQ A;  1OKD A;  3K8N A;  1BYE A;  1B4P A;  1NHO A;  5IMC A;  2C0D A;  3FHK A;  5IPG A;  1ABA A;  4MPG A;  3TKS C;  4MCU A;  1EGR A;  3EE2 A;  1EOG A;  1XG8 A;  1U3A A;  2AYT A;  4EF0 A;  4NAX A;  2VOC A;  2HXK A;  4QQ7 A;  2B5Y A;  4KCE A;  2MMZ A;  2UZ8 A;  5ECS A;  3VWV A;  1WPI A;  2DJ2 A;  1SU9 A;  1BJX A;  4GSS A;  4KSM A;  1PN0 A;  2X8C A;  2AHE A;  1FB0 A;  1PKW A;  3D21 A;  2CVK A;  3W6G A;  4EDZ A;  2VAF A;  1A23 A;  4WF4 A;  1FOH A;  2V41 A;  3EMX A;  3FZ4 A;  4PGT A;  4I2T A;  4F0C A;  4F9Z A;  4IVF A;  4RQX A;  3EIN A;  5C04 A;  5G5E A;  1NW2 A;  4ECB A;  5ID2 B;  3ZVJ D;  4KND A;  3ZIV A;  4G0I A;  2A2S A;  5ECK B;  3I43 A;  1OC8 A;  4XRD A;  2QC7 A;  2X8G A;  1M2A A;  4L5L A;  3G7J A;  1TRV A;  2CVD A;  4FQU A;  1Z6N A;  3F4S A;  3H93 A;  1ML6 A;  2AUV A;  5DBQ A;  1B48 A;  1GLP A;  2QA2 A;  3ZIT A;  2MBT A;  5CRH A;  1ERV A;  4PUA A;  1XW5 A;  3IDV A;  1O8W A;  4I2U A;  4NV5 A;  2L57 A;  5ECL B;  1J0F A;  3ZFB A;  1KBN A;  2YOI A;  3JCM L;  4ECJ A;  1UVZ A;  2EC4 A;  4X43 A;  4ZXG A;  3CSJ A;  1ZOF A;  2EIO A;  3ZRE A;  17GS A;  2K9F A;  4G0K A;  2JSY A;  4ZL8 A;  1M2B A;  4TXO A;  4F82 A;  1F2E A;  2YN1 A;  4PUF C;  1G0T A;  5ECP B;  5IQY A;  1FAA A;  2QKE A;  1PA3 A;  2M80 A;  2B5X A;  3LWA A;  3PH9 A;  2BJX A;  3R2Q A;  1Q98 A;  3MDK A;  4X1U A;  3MNG A;  2HRF A;  1DUG A;  4EUY A;  4KSO A;  1V2A A;  3IXR A;  3TRP A;  4TW5 A;  1ZYQ B;  2C3N A;  3CRT A;  3TOT A;  5AIS A;  2LQQ A;  2YCD A;  3C1R A;  3H8Q A;  2B1K A;  5DJL A;  2L4Q A;  2XPD A;  16GS A;  3LYK A;  3LXT A;  2FA8 A;  3QFA C;  4JE1 A;  4EC0 A;  4OMV A;  1VF1 A;  1S3C A;  2KP2 A;  2CQ9 A;  4RUV A;  3CMI A;  5D96 A;  1W89 A;  1TXX A;  3RPN A;  1QUW A;  1YEX A;  4GLT A;  4MK3 A;  1E2Y A;  4KX4 A;  2CV4 A;  2H1G A;  1JLV A;  3ED3 A;  2VM2 A;  2MMO A;  1K0M A;  2NDO A;  3MWH A;  4RQR A;  1VRS D;  3VFI A;  2H72 A; 
#chains in the Genus database with same CATH homology
 4Q5N A;  3SBC A;  4BVX B;  2IJY A;  3M9J A;  4IQ1 A;  5IMD A;  3FW2 A;  3MYD A;  2VCW A;  3VPT A;  1QFN A;  4JBB A;  3N5O A;  2YPM A;  5F07 A;  3NOF A;  5AIV A;  5HR2 A;  1R26 A;  5JCG A;  1AC1 A;  2ALB A;  1T3B A;  2H6X A;  3QDN A;  2VCV A;  4OO4 A;  2L6D A;  2V6K A;  4I97 A;  3ZIJ A;  2R5G A;  4NV2 A;  1M7T A;  2CA8 A;  4ACS A;  3TKS A;  5KN1 A;  4I5Q A;  4KDY A;  4JED A;  4OCE A;  3IV4 A;  1TI1 A;  4HUA A;  2D2Z A;  2ON5 A;  3DIE A;  3G7I A;  1HYU A;  4G2E A;  2H1A A;  2C0E A;  4PQH A;  2L59 A;  3CYN A;  2LKU A;  3UEM A;  4IP6 A;  2VL3 A;  2C4J A;  5EL8 A;  1OE8 A;  2LV3 A;  3HD5 A;  2VCZ A;  4N0Z A;  3WYW A;  2LRC A;  1TRS A;  3QR6 A;  5DQS A;  2A2R A;  1Z3E A;  1QMV A;  3RBT A;  1EV9 A;  4MP4 A;  1X5D A;  4IEL A;  4KW6 A;  4ID0 A;  4IW9 A;  2MMN A;  1I5G A;  3QAV A;  3KTB A;  1J08 A;  3CTG A;  3HVV A;  3F0I A;  3RPP A;  2DIZ A;  4XRA A;  5IMZ A;  1TRW A;  1QGV A;  2VUP A;  3IRA A;  2G2Q A;  4G10 A;  2H19 A;  2VD1 A;  3VWX A;  3HZ4 A;  4WF5 A;  4HJ2 A;  5ECI B;  4GST A;  1S3D A;  2C3T A;  1OYJ A;  4N10 A;  1VGL A;  2NVL A;  1JLW A;  3E3E A;  4V1A g;  1BED A;  1MDI A;  1K0A A;  2L6C A;  1SYR A;  6GSW A;  3QAW A;  2LST A;  4EO3 A;  1AQV A;  2CAI A;  4XS1 A;  5BMU A;  3IK9 A;  1TI3 A;  2GT5 A;  2M72 A;  3TRX A;  4Z2U A;  3F9U A;  2WJU A;  1A2J A;  1URM A;  2B3S A;  4J57 E;  5IO2 A;  4FYB A;  3S9F A;  4CY8 A;  3ISO A;  1NHY A;  2LS5 A;  1X9S B;  2CX3 A;  2I4A A;  1SJZ A;  4BL7 B;  2ZNM A;  4TR1 A;  4POK A;  5JWO B;  1WWJ A;  2XBI A;  1WRY A;  3KEB A;  3M0F A;  4POL A;  2HRK A;  1G6W A;  3CSH A;  1VF3 A;  3L0H A;  1AXD A;  2H75 A;  3D4M A;  1A0R P;  1OAZ A;  5J41 A;  3GUR A;  3Q74 A;  1GUM A;  4O5R A;  2IN3 A;  4DSS A;  1O85 A;  1ZCP A;  1G7O A;  4AJ6 A;  1WMJ A;  2R0P A;  3P2A A;  4IP1 A;  1YKC A;  3DRN A;  1SKS B;  2REM A;  4MJE A;  2PU9 C;  1JFU A;  4MF7 A;  1B9Y C;  3F6F A;  5CRW A;  5COH A;  2CZ2 A;  3F3R A;  13GS A;  5LNK e;  1N2A A;  1XCC A;  4JR4 A;  1TP9 A;  5ELA A;  3TJK A;  2X4A A;  5HFK A;  1GNW A;  2VO4 A;  5IMV A;  5DQY A;  4XTS A;  5KN3 A;  3IC4 A;  2HT9 A;  1Z7P A;  4Z7X A;  9GSS A;  3HHV A;  1A0F A;  2GS3 A;  4K0G A;  1G6Y A;  2ZUP A;  3GSS A;  4MZW A;  3O3T A;  4USS A;  5L71 A;  3SWL A;  1V9W A;  2P5R A;  2A2P A;  4GXZ A;  2CX4 A;  3LG6 A;  3O6T A;  1BX9 A;  2DKH A;  1TW9 A;  4ZBB A;  2H30 A;  4L0U A;  1O6J A;  3FK8 A;  5CO3 A;  4XCS A;  4EXJ A;  4Z2R A;  4BVY A;  1M9B A;  1XFL A;  4Q5F A;  1XVQ A;  3APQ A;  4N11 A;  2RM6 A;  5JWR B;  6GSS A;  1BQ7 A;  4HQS A;  2O89 A;  1SL0 B;  3ZMK A;  2YV7 A;  3FR6 A;  3D6I A;  3DVW A;  3UAP A;  2VIM A;  2J23 A;  2VCT A;  1QQ2 A;  5HFG A;  5D93 A;  4KE3 A;  4TRX A;  2H71 A;  1EOH A;  4JRR A;  1SK0 A;  2E2G A;  4PUR A;  2VL9 A;  4XS4 B;  3TKR A;  3RAZ A;  4KB3 A;  5DDL A;  3BD2 A;  4F0B A;  5IIZ A;  3L9S A;  2WDU A;  3FY7 A;  1YF0 A;  2GVP A;  5IMA A;  2IFQ B;  1EP7 A;  2O87 A;  3VWU A;  2VCQ A;  4WR5 A;  2L5O A;  4KUN A;  1UN2 A;  3ZZX A;  1FOV A;  4HEA 2;  1U88 A;  2V6O A;  2Z9S A;  2K8S A;  3GUS A;  4XIH A;  5F0G A;  5IPH A;  1SKW B;  1GP1 A;  2FWG A;  3C73 A;  2WFC A;  1T00 A;  2QA1 A;  1F37 A;  3NZN A;  5CP1 A;  1ST9 A;  3HYP A;  3TJF A;  1OC3 A;  5A4U A;  2H6Z A;  3EWL A;  1V98 A;  1DBY A;  1IYI A;  1GLQ A;  4PQI A;  3GKK A;  1ERU A;  4DSR A;  4BWS A;  3H79 A;  4YH2 A;  3KCM A;  3G9B A;  3MSZ A;  3DXB A;  4FO5 A;  1JZW A;  3GMF A;  3H1N A;  4GTU A;  2VLT A;  3KH9 A;  3W8J A;  4J2F A;  1ZGN A;  1EEM A;  1Z5Y E;  2FNO A;  3TDG A;  2HZE B;  1J9B A;  3MIX A;  3P7X A;  1R5A A;  1XZO A;  4GQC A;  4K0N A;  1M9A A;  4NWY A;  4TR4 A;  2YWO A;  3ZL5 A;  5DAK A;  2N5B A;  3LGC A;  4TVE A;  3APS A;  1YQ1 A;  1ZYP A;  4HJM A;  1E6B A;  5DCH A;  2CT6 A;  3ZFL A;  3ERG A;  3GA4 A;  5FHI A;  1XVW A;  5A4W A;  3IAM 2;  4AJ7 A;  4K6X A;  3PPU A;  2LRT A;  1FB6 A;  2DLX A;  2R4V A;  3BBY A;  1XXU A;  2N5A A;  5FWG A;  4OFM A;  3FYG A;  3A5W A;  1TRU A;  3DGQ A;  2V2G A;  4EE0 A;  5ECR B;  2C0F A;  4DSQ A;  2H8L A;  3FR9 A;  1ZZY A;  2A4V A;  1PL1 A;  3IBH A;  2FUG 2;  2FA4 A;  5F06 A;  5DAL B;  1JZR A;  2PMT A;  3GST A;  1PX7 A;  3UBK A;  3QFB C;  2EIQ A;  1R7H A;  2GSQ A;  1HNC A;  2IL3 A;  5CRD A;  6GSV A;  1GTB A;  1XOA A;  3GL5 A;  2FWE A;  3MAK A;  4GQF A;  3TGZ A;  5ECM B;  3TUE A;  3TKS E;  1W4V A;  2E0Q A;  1ZYE A;  1TK0 B;  2B1L A;  2WGR A;  2AV4 A;  4ZL7 A;  1O8X A;  4ZIJ A;  3P90 A;  1XWG A;  1AQW A;  4TKY A;  3D4T A;  2YWM A;  4PXO A;  2JZR A;  1SK1 A;  2ES7 A;  19GS A;  5ID2 A;  4ICY A;  1O81 A;  1THO A;  2LRN A;  2DJ3 A;  2DSA A;  3L9U A;  4K1F A;  1KTE A;  1CQG A;  3KMO A;  3I9V 2;  2PUK C;  20GS A;  3WGD A;  4XS6 A;  4H86 A;  5ABR A;  2LJR A;  5KEJ A;  1A2M A;  2C3Q A;  4K7N A;  2BTO T;  3EMP A;  1BG5 A;  4OD7 A;  2I81 A;  1F9M A;  2OA7 A;  1C72 A;  3ZML A;  6GSY A;  3VLN A;  4N0V A;  4OWY A;  4WBJ A;  3DML A;  2LNT A;  1U6T A;  4O5Q A;  1R4W A;  2PVO C;  1K0D A;  4IGJ A;  1SD8 A;  4MNN A;  4MDC A;  2OE1 A;  3FZ9 A;  1Y25 A;  4MLY A;  2DJ1 A;  3KZQ A;  4MH2 A;  2DJJ A;  2AAW A;  2K18 A;  4AF2 A;  3W8S A;  4WKW A;  3TRQ A;  3UVT A;  2R3X A;  2KP1 A;  1QXH A;  1ZL9 A;  4L8E A;  2FLS A;  2IPA A;  1SL1 B;  2P0G A;  2YWN A;  1G7E A;  4MMM A;  3GYK A;  3D0Z A;  5HFI A;  1OE7 A;  5CRG A;  2HI7 A;  3CXG A;  2HSH A;  3TJJ A;  2FD3 A;  4IQA A;  4F2I A;  4DVC A;  2GQM A;  2ON7 A;  2H0G A;  1PN9 A;  1WJK A;  1RK4 A;  3EUR A;  3OR5 A;  2H66 A;  3HCZ A;  3C8E A;  3D22 A;  4FYU A;  3I6A A;  1THX A;  2HLS A;  5DJM A;  3EU3 A;  4KAE A;  4EKZ A;  5ECO B;  4IN0 A;  2LUS A;  1K0O A;  1ZMA A;  1YJ6 A;  1TU8 A;  2KUC A;  5C00 A;  4K7I A;  1YF1 A;  5D73 A;  5CNW A;  3LYP A;  2VCX A;  4PNG A;  2WB9 A;  4BA7 A;  3GX0 A;  2LJA A;  3NIV A;  4BPY A;  3GKN A;  3EU4 A;  3LW9 A;  1RW1 A;  2R0G A;  4Z2T A;  4IJ3 A;  2PGT A;  4LA1 A;  2EIR A;  2XPE A;  4NPB A;  1N8J A;  1V58 A;  4PQ1 A;  3UIW A;  2TRX A;  2I3Y A;  1A8L A;  4WET A;  2YWI A;  4Q5Q A;  4NXI A;  1GSQ A;  4PX1 A;  1ERT A;  5IMF A;  4LL1 B;  2I9H A;  4G19 A;  3KP9 A;  2WRT A;  4JR6 A;  4HS1 A;  1LU4 A;  5J3R A;  4CHS A;  2OE0 A;  3GIX A;  1SD9 A;  4KDX A;  3AY8 A;  3VI5 A;  2TIR A;  3RHC A;  1K3Y A;  2PWJ A;  1XW9 A;  3HA9 A;  3G7Y A;  4KGI A;  3ERW A;  3IHG A;  4OFT A;  4K2X A;  4YQM A;  3U6V A;  1KEB A;  4EL1 A;  1SJI A;  2OJL A;  1MDJ A;  3EVI A;  2F9S A;  5GAN D;  1KNG A;  2N5F A;  1Y6E A;  4ECC A;  2H74 A;  3HVS A;  2YV9 A;  1F6M C;  2DML A;  10GS A;  4MF5 A;  5H5S A;  1SYX A;  3UAR A;  2FGX A;  4FIW A;  4NMU A;  1V40 A;  4HZ2 A;  2HNL A;  2GST A;  1ILO A;  2JSZ A;  3A3T A;  3KXO A;  4RI7 A;  3WT1 A;  2IMK A;  4RI6 A;  3GTU B;  4MH3 A;  1OC9 B;  3DKS A;  3UMA A;  2B7J A;  2FY6 A;  5IOW A;  1K0C A;  4D73 B;  3QMX A;  4MJB A;  3HJO A;  1TK8 B;  3V1W A;  3LFL A;  6GSU A;  1GNE A;  2JU5 A;  4I8B A;  2JL4 A;  2VL2 A;  3E0U A;  2CAQ A;  2DJ0 A;  4V1A p;  4KF9 A;  2MMA A;  3GV1 A;  3CBU A;  3U5R E;  5JWQ B;  1XW6 A;  2KHP A;  2K8V A;  1GTI A;  5AIX A;  2E2M A;  4J56 E;  3BJ5 A;  2C0G A;  3DEX A;  5KN2 A;  2MBS A;  3FZA A;  3C7M A;  1WP0 A;  1ERW A;  12GS A;  3ZLP A;  3BCI A;  2H0I A;  4G0L A;  1VF4 A;  1GTA A;  2IWT A;  5D9X A;  3TJG A;  3FKF A;  1B8X A;  1Z6M A;  4BL7 A;  1ZYN A;  3M3M A;  4AGS A;  1GTU A;  2F51 A;  1OVN A;  4ISD A;  4EIQ A;  2HZF A;  3EPT A;  3HDC A;  2NTO A;  3GN3 A;  1LBK A;  1NSW A;  2P5Q A;  4L5O A;  3HJM A;  1SEN A;  3GRX A;  5G5F A;  4YAV A;  3UL3 A;  1UA5 A;  1EWX A;  3TB2 A;  1GUL A;  1GL8 A;  1Q4J A;  5A4V A;  4ZBA A;  2ZCT A;  5GAP D;  5G31 A;  2H1B A;  1HNB A;  1GSY A;  1SJ6 A;  1BAY A;  4KH7 A;  3IK7 A;  3HZ8 A;  5J9C A;  1JZD A;  4EDY A;  5DCG A;  14GS A;  2DMM A;  5HQP A;  2GGT A;  3GX8 A;  2HRA A;  2G0F A;  1AIU A;  2H01 A;  3LSZ A;  2H70 A;  1MD4 A;  4HQZ A;  5IO0 A;  3M9K A;  3IOS A;  4ZB8 A;  4WEY A;  2LEG A;  2OBK A;  4LL4 B;  3FR3 A;  4MA9 A;  5D9V A;  1XWK A;  5CYY A;  4HU7 A;  3PIN A;  4MAB A;  1O73 A;  4YQU A;  4EVM A;  2F3M A;  3M8N A;  5F8B A;  8GSS A;  1CQH A;  2RUE A;  5ECN B;  2PVQ A;  4QL7 A;  1K0B A;  2R0C A;  2V32 A;  3DWV A;  1K3O A;  3WD6 A;  3IA1 A;  5DVB A;  1FG4 A;  3O76 A;  2IME A;  3ZTL A;  1MTC A;  2V1M A;  4LMV A;  3UBL A;  1YEP A;  4V2M A;  4TXO B;  2B5E A;  1T4Z A;  3A2W A;  5HR0 A;  2MYG A;  5G2Z A;  5F05 A;  4K2D A;  5B8B A;  1QK8 A;  3VPQ A;  2GSR A;  1GSD A;  1RQM A;  1FVK A;  3Q18 A;  4K9Z A;  4YAP A;  18GS A;  5D9W A;  2F8A A;  2O8V B;  1TOF A;  2JZT A;  5G1K A;  1XPV A;  1AAZ A;  3GL3 A;  1B4Q A;  2WCI A;  2H1D A;  4GRF A;  4YKG A;  1MDK A;  2BMX A;  5D9T A;  1SKR B;  2X99 A;  1ACV A;  1S3A A;  2H6Y A;  3QCP A;  4OCF A;  3P8W A;  3HKR A;  2YZU A;  5B6N A;  5E4W A;  3TCO A;  4I6X A;  3R3E A;  1GSF A;  2FWF A;  2IMF A;  1TTZ A;  1HQO A;  3PR8 A;  5GSS A;  3KIJ A;  4XS4 A;  4ZIL A;  3H4K A;  4FYC A;  1LJR A;  3L4N A;  1T4Y A;  2GSS A;  2JAD A;  5KOX A;  3KMN A;  2QSI A;  1FVJ A;  2LNS A;  1K0N A;  4IJI A;  2DBC A;  2YJ7 A;  2IFQ A;  5GZZ B;  2E7P A;  4K5S A;  1A8Y A;  4KDU A;  4ZB9 A;  5CAX A;  4PNF A;  2FHE A;  4MZC A;  11GS A;  2GTU A;  3L78 A;  1PL2 A;  1I9D A;  4NHW A;  1R5P A;  1ON4 A;  3DVX A;  3ME8 A;  3EC3 A;  4LLR A;  2L4C A;  1PRX A;  2IIY A;  4O5U A;  2GZY A;  4TXV A;  3GKM A;  4N30 A;  3ZRD A;  4A5P A;  4X0X A;  2R6K A;  3UVH A;  1TKD B;  3EYT A;  3WGX A;  5J4U A;  2CVB A;  5G30 A;  5B6M A;  1PD2 1;  3ZVJ A;  2GZZ A;  4IS0 A;  1T8E B;  2J9H A;  2CZ3 A;  4WXT A;  2X49 A;  5H5R A;  3PGT A;  4O7H A;  22GS A;  1O7U A;  1X5E A;  3A5I A;  1FHE A;  3HY2 A;  4GCI A;  2YZH A;  4O92 A;  4TOP A;  2VLV A;  1X0R A;  2HZE A;  2VL2 C;  3A2X A;  1HD2 A;  3Q6O A;  2RUF A;  2OAD A;  2YP6 A;  4ZB6 A;  3F4R A;  4G9H A;  1USB A;  2GZP A;  1EP8 A;  3KGK A;  4POM A;  3QD9 A;  3VUR A;  4ECI A;  4CDO A;  2PBJ A;  5J9B A;  1GRX A;  1PMT A;  3F4T A;  3KM6 A;  6GST A;  4WR4 A;  2GT6 A;  3FZ5 A;  1GSS A;  5CRE A;  4ML1 A;  1T7P B;  2B7K A;  3VK9 A;  3QPM A;  2GLR A;  1TDI A;  5JCW A;  4MF6 A;  3C1S A;  5B8A A;  5DAL A;  3LEF A;  3A2V A;  4WBR D;  2K6V A;  2KOK A;  1EEJ A;  4TR0 A;  4NHZ A;  3LXZ A;  4FH8 A;  3US3 A;  3D5J A;  3C71 A;  2DC5 A;  1Z9H A;  3TKP A;  2AB6 A;  4CY6 A;  3F3Q A;  4QL9 A;  4MJC A;  2RII A;  2GDR A;  1JZO A;  4E8E A;  3FMW A;  1PGT A;  1SK2 A;  3F6D A;  2HSM A;  5HR1 A;  3WT2 A;  4KA0 A;  1TJD A;  3DD3 A;  3HJP A;  3LQ7 A;  1Z7R A;  1GSE A;  2AJQ B;  2HSY A;  5D8I A;  1GH2 A;  1X5C A;  1H4O A;  3F8U A;  5IOX A;  2C1Y A;  3J7Y b;  1VF2 A;  1X9M B;  2RM5 A;  3UJ1 A;  1GSU A;  3GH9 A;  1DSB A;  2C8U A;  4ILF A;  2OE3 A;  3TOU A;  1XBS A;  2HYX A;  1YKA A;  5LD0 A;  4HU9 A;  4O32 A;  2VM1 A;  2KLX A;  1T1V A;  4TR1 B;  3GKX A;  1PQN A;  3GH6 A;  4OFN A;  3VWW A;  5FT3 A;  2H76 A;  2YJH A;  5EVO A;  4P3Y B;  2MZC A;  3F63 A;  2YAN A;  2JAC A;  1XWC A;  6GSX A;  3QAG A;  4OO5 A;  1FO5 A;  5KOW A;  1EZK A;  2XBQ A;  1U87 A;  4BVX A;  4DSS B;  2PPT A;  2H0H A;  1F3A A;  3FRC A;  5IM9 A;  4ZBD A;  5INY A;  4E8H A;  2X8H A;  2TRC P;  3KJY A;  3GHA A;  1SL2 B;  1WOU A;  4EIP A;  1PSQ A;  1XWA A;  3ZYW A;  3UOM A;  3LOR A;  1MD3 A;  3LJR A;  1MEK A;  5EY6 A;  4MJA A;  4F03 A;  1K3L A;  2IMI A;  4YQV A;  4KCA A;  5JCU A;  3BCK A;  4JU5 A;  5EPF A;  3RHB A;  5J5N A;  5E59 A;  5G1L A;  1YZX A;  3VI7 A;  3M1G A;  1WE0 A;  2XC2 A;  3KH7 A;  4JZQ A;  1GWC A;  5ECQ B;  5ENU A;  3HXS A;  2HE3 A;  1M2D A;  2O85 A;  2C80 A;  2WS2 A;  4K7O A;  1JHB A;  1AUC A;  4CW9 A;  2F8F A;  4LMW A;  1EGO A;  3ERF A;  5KN0 A;  1M99 A;  5AN1 A;  3RDW A;  1XWB A;  4ML6 A;  2DIY A;  2R37 A;  5ECH B;  1FW1 A;  3DYR A;  1DE2 A;  4BVY B;  3CSI A;  3KD0 A;  5H5Q A;  2OKA A;  3TJB A;  3KP8 A;  2R2J A;  4IHU A;  3GNJ A;  3IHQ A;  2LTK A;  2NBS A;  5LCZ A;  2PN8 A;  1TK5 B;  1A2L A;  4HZ4 A;  1PKZ A;  2XHF A;  4DEJ A;  2YNX A;  5A5K A;  2GQK A;  1F3B A;  3IPZ A;  1GUH A;  2DJK A;  2FCH A;  4HOJ A;  4V2L A;  4Q5R A;  4HDE A;  3I69 A;  5B7C A;  1WIK A;  2IMD A;  5AGY A;  1YDK A;  5HR3 A;  4AJ8 A;  2A4H A;  1M0U A;  2FWH A;  3FEU A;  3E9J B;  4ZL9 A;  1GUK A;  3N9J A;  3CRU A;  4X4J A;  1YY7 A;  1XOB A;  2JZS A;  4TR3 A;  4YKF A;  1TU7 A;  3IC8 A;  1PX6 A;  3GFK A;  2PER A;  1OKT A;  2M46 A;  1XIY A;  4V2N A;  2X64 A;  7GSS A;  2L5L A;  3IAS 2;  1EV4 A;  3WGE A;  1V57 A;  3QOU A;  1DE1 A;  1IYH A;  2OAC A;  4L0W A;  2B6M A;  1AQX A;  2WZ9 A;  1UC7 A;  2H73 A;  2LQO A;  2VLU A;  1A24 A;  4GF0 A;  2I1U A;  1B9X C;  3Q19 A;  4IBP A;  4IKH A;  5GST A;  4TN8 A;  2DKI A;  2QGV A;  2P31 A;  2OBI A;  3L9V A;  4K8M A;  4K5R A;  4XHM A;  4GWR A;  3TKQ A;  2HRN A;  2GQL A;  5BRT A;  3ME7 A;  1U3I A;  3HVX A;  3BOA A;  3KTL A;  4MPF A;  4ULX A;  2HFD A;  2WUL A;  1NM3 A;  1X9W B;  3IE3 A;  4HI7 A;  4PTS A;  4MZB A;  2NPB A;  4POB A;  2O7K A;  2LJK A;  5DAK B;  3GTU A;  5ELG A;  3J7Y k;  1OC9 A;  1H75 A;  3APO A;  1AW9 A;  4GSN A;  4D73 A;  2VD0 A;  2RLI A;  3CTF A;  1HNA A;  3IR4 A;  4BWQ A;  1OKD A;  3K8N A;  1BYE A;  1B4P A;  1NHO A;  5IMC A;  2C0D A;  3FHK A;  5IPG A;  1ABA A;  4MPG A;  3TKS C;  4MCU A;  1EGR A;  3EE2 A;  1EOG A;  1U3A A;  2AYT A;  4EF0 A;  4NAX A;  2VOC A;  2HXK A;  4QQ7 A;  2B5Y A;  4KCE A;  2MMZ A;  2UZ8 A;  5ECS A;  3VWV A;  1WPI A;  2DJ2 A;  1SU9 A;  1BJX A;  4GSS A;  4KSM A;  1PN0 A;  2X8C A;  2AHE A;  1FB0 A;  1PKW A;  3D21 A;  2CVK A;  3W6G A;  4EDZ A;  2VAF A;  1A23 A;  4WF4 A;  1FOH A;  2V41 A;  3EMX A;  3FZ4 A;  4PGT A;  4I2T A;  4F0C A;  4F9Z A;  4IVF A;  4RQX A;  3EIN A;  5C04 A;  5G5E A;  1NW2 A;  4ECB A;  5ID2 B;  3ZVJ D;  4KND A;  3ZIV A;  4G0I A;  2A2S A;  5ECK B;  3I43 A;  1OC8 A;  4XRD A;  2QC7 A;  2X8G A;  1M2A A;  4L5L A;  3G7J A;  1TRV A;  2CVD A;  4FQU A;  1Z6N A;  3F4S A;  3H93 A;  1ML6 A;  2AUV A;  5DBQ A;  1B48 A;  1GLP A;  2QA2 A;  3ZIT A;  2MBT A;  5CRH A;  1ERV A;  4PUA A;  1XW5 A;  3IDV A;  1O8W A;  4I2U A;  4NV5 A;  2L57 A;  5ECL B;  1J0F A;  3ZFB A;  1KBN A;  2YOI A;  3JCM L;  4ECJ A;  1UVZ A;  2EC4 A;  4X43 A;  4ZXG A;  3CSJ A;  1ZOF A;  2EIO A;  3ZRE A;  17GS A;  2K9F A;  4G0K A;  2JSY A;  4ZL8 A;  1M2B A;  4TXO A;  4F82 A;  1F2E A;  2YN1 A;  4PUF C;  1G0T A;  5ECP B;  5IQY A;  1FAA A;  2QKE A;  1PA3 A;  2M80 A;  2B5X A;  3LWA A;  3PH9 A;  2BJX A;  3R2Q A;  1Q98 A;  3MDK A;  4X1U A;  3MNG A;  2HRF A;  1DUG A;  4EUY A;  4KSO A;  1V2A A;  3IXR A;  3TRP A;  4TW5 A;  1ZYQ B;  2C3N A;  3CRT A;  3TOT A;  5AIS A;  2LQQ A;  2YCD A;  3C1R A;  3H8Q A;  2B1K A;  5DJL A;  2L4Q A;  2XPD A;  16GS A;  3LYK A;  3LXT A;  2FA8 A;  3QFA C;  4JE1 A;  4EC0 A;  4OMV A;  1VF1 A;  1S3C A;  2KP2 A;  2CQ9 A;  4RUV A;  3CMI A;  5D96 A;  1W89 A;  1TXX A;  3RPN A;  1QUW A;  1YEX A;  4GLT A;  4MK3 A;  1E2Y A;  4KX4 A;  2CV4 A;  2H1G A;  1JLV A;  3ED3 A;  2VM2 A;  2MMO A;  1K0M A;  2NDO A;  3MWH A;  4RQR A;  1VRS D;  3VFI A;  2H72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...