4OO5A

Crystal structure of s-nitrosated human thioredoxin mutant
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
105
structure length
104
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDQDVASESEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin
publication title Crystal Structure of a Thioredoxin Mutant Displays a Dynamic N-terminal Loop Surrounding an S-nitrosation Site
rcsb
source organism Homo sapiens
total genus 39
structure length 104
sequence length 105
ec nomenclature
pdb deposition date 2014-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4oo5A00
4AF2A 1M2DA 2K8VA 3TDGA 5JWRB 2H1DA 2MMNA 3KMOA 4F03A 5A4VA 1F2EA 1R5AA 4L8EA 4F9ZA 4KDYA 1W89A 5B6MA 3L4NA 5D9XA 4IHUA 2H0HA 2XPDA 2HRFA 1LBKA 4DSSA 1UN2A 3VWVA 4GLTA 1AQWA 4F2IA 5DCHA 2DMMA 2GS3A 2OACA 3HJMA 1RK4A 1SD9A 1A24A 2KOKA 1PN9A 3D21A 5D8IA 2A2RA 2C0FA 2HFDA 4MA9A 4EXJA 3ZFBA 3O6TA 4HU9A 3E3EA 2I4AA 1T8EB 3TOTA 1E6BA 1SKSB 3GH6A 2FWHA 3F8UA 5E59A 2GQKA 1X9MB 4POMA 4ECIA 2H6XA 2QKEA 3F63A 2GZZA 3RHBA 1URMA 4TXOA 2VCWA 3CYNA 1XW9A 5IMZA 1GWCA 1XCCA 2GT6A 3RPPA 3GV1A 5LCZA 2PPTA 1WP0A 4KCAA 2EIOA 2BMXA 3APOA 4TR1B 1YQ1A 3ZZXA 2DIZA 4O32A 2L6CA 1EZKA 2CVBA 2VCQA 4RQXA 3FZ9A 3S9FA 5G5EA 3H93A 2LV3A 2YANA 3F3QA 4I97A 1M99A 1GSSA 1GRXA 3NZNA 3QD9A 1GUKA 1AXDA 4TW5A 1M9BA 1NHYA 2KLXA 2YJHA 4TKYA 1R26A 3GTUB 2R37A 3FZ4A 4N11A 3EWLA 4F0BA 1EP7A 2DJ2A 1EV9A 2G0FA 1GSEA 4KB3A 5ECHB 4POBA 2PERA 2VL2A 4K7OA 1T4ZA 4L5OA 2IMIA 1ERTA 1F3AA 3MWHA 3KIJA 3FY7A 3UARA 2RLIA 20GSA 2M72A 3P7XA 3Q6OA 1SJZA 4WKWA 2TIRA 2IMEA 4FYUA 4ILFA 2XHFA 4ID0A 5ELGA 1OC3A 1GNWA 2IMDA 4MZBA 1GSDA 1CQGA 2PU9C 1JZWA 1XWCA 4YAVA 1EV4A 4PNGA 1ST9A 1YY7A 2PVOC 1F37A 2HSHA 2VAFA 4LL4B 1TK8B 1TU8A 2FWFA 5F07A 5G1KA 1YKAA 2VUPA 4KSMA 1OC9A 3ERFA 3KMNA 3FR9A 1ZGNA 3I69A 1XOAA 1S3CA 4ECJA 1THOA 5DAKB 3GHAA 2FNOA 3C73A 1EP8A 1J0FA 5J41A 3KD0A 5C04A 1VF1A 1SL0B 4OFMA 1BAYA 3PH9A 4YQVA 4PQIA 2GQMA 3HJOA 4TOPA 1A2JA 4BVYA 2I81A 3RBTA 2V6OA 11GSA 4N10A 3JCML 4JBBA 1TI3A 1B48A 3LXZA 4ZIJA 2DIYA 3P2AA 4D73A 3TJFA 1C72A 3UEMA 2YZUA 1A23A 3HZ4A 3ERWA 3WGXA 1T3BA 1USBA 6GSUA 3FZ5A 1M9AA 3EU4A 5DBQA 4RI7A 5D9WA 4OO4A 5KN0A 4MH2A 5IIZA 3GA4A 3CTFA 4OD7A 1SYRA 2M80A 2JSZA 5DJLA 5AISA 1V98A 2GLRA 2HLSA 1OE7A 3HD5A 5GSTA 2DMLA 3CSJA 4YQUA 5KEJA 3N9JA 3WT2A 1MTCA 5CRWA 5HR0A 2I3YA 1AW9A 4GSTA 5JCWA 3DVWA 2GZPA 1QGVA 2JSYA 2VIMA 2R5GA 1SKRB 4IP1A 6GSTA 2YNXA 1K0BA 4MPFA 3VWUA 1O8XA 4AJ7A 2GGTA 4V1Ag 5IPGA 1O8WA 5KN3A 9GSSA 2IJYA 1JZDA 2CQ9A 3L78A 2YP6A 3LORA 4OFNA 3G7JA 4EDYA 4H86A 2K18A 1OKDA 3KTLA 1OYJA 3IE3A 2ZUPA 5IMCA 4V2MA 3RAZA 2GDRA 3HDCA 4YQMA 3A2XA 3QAWA 5ECRB 12GSA 2ES7A 3M1GA 5HFKA 3EE2A 1PKWA 1B4PA 3UMAA 2CVKA 1DE2A 4XTSA 3Q19A 1N8JA 3F0IA 5FWGA 5A4WA 2ON7A 5ELAA 4PQ1A 4RUVA 1TDIA 3GKNA 4G2EA 4I2UA 1BQ7A 3GSTA 1FVJA 1QQ2A 3LGCA 1B4QA 3D4MA 1SYXA 1G7OA 2CX3A 4WBJA 3J7Yk 3EVIA 5ABRA 4XIHA 3EMXA 1XW5A 3LG6A 5J3RA 2AHEA 1R7HA 1UC7A 4GCIA 1A0FA 2QGVA 2LJRA 3UBLA 3FEUA 1YF0A 3ZREA 1Z3EA 3KCMA 1QK8A 1ZYQB 3MDKA 2LQOA 3D6IA 1BJXA 5ID2B 2IFQB 4EDZA 1Y6EA 2WGRA 5JWQB 2H19A 3IOSA 1B9YC 5EL8A 2K8SA 5DJMA 2C0EA 2NBSA 2L59A 1PX6A 2V41A 5B8BA 3L9UA 2OE3A 2QSIA 1OC8A 2HRNA 4DSQA 1SK0A 2JL4A 3E0UA 2CZ2A 1B9XC 2A4VA 1G7EA 1J08A 2HNLA 5HR3A 4X1UA 2IMFA 3UVTA 3HCZA 4TXVA 3E9JB 1DSBA 3ZVJA 3ZRDA 2PUKC 5J9CA 2RM6A 3MAKA 2AB6A 3D0ZA 4QL9A 3TKSC 5CAXA 1GSQA 2WZ9A 2LQQA 3ED3A 6GSWA 2F8AA 4JRRA 3VK9A 2H1AA 3QAGA 1JLWA 3O76A 14GSA 1K3OA 2CX4A 3DD3A 2C1YA 3ZMLA 1GTAA 3GX8A 1R4WA 3DWVA 3D22A 4TXOB 2H71A 2B1KA 2ALBA 3KJYA 5ECPB 3O3TA 4G9HA 3LQ7A 4J57E 2DLXA 4FH8A 2HZEA 3HVSA 4Q5FA 5GAPD 1X5DA 2L57A 1MDJA 1X5EA 3D4TA 3A2VA 2P5RA 2MBTA 3GN3A 5CNWA 2IMKA 2TRCP 4K9ZA 2IN3A 3VWXA 1PRXA 3CSIA 3ZYWA 1DUGA 1XVQA 4MLYA 1UA5A 3BCIA 1WE0A 3HVVA 2N5AA 1U3IA 4ISDA 5KN2A 1PGTA 4F0CA 2XBIA 1SU9A 1K0OA 3KP9A 4ZL9A 18GSA 1SJ6A 1NW2A 2GSTA 4GWRA 3IC4A 1W4VA 2FCHA 2B5EA 3I6AA 4Z7XA 3ZVJD 2VL3A 4WF4A 2F9SA 4HUAA 1GTIA 4GSSA 4MF5A 4BWQA 2FA8A 2YV7A 4K6XA 1PMTA 4K0GA 2H75A 3GYKA 4EC0A 5G31A 2MZCA 1SL1B 3A3TA 1OE8A 4EE0A 5J5NA 5LNKe 5H5QA 4GXZA 1TRWA 2R3XA 4ZL8A 3TGZA 3QOUA 1M2BA 1SK1A 1JHBA 5AN1A 5AGYA 4ZB6A 6GSXA 5L71A 1Z7RA 2L4CA 2N5BA 1EOGA 1QMVA 3P90A 2DSAA 4IELA 1YZXA 1OC9B 3H4KA 1Q98A 3LXTA 1TRVA 4NXIA 3C71A 1WMJA 5G30A 2VL2C 3GSSA 3NOFA 4AJ8A 3ISOA 1F3BA 2GZYA 2HT9A 4BPYA 5G1LA 3QFAC 1GTBA 4ZILA 4LMWA 3G7YA 3R2QA 2LS5A 5DDLA 3GL5A 1TW9A 2QC7A 3TKRA 4F82A 4PURA 5F0GA 1MD3A 1M7TA 3TKQA 1OAZA 1HNAA 2CZ3A 4IKHA 1K0NA 3VLNA 5IQYA 5B7CA 1X0RA 2VM1A 1R5PA 3WGDA 2C3TA 4DVCA 4CW9A 1XOBA 2L6DA 2LNTA 3ME8A 3IBHA 2BTOT 1YF1A 2KP1A 3L9VA 2YWOA 1U88A 4KCEA 3IXRA 4POKA 3DIEA 4D73B 1K0DA 2R2JA 2VLUA 2O85A 1V40A 2VD0A 2RUFA 3FW2A 3RDWA 4E8HA 3P8WA 1T1VA 3H79A 3HHVA 1KNGA 2YJ7A 3CMIA 1GSUA 1SL2B 8GSSA 1XVWA 1Q4JA 2REMA 2JZRA 1TI1A 5EVOA 2PBJA 2G2QA 3LWAA 1ABAA 5IM9A 1GTUA 3TJKA 3ZITA 2ZCTA 4WR5A 4IQAA 3LEFA 3GNJA 4KX4A 4KGIA 1O6JA 2WJUA 2MYGA 3KH7A 1YKCA 1AUCA 2C3QA 4IQ1A 1FB0A 4PUFC 3TRXA 1FVKA 19GSA 2H6YA 5LD0A 1M0UA 4AGSA 1XXUA 4RI6A 1VRSD 2H76A 4QQ7A 2V2GA 3J7Yb 4IJ3A 1TKDB 1FOVA 1AAZA 4TVEA 2H0IA 4G19A 1PQNA 2B7KA 4GRFA 3TJGA 5D9VA 3N5OA 4TR3A 1BG5A 5IO0A 1YEPA 3FKFA 2B3SA 3IV4A 3UAPA 2WCIA 5F06A 5DQYA 2F51A 5AIVA 1K0MA 2H8LA 4JZQA 1YJ6A 4I6XA 1HQOA 3UIWA 4OCFA 1VF2A 1FHEA 3ZL5A 1FO5A 4NWYA 4E8EA 1MEKA 3HY2A 4L0WA 5F05A 1OKTA 3ERGA 3HJPA 2WDUA 4Q5RA 1WRYA 2VCXA 4G10A 2KUCA 4XS4B 2E7PA 4GQFA 1JFUA 2WRTA 4WF5A 4EUYA 1DBYA 3C1SA 5IMDA 2CV4A 5IO2A 4NV5A 1S3AA 3UL3A 5FHIA 6GSVA 2C0GA 2L5OA 6GSYA 4MDCA 5DAKA 1S3DA 4PNFA 1GLPA 4LA1A 4L0UA 2H72A 2CAQA 4ACSA 2FWEA 2NDOA 4EVMA 5D9TA 4XCSA 3M9JA 1ZCPA 2PGTA 1EEMA 3F4SA 4KDXA 4EKZA 4FYBA 3VWWA 3D5JA 3H8QA 5ECMB 4OWYA 4LL1B 4XHMA 1JZRA 2LRNA 2B6MA 3CRTA 3ZLPA 4XRDA 2A2SA 1UVZA 1TOFA 3CXGA 4YAPA 2H1BA 1EOHA 3AY8A 4GQCA 1TK5B 3HVXA 1T7PB 1O81A 2NVLA 2LJKA 3IHQA 3VI5A 3DKSA 5CREA 2LNSA 5ECNB 2RIIA 2DJ1A 3IK7A 1ZMAA 5CP1A 4YH2A 3C7MA 1QFNA 2OADA 5H5RA 5G5FA 4HQSA 2C4JA 4MF6A 3ZTLA 5H5SA 1YEXA 2F8FA 2J9HA 3GUSA 4JU5A 2DJ3A 1NSWA 1A8YA 6GSSA 1F6MC 1BEDA 1NHOA 2MMZA 2FY6A 2YN1A 1Z6MA 1GH2A 4PX1A 3BBYA 2H01A 1AQXA 3TB2A 4ZL7A 2R4VA 5GZZB 2VO4A 4K8MA 5INYA 1A8LA 4MF7A 1IYIA 2H70A 1PL1A 1CQHA 2LRTA 2YOIA 1H4OA 4HS1A 1SKWB 2VLTA 1ERWA 3APSA 1GLQA 4ZBAA 4WR4A 1I5GA 4K7IA 2LKUA 5DALA 2JU5A 3QAVA 4KE3A 4O92A 3FR6A 1HD2A 2OE1A 5GSSA 2CT6A 1EEJA 4N0VA 3APQA 3IR4A 4DSSB 2H6ZA 2O89A 2HI7A 4ECCA 1BYEA 2E2MA 2IL3A 3F9UA 4IGJA 5ECIB 2YCDA 4MCUA 5D93A 7GSSA 3DRNA 4OCEA 4NV2A 2YWMA 2PMTA 2CAIA 4MH3A 1TJDA 2VM2A 3W8SA 2ON5A 3KH9A 3OR5A 3DGQA 3PGTA 2DJ0A 2EIQA 3BJ5A 4IS0A 4DEJA 4KW6A 5IMVA 1XWAA 2EC4A 4K1FA 2V6KA 3BOAA 3DEXA 2E0QA 3G7IA 4EF0A 2YWIA 1ERVA 1THXA 3QDNA 2LSTA 5IMAA 2N5FA 3TKSA 3DVXA 1Z5YE 2MMOA 3VURA 4GSNA 4MABA 5CO3A 2TRXA 4JEDA 2GTUA 2CVDA 4AJ6A 1SD8A 3V1WA 4I5QA 3L0HA 5CRGA 5ID2A 1PX7A 1ZOFA 3RHCA 1GULA 4WEYA 5B6NA 4JE1A 4MZCA 2Z9SA 1ON4A 5B8AA 3A5WA 3BCKA 3CSHA 3GURA 1RQMA 2IPAA 4GTUA 2KHPA 4L5LA 1JLVA 3DYRA 3WT1A 3TKPA 5F8BA 3ZFLA 1FB6A 2H74A 2DJKA 5KN1A 2H73A 1E2YA 2C80A 2HYXA 2LTKA 1K0AA 2FD3A 3RPNA 2HSYA 3GKXA 2HXKA 2VL9A 5IOXA 2GSQA 1O73A 3FYGA 2AV4A 1GL8A 3IA1A 2P5QA 13GSA 1N2AA 3GFKA 2X8HA 1HNCA 4TR0A 2FLSA 1V2AA 3L9SA 4JR4A 4KH7A 4J56E 3EURA 4PQHA 2GSSA 2JZSA 4FYCA 5ECQB 1AIUA 5ECLB 3I43A 4ECBA 3I9V2 3M0FA 4HEA2 3VFIA 2YZHA 1TRSA 4IBPA 3Q18A 3KM6A 1A2MA 3IRAA 4BL7A 4I8BA 2JADA 2CA8A 4KAEA 3PR8A 4ZB9A 3TOUA 3G9BA 1XW6A 4ZBBA 5EPFA 2JACA 4WETA 3CBUA 3EINA 1MDIA 1MDKA 4EO3A 3UVHA 3ME7A 4MPGA 1Z7PA 3IAM2 3LJRA 2EIRA 2B5YA 2XBQA 1O7UA 3FHKA 5G2ZA 3GIXA 3A2WA 4HJ2A 1AQVA 4MJAA 2GQLA 5JCGA 4N0ZA 1TP9A 5HR2A 5FT3A 3U6VA 1B8XA 1GP1A 5HQPA 5EY6A 3FZAA 3NIVA 1EGRA 3HZ8A 1ILOA 4K0NA 5HR1A 1GNEA 3LYKA 1IYHA 3VI7A 5D73A 4MJCA 4MJBA 2NTOA 3ZIVA 3MSZA 4HDEA 1A0RP 2PWJA 5DVBA 2OBIA 2K6VA 1EGOA 3GMFA 1Z6NA 3KEBA 2X64A 1SK2A 3KZQA 4PGTA 1TTZA 1GSFA 4TRXA 1X5CA 3U5RE 4WBRD 1GUMA 5J4UA 3LSZA 1PL2A 2C0DA 4NHWA 1KEBA 1PSQA 4TR1A 4HI7A 1V57A 3UJ1A 3TRPA 1XWGA 1GSYA 5CRHA 4I2TA 4P3YB 1YDKA 3WD6A 1U6TA 1RW1A 4NPBA 1Y25A 10GSA 2H30A 3US3A 2OA7A 4OMVA 5A5KA 1XZOA 2FHEA 3LYPA 2AUVA 4O7HA 1T00A 1XIYA 2K9FA 3DMLA 3C8EA 5JCUA 3KTBA 3GTUA 1G6WA 1MD4A 3QPMA 4IJIA 2ZNMA 3IPZA 1WPIA 4N30A 4ZXGA 1SJIA 5GAND 2FA4A 3GH9A 2O7KA 3FR3A 4POLA 1KBNA 2OE0A 3F6FA 4OO5A 2LJAA 4ML1A 1XWBA 2OBKA 1XWKA 4XRAA 3FRCA 3LFLA 1VF3A 4NAXA 3WYWA 2D2ZA 2I1UA 5C00A 4EL1A 3W8JA 1TU7A 5ECSA 4LLRA 1ZZYA 1LU4A 1K3LA 3EYTA 1TK0B 5A4UA 4IP6A 2O87A 4ZB8A 2DC5A 4HJMA 2FWGA 17GSA 3EC3A 2B5XA 3QCPA 5ENUA 2FUG2 1ZYEA 3M8NA 2X8GA 4XS6A 2VD1A 2XPEA 3F4TA 3HXSA 3TUEA 4K2DA 3SWLA 5COHA 1PD21 1G0TA 1NM3A 2H66A 3TKSE 16GSA 3GKMA 4IW9A 1XFLA 3ZMKA 1QXHA 3QMXA 2H0GA 1PA3A 5HFIA 4GF0A 2VCZA 5AIXA 4OFTA 3EMPA 2P31A 4KNDA 4NMUA 3BD2A 3F6DA 2PVQA 1FAAA 5IMFA 2YPMA 3CTGA 3F4RA 1F9MA 1GUHA 2M46A 3C1RA 4V2NA 4X0XA 1TXXA 2X99A 1G6YA 2WULA 2RUEA 5HFGA 5IOWA 2LRCA 2H1GA 4MP4A 1X9WB 2WS2A 2DJJA 2HZFA 3KXOA 3GRXA 3GL3A 5DALB 4MZWA 5DQSA 5IPHA 1KTEA 2KP2A 1K0CA 1ZL9A 4V2LA 2AJQB 2BJXA 4HOJA 1V9WA 4BVXA 3VPQA 3PINA 1SENA 2C8UA 5ECKB 4X43A 2NPBA 1AC1A 3ZIJA 3KP8A 1A2LA 2L4QA 2YWNA 4RQRA 4Q5QA 3W6GA 4K7NA 5DCGA 4ML6A 2C3NA 3TCOA 5JWOB 1EWXA 4KDUA 2VCVA 2V32A 1I9DA 4J2FA 3DXBA 4NHZA 3IDVA 4KA0A 5E4WA 4XS4A 4CHSA 4PXOA 3TJBA 1VGLA 3MNGA 1FW1A 1Z9HA 3HYPA 1HYUA 1U3AA 1J9BA 1O85A 4QL7A 2LEGA 2PN8A 2MBSA 3KGKA 4JR6A 4O5RA 2WFCA 4MJEA 3HA9A 1VF4A 2F3MA 3M3MA 2IIYA 2WB9A 4HU7A 3F3RA 2L5LA 4HQZA 1DE1A 2XC2A 1LJRA 2HZEB 4KUNA 5ECOB 4WXTA 2I9HA 3QFBC 4MK3A 3VPTA 4XS1A 2P0GA 4ZBDA 1H75A 5CYYA 2MMAA 4HZ4A 3WGEA 22GSA 2VLVA 4ULXA 2RM5A 2GSRA 1XPVA 2JZTA 2LUSA 1FG4A 1ACVA 2O8VB 5CRDA 3SBCA 2DBCA 1XBSA 1V58A 2IWTA 2HE3A 1BX9A 2FGXA 1HNBA 3EU3A 3CRUA 3UOMA 2AAWA 4HZ2A 4IN0A 3FK8A 3QR6A 1WIKA 2GT5A 3IAS2 4IVFA 4LMVA 1WJKA 1K3YA 2V1MA 2R6KA 4FIWA 4Q5NA 2X8CA 3GKKA 1U87A 2J23A 3GX0A 1WWJA 3H1NA 4DSRA 2OJLA 4BA7A 4BWSA 3HKRA 2YV9A 1ML6A 5D96A 3UBKA 2B7JA 1TRUA 1X9SB 5J9BA 4KSOA 4TN8A 1OVNA 2VOCA 1PKZA 2VCTA 4TR4A 3Q74A 1WOUA 3M9KA 2OKAA 1ERUA 4CDOA 1QUWA 3TRQA 1T4YA 1JZOA 4FO5A 2AYTA 4MMMA 2E2GA 3IK9A 2IFQA 2GVPA 3TJJA 4V1Ap 4PUAA 1M2AA 2B1LA 3K8NA
chains in the Genus database with same CATH superfamily
4AF2A 1M2DA 2K8VA 3TDGA 5JWRB 2H1DA 2MMNA 3KMOA 4F03A 5A4VA 1F2EA 1R5AA 4L8EA 4F9ZA 4KDYA 1W89A 5B6MA 3L4NA 5D9XA 4IHUA 2H0HA 2XPDA 2HRFA 1LBKA 4DSSA 1UN2A 3VWVA 4GLTA 4O5QA 1AQWA 4F2IA 5DCHA 2DMMA 2GS3A 2OACA 3HJMA 1RK4A 1SD9A 1A24A 2KOKA 1PN9A 3D21A 5D8IA 2A2RA 2C0FA 2HFDA 4MA9A 4EXJA 3ZFBA 3O6TA 4HU9A 3E3EA 4HSCX 2I4AA 1T8EB 3TOTA 1E6BA 1SKSB 3GH6A 2FWHA 3F8UA 5E59A 2GQKA 1X9MB 4POMA 4PTSA 4ECIA 2H6XA 2QKEA 3F63A 2GZZA 3RHBA 1URMA 4TXOA 2VCWA 3CYNA 1FOHA 1XW9A 4K5SA 4FQUA 5IMZA 1GWCA 1XCCA 3EPTA 2GT6A 3RPPA 3GV1A 5LCZA 2PPTA 4KF9A 1WP0A 4KCAA 2EIOA 2BMXA 3APOA 4TR1B 1YQ1A 3ZZXA 2DIZA 4O32A 2L6CA 1EZKA 2CVBA 2VCQA 4RQXA 3FZ9A 3S9FA 5G5EA 3H93A 2LV3A 2YANA 3F3QA 4I97A 4K5RA 1M99A 1GSSA 1GRXA 3NZNA 3QD9A 1GUKA 1AXDA 4TW5A 1M9BA 1NHYA 2KLXA 2YJHA 3MYDA 4TKYA 4YKFA 1R26A 3GTUB 4CY8A 2R37A 3FZ4A 4MNNA 4N11A 3EWLA 4F0BA 1EP7A 2DJ2A 1EV9A 2G0FA 1GSEA 4KB3A 5ECHB 4POBA 2PERA 2VL2A 4K7OA 1T4ZA 4L5OA 2IMIA 1ERTA 1F3AA 3MWHA 3KIJA 3FY7A 3UARA 2RLIA 20GSA 2M72A 3P7XA 3Q6OA 1SJZA 4WKWA 2TIRA 2IMEA 4FYUA 4ILFA 2XHFA 4ID0A 5ELGA 1OC3A 1GNWA 2IMDA 4MZBA 1GSDA 1CQGA 2PU9C 1JZWA 1XWCA 4YAVA 1EV4A 4PNGA 1ST9A 1YY7A 2PVOC 1F37A 2HSHA 2VAFA 4LL4B 1TK8B 1TU8A 2FWFA 5F07A 5G1KA 1YKAA 2VUPA 4KSMA 1OC9A 3ERFA 3KMNA 3FR9A 1ZGNA 3I69A 1XOAA 1S3CA 4ECJA 1THOA 5DAKB 3GHAA 2FNOA 3C73A 1EP8A 1J0FA 5J41A 1M3IA 3KD0A 5C04A 1VF1A 1SL0B 4OFMA 1BAYA 3PH9A 4YQVA 4PQIA 2GQMA 3HJOA 4TOPA 1A2JA 4BVYA 2I81A 3RBTA 2A2PA 2V6OA 11GSA 4N10A 3JCML 4JBBA 4G0IA 1TI3A 4BIKA 1B48A 3LXZA 4ZIJA 2DIYA 3P2AA 2UZ8A 4D73A 3TJFA 1C72A 3UEMA 2YZUA 1A23A 3HZ4A 3ERWA 3WGXA 1T3BA 1USBA 6GSUA 3FZ5A 1M9AA 3EU4A 5DBQA 4RI7A 5D9WA 4OO4A 5KN0A 4MH2A 5IIZA 3GA4A 3CTFA 4OD7A 1SYRA 2M80A 2JSZA 5DJLA 1V98A 5AISA 2GLRA 2HLSA 1OE7A 3HD5A 5GSTA 1ZYPA 2DMLA 3CSJA 4A5PA 4YQUA 5KEJA 3N9JA 3WT2A 1MTCA 5CRWA 5HR0A 2I3YA 1AW9A 4GSTA 5JCWA 3DVWA 2GZPA 1QGVA 2JSYA 2HSMA 2VIMA 2R5GA 1SKRB 4IP1A 6GSTA 2YNXA 1K0BA 4MPFA 3VWUA 1O8XA 4AJ7A 2GGTA 4V1Ag 5IPGA 1O8WA 5KN3A 9GSSA 2IJYA 1JZDA 2CQ9A 3L78A 2YP6A 3LORA 4OFNA 3G7JA 4EDYA 4H86A 2K18A 1OKDA 3KTLA 3R3EA 1OYJA 3IE3A 2ZUPA 5IMCA 4V2MA 3RAZA 2GDRA 3HDCA 4YQMA 3A2XA 3QAWA 5ECRB 12GSA 2ES7A 3M1GA 5HFKA 3EE2A 4G0KA 1PKWA 1B4PA 3UMAA 2CVKA 1DE2A 4XTSA 3Q19A 1N8JA 3F0IA 5FWGA 5A4WA 2ON7A 5ELAA 4PQ1A 4RUVA 1TDIA 3GKNA 4G2EA 4I2UA 1BQ7A 3GSTA 1FVJA 1QQ2A 3LGCA 1B4QA 3D4MA 1SYXA 1G7OA 2CX3A 4WBJA 3J7Yk 3EVIA 5ABRA 4XIHA 3EMXA 1XW5A 3LG6A 5J3RA 2AHEA 1R7HA 1UC7A 4GCIA 1A0FA 2QGVA 2LJRA 3UBLA 3FEUA 1YF0A 3ZREA 1Z3EA 3KCMA 1QK8A 1ZYQB 3MDKA 2LQOA 3D6IA 1BJXA 5ID2B 2IFQB 4EDZA 1Y6EA 2WGRA 5JWQB 2H19A 3IOSA 1B9YC 5EL8A 2K8SA 5DJMA 2C0EA 2NBSA 2L59A 1PX6A 2V41A 5B8BA 3L9UA 2OE3A 2QSIA 1OC8A 2HRNA 4DSQA 1SK0A 2JL4A 3E0UA 2CZ2A 1B9XC 2A4VA 1G7EA 1J08A 2HNLA 5HR3A 4X1UA 2IMFA 4G0LA 3UVTA 3HCZA 4TXVA 3E9JB 1DSBA 3ZVJA 3ZRDA 2PUKC 5J9CA 2RM6A 3MAKA 2AB6A 3D0ZA 4QL9A 3TKSC 5CAXA 1GSQA 2WZ9A 2LQQA 3ED3A 6GSWA 2F8AA 4JRRA 3VK9A 2H1AA 4Z2UA 3QAGA 1JLWA 3O76A 14GSA 1K3OA 2CX4A 3DD3A 2C1YA 3ZMLA 1GTAA 3GX8A 1R4WA 3DWVA 3D22A 4TXOB 2H71A 2B1KA 2ALBA 3KJYA 5ECPB 3O3TA 4G9HA 3LQ7A 4J57E 2DLXA 4FH8A 2HZEA 3HVSA 4Q5FA 5GAPD 1X5DA 2L57A 1MDJA 1X5EA 3D4TA 3A2VA 2P5RA 2MBTA 3GN3A 5CNWA 2IMKA 2TRCP 4K9ZA 2IN3A 3VWXA 1PRXA 3CSIA 3ZYWA 1DUGA 1XVQA 4MLYA 1UA5A 3BCIA 1WE0A 3HVVA 2N5AA 1U3IA 4ISDA 5KN2A 1PGTA 4F0CA 2XBIA 1SU9A 1K0OA 3KP9A 4ZL9A 18GSA 1SJ6A 1NW2A 2GSTA 4GWRA 3IC4A 1W4VA 2FCHA 2B5EA 3I6AA 4Z7XA 3ZVJD 2VL3A 4WF4A 2F9SA 4HUAA 1GTIA 4GSSA 4MF5A 4BWQA 2FA8A 2YV7A 4K6XA 1PMTA 4K0GA 2H75A 3GYKA 4EC0A 5G31A 2MZCA 1SL1B 3A3TA 1OE8A 4EE0A 5J5NA 5LNKe 5H5QA 4GXZA 1TRWA 2R3XA 4ZL8A 3TGZA 3QOUA 1M2BA 1SK1A 1JHBA 5AN1A 5AGYA 4ZB6A 6GSXA 5L71A 1Z7RA 2L4CA 2N5BA 1EOGA 1QMVA 3P90A 2DSAA 4IELA 1YZXA 1OC9B 3H4KA 1Q98A 3LXTA 1TRVA 4NXIA 3C71A 1WMJA 5G30A 2VL2C 3GSSA 3NOFA 4AJ8A 3ISOA 1F3BA 2GZYA 2HT9A 4BPYA 5G1LA 3QFAC 1GTBA 2QA2A 4ZILA 4LMWA 3G7YA 3R2QA 2LS5A 5DDLA 3GL5A 1TW9A 2QC7A 3TKRA 4F82A 4PURA 5F0GA 1MD3A 1M7TA 3TKQA 4BVYB 1OAZA 1HNAA 2CZ3A 4IKHA 1K0NA 3VLNA 5IQYA 5B7CA 1X0RA 2VM1A 1R5PA 3WGDA 2C3TA 4DVCA 4CW9A 1XOBA 2L6DA 2LNTA 3ME8A 3IBHA 2BTOT 1YF1A 2KP1A 3L9VA 2YWOA 1U88A 4KCEA 3IXRA 4POKA 3DIEA 4D73B 1K0DA 2R2JA 2VLUA 2O85A 1V40A 2VD0A 2RUFA 3FW2A 4Z2RA 3RDWA 4E8HA 3P8WA 1T1VA 3H79A 3HHVA 1KNGA 2YJ7A 3CMIA 1GSUA 1SL2B 8GSSA 1XVWA 1Q4JA 2REMA 2JZRA 1TI1A 5EVOA 2PBJA 2G2QA 3LWAA 1ABAA 5IM9A 1GTUA 3TJKA 3ZITA 2ZCTA 4WR5A 4IQAA 3LEFA 3GNJA 4KX4A 4KGIA 1O6JA 2WJUA 2MYGA 3KH7A 1YKCA 1AUCA 2C3QA 4IQ1A 1FB0A 4PUFC 3TRXA 1FVKA 19GSA 2H6YA 5LD0A 1M0UA 4AGSA 1XXUA 4RI6A 1VRSD 2H76A 1M3JA 4QQ7A 2V2GA 3J7Yb 4IJ3A 2X4AA 1TKDB 1FOVA 1AAZA 4TVEA 2H0IA 4G19A 1PQNA 2B7KA 4GRFA 3TJGA 5D9VA 3N5OA 4TR3A 1BG5A 5IO0A 1YEPA 3FKFA 2B3SA 3IV4A 4BVXB 3UAPA 4EIPA 2WCIA 5F06A 5DQYA 2F51A 5AIVA 1K0MA 2H8LA 4JZQA 1YJ6A 4I6XA 1HQOA 3UIWA 4OCFA 1VF2A 1FHEA 3ZL5A 1FO5A 4NWYA 4E8EA 1MEKA 3HY2A 4L0WA 5F05A 1OKTA 3ERGA 3HJPA 2WDUA 4Q5RA 1WRYA 2VCXA 4G10A 2KUCA 4XS4B 2E7PA 4GQFA 1JFUA 2WRTA 4WF5A 4O5UA 4EUYA 1DBYA 3C1SA 5IMDA 5KOWA 2CV4A 5IO2A 4NV5A 1S3AA 3UL3A 4EIQA 5FHIA 6GSVA 2C0GA 2L5OA 6GSYA 1ZYNA 4MDCA 5DAKA 1S3DA 4PNFA 1GLPA 4LA1A 4L0UA 2H72A 2CAQA 4ACSA 2FWEA 2NDOA 4EVMA 5D9TA 4XCSA 3M9JA 1ZCPA 2PGTA 1EEMA 3F4SA 4KDXA 4K2XA 4EKZA 4FYBA 3VWWA 3D5JA 3H8QA 5ECMB 4OWYA 4LL1B 4XHMA 1JZRA 2LRNA 2B6MA 3CRTA 3ZLPA 4XRDA 2A2SA 1UVZA 1TOFA 3CXGA 4YAPA 2H1BA 1EOHA 3AY8A 4GQCA 1TK5B 3HVXA 1T7PB 1O81A 2NVLA 2LJKA 3IHQA 3VI5A 3DKSA 5CREA 2LNSA 5ECNB 2RIIA 2DJ1A 3IK7A 1ZMAA 5CP1A 4YH2A 3C7MA 1QFNA 2OADA 5H5RA 5G5FA 4HQSA 2C4JA 4MF6A 3HVNA 3ZTLA 2HRKA 5H5SA 1YEXA 2F8FA 2J9HA 3GUSA 4JU5A 1PN0A 2DJ3A 1NSWA 1A8YA 6GSSA 1F6MC 1BEDA 1NHOA 2MMZA 2FY6A 2YN1A 1Z6MA 1GH2A 4PX1A 3BBYA 2H01A 1AQXA 3TB2A 4ZL7A 2R4VA 4USSA 5GZZB 2VO4A 4K8MA 5INYA 1A8LA 4MF7A 1IYIA 2H70A 1PL1A 1CQHA 2LRTA 2YOIA 1H4OA 4HS1A 1SKWB 2VLTA 1ERWA 3APSA 1GLQA 4ZBAA 4WR4A 1I5GA 4K7IA 2LKUA 5DALA 2JU5A 3QAVA 4KE3A 4O92A 3FR6A 1HD2A 2OE1A 4CY6A 5GSSA 2CT6A 1EEJA 4N0VA 3APQA 3IR4A 4DSSB 2H6ZA 2O89A 2HI7A 4ECCA 1BYEA 2E2MA 2IL3A 3F9UA 4IGJA 5ECIB 2YCDA 4MCUA 5D93A 7GSSA 3DRNA 4OCEA 4NV2A 2YWMA 2PMTA 2CAIA 4MH3A 1TJDA 2VM2A 3W8SA 2ON5A 3KH9A 3OR5A 3DGQA 3PGTA 2DJ0A 2EIQA 3BJ5A 4IS0A 4DEJA 4KW6A 5IMVA 1XWAA 2EC4A 4K1FA 3MIXA 2V6KA 3BOAA 3DEXA 2E0QA 3G7IA 4EF0A 2YWIA 1ERVA 1THXA 3QDNA 2LSTA 5IMAA 2N5FA 3TKSA 3DVXA 1Z5YE 2MMOA 3VURA 4GSNA 2HRAA 4MABA 5CO3A 2TRXA 4JEDA 2GTUA 2CVDA 4AJ6A 1SD8A 3V1WA 4I5QA 3L0HA 5CRGA 5ID2A 1PX7A 1ZOFA 3RHCA 1GULA 4WEYA 5B6NA 4JE1A 4MZCA 2Z9SA 4X4JA 1ON4A 5B8AA 3A5WA 3BCKA 3CSHA 3GURA 1RQMA 2IPAA 4GTUA 2KHPA 4L5LA 1JLVA 3DYRA 3WT1A 3TKPA 5F8BA 3ZFLA 1FB6A 2H74A 2DJKA 5KN1A 2H73A 1E2YA 2C80A 2HYXA 2LTKA 1K0AA 2FD3A 3RPNA 2HSYA 3GKXA 2HXKA 2VL9A 5IOXA 2GSQA 1O73A 3FYGA 2AV4A 1GL8A 3IA1A 2P5QA 13GSA 1N2AA 3GFKA 2X8HA 1HNCA 4TR0A 2FLSA 1V2AA 3L9SA 4JR4A 4KH7A 4J56E 3EURA 4PQHA 2GSSA 2JZSA 4FYCA 5ECQB 1AIUA 5ECLB 3I43A 4ECBA 3I9V2 3M0FA 4HEA2 3VFIA 2YZHA 1TRSA 4IBPA 3Q18A 3KM6A 1A2MA 3IRAA 4BL7A 4I8BA 2JADA 2CA8A 4KAEA 3PR8A 4ZB9A 3TOUA 3G9BA 1XW6A 1S3RA 4ZBBA 5EPFA 2JACA 4WETA 3CBUA 3EINA 1MDIA 1MDKA 4EO3A 3UVHA 3ME7A 4MPGA 1Z7PA 3IAM2 3LJRA 3A5IA 2EIRA 2B5YA 2XBQA 1O7UA 3FHKA 5G2ZA 3GIXA 3A2WA 4HJ2A 1AQVA 4MJAA 2GQLA 2X49A 5JCGA 4N0ZA 1TP9A 2R0PA 5HR2A 5FT3A 3U6VA 1B8XA 1GP1A 5HQPA 5EY6A 3FZAA 3NIVA 1EGRA 3HZ8A 1ILOA 4K0NA 5HR1A 1GNEA 3LYKA 1IYHA 3VI7A 5D73A 4MJCA 4MJBA 2NTOA 3ZIVA 3MSZA 4HDEA 3CQFA 1A0RP 2PWJA 5DVBA 2OBIA 2K6VA 1EGOA 3GMFA 1Z6NA 3KEBA 2X64A 1SK2A 3KZQA 4PGTA 1TTZA 1GSFA 4TRXA 1X5CA 3U5RE 4WBRD 1GUMA 5J4UA 3LSZA 1PL2A 2C0DA 4NHWA 1KEBA 2DKHA 1PSQA 4TR1A 4HI7A 1V57A 3UJ1A 3TRPA 1XWGA 1GSYA 5CRHA 4I2TA 4P3YB 1YDKA 3WD6A 1U6TA 1RW1A 4NPBA 1Y25A 10GSA 2H30A 3US3A 2OA7A 4OMVA 5A5KA 1XZOA 2FHEA 3LYPA 2AUVA 4O7HA 1T00A 1XIYA 2K9FA 3DMLA 3C8EA 5JCUA 3KTBA 3GTUA 1G6WA 1MD4A 3QPMA 4IJIA 2ZNMA 3IPZA 1WPIA 4N30A 4ZXGA 1SJIA 5GAND 2FA4A 3GH9A 2O7KA 3FR3A 3IHGA 4POLA 1KBNA 2OE0A 3F6FA 4OO5A 2LJAA 4ML1A 1XWBA 2OBKA 1XWKA 4XRAA 3FRCA 3LFLA 1VF3A 2QA1A 4NAXA 3WYWA 2D2ZA 2I1UA 5C00A 4EL1A 3W8JA 1TU7A 5ECSA 4LLRA 1ZZYA 1LU4A 1K3LA 3EYTA 1TK0B 5A4UA 4IP6A 2O87A 4ZB8A 2DC5A 4HJMA 2FWGA 17GSA 3EC3A 2B5XA 3QCPA 5ENUA 2FUG2 1ZYEA 3M8NA 2X8GA 4XS6A 2VD1A 2XPEA 3F4TA 3HXSA 3TUEA 4K2DA 3SWLA 5COHA 1PD21 1G0TA 1NM3A 2H66A 3TKSE 16GSA 3GKMA 4IW9A 1XFLA 3IC8A 3ZMKA 1QXHA 3QMXA 2H0GA 5BRTA 1PA3A 5HFIA 4GF0A 2VCZA 5AIXA 3FMWA 4OFTA 3EMPA 2P31A 4KNDA 3LW9A 4NMUA 3BD2A 3F6DA 2PVQA 2A4HA 1FAAA 5IMFA 2YPMA 3CTGA 3F4RA 1F9MA 1GUHA 2M46A 3C1RA 2R0GA 4V2NA 4X0XA 1TXXA 2X99A 1G6YA 2WULA 2RUEA 5HFGA 5IOWA 2LRCA 2DKIA 2H1GA 4MP4A 1X9WB 2WS2A 2DJJA 2HZFA 3KXOA 3GRXA 3GL3A 5DALB 4MZWA 5DQSA 5IPHA 1KTEA 2KP2A 1K0CA 1ZL9A 4V2LA 2AJQB 2BJXA 4HOJA 1V9WA 4BVXA 3VPQA 3PINA 1SENA 2C8UA 5ECKB 4X43A 2NPBA 1AC1A 1PFOA 3ZIJA 3KP8A 1A2LA 2L4QA 2YWNA 4RQRA 4Q5QA 3W6GA 4K7NA 5DCGA 4ML6A 2C3NA 3TCOA 5JWOB 1EWXA 4KDUA 2VCVA 2V32A 1I9DA 4J2FA 3DXBA 4NHZA 3IDVA 4KA0A 2R0CA 5E4WA 4XS4A 4CHSA 4PXOA 3TJBA 1VGLA 3MNGA 1FW1A 1Z9HA 3HYPA 1HYUA 1U3AA 1J9BA 1O85A 4QL7A 2LEGA 2PN8A 2MBSA 3KGKA 4JR6A 4O5RA 2WFCA 4MJEA 3HA9A 1VF4A 2F3MA 3M3MA 2IIYA 2WB9A 4HU7A 3F3RA 2L5LA 4HQZA 1DE1A 2XC2A 1LJRA 2HZEB 4KUNA 4WXTA 5ECOB 2I9HA 3QFBC 4MK3A 3VPTA 4XS1A 2P0GA 4ZBDA 1H75A 5CYYA 2MMAA 4HZ4A 4Z2TA 3WGEA 22GSA 2VLVA 4ULXA 2RM5A 2GSRA 1XPVA 2JZTA 2LUSA 1FG4A 1ACVA 2O8VB 5CRDA 3SBCA 2DBCA 1XBSA 1V58A 2IWTA 2HE3A 1BX9A 2FGXA 1HNBA 3EU3A 3CRUA 3UOMA 2AAWA 4HZ2A 4IN0A 3FK8A 3QR6A 1WIKA 2GT5A 3IAS2 4IVFA 4LMVA 1WJKA 1K3YA 2V1MA 2R6KA 4FIWA 4Q5NA 2X8CA 1XG8A 3GKKA 1U87A 2J23A 3GX0A 1WWJA 3H1NA 4DSRA 2OJLA 4BA7A 5KOXA 4BWSA 3HKRA 2YV9A 1ML6A 5D96A 3UBKA 2B7JA 1TRUA 3PPUA 1X9SB 5J9BA 4KSOA 4TN8A 1OVNA 2VOCA 1PKZA 2VCTA 4TR4A 3Q74A 1WOUA 3M9KA 2OKAA 1ERUA 4CDOA 1QUWA 3TRQA 1T4YA 1JZOA 4FO5A 2AYTA 4MMMA 2E2GA 3IK9A 4ICYA 2IFQA 2GVPA 3TJJA 5BMUA 4YKGA 4BL7B 4V1Ap 4PUAA 1M2AA 2B1LA 3K8NA
chains in the Genus database with same CATH topology
4AF2A 1M2DA 2K8VA 3TDGA 5JWRB 2H1DA 2MMNA 3KMOA 4F03A 5A4VA 1F2EA 1R5AA 4L8EA 4F9ZA 4KDYA 1W89A 5B6MA 3L4NA 5D9XA 4IHUA 2H0HA 2XPDA 2HRFA 1LBKA 4DSSA 1UN2A 3VWVA 4GLTA 4O5QA 1AQWA 4F2IA 5DCHA 2DMMA 2GS3A 2OACA 3HJMA 1RK4A 1SD9A 1A24A 2KOKA 1PN9A 3D21A 5D8IA 2A2RA 2C0FA 2HFDA 4MA9A 4EXJA 3ZFBA 3O6TA 4HU9A 3E3EA 2I4AA 1T8EB 3TOTA 1E6BA 1SKSB 3GH6A 2FWHA 3F8UA 5E59A 2GQKA 1X9MB 4POMA 4PTSA 4ECIA 2H6XA 2QKEA 3F63A 2GZZA 3RHBA 1URMA 4TXOA 2VCWA 3CYNA 1FOHA 1XW9A 4K5SA 4FQUA 5IMZA 1GWCA 1XCCA 3EPTA 2GT6A 3RPPA 3GV1A 5LCZA 2PPTA 4KF9A 1WP0A 4KCAA 2EIOA 2BMXA 3APOA 4TR1B 1YQ1A 3ZZXA 2DIZA 4O32A 2L6CA 1EZKA 2CVBA 2VCQA 4RQXA 3FZ9A 3S9FA 5G5EA 3H93A 2LV3A 2YANA 3F3QA 4I97A 4K5RA 1M99A 1GSSA 1GRXA 3NZNA 3QD9A 1GUKA 1AXDA 4TW5A 1M9BA 1NHYA 2KLXA 2YJHA 3MYDA 4TKYA 4YKFA 1R26A 3GTUB 4CY8A 2R37A 3FZ4A 4MNNA 4N11A 3EWLA 4F0BA 1EP7A 2DJ2A 1EV9A 2G0FA 1GSEA 4KB3A 5ECHB 4POBA 2PERA 2VL2A 4K7OA 1T4ZA 4L5OA 2IMIA 1ERTA 1F3AA 3MWHA 3KIJA 3FY7A 3UARA 2RLIA 20GSA 2M72A 3P7XA 3Q6OA 1SJZA 4WKWA 2TIRA 2IMEA 4FYUA 4ILFA 2XHFA 4ID0A 5ELGA 1OC3A 1GNWA 2IMDA 4MZBA 1GSDA 1CQGA 2PU9C 1JZWA 1XWCA 4YAVA 1EV4A 4PNGA 1ST9A 1YY7A 2PVOC 1F37A 2HSHA 2VAFA 4LL4B 1TK8B 1TU8A 2FWFA 5F07A 5G1KA 1YKAA 2VUPA 4KSMA 1OC9A 3ERFA 3KMNA 3FR9A 1ZGNA 3I69A 1XOAA 1S3CA 4ECJA 1THOA 5DAKB 3GHAA 2FNOA 3C73A 1EP8A 1J0FA 5J41A 3KD0A 5C04A 1VF1A 1SL0B 4OFMA 1BAYA 3PH9A 4YQVA 4PQIA 2GQMA 3HJOA 4TOPA 1A2JA 4BVYA 2I81A 3RBTA 2A2PA 2V6OA 11GSA 4N10A 3JCML 4JBBA 4G0IA 1TI3A 1B48A 3LXZA 4ZIJA 2DIYA 3P2AA 2UZ8A 4D73A 3TJFA 1C72A 3UEMA 2YZUA 1A23A 3HZ4A 3ERWA 3WGXA 1T3BA 1USBA 6GSUA 3FZ5A 1M9AA 3EU4A 5DBQA 4RI7A 5D9WA 4OO4A 5KN0A 4MH2A 5IIZA 3GA4A 3CTFA 4OD7A 1SYRA 2M80A 2JSZA 5DJLA 5AISA 1V98A 2GLRA 2HLSA 1OE7A 3HD5A 5GSTA 1ZYPA 2DMLA 3CSJA 4A5PA 4YQUA 5KEJA 3N9JA 3WT2A 1MTCA 5CRWA 5HR0A 2I3YA 1AW9A 4GSTA 5JCWA 3DVWA 2GZPA 1QGVA 2JSYA 2HSMA 2VIMA 2R5GA 1SKRB 4IP1A 6GSTA 2YNXA 1K0BA 4MPFA 3VWUA 1O8XA 4AJ7A 2GGTA 4V1Ag 5IPGA 1O8WA 5KN3A 9GSSA 2IJYA 1JZDA 2CQ9A 3L78A 2YP6A 3LORA 4OFNA 3G7JA 4EDYA 4H86A 2K18A 1OKDA 3KTLA 3R3EA 1OYJA 3IE3A 2ZUPA 5IMCA 4V2MA 3RAZA 2GDRA 3HDCA 4YQMA 3A2XA 3QAWA 5ECRB 12GSA 2ES7A 3M1GA 5HFKA 3EE2A 4G0KA 1PKWA 1B4PA 3UMAA 2CVKA 1DE2A 4XTSA 3Q19A 1N8JA 3F0IA 5FWGA 5A4WA 2ON7A 5ELAA 4PQ1A 4RUVA 1TDIA 3GKNA 4G2EA 4I2UA 1BQ7A 3GSTA 1FVJA 1QQ2A 3LGCA 1B4QA 3D4MA 1SYXA 1G7OA 2CX3A 4WBJA 3J7Yk 3EVIA 5ABRA 4XIHA 3EMXA 1XW5A 3LG6A 5J3RA 2AHEA 1R7HA 1UC7A 4GCIA 1A0FA 2QGVA 2LJRA 3UBLA 3FEUA 1YF0A 3ZREA 1Z3EA 3KCMA 1QK8A 1ZYQB 3MDKA 2LQOA 3D6IA 1BJXA 5ID2B 2IFQB 4EDZA 1Y6EA 2WGRA 5JWQB 2H19A 3IOSA 1B9YC 5EL8A 2K8SA 5DJMA 2C0EA 2NBSA 2L59A 1PX6A 2V41A 5B8BA 3L9UA 2OE3A 2QSIA 1OC8A 2HRNA 4DSQA 1SK0A 2JL4A 3E0UA 2CZ2A 1B9XC 2A4VA 1G7EA 1J08A 2HNLA 5HR3A 4X1UA 2IMFA 4G0LA 3UVTA 3HCZA 4TXVA 3E9JB 1DSBA 3ZVJA 3ZRDA 2PUKC 5J9CA 2RM6A 3MAKA 2AB6A 3D0ZA 4QL9A 3TKSC 5CAXA 1GSQA 2WZ9A 2LQQA 3ED3A 6GSWA 2F8AA 4JRRA 3VK9A 2H1AA 4Z2UA 3QAGA 1JLWA 3O76A 14GSA 1K3OA 2CX4A 3DD3A 2C1YA 3ZMLA 1GTAA 3GX8A 1R4WA 3DWVA 3D22A 4TXOB 2H71A 2B1KA 2ALBA 3KJYA 5ECPB 3O3TA 4G9HA 3LQ7A 4J57E 2DLXA 4FH8A 2HZEA 3HVSA 4Q5FA 5GAPD 1X5DA 2L57A 1MDJA 1X5EA 3D4TA 3A2VA 2P5RA 2MBTA 3GN3A 5CNWA 2IMKA 2TRCP 4K9ZA 2IN3A 3VWXA 1PRXA 3CSIA 3ZYWA 1DUGA 1XVQA 4MLYA 1UA5A 3BCIA 1WE0A 3HVVA 2N5AA 1U3IA 4ISDA 5KN2A 1PGTA 4F0CA 2XBIA 1SU9A 1K0OA 3KP9A 4ZL9A 18GSA 1SJ6A 1NW2A 2GSTA 4GWRA 3IC4A 1W4VA 2FCHA 2B5EA 3I6AA 4Z7XA 3ZVJD 2VL3A 4WF4A 2F9SA 4HUAA 1GTIA 4GSSA 4MF5A 4BWQA 2FA8A 2YV7A 4K6XA 1PMTA 4K0GA 2H75A 3GYKA 4EC0A 5G31A 2MZCA 1SL1B 3A3TA 1OE8A 4EE0A 5J5NA 5LNKe 5H5QA 4GXZA 1TRWA 2R3XA 4ZL8A 3TGZA 3QOUA 1M2BA 1SK1A 1JHBA 5AN1A 5AGYA 4ZB6A 6GSXA 5L71A 1Z7RA 2L4CA 2N5BA 1EOGA 1QMVA 3P90A 2DSAA 4IELA 1YZXA 1OC9B 3H4KA 1Q98A 3LXTA 1TRVA 4NXIA 3C71A 1WMJA 5G30A 2VL2C 3GSSA 3NOFA 4AJ8A 3ISOA 1F3BA 2GZYA 2HT9A 4BPYA 5G1LA 3QFAC 1GTBA 2QA2A 4ZILA 4LMWA 3G7YA 3R2QA 2LS5A 5DDLA 3GL5A 1TW9A 2QC7A 3TKRA 4F82A 4PURA 5F0GA 1MD3A 1M7TA 3TKQA 4BVYB 1OAZA 1HNAA 2CZ3A 4IKHA 1K0NA 3VLNA 5IQYA 5B7CA 1X0RA 2VM1A 1R5PA 3WGDA 2C3TA 4DVCA 4CW9A 1XOBA 2L6DA 2LNTA 3ME8A 3IBHA 2BTOT 1YF1A 2KP1A 3L9VA 2YWOA 1U88A 4KCEA 3IXRA 4POKA 3DIEA 4D73B 1K0DA 2R2JA 2VLUA 2O85A 1V40A 2VD0A 2RUFA 3FW2A 4Z2RA 3RDWA 4E8HA 3P8WA 1T1VA 3H79A 3HHVA 1KNGA 2YJ7A 3CMIA 1GSUA 1SL2B 8GSSA 1XVWA 1Q4JA 2REMA 2JZRA 1TI1A 5EVOA 2PBJA 2G2QA 3LWAA 1ABAA 5IM9A 1GTUA 3TJKA 3ZITA 2ZCTA 4WR5A 4IQAA 3LEFA 3GNJA 4KX4A 4KGIA 1O6JA 2WJUA 2MYGA 3KH7A 1YKCA 1AUCA 2C3QA 4IQ1A 1FB0A 4PUFC 3TRXA 1FVKA 19GSA 2H6YA 5LD0A 1M0UA 4AGSA 1XXUA 4RI6A 1VRSD 2H76A 4QQ7A 2V2GA 3J7Yb 4IJ3A 2X4AA 1TKDB 1FOVA 1AAZA 4TVEA 2H0IA 4G19A 1PQNA 2B7KA 4GRFA 3TJGA 5D9VA 3N5OA 4TR3A 1BG5A 5IO0A 1YEPA 3FKFA 2B3SA 3IV4A 4BVXB 3UAPA 4EIPA 2WCIA 5F06A 5DQYA 2F51A 5AIVA 1K0MA 2H8LA 4JZQA 1YJ6A 4I6XA 1HQOA 3UIWA 4OCFA 1VF2A 1FHEA 3ZL5A 1FO5A 4NWYA 4E8EA 1MEKA 3HY2A 4L0WA 5F05A 1OKTA 3ERGA 3HJPA 2WDUA 4Q5RA 1WRYA 2VCXA 4G10A 2KUCA 4XS4B 2E7PA 4GQFA 1JFUA 2WRTA 4WF5A 4O5UA 4EUYA 1DBYA 3C1SA 5IMDA 5KOWA 2CV4A 5IO2A 4NV5A 1S3AA 3UL3A 4EIQA 5FHIA 6GSVA 2C0GA 2L5OA 6GSYA 1ZYNA 4MDCA 5DAKA 1S3DA 4PNFA 1GLPA 4LA1A 4L0UA 2H72A 2CAQA 4ACSA 2FWEA 2NDOA 4EVMA 5D9TA 4XCSA 3M9JA 1ZCPA 2PGTA 1EEMA 3F4SA 4KDXA 4K2XA 4EKZA 4FYBA 3VWWA 3D5JA 3H8QA 5ECMB 4OWYA 4LL1B 4XHMA 1JZRA 2LRNA 2B6MA 3CRTA 3ZLPA 4XRDA 2A2SA 1UVZA 1TOFA 3CXGA 4YAPA 2H1BA 1EOHA 3AY8A 4GQCA 1TK5B 3HVXA 1T7PB 1O81A 2NVLA 2LJKA 3IHQA 3VI5A 3DKSA 5CREA 2LNSA 5ECNB 2RIIA 2DJ1A 3IK7A 1ZMAA 5CP1A 4YH2A 3C7MA 1QFNA 2OADA 5H5RA 5G5FA 4HQSA 2C4JA 4MF6A 3ZTLA 2HRKA 5H5SA 1YEXA 2F8FA 2J9HA 3GUSA 4JU5A 1PN0A 2DJ3A 1NSWA 1A8YA 6GSSA 1F6MC 1BEDA 1NHOA 2MMZA 2FY6A 2YN1A 1Z6MA 1GH2A 4PX1A 3BBYA 2H01A 1AQXA 3TB2A 4ZL7A 2R4VA 4USSA 5GZZB 2VO4A 4K8MA 5INYA 1A8LA 4MF7A 1IYIA 2H70A 1PL1A 1CQHA 2LRTA 2YOIA 1H4OA 4HS1A 1SKWB 2VLTA 1ERWA 3APSA 1GLQA 4ZBAA 4WR4A 1I5GA 4K7IA 2LKUA 5DALA 2JU5A 3QAVA 4KE3A 4O92A 3FR6A 1HD2A 2OE1A 4CY6A 5GSSA 2CT6A 1EEJA 4N0VA 3APQA 3IR4A 4DSSB 2H6ZA 2O89A 2HI7A 4ECCA 1BYEA 2E2MA 2IL3A 3F9UA 4IGJA 5ECIB 2YCDA 4MCUA 5D93A 7GSSA 3DRNA 4OCEA 4NV2A 2YWMA 2PMTA 2CAIA 4MH3A 1TJDA 2VM2A 3W8SA 2ON5A 3KH9A 3OR5A 3DGQA 3PGTA 2DJ0A 2EIQA 3BJ5A 4IS0A 4DEJA 4KW6A 5IMVA 1XWAA 2EC4A 4K1FA 3MIXA 2V6KA 3BOAA 3DEXA 2E0QA 3G7IA 4EF0A 2YWIA 1ERVA 1THXA 3QDNA 2LSTA 5IMAA 2N5FA 3TKSA 3DVXA 1Z5YE 2MMOA 3VURA 4GSNA 2HRAA 4MABA 5CO3A 2TRXA 4JEDA 2GTUA 2CVDA 4AJ6A 1SD8A 3V1WA 4I5QA 3L0HA 5CRGA 5ID2A 1PX7A 1ZOFA 3RHCA 1GULA 4WEYA 5B6NA 4JE1A 4MZCA 2Z9SA 4X4JA 1ON4A 5B8AA 3A5WA 3BCKA 3CSHA 3GURA 1RQMA 2IPAA 4GTUA 2KHPA 4L5LA 1JLVA 3DYRA 3WT1A 3TKPA 5F8BA 3ZFLA 1FB6A 2H74A 2DJKA 5KN1A 2H73A 1E2YA 2C80A 2HYXA 2LTKA 1K0AA 2FD3A 3RPNA 2HSYA 3GKXA 2HXKA 2VL9A 5IOXA 2GSQA 1O73A 3FYGA 2AV4A 1GL8A 3IA1A 2P5QA 13GSA 1N2AA 3GFKA 2X8HA 1HNCA 4TR0A 2FLSA 1V2AA 3L9SA 4JR4A 4KH7A 4J56E 3EURA 4PQHA 2GSSA 2JZSA 4FYCA 5ECQB 1AIUA 5ECLB 3I43A 4ECBA 3I9V2 3M0FA 4HEA2 3VFIA 2YZHA 1TRSA 4IBPA 3Q18A 3KM6A 1A2MA 3IRAA 4BL7A 4I8BA 2JADA 2CA8A 4KAEA 3PR8A 4ZB9A 3TOUA 3G9BA 1XW6A 4ZBBA 5EPFA 2JACA 4WETA 3CBUA 3EINA 1MDIA 1MDKA 4EO3A 3UVHA 3ME7A 4MPGA 1Z7PA 3IAM2 3LJRA 3A5IA 2EIRA 2B5YA 2XBQA 1O7UA 3FHKA 5G2ZA 3GIXA 3A2WA 4HJ2A 1AQVA 4MJAA 2GQLA 2X49A 5JCGA 4N0ZA 1TP9A 2R0PA 5HR2A 5FT3A 3U6VA 1B8XA 1GP1A 5HQPA 5EY6A 3FZAA 3NIVA 1EGRA 3HZ8A 1ILOA 4K0NA 5HR1A 1GNEA 3LYKA 1IYHA 3VI7A 5D73A 4MJCA 4MJBA 2NTOA 3ZIVA 3MSZA 4HDEA 1A0RP 2PWJA 5DVBA 2OBIA 2K6VA 1EGOA 3GMFA 1Z6NA 3KEBA 2X64A 1SK2A 3KZQA 4PGTA 1TTZA 1GSFA 4TRXA 1X5CA 3U5RE 4WBRD 1GUMA 5J4UA 3LSZA 1PL2A 2C0DA 4NHWA 1KEBA 2DKHA 1PSQA 4TR1A 4HI7A 1V57A 3UJ1A 3TRPA 1XWGA 1GSYA 5CRHA 4I2TA 4P3YB 1YDKA 3WD6A 1U6TA 1RW1A 4NPBA 1Y25A 10GSA 2H30A 3US3A 2OA7A 4OMVA 5A5KA 1XZOA 2FHEA 3LYPA 2AUVA 4O7HA 1T00A 1XIYA 2K9FA 3DMLA 3C8EA 5JCUA 3KTBA 3GTUA 1G6WA 1MD4A 3QPMA 4IJIA 2ZNMA 3IPZA 1WPIA 4N30A 4ZXGA 1SJIA 5GAND 2FA4A 3GH9A 2O7KA 3FR3A 3IHGA 4POLA 1KBNA 2OE0A 3F6FA 4OO5A 2LJAA 4ML1A 1XWBA 2OBKA 1XWKA 4XRAA 3FRCA 3LFLA 1VF3A 2QA1A 4NAXA 3WYWA 2D2ZA 2I1UA 5C00A 4EL1A 3W8JA 1TU7A 5ECSA 4LLRA 1ZZYA 1LU4A 1K3LA 3EYTA 1TK0B 5A4UA 4IP6A 2O87A 4ZB8A 2DC5A 4HJMA 2FWGA 17GSA 3EC3A 2B5XA 3QCPA 5ENUA 2FUG2 1ZYEA 3M8NA 2X8GA 4XS6A 2VD1A 2XPEA 3F4TA 3HXSA 3TUEA 4K2DA 3SWLA 5COHA 1PD21 1G0TA 1NM3A 2H66A 3TKSE 16GSA 3GKMA 4IW9A 1XFLA 3IC8A 3ZMKA 1QXHA 3QMXA 2H0GA 5BRTA 1PA3A 5HFIA 4GF0A 2VCZA 5AIXA 3FMWA 4OFTA 3EMPA 2P31A 4KNDA 3LW9A 4NMUA 3BD2A 3F6DA 2PVQA 2A4HA 1FAAA 5IMFA 2YPMA 3CTGA 3F4RA 1F9MA 1GUHA 2M46A 3C1RA 2R0GA 4V2NA 4X0XA 1TXXA 2X99A 1G6YA 2WULA 2RUEA 5HFGA 5IOWA 2LRCA 2DKIA 2H1GA 4MP4A 1X9WB 2WS2A 2DJJA 2HZFA 3KXOA 3GRXA 3GL3A 5DALB 4MZWA 5DQSA 5IPHA 1KTEA 2KP2A 1K0CA 1ZL9A 4V2LA 2AJQB 2BJXA 4HOJA 1V9WA 4BVXA 3VPQA 3PINA 1SENA 2C8UA 5ECKB 4X43A 2NPBA 1AC1A 3ZIJA 3KP8A 1A2LA 2L4QA 2YWNA 4RQRA 4Q5QA 3W6GA 4K7NA 5DCGA 4ML6A 2C3NA 3TCOA 5JWOB 1EWXA 4KDUA 2VCVA 2V32A 1I9DA 4J2FA 3DXBA 4NHZA 3IDVA 4KA0A 2R0CA 5E4WA 4XS4A 4CHSA 4PXOA 3TJBA 1VGLA 3MNGA 1FW1A 1Z9HA 3HYPA 1HYUA 1U3AA 1J9BA 1O85A 4QL7A 2LEGA 2PN8A 2MBSA 3KGKA 4JR6A 4O5RA 2WFCA 4MJEA 3HA9A 1VF4A 2F3MA 3M3MA 2IIYA 2WB9A 4HU7A 3F3RA 2L5LA 4HQZA 1DE1A 2XC2A 1LJRA 2HZEB 4KUNA 4WXTA 5ECOB 2I9HA 3QFBC 4MK3A 3VPTA 4XS1A 2P0GA 4ZBDA 1H75A 5CYYA 2MMAA 4HZ4A 4Z2TA 3WGEA 22GSA 2VLVA 4ULXA 2RM5A 2GSRA 1XPVA 2JZTA 2LUSA 1FG4A 1ACVA 2O8VB 5CRDA 3SBCA 2DBCA 1XBSA 1V58A 2IWTA 2HE3A 1BX9A 2FGXA 1HNBA 3EU3A 3CRUA 3UOMA 2AAWA 4HZ2A 4IN0A 3FK8A 3QR6A 1WIKA 2GT5A 3IAS2 4IVFA 4LMVA 1WJKA 1K3YA 2V1MA 2R6KA 4FIWA 4Q5NA 2X8CA 3GKKA 1U87A 2J23A 3GX0A 1WWJA 3H1NA 4DSRA 2OJLA 4BA7A 5KOXA 4BWSA 3HKRA 2YV9A 1ML6A 5D96A 3UBKA 2B7JA 1TRUA 3PPUA 1X9SB 5J9BA 4KSOA 4TN8A 1OVNA 2VOCA 1PKZA 2VCTA 4TR4A 3Q74A 1WOUA 3M9KA 2OKAA 1ERUA 4CDOA 1QUWA 3TRQA 1T4YA 1JZOA 4FO5A 2AYTA 4MMMA 2E2GA 3IK9A 4ICYA 2IFQA 2GVPA 3TJJA 5BMUA 4YKGA 4BL7B 4V1Ap 4PUAA 1M2AA 2B1LA 3K8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AF2 A;  1M2D A;  2K8V A;  3TDG A;  5JWR B;  2H1D A;  2MMN A;  3KMO A;  4F03 A;  5A4V A;  1F2E A;  1R5A A;  4L8E A;  4F9Z A;  4KDY A;  1W89 A;  5B6M A;  3L4N A;  5D9X A;  4IHU A;  2H0H A;  2XPD A;  2HRF A;  1LBK A;  4DSS A;  1UN2 A;  3VWV A;  4GLT A;  1AQW A;  4F2I A;  5DCH A;  2DMM A;  2GS3 A;  2OAC A;  3HJM A;  1RK4 A;  1SD9 A;  1A24 A;  2KOK A;  1PN9 A;  3D21 A;  5D8I A;  2A2R A;  2C0F A;  2HFD A;  4MA9 A;  4EXJ A;  3ZFB A;  3O6T A;  4HU9 A;  3E3E A;  2I4A A;  1T8E B;  3TOT A;  1E6B A;  1SKS B;  3GH6 A;  2FWH A;  3F8U A;  5E59 A;  2GQK A;  1X9M B;  4POM A;  4ECI A;  2H6X A;  2QKE A;  3F63 A;  2GZZ A;  3RHB A;  1URM A;  4TXO A;  2VCW A;  3CYN A;  1XW9 A;  5IMZ A;  1GWC A;  1XCC A;  2GT6 A;  3RPP A;  3GV1 A;  5LCZ A;  2PPT A;  1WP0 A;  4KCA A;  2EIO A;  2BMX A;  3APO A;  4TR1 B;  1YQ1 A;  3ZZX A;  2DIZ A;  4O32 A;  2L6C A;  1EZK A;  2CVB A;  2VCQ A;  4RQX A;  3FZ9 A;  3S9F A;  5G5E A;  3H93 A;  2LV3 A;  2YAN A;  3F3Q A;  4I97 A;  1M99 A;  1GSS A;  1GRX A;  3NZN A;  3QD9 A;  1GUK A;  1AXD A;  4TW5 A;  1M9B A;  1NHY A;  2KLX A;  2YJH A;  4TKY A;  1R26 A;  3GTU B;  2R37 A;  3FZ4 A;  4N11 A;  3EWL A;  4F0B A;  1EP7 A;  2DJ2 A;  1EV9 A;  2G0F A;  1GSE A;  4KB3 A;  5ECH B;  4POB A;  2PER A;  2VL2 A;  4K7O A;  1T4Z A;  4L5O A;  2IMI A;  1ERT A;  1F3A A;  3MWH A;  3KIJ A;  3FY7 A;  3UAR A;  2RLI A;  20GS A;  2M72 A;  3P7X A;  3Q6O A;  1SJZ A;  4WKW A;  2TIR A;  2IME A;  4FYU A;  4ILF A;  2XHF A;  4ID0 A;  5ELG A;  1OC3 A;  1GNW A;  2IMD A;  4MZB A;  1GSD A;  1CQG A;  2PU9 C;  1JZW A;  1XWC A;  4YAV A;  1EV4 A;  4PNG A;  1ST9 A;  1YY7 A;  2PVO C;  1F37 A;  2HSH A;  2VAF A;  4LL4 B;  1TK8 B;  1TU8 A;  2FWF A;  5F07 A;  5G1K A;  1YKA A;  2VUP A;  4KSM A;  1OC9 A;  3ERF A;  3KMN A;  3FR9 A;  1ZGN A;  3I69 A;  1XOA A;  1S3C A;  4ECJ A;  1THO A;  5DAK B;  3GHA A;  2FNO A;  3C73 A;  1EP8 A;  1J0F A;  5J41 A;  3KD0 A;  5C04 A;  1VF1 A;  1SL0 B;  4OFM A;  1BAY A;  3PH9 A;  4YQV A;  4PQI A;  2GQM A;  3HJO A;  4TOP A;  1A2J A;  4BVY A;  2I81 A;  3RBT A;  2V6O A;  11GS A;  4N10 A;  3JCM L;  4JBB A;  1TI3 A;  1B48 A;  3LXZ A;  4ZIJ A;  2DIY A;  3P2A A;  4D73 A;  3TJF A;  1C72 A;  3UEM A;  2YZU A;  1A23 A;  3HZ4 A;  3ERW A;  3WGX A;  1T3B A;  1USB A;  6GSU A;  3FZ5 A;  1M9A A;  3EU4 A;  5DBQ A;  4RI7 A;  5D9W A;  4OO4 A;  5KN0 A;  4MH2 A;  5IIZ A;  3GA4 A;  3CTF A;  4OD7 A;  1SYR A;  2M80 A;  2JSZ A;  5DJL A;  5AIS A;  1V98 A;  2GLR A;  2HLS A;  1OE7 A;  3HD5 A;  5GST A;  2DML A;  3CSJ A;  4YQU A;  5KEJ A;  3N9J A;  3WT2 A;  1MTC A;  5CRW A;  5HR0 A;  2I3Y A;  1AW9 A;  4GST A;  5JCW A;  3DVW A;  2GZP A;  1QGV A;  2JSY A;  2VIM A;  2R5G A;  1SKR B;  4IP1 A;  6GST A;  2YNX A;  1K0B A;  4MPF A;  3VWU A;  1O8X A;  4AJ7 A;  2GGT A;  4V1A g;  5IPG A;  1O8W A;  5KN3 A;  9GSS A;  2IJY A;  1JZD A;  2CQ9 A;  3L78 A;  2YP6 A;  3LOR A;  4OFN A;  3G7J A;  4EDY A;  4H86 A;  2K18 A;  1OKD A;  3KTL A;  1OYJ A;  3IE3 A;  2ZUP A;  5IMC A;  4V2M A;  3RAZ A;  2GDR A;  3HDC A;  4YQM A;  3A2X A;  3QAW A;  5ECR B;  12GS A;  2ES7 A;  3M1G A;  5HFK A;  3EE2 A;  1PKW A;  1B4P A;  3UMA A;  2CVK A;  1DE2 A;  4XTS A;  3Q19 A;  1N8J A;  3F0I A;  5FWG A;  5A4W A;  2ON7 A;  5ELA A;  4PQ1 A;  4RUV A;  1TDI A;  3GKN A;  4G2E A;  4I2U A;  1BQ7 A;  3GST A;  1FVJ A;  1QQ2 A;  3LGC A;  1B4Q A;  3D4M A;  1SYX A;  1G7O A;  2CX3 A;  4WBJ A;  3J7Y k;  3EVI A;  5ABR A;  4XIH A;  3EMX A;  1XW5 A;  3LG6 A;  5J3R A;  2AHE A;  1R7H A;  1UC7 A;  4GCI A;  1A0F A;  2QGV A;  2LJR A;  3UBL A;  3FEU A;  1YF0 A;  3ZRE A;  1Z3E A;  3KCM A;  1QK8 A;  1ZYQ B;  3MDK A;  2LQO A;  3D6I A;  1BJX A;  5ID2 B;  2IFQ B;  4EDZ A;  1Y6E A;  2WGR A;  5JWQ B;  2H19 A;  3IOS A;  1B9Y C;  5EL8 A;  2K8S A;  5DJM A;  2C0E A;  2NBS A;  2L59 A;  1PX6 A;  2V41 A;  5B8B A;  3L9U A;  2OE3 A;  2QSI A;  1OC8 A;  2HRN A;  4DSQ A;  1SK0 A;  2JL4 A;  3E0U A;  2CZ2 A;  1B9X C;  2A4V A;  1G7E A;  1J08 A;  2HNL A;  5HR3 A;  4X1U A;  2IMF A;  3UVT A;  3HCZ A;  4TXV A;  3E9J B;  1DSB A;  3ZVJ A;  3ZRD A;  2PUK C;  5J9C A;  2RM6 A;  3MAK A;  2AB6 A;  3D0Z A;  4QL9 A;  3TKS C;  5CAX A;  1GSQ A;  2WZ9 A;  2LQQ A;  3ED3 A;  6GSW A;  2F8A A;  4JRR A;  3VK9 A;  2H1A A;  3QAG A;  1JLW A;  3O76 A;  14GS A;  1K3O A;  2CX4 A;  3DD3 A;  2C1Y A;  3ZML A;  1GTA A;  3GX8 A;  1R4W A;  3DWV A;  3D22 A;  4TXO B;  2H71 A;  2B1K A;  2ALB A;  3KJY A;  5ECP B;  3O3T A;  4G9H A;  3LQ7 A;  4J57 E;  2DLX A;  4FH8 A;  2HZE A;  3HVS A;  4Q5F A;  5GAP D;  1X5D A;  2L57 A;  1MDJ A;  1X5E A;  3D4T A;  3A2V A;  2P5R A;  2MBT A;  3GN3 A;  5CNW A;  2IMK A;  2TRC P;  4K9Z A;  2IN3 A;  3VWX A;  1PRX A;  3CSI A;  3ZYW A;  1DUG A;  1XVQ A;  4MLY A;  1UA5 A;  3BCI A;  1WE0 A;  3HVV A;  2N5A A;  1U3I A;  4ISD A;  5KN2 A;  1PGT A;  4F0C A;  2XBI A;  1SU9 A;  1K0O A;  3KP9 A;  4ZL9 A;  18GS A;  1SJ6 A;  1NW2 A;  2GST A;  4GWR A;  3IC4 A;  1W4V A;  2FCH A;  2B5E A;  3I6A A;  4Z7X A;  3ZVJ D;  2VL3 A;  4WF4 A;  2F9S A;  4HUA A;  1GTI A;  4GSS A;  4MF5 A;  4BWQ A;  2FA8 A;  2YV7 A;  4K6X A;  1PMT A;  4K0G A;  2H75 A;  3GYK A;  4EC0 A;  5G31 A;  2MZC A;  1SL1 B;  3A3T A;  1OE8 A;  4EE0 A;  5J5N A;  5LNK e;  5H5Q A;  4GXZ A;  1TRW A;  2R3X A;  4ZL8 A;  3TGZ A;  3QOU A;  1M2B A;  1SK1 A;  1JHB A;  5AN1 A;  5AGY A;  4ZB6 A;  6GSX A;  5L71 A;  1Z7R A;  2L4C A;  2N5B A;  1EOG A;  1QMV A;  3P90 A;  2DSA A;  4IEL A;  1YZX A;  1OC9 B;  3H4K A;  1Q98 A;  3LXT A;  1TRV A;  4NXI A;  3C71 A;  1WMJ A;  5G30 A;  2VL2 C;  3GSS A;  3NOF A;  4AJ8 A;  3ISO A;  1F3B A;  2GZY A;  2HT9 A;  4BPY A;  5G1L A;  3QFA C;  1GTB A;  4ZIL A;  4LMW A;  3G7Y A;  3R2Q A;  2LS5 A;  5DDL A;  3GL5 A;  1TW9 A;  2QC7 A;  3TKR A;  4F82 A;  4PUR A;  5F0G A;  1MD3 A;  1M7T A;  3TKQ A;  1OAZ A;  1HNA A;  2CZ3 A;  4IKH A;  1K0N A;  3VLN A;  5IQY A;  5B7C A;  1X0R A;  2VM1 A;  1R5P A;  3WGD A;  2C3T A;  4DVC A;  4CW9 A;  1XOB A;  2L6D A;  2LNT A;  3ME8 A;  3IBH A;  2BTO T;  1YF1 A;  2KP1 A;  3L9V A;  2YWO A;  1U88 A;  4KCE A;  3IXR A;  4POK A;  3DIE A;  4D73 B;  1K0D A;  2R2J A;  2VLU A;  2O85 A;  1V40 A;  2VD0 A;  2RUF A;  3FW2 A;  3RDW A;  4E8H A;  3P8W A;  1T1V A;  3H79 A;  3HHV A;  1KNG A;  2YJ7 A;  3CMI A;  1GSU A;  1SL2 B;  8GSS A;  1XVW A;  1Q4J A;  2REM A;  2JZR A;  1TI1 A;  5EVO A;  2PBJ A;  2G2Q A;  3LWA A;  1ABA A;  5IM9 A;  1GTU A;  3TJK A;  3ZIT A;  2ZCT A;  4WR5 A;  4IQA A;  3LEF A;  3GNJ A;  4KX4 A;  4KGI A;  1O6J A;  2WJU A;  2MYG A;  3KH7 A;  1YKC A;  1AUC A;  2C3Q A;  4IQ1 A;  1FB0 A;  4PUF C;  3TRX A;  1FVK A;  19GS A;  2H6Y A;  5LD0 A;  1M0U A;  4AGS A;  1XXU A;  4RI6 A;  1VRS D;  2H76 A;  4QQ7 A;  2V2G A;  3J7Y b;  4IJ3 A;  1TKD B;  1FOV A;  1AAZ A;  4TVE A;  2H0I A;  4G19 A;  1PQN A;  2B7K A;  4GRF A;  3TJG A;  5D9V A;  3N5O A;  4TR3 A;  1BG5 A;  5IO0 A;  1YEP A;  3FKF A;  2B3S A;  3IV4 A;  3UAP A;  2WCI A;  5F06 A;  5DQY A;  2F51 A;  5AIV A;  1K0M A;  2H8L A;  4JZQ A;  1YJ6 A;  4I6X A;  1HQO A;  3UIW A;  4OCF A;  1VF2 A;  1FHE A;  3ZL5 A;  1FO5 A;  4NWY A;  4E8E A;  1MEK A;  3HY2 A;  4L0W A;  5F05 A;  1OKT A;  3ERG A;  3HJP A;  2WDU A;  4Q5R A;  1WRY A;  2VCX A;  4G10 A;  2KUC A;  4XS4 B;  2E7P A;  4GQF A;  1JFU A;  2WRT A;  4WF5 A;  4EUY A;  1DBY A;  3C1S A;  5IMD A;  2CV4 A;  5IO2 A;  4NV5 A;  1S3A A;  3UL3 A;  5FHI A;  6GSV A;  2C0G A;  2L5O A;  6GSY A;  4MDC A;  5DAK A;  1S3D A;  4PNF A;  1GLP A;  4LA1 A;  4L0U A;  2H72 A;  2CAQ A;  4ACS A;  2FWE A;  2NDO A;  4EVM A;  5D9T A;  4XCS A;  3M9J A;  1ZCP A;  2PGT A;  1EEM A;  3F4S A;  4KDX A;  4EKZ A;  4FYB A;  3VWW A;  3D5J A;  3H8Q A;  5ECM B;  4OWY A;  4LL1 B;  4XHM A;  1JZR A;  2LRN A;  2B6M A;  3CRT A;  3ZLP A;  4XRD A;  2A2S A;  1UVZ A;  1TOF A;  3CXG A;  4YAP A;  2H1B A;  1EOH A;  3AY8 A;  4GQC A;  1TK5 B;  3HVX A;  1T7P B;  1O81 A;  2NVL A;  2LJK A;  3IHQ A;  3VI5 A;  3DKS A;  5CRE A;  2LNS A;  5ECN B;  2RII A;  2DJ1 A;  3IK7 A;  1ZMA A;  5CP1 A;  4YH2 A;  3C7M A;  1QFN A;  2OAD A;  5H5R A;  5G5F A;  4HQS A;  2C4J A;  4MF6 A;  3ZTL A;  5H5S A;  1YEX A;  2F8F A;  2J9H A;  3GUS A;  4JU5 A;  2DJ3 A;  1NSW A;  1A8Y A;  6GSS A;  1F6M C;  1BED A;  1NHO A;  2MMZ A;  2FY6 A;  2YN1 A;  1Z6M A;  1GH2 A;  4PX1 A;  3BBY A;  2H01 A;  1AQX A;  3TB2 A;  4ZL7 A;  2R4V A;  5GZZ B;  2VO4 A;  4K8M A;  5INY A;  1A8L A;  4MF7 A;  1IYI A;  2H70 A;  1PL1 A;  1CQH A;  2LRT A;  2YOI A;  1H4O A;  4HS1 A;  1SKW B;  2VLT A;  1ERW A;  3APS A;  1GLQ A;  4ZBA A;  4WR4 A;  1I5G A;  4K7I A;  2LKU A;  5DAL A;  2JU5 A;  3QAV A;  4KE3 A;  4O92 A;  3FR6 A;  1HD2 A;  2OE1 A;  5GSS A;  2CT6 A;  1EEJ A;  4N0V A;  3APQ A;  3IR4 A;  4DSS B;  2H6Z A;  2O89 A;  2HI7 A;  4ECC A;  1BYE A;  2E2M A;  2IL3 A;  3F9U A;  4IGJ A;  5ECI B;  2YCD A;  4MCU A;  5D93 A;  7GSS A;  3DRN A;  4OCE A;  4NV2 A;  2YWM A;  2PMT A;  2CAI A;  4MH3 A;  1TJD A;  2VM2 A;  3W8S A;  2ON5 A;  3KH9 A;  3OR5 A;  3DGQ A;  3PGT A;  2DJ0 A;  2EIQ A;  3BJ5 A;  4IS0 A;  4DEJ A;  4KW6 A;  5IMV A;  1XWA A;  2EC4 A;  4K1F A;  2V6K A;  3BOA A;  3DEX A;  2E0Q A;  3G7I A;  4EF0 A;  2YWI A;  1ERV A;  1THX A;  3QDN A;  2LST A;  5IMA A;  2N5F A;  3TKS A;  3DVX A;  1Z5Y E;  2MMO A;  3VUR A;  4GSN A;  4MAB A;  5CO3 A;  2TRX A;  4JED A;  2GTU A;  2CVD A;  4AJ6 A;  1SD8 A;  3V1W A;  4I5Q A;  3L0H A;  5CRG A;  5ID2 A;  1PX7 A;  1ZOF A;  3RHC A;  1GUL A;  4WEY A;  5B6N A;  4JE1 A;  4MZC A;  2Z9S A;  1ON4 A;  5B8A A;  3A5W A;  3BCK A;  3CSH A;  3GUR A;  1RQM A;  2IPA A;  4GTU A;  2KHP A;  4L5L A;  1JLV A;  3DYR A;  3WT1 A;  3TKP A;  5F8B A;  3ZFL A;  1FB6 A;  2H74 A;  2DJK A;  5KN1 A;  2H73 A;  1E2Y A;  2C80 A;  2HYX A;  2LTK A;  1K0A A;  2FD3 A;  3RPN A;  2HSY A;  3GKX A;  2HXK A;  2VL9 A;  5IOX A;  2GSQ A;  1O73 A;  3FYG A;  2AV4 A;  1GL8 A;  3IA1 A;  2P5Q A;  13GS A;  1N2A A;  3GFK A;  2X8H A;  1HNC A;  4TR0 A;  2FLS A;  1V2A A;  3L9S A;  4JR4 A;  4KH7 A;  4J56 E;  3EUR A;  4PQH A;  2GSS A;  2JZS A;  4FYC A;  5ECQ B;  1AIU A;  5ECL B;  3I43 A;  4ECB A;  3I9V 2;  3M0F A;  4HEA 2;  3VFI A;  2YZH A;  1TRS A;  4IBP A;  3Q18 A;  3KM6 A;  1A2M A;  3IRA A;  4BL7 A;  4I8B A;  2JAD A;  2CA8 A;  4KAE A;  3PR8 A;  4ZB9 A;  3TOU A;  3G9B A;  1XW6 A;  4ZBB A;  5EPF A;  2JAC A;  4WET A;  3CBU A;  3EIN A;  1MDI A;  1MDK A;  4EO3 A;  3UVH A;  3ME7 A;  4MPG A;  1Z7P A;  3IAM 2;  3LJR A;  2EIR A;  2B5Y A;  2XBQ A;  1O7U A;  3FHK A;  5G2Z A;  3GIX A;  3A2W A;  4HJ2 A;  1AQV A;  4MJA A;  2GQL A;  5JCG A;  4N0Z A;  1TP9 A;  5HR2 A;  5FT3 A;  3U6V A;  1B8X A;  1GP1 A;  5HQP A;  5EY6 A;  3FZA A;  3NIV A;  1EGR A;  3HZ8 A;  1ILO A;  4K0N A;  5HR1 A;  1GNE A;  3LYK A;  1IYH A;  3VI7 A;  5D73 A;  4MJC A;  4MJB A;  2NTO A;  3ZIV A;  3MSZ A;  4HDE A;  1A0R P;  2PWJ A;  5DVB A;  2OBI A;  2K6V A;  1EGO A;  3GMF A;  1Z6N A;  3KEB A;  2X64 A;  1SK2 A;  3KZQ A;  4PGT A;  1TTZ A;  1GSF A;  4TRX A;  1X5C A;  3U5R E;  4WBR D;  1GUM A;  5J4U A;  3LSZ A;  1PL2 A;  2C0D A;  4NHW A;  1KEB A;  1PSQ A;  4TR1 A;  4HI7 A;  1V57 A;  3UJ1 A;  3TRP A;  1XWG A;  1GSY A;  5CRH A;  4I2T A;  4P3Y B;  1YDK A;  3WD6 A;  1U6T A;  1RW1 A;  4NPB A;  1Y25 A;  10GS A;  2H30 A;  3US3 A;  2OA7 A;  4OMV A;  5A5K A;  1XZO A;  2FHE A;  3LYP A;  2AUV A;  4O7H A;  1T00 A;  1XIY A;  2K9F A;  3DML A;  3C8E A;  5JCU A;  3KTB A;  3GTU A;  1G6W A;  1MD4 A;  3QPM A;  4IJI A;  2ZNM A;  3IPZ A;  1WPI A;  4N30 A;  4ZXG A;  1SJI A;  5GAN D;  2FA4 A;  3GH9 A;  2O7K A;  3FR3 A;  4POL A;  1KBN A;  2OE0 A;  3F6F A;  4OO5 A;  2LJA A;  4ML1 A;  1XWB A;  2OBK A;  1XWK A;  4XRA A;  3FRC A;  3LFL A;  1VF3 A;  4NAX A;  3WYW A;  2D2Z A;  2I1U A;  5C00 A;  4EL1 A;  3W8J A;  1TU7 A;  5ECS A;  4LLR A;  1ZZY A;  1LU4 A;  1K3L A;  3EYT A;  1TK0 B;  5A4U A;  4IP6 A;  2O87 A;  4ZB8 A;  2DC5 A;  4HJM A;  2FWG A;  17GS A;  3EC3 A;  2B5X A;  3QCP A;  5ENU A;  2FUG 2;  1ZYE A;  3M8N A;  2X8G A;  4XS6 A;  2VD1 A;  2XPE A;  3F4T A;  3HXS A;  3TUE A;  4K2D A;  3SWL A;  5COH A;  1PD2 1;  1G0T A;  1NM3 A;  2H66 A;  3TKS E;  16GS A;  3GKM A;  4IW9 A;  1XFL A;  3ZMK A;  1QXH A;  3QMX A;  2H0G A;  1PA3 A;  5HFI A;  4GF0 A;  2VCZ A;  5AIX A;  4OFT A;  3EMP A;  2P31 A;  4KND A;  4NMU A;  3BD2 A;  3F6D A;  2PVQ A;  1FAA A;  5IMF A;  2YPM A;  3CTG A;  3F4R A;  1F9M A;  1GUH A;  2M46 A;  3C1R A;  4V2N A;  4X0X A;  1TXX A;  2X99 A;  1G6Y A;  2WUL A;  2RUE A;  5HFG A;  5IOW A;  2LRC A;  2H1G A;  4MP4 A;  1X9W B;  2WS2 A;  2DJJ A;  2HZF A;  3KXO A;  3GRX A;  3GL3 A;  5DAL B;  4MZW A;  5DQS A;  5IPH A;  1KTE A;  2KP2 A;  1K0C A;  1ZL9 A;  4V2L A;  2AJQ B;  2BJX A;  4HOJ A;  1V9W A;  4BVX A;  3VPQ A;  3PIN A;  1SEN A;  2C8U A;  5ECK B;  4X43 A;  2NPB A;  1AC1 A;  3ZIJ A;  3KP8 A;  1A2L A;  2L4Q A;  2YWN A;  4RQR A;  4Q5Q A;  3W6G A;  4K7N A;  5DCG A;  4ML6 A;  2C3N A;  3TCO A;  5JWO B;  1EWX A;  4KDU A;  2VCV A;  2V32 A;  1I9D A;  4J2F A;  3DXB A;  4NHZ A;  3IDV A;  4KA0 A;  5E4W A;  4XS4 A;  4CHS A;  4PXO A;  3TJB A;  1VGL A;  3MNG A;  1FW1 A;  1Z9H A;  3HYP A;  1HYU A;  1U3A A;  1J9B A;  1O85 A;  4QL7 A;  2LEG A;  2PN8 A;  2MBS A;  3KGK A;  4JR6 A;  4O5R A;  2WFC A;  4MJE A;  3HA9 A;  1VF4 A;  2F3M A;  3M3M A;  2IIY A;  2WB9 A;  4HU7 A;  3F3R A;  2L5L A;  4HQZ A;  1DE1 A;  2XC2 A;  1LJR A;  2HZE B;  4KUN A;  5ECO B;  4WXT A;  2I9H A;  3QFB C;  4MK3 A;  3VPT A;  4XS1 A;  2P0G A;  4ZBD A;  1H75 A;  5CYY A;  2MMA A;  4HZ4 A;  3WGE A;  22GS A;  2VLV A;  4ULX A;  2RM5 A;  2GSR A;  1XPV A;  2JZT A;  2LUS A;  1FG4 A;  1ACV A;  2O8V B;  5CRD A;  3SBC A;  2DBC A;  1XBS A;  1V58 A;  2IWT A;  2HE3 A;  1BX9 A;  2FGX A;  1HNB A;  3EU3 A;  3CRU A;  3UOM A;  2AAW A;  4HZ2 A;  4IN0 A;  3FK8 A;  3QR6 A;  1WIK A;  2GT5 A;  3IAS 2;  4IVF A;  4LMV A;  1WJK A;  1K3Y A;  2V1M A;  2R6K A;  4FIW A;  4Q5N A;  2X8C A;  3GKK A;  1U87 A;  2J23 A;  3GX0 A;  1WWJ A;  3H1N A;  4DSR A;  2OJL A;  4BA7 A;  4BWS A;  3HKR A;  2YV9 A;  1ML6 A;  5D96 A;  3UBK A;  2B7J A;  1TRU A;  1X9S B;  5J9B A;  4KSO A;  4TN8 A;  1OVN A;  2VOC A;  1PKZ A;  2VCT A;  4TR4 A;  3Q74 A;  1WOU A;  3M9K A;  2OKA A;  1ERU A;  4CDO A;  1QUW A;  3TRQ A;  1T4Y A;  1JZO A;  4FO5 A;  2AYT A;  4MMM A;  2E2G A;  3IK9 A;  2IFQ A;  2GVP A;  3TJJ A;  4V1A p;  4PUA A;  1M2A A;  2B1L A;  3K8N A; 
#chains in the Genus database with same CATH topology
 4AF2 A;  1M2D A;  2K8V A;  3TDG A;  5JWR B;  2H1D A;  2MMN A;  3KMO A;  4F03 A;  5A4V A;  1F2E A;  1R5A A;  4L8E A;  4F9Z A;  4KDY A;  1W89 A;  5B6M A;  3L4N A;  5D9X A;  4IHU A;  2H0H A;  2XPD A;  2HRF A;  1LBK A;  4DSS A;  1UN2 A;  3VWV A;  4GLT A;  4O5Q A;  1AQW A;  4F2I A;  5DCH A;  2DMM A;  2GS3 A;  2OAC A;  3HJM A;  1RK4 A;  1SD9 A;  1A24 A;  2KOK A;  1PN9 A;  3D21 A;  5D8I A;  2A2R A;  2C0F A;  2HFD A;  4MA9 A;  4EXJ A;  3ZFB A;  3O6T A;  4HU9 A;  3E3E A;  4HSC X;  2I4A A;  1T8E B;  3TOT A;  1E6B A;  1SKS B;  3GH6 A;  2FWH A;  3F8U A;  5E59 A;  2GQK A;  1X9M B;  4POM A;  4PTS A;  4ECI A;  2H6X A;  2QKE A;  3F63 A;  2GZZ A;  3RHB A;  1URM A;  4TXO A;  2VCW A;  3CYN A;  1FOH A;  1XW9 A;  4K5S A;  4FQU A;  5IMZ A;  1GWC A;  1XCC A;  3EPT A;  2GT6 A;  3RPP A;  3GV1 A;  5LCZ A;  2PPT A;  4KF9 A;  1WP0 A;  4KCA A;  2EIO A;  2BMX A;  3APO A;  4TR1 B;  1YQ1 A;  3ZZX A;  2DIZ A;  4O32 A;  2L6C A;  1EZK A;  2CVB A;  2VCQ A;  4RQX A;  3FZ9 A;  3S9F A;  5G5E A;  3H93 A;  2LV3 A;  2YAN A;  3F3Q A;  4I97 A;  4K5R A;  1M99 A;  1GSS A;  1GRX A;  3NZN A;  3QD9 A;  1GUK A;  1AXD A;  4TW5 A;  1M9B A;  1NHY A;  2KLX A;  2YJH A;  3MYD A;  4TKY A;  4YKF A;  1R26 A;  3GTU B;  4CY8 A;  2R37 A;  3FZ4 A;  4MNN A;  4N11 A;  3EWL A;  4F0B A;  1EP7 A;  2DJ2 A;  1EV9 A;  2G0F A;  1GSE A;  4KB3 A;  5ECH B;  4POB A;  2PER A;  2VL2 A;  4K7O A;  1T4Z A;  4L5O A;  2IMI A;  1ERT A;  1F3A A;  3MWH A;  3KIJ A;  3FY7 A;  3UAR A;  2RLI A;  20GS A;  2M72 A;  3P7X A;  3Q6O A;  1SJZ A;  4WKW A;  2TIR A;  2IME A;  4FYU A;  4ILF A;  2XHF A;  4ID0 A;  5ELG A;  1OC3 A;  1GNW A;  2IMD A;  4MZB A;  1GSD A;  1CQG A;  2PU9 C;  1JZW A;  1XWC A;  4YAV A;  1EV4 A;  4PNG A;  1ST9 A;  1YY7 A;  2PVO C;  1F37 A;  2HSH A;  2VAF A;  4LL4 B;  1TK8 B;  1TU8 A;  2FWF A;  5F07 A;  5G1K A;  1YKA A;  2VUP A;  4KSM A;  1OC9 A;  3ERF A;  3KMN A;  3FR9 A;  1ZGN A;  3I69 A;  1XOA A;  1S3C A;  4ECJ A;  1THO A;  5DAK B;  3GHA A;  2FNO A;  3C73 A;  1EP8 A;  1J0F A;  5J41 A;  1M3I A;  3KD0 A;  5C04 A;  1VF1 A;  1SL0 B;  4OFM A;  1BAY A;  3PH9 A;  4YQV A;  4PQI A;  2GQM A;  3HJO A;  4TOP A;  1A2J A;  4BVY A;  2I81 A;  3RBT A;  2A2P A;  2V6O A;  11GS A;  4N10 A;  3JCM L;  4JBB A;  4G0I A;  1TI3 A;  4BIK A;  1B48 A;  3LXZ A;  4ZIJ A;  2DIY A;  3P2A A;  2UZ8 A;  4D73 A;  3TJF A;  1C72 A;  3UEM A;  2YZU A;  1A23 A;  3HZ4 A;  3ERW A;  3WGX A;  1T3B A;  1USB A;  6GSU A;  3FZ5 A;  1M9A A;  3EU4 A;  5DBQ A;  4RI7 A;  5D9W A;  4OO4 A;  5KN0 A;  4MH2 A;  5IIZ A;  3GA4 A;  3CTF A;  4OD7 A;  1SYR A;  2M80 A;  2JSZ A;  5DJL A;  1V98 A;  5AIS A;  2GLR A;  2HLS A;  1OE7 A;  3HD5 A;  5GST A;  1ZYP A;  2DML A;  3CSJ A;  4A5P A;  4YQU A;  5KEJ A;  3N9J A;  3WT2 A;  1MTC A;  5CRW A;  5HR0 A;  2I3Y A;  1AW9 A;  4GST A;  5JCW A;  3DVW A;  2GZP A;  1QGV A;  2JSY A;  2HSM A;  2VIM A;  2R5G A;  1SKR B;  4IP1 A;  6GST A;  2YNX A;  1K0B A;  4MPF A;  3VWU A;  1O8X A;  4AJ7 A;  2GGT A;  4V1A g;  5IPG A;  1O8W A;  5KN3 A;  9GSS A;  2IJY A;  1JZD A;  2CQ9 A;  3L78 A;  2YP6 A;  3LOR A;  4OFN A;  3G7J A;  4EDY A;  4H86 A;  2K18 A;  1OKD A;  3KTL A;  3R3E A;  1OYJ A;  3IE3 A;  2ZUP A;  5IMC A;  4V2M A;  3RAZ A;  2GDR A;  3HDC A;  4YQM A;  3A2X A;  3QAW A;  5ECR B;  12GS A;  2ES7 A;  3M1G A;  5HFK A;  3EE2 A;  4G0K A;  1PKW A;  1B4P A;  3UMA A;  2CVK A;  1DE2 A;  4XTS A;  3Q19 A;  1N8J A;  3F0I A;  5FWG A;  5A4W A;  2ON7 A;  5ELA A;  4PQ1 A;  4RUV A;  1TDI A;  3GKN A;  4G2E A;  4I2U A;  1BQ7 A;  3GST A;  1FVJ A;  1QQ2 A;  3LGC A;  1B4Q A;  3D4M A;  1SYX A;  1G7O A;  2CX3 A;  4WBJ A;  3J7Y k;  3EVI A;  5ABR A;  4XIH A;  3EMX A;  1XW5 A;  3LG6 A;  5J3R A;  2AHE A;  1R7H A;  1UC7 A;  4GCI A;  1A0F A;  2QGV A;  2LJR A;  3UBL A;  3FEU A;  1YF0 A;  3ZRE A;  1Z3E A;  3KCM A;  1QK8 A;  1ZYQ B;  3MDK A;  2LQO A;  3D6I A;  1BJX A;  5ID2 B;  2IFQ B;  4EDZ A;  1Y6E A;  2WGR A;  5JWQ B;  2H19 A;  3IOS A;  1B9Y C;  5EL8 A;  2K8S A;  5DJM A;  2C0E A;  2NBS A;  2L59 A;  1PX6 A;  2V41 A;  5B8B A;  3L9U A;  2OE3 A;  2QSI A;  1OC8 A;  2HRN A;  4DSQ A;  1SK0 A;  2JL4 A;  3E0U A;  2CZ2 A;  1B9X C;  2A4V A;  1G7E A;  1J08 A;  2HNL A;  5HR3 A;  4X1U A;  2IMF A;  4G0L A;  3UVT A;  3HCZ A;  4TXV A;  3E9J B;  1DSB A;  3ZVJ A;  3ZRD A;  2PUK C;  5J9C A;  2RM6 A;  3MAK A;  2AB6 A;  3D0Z A;  4QL9 A;  3TKS C;  5CAX A;  1GSQ A;  2WZ9 A;  2LQQ A;  3ED3 A;  6GSW A;  2F8A A;  4JRR A;  3VK9 A;  2H1A A;  4Z2U A;  3QAG A;  1JLW A;  3O76 A;  14GS A;  1K3O A;  2CX4 A;  3DD3 A;  2C1Y A;  3ZML A;  1GTA A;  3GX8 A;  1R4W A;  3DWV A;  3D22 A;  4TXO B;  2H71 A;  2B1K A;  2ALB A;  3KJY A;  5ECP B;  3O3T A;  4G9H A;  3LQ7 A;  4J57 E;  2DLX A;  4FH8 A;  2HZE A;  3HVS A;  4Q5F A;  5GAP D;  1X5D A;  2L57 A;  1MDJ A;  1X5E A;  3D4T A;  3A2V A;  2P5R A;  2MBT A;  3GN3 A;  5CNW A;  2IMK A;  2TRC P;  4K9Z A;  2IN3 A;  3VWX A;  1PRX A;  3CSI A;  3ZYW A;  1DUG A;  1XVQ A;  4MLY A;  1UA5 A;  3BCI A;  1WE0 A;  3HVV A;  2N5A A;  1U3I A;  4ISD A;  5KN2 A;  1PGT A;  4F0C A;  2XBI A;  1SU9 A;  1K0O A;  3KP9 A;  4ZL9 A;  18GS A;  1SJ6 A;  1NW2 A;  2GST A;  4GWR A;  3IC4 A;  1W4V A;  2FCH A;  2B5E A;  3I6A A;  4Z7X A;  3ZVJ D;  2VL3 A;  4WF4 A;  2F9S A;  4HUA A;  1GTI A;  4GSS A;  4MF5 A;  4BWQ A;  2FA8 A;  2YV7 A;  4K6X A;  1PMT A;  4K0G A;  2H75 A;  3GYK A;  4EC0 A;  5G31 A;  2MZC A;  1SL1 B;  3A3T A;  1OE8 A;  4EE0 A;  5J5N A;  5LNK e;  5H5Q A;  4GXZ A;  1TRW A;  2R3X A;  4ZL8 A;  3TGZ A;  3QOU A;  1M2B A;  1SK1 A;  1JHB A;  5AN1 A;  5AGY A;  4ZB6 A;  6GSX A;  5L71 A;  1Z7R A;  2L4C A;  2N5B A;  1EOG A;  1QMV A;  3P90 A;  2DSA A;  4IEL A;  1YZX A;  1OC9 B;  3H4K A;  1Q98 A;  3LXT A;  1TRV A;  4NXI A;  3C71 A;  1WMJ A;  5G30 A;  2VL2 C;  3GSS A;  3NOF A;  4AJ8 A;  3ISO A;  1F3B A;  2GZY A;  2HT9 A;  4BPY A;  5G1L A;  3QFA C;  1GTB A;  2QA2 A;  4ZIL A;  4LMW A;  3G7Y A;  3R2Q A;  2LS5 A;  5DDL A;  3GL5 A;  1TW9 A;  2QC7 A;  3TKR A;  4F82 A;  4PUR A;  5F0G A;  1MD3 A;  1M7T A;  3TKQ A;  4BVY B;  1OAZ A;  1HNA A;  2CZ3 A;  4IKH A;  1K0N A;  3VLN A;  5IQY A;  5B7C A;  1X0R A;  2VM1 A;  1R5P A;  3WGD A;  2C3T A;  4DVC A;  4CW9 A;  1XOB A;  2L6D A;  2LNT A;  3ME8 A;  3IBH A;  2BTO T;  1YF1 A;  2KP1 A;  3L9V A;  2YWO A;  1U88 A;  4KCE A;  3IXR A;  4POK A;  3DIE A;  4D73 B;  1K0D A;  2R2J A;  2VLU A;  2O85 A;  1V40 A;  2VD0 A;  2RUF A;  3FW2 A;  4Z2R A;  3RDW A;  4E8H A;  3P8W A;  1T1V A;  3H79 A;  3HHV A;  1KNG A;  2YJ7 A;  3CMI A;  1GSU A;  1SL2 B;  8GSS A;  1XVW A;  1Q4J A;  2REM A;  2JZR A;  1TI1 A;  5EVO A;  2PBJ A;  2G2Q A;  3LWA A;  1ABA A;  5IM9 A;  1GTU A;  3TJK A;  3ZIT A;  2ZCT A;  4WR5 A;  4IQA A;  3LEF A;  3GNJ A;  4KX4 A;  4KGI A;  1O6J A;  2WJU A;  2MYG A;  3KH7 A;  1YKC A;  1AUC A;  2C3Q A;  4IQ1 A;  1FB0 A;  4PUF C;  3TRX A;  1FVK A;  19GS A;  2H6Y A;  5LD0 A;  1M0U A;  4AGS A;  1XXU A;  4RI6 A;  1VRS D;  2H76 A;  1M3J A;  4QQ7 A;  2V2G A;  3J7Y b;  4IJ3 A;  2X4A A;  1TKD B;  1FOV A;  1AAZ A;  4TVE A;  2H0I A;  4G19 A;  1PQN A;  2B7K A;  4GRF A;  3TJG A;  5D9V A;  3N5O A;  4TR3 A;  1BG5 A;  5IO0 A;  1YEP A;  3FKF A;  2B3S A;  3IV4 A;  4BVX B;  3UAP A;  4EIP A;  2WCI A;  5F06 A;  5DQY A;  2F51 A;  5AIV A;  1K0M A;  2H8L A;  4JZQ A;  1YJ6 A;  4I6X A;  1HQO A;  3UIW A;  4OCF A;  1VF2 A;  1FHE A;  3ZL5 A;  1FO5 A;  4NWY A;  4E8E A;  1MEK A;  3HY2 A;  4L0W A;  5F05 A;  1OKT A;  3ERG A;  3HJP A;  2WDU A;  4Q5R A;  1WRY A;  2VCX A;  4G10 A;  2KUC A;  4XS4 B;  2E7P A;  4GQF A;  1JFU A;  2WRT A;  4WF5 A;  4O5U A;  4EUY A;  1DBY A;  3C1S A;  5IMD A;  5KOW A;  2CV4 A;  5IO2 A;  4NV5 A;  1S3A A;  3UL3 A;  4EIQ A;  5FHI A;  6GSV A;  2C0G A;  2L5O A;  6GSY A;  1ZYN A;  4MDC A;  5DAK A;  1S3D A;  4PNF A;  1GLP A;  4LA1 A;  4L0U A;  2H72 A;  2CAQ A;  4ACS A;  2FWE A;  2NDO A;  4EVM A;  5D9T A;  4XCS A;  3M9J A;  1ZCP A;  2PGT A;  1EEM A;  3F4S A;  4KDX A;  4K2X A;  4EKZ A;  4FYB A;  3VWW A;  3D5J A;  3H8Q A;  5ECM B;  4OWY A;  4LL1 B;  4XHM A;  1JZR A;  2LRN A;  2B6M A;  3CRT A;  3ZLP A;  4XRD A;  2A2S A;  1UVZ A;  1TOF A;  3CXG A;  4YAP A;  2H1B A;  1EOH A;  3AY8 A;  4GQC A;  1TK5 B;  3HVX A;  1T7P B;  1O81 A;  2NVL A;  2LJK A;  3IHQ A;  3VI5 A;  3DKS A;  5CRE A;  2LNS A;  5ECN B;  2RII A;  2DJ1 A;  3IK7 A;  1ZMA A;  5CP1 A;  4YH2 A;  3C7M A;  1QFN A;  2OAD A;  5H5R A;  5G5F A;  4HQS A;  2C4J A;  4MF6 A;  3HVN A;  3ZTL A;  2HRK A;  5H5S A;  1YEX A;  2F8F A;  2J9H A;  3GUS A;  4JU5 A;  1PN0 A;  2DJ3 A;  1NSW A;  1A8Y A;  6GSS A;  1F6M C;  1BED A;  1NHO A;  2MMZ A;  2FY6 A;  2YN1 A;  1Z6M A;  1GH2 A;  4PX1 A;  3BBY A;  2H01 A;  1AQX A;  3TB2 A;  4ZL7 A;  2R4V A;  4USS A;  5GZZ B;  2VO4 A;  4K8M A;  5INY A;  1A8L A;  4MF7 A;  1IYI A;  2H70 A;  1PL1 A;  1CQH A;  2LRT A;  2YOI A;  1H4O A;  4HS1 A;  1SKW B;  2VLT A;  1ERW A;  3APS A;  1GLQ A;  4ZBA A;  4WR4 A;  1I5G A;  4K7I A;  2LKU A;  5DAL A;  2JU5 A;  3QAV A;  4KE3 A;  4O92 A;  3FR6 A;  1HD2 A;  2OE1 A;  4CY6 A;  5GSS A;  2CT6 A;  1EEJ A;  4N0V A;  3APQ A;  3IR4 A;  4DSS B;  2H6Z A;  2O89 A;  2HI7 A;  4ECC A;  1BYE A;  2E2M A;  2IL3 A;  3F9U A;  4IGJ A;  5ECI B;  2YCD A;  4MCU A;  5D93 A;  7GSS A;  3DRN A;  4OCE A;  4NV2 A;  2YWM A;  2PMT A;  2CAI A;  4MH3 A;  1TJD A;  2VM2 A;  3W8S A;  2ON5 A;  3KH9 A;  3OR5 A;  3DGQ A;  3PGT A;  2DJ0 A;  2EIQ A;  3BJ5 A;  4IS0 A;  4DEJ A;  4KW6 A;  5IMV A;  1XWA A;  2EC4 A;  4K1F A;  3MIX A;  2V6K A;  3BOA A;  3DEX A;  2E0Q A;  3G7I A;  4EF0 A;  2YWI A;  1ERV A;  1THX A;  3QDN A;  2LST A;  5IMA A;  2N5F A;  3TKS A;  3DVX A;  1Z5Y E;  2MMO A;  3VUR A;  4GSN A;  2HRA A;  4MAB A;  5CO3 A;  2TRX A;  4JED A;  2GTU A;  2CVD A;  4AJ6 A;  1SD8 A;  3V1W A;  4I5Q A;  3L0H A;  5CRG A;  5ID2 A;  1PX7 A;  1ZOF A;  3RHC A;  1GUL A;  4WEY A;  5B6N A;  4JE1 A;  4MZC A;  2Z9S A;  4X4J A;  1ON4 A;  5B8A A;  3A5W A;  3BCK A;  3CSH A;  3GUR A;  1RQM A;  2IPA A;  4GTU A;  2KHP A;  4L5L A;  1JLV A;  3DYR A;  3WT1 A;  3TKP A;  5F8B A;  3ZFL A;  1FB6 A;  2H74 A;  2DJK A;  5KN1 A;  2H73 A;  1E2Y A;  2C80 A;  2HYX A;  2LTK A;  1K0A A;  2FD3 A;  3RPN A;  2HSY A;  3GKX A;  2HXK A;  2VL9 A;  5IOX A;  2GSQ A;  1O73 A;  3FYG A;  2AV4 A;  1GL8 A;  3IA1 A;  2P5Q A;  13GS A;  1N2A A;  3GFK A;  2X8H A;  1HNC A;  4TR0 A;  2FLS A;  1V2A A;  3L9S A;  4JR4 A;  4KH7 A;  4J56 E;  3EUR A;  4PQH A;  2GSS A;  2JZS A;  4FYC A;  5ECQ B;  1AIU A;  5ECL B;  3I43 A;  4ECB A;  3I9V 2;  3M0F A;  4HEA 2;  3VFI A;  2YZH A;  1TRS A;  4IBP A;  3Q18 A;  3KM6 A;  1A2M A;  3IRA A;  4BL7 A;  4I8B A;  2JAD A;  2CA8 A;  4KAE A;  3PR8 A;  4ZB9 A;  3TOU A;  3G9B A;  1XW6 A;  1S3R A;  4ZBB A;  5EPF A;  2JAC A;  4WET A;  3CBU A;  3EIN A;  1MDI A;  1MDK A;  4EO3 A;  3UVH A;  3ME7 A;  4MPG A;  1Z7P A;  3IAM 2;  3LJR A;  3A5I A;  2EIR A;  2B5Y A;  2XBQ A;  1O7U A;  3FHK A;  5G2Z A;  3GIX A;  3A2W A;  4HJ2 A;  1AQV A;  4MJA A;  2GQL A;  2X49 A;  5JCG A;  4N0Z A;  1TP9 A;  2R0P A;  5HR2 A;  5FT3 A;  3U6V A;  1B8X A;  1GP1 A;  5HQP A;  5EY6 A;  3FZA A;  3NIV A;  1EGR A;  3HZ8 A;  1ILO A;  4K0N A;  5HR1 A;  1GNE A;  3LYK A;  1IYH A;  3VI7 A;  5D73 A;  4MJC A;  4MJB A;  2NTO A;  3ZIV A;  3MSZ A;  4HDE A;  3CQF A;  1A0R P;  2PWJ A;  5DVB A;  2OBI A;  2K6V A;  1EGO A;  3GMF A;  1Z6N A;  3KEB A;  2X64 A;  1SK2 A;  3KZQ A;  4PGT A;  1TTZ A;  1GSF A;  4TRX A;  1X5C A;  3U5R E;  4WBR D;  1GUM A;  5J4U A;  3LSZ A;  1PL2 A;  2C0D A;  4NHW A;  1KEB A;  2DKH A;  1PSQ A;  4TR1 A;  4HI7 A;  1V57 A;  3UJ1 A;  3TRP A;  1XWG A;  1GSY A;  5CRH A;  4I2T A;  4P3Y B;  1YDK A;  3WD6 A;  1U6T A;  1RW1 A;  4NPB A;  1Y25 A;  10GS A;  2H30 A;  3US3 A;  2OA7 A;  4OMV A;  5A5K A;  1XZO A;  2FHE A;  3LYP A;  2AUV A;  4O7H A;  1T00 A;  1XIY A;  2K9F A;  3DML A;  3C8E A;  5JCU A;  3KTB A;  3GTU A;  1G6W A;  1MD4 A;  3QPM A;  4IJI A;  2ZNM A;  3IPZ A;  1WPI A;  4N30 A;  4ZXG A;  1SJI A;  5GAN D;  2FA4 A;  3GH9 A;  2O7K A;  3FR3 A;  3IHG A;  4POL A;  1KBN A;  2OE0 A;  3F6F A;  4OO5 A;  2LJA A;  4ML1 A;  1XWB A;  2OBK A;  1XWK A;  4XRA A;  3FRC A;  3LFL A;  1VF3 A;  2QA1 A;  4NAX A;  3WYW A;  2D2Z A;  2I1U A;  5C00 A;  4EL1 A;  3W8J A;  1TU7 A;  5ECS A;  4LLR A;  1ZZY A;  1LU4 A;  1K3L A;  3EYT A;  1TK0 B;  5A4U A;  4IP6 A;  2O87 A;  4ZB8 A;  2DC5 A;  4HJM A;  2FWG A;  17GS A;  3EC3 A;  2B5X A;  3QCP A;  5ENU A;  2FUG 2;  1ZYE A;  3M8N A;  2X8G A;  4XS6 A;  2VD1 A;  2XPE A;  3F4T A;  3HXS A;  3TUE A;  4K2D A;  3SWL A;  5COH A;  1PD2 1;  1G0T A;  1NM3 A;  2H66 A;  3TKS E;  16GS A;  3GKM A;  4IW9 A;  1XFL A;  3IC8 A;  3ZMK A;  1QXH A;  3QMX A;  2H0G A;  5BRT A;  1PA3 A;  5HFI A;  4GF0 A;  2VCZ A;  5AIX A;  3FMW A;  4OFT A;  3EMP A;  2P31 A;  4KND A;  3LW9 A;  4NMU A;  3BD2 A;  3F6D A;  2PVQ A;  2A4H A;  1FAA A;  5IMF A;  2YPM A;  3CTG A;  3F4R A;  1F9M A;  1GUH A;  2M46 A;  3C1R A;  2R0G A;  4V2N A;  4X0X A;  1TXX A;  2X99 A;  1G6Y A;  2WUL A;  2RUE A;  5HFG A;  5IOW A;  2LRC A;  2DKI A;  2H1G A;  4MP4 A;  1X9W B;  2WS2 A;  2DJJ A;  2HZF A;  3KXO A;  3GRX A;  3GL3 A;  5DAL B;  4MZW A;  5DQS A;  5IPH A;  1KTE A;  2KP2 A;  1K0C A;  1ZL9 A;  4V2L A;  2AJQ B;  2BJX A;  4HOJ A;  1V9W A;  4BVX A;  3VPQ A;  3PIN A;  1SEN A;  2C8U A;  5ECK B;  4X43 A;  2NPB A;  1AC1 A;  1PFO A;  3ZIJ A;  3KP8 A;  1A2L A;  2L4Q A;  2YWN A;  4RQR A;  4Q5Q A;  3W6G A;  4K7N A;  5DCG A;  4ML6 A;  2C3N A;  3TCO A;  5JWO B;  1EWX A;  4KDU A;  2VCV A;  2V32 A;  1I9D A;  4J2F A;  3DXB A;  4NHZ A;  3IDV A;  4KA0 A;  2R0C A;  5E4W A;  4XS4 A;  4CHS A;  4PXO A;  3TJB A;  1VGL A;  3MNG A;  1FW1 A;  1Z9H A;  3HYP A;  1HYU A;  1U3A A;  1J9B A;  1O85 A;  4QL7 A;  2LEG A;  2PN8 A;  2MBS A;  3KGK A;  4JR6 A;  4O5R A;  2WFC A;  4MJE A;  3HA9 A;  1VF4 A;  2F3M A;  3M3M A;  2IIY A;  2WB9 A;  4HU7 A;  3F3R A;  2L5L A;  4HQZ A;  1DE1 A;  2XC2 A;  1LJR A;  2HZE B;  4KUN A;  4WXT A;  5ECO B;  2I9H A;  3QFB C;  4MK3 A;  3VPT A;  4XS1 A;  2P0G A;  4ZBD A;  1H75 A;  5CYY A;  2MMA A;  4HZ4 A;  4Z2T A;  3WGE A;  22GS A;  2VLV A;  4ULX A;  2RM5 A;  2GSR A;  1XPV A;  2JZT A;  2LUS A;  1FG4 A;  1ACV A;  2O8V B;  5CRD A;  3SBC A;  2DBC A;  1XBS A;  1V58 A;  2IWT A;  2HE3 A;  1BX9 A;  2FGX A;  1HNB A;  3EU3 A;  3CRU A;  3UOM A;  2AAW A;  4HZ2 A;  4IN0 A;  3FK8 A;  3QR6 A;  1WIK A;  2GT5 A;  3IAS 2;  4IVF A;  4LMV A;  1WJK A;  1K3Y A;  2V1M A;  2R6K A;  4FIW A;  4Q5N A;  2X8C A;  1XG8 A;  3GKK A;  1U87 A;  2J23 A;  3GX0 A;  1WWJ A;  3H1N A;  4DSR A;  2OJL A;  4BA7 A;  5KOX A;  4BWS A;  3HKR A;  2YV9 A;  1ML6 A;  5D96 A;  3UBK A;  2B7J A;  1TRU A;  3PPU A;  1X9S B;  5J9B A;  4KSO A;  4TN8 A;  1OVN A;  2VOC A;  1PKZ A;  2VCT A;  4TR4 A;  3Q74 A;  1WOU A;  3M9K A;  2OKA A;  1ERU A;  4CDO A;  1QUW A;  3TRQ A;  1T4Y A;  1JZO A;  4FO5 A;  2AYT A;  4MMM A;  2E2G A;  3IK9 A;  4ICY A;  2IFQ A;  2GVP A;  3TJJ A;  5BMU A;  4YKG A;  4BL7 B;  4V1A p;  4PUA A;  1M2A A;  2B1L A;  3K8N A; 
#chains in the Genus database with same CATH homology
 4AF2 A;  1M2D A;  2K8V A;  3TDG A;  5JWR B;  2H1D A;  2MMN A;  3KMO A;  4F03 A;  5A4V A;  1F2E A;  1R5A A;  4L8E A;  4F9Z A;  4KDY A;  1W89 A;  5B6M A;  3L4N A;  5D9X A;  4IHU A;  2H0H A;  2XPD A;  2HRF A;  1LBK A;  4DSS A;  1UN2 A;  3VWV A;  4GLT A;  4O5Q A;  1AQW A;  4F2I A;  5DCH A;  2DMM A;  2GS3 A;  2OAC A;  3HJM A;  1RK4 A;  1SD9 A;  1A24 A;  2KOK A;  1PN9 A;  3D21 A;  5D8I A;  2A2R A;  2C0F A;  2HFD A;  4MA9 A;  4EXJ A;  3ZFB A;  3O6T A;  4HU9 A;  3E3E A;  2I4A A;  1T8E B;  3TOT A;  1E6B A;  1SKS B;  3GH6 A;  2FWH A;  3F8U A;  5E59 A;  2GQK A;  1X9M B;  4POM A;  4PTS A;  4ECI A;  2H6X A;  2QKE A;  3F63 A;  2GZZ A;  3RHB A;  1URM A;  4TXO A;  2VCW A;  3CYN A;  1FOH A;  1XW9 A;  4K5S A;  4FQU A;  5IMZ A;  1GWC A;  1XCC A;  3EPT A;  2GT6 A;  3RPP A;  3GV1 A;  5LCZ A;  2PPT A;  4KF9 A;  1WP0 A;  4KCA A;  2EIO A;  2BMX A;  3APO A;  4TR1 B;  1YQ1 A;  3ZZX A;  2DIZ A;  4O32 A;  2L6C A;  1EZK A;  2CVB A;  2VCQ A;  4RQX A;  3FZ9 A;  3S9F A;  5G5E A;  3H93 A;  2LV3 A;  2YAN A;  3F3Q A;  4I97 A;  4K5R A;  1M99 A;  1GSS A;  1GRX A;  3NZN A;  3QD9 A;  1GUK A;  1AXD A;  4TW5 A;  1M9B A;  1NHY A;  2KLX A;  2YJH A;  3MYD A;  4TKY A;  4YKF A;  1R26 A;  3GTU B;  4CY8 A;  2R37 A;  3FZ4 A;  4MNN A;  4N11 A;  3EWL A;  4F0B A;  1EP7 A;  2DJ2 A;  1EV9 A;  2G0F A;  1GSE A;  4KB3 A;  5ECH B;  4POB A;  2PER A;  2VL2 A;  4K7O A;  1T4Z A;  4L5O A;  2IMI A;  1ERT A;  1F3A A;  3MWH A;  3KIJ A;  3FY7 A;  3UAR A;  2RLI A;  20GS A;  2M72 A;  3P7X A;  3Q6O A;  1SJZ A;  4WKW A;  2TIR A;  2IME A;  4FYU A;  4ILF A;  2XHF A;  4ID0 A;  5ELG A;  1OC3 A;  1GNW A;  2IMD A;  4MZB A;  1GSD A;  1CQG A;  2PU9 C;  1JZW A;  1XWC A;  4YAV A;  1EV4 A;  4PNG A;  1ST9 A;  1YY7 A;  2PVO C;  1F37 A;  2HSH A;  2VAF A;  4LL4 B;  1TK8 B;  1TU8 A;  2FWF A;  5F07 A;  5G1K A;  1YKA A;  2VUP A;  4KSM A;  1OC9 A;  3ERF A;  3KMN A;  3FR9 A;  1ZGN A;  3I69 A;  1XOA A;  1S3C A;  4ECJ A;  1THO A;  5DAK B;  3GHA A;  2FNO A;  3C73 A;  1EP8 A;  1J0F A;  5J41 A;  3KD0 A;  5C04 A;  1VF1 A;  1SL0 B;  4OFM A;  1BAY A;  3PH9 A;  4YQV A;  4PQI A;  2GQM A;  3HJO A;  4TOP A;  1A2J A;  4BVY A;  2I81 A;  3RBT A;  2A2P A;  2V6O A;  11GS A;  4N10 A;  3JCM L;  4JBB A;  4G0I A;  1TI3 A;  1B48 A;  3LXZ A;  4ZIJ A;  2DIY A;  3P2A A;  2UZ8 A;  4D73 A;  3TJF A;  1C72 A;  3UEM A;  2YZU A;  1A23 A;  3HZ4 A;  3ERW A;  3WGX A;  1T3B A;  1USB A;  6GSU A;  3FZ5 A;  1M9A A;  3EU4 A;  5DBQ A;  4RI7 A;  5D9W A;  4OO4 A;  5KN0 A;  4MH2 A;  5IIZ A;  3GA4 A;  3CTF A;  4OD7 A;  1SYR A;  2M80 A;  2JSZ A;  5DJL A;  5AIS A;  1V98 A;  2GLR A;  2HLS A;  1OE7 A;  3HD5 A;  5GST A;  1ZYP A;  2DML A;  3CSJ A;  4A5P A;  4YQU A;  5KEJ A;  3N9J A;  3WT2 A;  1MTC A;  5CRW A;  5HR0 A;  2I3Y A;  1AW9 A;  4GST A;  5JCW A;  3DVW A;  2GZP A;  1QGV A;  2JSY A;  2HSM A;  2VIM A;  2R5G A;  1SKR B;  4IP1 A;  6GST A;  2YNX A;  1K0B A;  4MPF A;  3VWU A;  1O8X A;  4AJ7 A;  2GGT A;  4V1A g;  5IPG A;  1O8W A;  5KN3 A;  9GSS A;  2IJY A;  1JZD A;  2CQ9 A;  3L78 A;  2YP6 A;  3LOR A;  4OFN A;  3G7J A;  4EDY A;  4H86 A;  2K18 A;  1OKD A;  3KTL A;  3R3E A;  1OYJ A;  3IE3 A;  2ZUP A;  5IMC A;  4V2M A;  3RAZ A;  2GDR A;  3HDC A;  4YQM A;  3A2X A;  3QAW A;  5ECR B;  12GS A;  2ES7 A;  3M1G A;  5HFK A;  3EE2 A;  4G0K A;  1PKW A;  1B4P A;  3UMA A;  2CVK A;  1DE2 A;  4XTS A;  3Q19 A;  1N8J A;  3F0I A;  5FWG A;  5A4W A;  2ON7 A;  5ELA A;  4PQ1 A;  4RUV A;  1TDI A;  3GKN A;  4G2E A;  4I2U A;  1BQ7 A;  3GST A;  1FVJ A;  1QQ2 A;  3LGC A;  1B4Q A;  3D4M A;  1SYX A;  1G7O A;  2CX3 A;  4WBJ A;  3J7Y k;  3EVI A;  5ABR A;  4XIH A;  3EMX A;  1XW5 A;  3LG6 A;  5J3R A;  2AHE A;  1R7H A;  1UC7 A;  4GCI A;  1A0F A;  2QGV A;  2LJR A;  3UBL A;  3FEU A;  1YF0 A;  3ZRE A;  1Z3E A;  3KCM A;  1QK8 A;  1ZYQ B;  3MDK A;  2LQO A;  3D6I A;  1BJX A;  5ID2 B;  2IFQ B;  4EDZ A;  1Y6E A;  2WGR A;  5JWQ B;  2H19 A;  3IOS A;  1B9Y C;  5EL8 A;  2K8S A;  5DJM A;  2C0E A;  2NBS A;  2L59 A;  1PX6 A;  2V41 A;  5B8B A;  3L9U A;  2OE3 A;  2QSI A;  1OC8 A;  2HRN A;  4DSQ A;  1SK0 A;  2JL4 A;  3E0U A;  2CZ2 A;  1B9X C;  2A4V A;  1G7E A;  1J08 A;  2HNL A;  5HR3 A;  4X1U A;  2IMF A;  4G0L A;  3UVT A;  3HCZ A;  4TXV A;  3E9J B;  1DSB A;  3ZVJ A;  3ZRD A;  2PUK C;  5J9C A;  2RM6 A;  3MAK A;  2AB6 A;  3D0Z A;  4QL9 A;  3TKS C;  5CAX A;  1GSQ A;  2WZ9 A;  2LQQ A;  3ED3 A;  6GSW A;  2F8A A;  4JRR A;  3VK9 A;  2H1A A;  4Z2U A;  3QAG A;  1JLW A;  3O76 A;  14GS A;  1K3O A;  2CX4 A;  3DD3 A;  2C1Y A;  3ZML A;  1GTA A;  3GX8 A;  1R4W A;  3DWV A;  3D22 A;  4TXO B;  2H71 A;  2B1K A;  2ALB A;  3KJY A;  5ECP B;  3O3T A;  4G9H A;  3LQ7 A;  4J57 E;  2DLX A;  4FH8 A;  2HZE A;  3HVS A;  4Q5F A;  5GAP D;  1X5D A;  2L57 A;  1MDJ A;  1X5E A;  3D4T A;  3A2V A;  2P5R A;  2MBT A;  3GN3 A;  5CNW A;  2IMK A;  2TRC P;  4K9Z A;  2IN3 A;  3VWX A;  1PRX A;  3CSI A;  3ZYW A;  1DUG A;  1XVQ A;  4MLY A;  1UA5 A;  3BCI A;  1WE0 A;  3HVV A;  2N5A A;  1U3I A;  4ISD A;  5KN2 A;  1PGT A;  4F0C A;  2XBI A;  1SU9 A;  1K0O A;  3KP9 A;  4ZL9 A;  18GS A;  1SJ6 A;  1NW2 A;  2GST A;  4GWR A;  3IC4 A;  1W4V A;  2FCH A;  2B5E A;  3I6A A;  4Z7X A;  3ZVJ D;  2VL3 A;  4WF4 A;  2F9S A;  4HUA A;  1GTI A;  4GSS A;  4MF5 A;  4BWQ A;  2FA8 A;  2YV7 A;  4K6X A;  1PMT A;  4K0G A;  2H75 A;  3GYK A;  4EC0 A;  5G31 A;  2MZC A;  1SL1 B;  3A3T A;  1OE8 A;  4EE0 A;  5J5N A;  5LNK e;  5H5Q A;  4GXZ A;  1TRW A;  2R3X A;  4ZL8 A;  3TGZ A;  3QOU A;  1M2B A;  1SK1 A;  1JHB A;  5AN1 A;  5AGY A;  4ZB6 A;  6GSX A;  5L71 A;  1Z7R A;  2L4C A;  2N5B A;  1EOG A;  1QMV A;  3P90 A;  2DSA A;  4IEL A;  1YZX A;  1OC9 B;  3H4K A;  1Q98 A;  3LXT A;  1TRV A;  4NXI A;  3C71 A;  1WMJ A;  5G30 A;  2VL2 C;  3GSS A;  3NOF A;  4AJ8 A;  3ISO A;  1F3B A;  2GZY A;  2HT9 A;  4BPY A;  5G1L A;  3QFA C;  1GTB A;  2QA2 A;  4ZIL A;  4LMW A;  3G7Y A;  3R2Q A;  2LS5 A;  5DDL A;  3GL5 A;  1TW9 A;  2QC7 A;  3TKR A;  4F82 A;  4PUR A;  5F0G A;  1MD3 A;  1M7T A;  3TKQ A;  4BVY B;  1OAZ A;  1HNA A;  2CZ3 A;  4IKH A;  1K0N A;  3VLN A;  5IQY A;  5B7C A;  1X0R A;  2VM1 A;  1R5P A;  3WGD A;  2C3T A;  4DVC A;  4CW9 A;  1XOB A;  2L6D A;  2LNT A;  3ME8 A;  3IBH A;  2BTO T;  1YF1 A;  2KP1 A;  3L9V A;  2YWO A;  1U88 A;  4KCE A;  3IXR A;  4POK A;  3DIE A;  4D73 B;  1K0D A;  2R2J A;  2VLU A;  2O85 A;  1V40 A;  2VD0 A;  2RUF A;  3FW2 A;  4Z2R A;  3RDW A;  4E8H A;  3P8W A;  1T1V A;  3H79 A;  3HHV A;  1KNG A;  2YJ7 A;  3CMI A;  1GSU A;  1SL2 B;  8GSS A;  1XVW A;  1Q4J A;  2REM A;  2JZR A;  1TI1 A;  5EVO A;  2PBJ A;  2G2Q A;  3LWA A;  1ABA A;  5IM9 A;  1GTU A;  3TJK A;  3ZIT A;  2ZCT A;  4WR5 A;  4IQA A;  3LEF A;  3GNJ A;  4KX4 A;  4KGI A;  1O6J A;  2WJU A;  2MYG A;  3KH7 A;  1YKC A;  1AUC A;  2C3Q A;  4IQ1 A;  1FB0 A;  4PUF C;  3TRX A;  1FVK A;  19GS A;  2H6Y A;  5LD0 A;  1M0U A;  4AGS A;  1XXU A;  4RI6 A;  1VRS D;  2H76 A;  4QQ7 A;  2V2G A;  3J7Y b;  4IJ3 A;  2X4A A;  1TKD B;  1FOV A;  1AAZ A;  4TVE A;  2H0I A;  4G19 A;  1PQN A;  2B7K A;  4GRF A;  3TJG A;  5D9V A;  3N5O A;  4TR3 A;  1BG5 A;  5IO0 A;  1YEP A;  3FKF A;  2B3S A;  3IV4 A;  4BVX B;  3UAP A;  4EIP A;  2WCI A;  5F06 A;  5DQY A;  2F51 A;  5AIV A;  1K0M A;  2H8L A;  4JZQ A;  1YJ6 A;  4I6X A;  1HQO A;  3UIW A;  4OCF A;  1VF2 A;  1FHE A;  3ZL5 A;  1FO5 A;  4NWY A;  4E8E A;  1MEK A;  3HY2 A;  4L0W A;  5F05 A;  1OKT A;  3ERG A;  3HJP A;  2WDU A;  4Q5R A;  1WRY A;  2VCX A;  4G10 A;  2KUC A;  4XS4 B;  2E7P A;  4GQF A;  1JFU A;  2WRT A;  4WF5 A;  4O5U A;  4EUY A;  1DBY A;  3C1S A;  5IMD A;  5KOW A;  2CV4 A;  5IO2 A;  4NV5 A;  1S3A A;  3UL3 A;  4EIQ A;  5FHI A;  6GSV A;  2C0G A;  2L5O A;  6GSY A;  1ZYN A;  4MDC A;  5DAK A;  1S3D A;  4PNF A;  1GLP A;  4LA1 A;  4L0U A;  2H72 A;  2CAQ A;  4ACS A;  2FWE A;  2NDO A;  4EVM A;  5D9T A;  4XCS A;  3M9J A;  1ZCP A;  2PGT A;  1EEM A;  3F4S A;  4KDX A;  4K2X A;  4EKZ A;  4FYB A;  3VWW A;  3D5J A;  3H8Q A;  5ECM B;  4OWY A;  4LL1 B;  4XHM A;  1JZR A;  2LRN A;  2B6M A;  3CRT A;  3ZLP A;  4XRD A;  2A2S A;  1UVZ A;  1TOF A;  3CXG A;  4YAP A;  2H1B A;  1EOH A;  3AY8 A;  4GQC A;  1TK5 B;  3HVX A;  1T7P B;  1O81 A;  2NVL A;  2LJK A;  3IHQ A;  3VI5 A;  3DKS A;  5CRE A;  2LNS A;  5ECN B;  2RII A;  2DJ1 A;  3IK7 A;  1ZMA A;  5CP1 A;  4YH2 A;  3C7M A;  1QFN A;  2OAD A;  5H5R A;  5G5F A;  4HQS A;  2C4J A;  4MF6 A;  3ZTL A;  2HRK A;  5H5S A;  1YEX A;  2F8F A;  2J9H A;  3GUS A;  4JU5 A;  1PN0 A;  2DJ3 A;  1NSW A;  1A8Y A;  6GSS A;  1F6M C;  1BED A;  1NHO A;  2MMZ A;  2FY6 A;  2YN1 A;  1Z6M A;  1GH2 A;  4PX1 A;  3BBY A;  2H01 A;  1AQX A;  3TB2 A;  4ZL7 A;  2R4V A;  4USS A;  5GZZ B;  2VO4 A;  4K8M A;  5INY A;  1A8L A;  4MF7 A;  1IYI A;  2H70 A;  1PL1 A;  1CQH A;  2LRT A;  2YOI A;  1H4O A;  4HS1 A;  1SKW B;  2VLT A;  1ERW A;  3APS A;  1GLQ A;  4ZBA A;  4WR4 A;  1I5G A;  4K7I A;  2LKU A;  5DAL A;  2JU5 A;  3QAV A;  4KE3 A;  4O92 A;  3FR6 A;  1HD2 A;  2OE1 A;  4CY6 A;  5GSS A;  2CT6 A;  1EEJ A;  4N0V A;  3APQ A;  3IR4 A;  4DSS B;  2H6Z A;  2O89 A;  2HI7 A;  4ECC A;  1BYE A;  2E2M A;  2IL3 A;  3F9U A;  4IGJ A;  5ECI B;  2YCD A;  4MCU A;  5D93 A;  7GSS A;  3DRN A;  4OCE A;  4NV2 A;  2YWM A;  2PMT A;  2CAI A;  4MH3 A;  1TJD A;  2VM2 A;  3W8S A;  2ON5 A;  3KH9 A;  3OR5 A;  3DGQ A;  3PGT A;  2DJ0 A;  2EIQ A;  3BJ5 A;  4IS0 A;  4DEJ A;  4KW6 A;  5IMV A;  1XWA A;  2EC4 A;  4K1F A;  3MIX A;  2V6K A;  3BOA A;  3DEX A;  2E0Q A;  3G7I A;  4EF0 A;  2YWI A;  1ERV A;  1THX A;  3QDN A;  2LST A;  5IMA A;  2N5F A;  3TKS A;  3DVX A;  1Z5Y E;  2MMO A;  3VUR A;  4GSN A;  2HRA A;  4MAB A;  5CO3 A;  2TRX A;  4JED A;  2GTU A;  2CVD A;  4AJ6 A;  1SD8 A;  3V1W A;  4I5Q A;  3L0H A;  5CRG A;  5ID2 A;  1PX7 A;  1ZOF A;  3RHC A;  1GUL A;  4WEY A;  5B6N A;  4JE1 A;  4MZC A;  2Z9S A;  4X4J A;  1ON4 A;  5B8A A;  3A5W A;  3BCK A;  3CSH A;  3GUR A;  1RQM A;  2IPA A;  4GTU A;  2KHP A;  4L5L A;  1JLV A;  3DYR A;  3WT1 A;  3TKP A;  5F8B A;  3ZFL A;  1FB6 A;  2H74 A;  2DJK A;  5KN1 A;  2H73 A;  1E2Y A;  2C80 A;  2HYX A;  2LTK A;  1K0A A;  2FD3 A;  3RPN A;  2HSY A;  3GKX A;  2HXK A;  2VL9 A;  5IOX A;  2GSQ A;  1O73 A;  3FYG A;  2AV4 A;  1GL8 A;  3IA1 A;  2P5Q A;  13GS A;  1N2A A;  3GFK A;  2X8H A;  1HNC A;  4TR0 A;  2FLS A;  1V2A A;  3L9S A;  4JR4 A;  4KH7 A;  4J56 E;  3EUR A;  4PQH A;  2GSS A;  2JZS A;  4FYC A;  5ECQ B;  1AIU A;  5ECL B;  3I43 A;  4ECB A;  3I9V 2;  3M0F A;  4HEA 2;  3VFI A;  2YZH A;  1TRS A;  4IBP A;  3Q18 A;  3KM6 A;  1A2M A;  3IRA A;  4BL7 A;  4I8B A;  2JAD A;  2CA8 A;  4KAE A;  3PR8 A;  4ZB9 A;  3TOU A;  3G9B A;  1XW6 A;  4ZBB A;  5EPF A;  2JAC A;  4WET A;  3CBU A;  3EIN A;  1MDI A;  1MDK A;  4EO3 A;  3UVH A;  3ME7 A;  4MPG A;  1Z7P A;  3IAM 2;  3LJR A;  3A5I A;  2EIR A;  2B5Y A;  2XBQ A;  1O7U A;  3FHK A;  5G2Z A;  3GIX A;  3A2W A;  4HJ2 A;  1AQV A;  4MJA A;  2GQL A;  2X49 A;  5JCG A;  4N0Z A;  1TP9 A;  2R0P A;  5HR2 A;  5FT3 A;  3U6V A;  1B8X A;  1GP1 A;  5HQP A;  5EY6 A;  3FZA A;  3NIV A;  1EGR A;  3HZ8 A;  1ILO A;  4K0N A;  5HR1 A;  1GNE A;  3LYK A;  1IYH A;  3VI7 A;  5D73 A;  4MJC A;  4MJB A;  2NTO A;  3ZIV A;  3MSZ A;  4HDE A;  1A0R P;  2PWJ A;  5DVB A;  2OBI A;  2K6V A;  1EGO A;  3GMF A;  1Z6N A;  3KEB A;  2X64 A;  1SK2 A;  3KZQ A;  4PGT A;  1TTZ A;  1GSF A;  4TRX A;  1X5C A;  3U5R E;  4WBR D;  1GUM A;  5J4U A;  3LSZ A;  1PL2 A;  2C0D A;  4NHW A;  1KEB A;  2DKH A;  1PSQ A;  4TR1 A;  4HI7 A;  1V57 A;  3UJ1 A;  3TRP A;  1XWG A;  1GSY A;  5CRH A;  4I2T A;  4P3Y B;  1YDK A;  3WD6 A;  1U6T A;  1RW1 A;  4NPB A;  1Y25 A;  10GS A;  2H30 A;  3US3 A;  2OA7 A;  4OMV A;  5A5K A;  1XZO A;  2FHE A;  3LYP A;  2AUV A;  4O7H A;  1T00 A;  1XIY A;  2K9F A;  3DML A;  3C8E A;  5JCU A;  3KTB A;  3GTU A;  1G6W A;  1MD4 A;  3QPM A;  4IJI A;  2ZNM A;  3IPZ A;  1WPI A;  4N30 A;  4ZXG A;  1SJI A;  5GAN D;  2FA4 A;  3GH9 A;  2O7K A;  3FR3 A;  3IHG A;  4POL A;  1KBN A;  2OE0 A;  3F6F A;  4OO5 A;  2LJA A;  4ML1 A;  1XWB A;  2OBK A;  1XWK A;  4XRA A;  3FRC A;  3LFL A;  1VF3 A;  2QA1 A;  4NAX A;  3WYW A;  2D2Z A;  2I1U A;  5C00 A;  4EL1 A;  3W8J A;  1TU7 A;  5ECS A;  4LLR A;  1ZZY A;  1LU4 A;  1K3L A;  3EYT A;  1TK0 B;  5A4U A;  4IP6 A;  2O87 A;  4ZB8 A;  2DC5 A;  4HJM A;  2FWG A;  17GS A;  3EC3 A;  2B5X A;  3QCP A;  5ENU A;  2FUG 2;  1ZYE A;  3M8N A;  2X8G A;  4XS6 A;  2VD1 A;  2XPE A;  3F4T A;  3HXS A;  3TUE A;  4K2D A;  3SWL A;  5COH A;  1PD2 1;  1G0T A;  1NM3 A;  2H66 A;  3TKS E;  16GS A;  3GKM A;  4IW9 A;  1XFL A;  3IC8 A;  3ZMK A;  1QXH A;  3QMX A;  2H0G A;  5BRT A;  1PA3 A;  5HFI A;  4GF0 A;  2VCZ A;  5AIX A;  3FMW A;  4OFT A;  3EMP A;  2P31 A;  4KND A;  3LW9 A;  4NMU A;  3BD2 A;  3F6D A;  2PVQ A;  2A4H A;  1FAA A;  5IMF A;  2YPM A;  3CTG A;  3F4R A;  1F9M A;  1GUH A;  2M46 A;  3C1R A;  2R0G A;  4V2N A;  4X0X A;  1TXX A;  2X99 A;  1G6Y A;  2WUL A;  2RUE A;  5HFG A;  5IOW A;  2LRC A;  2DKI A;  2H1G A;  4MP4 A;  1X9W B;  2WS2 A;  2DJJ A;  2HZF A;  3KXO A;  3GRX A;  3GL3 A;  5DAL B;  4MZW A;  5DQS A;  5IPH A;  1KTE A;  2KP2 A;  1K0C A;  1ZL9 A;  4V2L A;  2AJQ B;  2BJX A;  4HOJ A;  1V9W A;  4BVX A;  3VPQ A;  3PIN A;  1SEN A;  2C8U A;  5ECK B;  4X43 A;  2NPB A;  1AC1 A;  3ZIJ A;  3KP8 A;  1A2L A;  2L4Q A;  2YWN A;  4RQR A;  4Q5Q A;  3W6G A;  4K7N A;  5DCG A;  4ML6 A;  2C3N A;  3TCO A;  5JWO B;  1EWX A;  4KDU A;  2VCV A;  2V32 A;  1I9D A;  4J2F A;  3DXB A;  4NHZ A;  3IDV A;  4KA0 A;  2R0C A;  5E4W A;  4XS4 A;  4CHS A;  4PXO A;  3TJB A;  1VGL A;  3MNG A;  1FW1 A;  1Z9H A;  3HYP A;  1HYU A;  1U3A A;  1J9B A;  1O85 A;  4QL7 A;  2LEG A;  2PN8 A;  2MBS A;  3KGK A;  4JR6 A;  4O5R A;  2WFC A;  4MJE A;  3HA9 A;  1VF4 A;  2F3M A;  3M3M A;  2IIY A;  2WB9 A;  4HU7 A;  3F3R A;  2L5L A;  4HQZ A;  1DE1 A;  2XC2 A;  1LJR A;  2HZE B;  4KUN A;  4WXT A;  5ECO B;  2I9H A;  3QFB C;  4MK3 A;  3VPT A;  4XS1 A;  2P0G A;  4ZBD A;  1H75 A;  5CYY A;  2MMA A;  4HZ4 A;  4Z2T A;  3WGE A;  22GS A;  2VLV A;  4ULX A;  2RM5 A;  2GSR A;  1XPV A;  2JZT A;  2LUS A;  1FG4 A;  1ACV A;  2O8V B;  5CRD A;  3SBC A;  2DBC A;  1XBS A;  1V58 A;  2IWT A;  2HE3 A;  1BX9 A;  2FGX A;  1HNB A;  3EU3 A;  3CRU A;  3UOM A;  2AAW A;  4HZ2 A;  4IN0 A;  3FK8 A;  3QR6 A;  1WIK A;  2GT5 A;  3IAS 2;  4IVF A;  4LMV A;  1WJK A;  1K3Y A;  2V1M A;  2R6K A;  4FIW A;  4Q5N A;  2X8C A;  3GKK A;  1U87 A;  2J23 A;  3GX0 A;  1WWJ A;  3H1N A;  4DSR A;  2OJL A;  4BA7 A;  5KOX A;  4BWS A;  3HKR A;  2YV9 A;  1ML6 A;  5D96 A;  3UBK A;  2B7J A;  1TRU A;  3PPU A;  1X9S B;  5J9B A;  4KSO A;  4TN8 A;  1OVN A;  2VOC A;  1PKZ A;  2VCT A;  4TR4 A;  3Q74 A;  1WOU A;  3M9K A;  2OKA A;  1ERU A;  4CDO A;  1QUW A;  3TRQ A;  1T4Y A;  1JZO A;  4FO5 A;  2AYT A;  4MMM A;  2E2G A;  3IK9 A;  4ICY A;  2IFQ A;  2GVP A;  3TJJ A;  5BMU A;  4YKG A;  4BL7 B;  4V1A p;  4PUA A;  1M2A A;  2B1L A;  3K8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...