3IC4A

The crystal structure of the glutaredoxin(grx-1) from archaeoglobus fulgidus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
92
structure length
92
Chain Sequence
GGRENLYFQGMAEVLMYGLSTCPHCKRTLEFLKREGVDFEVIWIDKLEGEERKKVIEKVHSISGSYSVPVVVKGDKHVLGYNEEKLKELIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutaredoxin (Grx-1)
publication title The crystal structure of the glutaredoxin from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
total genus 26
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ic4A00
2ZNMA 2B7JA 4X1UA 4GSNA 5IMAA 5GAND 1TI1A 2AB6A 3QFBC 2AAWA 5ELGA 2HSHA 4IQ1A 16GSA 4G2EA 3QAVA 1LU4A 5IMCA 3HA9A 2GT5A 4ZBAA 3W8SA 1FB6A 2KLXA 2B5YA 5D96A 3TKQA 4IELA 4ECJA 3RHCA 4F03A 3CTFA 3KGKA 1OKTA 2OBKA 1KEBA 1JZDA 3G7IA 1X0RA 1DUGA 5B8BA 4TXOB 1OE7A 2VCZA 2IMDA 2L57A 2G2QA 1FOVA 4TVEA 1K0AA 2JZRA 5H5QA 3F3QA 3UARA 2VCTA 4E8HA 1GSUA 5KN1A 1QFNA 5EVOA 1IYHA 5FT3A 3EYTA 4XCSA 1JLWA 3D0ZA 4JU5A 2KP1A 4IVFA 1WPIA 3ERGA 5F8BA 1W89A 1O81A 2KP2A 2H74A 3TJBA 2WFCA 3H93A 3UBLA 2H0HA 1MEKA 2H6YA 2TIRA 4XIHA 2LS5A 4O32A 1GSSA 3ME8A 3G7YA 4JR4A 3J7Yk 3DVXA 4AJ7A 1FW1A 4NV5A 1NHYA 5DQYA 4NV2A 4F2IA 3ZRDA 2ZCTA 4XTSA 4ZBBA 2LJAA 3HY2A 1XWAA 4I8BA 4YQVA 2FA4A 2IMEA 5G2ZA 1Q98A 4E8EA 2LSTA 2F8AA 4V2NA 2H76A 2VL9A 3ZMLA 1EZKA 1XWKA 1GH2A 3IAS2 1MTCA 2F3MA 3CMIA 4WXTA 4YAPA 1ERWA 5D93A 1PMTA 2IMIA 1GP1A 1AIUA 4WKWA 3GFKA 3RHBA 22GSA 3D4MA 5B6NA 1JZRA 1PGTA 1A0RP 5DALA 4BVXA 3UEMA 2IFQA 4DEJA 4AJ8A 4KCEA 4HQSA 5CNWA 5B8AA 5HR1A 3TRQA 1K3OA 2M46A 4PQ1A 3HVSA 1R5PA 11GSA 3F9UA 3LYKA 1ERVA 1Q4JA 3L4NA 2VCWA 4GCIA 3NOFA 3HJPA 1NSWA 1ERTA 4IW9A 4ML1A 4PURA 2C0GA 2C8UA 1AQWA 3DWVA 3LFLA 3U6VA 1J08A 3GKKA 2VL2C 2HXKA 1SJIA 3UOMA 2JSYA 4ML6A 4BVYA 5AGYA 2OE1A 7GSSA 1GL8A 3LXTA 1J9BA 3GX8A 5F06A 3IPZA 2PBJA 2IN3A 3EMPA 4ZL9A 4N11A 3A2VA 4NWYA 1Z7PA 4BPYA 3L9VA 2CZ3A 3KIJA 3KP8A 1SU9A 5KN2A 3WGDA 1S3CA 2L4QA 3PH9A 1YKAA 1H75A 4V1Ap 3A2WA 3KTBA 1HNBA 1OKDA 3DEXA 4EDZA 3F63A 3LGCA 3TRXA 4MPGA 4J56E 3RAZA 1ON4A 3HZ8A 3CSJA 3IRAA 3I9V2 1A0FA 4GLTA 3FHKA 3UVHA 1SD9A 5CRWA 3KMOA 5IPHA 3ZFLA 3GN3A 5B6MA 4FO5A 1GNWA 1QGVA 2A2RA 1PD21 4PNGA 3CBUA 2HE3A 4ZIJA 3ZVJA 5LD0A 1T1VA 1USBA 1O8WA 4Q5NA 2C3QA 3A3TA 1GTUA 3Q74A 4ULXA 1UN2A 5J41A 3Q18A 4G9HA 5IMDA 2EIOA 2GLRA 3F6FA 2X8GA 4EKZA 4BL7A 3DRNA 4MH2A 4NHZA 4N0VA 2LQQA 4FH8A 1U87A 1ZGNA 1I5GA 1DE2A 4NXIA 4RI7A 3E3EA 1G6YA 3ZMKA 1B9XC 1ZCPA 3LSZA 5AIXA 1V9WA 1YEPA 4ZL7A 4KAEA 2TRXA 3G9BA 3F4SA 2WRTA 1TK8B 1NW2A 1EP8A 3BD2A 2IIYA 1K3LA 2LRNA 5INYA 2IWTA 2GTUA 4HQZA 1M9AA 4K7IA 1XFLA 1GLPA 1XIYA 3LORA 4NHWA 1TRWA 3I43A 6GSSA 2GGTA 5AIVA 2CX4A 3ZL5A 2FNOA 4OFMA 2VLUA 4BWSA 5ECSA 2YZUA 1R4WA 1SD8A 4HJMA 3UBKA 3VLNA 1YDKA 4FYCA 1F3AA 4HEA2 1TK0B 1PKZA 4PQHA 5LNKe 2OBIA 1SKWB 5L71A 4TW5A 1VF4A 3EU4A 4ECCA 2E0QA 3IE3A 1LJRA 3F6DA 3KEBA 1H4OA 2O89A 2CVDA 1FHEA 1QUWA 5CRDA 3TOTA 1A23A 1GTAA 17GSA 3O3TA 3GH9A 3LWAA 2FD3A 5ECPB 2H73A 3TKSA 1THXA 1VGLA 2P0GA 3MSZA 6GSUA 2XHFA 4KX4A 5F07A 1SK2A 1THOA 3ERFA 2BMXA 5EY6A 2L59A 3EC3A 3ZIVA 3TJKA 3OR5A 1OAZA 5HQPA 1FG4A 1X5EA 2H1AA 3US3A 1ST9A 1T7PB 3FRCA 5E59A 1Z3EA 4IJ3A 4GQFA 1K0BA 1GUMA 2K8SA 4I2TA 5JCUA 3CSHA 1B4QA 4MZBA 3JCML 4TXVA 1XCCA 4OFNA 4CHSA 2BJXA 3PR8A 5DJLA 3MNGA 3UL3A 3EMXA 4IGJA 3VURA 2LV3A 1U3IA 3FZAA 3E9JB 4XRDA 4JZQA 2LUSA 2KOKA 5ECMB 2FLSA 1UC7A 2CVBA 1EOGA 1S3AA 3DMLA 3EINA 2VM1A 2XBQA 3C71A 4NMUA 1GNEA 3QD9A 1JZWA 2YNXA 5EL8A 3QPMA 1DSBA 4EL1A 3FY7A 5ABRA 2XBIA 2DSAA 3IDVA 3DIEA 3IR4A 6GSTA 1SK1A 1WIKA 4P3YB 3KD0A 1GTIA 1M2AA 3GKMA 2RM5A 3APQA 4DVCA 2H0GA 3IC4A 1E6BA 3L9SA 3HJMA 2CAQA 1EOHA 3MWHA 5B7CA 4LMVA 5GSTA 3C8EA 4AF2A 4ISDA 4WF4A 3RBTA 2P31A 2E7PA 4F0CA 4ACSA 2DMLA 5D8IA 1G6WA 1X9SB 1T4ZA 2L5OA 5ECIB 4MABA 1V58A 4IHUA 3FK8A 3C7MA 4WR5A 3FR3A 2C3TA 3IA1A 1SYXA 3L9UA 5ELAA 4MK3A 2IJYA 2VAFA 4K2DA 2J23A 1TRSA 1PN9A 3ZREA 2R5GA 1BX9A 4XS4B 2IMFA 3DXBA 3E0UA 1WE0A 3A5WA 1BEDA 1U88A 2WB9A 4CW9A 1K0NA 2MMOA 2HFDA 1PL1A 3V1WA 2AHEA 1K0MA 1O6JA 2JSZA 3A2XA 2OA7A 1FVJA 1JZOA 1V2AA 2HZEB 2HNLA 4MMMA 3GTUB 4POKA 4BA7A 1U6TA 1MDIA 2O87A 2CT6A 5F0GA 2GT6A 4MF6A 4PXOA 3TB2A 2V41A 3LYPA 2R37A 2B1KA 19GSA 3IV4A 3WGXA 4MZWA 1EGOA 4IN0A 4J57E 5IMZA 3UMAA 2H70A 3MAKA 1T4YA 2HRNA 4LMWA 3SWLA 4YQUA 1RK4A 1V98A 3GYKA 4DSSA 1J0FA 1G7OA 2OACA 3GL5A 3RPPA 2QGVA 1YF1A 2YJ7A 2I81A 1BQ7A 2R2JA 1V57A 2R4VA 4KDUA 4TR3A 3P2AA 3LXZA 2NBSA 1YJ6A 5CAXA 1LBKA 2MYGA 1WJKA 1M2BA 3KZQA 2CQ9A 4GTUA 1GSQA 2H6XA 1B4PA 4HS1A 1K3YA 2AV4A 2H71A 1A2LA 3ZFBA 3VK9A 1A8LA 4FYUA 3GIXA 3LQ7A 3Q19A 4XRAA 5IOWA 3ISOA 2GQKA 4JR6A 1ZYEA 4GWRA 2LNSA 1R5AA 2B1LA 5DDLA 1SL0B 4MZCA 1GSEA 1HYUA 1R7HA 2E2GA 2I4AA 3DGQA 1M9BA 1F3BA 1YKCA 4Q5RA 4WF5A 3LG6A 3IK9A 3VPTA 4DSSB 2GZZA 3M8NA 4O92A 1SJ6A 2Z9SA 3P8WA 2GZYA 2YN1A 2REMA 3DYRA 3HXSA 2QC7A 3HCZA 3IHQA 1B48A 4TRXA 2FWFA 5IOXA 1HD2A 3HHVA 3QCPA 1OE8A 4TR4A 2I9HA 2OE0A 2YWIA 2YPMA 2H30A 4ZXGA 3WT2A 2GZPA 2GDRA 4EO3A 2X99A 2DJ0A 3BBYA 5E4WA 5AISA 4XS1A 2LRTA 4F0BA 4XHMA 4IQAA 4TN8A 4GSSA 5GSSA 3C1RA 4MJCA 3VI5A 1HNAA 1YF0A 1EWXA 5KN0A 3FZ5A 1O73A 1PX6A 4IKHA 3EURA 3KJYA 5DALB 2XC2A 3HVVA 2IFQB 1TKDB 5A4WA 2N5AA 4ZILA 3HZ4A 1URMA 5D9TA 1N2AA 2B5EA 4LLRA 2H1DA 3ZIJA 2KHPA 4RI6A 1T00A 1MDKA 1UA5A 5CRHA 5HR3A 2VIMA 4EUYA 4PUAA 2QKEA 1A2MA 1X9MB 2A4VA 3RPNA 2IL3A 1TP9A 3VPQA 1WMJA 2NTOA 8GSSA 3KH9A 5DJMA 3IOSA 4O5RA 2X8HA 1F37A 3TKSE 1GULA 4F9ZA 4JE1A 2PERA 3GSTA 18GSA 2CX3A 3BOAA 3M3MA 5ID2A 3TUEA 2OADA 4XS6A 5KN3A 4MP4A 2X8CA 3UVTA 1K0CA 2CZ2A 2VL2A 3TGZA 3ZLPA 2K6VA 2DJ1A 2GSTA 1KNGA 2MBSA 1O8XA 3GA4A 3ZVJD 2NVLA 2CA8A 5DQSA 5IMFA 3N9JA 1FB0A 3FEUA 3HKRA 2QSIA 3VWVA 3FZ4A 4L5OA 2EIRA 3ZYWA 4MA9A 1GSFA 1SKRB 3LEFA 3VI7A 3KP9A 5DCHA 1TRUA 5F05A 3UJ1A 3CTGA 2B7KA 3P90A 2MMNA 1OC9A 4L8EA 3GKXA 3PGTA 2P5RA 2DJ2A 4IBPA 4CDOA 4KCAA 2IPAA 3TKSC 3CSIA 3BCKA 3W8JA 4POBA 3I69A 3WD6A 1GSYA 1EEJA 2YCDA 4HZ2A 12GSA 3WYWA 4DSRA 3IXRA 3EWLA 1PA3A 4RQRA 20GSA 3F0IA 2PN8A 4TOPA 3KTLA 2RIIA 1Y25A 4MCUA 4RUVA 5DVBA 1C72A 1JHBA 3J7Yb 3ERWA 4GRFA 5J9CA 1AW9A 2K8VA 2EC4A 1DBYA 3M1GA 5IIZA 2HT9A 4JRRA 1XXUA 1XW9A 1M2DA 1Z9HA 1OC9B 5G5EA 4KE3A 2WZ9A 4KDYA 5DBQA 4Z7XA 1VF1A 3DD3A 4DSQA 5J4UA 4POLA 4N10A 1SK0A 4WEYA 2VL3A 5G1KA 1T3BA 1GRXA 4LL4B 5DAKA 5ECLB 4GXZA 1JFUA 2ZUPA 3CRTA 4KH7A 1TXXA 1V40A 5D9XA 4NPBA 5D9WA 3BCIA 5CYYA 3GKNA 1BAYA 2YJHA 1SL2B 3QMXA 1GTBA 1SKSB 6GSYA 4AJ6A 1VF3A 1GSDA 2RUFA 3L0HA 4N30A 3VWXA 2J9HA 2GSRA 4GQCA 1UVZA 2AUVA 4ZL8A 4PUFC 2V6OA 2VOCA 5J3RA 5CRGA 1X9WB 3ZITA 3HVXA 5HR2A 1ZMAA 2M72A 1K0DA 4MLYA 1PX7A 4ZB9A 4YAVA 3KH7A 1R26A 4L0UA 1MD4A 4D73A 4KA0A 5D73A 1TTZA 3TJJA 2HI7A 1VRSD 4YQMA 2YWMA 4ECBA 2ES7A 2C0FA 1X5CA 1XWGA 3H4KA 4K7NA 4K1FA 5D9VA 2D2ZA 4IP6A 2F8FA 1X5DA 5ECOB 2E2MA 2VUPA 1PRXA 2MMZA 2RUEA 5JWRB 1XBSA 2JZSA 4MF5A 1XPVA 2HLSA 1Z6NA 4OMVA 4POMA 1AAZA 4ILFA 4MH3A 2L4CA 2R6KA 3M9KA 2A2SA 2NDOA 3FKFA 4MF7A 1WRYA 3D4TA 1PL2A 2VCXA 1XVWA 1O85A 3GURA 1AC1A 2HZFA 1TJDA 2FWHA 4GSTA 3GUSA 2LNTA 3L78A 3QFAC 6GSXA 1RW1A 2H0IA 5IMVA 2VD1A 1Z6MA 6GSVA 2V1MA 1FAAA 4KW6A 2FUG2 4I5QA 4OWYA 2FCHA 2N5FA 2H1BA 5IPGA 5KEJA 5HFGA 1GWCA 3QAWA 1WWJA 2C0DA 2MMAA 5IO2A 3F8UA 2CAIA 5AN1A 14GSA 3IAM2 3CYNA 3FYGA 4MJEA 1M7TA 3D22A 5H5SA 4PQIA 4V2LA 2DLXA 3F4TA 2OE3A 1G0TA 2HYXA 1M0UA 4JBBA 3FR6A 3TKPA 4WR4A 3O76A 4KSOA 2PVQA 4N0ZA 1A2JA 3GNJA 2K9FA 4ID0A 1F6MC 2H8LA 5CREA 1QK8A 5EPFA 1YEXA 1ERUA 2TRCP 1PSQA 1OC8A 2C1YA 2WDUA 4QL9A 2EIQA 5FHIA 5A4UA 3AY8A 2JL4A 2O8VB 3D6IA 2DBCA 3M0FA 2H01A 4QQ7A 5HR0A 1EGRA 1ZOFA 1GUKA 2VLVA 4Q5FA 2HRFA 1EP7A 4H86A 2WULA 4MDCA 4V1Ag 5IM9A 10GSA 1TU8A 2GVPA 2LTKA 4YH2A 3EE2A 4FIWA 3KXOA 1ACVA 1A8YA 1QXHA 3S9FA 3VWUA 4I2UA 1XOAA 1RQMA 1BG5A 3KMNA 13GSA 3WT1A 5JCGA 2DMMA 4ZB6A 4HU7A 3GX0A 5G30A 1BYEA 2YP6A 1MDJA 2WCIA 1GUHA 1OVNA 1G7EA 2FWGA 2C3NA 2CVKA 4NAXA 2BTOT 3ED3A 1YZXA 2PU9C 4F82A 2ON7A 2O85A 2XPEA 4FYBA 3EVIA 1TI3A 4MJBA 1ZYQB 1FVKA 2L6CA 3QAGA 1ZL9A 4LA1A 4TR1A 1F2EA 4OD7A 2B5XA 3GL3A 2B3SA 2F51A 2LJKA 4G19A 5C00A 3DVWA 3LJRA 2YOIA 2LQOA 5G5FA 4KB3A 4ECIA 6GSWA 2DJ3A 1ILOA 3ME7A 5LCZA 2CV4A 1ML6A 3W6GA 3MDKA 1EEMA 3K8NA 2GSQA 3IK7A 4KGIA 3GRXA 2VD0A 3TOUA 1W4VA 4HDEA 1Z7RA 2FWEA 3VFIA 2GS3A 3KCMA 4JEDA 2H75A 4PX1A 4OCFA 3GHAA 4J2FA 5ECHB 4OFTA 1QQ2A 2IMKA 4K0GA 1EV9A 3KM6A 5IQYA 1TK5B 5GZZB 2P5QA 4LL1B 1K0OA 1TU7A 2H66A 3M9JA 4TR1B 2GQMA 4WETA 1SL1B 1YQ1A 2M80A 3D21A 3SBCA 2DC5A 2AJQB 2PVOC 1XZOA 2C0EA 2JADA 5A5KA 5DCGA 3H79A 5GAPD 2VCQA 3EU3A 4EVMA 3HJOA 2PWJA 1WOUA 4AGSA 2YV7A 4EE0A 1CQGA 5JWQB 2FGXA 4V2MA 1ABAA 3NZNA 1TW9A 1XVQA 4HI7A 2V32A 1HQOA 3G7JA 4EXJA 2G0FA 3RDWA 2F9SA 2LRCA 4KDXA 5H5RA 2YZHA 5ECRB 1SJZA 4KUNA 4EF0A 3HDCA 4K7OA 1PKWA 2O7KA 2GQLA 3TDGA 1PQNA 2XPDA 1XWCA 3NIVA 1SENA 4HJ2A 1OC3A 2OKAA 2C80A 3DKSA 4OCEA 3VWWA 3TJGA 5ECKB 5G31A 3O6TA 3FW2A 1N8JA 5CO3A 1S3DA 2ALBA 3Q6OA 5C04A 2YWNA 4L5LA 4O7HA 1HNCA 3CRUA 3APSA 4IP1A 5ID2B 3C1SA 2OJLA 1DE1A 1XW6A 1AUCA 4PGTA 1F9MA 1GLQA 3D5JA 3ZTLA 5FWGA 5J9BA 3F4RA 1EV4A 4BWQA 1XOBA 1O7UA 1ZZYA 2H19A 2YV9A 4G10A 1TOFA 1XWBA 5HFKA 1QMVA 2FA8A 4K0NA 2VLTA 1AQVA 1KBNA 1CQHA 2MZCA 2I1UA 2H1GA 3BJ5A 2PMTA 4OO4A 1E2YA 3QOUA 3GSSA 1MD3A 1SYRA 1AXDA 2RLIA 4ZBDA 2WGRA 4ZB8A 4WBJA 1FO5A 2NPBA 3C73A 4K6XA 4MJAA 4X0XA 2YANA 2K18A 5JWOB 2JZTA 3QR6A 4RQXA 2B6MA 2ON5A 2PUKC 3GV1A 2JU5A 1BJXA 2L5LA 3WGEA 4HOJA 4EDYA 2DIYA 2WS2A 5A4VA 4EC0A 4X43A 5ENUA 3N5OA 3GH6A 4TKYA 1TDIA 2YWOA 4I97A 4Q5QA 2N5BA 1NHOA 1TRVA 2VCVA 3H8QA 2JACA 2AYTA 4L0WA 3UIWA 1AQXA 3TRPA 2FY6A 3UAPA 3F3RA 1OYJA 3FZ9A 3ZZXA 1A24A 5CP1A 4HZ4A 4IS0A 4HU9A 1I9DA 3P7XA 5DAKB 4K9ZA 4OO5A 4PNFA 1JLVA 1KTEA 4GF0A 2R3XA 1T8EB 2LJRA 2PGTA 5JCWA 3HYPA 2LEGA 3R2QA 1NM3A 3H1NA 2DJKA 4TR0A 3TCOA 2X64A 1M99A 4KNDA 5J5NA 5COHA 2C4JA 2VM2A 2L6DA 2H6ZA 2DJJA 2H72A 5HFIA 5G1LA 3IBHA 4I6XA 2RM6A 2HSYA 2V6KA 4XS4A 4KSMA 2I3YA 4MPFA 9GSSA 4HUAA 2PPTA 5ECQB 4WBRD 2WJUA 3APOA 5ECNB 2V2GA 1Z5YE 2LKUA 4D73B 2HZEA 2KUCA 1VF2A 2GSSA 2MBTA 1U3AA 3GTUA 1YY7A 1B9YC 1IYIA 4TXOA 3HD5A 1Y6EA 2VO4A 3CXGA 2FHEA 4K8MA 1WP0A 3I6AA 2DIZA 3GMFA 4IJIA 3QDNA 5IO0A 3U5RE 1B8XA 4QL7A 1XW5A 3TKRA 3PINA 3FR9A 3TJFA
chains in the Genus database with same CATH superfamily
2ZNMA 2B7JA 4X1UA 4GSNA 5IMAA 5GAND 1TI1A 2AB6A 3QFBC 2AAWA 5ELGA 2HSHA 4IQ1A 16GSA 4G2EA 3QAVA 1LU4A 5IMCA 2HRAA 3HA9A 2GT5A 4ZBAA 3W8SA 1FB6A 2KLXA 2B5YA 5D96A 3TKQA 4IELA 4ECJA 3RHCA 4F03A 3CTFA 3KGKA 1OKTA 2OBKA 1KEBA 1JZDA 3G7IA 1X0RA 1DUGA 5B8BA 4TXOB 1OE7A 2VCZA 2IMDA 2L57A 2G2QA 1FOVA 4TVEA 1K0AA 2JZRA 5H5QA 3F3QA 3UARA 2VCTA 4E8HA 1GSUA 5KN1A 1QFNA 5EVOA 1IYHA 5FT3A 3EYTA 4XCSA 1JLWA 1PFOA 3D0ZA 4JU5A 2KP1A 4IVFA 2QA1A 1WPIA 3ERGA 5F8BA 1W89A 1O81A 2KP2A 2H74A 3TJBA 2WFCA 3H93A 3UBLA 2H0HA 1MEKA 2H6YA 2TIRA 4XIHA 2LS5A 4O32A 1GSSA 3ME8A 3G7YA 4JR4A 3J7Yk 3DVXA 4AJ7A 1FW1A 4NV5A 1NHYA 5DQYA 4NV2A 4F2IA 3ZRDA 2ZCTA 4XTSA 4ZBBA 2LJAA 3HY2A 1XWAA 4I8BA 4YQVA 2FA4A 2IMEA 5G2ZA 1Q98A 4E8EA 2LSTA 4Z2TA 2F8AA 4V2NA 2H76A 2VL9A 3ZMLA 1EZKA 1XWKA 1GH2A 3IAS2 1MTCA 2F3MA 3CMIA 3CQFA 4WXTA 4YAPA 1ERWA 5D93A 1PMTA 2IMIA 1GP1A 1XG8A 1AIUA 4WKWA 3GFKA 3RHBA 22GSA 3D4MA 5B6NA 1JZRA 1PGTA 1A0RP 5DALA 4BVXA 3UEMA 2IFQA 4DEJA 4AJ8A 4KCEA 4HQSA 5CNWA 5B8AA 5HR1A 3TRQA 1K3OA 2M46A 4PQ1A 3HVSA 1R5PA 11GSA 3F9UA 3LYKA 1ERVA 1Q4JA 3L4NA 2VCWA 4GCIA 3NOFA 3HJPA 1NSWA 1ERTA 4IW9A 4ML1A 4PURA 2C0GA 2C8UA 4HSCX 1AQWA 3DWVA 3LFLA 3U6VA 1J08A 3GKKA 2VL2C 2HXKA 1SJIA 3UOMA 2JSYA 4ML6A 4BVYA 5AGYA 2OE1A 7GSSA 1GL8A 3LXTA 1J9BA 3GX8A 5F06A 3IPZA 2PBJA 2HSMA 2IN3A 3EMPA 4ZL9A 4N11A 3A2VA 4NWYA 1Z7PA 4BPYA 3L9VA 2CZ3A 3KIJA 3KP8A 1SU9A 5KN2A 3WGDA 1S3CA 2L4QA 3PH9A 1YKAA 1H75A 4V1Ap 3A2WA 3KTBA 1HNBA 1OKDA 3DEXA 4EDZA 2X49A 3F63A 3LGCA 3TRXA 4MPGA 4J56E 3RAZA 1ON4A 3HZ8A 3CSJA 3IRAA 3I9V2 1A0FA 4GLTA 3FHKA 3UVHA 1SD9A 5CRWA 3KMOA 5IPHA 3ZFLA 3GN3A 5B6MA 4FO5A 1GNWA 1QGVA 2A2RA 1PD21 4PNGA 3CBUA 2HE3A 4ZIJA 3ZVJA 5LD0A 1T1VA 1USBA 1O8WA 4Q5NA 2C3QA 3IC8A 3A3TA 1GTUA 3Q74A 4ULXA 1UN2A 5J41A 3Q18A 1FOHA 4G9HA 5IMDA 2EIOA 2GLRA 3F6FA 3EPTA 2X8GA 4EKZA 4BL7A 3DRNA 4MH2A 4NHZA 3A5IA 4N0VA 2LQQA 4FH8A 1U87A 1ZGNA 1I5GA 1DE2A 4NXIA 4RI7A 3E3EA 1G6YA 3ZMKA 1B9XC 1ZCPA 3LSZA 5AIXA 1V9WA 1YEPA 4ZL7A 4KAEA 2TRXA 3G9BA 3F4SA 2WRTA 1TK8B 1NW2A 1EP8A 3BD2A 2IIYA 1K3LA 2LRNA 5INYA 2IWTA 2GTUA 4HQZA 1M9AA 4K7IA 1XFLA 1GLPA 1XIYA 3LORA 4NHWA 1TRWA 3I43A 6GSSA 2GGTA 5AIVA 2CX4A 3ZL5A 2FNOA 4OFMA 3HVNA 2VLUA 4BL7B 4BWSA 5ECSA 2YZUA 1R4WA 1SD8A 4HJMA 4K5SA 3UBKA 3VLNA 1YDKA 4FYCA 1F3AA 4HEA2 1TK0B 1PKZA 4PQHA 5LNKe 2OBIA 1SKWB 5L71A 4TW5A 1VF4A 3EU4A 4ECCA 2E0QA 3IE3A 1LJRA 3F6DA 3KEBA 1H4OA 2O89A 2CVDA 4FQUA 1FHEA 1QUWA 5CRDA 3TOTA 1A23A 1GTAA 17GSA 3O3TA 3GH9A 3LWAA 2FD3A 5ECPB 2H73A 3TKSA 1THXA 1VGLA 2P0GA 3MSZA 6GSUA 2XHFA 4KX4A 5F07A 1SK2A 1THOA 3ERFA 2BMXA 5EY6A 2L59A 4A5PA 3EC3A 3ZIVA 3MYDA 3TJKA 3OR5A 1OAZA 5HQPA 4YKFA 1FG4A 1X5EA 2H1AA 3US3A 1ST9A 1T7PB 3FRCA 5E59A 1Z3EA 4IJ3A 4GQFA 5BRTA 1K0BA 1GUMA 4O5QA 2K8SA 4I2TA 5JCUA 3CSHA 1B4QA 4MZBA 3JCML 4TXVA 1XCCA 4OFNA 4CHSA 2BJXA 3PR8A 5DJLA 3MNGA 3UL3A 3EMXA 4IGJA 3VURA 2LV3A 1U3IA 3FZAA 3E9JB 4XRDA 4JZQA 2LUSA 2KOKA 5ECMB 2FLSA 1UC7A 2CVBA 1EOGA 1S3AA 3DMLA 3EINA 2VM1A 2XBQA 3C71A 4NMUA 1GNEA 3QD9A 1JZWA 2YNXA 5EL8A 3QPMA 1DSBA 4EL1A 3FY7A 5ABRA 2XBIA 2DSAA 3IDVA 3DIEA 3IR4A 6GSTA 1SK1A 1WIKA 4P3YB 3KD0A 1GTIA 1M2AA 3GKMA 2RM5A 4G0IA 3APQA 4DVCA 2H0GA 3IC4A 1E6BA 3L9SA 3HJMA 2CAQA 1EOHA 3MWHA 5B7CA 4LMVA 5GSTA 3C8EA 4AF2A 4ISDA 4WF4A 3RBTA 2P31A 2E7PA 4F0CA 4ACSA 2DMLA 5D8IA 1G6WA 1X9SB 1T4ZA 2L5OA 5ECIB 4MABA 1V58A 4IHUA 3FK8A 3C7MA 2A4HA 4WR5A 3FR3A 2C3TA 3IA1A 1SYXA 2X4AA 3L9UA 5ELAA 4MK3A 2IJYA 2VAFA 4K2DA 2J23A 1TRSA 1PN9A 3ZREA 2R5GA 1BX9A 4XS4B 2IMFA 3DXBA 3E0UA 1WE0A 3A5WA 1BEDA 1U88A 2WB9A 4CW9A 1K0NA 2MMOA 2HFDA 1PL1A 3V1WA 2AHEA 1K0MA 1O6JA 2JSZA 3A2XA 2OA7A 1FVJA 1JZOA 1V2AA 2HZEB 2HNLA 4MMMA 3GTUB 4POKA 4BA7A 1U6TA 1MDIA 2O87A 2CT6A 5F0GA 2GT6A 4MF6A 4PXOA 3TB2A 2V41A 3LYPA 2R37A 2B1KA 19GSA 3IV4A 3WGXA 4MZWA 1EGOA 4IN0A 4J57E 5IMZA 3UMAA 2H70A 3MAKA 1T4YA 2HRNA 4LMWA 3SWLA 4YQUA 1RK4A 1V98A 3GYKA 4DSSA 1J0FA 1G7OA 2OACA 3GL5A 3RPPA 2QGVA 1YF1A 2YJ7A 2UZ8A 2I81A 1BQ7A 2R2JA 1V57A 2R4VA 4KDUA 4TR3A 3P2AA 3LXZA 2NBSA 1YJ6A 5CAXA 1LBKA 2MYGA 5BMUA 1WJKA 1M2BA 3KZQA 4BIKA 2CQ9A 4GTUA 1GSQA 2H6XA 1B4PA 4HS1A 1K3YA 2AV4A 2H71A 1A2LA 3ZFBA 3VK9A 1A8LA 4FYUA 4EIPA 3GIXA 3LQ7A 3Q19A 4XRAA 5IOWA 3ISOA 2GQKA 4JR6A 1ZYEA 4GWRA 2LNSA 1R5AA 2B1LA 5DDLA 1SL0B 4MZCA 1GSEA 1HYUA 1R7HA 2E2GA 2I4AA 3DGQA 1M9BA 1F3BA 1YKCA 4Q5RA 4WF5A 3LG6A 3IK9A 3VPTA 4DSSB 2GZZA 3M8NA 4O92A 1SJ6A 2Z9SA 3P8WA 2GZYA 2YN1A 2REMA 3DYRA 3HXSA 2QC7A 3HCZA 3IHQA 1B48A 4TRXA 2FWFA 5IOXA 1HD2A 3HHVA 3QCPA 1OE8A 4TR4A 2I9HA 2OE0A 2YWIA 2YPMA 2H30A 4ZXGA 3WT2A 2GZPA 2GDRA 4EO3A 2X99A 2DJ0A 3BBYA 5E4WA 5AISA 4XS1A 2LRTA 4F0BA 4XHMA 4IQAA 4TN8A 4GSSA 5GSSA 3C1RA 4MJCA 3VI5A 1HNAA 1YF0A 1EWXA 5KN0A 3FZ5A 1O73A 1PX6A 4IKHA 3EURA 3KJYA 5DALB 4BVXB 2XC2A 3HVVA 2IFQB 1TKDB 5A4WA 2N5AA 4ZILA 3HZ4A 1URMA 5D9TA 4PTSA 1N2AA 2B5EA 4LLRA 2H1DA 3ZIJA 2KHPA 4Z2RA 4RI6A 1PN0A 1T00A 1MDKA 1UA5A 5CRHA 5HR3A 2VIMA 4EUYA 4PUAA 2QKEA 1A2MA 1X9MB 2A4VA 3RPNA 2IL3A 1TP9A 3VPQA 4BVYB 1WMJA 2NTOA 8GSSA 3KH9A 5DJMA 3IOSA 4O5RA 2X8HA 1F37A 3TKSE 1GULA 4F9ZA 4JE1A 2PERA 3GSTA 18GSA 2CX3A 3BOAA 3M3MA 5ID2A 3TUEA 2OADA 4XS6A 5KN3A 4MP4A 2X8CA 3UVTA 1K0CA 2CZ2A 2VL2A 3TGZA 4Z2UA 3ZLPA 2K6VA 2DJ1A 2GSTA 1KNGA 2MBSA 1O8XA 3GA4A 3ZVJD 2NVLA 2CA8A 4CY6A 5DQSA 5IMFA 5KOXA 3N9JA 1FB0A 3FEUA 3HKRA 2QSIA 3VWVA 3FZ4A 4L5OA 2EIRA 3ZYWA 4MA9A 1GSFA 4ICYA 1SKRB 3LEFA 3VI7A 3KP9A 5DCHA 1TRUA 5F05A 3UJ1A 3CTGA 2B7KA 3P90A 2MMNA 1OC9A 4L8EA 3GKXA 3PGTA 2P5RA 2DJ2A 4IBPA 4CDOA 4KCAA 2IPAA 3TKSC 3CSIA 3BCKA 3W8JA 4POBA 3I69A 3WD6A 1GSYA 1EEJA 2YCDA 4HZ2A 12GSA 3WYWA 4DSRA 3IXRA 3EWLA 1PA3A 4RQRA 20GSA 3F0IA 2PN8A 4TOPA 3KTLA 2RIIA 1Y25A 4MCUA 4RUVA 5DVBA 1C72A 1JHBA 2A2PA 3J7Yb 3ERWA 4GRFA 5J9CA 1AW9A 2K8VA 2EC4A 1DBYA 3M1GA 5IIZA 2HT9A 4JRRA 1XXUA 1XW9A 1M2DA 1Z9HA 1OC9B 5G5EA 4KE3A 2WZ9A 4KDYA 5DBQA 4Z7XA 1VF1A 3DD3A 4DSQA 5J4UA 4POLA 4N10A 1SK0A 4WEYA 2VL3A 5G1KA 1T3BA 1GRXA 4LL4B 5DAKA 5ECLB 4GXZA 1JFUA 2ZUPA 3CRTA 4KH7A 1TXXA 1V40A 5D9XA 4NPBA 5D9WA 3BCIA 5CYYA 3GKNA 1BAYA 2YJHA 1SL2B 3QMXA 1GTBA 1SKSB 6GSYA 4AJ6A 1VF3A 4X4JA 1GSDA 2RUFA 3L0HA 4N30A 3VWXA 2J9HA 2GSRA 1ZYNA 4GQCA 1UVZA 2AUVA 4ZL8A 4PUFC 2V6OA 2VOCA 5J3RA 5CRGA 1X9WB 3ZITA 3HVXA 5HR2A 1ZMAA 2M72A 1K0DA 4MLYA 1PX7A 4ZB9A 4YAVA 3KH7A 1R26A 4L0UA 1MD4A 4D73A 4KA0A 5D73A 1TTZA 3TJJA 2HI7A 1VRSD 4YQMA 2R0PA 2YWMA 4ECBA 2ES7A 2C0FA 1X5CA 1XWGA 1S3RA 3H4KA 4K7NA 4K1FA 5D9VA 2D2ZA 4IP6A 2F8FA 1X5DA 5ECOB 2E2MA 2VUPA 1PRXA 2MMZA 2RUEA 5JWRB 1XBSA 2JZSA 4MF5A 1XPVA 2HLSA 1Z6NA 4OMVA 4POMA 1AAZA 4ILFA 4MH3A 2L4CA 2R6KA 3R3EA 3M9KA 2A2SA 2NDOA 3FKFA 4MF7A 1WRYA 3D4TA 1PL2A 2VCXA 1XVWA 1O85A 3GURA 1AC1A 2HZFA 1TJDA 1ZYPA 2FWHA 4GSTA 3GUSA 2LNTA 3L78A 3QFAC 6GSXA 1RW1A 2H0IA 5IMVA 2VD1A 1Z6MA 6GSVA 2V1MA 1FAAA 4KW6A 2FUG2 4I5QA 4OWYA 2FCHA 2N5FA 2H1BA 5IPGA 5KEJA 5KOWA 5HFGA 1GWCA 3QAWA 1WWJA 2C0DA 2MMAA 5IO2A 3F8UA 2CAIA 5AN1A 14GSA 3IAM2 3CYNA 3FYGA 4MJEA 1M7TA 3D22A 5H5SA 4PQIA 4V2LA 2DLXA 3F4TA 2OE3A 1G0TA 2HYXA 1M0UA 1M3IA 4JBBA 3FR6A 3TKPA 4WR4A 3O76A 4KSOA 2PVQA 4N0ZA 1A2JA 3GNJA 2K9FA 4ID0A 1F6MC 2H8LA 5CREA 1QK8A 5EPFA 1YEXA 1ERUA 2TRCP 1PSQA 1OC8A 2QA2A 2C1YA 2WDUA 4QL9A 2DKIA 2EIQA 5FHIA 5A4UA 3AY8A 2JL4A 2O8VB 3D6IA 2DBCA 3M0FA 2H01A 4QQ7A 5HR0A 1EGRA 1ZOFA 4K2XA 1GUKA 2VLVA 4Q5FA 2HRFA 1EP7A 4H86A 2WULA 4MDCA 4V1Ag 5IM9A 10GSA 1TU8A 2GVPA 2LTKA 4YH2A 3EE2A 4FIWA 3KXOA 1ACVA 1A8YA 1QXHA 3S9FA 3VWUA 4I2UA 1XOAA 1RQMA 1BG5A 3KMNA 13GSA 3WT1A 5JCGA 2DMMA 4ZB6A 4HU7A 3GX0A 5G30A 1BYEA 2YP6A 1MDJA 2WCIA 4K5RA 1GUHA 1OVNA 1G7EA 2FWGA 2C3NA 2CVKA 4NAXA 2BTOT 3ED3A 1YZXA 2PU9C 4F82A 2ON7A 2O85A 2XPEA 4FYBA 3EVIA 1TI3A 4MJBA 1ZYQB 1FVKA 2L6CA 4YKGA 3QAGA 1ZL9A 4LA1A 4TR1A 1F2EA 4OD7A 2B5XA 3GL3A 2B3SA 2F51A 2LJKA 4G19A 5C00A 3DVWA 3LJRA 2YOIA 2LQOA 5G5FA 4KB3A 4ECIA 6GSWA 2DJ3A 1ILOA 3ME7A 5LCZA 2CV4A 4MNNA 1ML6A 3W6GA 3MDKA 1EEMA 3K8NA 2GSQA 4G0LA 2HRKA 3IK7A 4KGIA 3GRXA 2VD0A 3TOUA 1W4VA 4HDEA 1Z7RA 2FWEA 3VFIA 2GS3A 3PPUA 3KCMA 4JEDA 2H75A 4PX1A 4OCFA 3GHAA 4J2FA 5ECHB 4OFTA 1QQ2A 2IMKA 4K0GA 1EV9A 3KM6A 5IQYA 1TK5B 5GZZB 2P5QA 4LL1B 1K0OA 1TU7A 2H66A 3M9JA 4TR1B 2GQMA 4WETA 1SL1B 1YQ1A 2M80A 3D21A 4G0KA 3SBCA 2DC5A 2AJQB 2PVOC 1XZOA 2C0EA 2JADA 5A5KA 5DCGA 3H79A 5GAPD 2VCQA 3EU3A 4EVMA 3HJOA 2PWJA 1WOUA 4AGSA 2YV7A 4EE0A 1CQGA 5JWQB 2FGXA 4V2MA 1ABAA 3NZNA 1TW9A 1XVQA 4HI7A 2V32A 1HQOA 3G7JA 4EXJA 2G0FA 3RDWA 2F9SA 2LRCA 4KDXA 5H5RA 2YZHA 5ECRB 2R0GA 1SJZA 4KUNA 4EF0A 3HDCA 4K7OA 1PKWA 2O7KA 2GQLA 3TDGA 1PQNA 2XPDA 1XWCA 3NIVA 1SENA 4HJ2A 1OC3A 2OKAA 2C80A 3DKSA 4OCEA 3VWWA 3TJGA 5ECKB 5G31A 3O6TA 3FW2A 2R0CA 1N8JA 5CO3A 1S3DA 2ALBA 3Q6OA 5C04A 2YWNA 4L5LA 4O7HA 1HNCA 3CRUA 3APSA 4IP1A 5ID2B 3C1SA 2OJLA 1DE1A 1XW6A 1AUCA 4PGTA 1F9MA 1GLQA 3D5JA 3ZTLA 5FWGA 5J9BA 4KF9A 4O5UA 4CY8A 3F4RA 1EV4A 4BWQA 1XOBA 1O7UA 1ZZYA 2H19A 2YV9A 4G10A 3FMWA 1TOFA 1XWBA 5HFKA 1QMVA 2FA8A 4K0NA 2VLTA 1AQVA 1KBNA 1CQHA 2MZCA 2I1UA 2H1GA 3BJ5A 2PMTA 4OO4A 1E2YA 3QOUA 3GSSA 1MD3A 1SYRA 1AXDA 2RLIA 4ZBDA 2WGRA 4ZB8A 4WBJA 1FO5A 2NPBA 3C73A 4K6XA 4MJAA 3MIXA 4USSA 4X0XA 2YANA 2K18A 5JWOB 2JZTA 3QR6A 4RQXA 2B6MA 2ON5A 2PUKC 3GV1A 2JU5A 1BJXA 2L5LA 3WGEA 4HOJA 4EDYA 2DIYA 2WS2A 3IHGA 5A4VA 4EC0A 4X43A 5ENUA 3N5OA 3GH6A 4TKYA 1TDIA 2YWOA 2DKHA 4I97A 4Q5QA 2N5BA 1NHOA 1TRVA 2VCVA 3H8QA 2JACA 2AYTA 4L0WA 3UIWA 1AQXA 3TRPA 2FY6A 3UAPA 3F3RA 1OYJA 3FZ9A 3ZZXA 1A24A 5CP1A 4HZ4A 4IS0A 4HU9A 1M3JA 1I9DA 3P7XA 4EIQA 5DAKB 4K9ZA 4OO5A 4PNFA 1JLVA 1KTEA 4GF0A 2R3XA 1T8EB 2LJRA 2PGTA 5JCWA 3HYPA 2LEGA 3R2QA 1NM3A 3H1NA 2DJKA 4TR0A 3TCOA 2X64A 1M99A 4KNDA 5J5NA 5COHA 2C4JA 2VM2A 2L6DA 2H6ZA 2DJJA 2H72A 5HFIA 5G1LA 3IBHA 4I6XA 2RM6A 2HSYA 2V6KA 4XS4A 4KSMA 2I3YA 4MPFA 9GSSA 4HUAA 2PPTA 5ECQB 4WBRD 2WJUA 3APOA 5ECNB 2V2GA 3LW9A 1Z5YE 2LKUA 4D73B 2HZEA 2KUCA 1VF2A 2GSSA 2MBTA 1U3AA 3GTUA 1YY7A 1B9YC 1IYIA 4TXOA 3HD5A 1Y6EA 2VO4A 3CXGA 2FHEA 4K8MA 1WP0A 3I6AA 2DIZA 3GMFA 4IJIA 3QDNA 5IO0A 3U5RE 1B8XA 4QL7A 1XW5A 3TKRA 3PINA 3FR9A 3TJFA
chains in the Genus database with same CATH topology
2ZNMA 2B7JA 4X1UA 4GSNA 5IMAA 5GAND 1TI1A 2AB6A 3QFBC 2AAWA 5ELGA 2HSHA 4IQ1A 16GSA 4G2EA 3QAVA 1LU4A 5IMCA 2HRAA 3HA9A 2GT5A 4ZBAA 3W8SA 1FB6A 2KLXA 2B5YA 5D96A 3TKQA 4IELA 4ECJA 3RHCA 4F03A 3CTFA 3KGKA 1OKTA 2OBKA 1KEBA 1JZDA 3G7IA 1X0RA 1DUGA 5B8BA 4TXOB 1OE7A 2VCZA 2IMDA 2L57A 2G2QA 1FOVA 4TVEA 1K0AA 2JZRA 5H5QA 3F3QA 3UARA 2VCTA 4E8HA 1GSUA 5KN1A 1QFNA 5EVOA 1IYHA 5FT3A 3EYTA 4XCSA 1JLWA 3D0ZA 4JU5A 2KP1A 4IVFA 2QA1A 1WPIA 3ERGA 5F8BA 1W89A 1O81A 2KP2A 2H74A 3TJBA 2WFCA 3H93A 3UBLA 2H0HA 1MEKA 2H6YA 2TIRA 4XIHA 2LS5A 4O32A 1GSSA 3ME8A 3G7YA 4JR4A 3J7Yk 3DVXA 4AJ7A 1FW1A 4NV5A 1NHYA 5DQYA 4NV2A 4F2IA 3ZRDA 2ZCTA 4XTSA 4ZBBA 2LJAA 3HY2A 1XWAA 4I8BA 4YQVA 2FA4A 2IMEA 5G2ZA 1Q98A 4E8EA 2LSTA 4Z2TA 2F8AA 4V2NA 2H76A 2VL9A 3ZMLA 1EZKA 1XWKA 1GH2A 3IAS2 1MTCA 2F3MA 3CMIA 4WXTA 4YAPA 1ERWA 5D93A 1PMTA 2IMIA 1GP1A 1AIUA 4WKWA 3GFKA 3RHBA 22GSA 3D4MA 5B6NA 1JZRA 1PGTA 1A0RP 5DALA 4BVXA 3UEMA 2IFQA 4DEJA 4AJ8A 4KCEA 4HQSA 5CNWA 5B8AA 5HR1A 3TRQA 1K3OA 2M46A 4PQ1A 3HVSA 1R5PA 11GSA 3F9UA 3LYKA 1ERVA 1Q4JA 3L4NA 2VCWA 4GCIA 3NOFA 3HJPA 1NSWA 1ERTA 4IW9A 4ML1A 4PURA 2C0GA 2C8UA 1AQWA 3DWVA 3LFLA 3U6VA 1J08A 3GKKA 2VL2C 2HXKA 1SJIA 3UOMA 2JSYA 4ML6A 4BVYA 5AGYA 2OE1A 7GSSA 1GL8A 3LXTA 1J9BA 3GX8A 5F06A 3IPZA 2PBJA 2HSMA 2IN3A 3EMPA 4ZL9A 4N11A 3A2VA 4NWYA 1Z7PA 4BPYA 3L9VA 2CZ3A 3KIJA 3KP8A 1SU9A 5KN2A 3WGDA 1S3CA 2L4QA 3PH9A 1YKAA 1H75A 4V1Ap 3A2WA 3KTBA 1HNBA 1OKDA 3DEXA 4EDZA 2X49A 3F63A 3LGCA 3TRXA 4MPGA 4J56E 3RAZA 1ON4A 3HZ8A 3CSJA 3IRAA 3I9V2 1A0FA 4GLTA 3FHKA 3UVHA 1SD9A 5CRWA 3KMOA 5IPHA 3ZFLA 3GN3A 5B6MA 4FO5A 1GNWA 1QGVA 2A2RA 1PD21 4PNGA 3CBUA 2HE3A 4ZIJA 3ZVJA 5LD0A 1T1VA 1USBA 1O8WA 4Q5NA 2C3QA 3IC8A 3A3TA 1GTUA 3Q74A 4ULXA 1UN2A 5J41A 3Q18A 1FOHA 4G9HA 5IMDA 2EIOA 2GLRA 3F6FA 3EPTA 2X8GA 4EKZA 4BL7A 3DRNA 4MH2A 4NHZA 3A5IA 4N0VA 2LQQA 4FH8A 1U87A 1ZGNA 1I5GA 1DE2A 4NXIA 4RI7A 3E3EA 1G6YA 3ZMKA 1B9XC 1ZCPA 3LSZA 5AIXA 1V9WA 1YEPA 4ZL7A 4KAEA 2TRXA 3G9BA 3F4SA 2WRTA 1TK8B 1NW2A 1EP8A 3BD2A 2IIYA 1K3LA 2LRNA 5INYA 2IWTA 2GTUA 4HQZA 1M9AA 4K7IA 1XFLA 1GLPA 1XIYA 3LORA 4NHWA 1TRWA 3I43A 6GSSA 2GGTA 5AIVA 2CX4A 3ZL5A 2FNOA 4OFMA 2VLUA 4BL7B 4BWSA 5ECSA 2YZUA 1R4WA 1SD8A 4HJMA 4K5SA 3UBKA 3VLNA 1YDKA 4FYCA 1F3AA 4HEA2 1TK0B 1PKZA 4PQHA 5LNKe 2OBIA 1SKWB 5L71A 4TW5A 1VF4A 3EU4A 4ECCA 2E0QA 3IE3A 1LJRA 3F6DA 3KEBA 1H4OA 2O89A 2CVDA 4FQUA 1FHEA 1QUWA 5CRDA 3TOTA 1A23A 1GTAA 17GSA 3O3TA 3GH9A 3LWAA 2FD3A 5ECPB 2H73A 3TKSA 1THXA 1VGLA 2P0GA 3MSZA 6GSUA 2XHFA 4KX4A 5F07A 1SK2A 1THOA 3ERFA 2BMXA 5EY6A 2L59A 4A5PA 3EC3A 3ZIVA 3MYDA 3TJKA 3OR5A 1OAZA 5HQPA 4YKFA 1FG4A 1X5EA 2H1AA 3US3A 1ST9A 1T7PB 3FRCA 5E59A 1Z3EA 4IJ3A 4GQFA 5BRTA 1K0BA 1GUMA 4O5QA 2K8SA 4I2TA 5JCUA 3CSHA 1B4QA 4MZBA 3JCML 4TXVA 1XCCA 4OFNA 4CHSA 2BJXA 3PR8A 5DJLA 3MNGA 3UL3A 3EMXA 4IGJA 3VURA 2LV3A 1U3IA 3FZAA 3E9JB 4XRDA 4JZQA 2LUSA 2KOKA 5ECMB 2FLSA 1UC7A 2CVBA 1EOGA 1S3AA 3DMLA 3EINA 2VM1A 2XBQA 3C71A 4NMUA 1GNEA 3QD9A 1JZWA 2YNXA 5EL8A 3QPMA 1DSBA 4EL1A 3FY7A 5ABRA 2XBIA 2DSAA 3IDVA 3DIEA 3IR4A 6GSTA 1SK1A 1WIKA 4P3YB 3KD0A 1GTIA 1M2AA 3GKMA 2RM5A 4G0IA 3APQA 4DVCA 2H0GA 3IC4A 1E6BA 3L9SA 3HJMA 2CAQA 1EOHA 3MWHA 5B7CA 4LMVA 5GSTA 3C8EA 4AF2A 4ISDA 4WF4A 3RBTA 2P31A 2E7PA 4F0CA 4ACSA 2DMLA 5D8IA 1G6WA 1X9SB 1T4ZA 2L5OA 5ECIB 4MABA 1V58A 4IHUA 3FK8A 3C7MA 2A4HA 4WR5A 3FR3A 2C3TA 3IA1A 1SYXA 2X4AA 3L9UA 5ELAA 4MK3A 2IJYA 2VAFA 4K2DA 2J23A 1TRSA 1PN9A 3ZREA 2R5GA 1BX9A 4XS4B 2IMFA 3DXBA 3E0UA 1WE0A 3A5WA 1BEDA 1U88A 2WB9A 4CW9A 1K0NA 2MMOA 2HFDA 1PL1A 3V1WA 2AHEA 1K0MA 1O6JA 2JSZA 3A2XA 2OA7A 1FVJA 1JZOA 1V2AA 2HZEB 2HNLA 4MMMA 3GTUB 4POKA 4BA7A 1U6TA 1MDIA 2O87A 2CT6A 5F0GA 2GT6A 4MF6A 4PXOA 3TB2A 2V41A 3LYPA 2R37A 2B1KA 19GSA 3IV4A 3WGXA 4MZWA 1EGOA 4IN0A 4J57E 5IMZA 3UMAA 2H70A 3MAKA 1T4YA 2HRNA 4LMWA 3SWLA 4YQUA 1RK4A 1V98A 3GYKA 4DSSA 1J0FA 1G7OA 2OACA 3GL5A 3RPPA 2QGVA 1YF1A 2YJ7A 2UZ8A 2I81A 1BQ7A 2R2JA 1V57A 2R4VA 4KDUA 4TR3A 3P2AA 3LXZA 2NBSA 1YJ6A 5CAXA 1LBKA 2MYGA 5BMUA 1WJKA 1M2BA 3KZQA 2CQ9A 4GTUA 1GSQA 2H6XA 1B4PA 4HS1A 1K3YA 2AV4A 2H71A 1A2LA 3ZFBA 3VK9A 1A8LA 4FYUA 4EIPA 3GIXA 3LQ7A 3Q19A 4XRAA 5IOWA 3ISOA 2GQKA 4JR6A 1ZYEA 4GWRA 2LNSA 1R5AA 2B1LA 5DDLA 1SL0B 4MZCA 1GSEA 1HYUA 1R7HA 2E2GA 2I4AA 3DGQA 1M9BA 1F3BA 1YKCA 4Q5RA 4WF5A 3LG6A 3IK9A 3VPTA 4DSSB 2GZZA 3M8NA 4O92A 1SJ6A 2Z9SA 3P8WA 2GZYA 2YN1A 2REMA 3DYRA 3HXSA 2QC7A 3HCZA 3IHQA 1B48A 4TRXA 2FWFA 5IOXA 1HD2A 3HHVA 3QCPA 1OE8A 4TR4A 2I9HA 2OE0A 2YWIA 2YPMA 2H30A 4ZXGA 3WT2A 2GZPA 2GDRA 4EO3A 2X99A 2DJ0A 3BBYA 5E4WA 5AISA 4XS1A 2LRTA 4F0BA 4XHMA 4IQAA 4TN8A 4GSSA 5GSSA 3C1RA 4MJCA 3VI5A 1HNAA 1YF0A 1EWXA 5KN0A 3FZ5A 1O73A 1PX6A 4IKHA 3EURA 3KJYA 5DALB 4BVXB 2XC2A 3HVVA 2IFQB 1TKDB 5A4WA 2N5AA 4ZILA 3HZ4A 1URMA 5D9TA 4PTSA 1N2AA 2B5EA 4LLRA 2H1DA 3ZIJA 2KHPA 4Z2RA 4RI6A 1PN0A 1T00A 1MDKA 1UA5A 5CRHA 5HR3A 2VIMA 4EUYA 4PUAA 2QKEA 1A2MA 1X9MB 2A4VA 3RPNA 2IL3A 1TP9A 3VPQA 4BVYB 1WMJA 2NTOA 8GSSA 3KH9A 5DJMA 3IOSA 4O5RA 2X8HA 1F37A 3TKSE 1GULA 4F9ZA 4JE1A 2PERA 3GSTA 18GSA 2CX3A 3BOAA 3M3MA 5ID2A 3TUEA 2OADA 4XS6A 5KN3A 4MP4A 2X8CA 3UVTA 1K0CA 2CZ2A 2VL2A 3TGZA 4Z2UA 3ZLPA 2K6VA 2DJ1A 2GSTA 1KNGA 2MBSA 1O8XA 3GA4A 3ZVJD 2NVLA 2CA8A 4CY6A 5DQSA 5IMFA 5KOXA 3N9JA 1FB0A 3FEUA 3HKRA 2QSIA 3VWVA 3FZ4A 4L5OA 2EIRA 3ZYWA 4MA9A 1GSFA 4ICYA 1SKRB 3LEFA 3VI7A 3KP9A 5DCHA 1TRUA 5F05A 3UJ1A 3CTGA 2B7KA 3P90A 2MMNA 1OC9A 4L8EA 3GKXA 3PGTA 2P5RA 2DJ2A 4IBPA 4CDOA 4KCAA 2IPAA 3TKSC 3CSIA 3BCKA 3W8JA 4POBA 3I69A 3WD6A 1GSYA 1EEJA 2YCDA 4HZ2A 12GSA 3WYWA 4DSRA 3IXRA 3EWLA 1PA3A 4RQRA 20GSA 3F0IA 2PN8A 4TOPA 3KTLA 2RIIA 1Y25A 4MCUA 4RUVA 5DVBA 1C72A 1JHBA 2A2PA 3J7Yb 3ERWA 4GRFA 5J9CA 1AW9A 2K8VA 2EC4A 1DBYA 3M1GA 5IIZA 2HT9A 4JRRA 1XXUA 1XW9A 1M2DA 1Z9HA 1OC9B 5G5EA 4KE3A 2WZ9A 4KDYA 5DBQA 4Z7XA 1VF1A 3DD3A 4DSQA 5J4UA 4POLA 4N10A 1SK0A 4WEYA 2VL3A 5G1KA 1T3BA 1GRXA 4LL4B 5DAKA 5ECLB 4GXZA 1JFUA 2ZUPA 3CRTA 4KH7A 1TXXA 1V40A 5D9XA 4NPBA 5D9WA 3BCIA 5CYYA 3GKNA 1BAYA 2YJHA 1SL2B 3QMXA 1GTBA 1SKSB 6GSYA 4AJ6A 1VF3A 4X4JA 1GSDA 2RUFA 3L0HA 4N30A 3VWXA 2J9HA 2GSRA 1ZYNA 4GQCA 1UVZA 2AUVA 4ZL8A 4PUFC 2V6OA 2VOCA 5J3RA 5CRGA 1X9WB 3ZITA 3HVXA 5HR2A 1ZMAA 2M72A 1K0DA 4MLYA 1PX7A 4ZB9A 4YAVA 3KH7A 1R26A 4L0UA 1MD4A 4D73A 4KA0A 5D73A 1TTZA 3TJJA 2HI7A 1VRSD 4YQMA 2R0PA 2YWMA 4ECBA 2ES7A 2C0FA 1X5CA 1XWGA 3H4KA 4K7NA 4K1FA 5D9VA 2D2ZA 4IP6A 2F8FA 1X5DA 5ECOB 2E2MA 2VUPA 1PRXA 2MMZA 2RUEA 5JWRB 1XBSA 2JZSA 4MF5A 1XPVA 2HLSA 1Z6NA 4OMVA 4POMA 1AAZA 4ILFA 4MH3A 2L4CA 2R6KA 3R3EA 3M9KA 2A2SA 2NDOA 3FKFA 4MF7A 1WRYA 3D4TA 1PL2A 2VCXA 1XVWA 1O85A 3GURA 1AC1A 2HZFA 1TJDA 1ZYPA 2FWHA 4GSTA 3GUSA 2LNTA 3L78A 3QFAC 6GSXA 1RW1A 2H0IA 5IMVA 2VD1A 1Z6MA 6GSVA 2V1MA 1FAAA 4KW6A 2FUG2 4I5QA 4OWYA 2FCHA 2N5FA 2H1BA 5IPGA 5KEJA 5KOWA 5HFGA 1GWCA 3QAWA 1WWJA 2C0DA 2MMAA 5IO2A 3F8UA 2CAIA 5AN1A 14GSA 3IAM2 3CYNA 3FYGA 4MJEA 1M7TA 3D22A 5H5SA 4PQIA 4V2LA 2DLXA 3F4TA 2OE3A 1G0TA 2HYXA 1M0UA 4JBBA 3FR6A 3TKPA 4WR4A 3O76A 4KSOA 2PVQA 4N0ZA 1A2JA 3GNJA 2K9FA 4ID0A 1F6MC 2H8LA 5CREA 1QK8A 5EPFA 1YEXA 1ERUA 2TRCP 1PSQA 1OC8A 2QA2A 2C1YA 2WDUA 4QL9A 2DKIA 2EIQA 5FHIA 5A4UA 3AY8A 2JL4A 2O8VB 3D6IA 2DBCA 3M0FA 2H01A 4QQ7A 5HR0A 1EGRA 1ZOFA 4K2XA 1GUKA 2VLVA 4Q5FA 2HRFA 1EP7A 4H86A 2WULA 4MDCA 4V1Ag 5IM9A 10GSA 1TU8A 2GVPA 2LTKA 4YH2A 3EE2A 4FIWA 3KXOA 1ACVA 1A8YA 1QXHA 3S9FA 3VWUA 4I2UA 1XOAA 1RQMA 1BG5A 3KMNA 13GSA 3WT1A 5JCGA 2DMMA 4ZB6A 4HU7A 3GX0A 5G30A 1BYEA 2YP6A 1MDJA 2WCIA 4K5RA 1GUHA 1OVNA 1G7EA 2FWGA 2C3NA 2CVKA 4NAXA 2BTOT 3ED3A 1YZXA 2PU9C 4F82A 2ON7A 2O85A 2XPEA 4FYBA 3EVIA 1TI3A 4MJBA 1ZYQB 1FVKA 2L6CA 4YKGA 3QAGA 1ZL9A 4LA1A 4TR1A 1F2EA 4OD7A 2B5XA 3GL3A 2B3SA 2F51A 2LJKA 4G19A 5C00A 3DVWA 3LJRA 2YOIA 2LQOA 5G5FA 4KB3A 4ECIA 6GSWA 2DJ3A 1ILOA 3ME7A 5LCZA 2CV4A 4MNNA 1ML6A 3W6GA 3MDKA 1EEMA 3K8NA 2GSQA 4G0LA 2HRKA 3IK7A 4KGIA 3GRXA 2VD0A 3TOUA 1W4VA 4HDEA 1Z7RA 2FWEA 3VFIA 2GS3A 3PPUA 3KCMA 4JEDA 2H75A 4PX1A 4OCFA 3GHAA 4J2FA 5ECHB 4OFTA 1QQ2A 2IMKA 4K0GA 1EV9A 3KM6A 5IQYA 1TK5B 5GZZB 2P5QA 4LL1B 1K0OA 1TU7A 2H66A 3M9JA 4TR1B 2GQMA 4WETA 1SL1B 1YQ1A 2M80A 3D21A 4G0KA 3SBCA 2DC5A 2AJQB 2PVOC 1XZOA 2C0EA 2JADA 5A5KA 5DCGA 3H79A 5GAPD 2VCQA 3EU3A 4EVMA 3HJOA 2PWJA 1WOUA 4AGSA 2YV7A 4EE0A 1CQGA 5JWQB 2FGXA 4V2MA 1ABAA 3NZNA 1TW9A 1XVQA 4HI7A 2V32A 1HQOA 3G7JA 4EXJA 2G0FA 3RDWA 2F9SA 2LRCA 4KDXA 5H5RA 2YZHA 5ECRB 2R0GA 1SJZA 4KUNA 4EF0A 3HDCA 4K7OA 1PKWA 2O7KA 2GQLA 3TDGA 1PQNA 2XPDA 1XWCA 3NIVA 1SENA 4HJ2A 1OC3A 2OKAA 2C80A 3DKSA 4OCEA 3VWWA 3TJGA 5ECKB 5G31A 3O6TA 3FW2A 2R0CA 1N8JA 5CO3A 1S3DA 2ALBA 3Q6OA 5C04A 2YWNA 4L5LA 4O7HA 1HNCA 3CRUA 3APSA 4IP1A 5ID2B 3C1SA 2OJLA 1DE1A 1XW6A 1AUCA 4PGTA 1F9MA 1GLQA 3D5JA 3ZTLA 5FWGA 5J9BA 4KF9A 4O5UA 4CY8A 3F4RA 1EV4A 4BWQA 1XOBA 1O7UA 1ZZYA 2H19A 2YV9A 4G10A 3FMWA 1TOFA 1XWBA 5HFKA 1QMVA 2FA8A 4K0NA 2VLTA 1AQVA 1KBNA 1CQHA 2MZCA 2I1UA 2H1GA 3BJ5A 2PMTA 4OO4A 1E2YA 3QOUA 3GSSA 1MD3A 1SYRA 1AXDA 2RLIA 4ZBDA 2WGRA 4ZB8A 4WBJA 1FO5A 2NPBA 3C73A 4K6XA 4MJAA 3MIXA 4USSA 4X0XA 2YANA 2K18A 5JWOB 2JZTA 3QR6A 4RQXA 2B6MA 2ON5A 2PUKC 3GV1A 2JU5A 1BJXA 2L5LA 3WGEA 4HOJA 4EDYA 2DIYA 2WS2A 3IHGA 5A4VA 4EC0A 4X43A 5ENUA 3N5OA 3GH6A 4TKYA 1TDIA 2YWOA 2DKHA 4I97A 4Q5QA 2N5BA 1NHOA 1TRVA 2VCVA 3H8QA 2JACA 2AYTA 4L0WA 3UIWA 1AQXA 3TRPA 2FY6A 3UAPA 3F3RA 1OYJA 3FZ9A 3ZZXA 1A24A 5CP1A 4HZ4A 4IS0A 4HU9A 1I9DA 3P7XA 4EIQA 5DAKB 4K9ZA 4OO5A 4PNFA 1JLVA 1KTEA 4GF0A 2R3XA 1T8EB 2LJRA 2PGTA 5JCWA 3HYPA 2LEGA 3R2QA 1NM3A 3H1NA 2DJKA 4TR0A 3TCOA 2X64A 1M99A 4KNDA 5J5NA 5COHA 2C4JA 2VM2A 2L6DA 2H6ZA 2DJJA 2H72A 5HFIA 5G1LA 3IBHA 4I6XA 2RM6A 2HSYA 2V6KA 4XS4A 4KSMA 2I3YA 4MPFA 9GSSA 4HUAA 2PPTA 5ECQB 4WBRD 2WJUA 3APOA 5ECNB 2V2GA 3LW9A 1Z5YE 2LKUA 4D73B 2HZEA 2KUCA 1VF2A 2GSSA 2MBTA 1U3AA 3GTUA 1YY7A 1B9YC 1IYIA 4TXOA 3HD5A 1Y6EA 2VO4A 3CXGA 2FHEA 4K8MA 1WP0A 3I6AA 2DIZA 3GMFA 4IJIA 3QDNA 5IO0A 3U5RE 1B8XA 4QL7A 1XW5A 3TKRA 3PINA 3FR9A 3TJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZNM A;  2B7J A;  4X1U A;  4GSN A;  5IMA A;  5GAN D;  1TI1 A;  2AB6 A;  3QFB C;  2AAW A;  5ELG A;  2HSH A;  4IQ1 A;  16GS A;  4G2E A;  3QAV A;  1LU4 A;  5IMC A;  3HA9 A;  2GT5 A;  4ZBA A;  3W8S A;  1FB6 A;  2KLX A;  2B5Y A;  5D96 A;  3TKQ A;  4IEL A;  4ECJ A;  3RHC A;  4F03 A;  3CTF A;  3KGK A;  1OKT A;  2OBK A;  1KEB A;  1JZD A;  3G7I A;  1X0R A;  1DUG A;  5B8B A;  4TXO B;  1OE7 A;  2VCZ A;  2IMD A;  2L57 A;  2G2Q A;  1FOV A;  4TVE A;  1K0A A;  2JZR A;  5H5Q A;  3F3Q A;  3UAR A;  2VCT A;  4E8H A;  1GSU A;  5KN1 A;  1QFN A;  5EVO A;  1IYH A;  5FT3 A;  3EYT A;  4XCS A;  1JLW A;  3D0Z A;  4JU5 A;  2KP1 A;  4IVF A;  1WPI A;  3ERG A;  5F8B A;  1W89 A;  1O81 A;  2KP2 A;  2H74 A;  3TJB A;  2WFC A;  3H93 A;  3UBL A;  2H0H A;  1MEK A;  2H6Y A;  2TIR A;  4XIH A;  2LS5 A;  4O32 A;  1GSS A;  3ME8 A;  3G7Y A;  4JR4 A;  3J7Y k;  3DVX A;  4AJ7 A;  1FW1 A;  4NV5 A;  1NHY A;  5DQY A;  4NV2 A;  4F2I A;  3ZRD A;  2ZCT A;  4XTS A;  4ZBB A;  2LJA A;  3HY2 A;  1XWA A;  4I8B A;  4YQV A;  2FA4 A;  2IME A;  5G2Z A;  1Q98 A;  4E8E A;  2LST A;  2F8A A;  4V2N A;  2H76 A;  2VL9 A;  3ZML A;  1EZK A;  1XWK A;  1GH2 A;  3IAS 2;  1MTC A;  2F3M A;  3CMI A;  4WXT A;  4YAP A;  1ERW A;  5D93 A;  1PMT A;  2IMI A;  1GP1 A;  1AIU A;  4WKW A;  3GFK A;  3RHB A;  22GS A;  3D4M A;  5B6N A;  1JZR A;  1PGT A;  1A0R P;  5DAL A;  4BVX A;  3UEM A;  2IFQ A;  4DEJ A;  4AJ8 A;  4KCE A;  4HQS A;  5CNW A;  5B8A A;  5HR1 A;  3TRQ A;  1K3O A;  2M46 A;  4PQ1 A;  3HVS A;  1R5P A;  11GS A;  3F9U A;  3LYK A;  1ERV A;  1Q4J A;  3L4N A;  2VCW A;  4GCI A;  3NOF A;  3HJP A;  1NSW A;  1ERT A;  4IW9 A;  4ML1 A;  4PUR A;  2C0G A;  2C8U A;  1AQW A;  3DWV A;  3LFL A;  3U6V A;  1J08 A;  3GKK A;  2VL2 C;  2HXK A;  1SJI A;  3UOM A;  2JSY A;  4ML6 A;  4BVY A;  5AGY A;  2OE1 A;  7GSS A;  1GL8 A;  3LXT A;  1J9B A;  3GX8 A;  5F06 A;  3IPZ A;  2PBJ A;  2IN3 A;  3EMP A;  4ZL9 A;  4N11 A;  3A2V A;  4NWY A;  1Z7P A;  4BPY A;  3L9V A;  2CZ3 A;  3KIJ A;  3KP8 A;  1SU9 A;  5KN2 A;  3WGD A;  1S3C A;  2L4Q A;  3PH9 A;  1YKA A;  1H75 A;  4V1A p;  3A2W A;  3KTB A;  1HNB A;  1OKD A;  3DEX A;  4EDZ A;  3F63 A;  3LGC A;  3TRX A;  4MPG A;  4J56 E;  3RAZ A;  1ON4 A;  3HZ8 A;  3CSJ A;  3IRA A;  3I9V 2;  1A0F A;  4GLT A;  3FHK A;  3UVH A;  1SD9 A;  5CRW A;  3KMO A;  5IPH A;  3ZFL A;  3GN3 A;  5B6M A;  4FO5 A;  1GNW A;  1QGV A;  2A2R A;  1PD2 1;  4PNG A;  3CBU A;  2HE3 A;  4ZIJ A;  3ZVJ A;  5LD0 A;  1T1V A;  1USB A;  1O8W A;  4Q5N A;  2C3Q A;  3A3T A;  1GTU A;  3Q74 A;  4ULX A;  1UN2 A;  5J41 A;  3Q18 A;  4G9H A;  5IMD A;  2EIO A;  2GLR A;  3F6F A;  2X8G A;  4EKZ A;  4BL7 A;  3DRN A;  4MH2 A;  4NHZ A;  4N0V A;  2LQQ A;  4FH8 A;  1U87 A;  1ZGN A;  1I5G A;  1DE2 A;  4NXI A;  4RI7 A;  3E3E A;  1G6Y A;  3ZMK A;  1B9X C;  1ZCP A;  3LSZ A;  5AIX A;  1V9W A;  1YEP A;  4ZL7 A;  4KAE A;  2TRX A;  3G9B A;  3F4S A;  2WRT A;  1TK8 B;  1NW2 A;  1EP8 A;  3BD2 A;  2IIY A;  1K3L A;  2LRN A;  5INY A;  2IWT A;  2GTU A;  4HQZ A;  1M9A A;  4K7I A;  1XFL A;  1GLP A;  1XIY A;  3LOR A;  4NHW A;  1TRW A;  3I43 A;  6GSS A;  2GGT A;  5AIV A;  2CX4 A;  3ZL5 A;  2FNO A;  4OFM A;  2VLU A;  4BWS A;  5ECS A;  2YZU A;  1R4W A;  1SD8 A;  4HJM A;  3UBK A;  3VLN A;  1YDK A;  4FYC A;  1F3A A;  4HEA 2;  1TK0 B;  1PKZ A;  4PQH A;  5LNK e;  2OBI A;  1SKW B;  5L71 A;  4TW5 A;  1VF4 A;  3EU4 A;  4ECC A;  2E0Q A;  3IE3 A;  1LJR A;  3F6D A;  3KEB A;  1H4O A;  2O89 A;  2CVD A;  1FHE A;  1QUW A;  5CRD A;  3TOT A;  1A23 A;  1GTA A;  17GS A;  3O3T A;  3GH9 A;  3LWA A;  2FD3 A;  5ECP B;  2H73 A;  3TKS A;  1THX A;  1VGL A;  2P0G A;  3MSZ A;  6GSU A;  2XHF A;  4KX4 A;  5F07 A;  1SK2 A;  1THO A;  3ERF A;  2BMX A;  5EY6 A;  2L59 A;  3EC3 A;  3ZIV A;  3TJK A;  3OR5 A;  1OAZ A;  5HQP A;  1FG4 A;  1X5E A;  2H1A A;  3US3 A;  1ST9 A;  1T7P B;  3FRC A;  5E59 A;  1Z3E A;  4IJ3 A;  4GQF A;  1K0B A;  1GUM A;  2K8S A;  4I2T A;  5JCU A;  3CSH A;  1B4Q A;  4MZB A;  3JCM L;  4TXV A;  1XCC A;  4OFN A;  4CHS A;  2BJX A;  3PR8 A;  5DJL A;  3MNG A;  3UL3 A;  3EMX A;  4IGJ A;  3VUR A;  2LV3 A;  1U3I A;  3FZA A;  3E9J B;  4XRD A;  4JZQ A;  2LUS A;  2KOK A;  5ECM B;  2FLS A;  1UC7 A;  2CVB A;  1EOG A;  1S3A A;  3DML A;  3EIN A;  2VM1 A;  2XBQ A;  3C71 A;  4NMU A;  1GNE A;  3QD9 A;  1JZW A;  2YNX A;  5EL8 A;  3QPM A;  1DSB A;  4EL1 A;  3FY7 A;  5ABR A;  2XBI A;  2DSA A;  3IDV A;  3DIE A;  3IR4 A;  6GST A;  1SK1 A;  1WIK A;  4P3Y B;  3KD0 A;  1GTI A;  1M2A A;  3GKM A;  2RM5 A;  3APQ A;  4DVC A;  2H0G A;  3IC4 A;  1E6B A;  3L9S A;  3HJM A;  2CAQ A;  1EOH A;  3MWH A;  5B7C A;  4LMV A;  5GST A;  3C8E A;  4AF2 A;  4ISD A;  4WF4 A;  3RBT A;  2P31 A;  2E7P A;  4F0C A;  4ACS A;  2DML A;  5D8I A;  1G6W A;  1X9S B;  1T4Z A;  2L5O A;  5ECI B;  4MAB A;  1V58 A;  4IHU A;  3FK8 A;  3C7M A;  4WR5 A;  3FR3 A;  2C3T A;  3IA1 A;  1SYX A;  3L9U A;  5ELA A;  4MK3 A;  2IJY A;  2VAF A;  4K2D A;  2J23 A;  1TRS A;  1PN9 A;  3ZRE A;  2R5G A;  1BX9 A;  4XS4 B;  2IMF A;  3DXB A;  3E0U A;  1WE0 A;  3A5W A;  1BED A;  1U88 A;  2WB9 A;  4CW9 A;  1K0N A;  2MMO A;  2HFD A;  1PL1 A;  3V1W A;  2AHE A;  1K0M A;  1O6J A;  2JSZ A;  3A2X A;  2OA7 A;  1FVJ A;  1JZO A;  1V2A A;  2HZE B;  2HNL A;  4MMM A;  3GTU B;  4POK A;  4BA7 A;  1U6T A;  1MDI A;  2O87 A;  2CT6 A;  5F0G A;  2GT6 A;  4MF6 A;  4PXO A;  3TB2 A;  2V41 A;  3LYP A;  2R37 A;  2B1K A;  19GS A;  3IV4 A;  3WGX A;  4MZW A;  1EGO A;  4IN0 A;  4J57 E;  5IMZ A;  3UMA A;  2H70 A;  3MAK A;  1T4Y A;  2HRN A;  4LMW A;  3SWL A;  4YQU A;  1RK4 A;  1V98 A;  3GYK A;  4DSS A;  1J0F A;  1G7O A;  2OAC A;  3GL5 A;  3RPP A;  2QGV A;  1YF1 A;  2YJ7 A;  2I81 A;  1BQ7 A;  2R2J A;  1V57 A;  2R4V A;  4KDU A;  4TR3 A;  3P2A A;  3LXZ A;  2NBS A;  1YJ6 A;  5CAX A;  1LBK A;  2MYG A;  1WJK A;  1M2B A;  3KZQ A;  2CQ9 A;  4GTU A;  1GSQ A;  2H6X A;  1B4P A;  4HS1 A;  1K3Y A;  2AV4 A;  2H71 A;  1A2L A;  3ZFB A;  3VK9 A;  1A8L A;  4FYU A;  3GIX A;  3LQ7 A;  3Q19 A;  4XRA A;  5IOW A;  3ISO A;  2GQK A;  4JR6 A;  1ZYE A;  4GWR A;  2LNS A;  1R5A A;  2B1L A;  5DDL A;  1SL0 B;  4MZC A;  1GSE A;  1HYU A;  1R7H A;  2E2G A;  2I4A A;  3DGQ A;  1M9B A;  1F3B A;  1YKC A;  4Q5R A;  4WF5 A;  3LG6 A;  3IK9 A;  3VPT A;  4DSS B;  2GZZ A;  3M8N A;  4O92 A;  1SJ6 A;  2Z9S A;  3P8W A;  2GZY A;  2YN1 A;  2REM A;  3DYR A;  3HXS A;  2QC7 A;  3HCZ A;  3IHQ A;  1B48 A;  4TRX A;  2FWF A;  5IOX A;  1HD2 A;  3HHV A;  3QCP A;  1OE8 A;  4TR4 A;  2I9H A;  2OE0 A;  2YWI A;  2YPM A;  2H30 A;  4ZXG A;  3WT2 A;  2GZP A;  2GDR A;  4EO3 A;  2X99 A;  2DJ0 A;  3BBY A;  5E4W A;  5AIS A;  4XS1 A;  2LRT A;  4F0B A;  4XHM A;  4IQA A;  4TN8 A;  4GSS A;  5GSS A;  3C1R A;  4MJC A;  3VI5 A;  1HNA A;  1YF0 A;  1EWX A;  5KN0 A;  3FZ5 A;  1O73 A;  1PX6 A;  4IKH A;  3EUR A;  3KJY A;  5DAL B;  2XC2 A;  3HVV A;  2IFQ B;  1TKD B;  5A4W A;  2N5A A;  4ZIL A;  3HZ4 A;  1URM A;  5D9T A;  1N2A A;  2B5E A;  4LLR A;  2H1D A;  3ZIJ A;  2KHP A;  4RI6 A;  1T00 A;  1MDK A;  1UA5 A;  5CRH A;  5HR3 A;  2VIM A;  4EUY A;  4PUA A;  2QKE A;  1A2M A;  1X9M B;  2A4V A;  3RPN A;  2IL3 A;  1TP9 A;  3VPQ A;  1WMJ A;  2NTO A;  8GSS A;  3KH9 A;  5DJM A;  3IOS A;  4O5R A;  2X8H A;  1F37 A;  3TKS E;  1GUL A;  4F9Z A;  4JE1 A;  2PER A;  3GST A;  18GS A;  2CX3 A;  3BOA A;  3M3M A;  5ID2 A;  3TUE A;  2OAD A;  4XS6 A;  5KN3 A;  4MP4 A;  2X8C A;  3UVT A;  1K0C A;  2CZ2 A;  2VL2 A;  3TGZ A;  3ZLP A;  2K6V A;  2DJ1 A;  2GST A;  1KNG A;  2MBS A;  1O8X A;  3GA4 A;  3ZVJ D;  2NVL A;  2CA8 A;  5DQS A;  5IMF A;  3N9J A;  1FB0 A;  3FEU A;  3HKR A;  2QSI A;  3VWV A;  3FZ4 A;  4L5O A;  2EIR A;  3ZYW A;  4MA9 A;  1GSF A;  1SKR B;  3LEF A;  3VI7 A;  3KP9 A;  5DCH A;  1TRU A;  5F05 A;  3UJ1 A;  3CTG A;  2B7K A;  3P90 A;  2MMN A;  1OC9 A;  4L8E A;  3GKX A;  3PGT A;  2P5R A;  2DJ2 A;  4IBP A;  4CDO A;  4KCA A;  2IPA A;  3TKS C;  3CSI A;  3BCK A;  3W8J A;  4POB A;  3I69 A;  3WD6 A;  1GSY A;  1EEJ A;  2YCD A;  4HZ2 A;  12GS A;  3WYW A;  4DSR A;  3IXR A;  3EWL A;  1PA3 A;  4RQR A;  20GS A;  3F0I A;  2PN8 A;  4TOP A;  3KTL A;  2RII A;  1Y25 A;  4MCU A;  4RUV A;  5DVB A;  1C72 A;  1JHB A;  3J7Y b;  3ERW A;  4GRF A;  5J9C A;  1AW9 A;  2K8V A;  2EC4 A;  1DBY A;  3M1G A;  5IIZ A;  2HT9 A;  4JRR A;  1XXU A;  1XW9 A;  1M2D A;  1Z9H A;  1OC9 B;  5G5E A;  4KE3 A;  2WZ9 A;  4KDY A;  5DBQ A;  4Z7X A;  1VF1 A;  3DD3 A;  4DSQ A;  5J4U A;  4POL A;  4N10 A;  1SK0 A;  4WEY A;  2VL3 A;  5G1K A;  1T3B A;  1GRX A;  4LL4 B;  5DAK A;  5ECL B;  4GXZ A;  1JFU A;  2ZUP A;  3CRT A;  4KH7 A;  1TXX A;  1V40 A;  5D9X A;  4NPB A;  5D9W A;  3BCI A;  5CYY A;  3GKN A;  1BAY A;  2YJH A;  1SL2 B;  3QMX A;  1GTB A;  1SKS B;  6GSY A;  4AJ6 A;  1VF3 A;  1GSD A;  2RUF A;  3L0H A;  4N30 A;  3VWX A;  2J9H A;  2GSR A;  4GQC A;  1UVZ A;  2AUV A;  4ZL8 A;  4PUF C;  2V6O A;  2VOC A;  5J3R A;  5CRG A;  1X9W B;  3ZIT A;  3HVX A;  5HR2 A;  1ZMA A;  2M72 A;  1K0D A;  4MLY A;  1PX7 A;  4ZB9 A;  4YAV A;  3KH7 A;  1R26 A;  4L0U A;  1MD4 A;  4D73 A;  4KA0 A;  5D73 A;  1TTZ A;  3TJJ A;  2HI7 A;  1VRS D;  4YQM A;  2YWM A;  4ECB A;  2ES7 A;  2C0F A;  1X5C A;  1XWG A;  3H4K A;  4K7N A;  4K1F A;  5D9V A;  2D2Z A;  4IP6 A;  2F8F A;  1X5D A;  5ECO B;  2E2M A;  2VUP A;  1PRX A;  2MMZ A;  2RUE A;  5JWR B;  1XBS A;  2JZS A;  4MF5 A;  1XPV A;  2HLS A;  1Z6N A;  4OMV A;  4POM A;  1AAZ A;  4ILF A;  4MH3 A;  2L4C A;  2R6K A;  3M9K A;  2A2S A;  2NDO A;  3FKF A;  4MF7 A;  1WRY A;  3D4T A;  1PL2 A;  2VCX A;  1XVW A;  1O85 A;  3GUR A;  1AC1 A;  2HZF A;  1TJD A;  2FWH A;  4GST A;  3GUS A;  2LNT A;  3L78 A;  3QFA C;  6GSX A;  1RW1 A;  2H0I A;  5IMV A;  2VD1 A;  1Z6M A;  6GSV A;  2V1M A;  1FAA A;  4KW6 A;  2FUG 2;  4I5Q A;  4OWY A;  2FCH A;  2N5F A;  2H1B A;  5IPG A;  5KEJ A;  5HFG A;  1GWC A;  3QAW A;  1WWJ A;  2C0D A;  2MMA A;  5IO2 A;  3F8U A;  2CAI A;  5AN1 A;  14GS A;  3IAM 2;  3CYN A;  3FYG A;  4MJE A;  1M7T A;  3D22 A;  5H5S A;  4PQI A;  4V2L A;  2DLX A;  3F4T A;  2OE3 A;  1G0T A;  2HYX A;  1M0U A;  4JBB A;  3FR6 A;  3TKP A;  4WR4 A;  3O76 A;  4KSO A;  2PVQ A;  4N0Z A;  1A2J A;  3GNJ A;  2K9F A;  4ID0 A;  1F6M C;  2H8L A;  5CRE A;  1QK8 A;  5EPF A;  1YEX A;  1ERU A;  2TRC P;  1PSQ A;  1OC8 A;  2C1Y A;  2WDU A;  4QL9 A;  2EIQ A;  5FHI A;  5A4U A;  3AY8 A;  2JL4 A;  2O8V B;  3D6I A;  2DBC A;  3M0F A;  2H01 A;  4QQ7 A;  5HR0 A;  1EGR A;  1ZOF A;  1GUK A;  2VLV A;  4Q5F A;  2HRF A;  1EP7 A;  4H86 A;  2WUL A;  4MDC A;  4V1A g;  5IM9 A;  10GS A;  1TU8 A;  2GVP A;  2LTK A;  4YH2 A;  3EE2 A;  4FIW A;  3KXO A;  1ACV A;  1A8Y A;  1QXH A;  3S9F A;  3VWU A;  4I2U A;  1XOA A;  1RQM A;  1BG5 A;  3KMN A;  13GS A;  3WT1 A;  5JCG A;  2DMM A;  4ZB6 A;  4HU7 A;  3GX0 A;  5G30 A;  1BYE A;  2YP6 A;  1MDJ A;  2WCI A;  1GUH A;  1OVN A;  1G7E A;  2FWG A;  2C3N A;  2CVK A;  4NAX A;  2BTO T;  3ED3 A;  1YZX A;  2PU9 C;  4F82 A;  2ON7 A;  2O85 A;  2XPE A;  4FYB A;  3EVI A;  1TI3 A;  4MJB A;  1ZYQ B;  1FVK A;  2L6C A;  3QAG A;  1ZL9 A;  4LA1 A;  4TR1 A;  1F2E A;  4OD7 A;  2B5X A;  3GL3 A;  2B3S A;  2F51 A;  2LJK A;  4G19 A;  5C00 A;  3DVW A;  3LJR A;  2YOI A;  2LQO A;  5G5F A;  4KB3 A;  4ECI A;  6GSW A;  2DJ3 A;  1ILO A;  3ME7 A;  5LCZ A;  2CV4 A;  1ML6 A;  3W6G A;  3MDK A;  1EEM A;  3K8N A;  2GSQ A;  3IK7 A;  4KGI A;  3GRX A;  2VD0 A;  3TOU A;  1W4V A;  4HDE A;  1Z7R A;  2FWE A;  3VFI A;  2GS3 A;  3KCM A;  4JED A;  2H75 A;  4PX1 A;  4OCF A;  3GHA A;  4J2F A;  5ECH B;  4OFT A;  1QQ2 A;  2IMK A;  4K0G A;  1EV9 A;  3KM6 A;  5IQY A;  1TK5 B;  5GZZ B;  2P5Q A;  4LL1 B;  1K0O A;  1TU7 A;  2H66 A;  3M9J A;  4TR1 B;  2GQM A;  4WET A;  1SL1 B;  1YQ1 A;  2M80 A;  3D21 A;  3SBC A;  2DC5 A;  2AJQ B;  2PVO C;  1XZO A;  2C0E A;  2JAD A;  5A5K A;  5DCG A;  3H79 A;  5GAP D;  2VCQ A;  3EU3 A;  4EVM A;  3HJO A;  2PWJ A;  1WOU A;  4AGS A;  2YV7 A;  4EE0 A;  1CQG A;  5JWQ B;  2FGX A;  4V2M A;  1ABA A;  3NZN A;  1TW9 A;  1XVQ A;  4HI7 A;  2V32 A;  1HQO A;  3G7J A;  4EXJ A;  2G0F A;  3RDW A;  2F9S A;  2LRC A;  4KDX A;  5H5R A;  2YZH A;  5ECR B;  1SJZ A;  4KUN A;  4EF0 A;  3HDC A;  4K7O A;  1PKW A;  2O7K A;  2GQL A;  3TDG A;  1PQN A;  2XPD A;  1XWC A;  3NIV A;  1SEN A;  4HJ2 A;  1OC3 A;  2OKA A;  2C80 A;  3DKS A;  4OCE A;  3VWW A;  3TJG A;  5ECK B;  5G31 A;  3O6T A;  3FW2 A;  1N8J A;  5CO3 A;  1S3D A;  2ALB A;  3Q6O A;  5C04 A;  2YWN A;  4L5L A;  4O7H A;  1HNC A;  3CRU A;  3APS A;  4IP1 A;  5ID2 B;  3C1S A;  2OJL A;  1DE1 A;  1XW6 A;  1AUC A;  4PGT A;  1F9M A;  1GLQ A;  3D5J A;  3ZTL A;  5FWG A;  5J9B A;  3F4R A;  1EV4 A;  4BWQ A;  1XOB A;  1O7U A;  1ZZY A;  2H19 A;  2YV9 A;  4G10 A;  1TOF A;  1XWB A;  5HFK A;  1QMV A;  2FA8 A;  4K0N A;  2VLT A;  1AQV A;  1KBN A;  1CQH A;  2MZC A;  2I1U A;  2H1G A;  3BJ5 A;  2PMT A;  4OO4 A;  1E2Y A;  3QOU A;  3GSS A;  1MD3 A;  1SYR A;  1AXD A;  2RLI A;  4ZBD A;  2WGR A;  4ZB8 A;  4WBJ A;  1FO5 A;  2NPB A;  3C73 A;  4K6X A;  4MJA A;  4X0X A;  2YAN A;  2K18 A;  5JWO B;  2JZT A;  3QR6 A;  4RQX A;  2B6M A;  2ON5 A;  2PUK C;  3GV1 A;  2JU5 A;  1BJX A;  2L5L A;  3WGE A;  4HOJ A;  4EDY A;  2DIY A;  2WS2 A;  5A4V A;  4EC0 A;  4X43 A;  5ENU A;  3N5O A;  3GH6 A;  4TKY A;  1TDI A;  2YWO A;  4I97 A;  4Q5Q A;  2N5B A;  1NHO A;  1TRV A;  2VCV A;  3H8Q A;  2JAC A;  2AYT A;  4L0W A;  3UIW A;  1AQX A;  3TRP A;  2FY6 A;  3UAP A;  3F3R A;  1OYJ A;  3FZ9 A;  3ZZX A;  1A24 A;  5CP1 A;  4HZ4 A;  4IS0 A;  4HU9 A;  1I9D A;  3P7X A;  5DAK B;  4K9Z A;  4OO5 A;  4PNF A;  1JLV A;  1KTE A;  4GF0 A;  2R3X A;  1T8E B;  2LJR A;  2PGT A;  5JCW A;  3HYP A;  2LEG A;  3R2Q A;  1NM3 A;  3H1N A;  2DJK A;  4TR0 A;  3TCO A;  2X64 A;  1M99 A;  4KND A;  5J5N A;  5COH A;  2C4J A;  2VM2 A;  2L6D A;  2H6Z A;  2DJJ A;  2H72 A;  5HFI A;  5G1L A;  3IBH A;  4I6X A;  2RM6 A;  2HSY A;  2V6K A;  4XS4 A;  4KSM A;  2I3Y A;  4MPF A;  9GSS A;  4HUA A;  2PPT A;  5ECQ B;  4WBR D;  2WJU A;  3APO A;  5ECN B;  2V2G A;  1Z5Y E;  2LKU A;  4D73 B;  2HZE A;  2KUC A;  1VF2 A;  2GSS A;  2MBT A;  1U3A A;  3GTU A;  1YY7 A;  1B9Y C;  1IYI A;  4TXO A;  3HD5 A;  1Y6E A;  2VO4 A;  3CXG A;  2FHE A;  4K8M A;  1WP0 A;  3I6A A;  2DIZ A;  3GMF A;  4IJI A;  3QDN A;  5IO0 A;  3U5R E;  1B8X A;  4QL7 A;  1XW5 A;  3TKR A;  3PIN A;  3FR9 A;  3TJF A; 
#chains in the Genus database with same CATH topology
 2ZNM A;  2B7J A;  4X1U A;  4GSN A;  5IMA A;  5GAN D;  1TI1 A;  2AB6 A;  3QFB C;  2AAW A;  5ELG A;  2HSH A;  4IQ1 A;  16GS A;  4G2E A;  3QAV A;  1LU4 A;  5IMC A;  2HRA A;  3HA9 A;  2GT5 A;  4ZBA A;  3W8S A;  1FB6 A;  2KLX A;  2B5Y A;  5D96 A;  3TKQ A;  4IEL A;  4ECJ A;  3RHC A;  4F03 A;  3CTF A;  3KGK A;  1OKT A;  2OBK A;  1KEB A;  1JZD A;  3G7I A;  1X0R A;  1DUG A;  5B8B A;  4TXO B;  1OE7 A;  2VCZ A;  2IMD A;  2L57 A;  2G2Q A;  1FOV A;  4TVE A;  1K0A A;  2JZR A;  5H5Q A;  3F3Q A;  3UAR A;  2VCT A;  4E8H A;  1GSU A;  5KN1 A;  1QFN A;  5EVO A;  1IYH A;  5FT3 A;  3EYT A;  4XCS A;  1JLW A;  1PFO A;  3D0Z A;  4JU5 A;  2KP1 A;  4IVF A;  2QA1 A;  1WPI A;  3ERG A;  5F8B A;  1W89 A;  1O81 A;  2KP2 A;  2H74 A;  3TJB A;  2WFC A;  3H93 A;  3UBL A;  2H0H A;  1MEK A;  2H6Y A;  2TIR A;  4XIH A;  2LS5 A;  4O32 A;  1GSS A;  3ME8 A;  3G7Y A;  4JR4 A;  3J7Y k;  3DVX A;  4AJ7 A;  1FW1 A;  4NV5 A;  1NHY A;  5DQY A;  4NV2 A;  4F2I A;  3ZRD A;  2ZCT A;  4XTS A;  4ZBB A;  2LJA A;  3HY2 A;  1XWA A;  4I8B A;  4YQV A;  2FA4 A;  2IME A;  5G2Z A;  1Q98 A;  4E8E A;  2LST A;  4Z2T A;  2F8A A;  4V2N A;  2H76 A;  2VL9 A;  3ZML A;  1EZK A;  1XWK A;  1GH2 A;  3IAS 2;  1MTC A;  2F3M A;  3CMI A;  3CQF A;  4WXT A;  4YAP A;  1ERW A;  5D93 A;  1PMT A;  2IMI A;  1GP1 A;  1XG8 A;  1AIU A;  4WKW A;  3GFK A;  3RHB A;  22GS A;  3D4M A;  5B6N A;  1JZR A;  1PGT A;  1A0R P;  5DAL A;  4BVX A;  3UEM A;  2IFQ A;  4DEJ A;  4AJ8 A;  4KCE A;  4HQS A;  5CNW A;  5B8A A;  5HR1 A;  3TRQ A;  1K3O A;  2M46 A;  4PQ1 A;  3HVS A;  1R5P A;  11GS A;  3F9U A;  3LYK A;  1ERV A;  1Q4J A;  3L4N A;  2VCW A;  4GCI A;  3NOF A;  3HJP A;  1NSW A;  1ERT A;  4IW9 A;  4ML1 A;  4PUR A;  2C0G A;  2C8U A;  4HSC X;  1AQW A;  3DWV A;  3LFL A;  3U6V A;  1J08 A;  3GKK A;  2VL2 C;  2HXK A;  1SJI A;  3UOM A;  2JSY A;  4ML6 A;  4BVY A;  5AGY A;  2OE1 A;  7GSS A;  1GL8 A;  3LXT A;  1J9B A;  3GX8 A;  5F06 A;  3IPZ A;  2PBJ A;  2HSM A;  2IN3 A;  3EMP A;  4ZL9 A;  4N11 A;  3A2V A;  4NWY A;  1Z7P A;  4BPY A;  3L9V A;  2CZ3 A;  3KIJ A;  3KP8 A;  1SU9 A;  5KN2 A;  3WGD A;  1S3C A;  2L4Q A;  3PH9 A;  1YKA A;  1H75 A;  4V1A p;  3A2W A;  3KTB A;  1HNB A;  1OKD A;  3DEX A;  4EDZ A;  2X49 A;  3F63 A;  3LGC A;  3TRX A;  4MPG A;  4J56 E;  3RAZ A;  1ON4 A;  3HZ8 A;  3CSJ A;  3IRA A;  3I9V 2;  1A0F A;  4GLT A;  3FHK A;  3UVH A;  1SD9 A;  5CRW A;  3KMO A;  5IPH A;  3ZFL A;  3GN3 A;  5B6M A;  4FO5 A;  1GNW A;  1QGV A;  2A2R A;  1PD2 1;  4PNG A;  3CBU A;  2HE3 A;  4ZIJ A;  3ZVJ A;  5LD0 A;  1T1V A;  1USB A;  1O8W A;  4Q5N A;  2C3Q A;  3IC8 A;  3A3T A;  1GTU A;  3Q74 A;  4ULX A;  1UN2 A;  5J41 A;  3Q18 A;  1FOH A;  4G9H A;  5IMD A;  2EIO A;  2GLR A;  3F6F A;  3EPT A;  2X8G A;  4EKZ A;  4BL7 A;  3DRN A;  4MH2 A;  4NHZ A;  3A5I A;  4N0V A;  2LQQ A;  4FH8 A;  1U87 A;  1ZGN A;  1I5G A;  1DE2 A;  4NXI A;  4RI7 A;  3E3E A;  1G6Y A;  3ZMK A;  1B9X C;  1ZCP A;  3LSZ A;  5AIX A;  1V9W A;  1YEP A;  4ZL7 A;  4KAE A;  2TRX A;  3G9B A;  3F4S A;  2WRT A;  1TK8 B;  1NW2 A;  1EP8 A;  3BD2 A;  2IIY A;  1K3L A;  2LRN A;  5INY A;  2IWT A;  2GTU A;  4HQZ A;  1M9A A;  4K7I A;  1XFL A;  1GLP A;  1XIY A;  3LOR A;  4NHW A;  1TRW A;  3I43 A;  6GSS A;  2GGT A;  5AIV A;  2CX4 A;  3ZL5 A;  2FNO A;  4OFM A;  3HVN A;  2VLU A;  4BL7 B;  4BWS A;  5ECS A;  2YZU A;  1R4W A;  1SD8 A;  4HJM A;  4K5S A;  3UBK A;  3VLN A;  1YDK A;  4FYC A;  1F3A A;  4HEA 2;  1TK0 B;  1PKZ A;  4PQH A;  5LNK e;  2OBI A;  1SKW B;  5L71 A;  4TW5 A;  1VF4 A;  3EU4 A;  4ECC A;  2E0Q A;  3IE3 A;  1LJR A;  3F6D A;  3KEB A;  1H4O A;  2O89 A;  2CVD A;  4FQU A;  1FHE A;  1QUW A;  5CRD A;  3TOT A;  1A23 A;  1GTA A;  17GS A;  3O3T A;  3GH9 A;  3LWA A;  2FD3 A;  5ECP B;  2H73 A;  3TKS A;  1THX A;  1VGL A;  2P0G A;  3MSZ A;  6GSU A;  2XHF A;  4KX4 A;  5F07 A;  1SK2 A;  1THO A;  3ERF A;  2BMX A;  5EY6 A;  2L59 A;  4A5P A;  3EC3 A;  3ZIV A;  3MYD A;  3TJK A;  3OR5 A;  1OAZ A;  5HQP A;  4YKF A;  1FG4 A;  1X5E A;  2H1A A;  3US3 A;  1ST9 A;  1T7P B;  3FRC A;  5E59 A;  1Z3E A;  4IJ3 A;  4GQF A;  5BRT A;  1K0B A;  1GUM A;  4O5Q A;  2K8S A;  4I2T A;  5JCU A;  3CSH A;  1B4Q A;  4MZB A;  3JCM L;  4TXV A;  1XCC A;  4OFN A;  4CHS A;  2BJX A;  3PR8 A;  5DJL A;  3MNG A;  3UL3 A;  3EMX A;  4IGJ A;  3VUR A;  2LV3 A;  1U3I A;  3FZA A;  3E9J B;  4XRD A;  4JZQ A;  2LUS A;  2KOK A;  5ECM B;  2FLS A;  1UC7 A;  2CVB A;  1EOG A;  1S3A A;  3DML A;  3EIN A;  2VM1 A;  2XBQ A;  3C71 A;  4NMU A;  1GNE A;  3QD9 A;  1JZW A;  2YNX A;  5EL8 A;  3QPM A;  1DSB A;  4EL1 A;  3FY7 A;  5ABR A;  2XBI A;  2DSA A;  3IDV A;  3DIE A;  3IR4 A;  6GST A;  1SK1 A;  1WIK A;  4P3Y B;  3KD0 A;  1GTI A;  1M2A A;  3GKM A;  2RM5 A;  4G0I A;  3APQ A;  4DVC A;  2H0G A;  3IC4 A;  1E6B A;  3L9S A;  3HJM A;  2CAQ A;  1EOH A;  3MWH A;  5B7C A;  4LMV A;  5GST A;  3C8E A;  4AF2 A;  4ISD A;  4WF4 A;  3RBT A;  2P31 A;  2E7P A;  4F0C A;  4ACS A;  2DML A;  5D8I A;  1G6W A;  1X9S B;  1T4Z A;  2L5O A;  5ECI B;  4MAB A;  1V58 A;  4IHU A;  3FK8 A;  3C7M A;  2A4H A;  4WR5 A;  3FR3 A;  2C3T A;  3IA1 A;  1SYX A;  2X4A A;  3L9U A;  5ELA A;  4MK3 A;  2IJY A;  2VAF A;  4K2D A;  2J23 A;  1TRS A;  1PN9 A;  3ZRE A;  2R5G A;  1BX9 A;  4XS4 B;  2IMF A;  3DXB A;  3E0U A;  1WE0 A;  3A5W A;  1BED A;  1U88 A;  2WB9 A;  4CW9 A;  1K0N A;  2MMO A;  2HFD A;  1PL1 A;  3V1W A;  2AHE A;  1K0M A;  1O6J A;  2JSZ A;  3A2X A;  2OA7 A;  1FVJ A;  1JZO A;  1V2A A;  2HZE B;  2HNL A;  4MMM A;  3GTU B;  4POK A;  4BA7 A;  1U6T A;  1MDI A;  2O87 A;  2CT6 A;  5F0G A;  2GT6 A;  4MF6 A;  4PXO A;  3TB2 A;  2V41 A;  3LYP A;  2R37 A;  2B1K A;  19GS A;  3IV4 A;  3WGX A;  4MZW A;  1EGO A;  4IN0 A;  4J57 E;  5IMZ A;  3UMA A;  2H70 A;  3MAK A;  1T4Y A;  2HRN A;  4LMW A;  3SWL A;  4YQU A;  1RK4 A;  1V98 A;  3GYK A;  4DSS A;  1J0F A;  1G7O A;  2OAC A;  3GL5 A;  3RPP A;  2QGV A;  1YF1 A;  2YJ7 A;  2UZ8 A;  2I81 A;  1BQ7 A;  2R2J A;  1V57 A;  2R4V A;  4KDU A;  4TR3 A;  3P2A A;  3LXZ A;  2NBS A;  1YJ6 A;  5CAX A;  1LBK A;  2MYG A;  5BMU A;  1WJK A;  1M2B A;  3KZQ A;  4BIK A;  2CQ9 A;  4GTU A;  1GSQ A;  2H6X A;  1B4P A;  4HS1 A;  1K3Y A;  2AV4 A;  2H71 A;  1A2L A;  3ZFB A;  3VK9 A;  1A8L A;  4FYU A;  4EIP A;  3GIX A;  3LQ7 A;  3Q19 A;  4XRA A;  5IOW A;  3ISO A;  2GQK A;  4JR6 A;  1ZYE A;  4GWR A;  2LNS A;  1R5A A;  2B1L A;  5DDL A;  1SL0 B;  4MZC A;  1GSE A;  1HYU A;  1R7H A;  2E2G A;  2I4A A;  3DGQ A;  1M9B A;  1F3B A;  1YKC A;  4Q5R A;  4WF5 A;  3LG6 A;  3IK9 A;  3VPT A;  4DSS B;  2GZZ A;  3M8N A;  4O92 A;  1SJ6 A;  2Z9S A;  3P8W A;  2GZY A;  2YN1 A;  2REM A;  3DYR A;  3HXS A;  2QC7 A;  3HCZ A;  3IHQ A;  1B48 A;  4TRX A;  2FWF A;  5IOX A;  1HD2 A;  3HHV A;  3QCP A;  1OE8 A;  4TR4 A;  2I9H A;  2OE0 A;  2YWI A;  2YPM A;  2H30 A;  4ZXG A;  3WT2 A;  2GZP A;  2GDR A;  4EO3 A;  2X99 A;  2DJ0 A;  3BBY A;  5E4W A;  5AIS A;  4XS1 A;  2LRT A;  4F0B A;  4XHM A;  4IQA A;  4TN8 A;  4GSS A;  5GSS A;  3C1R A;  4MJC A;  3VI5 A;  1HNA A;  1YF0 A;  1EWX A;  5KN0 A;  3FZ5 A;  1O73 A;  1PX6 A;  4IKH A;  3EUR A;  3KJY A;  5DAL B;  4BVX B;  2XC2 A;  3HVV A;  2IFQ B;  1TKD B;  5A4W A;  2N5A A;  4ZIL A;  3HZ4 A;  1URM A;  5D9T A;  4PTS A;  1N2A A;  2B5E A;  4LLR A;  2H1D A;  3ZIJ A;  2KHP A;  4Z2R A;  4RI6 A;  1PN0 A;  1T00 A;  1MDK A;  1UA5 A;  5CRH A;  5HR3 A;  2VIM A;  4EUY A;  4PUA A;  2QKE A;  1A2M A;  1X9M B;  2A4V A;  3RPN A;  2IL3 A;  1TP9 A;  3VPQ A;  4BVY B;  1WMJ A;  2NTO A;  8GSS A;  3KH9 A;  5DJM A;  3IOS A;  4O5R A;  2X8H A;  1F37 A;  3TKS E;  1GUL A;  4F9Z A;  4JE1 A;  2PER A;  3GST A;  18GS A;  2CX3 A;  3BOA A;  3M3M A;  5ID2 A;  3TUE A;  2OAD A;  4XS6 A;  5KN3 A;  4MP4 A;  2X8C A;  3UVT A;  1K0C A;  2CZ2 A;  2VL2 A;  3TGZ A;  4Z2U A;  3ZLP A;  2K6V A;  2DJ1 A;  2GST A;  1KNG A;  2MBS A;  1O8X A;  3GA4 A;  3ZVJ D;  2NVL A;  2CA8 A;  4CY6 A;  5DQS A;  5IMF A;  5KOX A;  3N9J A;  1FB0 A;  3FEU A;  3HKR A;  2QSI A;  3VWV A;  3FZ4 A;  4L5O A;  2EIR A;  3ZYW A;  4MA9 A;  1GSF A;  4ICY A;  1SKR B;  3LEF A;  3VI7 A;  3KP9 A;  5DCH A;  1TRU A;  5F05 A;  3UJ1 A;  3CTG A;  2B7K A;  3P90 A;  2MMN A;  1OC9 A;  4L8E A;  3GKX A;  3PGT A;  2P5R A;  2DJ2 A;  4IBP A;  4CDO A;  4KCA A;  2IPA A;  3TKS C;  3CSI A;  3BCK A;  3W8J A;  4POB A;  3I69 A;  3WD6 A;  1GSY A;  1EEJ A;  2YCD A;  4HZ2 A;  12GS A;  3WYW A;  4DSR A;  3IXR A;  3EWL A;  1PA3 A;  4RQR A;  20GS A;  3F0I A;  2PN8 A;  4TOP A;  3KTL A;  2RII A;  1Y25 A;  4MCU A;  4RUV A;  5DVB A;  1C72 A;  1JHB A;  2A2P A;  3J7Y b;  3ERW A;  4GRF A;  5J9C A;  1AW9 A;  2K8V A;  2EC4 A;  1DBY A;  3M1G A;  5IIZ A;  2HT9 A;  4JRR A;  1XXU A;  1XW9 A;  1M2D A;  1Z9H A;  1OC9 B;  5G5E A;  4KE3 A;  2WZ9 A;  4KDY A;  5DBQ A;  4Z7X A;  1VF1 A;  3DD3 A;  4DSQ A;  5J4U A;  4POL A;  4N10 A;  1SK0 A;  4WEY A;  2VL3 A;  5G1K A;  1T3B A;  1GRX A;  4LL4 B;  5DAK A;  5ECL B;  4GXZ A;  1JFU A;  2ZUP A;  3CRT A;  4KH7 A;  1TXX A;  1V40 A;  5D9X A;  4NPB A;  5D9W A;  3BCI A;  5CYY A;  3GKN A;  1BAY A;  2YJH A;  1SL2 B;  3QMX A;  1GTB A;  1SKS B;  6GSY A;  4AJ6 A;  1VF3 A;  4X4J A;  1GSD A;  2RUF A;  3L0H A;  4N30 A;  3VWX A;  2J9H A;  2GSR A;  1ZYN A;  4GQC A;  1UVZ A;  2AUV A;  4ZL8 A;  4PUF C;  2V6O A;  2VOC A;  5J3R A;  5CRG A;  1X9W B;  3ZIT A;  3HVX A;  5HR2 A;  1ZMA A;  2M72 A;  1K0D A;  4MLY A;  1PX7 A;  4ZB9 A;  4YAV A;  3KH7 A;  1R26 A;  4L0U A;  1MD4 A;  4D73 A;  4KA0 A;  5D73 A;  1TTZ A;  3TJJ A;  2HI7 A;  1VRS D;  4YQM A;  2R0P A;  2YWM A;  4ECB A;  2ES7 A;  2C0F A;  1X5C A;  1XWG A;  1S3R A;  3H4K A;  4K7N A;  4K1F A;  5D9V A;  2D2Z A;  4IP6 A;  2F8F A;  1X5D A;  5ECO B;  2E2M A;  2VUP A;  1PRX A;  2MMZ A;  2RUE A;  5JWR B;  1XBS A;  2JZS A;  4MF5 A;  1XPV A;  2HLS A;  1Z6N A;  4OMV A;  4POM A;  1AAZ A;  4ILF A;  4MH3 A;  2L4C A;  2R6K A;  3R3E A;  3M9K A;  2A2S A;  2NDO A;  3FKF A;  4MF7 A;  1WRY A;  3D4T A;  1PL2 A;  2VCX A;  1XVW A;  1O85 A;  3GUR A;  1AC1 A;  2HZF A;  1TJD A;  1ZYP A;  2FWH A;  4GST A;  3GUS A;  2LNT A;  3L78 A;  3QFA C;  6GSX A;  1RW1 A;  2H0I A;  5IMV A;  2VD1 A;  1Z6M A;  6GSV A;  2V1M A;  1FAA A;  4KW6 A;  2FUG 2;  4I5Q A;  4OWY A;  2FCH A;  2N5F A;  2H1B A;  5IPG A;  5KEJ A;  5KOW A;  5HFG A;  1GWC A;  3QAW A;  1WWJ A;  2C0D A;  2MMA A;  5IO2 A;  3F8U A;  2CAI A;  5AN1 A;  14GS A;  3IAM 2;  3CYN A;  3FYG A;  4MJE A;  1M7T A;  3D22 A;  5H5S A;  4PQI A;  4V2L A;  2DLX A;  3F4T A;  2OE3 A;  1G0T A;  2HYX A;  1M0U A;  1M3I A;  4JBB A;  3FR6 A;  3TKP A;  4WR4 A;  3O76 A;  4KSO A;  2PVQ A;  4N0Z A;  1A2J A;  3GNJ A;  2K9F A;  4ID0 A;  1F6M C;  2H8L A;  5CRE A;  1QK8 A;  5EPF A;  1YEX A;  1ERU A;  2TRC P;  1PSQ A;  1OC8 A;  2QA2 A;  2C1Y A;  2WDU A;  4QL9 A;  2DKI A;  2EIQ A;  5FHI A;  5A4U A;  3AY8 A;  2JL4 A;  2O8V B;  3D6I A;  2DBC A;  3M0F A;  2H01 A;  4QQ7 A;  5HR0 A;  1EGR A;  1ZOF A;  4K2X A;  1GUK A;  2VLV A;  4Q5F A;  2HRF A;  1EP7 A;  4H86 A;  2WUL A;  4MDC A;  4V1A g;  5IM9 A;  10GS A;  1TU8 A;  2GVP A;  2LTK A;  4YH2 A;  3EE2 A;  4FIW A;  3KXO A;  1ACV A;  1A8Y A;  1QXH A;  3S9F A;  3VWU A;  4I2U A;  1XOA A;  1RQM A;  1BG5 A;  3KMN A;  13GS A;  3WT1 A;  5JCG A;  2DMM A;  4ZB6 A;  4HU7 A;  3GX0 A;  5G30 A;  1BYE A;  2YP6 A;  1MDJ A;  2WCI A;  4K5R A;  1GUH A;  1OVN A;  1G7E A;  2FWG A;  2C3N A;  2CVK A;  4NAX A;  2BTO T;  3ED3 A;  1YZX A;  2PU9 C;  4F82 A;  2ON7 A;  2O85 A;  2XPE A;  4FYB A;  3EVI A;  1TI3 A;  4MJB A;  1ZYQ B;  1FVK A;  2L6C A;  4YKG A;  3QAG A;  1ZL9 A;  4LA1 A;  4TR1 A;  1F2E A;  4OD7 A;  2B5X A;  3GL3 A;  2B3S A;  2F51 A;  2LJK A;  4G19 A;  5C00 A;  3DVW A;  3LJR A;  2YOI A;  2LQO A;  5G5F A;  4KB3 A;  4ECI A;  6GSW A;  2DJ3 A;  1ILO A;  3ME7 A;  5LCZ A;  2CV4 A;  4MNN A;  1ML6 A;  3W6G A;  3MDK A;  1EEM A;  3K8N A;  2GSQ A;  4G0L A;  2HRK A;  3IK7 A;  4KGI A;  3GRX A;  2VD0 A;  3TOU A;  1W4V A;  4HDE A;  1Z7R A;  2FWE A;  3VFI A;  2GS3 A;  3PPU A;  3KCM A;  4JED A;  2H75 A;  4PX1 A;  4OCF A;  3GHA A;  4J2F A;  5ECH B;  4OFT A;  1QQ2 A;  2IMK A;  4K0G A;  1EV9 A;  3KM6 A;  5IQY A;  1TK5 B;  5GZZ B;  2P5Q A;  4LL1 B;  1K0O A;  1TU7 A;  2H66 A;  3M9J A;  4TR1 B;  2GQM A;  4WET A;  1SL1 B;  1YQ1 A;  2M80 A;  3D21 A;  4G0K A;  3SBC A;  2DC5 A;  2AJQ B;  2PVO C;  1XZO A;  2C0E A;  2JAD A;  5A5K A;  5DCG A;  3H79 A;  5GAP D;  2VCQ A;  3EU3 A;  4EVM A;  3HJO A;  2PWJ A;  1WOU A;  4AGS A;  2YV7 A;  4EE0 A;  1CQG A;  5JWQ B;  2FGX A;  4V2M A;  1ABA A;  3NZN A;  1TW9 A;  1XVQ A;  4HI7 A;  2V32 A;  1HQO A;  3G7J A;  4EXJ A;  2G0F A;  3RDW A;  2F9S A;  2LRC A;  4KDX A;  5H5R A;  2YZH A;  5ECR B;  2R0G A;  1SJZ A;  4KUN A;  4EF0 A;  3HDC A;  4K7O A;  1PKW A;  2O7K A;  2GQL A;  3TDG A;  1PQN A;  2XPD A;  1XWC A;  3NIV A;  1SEN A;  4HJ2 A;  1OC3 A;  2OKA A;  2C80 A;  3DKS A;  4OCE A;  3VWW A;  3TJG A;  5ECK B;  5G31 A;  3O6T A;  3FW2 A;  2R0C A;  1N8J A;  5CO3 A;  1S3D A;  2ALB A;  3Q6O A;  5C04 A;  2YWN A;  4L5L A;  4O7H A;  1HNC A;  3CRU A;  3APS A;  4IP1 A;  5ID2 B;  3C1S A;  2OJL A;  1DE1 A;  1XW6 A;  1AUC A;  4PGT A;  1F9M A;  1GLQ A;  3D5J A;  3ZTL A;  5FWG A;  5J9B A;  4KF9 A;  4O5U A;  4CY8 A;  3F4R A;  1EV4 A;  4BWQ A;  1XOB A;  1O7U A;  1ZZY A;  2H19 A;  2YV9 A;  4G10 A;  3FMW A;  1TOF A;  1XWB A;  5HFK A;  1QMV A;  2FA8 A;  4K0N A;  2VLT A;  1AQV A;  1KBN A;  1CQH A;  2MZC A;  2I1U A;  2H1G A;  3BJ5 A;  2PMT A;  4OO4 A;  1E2Y A;  3QOU A;  3GSS A;  1MD3 A;  1SYR A;  1AXD A;  2RLI A;  4ZBD A;  2WGR A;  4ZB8 A;  4WBJ A;  1FO5 A;  2NPB A;  3C73 A;  4K6X A;  4MJA A;  3MIX A;  4USS A;  4X0X A;  2YAN A;  2K18 A;  5JWO B;  2JZT A;  3QR6 A;  4RQX A;  2B6M A;  2ON5 A;  2PUK C;  3GV1 A;  2JU5 A;  1BJX A;  2L5L A;  3WGE A;  4HOJ A;  4EDY A;  2DIY A;  2WS2 A;  3IHG A;  5A4V A;  4EC0 A;  4X43 A;  5ENU A;  3N5O A;  3GH6 A;  4TKY A;  1TDI A;  2YWO A;  2DKH A;  4I97 A;  4Q5Q A;  2N5B A;  1NHO A;  1TRV A;  2VCV A;  3H8Q A;  2JAC A;  2AYT A;  4L0W A;  3UIW A;  1AQX A;  3TRP A;  2FY6 A;  3UAP A;  3F3R A;  1OYJ A;  3FZ9 A;  3ZZX A;  1A24 A;  5CP1 A;  4HZ4 A;  4IS0 A;  4HU9 A;  1M3J A;  1I9D A;  3P7X A;  4EIQ A;  5DAK B;  4K9Z A;  4OO5 A;  4PNF A;  1JLV A;  1KTE A;  4GF0 A;  2R3X A;  1T8E B;  2LJR A;  2PGT A;  5JCW A;  3HYP A;  2LEG A;  3R2Q A;  1NM3 A;  3H1N A;  2DJK A;  4TR0 A;  3TCO A;  2X64 A;  1M99 A;  4KND A;  5J5N A;  5COH A;  2C4J A;  2VM2 A;  2L6D A;  2H6Z A;  2DJJ A;  2H72 A;  5HFI A;  5G1L A;  3IBH A;  4I6X A;  2RM6 A;  2HSY A;  2V6K A;  4XS4 A;  4KSM A;  2I3Y A;  4MPF A;  9GSS A;  4HUA A;  2PPT A;  5ECQ B;  4WBR D;  2WJU A;  3APO A;  5ECN B;  2V2G A;  3LW9 A;  1Z5Y E;  2LKU A;  4D73 B;  2HZE A;  2KUC A;  1VF2 A;  2GSS A;  2MBT A;  1U3A A;  3GTU A;  1YY7 A;  1B9Y C;  1IYI A;  4TXO A;  3HD5 A;  1Y6E A;  2VO4 A;  3CXG A;  2FHE A;  4K8M A;  1WP0 A;  3I6A A;  2DIZ A;  3GMF A;  4IJI A;  3QDN A;  5IO0 A;  3U5R E;  1B8X A;  4QL7 A;  1XW5 A;  3TKR A;  3PIN A;  3FR9 A;  3TJF A; 
#chains in the Genus database with same CATH homology
 2ZNM A;  2B7J A;  4X1U A;  4GSN A;  5IMA A;  5GAN D;  1TI1 A;  2AB6 A;  3QFB C;  2AAW A;  5ELG A;  2HSH A;  4IQ1 A;  16GS A;  4G2E A;  3QAV A;  1LU4 A;  5IMC A;  2HRA A;  3HA9 A;  2GT5 A;  4ZBA A;  3W8S A;  1FB6 A;  2KLX A;  2B5Y A;  5D96 A;  3TKQ A;  4IEL A;  4ECJ A;  3RHC A;  4F03 A;  3CTF A;  3KGK A;  1OKT A;  2OBK A;  1KEB A;  1JZD A;  3G7I A;  1X0R A;  1DUG A;  5B8B A;  4TXO B;  1OE7 A;  2VCZ A;  2IMD A;  2L57 A;  2G2Q A;  1FOV A;  4TVE A;  1K0A A;  2JZR A;  5H5Q A;  3F3Q A;  3UAR A;  2VCT A;  4E8H A;  1GSU A;  5KN1 A;  1QFN A;  5EVO A;  1IYH A;  5FT3 A;  3EYT A;  4XCS A;  1JLW A;  3D0Z A;  4JU5 A;  2KP1 A;  4IVF A;  2QA1 A;  1WPI A;  3ERG A;  5F8B A;  1W89 A;  1O81 A;  2KP2 A;  2H74 A;  3TJB A;  2WFC A;  3H93 A;  3UBL A;  2H0H A;  1MEK A;  2H6Y A;  2TIR A;  4XIH A;  2LS5 A;  4O32 A;  1GSS A;  3ME8 A;  3G7Y A;  4JR4 A;  3J7Y k;  3DVX A;  4AJ7 A;  1FW1 A;  4NV5 A;  1NHY A;  5DQY A;  4NV2 A;  4F2I A;  3ZRD A;  2ZCT A;  4XTS A;  4ZBB A;  2LJA A;  3HY2 A;  1XWA A;  4I8B A;  4YQV A;  2FA4 A;  2IME A;  5G2Z A;  1Q98 A;  4E8E A;  2LST A;  4Z2T A;  2F8A A;  4V2N A;  2H76 A;  2VL9 A;  3ZML A;  1EZK A;  1XWK A;  1GH2 A;  3IAS 2;  1MTC A;  2F3M A;  3CMI A;  4WXT A;  4YAP A;  1ERW A;  5D93 A;  1PMT A;  2IMI A;  1GP1 A;  1AIU A;  4WKW A;  3GFK A;  3RHB A;  22GS A;  3D4M A;  5B6N A;  1JZR A;  1PGT A;  1A0R P;  5DAL A;  4BVX A;  3UEM A;  2IFQ A;  4DEJ A;  4AJ8 A;  4KCE A;  4HQS A;  5CNW A;  5B8A A;  5HR1 A;  3TRQ A;  1K3O A;  2M46 A;  4PQ1 A;  3HVS A;  1R5P A;  11GS A;  3F9U A;  3LYK A;  1ERV A;  1Q4J A;  3L4N A;  2VCW A;  4GCI A;  3NOF A;  3HJP A;  1NSW A;  1ERT A;  4IW9 A;  4ML1 A;  4PUR A;  2C0G A;  2C8U A;  1AQW A;  3DWV A;  3LFL A;  3U6V A;  1J08 A;  3GKK A;  2VL2 C;  2HXK A;  1SJI A;  3UOM A;  2JSY A;  4ML6 A;  4BVY A;  5AGY A;  2OE1 A;  7GSS A;  1GL8 A;  3LXT A;  1J9B A;  3GX8 A;  5F06 A;  3IPZ A;  2PBJ A;  2HSM A;  2IN3 A;  3EMP A;  4ZL9 A;  4N11 A;  3A2V A;  4NWY A;  1Z7P A;  4BPY A;  3L9V A;  2CZ3 A;  3KIJ A;  3KP8 A;  1SU9 A;  5KN2 A;  3WGD A;  1S3C A;  2L4Q A;  3PH9 A;  1YKA A;  1H75 A;  4V1A p;  3A2W A;  3KTB A;  1HNB A;  1OKD A;  3DEX A;  4EDZ A;  2X49 A;  3F63 A;  3LGC A;  3TRX A;  4MPG A;  4J56 E;  3RAZ A;  1ON4 A;  3HZ8 A;  3CSJ A;  3IRA A;  3I9V 2;  1A0F A;  4GLT A;  3FHK A;  3UVH A;  1SD9 A;  5CRW A;  3KMO A;  5IPH A;  3ZFL A;  3GN3 A;  5B6M A;  4FO5 A;  1GNW A;  1QGV A;  2A2R A;  1PD2 1;  4PNG A;  3CBU A;  2HE3 A;  4ZIJ A;  3ZVJ A;  5LD0 A;  1T1V A;  1USB A;  1O8W A;  4Q5N A;  2C3Q A;  3IC8 A;  3A3T A;  1GTU A;  3Q74 A;  4ULX A;  1UN2 A;  5J41 A;  3Q18 A;  1FOH A;  4G9H A;  5IMD A;  2EIO A;  2GLR A;  3F6F A;  3EPT A;  2X8G A;  4EKZ A;  4BL7 A;  3DRN A;  4MH2 A;  4NHZ A;  3A5I A;  4N0V A;  2LQQ A;  4FH8 A;  1U87 A;  1ZGN A;  1I5G A;  1DE2 A;  4NXI A;  4RI7 A;  3E3E A;  1G6Y A;  3ZMK A;  1B9X C;  1ZCP A;  3LSZ A;  5AIX A;  1V9W A;  1YEP A;  4ZL7 A;  4KAE A;  2TRX A;  3G9B A;  3F4S A;  2WRT A;  1TK8 B;  1NW2 A;  1EP8 A;  3BD2 A;  2IIY A;  1K3L A;  2LRN A;  5INY A;  2IWT A;  2GTU A;  4HQZ A;  1M9A A;  4K7I A;  1XFL A;  1GLP A;  1XIY A;  3LOR A;  4NHW A;  1TRW A;  3I43 A;  6GSS A;  2GGT A;  5AIV A;  2CX4 A;  3ZL5 A;  2FNO A;  4OFM A;  2VLU A;  4BL7 B;  4BWS A;  5ECS A;  2YZU A;  1R4W A;  1SD8 A;  4HJM A;  4K5S A;  3UBK A;  3VLN A;  1YDK A;  4FYC A;  1F3A A;  4HEA 2;  1TK0 B;  1PKZ A;  4PQH A;  5LNK e;  2OBI A;  1SKW B;  5L71 A;  4TW5 A;  1VF4 A;  3EU4 A;  4ECC A;  2E0Q A;  3IE3 A;  1LJR A;  3F6D A;  3KEB A;  1H4O A;  2O89 A;  2CVD A;  4FQU A;  1FHE A;  1QUW A;  5CRD A;  3TOT A;  1A23 A;  1GTA A;  17GS A;  3O3T A;  3GH9 A;  3LWA A;  2FD3 A;  5ECP B;  2H73 A;  3TKS A;  1THX A;  1VGL A;  2P0G A;  3MSZ A;  6GSU A;  2XHF A;  4KX4 A;  5F07 A;  1SK2 A;  1THO A;  3ERF A;  2BMX A;  5EY6 A;  2L59 A;  4A5P A;  3EC3 A;  3ZIV A;  3MYD A;  3TJK A;  3OR5 A;  1OAZ A;  5HQP A;  4YKF A;  1FG4 A;  1X5E A;  2H1A A;  3US3 A;  1ST9 A;  1T7P B;  3FRC A;  5E59 A;  1Z3E A;  4IJ3 A;  4GQF A;  5BRT A;  1K0B A;  1GUM A;  4O5Q A;  2K8S A;  4I2T A;  5JCU A;  3CSH A;  1B4Q A;  4MZB A;  3JCM L;  4TXV A;  1XCC A;  4OFN A;  4CHS A;  2BJX A;  3PR8 A;  5DJL A;  3MNG A;  3UL3 A;  3EMX A;  4IGJ A;  3VUR A;  2LV3 A;  1U3I A;  3FZA A;  3E9J B;  4XRD A;  4JZQ A;  2LUS A;  2KOK A;  5ECM B;  2FLS A;  1UC7 A;  2CVB A;  1EOG A;  1S3A A;  3DML A;  3EIN A;  2VM1 A;  2XBQ A;  3C71 A;  4NMU A;  1GNE A;  3QD9 A;  1JZW A;  2YNX A;  5EL8 A;  3QPM A;  1DSB A;  4EL1 A;  3FY7 A;  5ABR A;  2XBI A;  2DSA A;  3IDV A;  3DIE A;  3IR4 A;  6GST A;  1SK1 A;  1WIK A;  4P3Y B;  3KD0 A;  1GTI A;  1M2A A;  3GKM A;  2RM5 A;  4G0I A;  3APQ A;  4DVC A;  2H0G A;  3IC4 A;  1E6B A;  3L9S A;  3HJM A;  2CAQ A;  1EOH A;  3MWH A;  5B7C A;  4LMV A;  5GST A;  3C8E A;  4AF2 A;  4ISD A;  4WF4 A;  3RBT A;  2P31 A;  2E7P A;  4F0C A;  4ACS A;  2DML A;  5D8I A;  1G6W A;  1X9S B;  1T4Z A;  2L5O A;  5ECI B;  4MAB A;  1V58 A;  4IHU A;  3FK8 A;  3C7M A;  2A4H A;  4WR5 A;  3FR3 A;  2C3T A;  3IA1 A;  1SYX A;  2X4A A;  3L9U A;  5ELA A;  4MK3 A;  2IJY A;  2VAF A;  4K2D A;  2J23 A;  1TRS A;  1PN9 A;  3ZRE A;  2R5G A;  1BX9 A;  4XS4 B;  2IMF A;  3DXB A;  3E0U A;  1WE0 A;  3A5W A;  1BED A;  1U88 A;  2WB9 A;  4CW9 A;  1K0N A;  2MMO A;  2HFD A;  1PL1 A;  3V1W A;  2AHE A;  1K0M A;  1O6J A;  2JSZ A;  3A2X A;  2OA7 A;  1FVJ A;  1JZO A;  1V2A A;  2HZE B;  2HNL A;  4MMM A;  3GTU B;  4POK A;  4BA7 A;  1U6T A;  1MDI A;  2O87 A;  2CT6 A;  5F0G A;  2GT6 A;  4MF6 A;  4PXO A;  3TB2 A;  2V41 A;  3LYP A;  2R37 A;  2B1K A;  19GS A;  3IV4 A;  3WGX A;  4MZW A;  1EGO A;  4IN0 A;  4J57 E;  5IMZ A;  3UMA A;  2H70 A;  3MAK A;  1T4Y A;  2HRN A;  4LMW A;  3SWL A;  4YQU A;  1RK4 A;  1V98 A;  3GYK A;  4DSS A;  1J0F A;  1G7O A;  2OAC A;  3GL5 A;  3RPP A;  2QGV A;  1YF1 A;  2YJ7 A;  2UZ8 A;  2I81 A;  1BQ7 A;  2R2J A;  1V57 A;  2R4V A;  4KDU A;  4TR3 A;  3P2A A;  3LXZ A;  2NBS A;  1YJ6 A;  5CAX A;  1LBK A;  2MYG A;  5BMU A;  1WJK A;  1M2B A;  3KZQ A;  2CQ9 A;  4GTU A;  1GSQ A;  2H6X A;  1B4P A;  4HS1 A;  1K3Y A;  2AV4 A;  2H71 A;  1A2L A;  3ZFB A;  3VK9 A;  1A8L A;  4FYU A;  4EIP A;  3GIX A;  3LQ7 A;  3Q19 A;  4XRA A;  5IOW A;  3ISO A;  2GQK A;  4JR6 A;  1ZYE A;  4GWR A;  2LNS A;  1R5A A;  2B1L A;  5DDL A;  1SL0 B;  4MZC A;  1GSE A;  1HYU A;  1R7H A;  2E2G A;  2I4A A;  3DGQ A;  1M9B A;  1F3B A;  1YKC A;  4Q5R A;  4WF5 A;  3LG6 A;  3IK9 A;  3VPT A;  4DSS B;  2GZZ A;  3M8N A;  4O92 A;  1SJ6 A;  2Z9S A;  3P8W A;  2GZY A;  2YN1 A;  2REM A;  3DYR A;  3HXS A;  2QC7 A;  3HCZ A;  3IHQ A;  1B48 A;  4TRX A;  2FWF A;  5IOX A;  1HD2 A;  3HHV A;  3QCP A;  1OE8 A;  4TR4 A;  2I9H A;  2OE0 A;  2YWI A;  2YPM A;  2H30 A;  4ZXG A;  3WT2 A;  2GZP A;  2GDR A;  4EO3 A;  2X99 A;  2DJ0 A;  3BBY A;  5E4W A;  5AIS A;  4XS1 A;  2LRT A;  4F0B A;  4XHM A;  4IQA A;  4TN8 A;  4GSS A;  5GSS A;  3C1R A;  4MJC A;  3VI5 A;  1HNA A;  1YF0 A;  1EWX A;  5KN0 A;  3FZ5 A;  1O73 A;  1PX6 A;  4IKH A;  3EUR A;  3KJY A;  5DAL B;  4BVX B;  2XC2 A;  3HVV A;  2IFQ B;  1TKD B;  5A4W A;  2N5A A;  4ZIL A;  3HZ4 A;  1URM A;  5D9T A;  4PTS A;  1N2A A;  2B5E A;  4LLR A;  2H1D A;  3ZIJ A;  2KHP A;  4Z2R A;  4RI6 A;  1PN0 A;  1T00 A;  1MDK A;  1UA5 A;  5CRH A;  5HR3 A;  2VIM A;  4EUY A;  4PUA A;  2QKE A;  1A2M A;  1X9M B;  2A4V A;  3RPN A;  2IL3 A;  1TP9 A;  3VPQ A;  4BVY B;  1WMJ A;  2NTO A;  8GSS A;  3KH9 A;  5DJM A;  3IOS A;  4O5R A;  2X8H A;  1F37 A;  3TKS E;  1GUL A;  4F9Z A;  4JE1 A;  2PER A;  3GST A;  18GS A;  2CX3 A;  3BOA A;  3M3M A;  5ID2 A;  3TUE A;  2OAD A;  4XS6 A;  5KN3 A;  4MP4 A;  2X8C A;  3UVT A;  1K0C A;  2CZ2 A;  2VL2 A;  3TGZ A;  4Z2U A;  3ZLP A;  2K6V A;  2DJ1 A;  2GST A;  1KNG A;  2MBS A;  1O8X A;  3GA4 A;  3ZVJ D;  2NVL A;  2CA8 A;  4CY6 A;  5DQS A;  5IMF A;  5KOX A;  3N9J A;  1FB0 A;  3FEU A;  3HKR A;  2QSI A;  3VWV A;  3FZ4 A;  4L5O A;  2EIR A;  3ZYW A;  4MA9 A;  1GSF A;  4ICY A;  1SKR B;  3LEF A;  3VI7 A;  3KP9 A;  5DCH A;  1TRU A;  5F05 A;  3UJ1 A;  3CTG A;  2B7K A;  3P90 A;  2MMN A;  1OC9 A;  4L8E A;  3GKX A;  3PGT A;  2P5R A;  2DJ2 A;  4IBP A;  4CDO A;  4KCA A;  2IPA A;  3TKS C;  3CSI A;  3BCK A;  3W8J A;  4POB A;  3I69 A;  3WD6 A;  1GSY A;  1EEJ A;  2YCD A;  4HZ2 A;  12GS A;  3WYW A;  4DSR A;  3IXR A;  3EWL A;  1PA3 A;  4RQR A;  20GS A;  3F0I A;  2PN8 A;  4TOP A;  3KTL A;  2RII A;  1Y25 A;  4MCU A;  4RUV A;  5DVB A;  1C72 A;  1JHB A;  2A2P A;  3J7Y b;  3ERW A;  4GRF A;  5J9C A;  1AW9 A;  2K8V A;  2EC4 A;  1DBY A;  3M1G A;  5IIZ A;  2HT9 A;  4JRR A;  1XXU A;  1XW9 A;  1M2D A;  1Z9H A;  1OC9 B;  5G5E A;  4KE3 A;  2WZ9 A;  4KDY A;  5DBQ A;  4Z7X A;  1VF1 A;  3DD3 A;  4DSQ A;  5J4U A;  4POL A;  4N10 A;  1SK0 A;  4WEY A;  2VL3 A;  5G1K A;  1T3B A;  1GRX A;  4LL4 B;  5DAK A;  5ECL B;  4GXZ A;  1JFU A;  2ZUP A;  3CRT A;  4KH7 A;  1TXX A;  1V40 A;  5D9X A;  4NPB A;  5D9W A;  3BCI A;  5CYY A;  3GKN A;  1BAY A;  2YJH A;  1SL2 B;  3QMX A;  1GTB A;  1SKS B;  6GSY A;  4AJ6 A;  1VF3 A;  4X4J A;  1GSD A;  2RUF A;  3L0H A;  4N30 A;  3VWX A;  2J9H A;  2GSR A;  1ZYN A;  4GQC A;  1UVZ A;  2AUV A;  4ZL8 A;  4PUF C;  2V6O A;  2VOC A;  5J3R A;  5CRG A;  1X9W B;  3ZIT A;  3HVX A;  5HR2 A;  1ZMA A;  2M72 A;  1K0D A;  4MLY A;  1PX7 A;  4ZB9 A;  4YAV A;  3KH7 A;  1R26 A;  4L0U A;  1MD4 A;  4D73 A;  4KA0 A;  5D73 A;  1TTZ A;  3TJJ A;  2HI7 A;  1VRS D;  4YQM A;  2R0P A;  2YWM A;  4ECB A;  2ES7 A;  2C0F A;  1X5C A;  1XWG A;  3H4K A;  4K7N A;  4K1F A;  5D9V A;  2D2Z A;  4IP6 A;  2F8F A;  1X5D A;  5ECO B;  2E2M A;  2VUP A;  1PRX A;  2MMZ A;  2RUE A;  5JWR B;  1XBS A;  2JZS A;  4MF5 A;  1XPV A;  2HLS A;  1Z6N A;  4OMV A;  4POM A;  1AAZ A;  4ILF A;  4MH3 A;  2L4C A;  2R6K A;  3R3E A;  3M9K A;  2A2S A;  2NDO A;  3FKF A;  4MF7 A;  1WRY A;  3D4T A;  1PL2 A;  2VCX A;  1XVW A;  1O85 A;  3GUR A;  1AC1 A;  2HZF A;  1TJD A;  1ZYP A;  2FWH A;  4GST A;  3GUS A;  2LNT A;  3L78 A;  3QFA C;  6GSX A;  1RW1 A;  2H0I A;  5IMV A;  2VD1 A;  1Z6M A;  6GSV A;  2V1M A;  1FAA A;  4KW6 A;  2FUG 2;  4I5Q A;  4OWY A;  2FCH A;  2N5F A;  2H1B A;  5IPG A;  5KEJ A;  5KOW A;  5HFG A;  1GWC A;  3QAW A;  1WWJ A;  2C0D A;  2MMA A;  5IO2 A;  3F8U A;  2CAI A;  5AN1 A;  14GS A;  3IAM 2;  3CYN A;  3FYG A;  4MJE A;  1M7T A;  3D22 A;  5H5S A;  4PQI A;  4V2L A;  2DLX A;  3F4T A;  2OE3 A;  1G0T A;  2HYX A;  1M0U A;  4JBB A;  3FR6 A;  3TKP A;  4WR4 A;  3O76 A;  4KSO A;  2PVQ A;  4N0Z A;  1A2J A;  3GNJ A;  2K9F A;  4ID0 A;  1F6M C;  2H8L A;  5CRE A;  1QK8 A;  5EPF A;  1YEX A;  1ERU A;  2TRC P;  1PSQ A;  1OC8 A;  2QA2 A;  2C1Y A;  2WDU A;  4QL9 A;  2DKI A;  2EIQ A;  5FHI A;  5A4U A;  3AY8 A;  2JL4 A;  2O8V B;  3D6I A;  2DBC A;  3M0F A;  2H01 A;  4QQ7 A;  5HR0 A;  1EGR A;  1ZOF A;  4K2X A;  1GUK A;  2VLV A;  4Q5F A;  2HRF A;  1EP7 A;  4H86 A;  2WUL A;  4MDC A;  4V1A g;  5IM9 A;  10GS A;  1TU8 A;  2GVP A;  2LTK A;  4YH2 A;  3EE2 A;  4FIW A;  3KXO A;  1ACV A;  1A8Y A;  1QXH A;  3S9F A;  3VWU A;  4I2U A;  1XOA A;  1RQM A;  1BG5 A;  3KMN A;  13GS A;  3WT1 A;  5JCG A;  2DMM A;  4ZB6 A;  4HU7 A;  3GX0 A;  5G30 A;  1BYE A;  2YP6 A;  1MDJ A;  2WCI A;  4K5R A;  1GUH A;  1OVN A;  1G7E A;  2FWG A;  2C3N A;  2CVK A;  4NAX A;  2BTO T;  3ED3 A;  1YZX A;  2PU9 C;  4F82 A;  2ON7 A;  2O85 A;  2XPE A;  4FYB A;  3EVI A;  1TI3 A;  4MJB A;  1ZYQ B;  1FVK A;  2L6C A;  4YKG A;  3QAG A;  1ZL9 A;  4LA1 A;  4TR1 A;  1F2E A;  4OD7 A;  2B5X A;  3GL3 A;  2B3S A;  2F51 A;  2LJK A;  4G19 A;  5C00 A;  3DVW A;  3LJR A;  2YOI A;  2LQO A;  5G5F A;  4KB3 A;  4ECI A;  6GSW A;  2DJ3 A;  1ILO A;  3ME7 A;  5LCZ A;  2CV4 A;  4MNN A;  1ML6 A;  3W6G A;  3MDK A;  1EEM A;  3K8N A;  2GSQ A;  4G0L A;  2HRK A;  3IK7 A;  4KGI A;  3GRX A;  2VD0 A;  3TOU A;  1W4V A;  4HDE A;  1Z7R A;  2FWE A;  3VFI A;  2GS3 A;  3PPU A;  3KCM A;  4JED A;  2H75 A;  4PX1 A;  4OCF A;  3GHA A;  4J2F A;  5ECH B;  4OFT A;  1QQ2 A;  2IMK A;  4K0G A;  1EV9 A;  3KM6 A;  5IQY A;  1TK5 B;  5GZZ B;  2P5Q A;  4LL1 B;  1K0O A;  1TU7 A;  2H66 A;  3M9J A;  4TR1 B;  2GQM A;  4WET A;  1SL1 B;  1YQ1 A;  2M80 A;  3D21 A;  4G0K A;  3SBC A;  2DC5 A;  2AJQ B;  2PVO C;  1XZO A;  2C0E A;  2JAD A;  5A5K A;  5DCG A;  3H79 A;  5GAP D;  2VCQ A;  3EU3 A;  4EVM A;  3HJO A;  2PWJ A;  1WOU A;  4AGS A;  2YV7 A;  4EE0 A;  1CQG A;  5JWQ B;  2FGX A;  4V2M A;  1ABA A;  3NZN A;  1TW9 A;  1XVQ A;  4HI7 A;  2V32 A;  1HQO A;  3G7J A;  4EXJ A;  2G0F A;  3RDW A;  2F9S A;  2LRC A;  4KDX A;  5H5R A;  2YZH A;  5ECR B;  2R0G A;  1SJZ A;  4KUN A;  4EF0 A;  3HDC A;  4K7O A;  1PKW A;  2O7K A;  2GQL A;  3TDG A;  1PQN A;  2XPD A;  1XWC A;  3NIV A;  1SEN A;  4HJ2 A;  1OC3 A;  2OKA A;  2C80 A;  3DKS A;  4OCE A;  3VWW A;  3TJG A;  5ECK B;  5G31 A;  3O6T A;  3FW2 A;  2R0C A;  1N8J A;  5CO3 A;  1S3D A;  2ALB A;  3Q6O A;  5C04 A;  2YWN A;  4L5L A;  4O7H A;  1HNC A;  3CRU A;  3APS A;  4IP1 A;  5ID2 B;  3C1S A;  2OJL A;  1DE1 A;  1XW6 A;  1AUC A;  4PGT A;  1F9M A;  1GLQ A;  3D5J A;  3ZTL A;  5FWG A;  5J9B A;  4KF9 A;  4O5U A;  4CY8 A;  3F4R A;  1EV4 A;  4BWQ A;  1XOB A;  1O7U A;  1ZZY A;  2H19 A;  2YV9 A;  4G10 A;  3FMW A;  1TOF A;  1XWB A;  5HFK A;  1QMV A;  2FA8 A;  4K0N A;  2VLT A;  1AQV A;  1KBN A;  1CQH A;  2MZC A;  2I1U A;  2H1G A;  3BJ5 A;  2PMT A;  4OO4 A;  1E2Y A;  3QOU A;  3GSS A;  1MD3 A;  1SYR A;  1AXD A;  2RLI A;  4ZBD A;  2WGR A;  4ZB8 A;  4WBJ A;  1FO5 A;  2NPB A;  3C73 A;  4K6X A;  4MJA A;  3MIX A;  4USS A;  4X0X A;  2YAN A;  2K18 A;  5JWO B;  2JZT A;  3QR6 A;  4RQX A;  2B6M A;  2ON5 A;  2PUK C;  3GV1 A;  2JU5 A;  1BJX A;  2L5L A;  3WGE A;  4HOJ A;  4EDY A;  2DIY A;  2WS2 A;  3IHG A;  5A4V A;  4EC0 A;  4X43 A;  5ENU A;  3N5O A;  3GH6 A;  4TKY A;  1TDI A;  2YWO A;  2DKH A;  4I97 A;  4Q5Q A;  2N5B A;  1NHO A;  1TRV A;  2VCV A;  3H8Q A;  2JAC A;  2AYT A;  4L0W A;  3UIW A;  1AQX A;  3TRP A;  2FY6 A;  3UAP A;  3F3R A;  1OYJ A;  3FZ9 A;  3ZZX A;  1A24 A;  5CP1 A;  4HZ4 A;  4IS0 A;  4HU9 A;  1I9D A;  3P7X A;  4EIQ A;  5DAK B;  4K9Z A;  4OO5 A;  4PNF A;  1JLV A;  1KTE A;  4GF0 A;  2R3X A;  1T8E B;  2LJR A;  2PGT A;  5JCW A;  3HYP A;  2LEG A;  3R2Q A;  1NM3 A;  3H1N A;  2DJK A;  4TR0 A;  3TCO A;  2X64 A;  1M99 A;  4KND A;  5J5N A;  5COH A;  2C4J A;  2VM2 A;  2L6D A;  2H6Z A;  2DJJ A;  2H72 A;  5HFI A;  5G1L A;  3IBH A;  4I6X A;  2RM6 A;  2HSY A;  2V6K A;  4XS4 A;  4KSM A;  2I3Y A;  4MPF A;  9GSS A;  4HUA A;  2PPT A;  5ECQ B;  4WBR D;  2WJU A;  3APO A;  5ECN B;  2V2G A;  3LW9 A;  1Z5Y E;  2LKU A;  4D73 B;  2HZE A;  2KUC A;  1VF2 A;  2GSS A;  2MBT A;  1U3A A;  3GTU A;  1YY7 A;  1B9Y C;  1IYI A;  4TXO A;  3HD5 A;  1Y6E A;  2VO4 A;  3CXG A;  2FHE A;  4K8M A;  1WP0 A;  3I6A A;  2DIZ A;  3GMF A;  4IJI A;  3QDN A;  5IO0 A;  3U5R E;  1B8X A;  4QL7 A;  1XW5 A;  3TKR A;  3PIN A;  3FR9 A;  3TJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...