3IC4A

The crystal structure of the glutaredoxin(grx-1) from archaeoglobus fulgidus
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
92
structure length
92
Chain Sequence
GGRENLYFQGMAEVLMYGLSTCPHCKRTLEFLKREGVDFEVIWIDKLEGEERKKVIEKVHSISGSYSVPVVVKGDKHVLGYNEEKLKELIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaredoxin (Grx-1)
publication title The crystal structure of the glutaredoxin from Archaeoglobus fulgidus
rcsb
source organism Archaeoglobus fulgidus
molecule tags Oxidoreductase
total genus 26
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2009-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3ic4A00
4NWYA 2LS5A 2JZTA 4J56E 3GKNA 1GUHA 4OFMA 2H76A 3VURA 2F8AA 3FR9A 4FH8A 4EUYA 3QAVA 3F4SA 4EL1A 3IPZA 2YWMA 1CQGA 5H5RA 2EIOA 2E7PA 1TP9A 1R26A 4N10A 1WIKA 4K0NA 2H70A 5HR3A 1WJKA 3L78A 1T1VA 3F0IA 2L4CA 2FNOA 4OD7A 1YJ6A 4BVYA 1FHEA 3D4MA 3TRQA 2L59A 2VM1A 1DUGA 5ECLB 4IQ1A 4EC0A 3RAZA 4GLTA 3ED3A 1JLVA 1YEPA 2H75A 4HU9A 4HOJA 2C3TA 1K3YA 4JR4A 2YN1A 2MMAA 2NBSA 5GSSA 4XS1A 5J3RA 1BQ7A 3EINA 1FO5A 5L71A 3ZVJD 2O87A 1BG5A 4PQHA 1F6MC 3IA1A 1SJIA 1GUKA 4MLYA 1SENA 3ME8A 3IR4A 3WT2A 1PL1A 3V1WA 1TU7A 3IHQA 4AF2A 3FKFA 5DCHA 3DVXA 3TJBA 3RHBA 4IP6A 3FZAA 3GTUB 3L9SA 2YJHA 4NXIA 5ECPB 1MD3A 2B7KA 4LL4B 2XPEA 4WETA 2L6DA 5F07A 2R5GA 2WULA 2E0QA 9GSSA 1BEDA 3KMOA 3QR6A 4MJEA 1BAYA 1THOA 2F9SA 1OYJA 1W4VA 4ZB8A 3LEFA 5G1KA 2REMA 3GN3A 3VFIA 5G2ZA 3GKKA 3Q19A 2JSZA 3HJMA 4X43A 3VWUA 1TRWA 5IMVA 3EURA 4IS0A 1PSQA 1KBNA 4YQUA 3DKSA 5IPHA 5ECRB 1U88A 3ZITA 2M72A 2DC5A 4OMVA 4EDZA 5G5EA 2GLRA 5IMDA 2LSTA 5C04A 1DSBA 2MYGA 6GSSA 4N11A 1TK5B 1S3AA 2HSYA 1NM3A 1JFUA 1GWCA 2I1UA 4MH2A 2N5BA 3IAS2 4NAXA 2C3QA 4MPGA 4GF0A 3APSA 3ISOA 1V57A 1M2DA 2IJYA 2XHFA 4HQZA 5A4VA 1PA3A 3QFBC 1ZOFA 3MNGA 5IOXA 3O3TA 1UC7A 3GSSA 4HUAA 3HVVA 2HRFA 4ZB9A 1C72A 5KN3A 16GSA 5D96A 4JR6A 1GTUA 3SWLA 4G9HA 1WRYA 1SD9A 5IMCA 2H0IA 5D8IA 4L5LA 3TOUA 4MH3A 4FIWA 4I5QA 1GSSA 1Q4JA 2LQQA 3GUSA 3K8NA 3QOUA 4O32A 2YJ7A 1ERWA 5ECMB 4AJ7A 5D73A 1V40A 3CYNA 3P8WA 2LKUA 4MJBA 4WF4A 4MPFA 1Z9HA 5HQPA 2AV4A 2O7KA 2CT6A 3P2AA 5ECIB 2VCXA 3EE2A 3WGEA 1B8XA 2QKEA 4K8MA 2FA8A 2H6XA 1SJ6A 2R6KA 3UJ1A 4HJMA 2CZ2A 1M99A 4CHSA 3TJKA 13GSA 3H93A 5CAXA 4DSRA 4V1Ap 3GKMA 1ERVA 2O85A 4ZL9A 2I9HA 3IE3A 3GL3A 2OACA 1AW9A 1GSDA 2L5OA 2JACA 2VD0A 1EWXA 1K0OA 1MDIA 2IMEA 4L0UA 1PMTA 4MK3A 3W8SA 2FD3A 4H86A 4TKYA 3DVWA 4F03A 2CZ3A 5JCUA 2PGTA 4F0BA 4MF6A 2TRXA 3A2WA 2Z9SA 2FA4A 3U6VA 4F82A 2DJ2A 4DSSB 3RPPA 5FWGA 1S3CA 1X9WB 4NMUA 3HZ8A 2GZYA 1USBA 4XS6A 1YQ1A 3APOA 3EVIA 4HI7A 2R2JA 3A2XA 5B8AA 1O73A 3WD6A 2H30A 3BD2A 5AGYA 1PX7A 3TKSC 1XWGA 4KA0A 2XC2A 4Q5QA 3F8UA 1ZL9A 2V41A 4I8BA 4BWQA 3ZIVA 3TJFA 4TN8A 1OC9B 3W8JA 5CRDA 1SK2A 5DBQA 4QL9A 2FGXA 4ID0A 2H6ZA 2YWIA 2CX3A 3GKXA 1TRVA 3FK8A 3GH6A 1SK0A 4MJAA 2HRNA 4HEA2 3CBUA 3PINA 2YWOA 2VLVA 4XRDA 2I3YA 1V58A 2CAIA 1MDKA 1Z3EA 3F6FA 5GAPD 3G7IA 3F3RA 3ZRDA 1FVKA 2MMOA 4IQAA 4POBA 3LJRA 4IJ3A 4ZBDA 3P7XA 1Y6EA 2LRCA 5ELGA 2PMTA 1F3BA 1KEBA 2B5EA 1EP8A 4N0VA 1BYEA 2WDUA 4N0ZA 4EXJA 2RUFA 2GDRA 5A5KA 3LG6A 5G5FA 1U6TA 1NW2A 2OE0A 5GAND 1TI1A 2VCWA 3PR8A 5J41A 4KNDA 1OVNA 3C7MA 3FHKA 1XWAA 5DCGA 2KOKA 2FWFA 2X64A 4JRRA 4PXOA 4GCIA 1QMVA 2VM2A 5B6MA 2IMFA 1A0FA 1LU4A 2YZUA 2A2RA 3GX8A 1QXHA 2MMZA 2R3XA 5IPGA 2H01A 3Q18A 2PVOC 2YNXA 1T00A 4IJIA 5DQYA 2H71A 4AJ6A 1GSUA 4GSTA 3I69A 4KW6A 4ECBA 4O7HA 2GSTA 3O76A 4K1FA 3VWXA 5GSTA 5IMFA 1BJXA 3A5WA 2C80A 3O6TA 4WBJA 3N5OA 1KTEA 2D2ZA 5J4UA 8GSSA 1GLQA 4P3YB 3GYKA 1O81A 4XRAA 4D73A 5COHA 2AJQB 3GSTA 4TR3A 2VO4A 1WWJA 3C1RA 3EWLA 5CRWA 1PQNA 2YV7A 4GXZA 2F3MA 2P31A 3ZVJA 5ECNB 1ML6A 2GTUA 1ZCPA 2VIMA 2VCZA 1XWCA 2VL2C 6GSXA 1HNAA 2GSRA 4KDXA 5CP1A 1ACVA 4KGIA 5ELAA 4Z7XA 1AXDA 1EZKA 2HYXA 3KD0A 1TK8B 2LNSA 1ZGNA 4OCFA 4BWSA 5DVBA 1Z6NA 1XCCA 1S3DA 1U3IA 3H79A 5EVOA 4K9ZA 3RPNA 1J0FA 4DVCA 2NPBA 3IK9A 5HR2A 1YDKA 2VL2A 5HR0A 2WCIA 3N9JA 4TR1B 1B4PA 1QQ2A 3UBKA 4PNGA 2FY6A 5KEJA 3BOAA 2HXKA 2NTOA 10GSA 4NV5A 2G2QA 3KXOA 1SL1B 2GQKA 2LJRA 3Q6OA 4EO3A 1A2MA 2YANA 2C0EA 2IL3A 3FR6A 2KP1A 3J7Yb 1OE7A 5G30A 4K0GA 5F8BA 3GFKA 2G0FA 3GL5A 4MA9A 3AY8A 3UEMA 3W6GA 1EEJA 3FZ5A 2VCQA 12GSA 3M0FA 2CX4A 5IOWA 3FR3A 1R5AA 2X8GA 5CRHA 2X8CA 1JZOA 1G6YA 1NHYA 2TRCP 1VF2A 3IK7A 4ZB6A 3Q74A 2H0GA 1NHOA 1PD21 2NVLA 3UOMA 4MF7A 1AQXA 3UBLA 4TVEA 2PUKC 2GSSA 5ECSA 2DJ1A 5ABRA 3VWWA 2JZRA 4IGJA 1A2LA 18GSA 4LMVA 4POKA 1GULA 4OWYA 1FOVA 1VRSD 1JHBA 1A8LA 1KNGA 1PL2A 1SYRA 2YP6A 1X5DA 1PKWA 3C71A 3RHCA 1G6WA 4Q5RA 1X5EA 4NPBA 3QDNA 3CTFA 3EYTA 1O85A 3FY7A 3WT1A 5INYA 3GV1A 3M8NA 4DSQA 4ML6A 2HSHA 4N30A 5EL8A 3TKQA 2DIZA 2L6CA 3MSZA 2O8VB 1T3BA 3CSIA 3TCOA 1BX9A 4ECIA 5ID2B 3KGKA 1OC8A 4ZL8A 2KHPA 1FB6A 2OE1A 4IBPA 2LV3A 1O8XA 1DE2A 2C1YA 1TW9A 5AIXA 1T8EB 2KP2A 3D21A 1AUCA 5ECQB 3NZNA 2KUCA 1T4YA 3F4RA 2MMNA 4LMWA 1G7EA 2P5RA 4TR1A 2H1BA 1SL0B 1HNCA 4HQSA 3DD3A 1G7OA 1SU9A 2JSYA 1SYXA 1A23A 5FHIA 4ZL7A 5CO3A 2CQ9A 4F2IA 1YKCA 1FVJA 4NV2A 1Z7PA 3ZMLA 3LORA 5ECHB 3HZ4A 1YKAA 3M9KA 2OE3A 4OO4A 2IMKA 1O6JA 2LRTA 4GSNA 4XIHA 2V1MA 2EC4A 5ECOB 2WZ9A 5D9WA 5DALA 1VF1A 2X99A 5FT3A 2YOIA 1IYHA 3QFAC 3TJGA 3VPTA 4BPYA 3APQA 4OFNA 1PKZA 2QGVA 4IVFA 3F63A 1U87A 5F05A 1EV4A 3ME7A 4FYUA 2ALBA 1Y25A 4XTSA 3UL3A 1QGVA 5AISA 5IM9A 3CTGA 3KH9A 3LSZA 2IMDA 1SL2B 3OR5A 2CVBA 3L9UA 4RI6A 2PN8A 4BVXA 1JZWA 3U5RE 1VF4A 4ZBBA 2GQMA 4NHZA 2OBIA 2HZFA 1LBKA 3UARA 5B8BA 3HVXA 2IIYA 2M80A 4HU7A 5AN1A 3TKSE 1MTCA 1F3AA 4KSOA 3TDGA 1HD2A 5F0GA 3D5JA 1K0AA 1AQVA 4ML1A 5LNKe 2MZCA 2BTOT 4XS4A 5J5NA 3BBYA 6GSTA 1Z5YE 3G7YA 4EDYA 2WGRA 2RM5A 1TU8A 2C0GA 5DJLA 1K0NA 1M2AA 1XFLA 1TKDB 2KLXA 2GT5A 1THXA 2CVDA 5ID2A 2VL3A 1WOUA 4PQ1A 3DEXA 2B6MA 1M9BA 2WJUA 3IXRA 4KCAA 4F9ZA 1WP0A 4PURA 4Q5NA 4ZILA 2IN3A 2DJ3A 3C8EA 1K3OA 1XW5A 2DJJA 4ISDA 5G1LA 4FYCA 2HI7A 3GMFA 1TJDA 2K9FA 1X9MB 2TIRA 2GS3A 4IKHA 3ZIJA 3WGXA 1XWBA 3VI5A 1SD8A 2AB6A 3FRCA 4Q5FA 2GVPA 3DIEA 3ERFA 4PUAA 4D73B 3FYGA 5LCZA 4GQCA 1XW9A 3ZLPA 1XIYA 2E2GA 2YPMA 22GSA 2H72A 3KEBA 4PX1A 1AAZA 1UA5A 4GTUA 3ZMKA 4ECCA 1M9AA 5C00A 1AIUA 2H1GA 3TJJA 3TKSA 1OKTA 19GSA 2AUVA 1QUWA 1TOFA 3E9JB 2K6VA 1YEXA 4KH7A 1ZYEA 2H73A 2VCVA 4TXOA 4K6XA 3KM6A 2FWEA 5E4WA 4K7IA 2GZPA 5GZZB 2B1LA 2XBQA 2OJLA 3HD5A 3I9V2 4XCSA 1O8WA 2LNTA 3GHAA 3MAKA 3IBHA 2CVKA 3BCIA 4TW5A 3F3QA 1ST9A 4LLRA 1DBYA 2ZCTA 2H6YA 7GSSA 3S9FA 4QQ7A 4EVMA 3NIVA 2VD1A 5KN2A 2H66A 3TB2A 2C3NA 4V2NA 1GNEA 5IQYA 4DEJA 2BJXA 2R37A 3CMIA 2LTKA 2PPTA 1FB0A 3ZL5A 1EOGA 4X0XA 1H4OA 3GH9A 14GSA 4E8EA 2V6OA 3FZ9A 5CREA 1M2BA 4POMA 2PWJA 2LRNA 2H0HA 3MWHA 4TXVA 1PGTA 4I2TA 4RQRA 4RUVA 2JU5A 2WS2A 2DJKA 4L5OA 3GX0A 3TGZA 4TRXA 5JWRB 1V2AA 4NHWA 1XPVA 4WXTA 3QAGA 1GP1A 1XOAA 2FHEA 4J57E 3NOFA 5JCGA 4FYBA 3M9JA 3I43A 3EU4A 1HQOA 2LUSA 5DJMA 4YAPA 1R5PA 1GH2A 5DQSA 2HFDA 1F9MA 2R4VA 2MBSA 1PN9A 4I2UA 2H8LA 5ECKB 4MABA 5KN0A 1XZOA 2JADA 1LJRA 1GSYA 3TRPA 3FZ4A 2JL4A 3BCKA 4JU5A 4ILFA 1GNWA 1XWKA 2B5XA 1TDIA 3DYRA 4PUFC 1B4QA 2F51A 5KN1A 1W89A 3BJ5A 3D22A 2O89A 4KSMA 2PVQA 4HDEA 4KX4A 3LYPA 2HT9A 2GZZA 4ZBAA 1ERUA 1J9BA 4POLA 4EF0A 3L4NA 4O5RA 1AC1A 4G2EA 5CNWA 2DMLA 2HLSA 2B1KA 3QMXA 3D0ZA 5HFKA 3MDKA 1Q98A 4CDOA 3IAM2 1SKRB 3DGQA 4KDYA 4V1Ag 1GSFA 2ZNMA 4KAEA 2DIYA 2IFQA 3LGCA 4MF5A 4JBBA 1H75A 2IPAA 2J23A 3UAPA 1GSEA 3E3EA 2RM6A 1T4ZA 3LXZA 3A3TA 5DALB 3IDVA 3TKRA 4YH2A 3J7Yk 1PRXA 4OO5A 2VOCA 1JZDA 17GSA 2OKAA 1GLPA 3HXSA 2L57A 2YV9A 1ON4A 1HYUA 5J9CA 1B9YC 4TR4A 4EKZA 1TI3A 2V6KA 5ENUA 1R7HA 1A8YA 5EPFA 3P90A 4ULXA 4IP1A 4TR0A 1Z6MA 4L8EA 2I81A 3ZTLA 11GSA 2ZUPA 1B48A 2ES7A 2H1AA 3VPQA 1OC3A 1TRUA 1N8JA 2PBJA 4JZQA 4XS4B 2EIRA 3HCZA 2I4AA 1F2EA 1V98A 3R2QA 5G31A 1ZYQB 5D9TA 6GSWA 4GQFA 5DAKA 3TKPA 3F6DA 1B9XC 2DBCA 2A2SA 3SBCA 4ZXGA 2PU9C 4GRFA 5E59A 1SK1A 2NDOA 2H74A 3TRXA 2BMXA 2HZEA 3IOSA 1AQWA 3KH7A 3LYKA 6GSUA 1K3LA 4F0CA 3HA9A 2FUG2 2QSIA 1TK0B 2LJAA 1I9DA 1YF1A 2RLIA 4K7NA 1A2JA 3JCML 5HFIA 3PGTA 1R4WA 1EGRA 3KTBA 4TOPA 1ABAA 5IO0A 2V2GA 3KJYA 4OCEA 1X9SB 5IMAA 2H19A 3UVHA 1X0RA 3FW2A 5CRGA 1J08A 2RUEA 2C0FA 4WKWA 1RW1A 3KP9A 3M1GA 2WRTA 3KZQA 1GTAA 1XVWA 3CRUA 1ZMAA 4MZWA 6GSYA 4IW9A 2ON7A 1F37A 3QAWA 4PQIA 4AGSA 4ECJA 4I6XA 3EU3A 4HS1A 1UN2A 2DJ0A 4L0WA 5JWOB 1OAZA 2RIIA 4K2DA 2C4JA 5A4UA 3E0UA 3VI7A 1WMJA 2C8UA 1YZXA 2YZHA 2HE3A 4KCEA 2CV4A 1I5GA 3UVTA 2GQLA 3IRAA 4HJ2A 1OKDA 2XPDA 2MBTA 2C0DA 2DMMA 1ERTA 4TXOB 1EGOA 4KUNA 3IV4A 2VL9A 2OADA 3RDWA 3HHVA 4G19A 1VF3A 1HNBA 3GTUA 3RBTA 2OA7A 4EE0A 3L0HA 5HR1A 2B3SA 3A2VA 1OE8A 3M3MA 4I97A 1FAAA 3QD9A 3GURA 3TOTA 3HKRA 1RQMA 2X8HA 4X1UA 4J2FA 4AJ8A 3LXTA 3EMXA 5HFGA 3G7JA 3VWVA 3IC4A 4E8HA 3DXBA 1TRSA 2QC7A 4V2MA 3WGDA 3C73A 2FWGA 3ERGA 2WB9A 3GNJA 3UIWA 3LWAA 1K0CA 3DMLA 4KDUA 2K8SA 1GTBA 3D6IA 2AYTA 1UVZA 5J9BA 3UMAA 3KTLA 4MP4A 4MZBA 4BA7A 1ZZYA 1RK4A 3CRTA 4MCUA 3PH9A 2FLSA 2YCDA 3F4TA 2B5YA 1EV9A 2N5AA 1A24A 2VCTA 2A4VA 1WE0A 3VK9A 3US3A 4CW9A 3KMNA 2AAWA 4G10A 1YY7A 2VUPA 1GSQA 3QPMA 2K18A 4WR5A 3D4TA 1QK8A 1EEMA 1MEKA 5D9VA 2ON5A 6GSVA 1M0UA 1JZRA 1GTIA 1DE1A 2VLTA 4ACSA 3ZFBA 1PX6A 3L9VA 3LFLA 1URMA 1K0MA 2M46A 3H8QA 3CSHA 4WR4A 4K7OA 4MJCA 5F06A 2DLXA 5JWQB 3ZZXA 2EIQA 1SKSB 4PNFA 3C1SA 1MDJA 1X5CA 1EOHA 1GUMA 2LJKA 5A4WA 1GL8A 3HY2A 1SKWB 4GSSA 3CSJA 5IO2A 3HJPA 2B7JA 2K8VA 1MD4A 4YQMA 2HNLA 4RI7A 5D93A 2FWHA 2J9HA 1M7TA 1XW6A 2LQOA 1NSWA 1IYIA 3H1NA 4HZ4A 4LA1A 2P0GA 4LL1B 5B6NA 3DRNA 3VLNA 4KB3A 2F8FA 3F9UA 1VGLA 1N2AA 4OFTA 1WPIA 3GIXA 1O7UA 3WYWA 1V9WA 3KIJA 2JZSA 1XOBA 5B7CA 2GGTA 1K0DA 1TTZA 3QCPA 4ZIJA 2IMIA 2IWTA 3CXGA 3ZFLA 2IFQB 3GA4A 3HVSA 3HJOA 5H5QA 2N5FA 2AHEA 4V2LA 1K0BA 3ZREA 4FO5A 4WBRD 4WF5A 5H5SA 3EC3A 2XBIA 3TUEA 1Z7RA 1XBSA 4WEYA 1FG4A 2OBKA 4RQXA 3ERWA 4YQVA 5AIVA 4HZ2A 2PERA 1E2YA 3FEUA 3HYPA 4MDCA 1FW1A 4KE3A 2V32A 1ILOA 2VLUA 2CA8A 4O92A 1E6BA 1JLWA 5IIZA 2WFCA 4DSSA 2YWNA 2L5LA 4GWRA 5DDLA 2CAQA 1TXXA 4XHMA 1G0TA 1XXUA 1U3AA 4JEDA 1SJZA 5D9XA 3ZYWA 4MMMA 1QFNA 5LD0A 1T7PB 4IELA 2L4QA 5JCWA 5DAKB 2P5QA 2GT6A 1YF0A 3EMPA 4MZCA 2DSAA 1EP7A 2E2MA 2H1DA 4BL7A 3LQ7A 5CYYA 2HZEB 4JE1A 1CQHA 3I6AA 3DWVA 2FCHA 3G9BA 5EY6A 1XVQA 1GRXA 2LEGA 20GSA 2GSQA 3KP8A 4YAVA 4PGTA 3GRXA 1OC9A 4QL7A 5IMZA 3H4KA 4IN0A 4IHUA 2VAFA 3HDCA 3KCMA 1A0RP
chains in the Genus database with same CATH superfamily
4NWYA 2LS5A 2JZTA 4J56E 3GKNA 1GUHA 4OFMA 2H76A 3VURA 2F8AA 3FR9A 4FH8A 4G0KA 4EUYA 3QAVA 3F4SA 4EL1A 3IPZA 2YWMA 1CQGA 5H5RA 2EIOA 2E7PA 1TP9A 1FOHA 1R26A 4N10A 1WIKA 4K0NA 2H70A 5HR3A 1WJKA 3L78A 1T1VA 3F0IA 2L4CA 2FNOA 4OD7A 1YJ6A 4MNNA 4BVYA 1FHEA 3D4MA 3MYDA 3TRQA 2L59A 2VM1A 1DUGA 5ECLB 4IQ1A 4EC0A 3RAZA 4GLTA 3ED3A 1JLVA 1YEPA 2H75A 4HU9A 4HOJA 2C3TA 1K3YA 4JR4A 2YN1A 2MMAA 2NBSA 2A2PA 5GSSA 4XS1A 5J3RA 1BQ7A 3EINA 1FO5A 5L71A 3ZVJD 2O87A 1BG5A 4YKGA 4PQHA 1F6MC 3IA1A 1SJIA 1GUKA 4MLYA 1SENA 3ME8A 3IR4A 4Z2TA 3WT2A 1PL1A 3V1WA 1TU7A 3IHQA 4AF2A 3FKFA 5DCHA 3DVXA 3TJBA 3RHBA 4IP6A 3FZAA 3GTUB 3L9SA 2YJHA 4NXIA 5ECPB 1MD3A 2B7KA 4LL4B 2XPEA 4WETA 2L6DA 5F07A 2R5GA 2WULA 2E0QA 9GSSA 1BEDA 3KMOA 3QR6A 4MJEA 1BAYA 1THOA 2F9SA 1OYJA 1W4VA 4ZB8A 3LEFA 5G1KA 2REMA 3GN3A 3VFIA 5G2ZA 3GKKA 3Q19A 2JSZA 3HJMA 4X43A 3VWUA 1TRWA 5IMVA 3EURA 4IS0A 1PSQA 1KBNA 4YQUA 3DKSA 5IPHA 5ECRB 1U88A 3ZITA 2M72A 2DC5A 4OMVA 4EDZA 5G5EA 2GLRA 5IMDA 2LSTA 5C04A 1DSBA 2MYGA 6GSSA 4N11A 1TK5B 1S3AA 2HSYA 1NM3A 1JFUA 1GWCA 2I1UA 4MH2A 2N5BA 3IAS2 5BRTA 4NAXA 2C3QA 4MPGA 4GF0A 3APSA 3ISOA 1V57A 1M2DA 2IJYA 2XHFA 4HQZA 5A4VA 1PA3A 3QFBC 1ZOFA 3MNGA 5IOXA 3O3TA 1UC7A 3GSSA 4HUAA 3CQFA 3HVVA 2HRFA 4FQUA 4ZB9A 1C72A 5KN3A 16GSA 5D96A 4JR6A 1GTUA 3SWLA 4G9HA 1WRYA 1SD9A 5IMCA 2H0IA 5D8IA 4L5LA 3TOUA 4MH3A 4FIWA 4I5QA 1GSSA 1Q4JA 2LQQA 3GUSA 3K8NA 3QOUA 2HRAA 4O32A 2YJ7A 1ERWA 5ECMB 4AJ7A 5D73A 1V40A 3CYNA 3P8WA 2LKUA 4MJBA 4WF4A 4MPFA 1Z9HA 5HQPA 2AV4A 2O7KA 2CT6A 3P2AA 5ECIB 2VCXA 3EE2A 3WGEA 1B8XA 2QKEA 4K8MA 2FA8A 2H6XA 1SJ6A 2R6KA 3UJ1A 4HJMA 4K5RA 2CZ2A 1M99A 4CHSA 3TJKA 13GSA 4BIKA 3H93A 5CAXA 4DSRA 4V1Ap 3GKMA 1ERVA 2X49A 2O85A 4ZL9A 2I9HA 3IE3A 3GL3A 2OACA 1AW9A 1GSDA 2L5OA 2JACA 2VD0A 1EWXA 1K0OA 1MDIA 2IMEA 4L0UA 1PMTA 4MK3A 3W8SA 5KOWA 2FD3A 4H86A 4TKYA 3DVWA 4F03A 2CZ3A 5JCUA 2PGTA 4F0BA 4MF6A 2TRXA 3A2WA 2Z9SA 2FA4A 3U6VA 4F82A 2DJ2A 4DSSB 3RPPA 5FWGA 1S3CA 1X9WB 4NMUA 3HZ8A 2GZYA 1USBA 4XS6A 1YQ1A 3APOA 3EVIA 4HI7A 2R2JA 3A2XA 5B8AA 1O73A 3WD6A 2H30A 3BD2A 4BL7B 5AGYA 1PX7A 3TKSC 1XWGA 4KA0A 2XC2A 4Q5QA 3F8UA 1ZL9A 2V41A 4I8BA 4BWQA 3ZIVA 3TJFA 4TN8A 1OC9B 3W8JA 5CRDA 1SK2A 5DBQA 4QL9A 2FGXA 4ID0A 2H6ZA 2YWIA 2CX3A 3GKXA 1TRVA 3FK8A 3GH6A 1SK0A 4MJAA 2HRNA 4HEA2 3CBUA 3PINA 2YWOA 1S3RA 2VLVA 4XRDA 2I3YA 1V58A 2CAIA 1MDKA 1Z3EA 3F6FA 5GAPD 3G7IA 3F3RA 3ZRDA 1FVKA 2MMOA 4IQAA 4POBA 3LJRA 4IJ3A 4ZBDA 4BVYB 3P7XA 1Y6EA 2LRCA 5ELGA 2PMTA 1F3BA 1KEBA 2B5EA 1EP8A 4N0VA 1BYEA 2WDUA 4N0ZA 4EXJA 2RUFA 2GDRA 5A5KA 3LG6A 5G5FA 1U6TA 1NW2A 2OE0A 5GAND 1TI1A 2VCWA 3PR8A 5J41A 4KNDA 1OVNA 3C7MA 3FHKA 1XWAA 5DCGA 2KOKA 2FWFA 2X64A 4JRRA 4PXOA 4GCIA 1QMVA 4USSA 2VM2A 5B6MA 2IMFA 1A0FA 1LU4A 2YZUA 2A2RA 3GX8A 1QXHA 2MMZA 2R3XA 5IPGA 2H01A 3Q18A 2PVOC 2YNXA 1T00A 4IJIA 5DQYA 2H71A 4AJ6A 1GSUA 4GSTA 3I69A 4KW6A 4ECBA 4O7HA 2GSTA 3O76A 4K1FA 3VWXA 5GSTA 5IMFA 1BJXA 3A5WA 2C80A 3O6TA 4WBJA 3N5OA 1KTEA 2D2ZA 5J4UA 8GSSA 1GLQA 4P3YB 3GYKA 1O81A 4XRAA 4D73A 5COHA 2AJQB 3GSTA 4TR3A 2VO4A 1WWJA 3C1RA 3EWLA 5CRWA 1PQNA 2YV7A 4GXZA 2F3MA 2P31A 3ZVJA 5ECNB 1ML6A 2GTUA 1ZCPA 2VIMA 2VCZA 1XWCA 2VL2C 6GSXA 1HNAA 2GSRA 2R0GA 5CP1A 4KDXA 1ACVA 2QA2A 4KGIA 5ELAA 4Z7XA 1AXDA 1EZKA 2HYXA 3KD0A 1TK8B 2LNSA 1ZGNA 4KF9A 4OCFA 4BWSA 5DVBA 1Z6NA 1XCCA 1S3DA 1U3IA 3H79A 5EVOA 4K9ZA 3RPNA 1J0FA 4DVCA 2NPBA 3IK9A 5HR2A 1YDKA 2VL2A 5HR0A 2WCIA 3N9JA 4TR1B 1B4PA 1QQ2A 3UBKA 4PNGA 2FY6A 5KEJA 3BOAA 2HXKA 2NTOA 10GSA 4NV5A 3R3EA 2G2QA 3KXOA 1SL1B 2GQKA 2LJRA 3Q6OA 4EO3A 1A2MA 2YANA 2C0EA 2IL3A 3FR6A 2KP1A 4EIQA 3J7Yb 1OE7A 4EIPA 5G30A 4K0GA 5F8BA 3GFKA 2G0FA 3GL5A 4MA9A 3AY8A 3UEMA 3W6GA 1EEJA 3FZ5A 2VCQA 12GSA 3M0FA 2CX4A 5IOWA 3FR3A 1R5AA 2X8GA 5CRHA 2X8CA 1JZOA 3IHGA 1G6YA 1NHYA 2TRCP 1VF2A 3IK7A 4ZB6A 3Q74A 2H0GA 1NHOA 1PD21 2NVLA 3UOMA 4MF7A 1AQXA 3UBLA 4TVEA 2PUKC 2GSSA 5ECSA 2DJ1A 2R0PA 5ABRA 3VWWA 2JZRA 4IGJA 1A2LA 18GSA 4LMVA 4POKA 1GULA 4Z2UA 4OWYA 1FOVA 1VRSD 1JHBA 1A8LA 1KNGA 1PL2A 1SYRA 2YP6A 1X5DA 1PKWA 3C71A 3RHCA 1G6WA 4Q5RA 1X5EA 4NPBA 3QDNA 3CTFA 3EYTA 1O85A 3FY7A 3WT1A 5INYA 3GV1A 3M8NA 4DSQA 4ML6A 2HSHA 4N30A 5EL8A 3TKQA 2DIZA 2L6CA 3MSZA 2O8VB 1T3BA 3CSIA 3TCOA 1BX9A 4ECIA 5ID2B 3KGKA 1OC8A 4ZL8A 2KHPA 1FB6A 2OE1A 4IBPA 2LV3A 1O8XA 1DE2A 2C1YA 1TW9A 5AIXA 1T8EB 2KP2A 3D21A 1AUCA 5ECQB 3NZNA 2KUCA 1T4YA 3F4RA 4HSCX 2MMNA 4LMWA 1G7EA 2P5RA 4TR1A 2UZ8A 2H1BA 1SL0B 1HNCA 3FMWA 4HQSA 3DD3A 1G7OA 1SU9A 2JSYA 1SYXA 1A23A 5FHIA 4ZL7A 5CO3A 2CQ9A 4F2IA 1YKCA 1FVJA 4NV2A 1Z7PA 3ZMLA 3LORA 5ECHB 3HZ4A 1YKAA 3M9KA 2OE3A 4OO4A 2IMKA 1O6JA 2LRTA 4GSNA 4XIHA 2V1MA 2EC4A 5ECOB 2WZ9A 5D9WA 5DALA 1VF1A 2X99A 5FT3A 2YOIA 1IYHA 3QFAC 3TJGA 3VPTA 4BPYA 3APQA 4OFNA 1PKZA 2QGVA 4IVFA 3F63A 1U87A 5F05A 1EV4A 3ME7A 4FYUA 2ALBA 1Y25A 4XTSA 3UL3A 1QGVA 5AISA 5IM9A 3CTGA 3KH9A 3LSZA 2IMDA 1SL2B 3OR5A 2CVBA 3L9UA 4RI6A 2PN8A 4BVXA 1JZWA 3U5RE 1VF4A 4ZBBA 2GQMA 4NHZA 2OBIA 2HZFA 1LBKA 3UARA 5B8BA 3HVXA 2QA1A 2IIYA 2M80A 4HU7A 5AN1A 3TKSE 1MTCA 1F3AA 4KSOA 3TDGA 1HD2A 5F0GA 3D5JA 1K0AA 1AQVA 4ML1A 5LNKe 2MZCA 2BTOT 4XS4A 5J5NA 3BBYA 6GSTA 2A4HA 1Z5YE 3G7YA 4EDYA 2WGRA 2RM5A 1TU8A 2C0GA 5DJLA 1K0NA 1M2AA 1XFLA 1TKDB 2KLXA 2GT5A 1THXA 2CVDA 5ID2A 2VL3A 1WOUA 4PQ1A 3DEXA 2B6MA 1M9BA 2WJUA 3IXRA 4KCAA 5KOXA 4F9ZA 1WP0A 4PURA 4Q5NA 4ZILA 2IN3A 2DJ3A 3C8EA 1K3OA 1XW5A 2DJJA 4ISDA 5G1LA 4FYCA 2HI7A 3GMFA 1TJDA 2K9FA 1X9MB 2TIRA 2GS3A 4IKHA 3ZIJA 3WGXA 1XWBA 3VI5A 1SD8A 2AB6A 3FRCA 4Q5FA 3PPUA 2GVPA 3DIEA 4CY6A 3ERFA 4PUAA 4D73B 3FYGA 5LCZA 4GQCA 1XW9A 3ZLPA 1XIYA 4Z2RA 2E2GA 2YPMA 22GSA 2H72A 3KEBA 4PX1A 1AAZA 1UA5A 4GTUA 3ZMKA 4ECCA 1M9AA 5C00A 1AIUA 2H1GA 3TJJA 1XG8A 3TKSA 1OKTA 19GSA 2AUVA 1QUWA 1TOFA 3E9JB 2K6VA 4G0LA 1YEXA 4KH7A 1ZYEA 2H73A 2VCVA 4TXOA 4K6XA 3KM6A 2FWEA 5E4WA 4K7IA 2GZPA 5GZZB 2B1LA 2XBQA 2OJLA 3HD5A 3I9V2 4XCSA 1O8WA 2LNTA 3GHAA 3MAKA 3IBHA 2CVKA 3BCIA 4TW5A 3F3QA 1ST9A 4LLRA 1DBYA 2ZCTA 2H6YA 7GSSA 3S9FA 4QQ7A 4EVMA 3NIVA 2VD1A 5KN2A 2H66A 3TB2A 2C3NA 4V2NA 1GNEA 5IQYA 4DEJA 2BJXA 2R37A 3CMIA 2LTKA 2PPTA 1FB0A 3ZL5A 1EOGA 4X0XA 1H4OA 3GH9A 14GSA 4E8EA 2V6OA 4A5PA 3FZ9A 5CREA 1M2BA 4POMA 2PWJA 2LRNA 2H0HA 3MWHA 4TXVA 1PGTA 4I2TA 4RQRA 4RUVA 2JU5A 2WS2A 2DJKA 4L5OA 4O5UA 3GX0A 3TGZA 4TRXA 5JWRB 1V2AA 4NHWA 1XPVA 4WXTA 3QAGA 1GP1A 1XOAA 2FHEA 4J57E 4ICYA 3NOFA 4K5SA 5JCGA 2DKHA 4FYBA 3M9JA 3I43A 3EU4A 1HQOA 2LUSA 5DJMA 4YAPA 1R5PA 1GH2A 5DQSA 2HFDA 1F9MA 2R4VA 2MBSA 1PN9A 4I2UA 2H8LA 5ECKB 4MABA 5KN0A 1XZOA 2DKIA 2JADA 1LJRA 1GSYA 3TRPA 3FZ4A 2JL4A 3BCKA 4JU5A 4ILFA 1GNWA 1XWKA 2B5XA 1TDIA 3DYRA 4PUFC 1B4QA 2F51A 5KN1A 1W89A 3BJ5A 3D22A 2O89A 4KSMA 2PVQA 4HDEA 4KX4A 3LYPA 2HT9A 2GZZA 4ZBAA 1ERUA 1J9BA 4POLA 4EF0A 3L4NA 4O5RA 1AC1A 4G2EA 5CNWA 2DMLA 2HLSA 2B1KA 3QMXA 3D0ZA 5HFKA 3MDKA 1Q98A 4CDOA 3IAM2 1SKRB 3DGQA 4KDYA 4V1Ag 1GSFA 2ZNMA 4KAEA 2DIYA 1M3IA 2IFQA 3LGCA 4MF5A 4JBBA 1H75A 2IPAA 2J23A 3UAPA 1GSEA 3E3EA 2RM6A 1T4ZA 3LXZA 3A3TA 5DALB 3IDVA 3TKRA 4YH2A 3J7Yk 1PRXA 4OO5A 2VOCA 1JZDA 17GSA 2OKAA 1GLPA 3HXSA 2L57A 2YV9A 1ON4A 1HYUA 5J9CA 1B9YC 4TR4A 4EKZA 1TI3A 2V6KA 5ENUA 1R7HA 1A8YA 5EPFA 3P90A 1ZYPA 4ULXA 4IP1A 3HVNA 4TR0A 4BVXB 1Z6MA 4L8EA 2I81A 4X4JA 3ZTLA 11GSA 2ZUPA 1B48A 2ES7A 2H1AA 3VPQA 1OC3A 1TRUA 1N8JA 2PBJA 4JZQA 4XS4B 1PN0A 2EIRA 3HCZA 2I4AA 3LW9A 1F2EA 1V98A 3R2QA 5G31A 1ZYQB 5D9TA 6GSWA 4GQFA 5DAKA 3TKPA 3F6DA 1B9XC 2DBCA 2A2SA 3SBCA 4ZXGA 2PU9C 4GRFA 5E59A 1SK1A 2NDOA 2H74A 3TRXA 2BMXA 2HZEA 3IOSA 1AQWA 2R0CA 3KH7A 3LYKA 6GSUA 1K3LA 4F0CA 3HA9A 2FUG2 2QSIA 1TK0B 2LJAA 1I9DA 2X4AA 1YF1A 2RLIA 4K7NA 1A2JA 3JCML 5HFIA 3PGTA 1R4WA 1EGRA 4G0IA 3KTBA 4TOPA 1ABAA 5IO0A 2V2GA 3KJYA 4OCEA 1X9SB 5IMAA 2H19A 3UVHA 1X0RA 3FW2A 5CRGA 1J08A 2RUEA 2C0FA 4WKWA 1RW1A 3KP9A 3M1GA 2WRTA 3KZQA 1GTAA 1XVWA 3CRUA 1ZMAA 4MZWA 6GSYA 4IW9A 2ON7A 1F37A 3QAWA 4PQIA 4AGSA 4ECJA 4I6XA 3EU3A 4HS1A 1UN2A 2DJ0A 4L0WA 5JWOB 1OAZA 2RIIA 4K2DA 2C4JA 5A4UA 3E0UA 3VI7A 1WMJA 2C8UA 1YZXA 2YZHA 2HE3A 4KCEA 2CV4A 1I5GA 3MIXA 3UVTA 4PTSA 2GQLA 3IRAA 4HJ2A 1OKDA 2XPDA 2MBTA 2C0DA 2DMMA 1ERTA 4TXOB 3IC8A 1EGOA 4KUNA 3IV4A 2VL9A 2OADA 3RDWA 3HHVA 4G19A 1VF3A 1HNBA 3GTUA 3RBTA 2OA7A 4EE0A 3L0HA 5HR1A 2B3SA 3A2VA 1OE8A 3M3MA 4I97A 1FAAA 3QD9A 1PFOA 3GURA 3TOTA 3HKRA 1RQMA 2X8HA 4X1UA 4J2FA 4AJ8A 3LXTA 3EMXA 5HFGA 3G7JA 3VWVA 3EPTA 3IC4A 4E8HA 3DXBA 2HRKA 1TRSA 2QC7A 4V2MA 3WGDA 3C73A 2FWGA 3ERGA 2WB9A 3GNJA 4CY8A 3UIWA 3LWAA 1K0CA 3DMLA 4KDUA 2K8SA 1GTBA 3D6IA 2AYTA 2HSMA 1UVZA 5J9BA 3UMAA 3KTLA 4MP4A 4MZBA 4BA7A 1ZZYA 1RK4A 3CRTA 4MCUA 3PH9A 2FLSA 2YCDA 3F4TA 2B5YA 1EV9A 2N5AA 1A24A 2VCTA 2A4VA 1WE0A 3VK9A 3US3A 4CW9A 1M3JA 3KMNA 2AAWA 4G10A 1YY7A 2VUPA 1GSQA 3QPMA 2K18A 4WR5A 3D4TA 1QK8A 1EEMA 1MEKA 5D9VA 2ON5A 6GSVA 1M0UA 1JZRA 1GTIA 1DE1A 2VLTA 4ACSA 3ZFBA 1PX6A 3L9VA 3LFLA 1URMA 1K0MA 2M46A 3H8QA 3CSHA 4WR4A 4K7OA 4MJCA 5F06A 2DLXA 5JWQB 3ZZXA 2EIQA 1SKSB 4PNFA 1ZYNA 3C1SA 1MDJA 1X5CA 1EOHA 1GUMA 2LJKA 5A4WA 1GL8A 3HY2A 1SKWB 4GSSA 3CSJA 5IO2A 4K2XA 3HJPA 2B7JA 2K8VA 1MD4A 4YQMA 2HNLA 4RI7A 5D93A 2FWHA 2J9HA 5BMUA 1M7TA 1XW6A 2LQOA 1NSWA 1IYIA 3H1NA 4HZ4A 4LA1A 2P0GA 4LL1B 5B6NA 3DRNA 3VLNA 4KB3A 2F8FA 3F9UA 1VGLA 1N2AA 4OFTA 1WPIA 3GIXA 1O7UA 3WYWA 1V9WA 3KIJA 2JZSA 1XOBA 5B7CA 2GGTA 1K0DA 1TTZA 3QCPA 4ZIJA 2IMIA 2IWTA 3A5IA 3CXGA 3ZFLA 2IFQB 3GA4A 3HVSA 3HJOA 5H5QA 2N5FA 4O5QA 2AHEA 4V2LA 1K0BA 3ZREA 4FO5A 4WBRD 4WF5A 5H5SA 3EC3A 2XBIA 3TUEA 1Z7RA 1XBSA 4WEYA 1FG4A 2OBKA 4RQXA 3ERWA 4YQVA 5AIVA 4HZ2A 2PERA 1E2YA 3FEUA 3HYPA 4MDCA 1FW1A 4KE3A 2V32A 1ILOA 2VLUA 2CA8A 4O92A 1E6BA 1JLWA 5IIZA 2WFCA 4DSSA 2YWNA 2L5LA 4GWRA 5DDLA 2CAQA 1TXXA 4XHMA 1G0TA 1XXUA 1U3AA 4JEDA 1SJZA 5D9XA 3ZYWA 4MMMA 1QFNA 5LD0A 1T7PB 4IELA 2L4QA 5JCWA 5DAKB 2P5QA 2GT6A 1YF0A 3EMPA 4MZCA 4YKFA 2DSAA 1EP7A 2E2MA 2H1DA 4BL7A 3LQ7A 5CYYA 2HZEB 4JE1A 1CQHA 3I6AA 3DWVA 2FCHA 3G9BA 5EY6A 1XVQA 1GRXA 2LEGA 20GSA 2GSQA 3KP8A 4YAVA 4PGTA 3GRXA 1OC9A 4QL7A 5IMZA 3H4KA 4IN0A 4IHUA 2VAFA 3HDCA 3KCMA 1A0RP
chains in the Genus database with same CATH topology
4NWYA 2LS5A 2JZTA 4J56E 3GKNA 1GUHA 4OFMA 2H76A 3VURA 2F8AA 3FR9A 4FH8A 4G0KA 4EUYA 3QAVA 3F4SA 4EL1A 3IPZA 2YWMA 1CQGA 5H5RA 2EIOA 2E7PA 1TP9A 1FOHA 1R26A 4N10A 1WIKA 4K0NA 2H70A 5HR3A 1WJKA 3L78A 1T1VA 3F0IA 2L4CA 2FNOA 4OD7A 1YJ6A 4MNNA 4BVYA 1FHEA 3D4MA 3MYDA 3TRQA 2L59A 2VM1A 1DUGA 5ECLB 4IQ1A 4EC0A 3RAZA 4GLTA 3ED3A 1JLVA 1YEPA 2H75A 4HU9A 4HOJA 2C3TA 1K3YA 4JR4A 2YN1A 2MMAA 2NBSA 2A2PA 5GSSA 4XS1A 5J3RA 1BQ7A 3EINA 1FO5A 5L71A 3ZVJD 2O87A 1BG5A 4YKGA 4PQHA 1F6MC 3IA1A 1SJIA 1GUKA 4MLYA 1SENA 3ME8A 3IR4A 4Z2TA 3WT2A 1PL1A 3V1WA 1TU7A 3IHQA 4AF2A 3FKFA 5DCHA 3DVXA 3TJBA 3RHBA 4IP6A 3FZAA 3GTUB 3L9SA 2YJHA 4NXIA 5ECPB 1MD3A 2B7KA 4LL4B 2XPEA 4WETA 2L6DA 5F07A 2R5GA 2WULA 2E0QA 9GSSA 1BEDA 3KMOA 3QR6A 4MJEA 1BAYA 1THOA 2F9SA 1OYJA 1W4VA 4ZB8A 3LEFA 5G1KA 2REMA 3GN3A 3VFIA 5G2ZA 3GKKA 3Q19A 2JSZA 3HJMA 4X43A 3VWUA 1TRWA 5IMVA 3EURA 4IS0A 1PSQA 1KBNA 4YQUA 3DKSA 5IPHA 5ECRB 1U88A 3ZITA 2M72A 2DC5A 4OMVA 4EDZA 5G5EA 2GLRA 5IMDA 2LSTA 5C04A 1DSBA 2MYGA 6GSSA 4N11A 1TK5B 1S3AA 2HSYA 1NM3A 1JFUA 1GWCA 2I1UA 4MH2A 2N5BA 3IAS2 5BRTA 4NAXA 2C3QA 4MPGA 4GF0A 3APSA 3ISOA 1V57A 1M2DA 2IJYA 2XHFA 4HQZA 5A4VA 1PA3A 3QFBC 1ZOFA 3MNGA 5IOXA 3O3TA 1UC7A 3GSSA 4HUAA 3HVVA 2HRFA 4FQUA 4ZB9A 1C72A 5KN3A 16GSA 5D96A 4JR6A 1GTUA 3SWLA 4G9HA 1WRYA 1SD9A 5IMCA 2H0IA 5D8IA 4L5LA 3TOUA 4MH3A 4FIWA 4I5QA 1GSSA 1Q4JA 2LQQA 3GUSA 3K8NA 3QOUA 2HRAA 4O32A 2YJ7A 1ERWA 5ECMB 4AJ7A 5D73A 1V40A 3CYNA 3P8WA 2LKUA 4MJBA 4WF4A 4MPFA 1Z9HA 5HQPA 2AV4A 2O7KA 2CT6A 3P2AA 5ECIB 2VCXA 3EE2A 3WGEA 1B8XA 2QKEA 4K8MA 2FA8A 2H6XA 1SJ6A 2R6KA 3UJ1A 4HJMA 4K5RA 2CZ2A 1M99A 4CHSA 3TJKA 13GSA 3H93A 5CAXA 4DSRA 4V1Ap 3GKMA 1ERVA 2X49A 2O85A 4ZL9A 2I9HA 3IE3A 3GL3A 2OACA 1AW9A 1GSDA 2L5OA 2JACA 2VD0A 1EWXA 1K0OA 1MDIA 2IMEA 4L0UA 1PMTA 4MK3A 3W8SA 5KOWA 2FD3A 4H86A 4TKYA 3DVWA 4F03A 2CZ3A 5JCUA 2PGTA 4F0BA 4MF6A 2TRXA 3A2WA 2Z9SA 2FA4A 3U6VA 4F82A 2DJ2A 4DSSB 3RPPA 5FWGA 1S3CA 1X9WB 4NMUA 3HZ8A 2GZYA 1USBA 4XS6A 1YQ1A 3APOA 3EVIA 4HI7A 2R2JA 3A2XA 5B8AA 1O73A 3WD6A 2H30A 3BD2A 4BL7B 5AGYA 1PX7A 3TKSC 1XWGA 4KA0A 2XC2A 4Q5QA 3F8UA 1ZL9A 2V41A 4I8BA 4BWQA 3ZIVA 3TJFA 4TN8A 1OC9B 3W8JA 5CRDA 1SK2A 5DBQA 4QL9A 2FGXA 4ID0A 2H6ZA 2YWIA 2CX3A 3GKXA 1TRVA 3FK8A 3GH6A 1SK0A 4MJAA 2HRNA 4HEA2 3CBUA 3PINA 2YWOA 2VLVA 4XRDA 2I3YA 1V58A 2CAIA 1MDKA 1Z3EA 3F6FA 5GAPD 3G7IA 3F3RA 3ZRDA 1FVKA 2MMOA 4IQAA 4POBA 3LJRA 4IJ3A 4ZBDA 4BVYB 3P7XA 1Y6EA 2LRCA 5ELGA 2PMTA 1F3BA 1KEBA 2B5EA 1EP8A 4N0VA 1BYEA 2WDUA 4N0ZA 4EXJA 2RUFA 2GDRA 5A5KA 3LG6A 5G5FA 1U6TA 1NW2A 2OE0A 5GAND 1TI1A 2VCWA 3PR8A 5J41A 4KNDA 1OVNA 3C7MA 3FHKA 1XWAA 5DCGA 2KOKA 2FWFA 2X64A 4JRRA 4PXOA 4GCIA 1QMVA 4USSA 2VM2A 5B6MA 2IMFA 1A0FA 1LU4A 2YZUA 2A2RA 3GX8A 1QXHA 2MMZA 2R3XA 5IPGA 2H01A 3Q18A 2PVOC 2YNXA 1T00A 4IJIA 5DQYA 2H71A 4AJ6A 1GSUA 4GSTA 3I69A 4KW6A 4ECBA 4O7HA 2GSTA 3O76A 4K1FA 3VWXA 5GSTA 5IMFA 1BJXA 3A5WA 2C80A 3O6TA 4WBJA 3N5OA 1KTEA 2D2ZA 5J4UA 8GSSA 1GLQA 4P3YB 3GYKA 1O81A 4XRAA 4D73A 5COHA 2AJQB 3GSTA 4TR3A 2VO4A 1WWJA 3C1RA 3EWLA 5CRWA 1PQNA 2YV7A 4GXZA 2F3MA 2P31A 3ZVJA 5ECNB 1ML6A 2GTUA 1ZCPA 2VIMA 2VCZA 1XWCA 2VL2C 6GSXA 1HNAA 2GSRA 2R0GA 5CP1A 4KDXA 1ACVA 2QA2A 4KGIA 5ELAA 4Z7XA 1AXDA 1EZKA 2HYXA 3KD0A 1TK8B 2LNSA 1ZGNA 4KF9A 4OCFA 4BWSA 5DVBA 1Z6NA 1XCCA 1S3DA 1U3IA 3H79A 5EVOA 4K9ZA 3RPNA 1J0FA 4DVCA 2NPBA 3IK9A 5HR2A 1YDKA 2VL2A 5HR0A 2WCIA 3N9JA 4TR1B 1B4PA 1QQ2A 3UBKA 4PNGA 2FY6A 5KEJA 3BOAA 2HXKA 2NTOA 10GSA 4NV5A 3R3EA 2G2QA 3KXOA 1SL1B 2GQKA 2LJRA 3Q6OA 4EO3A 1A2MA 2YANA 2C0EA 2IL3A 3FR6A 2KP1A 4EIQA 3J7Yb 1OE7A 4EIPA 5G30A 4K0GA 5F8BA 3GFKA 2G0FA 3GL5A 4MA9A 3AY8A 3UEMA 3W6GA 1EEJA 3FZ5A 2VCQA 12GSA 3M0FA 2CX4A 5IOWA 3FR3A 1R5AA 2X8GA 5CRHA 2X8CA 1JZOA 3IHGA 1G6YA 1NHYA 2TRCP 1VF2A 3IK7A 4ZB6A 3Q74A 2H0GA 1NHOA 1PD21 2NVLA 3UOMA 4MF7A 1AQXA 3UBLA 4TVEA 2PUKC 2GSSA 5ECSA 2DJ1A 2R0PA 5ABRA 3VWWA 2JZRA 4IGJA 1A2LA 18GSA 4LMVA 4POKA 1GULA 4Z2UA 4OWYA 1FOVA 1VRSD 1JHBA 1A8LA 1KNGA 1PL2A 1SYRA 2YP6A 1X5DA 1PKWA 3C71A 3RHCA 1G6WA 4Q5RA 1X5EA 4NPBA 3QDNA 3CTFA 3EYTA 1O85A 3FY7A 3WT1A 5INYA 3GV1A 3M8NA 4DSQA 4ML6A 2HSHA 4N30A 5EL8A 3TKQA 2DIZA 2L6CA 3MSZA 2O8VB 1T3BA 3CSIA 3TCOA 1BX9A 4ECIA 5ID2B 3KGKA 1OC8A 4ZL8A 2KHPA 1FB6A 2OE1A 4IBPA 2LV3A 1O8XA 1DE2A 2C1YA 1TW9A 5AIXA 1T8EB 2KP2A 3D21A 1AUCA 5ECQB 3NZNA 2KUCA 1T4YA 3F4RA 2MMNA 4LMWA 1G7EA 2P5RA 4TR1A 2UZ8A 2H1BA 1SL0B 1HNCA 3FMWA 4HQSA 3DD3A 1G7OA 1SU9A 2JSYA 1SYXA 1A23A 5FHIA 4ZL7A 5CO3A 2CQ9A 4F2IA 1YKCA 1FVJA 4NV2A 1Z7PA 3ZMLA 3LORA 5ECHB 3HZ4A 1YKAA 3M9KA 2OE3A 4OO4A 2IMKA 1O6JA 2LRTA 4GSNA 4XIHA 2V1MA 2EC4A 5ECOB 2WZ9A 5D9WA 5DALA 1VF1A 2X99A 5FT3A 2YOIA 1IYHA 3QFAC 3TJGA 3VPTA 4BPYA 3APQA 4OFNA 1PKZA 2QGVA 4IVFA 3F63A 1U87A 5F05A 1EV4A 3ME7A 4FYUA 2ALBA 1Y25A 4XTSA 3UL3A 1QGVA 5AISA 5IM9A 3CTGA 3KH9A 3LSZA 2IMDA 1SL2B 3OR5A 2CVBA 3L9UA 4RI6A 2PN8A 4BVXA 1JZWA 3U5RE 1VF4A 4ZBBA 2GQMA 4NHZA 2OBIA 2HZFA 1LBKA 3UARA 5B8BA 3HVXA 2QA1A 2IIYA 2M80A 4HU7A 5AN1A 3TKSE 1MTCA 1F3AA 4KSOA 3TDGA 1HD2A 5F0GA 3D5JA 1K0AA 1AQVA 4ML1A 5LNKe 2MZCA 2BTOT 4XS4A 5J5NA 3BBYA 6GSTA 2A4HA 1Z5YE 3G7YA 4EDYA 2WGRA 2RM5A 1TU8A 2C0GA 5DJLA 1K0NA 1M2AA 1XFLA 1TKDB 2KLXA 2GT5A 1THXA 2CVDA 5ID2A 2VL3A 1WOUA 4PQ1A 3DEXA 2B6MA 1M9BA 2WJUA 3IXRA 4KCAA 5KOXA 4F9ZA 1WP0A 4PURA 4Q5NA 4ZILA 2IN3A 2DJ3A 3C8EA 1K3OA 1XW5A 2DJJA 4ISDA 5G1LA 4FYCA 2HI7A 3GMFA 1TJDA 2K9FA 1X9MB 2TIRA 2GS3A 4IKHA 3ZIJA 3WGXA 1XWBA 3VI5A 1SD8A 2AB6A 3FRCA 4Q5FA 3PPUA 2GVPA 3DIEA 4CY6A 3ERFA 4PUAA 4D73B 3FYGA 5LCZA 4GQCA 1XW9A 3ZLPA 1XIYA 4Z2RA 2E2GA 2YPMA 22GSA 2H72A 3KEBA 4PX1A 1AAZA 1UA5A 4GTUA 3ZMKA 4ECCA 1M9AA 5C00A 1AIUA 2H1GA 3TJJA 3TKSA 1OKTA 19GSA 2AUVA 1QUWA 1TOFA 3E9JB 2K6VA 4G0LA 1YEXA 4KH7A 1ZYEA 2H73A 2VCVA 4TXOA 4K6XA 3KM6A 2FWEA 5E4WA 4K7IA 2GZPA 5GZZB 2B1LA 2XBQA 2OJLA 3HD5A 3I9V2 4XCSA 1O8WA 2LNTA 3GHAA 3MAKA 3IBHA 2CVKA 3BCIA 4TW5A 3F3QA 1ST9A 4LLRA 1DBYA 2ZCTA 2H6YA 7GSSA 3S9FA 4QQ7A 4EVMA 3NIVA 2VD1A 5KN2A 2H66A 3TB2A 2C3NA 4V2NA 1GNEA 5IQYA 4DEJA 2BJXA 2R37A 3CMIA 2LTKA 2PPTA 1FB0A 3ZL5A 1EOGA 4X0XA 1H4OA 3GH9A 14GSA 4E8EA 2V6OA 4A5PA 3FZ9A 5CREA 1M2BA 4POMA 2PWJA 2LRNA 2H0HA 3MWHA 4TXVA 1PGTA 4I2TA 4RQRA 4RUVA 2JU5A 2WS2A 2DJKA 4L5OA 4O5UA 3GX0A 3TGZA 4TRXA 5JWRB 1V2AA 4NHWA 1XPVA 4WXTA 3QAGA 1GP1A 1XOAA 2FHEA 4J57E 4ICYA 3NOFA 4K5SA 5JCGA 2DKHA 4FYBA 3M9JA 3I43A 3EU4A 1HQOA 2LUSA 5DJMA 4YAPA 1R5PA 1GH2A 5DQSA 2HFDA 1F9MA 2R4VA 2MBSA 1PN9A 4I2UA 2H8LA 5ECKB 4MABA 5KN0A 1XZOA 2DKIA 2JADA 1LJRA 1GSYA 3TRPA 3FZ4A 2JL4A 3BCKA 4JU5A 4ILFA 1GNWA 1XWKA 2B5XA 1TDIA 3DYRA 4PUFC 1B4QA 2F51A 5KN1A 1W89A 3BJ5A 3D22A 2O89A 4KSMA 2PVQA 4HDEA 4KX4A 3LYPA 2HT9A 2GZZA 4ZBAA 1ERUA 1J9BA 4POLA 4EF0A 3L4NA 4O5RA 1AC1A 4G2EA 5CNWA 2DMLA 2HLSA 2B1KA 3QMXA 3D0ZA 5HFKA 3MDKA 1Q98A 4CDOA 3IAM2 1SKRB 3DGQA 4KDYA 4V1Ag 1GSFA 2ZNMA 4KAEA 2DIYA 2IFQA 3LGCA 4MF5A 4JBBA 1H75A 2IPAA 2J23A 3UAPA 1GSEA 3E3EA 2RM6A 1T4ZA 3LXZA 3A3TA 5DALB 3IDVA 3TKRA 4YH2A 3J7Yk 1PRXA 4OO5A 2VOCA 1JZDA 17GSA 2OKAA 1GLPA 3HXSA 2L57A 2YV9A 1ON4A 1HYUA 5J9CA 1B9YC 4TR4A 4EKZA 1TI3A 2V6KA 5ENUA 1R7HA 1A8YA 5EPFA 3P90A 1ZYPA 4ULXA 4IP1A 4TR0A 4BVXB 1Z6MA 4L8EA 2I81A 4X4JA 3ZTLA 11GSA 2ZUPA 1B48A 2ES7A 2H1AA 3VPQA 1OC3A 1TRUA 1N8JA 2PBJA 4JZQA 4XS4B 1PN0A 2EIRA 3HCZA 2I4AA 3LW9A 1F2EA 1V98A 3R2QA 5G31A 1ZYQB 5D9TA 6GSWA 4GQFA 5DAKA 3TKPA 3F6DA 1B9XC 2DBCA 2A2SA 3SBCA 4ZXGA 2PU9C 4GRFA 5E59A 1SK1A 2NDOA 2H74A 3TRXA 2BMXA 2HZEA 3IOSA 1AQWA 2R0CA 3KH7A 3LYKA 6GSUA 1K3LA 4F0CA 3HA9A 2FUG2 2QSIA 1TK0B 2LJAA 1I9DA 2X4AA 1YF1A 2RLIA 4K7NA 1A2JA 3JCML 5HFIA 3PGTA 1R4WA 1EGRA 4G0IA 3KTBA 4TOPA 1ABAA 5IO0A 2V2GA 3KJYA 4OCEA 1X9SB 5IMAA 2H19A 3UVHA 1X0RA 3FW2A 5CRGA 1J08A 2RUEA 2C0FA 4WKWA 1RW1A 3KP9A 3M1GA 2WRTA 3KZQA 1GTAA 1XVWA 3CRUA 1ZMAA 4MZWA 6GSYA 4IW9A 2ON7A 1F37A 3QAWA 4PQIA 4AGSA 4ECJA 4I6XA 3EU3A 4HS1A 1UN2A 2DJ0A 4L0WA 5JWOB 1OAZA 2RIIA 4K2DA 2C4JA 5A4UA 3E0UA 3VI7A 1WMJA 2C8UA 1YZXA 2YZHA 2HE3A 4KCEA 2CV4A 1I5GA 3MIXA 3UVTA 4PTSA 2GQLA 3IRAA 4HJ2A 1OKDA 2XPDA 2MBTA 2C0DA 2DMMA 1ERTA 4TXOB 3IC8A 1EGOA 4KUNA 3IV4A 2VL9A 2OADA 3RDWA 3HHVA 4G19A 1VF3A 1HNBA 3GTUA 3RBTA 2OA7A 4EE0A 3L0HA 5HR1A 2B3SA 3A2VA 1OE8A 3M3MA 4I97A 1FAAA 3QD9A 3GURA 3TOTA 3HKRA 1RQMA 2X8HA 4X1UA 4J2FA 4AJ8A 3LXTA 3EMXA 5HFGA 3G7JA 3VWVA 3EPTA 3IC4A 4E8HA 3DXBA 2HRKA 1TRSA 2QC7A 4V2MA 3WGDA 3C73A 2FWGA 3ERGA 2WB9A 3GNJA 4CY8A 3UIWA 3LWAA 1K0CA 3DMLA 4KDUA 2K8SA 1GTBA 3D6IA 2AYTA 2HSMA 1UVZA 5J9BA 3UMAA 3KTLA 4MP4A 4MZBA 4BA7A 1ZZYA 1RK4A 3CRTA 4MCUA 3PH9A 2FLSA 2YCDA 3F4TA 2B5YA 1EV9A 2N5AA 1A24A 2VCTA 2A4VA 1WE0A 3VK9A 3US3A 4CW9A 3KMNA 2AAWA 4G10A 1YY7A 2VUPA 1GSQA 3QPMA 2K18A 4WR5A 3D4TA 1QK8A 1EEMA 1MEKA 5D9VA 2ON5A 6GSVA 1M0UA 1JZRA 1GTIA 1DE1A 2VLTA 4ACSA 3ZFBA 1PX6A 3L9VA 3LFLA 1URMA 1K0MA 2M46A 3H8QA 3CSHA 4WR4A 4K7OA 4MJCA 5F06A 2DLXA 5JWQB 3ZZXA 2EIQA 1SKSB 4PNFA 1ZYNA 3C1SA 1MDJA 1X5CA 1EOHA 1GUMA 2LJKA 5A4WA 1GL8A 3HY2A 1SKWB 4GSSA 3CSJA 5IO2A 4K2XA 3HJPA 2B7JA 2K8VA 1MD4A 4YQMA 2HNLA 4RI7A 5D93A 2FWHA 2J9HA 5BMUA 1M7TA 1XW6A 2LQOA 1NSWA 1IYIA 3H1NA 4HZ4A 4LA1A 2P0GA 4LL1B 5B6NA 3DRNA 3VLNA 4KB3A 2F8FA 3F9UA 1VGLA 1N2AA 4OFTA 1WPIA 3GIXA 1O7UA 3WYWA 1V9WA 3KIJA 2JZSA 1XOBA 5B7CA 2GGTA 1K0DA 1TTZA 3QCPA 4ZIJA 2IMIA 2IWTA 3A5IA 3CXGA 3ZFLA 2IFQB 3GA4A 3HVSA 3HJOA 5H5QA 2N5FA 4O5QA 2AHEA 4V2LA 1K0BA 3ZREA 4FO5A 4WBRD 4WF5A 5H5SA 3EC3A 2XBIA 3TUEA 1Z7RA 1XBSA 4WEYA 1FG4A 2OBKA 4RQXA 3ERWA 4YQVA 5AIVA 4HZ2A 2PERA 1E2YA 3FEUA 3HYPA 4MDCA 1FW1A 4KE3A 2V32A 1ILOA 2VLUA 2CA8A 4O92A 1E6BA 1JLWA 5IIZA 2WFCA 4DSSA 2YWNA 2L5LA 4GWRA 5DDLA 2CAQA 1TXXA 4XHMA 1G0TA 1XXUA 1U3AA 4JEDA 1SJZA 5D9XA 3ZYWA 4MMMA 1QFNA 5LD0A 1T7PB 4IELA 2L4QA 5JCWA 5DAKB 2P5QA 2GT6A 1YF0A 3EMPA 4MZCA 4YKFA 2DSAA 1EP7A 2E2MA 2H1DA 4BL7A 3LQ7A 5CYYA 2HZEB 4JE1A 1CQHA 3I6AA 3DWVA 2FCHA 3G9BA 5EY6A 1XVQA 1GRXA 2LEGA 20GSA 2GSQA 3KP8A 4YAVA 4PGTA 3GRXA 1OC9A 4QL7A 5IMZA 3H4KA 4IN0A 4IHUA 2VAFA 3HDCA 3KCMA 1A0RP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NWY A;  2LS5 A;  2JZT A;  4J56 E;  3GKN A;  1GUH A;  4OFM A;  2H76 A;  3VUR A;  2F8A A;  3FR9 A;  4FH8 A;  4EUY A;  3QAV A;  3F4S A;  4EL1 A;  3IPZ A;  2YWM A;  1CQG A;  5H5R A;  2EIO A;  2E7P A;  1TP9 A;  1R26 A;  4N10 A;  1WIK A;  4K0N A;  2H70 A;  5HR3 A;  1WJK A;  3L78 A;  1T1V A;  3F0I A;  2L4C A;  2FNO A;  4OD7 A;  1YJ6 A;  4BVY A;  1FHE A;  3D4M A;  3TRQ A;  2L59 A;  2VM1 A;  1DUG A;  5ECL B;  4IQ1 A;  4EC0 A;  3RAZ A;  4GLT A;  3ED3 A;  1JLV A;  1YEP A;  2H75 A;  4HU9 A;  4HOJ A;  2C3T A;  1K3Y A;  4JR4 A;  2YN1 A;  2MMA A;  2NBS A;  5GSS A;  4XS1 A;  5J3R A;  1BQ7 A;  3EIN A;  1FO5 A;  5L71 A;  3ZVJ D;  2O87 A;  1BG5 A;  4PQH A;  1F6M C;  3IA1 A;  1SJI A;  1GUK A;  4MLY A;  1SEN A;  3ME8 A;  3IR4 A;  3WT2 A;  1PL1 A;  3V1W A;  1TU7 A;  3IHQ A;  4AF2 A;  3FKF A;  5DCH A;  3DVX A;  3TJB A;  3RHB A;  4IP6 A;  3FZA A;  3GTU B;  3L9S A;  2YJH A;  4NXI A;  5ECP B;  1MD3 A;  2B7K A;  4LL4 B;  2XPE A;  4WET A;  2L6D A;  5F07 A;  2R5G A;  2WUL A;  2E0Q A;  9GSS A;  1BED A;  3KMO A;  3QR6 A;  4MJE A;  1BAY A;  1THO A;  2F9S A;  1OYJ A;  1W4V A;  4ZB8 A;  3LEF A;  5G1K A;  2REM A;  3GN3 A;  3VFI A;  5G2Z A;  3GKK A;  3Q19 A;  2JSZ A;  3HJM A;  4X43 A;  3VWU A;  1TRW A;  5IMV A;  3EUR A;  4IS0 A;  1PSQ A;  1KBN A;  4YQU A;  3DKS A;  5IPH A;  5ECR B;  1U88 A;  3ZIT A;  2M72 A;  2DC5 A;  4OMV A;  4EDZ A;  5G5E A;  2GLR A;  5IMD A;  2LST A;  5C04 A;  1DSB A;  2MYG A;  6GSS A;  4N11 A;  1TK5 B;  1S3A A;  2HSY A;  1NM3 A;  1JFU A;  1GWC A;  2I1U A;  4MH2 A;  2N5B A;  3IAS 2;  4NAX A;  2C3Q A;  4MPG A;  4GF0 A;  3APS A;  3ISO A;  1V57 A;  1M2D A;  2IJY A;  2XHF A;  4HQZ A;  5A4V A;  1PA3 A;  3QFB C;  1ZOF A;  3MNG A;  5IOX A;  3O3T A;  1UC7 A;  3GSS A;  4HUA A;  3HVV A;  2HRF A;  4ZB9 A;  1C72 A;  5KN3 A;  16GS A;  5D96 A;  4JR6 A;  1GTU A;  3SWL A;  4G9H A;  1WRY A;  1SD9 A;  5IMC A;  2H0I A;  5D8I A;  4L5L A;  3TOU A;  4MH3 A;  4FIW A;  4I5Q A;  1GSS A;  1Q4J A;  2LQQ A;  3GUS A;  3K8N A;  3QOU A;  4O32 A;  2YJ7 A;  1ERW A;  5ECM B;  4AJ7 A;  5D73 A;  1V40 A;  3CYN A;  3P8W A;  2LKU A;  4MJB A;  4WF4 A;  4MPF A;  1Z9H A;  5HQP A;  2AV4 A;  2O7K A;  2CT6 A;  3P2A A;  5ECI B;  2VCX A;  3EE2 A;  3WGE A;  1B8X A;  2QKE A;  4K8M A;  2FA8 A;  2H6X A;  1SJ6 A;  2R6K A;  3UJ1 A;  4HJM A;  2CZ2 A;  1M99 A;  4CHS A;  3TJK A;  13GS A;  3H93 A;  5CAX A;  4DSR A;  4V1A p;  3GKM A;  1ERV A;  2O85 A;  4ZL9 A;  2I9H A;  3IE3 A;  3GL3 A;  2OAC A;  1AW9 A;  1GSD A;  2L5O A;  2JAC A;  2VD0 A;  1EWX A;  1K0O A;  1MDI A;  2IME A;  4L0U A;  1PMT A;  4MK3 A;  3W8S A;  2FD3 A;  4H86 A;  4TKY A;  3DVW A;  4F03 A;  2CZ3 A;  5JCU A;  2PGT A;  4F0B A;  4MF6 A;  2TRX A;  3A2W A;  2Z9S A;  2FA4 A;  3U6V A;  4F82 A;  2DJ2 A;  4DSS B;  3RPP A;  5FWG A;  1S3C A;  1X9W B;  4NMU A;  3HZ8 A;  2GZY A;  1USB A;  4XS6 A;  1YQ1 A;  3APO A;  3EVI A;  4HI7 A;  2R2J A;  3A2X A;  5B8A A;  1O73 A;  3WD6 A;  2H30 A;  3BD2 A;  5AGY A;  1PX7 A;  3TKS C;  1XWG A;  4KA0 A;  2XC2 A;  4Q5Q A;  3F8U A;  1ZL9 A;  2V41 A;  4I8B A;  4BWQ A;  3ZIV A;  3TJF A;  4TN8 A;  1OC9 B;  3W8J A;  5CRD A;  1SK2 A;  5DBQ A;  4QL9 A;  2FGX A;  4ID0 A;  2H6Z A;  2YWI A;  2CX3 A;  3GKX A;  1TRV A;  3FK8 A;  3GH6 A;  1SK0 A;  4MJA A;  2HRN A;  4HEA 2;  3CBU A;  3PIN A;  2YWO A;  2VLV A;  4XRD A;  2I3Y A;  1V58 A;  2CAI A;  1MDK A;  1Z3E A;  3F6F A;  5GAP D;  3G7I A;  3F3R A;  3ZRD A;  1FVK A;  2MMO A;  4IQA A;  4POB A;  3LJR A;  4IJ3 A;  4ZBD A;  3P7X A;  1Y6E A;  2LRC A;  5ELG A;  2PMT A;  1F3B A;  1KEB A;  2B5E A;  1EP8 A;  4N0V A;  1BYE A;  2WDU A;  4N0Z A;  4EXJ A;  2RUF A;  2GDR A;  5A5K A;  3LG6 A;  5G5F A;  1U6T A;  1NW2 A;  2OE0 A;  5GAN D;  1TI1 A;  2VCW A;  3PR8 A;  5J41 A;  4KND A;  1OVN A;  3C7M A;  3FHK A;  1XWA A;  5DCG A;  2KOK A;  2FWF A;  2X64 A;  4JRR A;  4PXO A;  4GCI A;  1QMV A;  2VM2 A;  5B6M A;  2IMF A;  1A0F A;  1LU4 A;  2YZU A;  2A2R A;  3GX8 A;  1QXH A;  2MMZ A;  2R3X A;  5IPG A;  2H01 A;  3Q18 A;  2PVO C;  2YNX A;  1T00 A;  4IJI A;  5DQY A;  2H71 A;  4AJ6 A;  1GSU A;  4GST A;  3I69 A;  4KW6 A;  4ECB A;  4O7H A;  2GST A;  3O76 A;  4K1F A;  3VWX A;  5GST A;  5IMF A;  1BJX A;  3A5W A;  2C80 A;  3O6T A;  4WBJ A;  3N5O A;  1KTE A;  2D2Z A;  5J4U A;  8GSS A;  1GLQ A;  4P3Y B;  3GYK A;  1O81 A;  4XRA A;  4D73 A;  5COH A;  2AJQ B;  3GST A;  4TR3 A;  2VO4 A;  1WWJ A;  3C1R A;  3EWL A;  5CRW A;  1PQN A;  2YV7 A;  4GXZ A;  2F3M A;  2P31 A;  3ZVJ A;  5ECN B;  1ML6 A;  2GTU A;  1ZCP A;  2VIM A;  2VCZ A;  1XWC A;  2VL2 C;  6GSX A;  1HNA A;  2GSR A;  4KDX A;  5CP1 A;  1ACV A;  4KGI A;  5ELA A;  4Z7X A;  1AXD A;  1EZK A;  2HYX A;  3KD0 A;  1TK8 B;  2LNS A;  1ZGN A;  4OCF A;  4BWS A;  5DVB A;  1Z6N A;  1XCC A;  1S3D A;  1U3I A;  3H79 A;  5EVO A;  4K9Z A;  3RPN A;  1J0F A;  4DVC A;  2NPB A;  3IK9 A;  5HR2 A;  1YDK A;  2VL2 A;  5HR0 A;  2WCI A;  3N9J A;  4TR1 B;  1B4P A;  1QQ2 A;  3UBK A;  4PNG A;  2FY6 A;  5KEJ A;  3BOA A;  2HXK A;  2NTO A;  10GS A;  4NV5 A;  2G2Q A;  3KXO A;  1SL1 B;  2GQK A;  2LJR A;  3Q6O A;  4EO3 A;  1A2M A;  2YAN A;  2C0E A;  2IL3 A;  3FR6 A;  2KP1 A;  3J7Y b;  1OE7 A;  5G30 A;  4K0G A;  5F8B A;  3GFK A;  2G0F A;  3GL5 A;  4MA9 A;  3AY8 A;  3UEM A;  3W6G A;  1EEJ A;  3FZ5 A;  2VCQ A;  12GS A;  3M0F A;  2CX4 A;  5IOW A;  3FR3 A;  1R5A A;  2X8G A;  5CRH A;  2X8C A;  1JZO A;  1G6Y A;  1NHY A;  2TRC P;  1VF2 A;  3IK7 A;  4ZB6 A;  3Q74 A;  2H0G A;  1NHO A;  1PD2 1;  2NVL A;  3UOM A;  4MF7 A;  1AQX A;  3UBL A;  4TVE A;  2PUK C;  2GSS A;  5ECS A;  2DJ1 A;  5ABR A;  3VWW A;  2JZR A;  4IGJ A;  1A2L A;  18GS A;  4LMV A;  4POK A;  1GUL A;  4OWY A;  1FOV A;  1VRS D;  1JHB A;  1A8L A;  1KNG A;  1PL2 A;  1SYR A;  2YP6 A;  1X5D A;  1PKW A;  3C71 A;  3RHC A;  1G6W A;  4Q5R A;  1X5E A;  4NPB A;  3QDN A;  3CTF A;  3EYT A;  1O85 A;  3FY7 A;  3WT1 A;  5INY A;  3GV1 A;  3M8N A;  4DSQ A;  4ML6 A;  2HSH A;  4N30 A;  5EL8 A;  3TKQ A;  2DIZ A;  2L6C A;  3MSZ A;  2O8V B;  1T3B A;  3CSI A;  3TCO A;  1BX9 A;  4ECI A;  5ID2 B;  3KGK A;  1OC8 A;  4ZL8 A;  2KHP A;  1FB6 A;  2OE1 A;  4IBP A;  2LV3 A;  1O8X A;  1DE2 A;  2C1Y A;  1TW9 A;  5AIX A;  1T8E B;  2KP2 A;  3D21 A;  1AUC A;  5ECQ B;  3NZN A;  2KUC A;  1T4Y A;  3F4R A;  2MMN A;  4LMW A;  1G7E A;  2P5R A;  4TR1 A;  2H1B A;  1SL0 B;  1HNC A;  4HQS A;  3DD3 A;  1G7O A;  1SU9 A;  2JSY A;  1SYX A;  1A23 A;  5FHI A;  4ZL7 A;  5CO3 A;  2CQ9 A;  4F2I A;  1YKC A;  1FVJ A;  4NV2 A;  1Z7P A;  3ZML A;  3LOR A;  5ECH B;  3HZ4 A;  1YKA A;  3M9K A;  2OE3 A;  4OO4 A;  2IMK A;  1O6J A;  2LRT A;  4GSN A;  4XIH A;  2V1M A;  2EC4 A;  5ECO B;  2WZ9 A;  5D9W A;  5DAL A;  1VF1 A;  2X99 A;  5FT3 A;  2YOI A;  1IYH A;  3QFA C;  3TJG A;  3VPT A;  4BPY A;  3APQ A;  4OFN A;  1PKZ A;  2QGV A;  4IVF A;  3F63 A;  1U87 A;  5F05 A;  1EV4 A;  3ME7 A;  4FYU A;  2ALB A;  1Y25 A;  4XTS A;  3UL3 A;  1QGV A;  5AIS A;  5IM9 A;  3CTG A;  3KH9 A;  3LSZ A;  2IMD A;  1SL2 B;  3OR5 A;  2CVB A;  3L9U A;  4RI6 A;  2PN8 A;  4BVX A;  1JZW A;  3U5R E;  1VF4 A;  4ZBB A;  2GQM A;  4NHZ A;  2OBI A;  2HZF A;  1LBK A;  3UAR A;  5B8B A;  3HVX A;  2IIY A;  2M80 A;  4HU7 A;  5AN1 A;  3TKS E;  1MTC A;  1F3A A;  4KSO A;  3TDG A;  1HD2 A;  5F0G A;  3D5J A;  1K0A A;  1AQV A;  4ML1 A;  5LNK e;  2MZC A;  2BTO T;  4XS4 A;  5J5N A;  3BBY A;  6GST A;  1Z5Y E;  3G7Y A;  4EDY A;  2WGR A;  2RM5 A;  1TU8 A;  2C0G A;  5DJL A;  1K0N A;  1M2A A;  1XFL A;  1TKD B;  2KLX A;  2GT5 A;  1THX A;  2CVD A;  5ID2 A;  2VL3 A;  1WOU A;  4PQ1 A;  3DEX A;  2B6M A;  1M9B A;  2WJU A;  3IXR A;  4KCA A;  4F9Z A;  1WP0 A;  4PUR A;  4Q5N A;  4ZIL A;  2IN3 A;  2DJ3 A;  3C8E A;  1K3O A;  1XW5 A;  2DJJ A;  4ISD A;  5G1L A;  4FYC A;  2HI7 A;  3GMF A;  1TJD A;  2K9F A;  1X9M B;  2TIR A;  2GS3 A;  4IKH A;  3ZIJ A;  3WGX A;  1XWB A;  3VI5 A;  1SD8 A;  2AB6 A;  3FRC A;  4Q5F A;  2GVP A;  3DIE A;  3ERF A;  4PUA A;  4D73 B;  3FYG A;  5LCZ A;  4GQC A;  1XW9 A;  3ZLP A;  1XIY A;  2E2G A;  2YPM A;  22GS A;  2H72 A;  3KEB A;  4PX1 A;  1AAZ A;  1UA5 A;  4GTU A;  3ZMK A;  4ECC A;  1M9A A;  5C00 A;  1AIU A;  2H1G A;  3TJJ A;  3TKS A;  1OKT A;  19GS A;  2AUV A;  1QUW A;  1TOF A;  3E9J B;  2K6V A;  1YEX A;  4KH7 A;  1ZYE A;  2H73 A;  2VCV A;  4TXO A;  4K6X A;  3KM6 A;  2FWE A;  5E4W A;  4K7I A;  2GZP A;  5GZZ B;  2B1L A;  2XBQ A;  2OJL A;  3HD5 A;  3I9V 2;  4XCS A;  1O8W A;  2LNT A;  3GHA A;  3MAK A;  3IBH A;  2CVK A;  3BCI A;  4TW5 A;  3F3Q A;  1ST9 A;  4LLR A;  1DBY A;  2ZCT A;  2H6Y A;  7GSS A;  3S9F A;  4QQ7 A;  4EVM A;  3NIV A;  2VD1 A;  5KN2 A;  2H66 A;  3TB2 A;  2C3N A;  4V2N A;  1GNE A;  5IQY A;  4DEJ A;  2BJX A;  2R37 A;  3CMI A;  2LTK A;  2PPT A;  1FB0 A;  3ZL5 A;  1EOG A;  4X0X A;  1H4O A;  3GH9 A;  14GS A;  4E8E A;  2V6O A;  3FZ9 A;  5CRE A;  1M2B A;  4POM A;  2PWJ A;  2LRN A;  2H0H A;  3MWH A;  4TXV A;  1PGT A;  4I2T A;  4RQR A;  4RUV A;  2JU5 A;  2WS2 A;  2DJK A;  4L5O A;  3GX0 A;  3TGZ A;  4TRX A;  5JWR B;  1V2A A;  4NHW A;  1XPV A;  4WXT A;  3QAG A;  1GP1 A;  1XOA A;  2FHE A;  4J57 E;  3NOF A;  5JCG A;  4FYB A;  3M9J A;  3I43 A;  3EU4 A;  1HQO A;  2LUS A;  5DJM A;  4YAP A;  1R5P A;  1GH2 A;  5DQS A;  2HFD A;  1F9M A;  2R4V A;  2MBS A;  1PN9 A;  4I2U A;  2H8L A;  5ECK B;  4MAB A;  5KN0 A;  1XZO A;  2JAD A;  1LJR A;  1GSY A;  3TRP A;  3FZ4 A;  2JL4 A;  3BCK A;  4JU5 A;  4ILF A;  1GNW A;  1XWK A;  2B5X A;  1TDI A;  3DYR A;  4PUF C;  1B4Q A;  2F51 A;  5KN1 A;  1W89 A;  3BJ5 A;  3D22 A;  2O89 A;  4KSM A;  2PVQ A;  4HDE A;  4KX4 A;  3LYP A;  2HT9 A;  2GZZ A;  4ZBA A;  1ERU A;  1J9B A;  4POL A;  4EF0 A;  3L4N A;  4O5R A;  1AC1 A;  4G2E A;  5CNW A;  2DML A;  2HLS A;  2B1K A;  3QMX A;  3D0Z A;  5HFK A;  3MDK A;  1Q98 A;  4CDO A;  3IAM 2;  1SKR B;  3DGQ A;  4KDY A;  4V1A g;  1GSF A;  2ZNM A;  4KAE A;  2DIY A;  2IFQ A;  3LGC A;  4MF5 A;  4JBB A;  1H75 A;  2IPA A;  2J23 A;  3UAP A;  1GSE A;  3E3E A;  2RM6 A;  1T4Z A;  3LXZ A;  3A3T A;  5DAL B;  3IDV A;  3TKR A;  4YH2 A;  3J7Y k;  1PRX A;  4OO5 A;  2VOC A;  1JZD A;  17GS A;  2OKA A;  1GLP A;  3HXS A;  2L57 A;  2YV9 A;  1ON4 A;  1HYU A;  5J9C A;  1B9Y C;  4TR4 A;  4EKZ A;  1TI3 A;  2V6K A;  5ENU A;  1R7H A;  1A8Y A;  5EPF A;  3P90 A;  4ULX A;  4IP1 A;  4TR0 A;  1Z6M A;  4L8E A;  2I81 A;  3ZTL A;  11GS A;  2ZUP A;  1B48 A;  2ES7 A;  2H1A A;  3VPQ A;  1OC3 A;  1TRU A;  1N8J A;  2PBJ A;  4JZQ A;  4XS4 B;  2EIR A;  3HCZ A;  2I4A A;  1F2E A;  1V98 A;  3R2Q A;  5G31 A;  1ZYQ B;  5D9T A;  6GSW A;  4GQF A;  5DAK A;  3TKP A;  3F6D A;  1B9X C;  2DBC A;  2A2S A;  3SBC A;  4ZXG A;  2PU9 C;  4GRF A;  5E59 A;  1SK1 A;  2NDO A;  2H74 A;  3TRX A;  2BMX A;  2HZE A;  3IOS A;  1AQW A;  3KH7 A;  3LYK A;  6GSU A;  1K3L A;  4F0C A;  3HA9 A;  2FUG 2;  2QSI A;  1TK0 B;  2LJA A;  1I9D A;  1YF1 A;  2RLI A;  4K7N A;  1A2J A;  3JCM L;  5HFI A;  3PGT A;  1R4W A;  1EGR A;  3KTB A;  4TOP A;  1ABA A;  5IO0 A;  2V2G A;  3KJY A;  4OCE A;  1X9S B;  5IMA A;  2H19 A;  3UVH A;  1X0R A;  3FW2 A;  5CRG A;  1J08 A;  2RUE A;  2C0F A;  4WKW A;  1RW1 A;  3KP9 A;  3M1G A;  2WRT A;  3KZQ A;  1GTA A;  1XVW A;  3CRU A;  1ZMA A;  4MZW A;  6GSY A;  4IW9 A;  2ON7 A;  1F37 A;  3QAW A;  4PQI A;  4AGS A;  4ECJ A;  4I6X A;  3EU3 A;  4HS1 A;  1UN2 A;  2DJ0 A;  4L0W A;  5JWO B;  1OAZ A;  2RII A;  4K2D A;  2C4J A;  5A4U A;  3E0U A;  3VI7 A;  1WMJ A;  2C8U A;  1YZX A;  2YZH A;  2HE3 A;  4KCE A;  2CV4 A;  1I5G A;  3UVT A;  2GQL A;  3IRA A;  4HJ2 A;  1OKD A;  2XPD A;  2MBT A;  2C0D A;  2DMM A;  1ERT A;  4TXO B;  1EGO A;  4KUN A;  3IV4 A;  2VL9 A;  2OAD A;  3RDW A;  3HHV A;  4G19 A;  1VF3 A;  1HNB A;  3GTU A;  3RBT A;  2OA7 A;  4EE0 A;  3L0H A;  5HR1 A;  2B3S A;  3A2V A;  1OE8 A;  3M3M A;  4I97 A;  1FAA A;  3QD9 A;  3GUR A;  3TOT A;  3HKR A;  1RQM A;  2X8H A;  4X1U A;  4J2F A;  4AJ8 A;  3LXT A;  3EMX A;  5HFG A;  3G7J A;  3VWV A;  3IC4 A;  4E8H A;  3DXB A;  1TRS A;  2QC7 A;  4V2M A;  3WGD A;  3C73 A;  2FWG A;  3ERG A;  2WB9 A;  3GNJ A;  3UIW A;  3LWA A;  1K0C A;  3DML A;  4KDU A;  2K8S A;  1GTB A;  3D6I A;  2AYT A;  1UVZ A;  5J9B A;  3UMA A;  3KTL A;  4MP4 A;  4MZB A;  4BA7 A;  1ZZY A;  1RK4 A;  3CRT A;  4MCU A;  3PH9 A;  2FLS A;  2YCD A;  3F4T A;  2B5Y A;  1EV9 A;  2N5A A;  1A24 A;  2VCT A;  2A4V A;  1WE0 A;  3VK9 A;  3US3 A;  4CW9 A;  3KMN A;  2AAW A;  4G10 A;  1YY7 A;  2VUP A;  1GSQ A;  3QPM A;  2K18 A;  4WR5 A;  3D4T A;  1QK8 A;  1EEM A;  1MEK A;  5D9V A;  2ON5 A;  6GSV A;  1M0U A;  1JZR A;  1GTI A;  1DE1 A;  2VLT A;  4ACS A;  3ZFB A;  1PX6 A;  3L9V A;  3LFL A;  1URM A;  1K0M A;  2M46 A;  3H8Q A;  3CSH A;  4WR4 A;  4K7O A;  4MJC A;  5F06 A;  2DLX A;  5JWQ B;  3ZZX A;  2EIQ A;  1SKS B;  4PNF A;  3C1S A;  1MDJ A;  1X5C A;  1EOH A;  1GUM A;  2LJK A;  5A4W A;  1GL8 A;  3HY2 A;  1SKW B;  4GSS A;  3CSJ A;  5IO2 A;  3HJP A;  2B7J A;  2K8V A;  1MD4 A;  4YQM A;  2HNL A;  4RI7 A;  5D93 A;  2FWH A;  2J9H A;  1M7T A;  1XW6 A;  2LQO A;  1NSW A;  1IYI A;  3H1N A;  4HZ4 A;  4LA1 A;  2P0G A;  4LL1 B;  5B6N A;  3DRN A;  3VLN A;  4KB3 A;  2F8F A;  3F9U A;  1VGL A;  1N2A A;  4OFT A;  1WPI A;  3GIX A;  1O7U A;  3WYW A;  1V9W A;  3KIJ A;  2JZS A;  1XOB A;  5B7C A;  2GGT A;  1K0D A;  1TTZ A;  3QCP A;  4ZIJ A;  2IMI A;  2IWT A;  3CXG A;  3ZFL A;  2IFQ B;  3GA4 A;  3HVS A;  3HJO A;  5H5Q A;  2N5F A;  2AHE A;  4V2L A;  1K0B A;  3ZRE A;  4FO5 A;  4WBR D;  4WF5 A;  5H5S A;  3EC3 A;  2XBI A;  3TUE A;  1Z7R A;  1XBS A;  4WEY A;  1FG4 A;  2OBK A;  4RQX A;  3ERW A;  4YQV A;  5AIV A;  4HZ2 A;  2PER A;  1E2Y A;  3FEU A;  3HYP A;  4MDC A;  1FW1 A;  4KE3 A;  2V32 A;  1ILO A;  2VLU A;  2CA8 A;  4O92 A;  1E6B A;  1JLW A;  5IIZ A;  2WFC A;  4DSS A;  2YWN A;  2L5L A;  4GWR A;  5DDL A;  2CAQ A;  1TXX A;  4XHM A;  1G0T A;  1XXU A;  1U3A A;  4JED A;  1SJZ A;  5D9X A;  3ZYW A;  4MMM A;  1QFN A;  5LD0 A;  1T7P B;  4IEL A;  2L4Q A;  5JCW A;  5DAK B;  2P5Q A;  2GT6 A;  1YF0 A;  3EMP A;  4MZC A;  2DSA A;  1EP7 A;  2E2M A;  2H1D A;  4BL7 A;  3LQ7 A;  5CYY A;  2HZE B;  4JE1 A;  1CQH A;  3I6A A;  3DWV A;  2FCH A;  3G9B A;  5EY6 A;  1XVQ A;  1GRX A;  2LEG A;  20GS A;  2GSQ A;  3KP8 A;  4YAV A;  4PGT A;  3GRX A;  1OC9 A;  4QL7 A;  5IMZ A;  3H4K A;  4IN0 A;  4IHU A;  2VAF A;  3HDC A;  3KCM A;  1A0R P; 
#chains in the Genus database with same CATH topology
 4NWY A;  2LS5 A;  2JZT A;  4J56 E;  3GKN A;  1GUH A;  4OFM A;  2H76 A;  3VUR A;  2F8A A;  3FR9 A;  4FH8 A;  4G0K A;  4EUY A;  3QAV A;  3F4S A;  4EL1 A;  3IPZ A;  2YWM A;  1CQG A;  5H5R A;  2EIO A;  2E7P A;  1TP9 A;  1FOH A;  1R26 A;  4N10 A;  1WIK A;  4K0N A;  2H70 A;  5HR3 A;  1WJK A;  3L78 A;  1T1V A;  3F0I A;  2L4C A;  2FNO A;  4OD7 A;  1YJ6 A;  4MNN A;  4BVY A;  1FHE A;  3D4M A;  3MYD A;  3TRQ A;  2L59 A;  2VM1 A;  1DUG A;  5ECL B;  4IQ1 A;  4EC0 A;  3RAZ A;  4GLT A;  3ED3 A;  1JLV A;  1YEP A;  2H75 A;  4HU9 A;  4HOJ A;  2C3T A;  1K3Y A;  4JR4 A;  2YN1 A;  2MMA A;  2NBS A;  2A2P A;  5GSS A;  4XS1 A;  5J3R A;  1BQ7 A;  3EIN A;  1FO5 A;  5L71 A;  3ZVJ D;  2O87 A;  1BG5 A;  4YKG A;  4PQH A;  1F6M C;  3IA1 A;  1SJI A;  1GUK A;  4MLY A;  1SEN A;  3ME8 A;  3IR4 A;  4Z2T A;  3WT2 A;  1PL1 A;  3V1W A;  1TU7 A;  3IHQ A;  4AF2 A;  3FKF A;  5DCH A;  3DVX A;  3TJB A;  3RHB A;  4IP6 A;  3FZA A;  3GTU B;  3L9S A;  2YJH A;  4NXI A;  5ECP B;  1MD3 A;  2B7K A;  4LL4 B;  2XPE A;  4WET A;  2L6D A;  5F07 A;  2R5G A;  2WUL A;  2E0Q A;  9GSS A;  1BED A;  3KMO A;  3QR6 A;  4MJE A;  1BAY A;  1THO A;  2F9S A;  1OYJ A;  1W4V A;  4ZB8 A;  3LEF A;  5G1K A;  2REM A;  3GN3 A;  3VFI A;  5G2Z A;  3GKK A;  3Q19 A;  2JSZ A;  3HJM A;  4X43 A;  3VWU A;  1TRW A;  5IMV A;  3EUR A;  4IS0 A;  1PSQ A;  1KBN A;  4YQU A;  3DKS A;  5IPH A;  5ECR B;  1U88 A;  3ZIT A;  2M72 A;  2DC5 A;  4OMV A;  4EDZ A;  5G5E A;  2GLR A;  5IMD A;  2LST A;  5C04 A;  1DSB A;  2MYG A;  6GSS A;  4N11 A;  1TK5 B;  1S3A A;  2HSY A;  1NM3 A;  1JFU A;  1GWC A;  2I1U A;  4MH2 A;  2N5B A;  3IAS 2;  5BRT A;  4NAX A;  2C3Q A;  4MPG A;  4GF0 A;  3APS A;  3ISO A;  1V57 A;  1M2D A;  2IJY A;  2XHF A;  4HQZ A;  5A4V A;  1PA3 A;  3QFB C;  1ZOF A;  3MNG A;  5IOX A;  3O3T A;  1UC7 A;  3GSS A;  4HUA A;  3CQF A;  3HVV A;  2HRF A;  4FQU A;  4ZB9 A;  1C72 A;  5KN3 A;  16GS A;  5D96 A;  4JR6 A;  1GTU A;  3SWL A;  4G9H A;  1WRY A;  1SD9 A;  5IMC A;  2H0I A;  5D8I A;  4L5L A;  3TOU A;  4MH3 A;  4FIW A;  4I5Q A;  1GSS A;  1Q4J A;  2LQQ A;  3GUS A;  3K8N A;  3QOU A;  2HRA A;  4O32 A;  2YJ7 A;  1ERW A;  5ECM B;  4AJ7 A;  5D73 A;  1V40 A;  3CYN A;  3P8W A;  2LKU A;  4MJB A;  4WF4 A;  4MPF A;  1Z9H A;  5HQP A;  2AV4 A;  2O7K A;  2CT6 A;  3P2A A;  5ECI B;  2VCX A;  3EE2 A;  3WGE A;  1B8X A;  2QKE A;  4K8M A;  2FA8 A;  2H6X A;  1SJ6 A;  2R6K A;  3UJ1 A;  4HJM A;  4K5R A;  2CZ2 A;  1M99 A;  4CHS A;  3TJK A;  13GS A;  4BIK A;  3H93 A;  5CAX A;  4DSR A;  4V1A p;  3GKM A;  1ERV A;  2X49 A;  2O85 A;  4ZL9 A;  2I9H A;  3IE3 A;  3GL3 A;  2OAC A;  1AW9 A;  1GSD A;  2L5O A;  2JAC A;  2VD0 A;  1EWX A;  1K0O A;  1MDI A;  2IME A;  4L0U A;  1PMT A;  4MK3 A;  3W8S A;  5KOW A;  2FD3 A;  4H86 A;  4TKY A;  3DVW A;  4F03 A;  2CZ3 A;  5JCU A;  2PGT A;  4F0B A;  4MF6 A;  2TRX A;  3A2W A;  2Z9S A;  2FA4 A;  3U6V A;  4F82 A;  2DJ2 A;  4DSS B;  3RPP A;  5FWG A;  1S3C A;  1X9W B;  4NMU A;  3HZ8 A;  2GZY A;  1USB A;  4XS6 A;  1YQ1 A;  3APO A;  3EVI A;  4HI7 A;  2R2J A;  3A2X A;  5B8A A;  1O73 A;  3WD6 A;  2H30 A;  3BD2 A;  4BL7 B;  5AGY A;  1PX7 A;  3TKS C;  1XWG A;  4KA0 A;  2XC2 A;  4Q5Q A;  3F8U A;  1ZL9 A;  2V41 A;  4I8B A;  4BWQ A;  3ZIV A;  3TJF A;  4TN8 A;  1OC9 B;  3W8J A;  5CRD A;  1SK2 A;  5DBQ A;  4QL9 A;  2FGX A;  4ID0 A;  2H6Z A;  2YWI A;  2CX3 A;  3GKX A;  1TRV A;  3FK8 A;  3GH6 A;  1SK0 A;  4MJA A;  2HRN A;  4HEA 2;  3CBU A;  3PIN A;  2YWO A;  1S3R A;  2VLV A;  4XRD A;  2I3Y A;  1V58 A;  2CAI A;  1MDK A;  1Z3E A;  3F6F A;  5GAP D;  3G7I A;  3F3R A;  3ZRD A;  1FVK A;  2MMO A;  4IQA A;  4POB A;  3LJR A;  4IJ3 A;  4ZBD A;  4BVY B;  3P7X A;  1Y6E A;  2LRC A;  5ELG A;  2PMT A;  1F3B A;  1KEB A;  2B5E A;  1EP8 A;  4N0V A;  1BYE A;  2WDU A;  4N0Z A;  4EXJ A;  2RUF A;  2GDR A;  5A5K A;  3LG6 A;  5G5F A;  1U6T A;  1NW2 A;  2OE0 A;  5GAN D;  1TI1 A;  2VCW A;  3PR8 A;  5J41 A;  4KND A;  1OVN A;  3C7M A;  3FHK A;  1XWA A;  5DCG A;  2KOK A;  2FWF A;  2X64 A;  4JRR A;  4PXO A;  4GCI A;  1QMV A;  4USS A;  2VM2 A;  5B6M A;  2IMF A;  1A0F A;  1LU4 A;  2YZU A;  2A2R A;  3GX8 A;  1QXH A;  2MMZ A;  2R3X A;  5IPG A;  2H01 A;  3Q18 A;  2PVO C;  2YNX A;  1T00 A;  4IJI A;  5DQY A;  2H71 A;  4AJ6 A;  1GSU A;  4GST A;  3I69 A;  4KW6 A;  4ECB A;  4O7H A;  2GST A;  3O76 A;  4K1F A;  3VWX A;  5GST A;  5IMF A;  1BJX A;  3A5W A;  2C80 A;  3O6T A;  4WBJ A;  3N5O A;  1KTE A;  2D2Z A;  5J4U A;  8GSS A;  1GLQ A;  4P3Y B;  3GYK A;  1O81 A;  4XRA A;  4D73 A;  5COH A;  2AJQ B;  3GST A;  4TR3 A;  2VO4 A;  1WWJ A;  3C1R A;  3EWL A;  5CRW A;  1PQN A;  2YV7 A;  4GXZ A;  2F3M A;  2P31 A;  3ZVJ A;  5ECN B;  1ML6 A;  2GTU A;  1ZCP A;  2VIM A;  2VCZ A;  1XWC A;  2VL2 C;  6GSX A;  1HNA A;  2GSR A;  2R0G A;  5CP1 A;  4KDX A;  1ACV A;  2QA2 A;  4KGI A;  5ELA A;  4Z7X A;  1AXD A;  1EZK A;  2HYX A;  3KD0 A;  1TK8 B;  2LNS A;  1ZGN A;  4KF9 A;  4OCF A;  4BWS A;  5DVB A;  1Z6N A;  1XCC A;  1S3D A;  1U3I A;  3H79 A;  5EVO A;  4K9Z A;  3RPN A;  1J0F A;  4DVC A;  2NPB A;  3IK9 A;  5HR2 A;  1YDK A;  2VL2 A;  5HR0 A;  2WCI A;  3N9J A;  4TR1 B;  1B4P A;  1QQ2 A;  3UBK A;  4PNG A;  2FY6 A;  5KEJ A;  3BOA A;  2HXK A;  2NTO A;  10GS A;  4NV5 A;  3R3E A;  2G2Q A;  3KXO A;  1SL1 B;  2GQK A;  2LJR A;  3Q6O A;  4EO3 A;  1A2M A;  2YAN A;  2C0E A;  2IL3 A;  3FR6 A;  2KP1 A;  4EIQ A;  3J7Y b;  1OE7 A;  4EIP A;  5G30 A;  4K0G A;  5F8B A;  3GFK A;  2G0F A;  3GL5 A;  4MA9 A;  3AY8 A;  3UEM A;  3W6G A;  1EEJ A;  3FZ5 A;  2VCQ A;  12GS A;  3M0F A;  2CX4 A;  5IOW A;  3FR3 A;  1R5A A;  2X8G A;  5CRH A;  2X8C A;  1JZO A;  3IHG A;  1G6Y A;  1NHY A;  2TRC P;  1VF2 A;  3IK7 A;  4ZB6 A;  3Q74 A;  2H0G A;  1NHO A;  1PD2 1;  2NVL A;  3UOM A;  4MF7 A;  1AQX A;  3UBL A;  4TVE A;  2PUK C;  2GSS A;  5ECS A;  2DJ1 A;  2R0P A;  5ABR A;  3VWW A;  2JZR A;  4IGJ A;  1A2L A;  18GS A;  4LMV A;  4POK A;  1GUL A;  4Z2U A;  4OWY A;  1FOV A;  1VRS D;  1JHB A;  1A8L A;  1KNG A;  1PL2 A;  1SYR A;  2YP6 A;  1X5D A;  1PKW A;  3C71 A;  3RHC A;  1G6W A;  4Q5R A;  1X5E A;  4NPB A;  3QDN A;  3CTF A;  3EYT A;  1O85 A;  3FY7 A;  3WT1 A;  5INY A;  3GV1 A;  3M8N A;  4DSQ A;  4ML6 A;  2HSH A;  4N30 A;  5EL8 A;  3TKQ A;  2DIZ A;  2L6C A;  3MSZ A;  2O8V B;  1T3B A;  3CSI A;  3TCO A;  1BX9 A;  4ECI A;  5ID2 B;  3KGK A;  1OC8 A;  4ZL8 A;  2KHP A;  1FB6 A;  2OE1 A;  4IBP A;  2LV3 A;  1O8X A;  1DE2 A;  2C1Y A;  1TW9 A;  5AIX A;  1T8E B;  2KP2 A;  3D21 A;  1AUC A;  5ECQ B;  3NZN A;  2KUC A;  1T4Y A;  3F4R A;  4HSC X;  2MMN A;  4LMW A;  1G7E A;  2P5R A;  4TR1 A;  2UZ8 A;  2H1B A;  1SL0 B;  1HNC A;  3FMW A;  4HQS A;  3DD3 A;  1G7O A;  1SU9 A;  2JSY A;  1SYX A;  1A23 A;  5FHI A;  4ZL7 A;  5CO3 A;  2CQ9 A;  4F2I A;  1YKC A;  1FVJ A;  4NV2 A;  1Z7P A;  3ZML A;  3LOR A;  5ECH B;  3HZ4 A;  1YKA A;  3M9K A;  2OE3 A;  4OO4 A;  2IMK A;  1O6J A;  2LRT A;  4GSN A;  4XIH A;  2V1M A;  2EC4 A;  5ECO B;  2WZ9 A;  5D9W A;  5DAL A;  1VF1 A;  2X99 A;  5FT3 A;  2YOI A;  1IYH A;  3QFA C;  3TJG A;  3VPT A;  4BPY A;  3APQ A;  4OFN A;  1PKZ A;  2QGV A;  4IVF A;  3F63 A;  1U87 A;  5F05 A;  1EV4 A;  3ME7 A;  4FYU A;  2ALB A;  1Y25 A;  4XTS A;  3UL3 A;  1QGV A;  5AIS A;  5IM9 A;  3CTG A;  3KH9 A;  3LSZ A;  2IMD A;  1SL2 B;  3OR5 A;  2CVB A;  3L9U A;  4RI6 A;  2PN8 A;  4BVX A;  1JZW A;  3U5R E;  1VF4 A;  4ZBB A;  2GQM A;  4NHZ A;  2OBI A;  2HZF A;  1LBK A;  3UAR A;  5B8B A;  3HVX A;  2QA1 A;  2IIY A;  2M80 A;  4HU7 A;  5AN1 A;  3TKS E;  1MTC A;  1F3A A;  4KSO A;  3TDG A;  1HD2 A;  5F0G A;  3D5J A;  1K0A A;  1AQV A;  4ML1 A;  5LNK e;  2MZC A;  2BTO T;  4XS4 A;  5J5N A;  3BBY A;  6GST A;  2A4H A;  1Z5Y E;  3G7Y A;  4EDY A;  2WGR A;  2RM5 A;  1TU8 A;  2C0G A;  5DJL A;  1K0N A;  1M2A A;  1XFL A;  1TKD B;  2KLX A;  2GT5 A;  1THX A;  2CVD A;  5ID2 A;  2VL3 A;  1WOU A;  4PQ1 A;  3DEX A;  2B6M A;  1M9B A;  2WJU A;  3IXR A;  4KCA A;  5KOX A;  4F9Z A;  1WP0 A;  4PUR A;  4Q5N A;  4ZIL A;  2IN3 A;  2DJ3 A;  3C8E A;  1K3O A;  1XW5 A;  2DJJ A;  4ISD A;  5G1L A;  4FYC A;  2HI7 A;  3GMF A;  1TJD A;  2K9F A;  1X9M B;  2TIR A;  2GS3 A;  4IKH A;  3ZIJ A;  3WGX A;  1XWB A;  3VI5 A;  1SD8 A;  2AB6 A;  3FRC A;  4Q5F A;  3PPU A;  2GVP A;  3DIE A;  4CY6 A;  3ERF A;  4PUA A;  4D73 B;  3FYG A;  5LCZ A;  4GQC A;  1XW9 A;  3ZLP A;  1XIY A;  4Z2R A;  2E2G A;  2YPM A;  22GS A;  2H72 A;  3KEB A;  4PX1 A;  1AAZ A;  1UA5 A;  4GTU A;  3ZMK A;  4ECC A;  1M9A A;  5C00 A;  1AIU A;  2H1G A;  3TJJ A;  1XG8 A;  3TKS A;  1OKT A;  19GS A;  2AUV A;  1QUW A;  1TOF A;  3E9J B;  2K6V A;  4G0L A;  1YEX A;  4KH7 A;  1ZYE A;  2H73 A;  2VCV A;  4TXO A;  4K6X A;  3KM6 A;  2FWE A;  5E4W A;  4K7I A;  2GZP A;  5GZZ B;  2B1L A;  2XBQ A;  2OJL A;  3HD5 A;  3I9V 2;  4XCS A;  1O8W A;  2LNT A;  3GHA A;  3MAK A;  3IBH A;  2CVK A;  3BCI A;  4TW5 A;  3F3Q A;  1ST9 A;  4LLR A;  1DBY A;  2ZCT A;  2H6Y A;  7GSS A;  3S9F A;  4QQ7 A;  4EVM A;  3NIV A;  2VD1 A;  5KN2 A;  2H66 A;  3TB2 A;  2C3N A;  4V2N A;  1GNE A;  5IQY A;  4DEJ A;  2BJX A;  2R37 A;  3CMI A;  2LTK A;  2PPT A;  1FB0 A;  3ZL5 A;  1EOG A;  4X0X A;  1H4O A;  3GH9 A;  14GS A;  4E8E A;  2V6O A;  4A5P A;  3FZ9 A;  5CRE A;  1M2B A;  4POM A;  2PWJ A;  2LRN A;  2H0H A;  3MWH A;  4TXV A;  1PGT A;  4I2T A;  4RQR A;  4RUV A;  2JU5 A;  2WS2 A;  2DJK A;  4L5O A;  4O5U A;  3GX0 A;  3TGZ A;  4TRX A;  5JWR B;  1V2A A;  4NHW A;  1XPV A;  4WXT A;  3QAG A;  1GP1 A;  1XOA A;  2FHE A;  4J57 E;  4ICY A;  3NOF A;  4K5S A;  5JCG A;  2DKH A;  4FYB A;  3M9J A;  3I43 A;  3EU4 A;  1HQO A;  2LUS A;  5DJM A;  4YAP A;  1R5P A;  1GH2 A;  5DQS A;  2HFD A;  1F9M A;  2R4V A;  2MBS A;  1PN9 A;  4I2U A;  2H8L A;  5ECK B;  4MAB A;  5KN0 A;  1XZO A;  2DKI A;  2JAD A;  1LJR A;  1GSY A;  3TRP A;  3FZ4 A;  2JL4 A;  3BCK A;  4JU5 A;  4ILF A;  1GNW A;  1XWK A;  2B5X A;  1TDI A;  3DYR A;  4PUF C;  1B4Q A;  2F51 A;  5KN1 A;  1W89 A;  3BJ5 A;  3D22 A;  2O89 A;  4KSM A;  2PVQ A;  4HDE A;  4KX4 A;  3LYP A;  2HT9 A;  2GZZ A;  4ZBA A;  1ERU A;  1J9B A;  4POL A;  4EF0 A;  3L4N A;  4O5R A;  1AC1 A;  4G2E A;  5CNW A;  2DML A;  2HLS A;  2B1K A;  3QMX A;  3D0Z A;  5HFK A;  3MDK A;  1Q98 A;  4CDO A;  3IAM 2;  1SKR B;  3DGQ A;  4KDY A;  4V1A g;  1GSF A;  2ZNM A;  4KAE A;  2DIY A;  1M3I A;  2IFQ A;  3LGC A;  4MF5 A;  4JBB A;  1H75 A;  2IPA A;  2J23 A;  3UAP A;  1GSE A;  3E3E A;  2RM6 A;  1T4Z A;  3LXZ A;  3A3T A;  5DAL B;  3IDV A;  3TKR A;  4YH2 A;  3J7Y k;  1PRX A;  4OO5 A;  2VOC A;  1JZD A;  17GS A;  2OKA A;  1GLP A;  3HXS A;  2L57 A;  2YV9 A;  1ON4 A;  1HYU A;  5J9C A;  1B9Y C;  4TR4 A;  4EKZ A;  1TI3 A;  2V6K A;  5ENU A;  1R7H A;  1A8Y A;  5EPF A;  3P90 A;  1ZYP A;  4ULX A;  4IP1 A;  3HVN A;  4TR0 A;  4BVX B;  1Z6M A;  4L8E A;  2I81 A;  4X4J A;  3ZTL A;  11GS A;  2ZUP A;  1B48 A;  2ES7 A;  2H1A A;  3VPQ A;  1OC3 A;  1TRU A;  1N8J A;  2PBJ A;  4JZQ A;  4XS4 B;  1PN0 A;  2EIR A;  3HCZ A;  2I4A A;  3LW9 A;  1F2E A;  1V98 A;  3R2Q A;  5G31 A;  1ZYQ B;  5D9T A;  6GSW A;  4GQF A;  5DAK A;  3TKP A;  3F6D A;  1B9X C;  2DBC A;  2A2S A;  3SBC A;  4ZXG A;  2PU9 C;  4GRF A;  5E59 A;  1SK1 A;  2NDO A;  2H74 A;  3TRX A;  2BMX A;  2HZE A;  3IOS A;  1AQW A;  2R0C A;  3KH7 A;  3LYK A;  6GSU A;  1K3L A;  4F0C A;  3HA9 A;  2FUG 2;  2QSI A;  1TK0 B;  2LJA A;  1I9D A;  2X4A A;  1YF1 A;  2RLI A;  4K7N A;  1A2J A;  3JCM L;  5HFI A;  3PGT A;  1R4W A;  1EGR A;  4G0I A;  3KTB A;  4TOP A;  1ABA A;  5IO0 A;  2V2G A;  3KJY A;  4OCE A;  1X9S B;  5IMA A;  2H19 A;  3UVH A;  1X0R A;  3FW2 A;  5CRG A;  1J08 A;  2RUE A;  2C0F A;  4WKW A;  1RW1 A;  3KP9 A;  3M1G A;  2WRT A;  3KZQ A;  1GTA A;  1XVW A;  3CRU A;  1ZMA A;  4MZW A;  6GSY A;  4IW9 A;  2ON7 A;  1F37 A;  3QAW A;  4PQI A;  4AGS A;  4ECJ A;  4I6X A;  3EU3 A;  4HS1 A;  1UN2 A;  2DJ0 A;  4L0W A;  5JWO B;  1OAZ A;  2RII A;  4K2D A;  2C4J A;  5A4U A;  3E0U A;  3VI7 A;  1WMJ A;  2C8U A;  1YZX A;  2YZH A;  2HE3 A;  4KCE A;  2CV4 A;  1I5G A;  3MIX A;  3UVT A;  4PTS A;  2GQL A;  3IRA A;  4HJ2 A;  1OKD A;  2XPD A;  2MBT A;  2C0D A;  2DMM A;  1ERT A;  4TXO B;  3IC8 A;  1EGO A;  4KUN A;  3IV4 A;  2VL9 A;  2OAD A;  3RDW A;  3HHV A;  4G19 A;  1VF3 A;  1HNB A;  3GTU A;  3RBT A;  2OA7 A;  4EE0 A;  3L0H A;  5HR1 A;  2B3S A;  3A2V A;  1OE8 A;  3M3M A;  4I97 A;  1FAA A;  3QD9 A;  1PFO A;  3GUR A;  3TOT A;  3HKR A;  1RQM A;  2X8H A;  4X1U A;  4J2F A;  4AJ8 A;  3LXT A;  3EMX A;  5HFG A;  3G7J A;  3VWV A;  3EPT A;  3IC4 A;  4E8H A;  3DXB A;  2HRK A;  1TRS A;  2QC7 A;  4V2M A;  3WGD A;  3C73 A;  2FWG A;  3ERG A;  2WB9 A;  3GNJ A;  4CY8 A;  3UIW A;  3LWA A;  1K0C A;  3DML A;  4KDU A;  2K8S A;  1GTB A;  3D6I A;  2AYT A;  2HSM A;  1UVZ A;  5J9B A;  3UMA A;  3KTL A;  4MP4 A;  4MZB A;  4BA7 A;  1ZZY A;  1RK4 A;  3CRT A;  4MCU A;  3PH9 A;  2FLS A;  2YCD A;  3F4T A;  2B5Y A;  1EV9 A;  2N5A A;  1A24 A;  2VCT A;  2A4V A;  1WE0 A;  3VK9 A;  3US3 A;  4CW9 A;  1M3J A;  3KMN A;  2AAW A;  4G10 A;  1YY7 A;  2VUP A;  1GSQ A;  3QPM A;  2K18 A;  4WR5 A;  3D4T A;  1QK8 A;  1EEM A;  1MEK A;  5D9V A;  2ON5 A;  6GSV A;  1M0U A;  1JZR A;  1GTI A;  1DE1 A;  2VLT A;  4ACS A;  3ZFB A;  1PX6 A;  3L9V A;  3LFL A;  1URM A;  1K0M A;  2M46 A;  3H8Q A;  3CSH A;  4WR4 A;  4K7O A;  4MJC A;  5F06 A;  2DLX A;  5JWQ B;  3ZZX A;  2EIQ A;  1SKS B;  4PNF A;  1ZYN A;  3C1S A;  1MDJ A;  1X5C A;  1EOH A;  1GUM A;  2LJK A;  5A4W A;  1GL8 A;  3HY2 A;  1SKW B;  4GSS A;  3CSJ A;  5IO2 A;  4K2X A;  3HJP A;  2B7J A;  2K8V A;  1MD4 A;  4YQM A;  2HNL A;  4RI7 A;  5D93 A;  2FWH A;  2J9H A;  5BMU A;  1M7T A;  1XW6 A;  2LQO A;  1NSW A;  1IYI A;  3H1N A;  4HZ4 A;  4LA1 A;  2P0G A;  4LL1 B;  5B6N A;  3DRN A;  3VLN A;  4KB3 A;  2F8F A;  3F9U A;  1VGL A;  1N2A A;  4OFT A;  1WPI A;  3GIX A;  1O7U A;  3WYW A;  1V9W A;  3KIJ A;  2JZS A;  1XOB A;  5B7C A;  2GGT A;  1K0D A;  1TTZ A;  3QCP A;  4ZIJ A;  2IMI A;  2IWT A;  3A5I A;  3CXG A;  3ZFL A;  2IFQ B;  3GA4 A;  3HVS A;  3HJO A;  5H5Q A;  2N5F A;  4O5Q A;  2AHE A;  4V2L A;  1K0B A;  3ZRE A;  4FO5 A;  4WBR D;  4WF5 A;  5H5S A;  3EC3 A;  2XBI A;  3TUE A;  1Z7R A;  1XBS A;  4WEY A;  1FG4 A;  2OBK A;  4RQX A;  3ERW A;  4YQV A;  5AIV A;  4HZ2 A;  2PER A;  1E2Y A;  3FEU A;  3HYP A;  4MDC A;  1FW1 A;  4KE3 A;  2V32 A;  1ILO A;  2VLU A;  2CA8 A;  4O92 A;  1E6B A;  1JLW A;  5IIZ A;  2WFC A;  4DSS A;  2YWN A;  2L5L A;  4GWR A;  5DDL A;  2CAQ A;  1TXX A;  4XHM A;  1G0T A;  1XXU A;  1U3A A;  4JED A;  1SJZ A;  5D9X A;  3ZYW A;  4MMM A;  1QFN A;  5LD0 A;  1T7P B;  4IEL A;  2L4Q A;  5JCW A;  5DAK B;  2P5Q A;  2GT6 A;  1YF0 A;  3EMP A;  4MZC A;  4YKF A;  2DSA A;  1EP7 A;  2E2M A;  2H1D A;  4BL7 A;  3LQ7 A;  5CYY A;  2HZE B;  4JE1 A;  1CQH A;  3I6A A;  3DWV A;  2FCH A;  3G9B A;  5EY6 A;  1XVQ A;  1GRX A;  2LEG A;  20GS A;  2GSQ A;  3KP8 A;  4YAV A;  4PGT A;  3GRX A;  1OC9 A;  4QL7 A;  5IMZ A;  3H4K A;  4IN0 A;  4IHU A;  2VAF A;  3HDC A;  3KCM A;  1A0R P; 
#chains in the Genus database with same CATH homology
 4NWY A;  2LS5 A;  2JZT A;  4J56 E;  3GKN A;  1GUH A;  4OFM A;  2H76 A;  3VUR A;  2F8A A;  3FR9 A;  4FH8 A;  4G0K A;  4EUY A;  3QAV A;  3F4S A;  4EL1 A;  3IPZ A;  2YWM A;  1CQG A;  5H5R A;  2EIO A;  2E7P A;  1TP9 A;  1FOH A;  1R26 A;  4N10 A;  1WIK A;  4K0N A;  2H70 A;  5HR3 A;  1WJK A;  3L78 A;  1T1V A;  3F0I A;  2L4C A;  2FNO A;  4OD7 A;  1YJ6 A;  4MNN A;  4BVY A;  1FHE A;  3D4M A;  3MYD A;  3TRQ A;  2L59 A;  2VM1 A;  1DUG A;  5ECL B;  4IQ1 A;  4EC0 A;  3RAZ A;  4GLT A;  3ED3 A;  1JLV A;  1YEP A;  2H75 A;  4HU9 A;  4HOJ A;  2C3T A;  1K3Y A;  4JR4 A;  2YN1 A;  2MMA A;  2NBS A;  2A2P A;  5GSS A;  4XS1 A;  5J3R A;  1BQ7 A;  3EIN A;  1FO5 A;  5L71 A;  3ZVJ D;  2O87 A;  1BG5 A;  4YKG A;  4PQH A;  1F6M C;  3IA1 A;  1SJI A;  1GUK A;  4MLY A;  1SEN A;  3ME8 A;  3IR4 A;  4Z2T A;  3WT2 A;  1PL1 A;  3V1W A;  1TU7 A;  3IHQ A;  4AF2 A;  3FKF A;  5DCH A;  3DVX A;  3TJB A;  3RHB A;  4IP6 A;  3FZA A;  3GTU B;  3L9S A;  2YJH A;  4NXI A;  5ECP B;  1MD3 A;  2B7K A;  4LL4 B;  2XPE A;  4WET A;  2L6D A;  5F07 A;  2R5G A;  2WUL A;  2E0Q A;  9GSS A;  1BED A;  3KMO A;  3QR6 A;  4MJE A;  1BAY A;  1THO A;  2F9S A;  1OYJ A;  1W4V A;  4ZB8 A;  3LEF A;  5G1K A;  2REM A;  3GN3 A;  3VFI A;  5G2Z A;  3GKK A;  3Q19 A;  2JSZ A;  3HJM A;  4X43 A;  3VWU A;  1TRW A;  5IMV A;  3EUR A;  4IS0 A;  1PSQ A;  1KBN A;  4YQU A;  3DKS A;  5IPH A;  5ECR B;  1U88 A;  3ZIT A;  2M72 A;  2DC5 A;  4OMV A;  4EDZ A;  5G5E A;  2GLR A;  5IMD A;  2LST A;  5C04 A;  1DSB A;  2MYG A;  6GSS A;  4N11 A;  1TK5 B;  1S3A A;  2HSY A;  1NM3 A;  1JFU A;  1GWC A;  2I1U A;  4MH2 A;  2N5B A;  3IAS 2;  5BRT A;  4NAX A;  2C3Q A;  4MPG A;  4GF0 A;  3APS A;  3ISO A;  1V57 A;  1M2D A;  2IJY A;  2XHF A;  4HQZ A;  5A4V A;  1PA3 A;  3QFB C;  1ZOF A;  3MNG A;  5IOX A;  3O3T A;  1UC7 A;  3GSS A;  4HUA A;  3HVV A;  2HRF A;  4FQU A;  4ZB9 A;  1C72 A;  5KN3 A;  16GS A;  5D96 A;  4JR6 A;  1GTU A;  3SWL A;  4G9H A;  1WRY A;  1SD9 A;  5IMC A;  2H0I A;  5D8I A;  4L5L A;  3TOU A;  4MH3 A;  4FIW A;  4I5Q A;  1GSS A;  1Q4J A;  2LQQ A;  3GUS A;  3K8N A;  3QOU A;  2HRA A;  4O32 A;  2YJ7 A;  1ERW A;  5ECM B;  4AJ7 A;  5D73 A;  1V40 A;  3CYN A;  3P8W A;  2LKU A;  4MJB A;  4WF4 A;  4MPF A;  1Z9H A;  5HQP A;  2AV4 A;  2O7K A;  2CT6 A;  3P2A A;  5ECI B;  2VCX A;  3EE2 A;  3WGE A;  1B8X A;  2QKE A;  4K8M A;  2FA8 A;  2H6X A;  1SJ6 A;  2R6K A;  3UJ1 A;  4HJM A;  4K5R A;  2CZ2 A;  1M99 A;  4CHS A;  3TJK A;  13GS A;  3H93 A;  5CAX A;  4DSR A;  4V1A p;  3GKM A;  1ERV A;  2X49 A;  2O85 A;  4ZL9 A;  2I9H A;  3IE3 A;  3GL3 A;  2OAC A;  1AW9 A;  1GSD A;  2L5O A;  2JAC A;  2VD0 A;  1EWX A;  1K0O A;  1MDI A;  2IME A;  4L0U A;  1PMT A;  4MK3 A;  3W8S A;  5KOW A;  2FD3 A;  4H86 A;  4TKY A;  3DVW A;  4F03 A;  2CZ3 A;  5JCU A;  2PGT A;  4F0B A;  4MF6 A;  2TRX A;  3A2W A;  2Z9S A;  2FA4 A;  3U6V A;  4F82 A;  2DJ2 A;  4DSS B;  3RPP A;  5FWG A;  1S3C A;  1X9W B;  4NMU A;  3HZ8 A;  2GZY A;  1USB A;  4XS6 A;  1YQ1 A;  3APO A;  3EVI A;  4HI7 A;  2R2J A;  3A2X A;  5B8A A;  1O73 A;  3WD6 A;  2H30 A;  3BD2 A;  4BL7 B;  5AGY A;  1PX7 A;  3TKS C;  1XWG A;  4KA0 A;  2XC2 A;  4Q5Q A;  3F8U A;  1ZL9 A;  2V41 A;  4I8B A;  4BWQ A;  3ZIV A;  3TJF A;  4TN8 A;  1OC9 B;  3W8J A;  5CRD A;  1SK2 A;  5DBQ A;  4QL9 A;  2FGX A;  4ID0 A;  2H6Z A;  2YWI A;  2CX3 A;  3GKX A;  1TRV A;  3FK8 A;  3GH6 A;  1SK0 A;  4MJA A;  2HRN A;  4HEA 2;  3CBU A;  3PIN A;  2YWO A;  2VLV A;  4XRD A;  2I3Y A;  1V58 A;  2CAI A;  1MDK A;  1Z3E A;  3F6F A;  5GAP D;  3G7I A;  3F3R A;  3ZRD A;  1FVK A;  2MMO A;  4IQA A;  4POB A;  3LJR A;  4IJ3 A;  4ZBD A;  4BVY B;  3P7X A;  1Y6E A;  2LRC A;  5ELG A;  2PMT A;  1F3B A;  1KEB A;  2B5E A;  1EP8 A;  4N0V A;  1BYE A;  2WDU A;  4N0Z A;  4EXJ A;  2RUF A;  2GDR A;  5A5K A;  3LG6 A;  5G5F A;  1U6T A;  1NW2 A;  2OE0 A;  5GAN D;  1TI1 A;  2VCW A;  3PR8 A;  5J41 A;  4KND A;  1OVN A;  3C7M A;  3FHK A;  1XWA A;  5DCG A;  2KOK A;  2FWF A;  2X64 A;  4JRR A;  4PXO A;  4GCI A;  1QMV A;  4USS A;  2VM2 A;  5B6M A;  2IMF A;  1A0F A;  1LU4 A;  2YZU A;  2A2R A;  3GX8 A;  1QXH A;  2MMZ A;  2R3X A;  5IPG A;  2H01 A;  3Q18 A;  2PVO C;  2YNX A;  1T00 A;  4IJI A;  5DQY A;  2H71 A;  4AJ6 A;  1GSU A;  4GST A;  3I69 A;  4KW6 A;  4ECB A;  4O7H A;  2GST A;  3O76 A;  4K1F A;  3VWX A;  5GST A;  5IMF A;  1BJX A;  3A5W A;  2C80 A;  3O6T A;  4WBJ A;  3N5O A;  1KTE A;  2D2Z A;  5J4U A;  8GSS A;  1GLQ A;  4P3Y B;  3GYK A;  1O81 A;  4XRA A;  4D73 A;  5COH A;  2AJQ B;  3GST A;  4TR3 A;  2VO4 A;  1WWJ A;  3C1R A;  3EWL A;  5CRW A;  1PQN A;  2YV7 A;  4GXZ A;  2F3M A;  2P31 A;  3ZVJ A;  5ECN B;  1ML6 A;  2GTU A;  1ZCP A;  2VIM A;  2VCZ A;  1XWC A;  2VL2 C;  6GSX A;  1HNA A;  2GSR A;  2R0G A;  5CP1 A;  4KDX A;  1ACV A;  2QA2 A;  4KGI A;  5ELA A;  4Z7X A;  1AXD A;  1EZK A;  2HYX A;  3KD0 A;  1TK8 B;  2LNS A;  1ZGN A;  4KF9 A;  4OCF A;  4BWS A;  5DVB A;  1Z6N A;  1XCC A;  1S3D A;  1U3I A;  3H79 A;  5EVO A;  4K9Z A;  3RPN A;  1J0F A;  4DVC A;  2NPB A;  3IK9 A;  5HR2 A;  1YDK A;  2VL2 A;  5HR0 A;  2WCI A;  3N9J A;  4TR1 B;  1B4P A;  1QQ2 A;  3UBK A;  4PNG A;  2FY6 A;  5KEJ A;  3BOA A;  2HXK A;  2NTO A;  10GS A;  4NV5 A;  3R3E A;  2G2Q A;  3KXO A;  1SL1 B;  2GQK A;  2LJR A;  3Q6O A;  4EO3 A;  1A2M A;  2YAN A;  2C0E A;  2IL3 A;  3FR6 A;  2KP1 A;  4EIQ A;  3J7Y b;  1OE7 A;  4EIP A;  5G30 A;  4K0G A;  5F8B A;  3GFK A;  2G0F A;  3GL5 A;  4MA9 A;  3AY8 A;  3UEM A;  3W6G A;  1EEJ A;  3FZ5 A;  2VCQ A;  12GS A;  3M0F A;  2CX4 A;  5IOW A;  3FR3 A;  1R5A A;  2X8G A;  5CRH A;  2X8C A;  1JZO A;  3IHG A;  1G6Y A;  1NHY A;  2TRC P;  1VF2 A;  3IK7 A;  4ZB6 A;  3Q74 A;  2H0G A;  1NHO A;  1PD2 1;  2NVL A;  3UOM A;  4MF7 A;  1AQX A;  3UBL A;  4TVE A;  2PUK C;  2GSS A;  5ECS A;  2DJ1 A;  2R0P A;  5ABR A;  3VWW A;  2JZR A;  4IGJ A;  1A2L A;  18GS A;  4LMV A;  4POK A;  1GUL A;  4Z2U A;  4OWY A;  1FOV A;  1VRS D;  1JHB A;  1A8L A;  1KNG A;  1PL2 A;  1SYR A;  2YP6 A;  1X5D A;  1PKW A;  3C71 A;  3RHC A;  1G6W A;  4Q5R A;  1X5E A;  4NPB A;  3QDN A;  3CTF A;  3EYT A;  1O85 A;  3FY7 A;  3WT1 A;  5INY A;  3GV1 A;  3M8N A;  4DSQ A;  4ML6 A;  2HSH A;  4N30 A;  5EL8 A;  3TKQ A;  2DIZ A;  2L6C A;  3MSZ A;  2O8V B;  1T3B A;  3CSI A;  3TCO A;  1BX9 A;  4ECI A;  5ID2 B;  3KGK A;  1OC8 A;  4ZL8 A;  2KHP A;  1FB6 A;  2OE1 A;  4IBP A;  2LV3 A;  1O8X A;  1DE2 A;  2C1Y A;  1TW9 A;  5AIX A;  1T8E B;  2KP2 A;  3D21 A;  1AUC A;  5ECQ B;  3NZN A;  2KUC A;  1T4Y A;  3F4R A;  2MMN A;  4LMW A;  1G7E A;  2P5R A;  4TR1 A;  2UZ8 A;  2H1B A;  1SL0 B;  1HNC A;  3FMW A;  4HQS A;  3DD3 A;  1G7O A;  1SU9 A;  2JSY A;  1SYX A;  1A23 A;  5FHI A;  4ZL7 A;  5CO3 A;  2CQ9 A;  4F2I A;  1YKC A;  1FVJ A;  4NV2 A;  1Z7P A;  3ZML A;  3LOR A;  5ECH B;  3HZ4 A;  1YKA A;  3M9K A;  2OE3 A;  4OO4 A;  2IMK A;  1O6J A;  2LRT A;  4GSN A;  4XIH A;  2V1M A;  2EC4 A;  5ECO B;  2WZ9 A;  5D9W A;  5DAL A;  1VF1 A;  2X99 A;  5FT3 A;  2YOI A;  1IYH A;  3QFA C;  3TJG A;  3VPT A;  4BPY A;  3APQ A;  4OFN A;  1PKZ A;  2QGV A;  4IVF A;  3F63 A;  1U87 A;  5F05 A;  1EV4 A;  3ME7 A;  4FYU A;  2ALB A;  1Y25 A;  4XTS A;  3UL3 A;  1QGV A;  5AIS A;  5IM9 A;  3CTG A;  3KH9 A;  3LSZ A;  2IMD A;  1SL2 B;  3OR5 A;  2CVB A;  3L9U A;  4RI6 A;  2PN8 A;  4BVX A;  1JZW A;  3U5R E;  1VF4 A;  4ZBB A;  2GQM A;  4NHZ A;  2OBI A;  2HZF A;  1LBK A;  3UAR A;  5B8B A;  3HVX A;  2QA1 A;  2IIY A;  2M80 A;  4HU7 A;  5AN1 A;  3TKS E;  1MTC A;  1F3A A;  4KSO A;  3TDG A;  1HD2 A;  5F0G A;  3D5J A;  1K0A A;  1AQV A;  4ML1 A;  5LNK e;  2MZC A;  2BTO T;  4XS4 A;  5J5N A;  3BBY A;  6GST A;  2A4H A;  1Z5Y E;  3G7Y A;  4EDY A;  2WGR A;  2RM5 A;  1TU8 A;  2C0G A;  5DJL A;  1K0N A;  1M2A A;  1XFL A;  1TKD B;  2KLX A;  2GT5 A;  1THX A;  2CVD A;  5ID2 A;  2VL3 A;  1WOU A;  4PQ1 A;  3DEX A;  2B6M A;  1M9B A;  2WJU A;  3IXR A;  4KCA A;  5KOX A;  4F9Z A;  1WP0 A;  4PUR A;  4Q5N A;  4ZIL A;  2IN3 A;  2DJ3 A;  3C8E A;  1K3O A;  1XW5 A;  2DJJ A;  4ISD A;  5G1L A;  4FYC A;  2HI7 A;  3GMF A;  1TJD A;  2K9F A;  1X9M B;  2TIR A;  2GS3 A;  4IKH A;  3ZIJ A;  3WGX A;  1XWB A;  3VI5 A;  1SD8 A;  2AB6 A;  3FRC A;  4Q5F A;  3PPU A;  2GVP A;  3DIE A;  4CY6 A;  3ERF A;  4PUA A;  4D73 B;  3FYG A;  5LCZ A;  4GQC A;  1XW9 A;  3ZLP A;  1XIY A;  4Z2R A;  2E2G A;  2YPM A;  22GS A;  2H72 A;  3KEB A;  4PX1 A;  1AAZ A;  1UA5 A;  4GTU A;  3ZMK A;  4ECC A;  1M9A A;  5C00 A;  1AIU A;  2H1G A;  3TJJ A;  3TKS A;  1OKT A;  19GS A;  2AUV A;  1QUW A;  1TOF A;  3E9J B;  2K6V A;  4G0L A;  1YEX A;  4KH7 A;  1ZYE A;  2H73 A;  2VCV A;  4TXO A;  4K6X A;  3KM6 A;  2FWE A;  5E4W A;  4K7I A;  2GZP A;  5GZZ B;  2B1L A;  2XBQ A;  2OJL A;  3HD5 A;  3I9V 2;  4XCS A;  1O8W A;  2LNT A;  3GHA A;  3MAK A;  3IBH A;  2CVK A;  3BCI A;  4TW5 A;  3F3Q A;  1ST9 A;  4LLR A;  1DBY A;  2ZCT A;  2H6Y A;  7GSS A;  3S9F A;  4QQ7 A;  4EVM A;  3NIV A;  2VD1 A;  5KN2 A;  2H66 A;  3TB2 A;  2C3N A;  4V2N A;  1GNE A;  5IQY A;  4DEJ A;  2BJX A;  2R37 A;  3CMI A;  2LTK A;  2PPT A;  1FB0 A;  3ZL5 A;  1EOG A;  4X0X A;  1H4O A;  3GH9 A;  14GS A;  4E8E A;  2V6O A;  4A5P A;  3FZ9 A;  5CRE A;  1M2B A;  4POM A;  2PWJ A;  2LRN A;  2H0H A;  3MWH A;  4TXV A;  1PGT A;  4I2T A;  4RQR A;  4RUV A;  2JU5 A;  2WS2 A;  2DJK A;  4L5O A;  4O5U A;  3GX0 A;  3TGZ A;  4TRX A;  5JWR B;  1V2A A;  4NHW A;  1XPV A;  4WXT A;  3QAG A;  1GP1 A;  1XOA A;  2FHE A;  4J57 E;  4ICY A;  3NOF A;  4K5S A;  5JCG A;  2DKH A;  4FYB A;  3M9J A;  3I43 A;  3EU4 A;  1HQO A;  2LUS A;  5DJM A;  4YAP A;  1R5P A;  1GH2 A;  5DQS A;  2HFD A;  1F9M A;  2R4V A;  2MBS A;  1PN9 A;  4I2U A;  2H8L A;  5ECK B;  4MAB A;  5KN0 A;  1XZO A;  2DKI A;  2JAD A;  1LJR A;  1GSY A;  3TRP A;  3FZ4 A;  2JL4 A;  3BCK A;  4JU5 A;  4ILF A;  1GNW A;  1XWK A;  2B5X A;  1TDI A;  3DYR A;  4PUF C;  1B4Q A;  2F51 A;  5KN1 A;  1W89 A;  3BJ5 A;  3D22 A;  2O89 A;  4KSM A;  2PVQ A;  4HDE A;  4KX4 A;  3LYP A;  2HT9 A;  2GZZ A;  4ZBA A;  1ERU A;  1J9B A;  4POL A;  4EF0 A;  3L4N A;  4O5R A;  1AC1 A;  4G2E A;  5CNW A;  2DML A;  2HLS A;  2B1K A;  3QMX A;  3D0Z A;  5HFK A;  3MDK A;  1Q98 A;  4CDO A;  3IAM 2;  1SKR B;  3DGQ A;  4KDY A;  4V1A g;  1GSF A;  2ZNM A;  4KAE A;  2DIY A;  2IFQ A;  3LGC A;  4MF5 A;  4JBB A;  1H75 A;  2IPA A;  2J23 A;  3UAP A;  1GSE A;  3E3E A;  2RM6 A;  1T4Z A;  3LXZ A;  3A3T A;  5DAL B;  3IDV A;  3TKR A;  4YH2 A;  3J7Y k;  1PRX A;  4OO5 A;  2VOC A;  1JZD A;  17GS A;  2OKA A;  1GLP A;  3HXS A;  2L57 A;  2YV9 A;  1ON4 A;  1HYU A;  5J9C A;  1B9Y C;  4TR4 A;  4EKZ A;  1TI3 A;  2V6K A;  5ENU A;  1R7H A;  1A8Y A;  5EPF A;  3P90 A;  1ZYP A;  4ULX A;  4IP1 A;  4TR0 A;  4BVX B;  1Z6M A;  4L8E A;  2I81 A;  4X4J A;  3ZTL A;  11GS A;  2ZUP A;  1B48 A;  2ES7 A;  2H1A A;  3VPQ A;  1OC3 A;  1TRU A;  1N8J A;  2PBJ A;  4JZQ A;  4XS4 B;  1PN0 A;  2EIR A;  3HCZ A;  2I4A A;  3LW9 A;  1F2E A;  1V98 A;  3R2Q A;  5G31 A;  1ZYQ B;  5D9T A;  6GSW A;  4GQF A;  5DAK A;  3TKP A;  3F6D A;  1B9X C;  2DBC A;  2A2S A;  3SBC A;  4ZXG A;  2PU9 C;  4GRF A;  5E59 A;  1SK1 A;  2NDO A;  2H74 A;  3TRX A;  2BMX A;  2HZE A;  3IOS A;  1AQW A;  2R0C A;  3KH7 A;  3LYK A;  6GSU A;  1K3L A;  4F0C A;  3HA9 A;  2FUG 2;  2QSI A;  1TK0 B;  2LJA A;  1I9D A;  2X4A A;  1YF1 A;  2RLI A;  4K7N A;  1A2J A;  3JCM L;  5HFI A;  3PGT A;  1R4W A;  1EGR A;  4G0I A;  3KTB A;  4TOP A;  1ABA A;  5IO0 A;  2V2G A;  3KJY A;  4OCE A;  1X9S B;  5IMA A;  2H19 A;  3UVH A;  1X0R A;  3FW2 A;  5CRG A;  1J08 A;  2RUE A;  2C0F A;  4WKW A;  1RW1 A;  3KP9 A;  3M1G A;  2WRT A;  3KZQ A;  1GTA A;  1XVW A;  3CRU A;  1ZMA A;  4MZW A;  6GSY A;  4IW9 A;  2ON7 A;  1F37 A;  3QAW A;  4PQI A;  4AGS A;  4ECJ A;  4I6X A;  3EU3 A;  4HS1 A;  1UN2 A;  2DJ0 A;  4L0W A;  5JWO B;  1OAZ A;  2RII A;  4K2D A;  2C4J A;  5A4U A;  3E0U A;  3VI7 A;  1WMJ A;  2C8U A;  1YZX A;  2YZH A;  2HE3 A;  4KCE A;  2CV4 A;  1I5G A;  3MIX A;  3UVT A;  4PTS A;  2GQL A;  3IRA A;  4HJ2 A;  1OKD A;  2XPD A;  2MBT A;  2C0D A;  2DMM A;  1ERT A;  4TXO B;  3IC8 A;  1EGO A;  4KUN A;  3IV4 A;  2VL9 A;  2OAD A;  3RDW A;  3HHV A;  4G19 A;  1VF3 A;  1HNB A;  3GTU A;  3RBT A;  2OA7 A;  4EE0 A;  3L0H A;  5HR1 A;  2B3S A;  3A2V A;  1OE8 A;  3M3M A;  4I97 A;  1FAA A;  3QD9 A;  3GUR A;  3TOT A;  3HKR A;  1RQM A;  2X8H A;  4X1U A;  4J2F A;  4AJ8 A;  3LXT A;  3EMX A;  5HFG A;  3G7J A;  3VWV A;  3EPT A;  3IC4 A;  4E8H A;  3DXB A;  2HRK A;  1TRS A;  2QC7 A;  4V2M A;  3WGD A;  3C73 A;  2FWG A;  3ERG A;  2WB9 A;  3GNJ A;  4CY8 A;  3UIW A;  3LWA A;  1K0C A;  3DML A;  4KDU A;  2K8S A;  1GTB A;  3D6I A;  2AYT A;  2HSM A;  1UVZ A;  5J9B A;  3UMA A;  3KTL A;  4MP4 A;  4MZB A;  4BA7 A;  1ZZY A;  1RK4 A;  3CRT A;  4MCU A;  3PH9 A;  2FLS A;  2YCD A;  3F4T A;  2B5Y A;  1EV9 A;  2N5A A;  1A24 A;  2VCT A;  2A4V A;  1WE0 A;  3VK9 A;  3US3 A;  4CW9 A;  3KMN A;  2AAW A;  4G10 A;  1YY7 A;  2VUP A;  1GSQ A;  3QPM A;  2K18 A;  4WR5 A;  3D4T A;  1QK8 A;  1EEM A;  1MEK A;  5D9V A;  2ON5 A;  6GSV A;  1M0U A;  1JZR A;  1GTI A;  1DE1 A;  2VLT A;  4ACS A;  3ZFB A;  1PX6 A;  3L9V A;  3LFL A;  1URM A;  1K0M A;  2M46 A;  3H8Q A;  3CSH A;  4WR4 A;  4K7O A;  4MJC A;  5F06 A;  2DLX A;  5JWQ B;  3ZZX A;  2EIQ A;  1SKS B;  4PNF A;  1ZYN A;  3C1S A;  1MDJ A;  1X5C A;  1EOH A;  1GUM A;  2LJK A;  5A4W A;  1GL8 A;  3HY2 A;  1SKW B;  4GSS A;  3CSJ A;  5IO2 A;  4K2X A;  3HJP A;  2B7J A;  2K8V A;  1MD4 A;  4YQM A;  2HNL A;  4RI7 A;  5D93 A;  2FWH A;  2J9H A;  5BMU A;  1M7T A;  1XW6 A;  2LQO A;  1NSW A;  1IYI A;  3H1N A;  4HZ4 A;  4LA1 A;  2P0G A;  4LL1 B;  5B6N A;  3DRN A;  3VLN A;  4KB3 A;  2F8F A;  3F9U A;  1VGL A;  1N2A A;  4OFT A;  1WPI A;  3GIX A;  1O7U A;  3WYW A;  1V9W A;  3KIJ A;  2JZS A;  1XOB A;  5B7C A;  2GGT A;  1K0D A;  1TTZ A;  3QCP A;  4ZIJ A;  2IMI A;  2IWT A;  3A5I A;  3CXG A;  3ZFL A;  2IFQ B;  3GA4 A;  3HVS A;  3HJO A;  5H5Q A;  2N5F A;  4O5Q A;  2AHE A;  4V2L A;  1K0B A;  3ZRE A;  4FO5 A;  4WBR D;  4WF5 A;  5H5S A;  3EC3 A;  2XBI A;  3TUE A;  1Z7R A;  1XBS A;  4WEY A;  1FG4 A;  2OBK A;  4RQX A;  3ERW A;  4YQV A;  5AIV A;  4HZ2 A;  2PER A;  1E2Y A;  3FEU A;  3HYP A;  4MDC A;  1FW1 A;  4KE3 A;  2V32 A;  1ILO A;  2VLU A;  2CA8 A;  4O92 A;  1E6B A;  1JLW A;  5IIZ A;  2WFC A;  4DSS A;  2YWN A;  2L5L A;  4GWR A;  5DDL A;  2CAQ A;  1TXX A;  4XHM A;  1G0T A;  1XXU A;  1U3A A;  4JED A;  1SJZ A;  5D9X A;  3ZYW A;  4MMM A;  1QFN A;  5LD0 A;  1T7P B;  4IEL A;  2L4Q A;  5JCW A;  5DAK B;  2P5Q A;  2GT6 A;  1YF0 A;  3EMP A;  4MZC A;  4YKF A;  2DSA A;  1EP7 A;  2E2M A;  2H1D A;  4BL7 A;  3LQ7 A;  5CYY A;  2HZE B;  4JE1 A;  1CQH A;  3I6A A;  3DWV A;  2FCH A;  3G9B A;  5EY6 A;  1XVQ A;  1GRX A;  2LEG A;  20GS A;  2GSQ A;  3KP8 A;  4YAV A;  4PGT A;  3GRX A;  1OC9 A;  4QL7 A;  5IMZ A;  3H4K A;  4IN0 A;  4IHU A;  2VAF A;  3HDC A;  3KCM A;  1A0R P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...