4DVCA

Structural and functional studies of tcpg, the vibrio cholerae dsba disulfide-forming protein required for pilus and cholera toxin production
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
184
structure length
184
Chain Sequence
SNAAQFKEGEHYQVLKTPASSSPVVSEFFSFYCPHCNTFEPIIAQLKQQLPEGAKFQKNHVSFMGGNMGQAMSKAYATMIALEVEDKMVPVMFNRIHTLRKPPKDEQELRQIFLDEGIDAAKFDAAYNGFAVDSMVHRFDKQFQDSGLTGVPAVVVNNRYLVQGQSAKSLDEYFDLVNYLLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol:disulfide interchange protein DsbA
publication title The 1.2 A resolution crystal structure of TcpG, the Vibrio cholerae DsbA disulfide-forming protein required for pilus and cholera-toxin production
pubmed doi rcsb
source organism Vibrio cholerae
total genus 61
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2012-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4dvcA00
1X5DA 1Z6MA 2LUSA 2DJKA 3HCZA 5ECHB 4EF0A 1AW9A 2PMTA 4ZBAA 4JRRA 1M7TA 4HI7A 4HQZA 2FY6A 1N8JA 5D73A 3GL5A 3TCOA 4HZ2A 4BA7A 2XPEA 4XS1A 1CQGA 2V32A 5IOWA 5DDLA 2FHEA 3LWAA 3EMXA 3EU4A 3A2VA 4RQXA 5D9TA 3IBHA 3M9JA 1T3BA 4LA1A 5L71A 1GRXA 2LJAA 1EZKA 4MMMA 1PD21 5B8BA 2R3XA 2L5LA 3P8WA 1FB6A 2P31A 2Z9SA 2ZNMA 2E2GA 1Z6NA 2MMZA 6GSWA 4F0CA 2KLXA 2H6YA 1PKWA 3GL3A 3L4NA 2MBSA 2DJ0A 2JSYA 5D93A 4HS1A 1PX7A 2PWJA 4TW5A 1ZZYA 2VM2A 2JL4A 17GSA 3APOA 1Y25A 1J0FA 4NHZA 4XHMA 2N5BA 5IPGA 2O87A 2GDRA 2X8HA 4GWRA 2GQMA 4OFNA 5F05A 1THXA 4BVYA 2OADA 2H72A 1A0RP 1UC7A 4GRFA 5HFIA 13GSA 4FIWA 1T4ZA 3ZLPA 2YZUA 1YY7A 3S9FA 3CSJA 1AIUA 4DVCA 1S3DA 3EC3A 3RPNA 4E8HA 1G7EA 1T8EB 3M9KA 2V41A 2DSAA 4I2UA 4BVXA 3ZVJD 3EYTA 3KTBA 2QSIA 1XXUA 3NIVA 3IDVA 3O76A 11GSA 5DCGA 4OWYA 1QXHA 2GQKA 1SD9A 1RQMA 2GQLA 1GSYA 1ZOFA 2IFQA 5H5SA 2BJXA 2H0IA 2VLVA 4PNFA 3D4MA 2R4VA 1ZGNA 3DRNA 4GF0A 3UAPA 4Q5QA 3ZFBA 1X9WB 4AJ7A 4JEDA 4CW9A 1R7HA 5CRDA 1EEMA 1AQXA 1GSEA 2YANA 3P2AA 2YOIA 4WBJA 1FW1A 1AXDA 3W6GA 2HE3A 5B6NA 1C72A 2VD1A 2EC4A 2GSSA 4I97A 1ERUA 1K0DA 5IIZA 14GSA 2KUCA 4J2FA 3Q74A 2VCVA 2HSHA 5F06A 5A5KA 5FT3A 1FVKA 4POBA 4POMA 4POKA 4KDXA 3HVSA 4BL7A 5J3RA 1TK5B 4TXOB 3ZIJA 3GIXA 2V6KA 4HUAA 3TJGA 4PQIA 2I81A 4ACSA 5B6MA 4G9HA 1WIKA 4X43A 3U5RE 3C8EA 2LQOA 3HD5A 4N0VA 4LLRA 1GUMA 4K1FA 3UBLA 2GZZA 4KGIA 2LSTA 1N2AA 2VCZA 3UIWA 1PGTA 1VF2A 1Z7PA 5CRGA 1B8XA 4GSNA 2MYGA 3MSZA 2R6KA 1TU7A 2H0GA 4NV5A 3L9VA 3APQA 4KNDA 2VLTA 3W8SA 3MAKA 1OC8A 3RDWA 3ME7A 4NHWA 1HNCA 1GTUA 1U6TA 3IR4A 1GSUA 5DALA 16GSA 4MZBA 3C71A 2AJQB 4IHUA 1V57A 4EXJA 1TJDA 3TKSA 2CZ2A 2H75A 1ON4A 2GZYA 3EMPA 1K0AA 2GSRA 2FWFA 1BAYA 1F9MA 4TR0A 5C04A 1XVWA 1URMA 2PVQA 2HI7A 4WKWA 3BOAA 1MEKA 2F8AA 2LJRA 2P0GA 4KSMA 4F03A 2WDUA 2OA7A 1XWCA 5F07A 1TRUA 1DUGA 1OE7A 3F4TA 1GWCA 1THOA 5CRWA 3QOUA 5ECPB 2RUFA 1WJKA 4ZL8A 2MMNA 5DBQA 1BX9A 2A2RA 1R4WA 3GTUB 1SENA 1OAZA 4HQSA 3VURA 4TRXA 3KM6A 4ZB8A 5ENUA 3TUEA 2IMFA 2TRXA 1S3CA 4XTSA 1V9WA 1AQWA 4K2DA 4CDOA 4IQ1A 5ECIB 3TKSE 3L78A 2R37A 4WR4A 3LFLA 5HR1A 4WXTA 3LORA 3VPQA 5CNWA 3VK9A 1K0OA 1SL0B 2AYTA 2P5RA 1A2JA 1JLWA 4J57E 2LV3A 5CAXA 2REMA 5ECNB 4HU9A 1JFUA 3RAZA 4IGJA 2CT6A 3KH7A 4XS6A 3DMLA 2EIRA 3DWVA 5JCUA 4MP4A 2CQ9A 2FUG2 2PGTA 2IWTA 2GT6A 3LQ7A 1TRVA 4QQ7A 1O73A 2GZPA 6GSSA 2VUPA 3WGXA 3MNGA 4MF6A 4XS4A 2HNLA 4O92A 5KEJA 1Y6EA 2H0HA 3ZIVA 1IYHA 5G30A 5CYYA 4H86A 1K0NA 3D4TA 5IMZA 5IPHA 5ECOB 3D21A 1M2BA 2EIOA 2E2MA 2MMAA 4TR1B 2LS5A 1F6MC 4L0UA 3N5OA 9GSSA 2FWEA 1FO5A 3G9BA 1A8LA 5ECRB 1G7OA 3FZ9A 1PQNA 4F2IA 4MH3A 3UBKA 3QAWA 3IC4A 1AUCA 4QL7A 2XC2A 1K3YA 1F3AA 3HKRA 4MF7A 1SJ6A 1ZMAA 2AB6A 1LU4A 1B4PA 1O6JA 1OC9A 1GH2A 2I9HA 1GTBA 5ECMB 2PBJA 3F9UA 5LD0A 3HZ4A 1U3IA 3VWXA 4ISDA 2H76A 1FAAA 2YNXA 4K7IA 5LCZA 1XW9A 4L5OA 3GSSA 5INYA 5ECLB 3M3MA 4GQFA 3KEBA 1ZYEA 4O32A 4JU5A 1QFNA 2K9FA 4XCSA 4K7OA 1EP7A 5FWGA 2DJJA 4MZCA 3G7JA 3HY2A 2CVKA 3TOUA 1V2AA 4GCIA 1YKCA 4DSRA 3KTLA 1EEJA 3PGTA 1BQ7A 1TI3A 4NAXA 3R2QA 1EGOA 3G7YA 4KDYA 3HHVA 2GSQA 3CRTA 5E59A 3TKPA 5DQSA 4EUYA 2IJYA 2FNOA 1XFLA 2CA8A 4G10A 3VWUA 5CP1A 1K3OA 1YQ1A 3PINA 2C3NA 2H30A 2B1LA 2H1BA 3EU3A 1YKAA 1Z5YE 3I69A 4KA0A 1GTIA 4V2NA 3F3RA 3UL3A 3FKFA 2CV4A 1EV9A 3LSZA 1JZWA 2BMXA 2FA4A 3HDCA 1M0UA 5LNKe 4HDEA 5HFKA 1G0TA 2LTKA 2L4QA 1QMVA 1TDIA 1HYUA 3HJMA 1W4VA 1H4OA 4K7NA 4IVFA 1FVJA 4FYUA 4TN8A 3GFKA 4YQVA 5AGYA 1NHYA 1HNBA 3ZL5A 3K8NA 5GSTA 2IL3A 2X99A 6GSUA 3U6VA 3Q6OA 3QMXA 4PUAA 2OE3A 3IAS2 22GSA 2C0GA 2YV9A 2C0FA 4ULXA 2H8LA 3E3EA 4EVMA 1VRSD 3DEXA 5ID2A 3P90A 5J4UA 1AAZA 3CBUA 2V6OA 1S3AA 5ID2B 2A2SA 4KX4A 4FYBA 3VPTA 4I8BA 5D8IA 5D9VA 2YPMA 2B6MA 2ZUPA 2VAFA 4XRAA 1NW2A 3CSHA 4PURA 5E4WA 1YEPA 3F8UA 3F4RA 2CAIA 4O7HA 3J7Yb 4ECBA 1QGVA 1G6WA 2RM5A 1NM3A 2I4AA 3LXTA 2DBCA 3Q19A 1TP9A 2LQQA 2F8FA 4ZL7A 1Q98A 4KCEA 3CTFA 2X8GA 3VWVA 3F6DA 1E2YA 1XWBA 1ZL9A 3CRUA 1XOAA 4NXIA 5ECKB 2J23A 4NWYA 3DXBA 3C7MA 4PXOA 3KGKA 2PERA 2OBKA 3RHBA 1LBKA 1VF4A 2AHEA 1V98A 1TW9A 10GSA 1WOUA 3F6FA 3EINA 1FHEA 1XBSA 2VOCA 4FH8A 3MWHA 5G31A 3TJKA 1ERWA 3EURA 4K0GA 2VL2C 2GGTA 2WS2A 3TRPA 4IKHA 2HLSA 2L59A 3P7XA 2B7KA 2M80A 1XWGA 1U3AA 3DKSA 1JZOA 1MDJA 3EE2A 3M8NA 2NTOA 5KN3A 2QKEA 3UVHA 3GUSA 4TXOA 3V1WA 4K6XA 4ML1A 5ECSA 3LG6A 2YP6A 2RIIA 2VM1A 2K8SA 1JLVA 3QDNA 4POLA 4D73A 3FZ5A 4N11A 4D73B 1TXXA 1XPVA 4KDUA 1GUHA 3IV4A 1M99A 3ZVJA 1NSWA 2O8VB 3ZREA 1K0CA 1WPIA 5J41A 2XHFA 3LYPA 4N30A 4KH7A 4TR3A 1SK1A 3OR5A 4MJBA 3A2WA 3E9JB 3QAVA 3GV1A 5JWQB 5G1KA 4KE3A 3UMAA 4AJ6A 3KMNA 4BWQA 1WE0A 3LEFA 2WCIA 5HR0A 2ZCTA 3TJFA 4ZXGA 2EIQA 4IJIA 3ERFA 5C00A 2OBIA 1PL2A 4IN0A 1WP0A 3H1NA 4PNGA 3RPPA 2FCHA 4WEYA 1ST9A 4NPBA 4IJ3A 3FYGA 3WT1A 2IN3A 2DIZA 4TR4A 5J9BA 1DSBA 1YJ6A 1OC3A 4DSSB 1NHOA 2YWMA 3RBTA 2K8VA 2YJHA 2A4VA 2FA8A 5EPFA 1MD4A 4AF2A 5A4UA 3D0ZA 3H4KA 3GH6A 3WGEA 2G0FA 2DMLA 2CZ3A 3TOTA 3UEMA 1I9DA 3CXGA 4OO4A 3GKMA 4LMVA 3BJ5A 1O8WA 1BYEA 1HD2A 5F8BA 2H1GA 3GTUA 1T7PB 2G2QA 2VD0A 4FO5A 1ERVA 2VL9A 1E6BA 1PX6A 3E0UA 1ERTA 2AUVA 3US3A 1SD8A 1R26A 4BWSA 4MA9A 1SYRA 2OACA 2C3QA 5EL8A 1A24A 2QC7A 3BD2A 2RLIA 3GA4A 3EVIA 1MTCA 1FOVA 1ZYQB 1M9BA 1GUKA 6GSYA 4GXZA 1Q4JA 3FRCA 3A3TA 3TB2A 4IQAA 5H5RA 3ERWA 4HU7A 2JU5A 3C1RA 3ZMKA 1DE2A 6GSXA 3KZQA 4EDYA 2V2GA 3GSTA 3KXOA 4EL1A 2HXKA 4DEJA 4KUNA 1X0RA 1A8YA 1GLQA 1JHBA 1TK0B 4TOPA 2IMDA 2QGVA 5IOXA 4TR1A 4PQHA 4GSSA 1SK0A 5ELGA 1YF1A 4YAPA 5DJLA 2B3SA 2OE0A 4MDCA 5COHA 1WMJA 5DCHA 2K18A 3KIJA 2L57A 3FR3A 3GKKA 4G19A 4PQ1A 5GAPD 2PN8A 2MBTA 4JZQA 4MLYA 1ABAA 2NDOA 4EC0A 2GTUA 1MDKA 5IO2A 4MJAA 2XPDA 4BPYA 2O85A 4X1UA 1IYIA 1CQHA 5B7CA 2F51A 3CYNA 5F0GA 5AN1A 4ML6A 3CMIA 1OVNA 2GLRA 2H6XA 3F0IA 3GYKA 2HZEB 2DJ1A 4MABA 7GSSA 2IMIA 3H79A 1TOFA 1SKRB 3QFBC 2OE1A 2XBIA 3DVXA 1M2DA 4HZ4A 3QAGA 2L5OA 5ECQB 4XIHA 1BG5A 2JSZA 4ZBDA 2I1UA 3IRAA 5FHIA 2H66A 3O3TA 4JE1A 1RW1A 4OD7A 1AC1A 2B5XA 3M0FA 5JCGA 2YJ7A 2VL2A 2WGRA 3HXSA 3QD9A 1V58A 3GKNA 1SKWB 2L6CA 4GTUA 5G5EA 4ECIA 1B9YC 2H71A 1T00A 3F4SA 3GX0A 4OCFA 3MDKA 3GH9A 3PR8A 2C3TA 1R5AA 4MPFA 2ALBA 4K8MA 4N0ZA 1QQ2A 2OKAA 1PA3A 2GSTA 3QFAC 5IMDA 3ZRDA 1SU9A 1VF3A 1XWAA 2KP1A 4RQRA 4RUVA 2GVPA 4MK3A 4WETA 4JR4A 2X64A 2AAWA 1R5PA 5IMCA 3QR6A 1W89A 2LKUA 4ZBBA 1LJRA 5G2ZA 5IMVA 2DJ2A 3FR9A 5D9WA 1MDIA 1SYXA 1SKSB 3IK9A 2H19A 1HQOA 5CRHA 4K9ZA 19GSA 4WR5A 1ACVA 5D96A 2LRTA 1ILOA 2ES7A 1EP8A 3G7IA 4HJMA 3HYPA 3ME8A 3VI5A 4CHSA 4X0XA 2NBSA 5JWOB 4YQMA 3H93A 3DIEA 2C1YA 1XW5A 2HZFA 3ZTLA 1DBYA 3F3QA 1XW6A 1GTAA 3SBCA 3KJYA 4IP6A 4GSTA 5DJMA 3IHQA 1GSQA 5DAKA 5AIVA 4ZL9A 1FG4A 3GKXA 2J9HA 4KB3A 3IE3A 5DAKB 1A2MA 2FD3A 1TKDB 1X9MB 5D9XA 1PSQA 5DVBA 4V1Ag 5HR2A 1AQVA 2ON7A 2WRTA 3HJPA 4MH2A 3IXRA 2YWIA 1SL2B 3VLNA 1BEDA 2N5FA 5EY6A 2XBQA 1FB0A 3GURA 2IMEA 4PUFC 4FYCA 2H1AA 4YQUA 1J9BA 4ZIJA 2CVDA 3UJ1A 3JCML 2M46A 1YZXA 4J56E 1ZCPA 4PX1A 2HRNA 2L6DA 5J5NA 2LRNA 2LNTA 1GSSA 1Z3EA 5IM9A 3D5JA 3M1GA 3ZYWA 1SL1B 4TKYA 2VLUA 1GL8A 2DC5A 3I43A 3ZMLA 3N9JA 2H6ZA 1EWXA 2M72A 3F63A 2DLXA 4OMVA 3VWWA 4IELA 3GN3A 1F37A 5EVOA 3J7Yk 1B9XC 1SK2A 4KW6A 1TI1A 2C0DA 2HSYA 1XVQA 3GRXA 3Q18A 2YN1A 4NV2A 4GLTA 3A5WA 2H70A 3APSA 3FW2A 3UOMA 1M9AA 2PU9C 3I9V2 5KN0A 4WF5A 1EGRA 2VCWA 4MPGA 1MD3A 1GP1A 1GNEA 3KH9A 3ZZXA 2C8UA 1K3LA 3DGQA 3C1SA 2DMMA 1GULA 2FLSA 5G5FA 1YF0A 1OKTA 2TIRA 4I5QA 4MF5A 5GAND 4IBPA 2IFQB 1PL1A 3HVXA 2F9SA 2IIYA 4L8EA 1TTZA 4MZWA 2TRCP 1TK8B 2JADA 4ID0A 1A2LA 2H1DA 4F82A 4WF4A 5ELAA 4I2TA 1G6YA 1WRYA 2VCTA 4DSQA 1K0MA 2H01A 1H75A 3EWLA 4LMWA 1X5CA 2OJLA 2D2ZA 3FEUA 1VGLA 2RUEA 1JZDA 3TRXA 3O6TA 1K0BA 1B48A 5AISA 1XZOA 3QCPA 1PKZA 2B5YA 2B5EA 2VO4A 3TDGA 1KTEA 3GX8A 1EOGA 2VCQA 5KN2A 4KAEA 4ZB9A 1O8XA 3KMOA 4OO5A 3UVTA 3DD3A 3SWLA 4L0WA 1OYJA 2PPTA 3W8JA 3L0HA 1X5EA 4KSOA 2E0QA 5DQYA 1RK4A 1A23A 2JZTA 1F3BA 3L9UA 2WJUA 1XWKA 3FY7A 1T1VA 3A2XA 1UVZA 4N10A 6GSTA 5IQYA 1O7UA 2CVBA 3WT2A 3ZFLA 18GSA 3ERGA 2BTOT 3IOSA 1UA5A 3GHAA 4TXVA 5HR3A 2DJ3A 2H73A 1J08A 3ZITA 2CX3A 3KD0A 4V1Ap 2F3MA 1USBA 2HRFA 3KP9A 1PRXA 5DALB 4P3YB 1UN2A 4DSSA 4EE0A 4HOJA 1I5GA 4OFTA 1QUWA 4HEA2 5IMFA 2KP2A 3BCIA 2PUKC 2KOKA 1TRWA 4V2LA 4IW9A 1YDKA 2WZ9A 4V2MA 2YWOA 5IO0A 4ECCA 3KCMA 2B7JA 1PN9A 1XIYA 4KCAA 4E8EA 1YEXA 1KEBA 2IPAA 3LGCA 5A4VA 1TRSA 2B1KA 2FWHA 2C0EA 1GSDA 3FK8A 1M2AA 2AV4A 3IPZA 2ON5A 1Z7RA 4WBRD 1VF1A 3TKRA 8GSSA 1JZRA 4MCUA 3HZ8A 1XOBA 3AY8A 4LL4B 3PH9A 2PVOC 3IK7A 4ILFA 4PGTA 4HJ2A 5GZZB 2C80A 2IMKA 3DYRA 2GT5A 2WULA 3L9SA 2I3YA 1GLPA 3KP8A 4GQCA 4TVEA 1OKDA 4MJEA 2WFCA 6GSVA 1TU8A 2GS3A 3VFIA 3CSIA 1XCCA 4RI6A 2CAQA 3D6IA 4MJCA 5A4WA 2YWNA 4EO3A 2H74A 4JR6A 4QL9A 1KNGA 3HVVA 2C4JA 2RM6A 1WWJA 2JZSA 2O7KA 2R5GA 3UARA 2NVLA 3VI7A 2LRCA 4F9ZA 2E7PA 5CO3A 1EOHA 5G1LA 3FZAA 2MZCA 1OE8A 5AIXA 4OCEA 1BJXA 2LNSA 3FR6A 4XS4B 4L5LA 1PMTA 2DIYA 3LXZA 3GNJA 3FZ4A 3HJOA 5GSSA 4YH2A 20GSA 4Q5FA 1SJIA 2P5QA 2CX4A 3NZNA 3TJJA 3HA9A 5B8AA 2FGXA 3IAM2 1U88A 1GSFA 3TRQA 5JCWA 3TKQA 1QK8A 3I6AA 2HZEA 4OFMA 1ML6A 2KHPA 3LJRA 4RI7A 1DE1A 3TGZA 4K0NA 3CTGA 2JACA 2WB9A 1SJZA 4EKZA 5ABRA 5JWRB 3BCKA 5J9CA 3DVWA 2VIMA 2YZHA 4Z7XA 2NPBA 2K6VA 5H5QA 2YV7A 2FWGA 3C73A 1OC9B 3ISOA 2V1MA 4G2EA 1KBNA 2R2JA 1B4QA 4YAVA 2VL3A 4XRDA 3IA1A 4Q5RA 12GSA 2X8CA 2L4CA 4IS0A 2N5AA 1A0FA 2YCDA 3TKSC 2MMOA 5HQPA 3FHKA 2HFDA 5IMAA 5HFGA 3D22A 4EDZA 4ZILA 2LEGA 4IP1A 1HNAA 1U87A 2LJKA 3QPMA 4I6XA 4ZB6A 3RHCA 1EV4A 4AGSA 2HT9A 1O81A 4AJ8A 1Z9HA 3LYKA 4NMUA 5KN1A 4LL1B 4JBBA 4F0BA 1GNWA 3WD6A 3WGDA 1X9SB 3TJBA 3WYWA 3BBYA 1V40A 3H8QA 4O5RA 2HYXA 1T4YA 1O85A 2O89A 2VCXA 5CREA 1F2EA 3GMFA 4ECJA 3NOFA 4Q5NA 2JZRA 3ED3A
chains in the Genus database with same CATH superfamily
1X5DA 1Z6MA 2LUSA 2DJKA 3HCZA 5ECHB 4EF0A 1AW9A 2PMTA 4ZBAA 4JRRA 1M7TA 4HI7A 4HQZA 2FY6A 1N8JA 5D73A 3GL5A 3TCOA 4HZ2A 4BA7A 2XPEA 4XS1A 1CQGA 2V32A 5IOWA 5DDLA 2FHEA 3LWAA 3EMXA 3EU4A 3A2VA 4RQXA 5D9TA 3IBHA 3M9JA 1T3BA 4LA1A 5L71A 1GRXA 2LJAA 1EZKA 4MMMA 1PD21 5B8BA 2R3XA 2L5LA 3P8WA 1FB6A 2P31A 2Z9SA 2ZNMA 2E2GA 1Z6NA 2MMZA 6GSWA 4F0CA 2KLXA 2H6YA 1PKWA 4HSCX 3GL3A 3L4NA 2MBSA 2DJ0A 2JSYA 5D93A 4HS1A 1PX7A 2PWJA 4TW5A 1ZZYA 2VM2A 2JL4A 5KOWA 17GSA 3APOA 1Y25A 1J0FA 4NHZA 4XHMA 2N5BA 5IPGA 2O87A 2GDRA 2X8HA 4GWRA 2GQMA 4OFNA 5F05A 1THXA 4BVYA 2OADA 2H72A 1A0RP 1UC7A 3MIXA 4GRFA 5HFIA 13GSA 4FIWA 1T4ZA 3ZLPA 2YZUA 1YY7A 3S9FA 3CSJA 1AIUA 4DVCA 1S3DA 3EC3A 3RPNA 4E8HA 1G7EA 4PTSA 1T8EB 3M9KA 2V41A 2DSAA 4I2UA 4BVXA 3ZVJD 3EYTA 1FOHA 3KTBA 2QSIA 1XXUA 3NIVA 3IDVA 3O76A 11GSA 5DCGA 4OWYA 1QXHA 2GQKA 1SD9A 1RQMA 2GQLA 1GSYA 1ZOFA 2IFQA 5H5SA 2BJXA 2H0IA 2VLVA 4PNFA 3D4MA 2R4VA 1ZGNA 3DRNA 4GF0A 3UAPA 4Q5QA 3ZFBA 1X9WB 4AJ7A 4JEDA 4CW9A 1R7HA 5CRDA 1EEMA 1AQXA 1GSEA 2YANA 3P2AA 2YOIA 4WBJA 1FW1A 1AXDA 3W6GA 2HE3A 5B6NA 1C72A 2VD1A 2EC4A 2GSSA 4I97A 1ERUA 1K0DA 5IIZA 14GSA 2KUCA 4J2FA 3Q74A 2VCVA 2HSHA 5F06A 5A5KA 5FT3A 1FVKA 4POBA 4POMA 4POKA 4KDXA 3HVSA 4BL7A 5J3RA 1TK5B 4TXOB 3ZIJA 4G0LA 3GIXA 2V6KA 4HUAA 3TJGA 4PQIA 2I81A 4ACSA 5B6MA 4G9HA 1WIKA 4X43A 3U5RE 3C8EA 2LQOA 3HD5A 4N0VA 4LLRA 1GUMA 4K1FA 3UBLA 2GZZA 4KGIA 2LSTA 1N2AA 2VCZA 3UIWA 1PGTA 1VF2A 1Z7PA 5CRGA 1B8XA 4GSNA 2MYGA 3MSZA 2R6KA 4G0KA 1TU7A 2H0GA 4NV5A 3L9VA 3APQA 4KNDA 2HSMA 2VLTA 3W8SA 3MAKA 1OC8A 3RDWA 3ME7A 4NHWA 1HNCA 1GTUA 1U6TA 3IR4A 1GSUA 5DALA 16GSA 4MZBA 3C71A 2AJQB 4IHUA 1V57A 4EXJA 1TJDA 3TKSA 2CZ2A 2H75A 1ZYPA 1ON4A 2GZYA 3EMPA 1K0AA 2GSRA 2FWFA 1BAYA 1F9MA 4TR0A 5C04A 1XVWA 1URMA 2PVQA 2HI7A 4WKWA 3BOAA 5KOXA 1MEKA 2F8AA 2LJRA 2P0GA 4KSMA 4F03A 2WDUA 2OA7A 1XWCA 5F07A 1TRUA 1DUGA 1OE7A 3F4TA 1GWCA 1THOA 3A5IA 5CRWA 3QOUA 5ECPB 2RUFA 1WJKA 4ZL8A 2MMNA 5DBQA 1BX9A 2A2RA 1R4WA 3GTUB 1SENA 1OAZA 4HQSA 3VURA 4TRXA 3KM6A 4ZB8A 5ENUA 3TUEA 2IMFA 2TRXA 1S3CA 4XTSA 1V9WA 1AQWA 4K2DA 4CDOA 4IQ1A 5ECIB 3TKSE 3L78A 3EPTA 2R37A 4WR4A 3LFLA 5HR1A 4WXTA 3LORA 3VPQA 5CNWA 3VK9A 1K0OA 1SL0B 2AYTA 2P5RA 1A2JA 1JLWA 4J57E 2LV3A 5CAXA 2REMA 5ECNB 4HU9A 1JFUA 3RAZA 4IGJA 2CT6A 3KH7A 4XS6A 3DMLA 2EIRA 3DWVA 5JCUA 4MP4A 2CQ9A 2FUG2 2PGTA 2IWTA 2GT6A 3LQ7A 1TRVA 4QQ7A 1O73A 2GZPA 6GSSA 2VUPA 3WGXA 3IHGA 3MNGA 4MF6A 4XS4A 2HNLA 4O92A 5KEJA 1Y6EA 2H0HA 3ZIVA 1IYHA 5G30A 5CYYA 4H86A 1K0NA 3D4TA 5IMZA 5IPHA 5ECOB 3D21A 1M2BA 2EIOA 2E2MA 2MMAA 4TR1B 2LS5A 1F6MC 4L0UA 3N5OA 9GSSA 2FWEA 1FO5A 3G9BA 1A8LA 5ECRB 1G7OA 3FZ9A 1PQNA 4F2IA 4MH3A 3UBKA 3QAWA 3IC4A 1AUCA 4QL7A 2XC2A 1K3YA 1F3AA 4K5RA 3HKRA 4MF7A 1SJ6A 1ZMAA 2AB6A 1LU4A 1B4PA 1O6JA 1OC9A 1GH2A 2I9HA 1GTBA 5ECMB 2PBJA 3F9UA 5LD0A 3HZ4A 1U3IA 3VWXA 4ISDA 2H76A 1FAAA 2YNXA 4K7IA 5LCZA 1XW9A 4L5OA 3GSSA 5INYA 5ECLB 3M3MA 4GQFA 3KEBA 1ZYEA 4O32A 4JU5A 1QFNA 2K9FA 4XCSA 4K7OA 1EP7A 5FWGA 2DJJA 4MZCA 3G7JA 3HY2A 2CVKA 3TOUA 1V2AA 4GCIA 1YKCA 4DSRA 3KTLA 1EEJA 3PGTA 1BQ7A 1TI3A 4NAXA 3R2QA 1EGOA 3G7YA 4KDYA 4X4JA 3HHVA 2GSQA 3CRTA 5E59A 3TKPA 5DQSA 4EUYA 2IJYA 2FNOA 1XFLA 2CA8A 4G10A 3VWUA 5CP1A 1K3OA 1YQ1A 3PINA 2C3NA 2H30A 2B1LA 2H1BA 3EU3A 1YKAA 1Z5YE 3I69A 4KA0A 1GTIA 4V2NA 3F3RA 3UL3A 3FKFA 2CV4A 1EV9A 3LSZA 1JZWA 2BMXA 2FA4A 3HDCA 1M0UA 5LNKe 4HDEA 2A4HA 5HFKA 1G0TA 2LTKA 2L4QA 1QMVA 1TDIA 1HYUA 3HJMA 1W4VA 1H4OA 4K7NA 4IVFA 1FVJA 4FYUA 4TN8A 3GFKA 4YQVA 5AGYA 1NHYA 1HNBA 3ZL5A 3K8NA 5GSTA 2IL3A 2X99A 6GSUA 3U6VA 3Q6OA 3QMXA 4PUAA 2OE3A 3IAS2 22GSA 2C0GA 2YV9A 2C0FA 4ULXA 2H8LA 3E3EA 4EVMA 1VRSD 3DEXA 5ID2A 3P90A 5J4UA 1AAZA 3CBUA 2V6OA 1S3AA 5ID2B 2A2SA 4KX4A 4FYBA 3VPTA 4I8BA 5D8IA 5D9VA 2YPMA 2B6MA 2ZUPA 2QA1A 2VAFA 4XRAA 1NW2A 3CSHA 4PURA 5E4WA 1YEPA 3F8UA 3F4RA 2CAIA 4O7HA 3J7Yb 4ECBA 1QGVA 1G6WA 2RM5A 1NM3A 2I4AA 3LXTA 2DBCA 3Q19A 1TP9A 2LQQA 2F8FA 4ZL7A 4FQUA 1Q98A 4KCEA 3CTFA 2X8GA 3VWVA 3F6DA 1E2YA 1XWBA 1ZL9A 3CRUA 1XOAA 4NXIA 5ECKB 2J23A 4Z2RA 4A5PA 4NWYA 3DXBA 3C7MA 4PXOA 3KGKA 2PERA 2OBKA 3RHBA 3HVNA 1LBKA 1VF4A 2AHEA 1V98A 1TW9A 10GSA 1WOUA 3F6FA 3EINA 1FHEA 1XBSA 2QA2A 2VOCA 4FH8A 3MWHA 5G31A 3TJKA 1ERWA 3EURA 4K0GA 2VL2C 2GGTA 2WS2A 3TRPA 4IKHA 2HLSA 2L59A 3P7XA 2B7KA 2M80A 1XWGA 1U3AA 3DKSA 1JZOA 1MDJA 3EE2A 3M8NA 2NTOA 5KN3A 2QKEA 3UVHA 4EIPA 3GUSA 4TXOA 3V1WA 4K6XA 4ML1A 5ECSA 3LG6A 2YP6A 2RIIA 2VM1A 2K8SA 1PN0A 1JLVA 3QDNA 4POLA 4D73A 3FZ5A 4N11A 4D73B 1TXXA 1XPVA 4KDUA 1GUHA 3IV4A 1M99A 3ZVJA 1NSWA 2O8VB 3ZREA 1K0CA 1WPIA 5J41A 2XHFA 3LYPA 4N30A 4KH7A 4TR3A 1SK1A 3OR5A 4MJBA 3A2WA 2DKIA 3E9JB 4EIQA 3QAVA 3GV1A 5JWQB 5G1KA 4KE3A 3UMAA 4AJ6A 3KMNA 4BWQA 1WE0A 3LEFA 2WCIA 5HR0A 2ZCTA 3TJFA 4ZXGA 2EIQA 4IJIA 3ERFA 5C00A 2OBIA 5BRTA 1PL2A 4IN0A 1WP0A 3H1NA 4PNGA 3RPPA 2FCHA 4WEYA 1ST9A 4NPBA 4IJ3A 3FYGA 3WT1A 2IN3A 2DIZA 4TR4A 5J9BA 1DSBA 1YJ6A 1OC3A 4DSSB 1NHOA 1S3RA 2YWMA 3RBTA 2K8VA 2YJHA 2A4VA 4CY6A 2FA8A 5EPFA 1MD4A 4AF2A 5A4UA 3D0ZA 3H4KA 3GH6A 3WGEA 2G0FA 4Z2TA 2DMLA 2CZ3A 3TOTA 3UEMA 1I9DA 3CXGA 4OO4A 3GKMA 4LMVA 3BJ5A 1O8WA 1BYEA 1HD2A 5F8BA 2H1GA 3GTUA 1T7PB 2G2QA 2VD0A 4FO5A 1ERVA 2VL9A 1E6BA 1PX6A 3E0UA 1ERTA 2AUVA 3US3A 1SD8A 1R26A 4BWSA 4MA9A 1SYRA 2OACA 2C3QA 5EL8A 1A24A 2QC7A 4K5SA 3BD2A 3MYDA 2RLIA 3GA4A 3EVIA 1MTCA 1FOVA 1ZYQB 1M9BA 1GUKA 6GSYA 4GXZA 4Z2UA 1Q4JA 3FRCA 3A3TA 3TB2A 4IQAA 5H5RA 3ERWA 4HU7A 2JU5A 3C1RA 3ZMKA 1DE2A 6GSXA 3KZQA 4EDYA 2V2GA 3GSTA 3KXOA 4EL1A 2HXKA 4DEJA 4KUNA 1X0RA 1A8YA 1GLQA 1JHBA 1TK0B 4YKFA 4TOPA 3FMWA 2IMDA 2QGVA 5IOXA 4TR1A 4PQHA 4GSSA 1SK0A 5ELGA 1YF1A 3PPUA 4YAPA 5DJLA 2B3SA 2X49A 2OE0A 4MDCA 5COHA 1WMJA 5DCHA 2K18A 3KIJA 2L57A 3FR3A 3GKKA 4G19A 4PQ1A 5GAPD 2PN8A 2MBTA 4JZQA 4MLYA 1ABAA 2NDOA 4EC0A 2GTUA 1MDKA 5IO2A 4MJAA 2XPDA 4BPYA 2O85A 4X1UA 1IYIA 1CQHA 5B7CA 2F51A 3CYNA 5F0GA 5AN1A 4ML6A 3CMIA 1OVNA 2GLRA 2H6XA 3F0IA 3GYKA 2HZEB 2DJ1A 4MABA 7GSSA 2IMIA 3H79A 1TOFA 1SKRB 3QFBC 2OE1A 2XBIA 3DVXA 1M2DA 4HZ4A 3QAGA 2L5OA 5ECQB 4XIHA 1BG5A 2JSZA 4ZBDA 2I1UA 3IRAA 5FHIA 2H66A 3O3TA 4JE1A 1RW1A 4OD7A 1AC1A 2B5XA 3M0FA 5JCGA 2YJ7A 2HRAA 2VL2A 2WGRA 3HXSA 3QD9A 1V58A 3GKNA 1SKWB 2L6CA 4GTUA 5G5EA 4ECIA 1B9YC 2H71A 1T00A 3F4SA 3GX0A 4OCFA 3MDKA 3GH9A 3PR8A 4CY8A 5BMUA 2C3TA 1R5AA 4MPFA 2ALBA 4K8MA 4N0ZA 1QQ2A 2OKAA 1PA3A 2GSTA 3QFAC 5IMDA 3ZRDA 1SU9A 1VF3A 1XWAA 2KP1A 4RQRA 4RUVA 2GVPA 4MK3A 4WETA 4JR4A 2X64A 2AAWA 1R5PA 5IMCA 3QR6A 1W89A 2LKUA 4ZBBA 1LJRA 5G2ZA 4MNNA 5IMVA 2DJ2A 2R0CA 3FR9A 2UZ8A 5D9WA 1MDIA 1SYXA 1SKSB 3IK9A 2H19A 1HQOA 5CRHA 4K9ZA 19GSA 4WR5A 1ACVA 5D96A 2LRTA 1ILOA 2ES7A 1EP8A 3G7IA 4HJMA 2X4AA 3HYPA 3ME8A 3VI5A 4CHSA 4X0XA 2NBSA 5JWOB 4YQMA 3H93A 3DIEA 2C1YA 1XW5A 2HZFA 3ZTLA 1DBYA 3F3QA 1XW6A 1GTAA 3SBCA 3KJYA 4IP6A 4GSTA 5DJMA 3IHQA 1GSQA 5DAKA 5AIVA 4ZL9A 1FG4A 3GKXA 2J9HA 4KB3A 3IE3A 5DAKB 1A2MA 2FD3A 1TKDB 1X9MB 5D9XA 1PSQA 5DVBA 4V1Ag 5HR2A 1AQVA 2ON7A 2WRTA 3HJPA 4MH2A 3IXRA 2YWIA 1SL2B 3VLNA 1BEDA 2N5FA 2XBQA 5EY6A 1FB0A 3GURA 2IMEA 4PUFC 4FYCA 2H1AA 4YQUA 1J9BA 4ZIJA 2CVDA 3UJ1A 3JCML 2M46A 1YZXA 4J56E 1ZCPA 4PX1A 2HRNA 2L6DA 5J5NA 2LRNA 2LNTA 1GSSA 1Z3EA 5IM9A 3D5JA 3M1GA 3ZYWA 1SL1B 4TKYA 2VLUA 1GL8A 2DC5A 3I43A 3ZMLA 3N9JA 2H6ZA 2R0GA 1EWXA 2M72A 3F63A 2DLXA 4OMVA 1ZYNA 3VWWA 1M3IA 4IELA 3GN3A 1F37A 5EVOA 3J7Yk 1B9XC 1SK2A 4KW6A 4BVYB 1TI1A 2C0DA 2HSYA 1XVQA 4ICYA 3GRXA 3Q18A 2YN1A 4NV2A 4GLTA 3A5WA 2H70A 3APSA 3FW2A 3UOMA 1M9AA 2PU9C 3I9V2 5KN0A 4WF5A 1EGRA 2VCWA 4MPGA 2HRKA 1MD3A 1GP1A 1GNEA 4BVXB 3KH9A 3ZZXA 2C8UA 1K3LA 3DGQA 3C1SA 2DMMA 1GULA 2FLSA 5G5FA 1YF0A 1OKTA 2TIRA 4I5QA 4MF5A 5GAND 4IBPA 3IC8A 2IFQB 1PL1A 3HVXA 2F9SA 2IIYA 4KF9A 4L8EA 1TTZA 4MZWA 2TRCP 1TK8B 4USSA 2JADA 4ID0A 1A2LA 2H1DA 4F82A 4WF4A 5ELAA 4I2TA 1G6YA 1WRYA 2VCTA 4DSQA 1K0MA 2H01A 1H75A 3EWLA 4LMWA 1X5CA 2OJLA 2D2ZA 3FEUA 1VGLA 2RUEA 1JZDA 3TRXA 3O6TA 1K0BA 1B48A 5AISA 1XZOA 3QCPA 1PKZA 2B5YA 2B5EA 2VO4A 3TDGA 1KTEA 3GX8A 4BL7B 1EOGA 2VCQA 5KN2A 4KAEA 4ZB9A 1O8XA 3KMOA 4OO5A 3UVTA 3DD3A 3SWLA 4L0WA 1OYJA 2PPTA 3W8JA 3L0HA 1X5EA 4KSOA 2E0QA 5DQYA 1RK4A 1A23A 2JZTA 1F3BA 3L9UA 2WJUA 1XWKA 3FY7A 1T1VA 3A2XA 1UVZA 4N10A 6GSTA 5IQYA 1O7UA 2CVBA 3WT2A 3ZFLA 18GSA 3ERGA 2BTOT 3IOSA 1UA5A 3GHAA 4TXVA 5HR3A 2DJ3A 2H73A 1J08A 3ZITA 2CX3A 3KD0A 4V1Ap 2F3MA 1USBA 2HRFA 3KP9A 1PRXA 5DALB 4P3YB 1UN2A 4DSSA 4EE0A 4HOJA 1I5GA 4OFTA 1QUWA 4HEA2 5IMFA 2KP2A 3BCIA 2PUKC 2KOKA 1TRWA 4V2LA 4IW9A 1YDKA 2WZ9A 4V2MA 2YWOA 5IO0A 4ECCA 3KCMA 2B7JA 1PN9A 1XIYA 4KCAA 4E8EA 1XG8A 1YEXA 1KEBA 2IPAA 3LGCA 5A4VA 1TRSA 2B1KA 2FWHA 4YKGA 2C0EA 1GSDA 3FK8A 1M2AA 4BIKA 2AV4A 3IPZA 2ON5A 1Z7RA 4WBRD 1VF1A 3TKRA 8GSSA 1JZRA 4MCUA 4G0IA 3HZ8A 1XOBA 3AY8A 4LL4B 3PH9A 2PVOC 3IK7A 4ILFA 4PGTA 4HJ2A 5GZZB 2C80A 2IMKA 3DYRA 2A2PA 2GT5A 2WULA 3L9SA 2I3YA 1GLPA 3KP8A 4GQCA 4TVEA 1OKDA 4MJEA 2WFCA 6GSVA 1TU8A 2GS3A 3VFIA 3CSIA 1XCCA 4RI6A 2CAQA 3D6IA 4MJCA 5A4WA 2YWNA 4EO3A 2H74A 4JR6A 4QL9A 1KNGA 3HVVA 2C4JA 2RM6A 1WWJA 2JZSA 2O7KA 2R5GA 3UARA 2NVLA 3VI7A 2LRCA 4F9ZA 2E7PA 5CO3A 2R0PA 1EOHA 5G1LA 3FZAA 2MZCA 1OE8A 5AIXA 4OCEA 1BJXA 2LNSA 3FR6A 2DKHA 4XS4B 4L5LA 1PMTA 2DIYA 3LXZA 4K2XA 3GNJA 3FZ4A 3HJOA 5GSSA 4YH2A 20GSA 4Q5FA 1SJIA 2P5QA 2CX4A 3NZNA 3TJJA 3HA9A 5B8AA 2FGXA 3IAM2 1U88A 3LW9A 1GSFA 3TRQA 5JCWA 3TKQA 3CQFA 1QK8A 3I6AA 2HZEA 4OFMA 1M3JA 1ML6A 2KHPA 3LJRA 4RI7A 1DE1A 1PFOA 3TGZA 4K0NA 3CTGA 2JACA 2WB9A 1SJZA 4EKZA 5ABRA 5JWRB 3BCKA 5J9CA 3DVWA 2VIMA 2YZHA 4Z7XA 2NPBA 2K6VA 5H5QA 2YV7A 2FWGA 3C73A 1OC9B 3ISOA 2V1MA 4G2EA 3R3EA 1KBNA 2R2JA 1B4QA 4YAVA 2VL3A 4XRDA 3IA1A 4Q5RA 12GSA 4O5UA 2X8CA 2L4CA 4IS0A 2N5AA 1A0FA 2YCDA 3TKSC 2MMOA 5HQPA 3FHKA 2HFDA 4O5QA 5IMAA 5HFGA 3D22A 4EDZA 4ZILA 2LEGA 4IP1A 1HNAA 1U87A 2LJKA 3QPMA 4I6XA 4ZB6A 3RHCA 1EV4A 4AGSA 2HT9A 1O81A 4AJ8A 1Z9HA 3LYKA 4NMUA 5KN1A 4LL1B 4JBBA 4F0BA 1GNWA 3WD6A 3WGDA 1X9SB 3TJBA 3WYWA 3BBYA 1V40A 3H8QA 4O5RA 2HYXA 1T4YA 1O85A 2O89A 2VCXA 5CREA 1F2EA 3GMFA 4ECJA 3NOFA 4Q5NA 2JZRA 3ED3A
chains in the Genus database with same CATH topology
1X5DA 1Z6MA 2LUSA 2DJKA 3HCZA 5ECHB 4EF0A 1AW9A 2PMTA 4ZBAA 4JRRA 1M7TA 4HI7A 4HQZA 2FY6A 1N8JA 5D73A 3GL5A 3TCOA 4HZ2A 4BA7A 2XPEA 4XS1A 1CQGA 2V32A 5IOWA 5DDLA 2FHEA 3LWAA 3EMXA 3EU4A 3A2VA 4RQXA 5D9TA 3IBHA 3M9JA 1T3BA 4LA1A 5L71A 1GRXA 2LJAA 1EZKA 4MMMA 1PD21 5B8BA 2R3XA 2L5LA 3P8WA 1FB6A 2P31A 2Z9SA 2ZNMA 2E2GA 1Z6NA 2MMZA 6GSWA 4F0CA 2KLXA 2H6YA 1PKWA 3GL3A 3L4NA 2MBSA 2DJ0A 2JSYA 5D93A 4HS1A 1PX7A 2PWJA 4TW5A 1ZZYA 2VM2A 2JL4A 5KOWA 17GSA 3APOA 1Y25A 1J0FA 4NHZA 4XHMA 2N5BA 5IPGA 2O87A 2GDRA 2X8HA 4GWRA 2GQMA 4OFNA 5F05A 1THXA 4BVYA 2OADA 2H72A 1A0RP 1UC7A 3MIXA 4GRFA 5HFIA 13GSA 4FIWA 1T4ZA 3ZLPA 2YZUA 1YY7A 3S9FA 3CSJA 1AIUA 4DVCA 1S3DA 3EC3A 3RPNA 4E8HA 1G7EA 4PTSA 1T8EB 3M9KA 2V41A 2DSAA 4I2UA 4BVXA 3ZVJD 3EYTA 1FOHA 3KTBA 2QSIA 1XXUA 3NIVA 3IDVA 3O76A 11GSA 5DCGA 4OWYA 1QXHA 2GQKA 1SD9A 1RQMA 2GQLA 1GSYA 1ZOFA 2IFQA 5H5SA 2BJXA 2H0IA 2VLVA 4PNFA 3D4MA 2R4VA 1ZGNA 3DRNA 4GF0A 3UAPA 4Q5QA 3ZFBA 1X9WB 4AJ7A 4JEDA 4CW9A 1R7HA 5CRDA 1EEMA 1AQXA 1GSEA 2YANA 3P2AA 2YOIA 4WBJA 1FW1A 1AXDA 3W6GA 2HE3A 5B6NA 1C72A 2VD1A 2EC4A 2GSSA 4I97A 1ERUA 1K0DA 5IIZA 14GSA 2KUCA 4J2FA 3Q74A 2VCVA 2HSHA 5F06A 5A5KA 5FT3A 1FVKA 4POBA 4POMA 4POKA 4KDXA 3HVSA 4BL7A 5J3RA 1TK5B 4TXOB 3ZIJA 4G0LA 3GIXA 2V6KA 4HUAA 3TJGA 4PQIA 2I81A 4ACSA 5B6MA 4G9HA 1WIKA 4X43A 3U5RE 3C8EA 2LQOA 3HD5A 4N0VA 4LLRA 1GUMA 4K1FA 3UBLA 2GZZA 4KGIA 2LSTA 1N2AA 2VCZA 3UIWA 1PGTA 1VF2A 1Z7PA 5CRGA 1B8XA 4GSNA 2MYGA 3MSZA 2R6KA 4G0KA 1TU7A 2H0GA 4NV5A 3L9VA 3APQA 4KNDA 2HSMA 2VLTA 3W8SA 3MAKA 1OC8A 3RDWA 3ME7A 4NHWA 1HNCA 1GTUA 1U6TA 3IR4A 1GSUA 5DALA 16GSA 4MZBA 3C71A 2AJQB 4IHUA 1V57A 4EXJA 1TJDA 3TKSA 2CZ2A 2H75A 1ZYPA 1ON4A 2GZYA 3EMPA 1K0AA 2GSRA 2FWFA 1BAYA 1F9MA 4TR0A 5C04A 1XVWA 1URMA 2PVQA 2HI7A 4WKWA 3BOAA 5KOXA 1MEKA 2F8AA 2LJRA 2P0GA 4KSMA 4F03A 2WDUA 2OA7A 1XWCA 5F07A 1TRUA 1DUGA 1OE7A 3F4TA 1GWCA 1THOA 3A5IA 5CRWA 3QOUA 5ECPB 2RUFA 1WJKA 4ZL8A 2MMNA 5DBQA 1BX9A 2A2RA 1R4WA 3GTUB 1SENA 1OAZA 4HQSA 3VURA 4TRXA 3KM6A 4ZB8A 5ENUA 3TUEA 2IMFA 2TRXA 1S3CA 4XTSA 1V9WA 1AQWA 4K2DA 4CDOA 4IQ1A 5ECIB 3TKSE 3L78A 3EPTA 2R37A 4WR4A 3LFLA 5HR1A 4WXTA 3LORA 3VPQA 5CNWA 3VK9A 1K0OA 1SL0B 2AYTA 2P5RA 1A2JA 1JLWA 4J57E 2LV3A 5CAXA 2REMA 5ECNB 4HU9A 1JFUA 3RAZA 4IGJA 2CT6A 3KH7A 4XS6A 3DMLA 2EIRA 3DWVA 5JCUA 4MP4A 2CQ9A 2FUG2 2PGTA 2IWTA 2GT6A 3LQ7A 1TRVA 4QQ7A 1O73A 2GZPA 6GSSA 2VUPA 3WGXA 3IHGA 3MNGA 4MF6A 4XS4A 2HNLA 4O92A 5KEJA 1Y6EA 2H0HA 3ZIVA 1IYHA 5G30A 5CYYA 4H86A 1K0NA 3D4TA 5IMZA 5IPHA 5ECOB 3D21A 1M2BA 2EIOA 2E2MA 2MMAA 4TR1B 2LS5A 1F6MC 4L0UA 3N5OA 9GSSA 2FWEA 1FO5A 3G9BA 1A8LA 5ECRB 1G7OA 3FZ9A 1PQNA 4F2IA 4MH3A 3UBKA 3QAWA 3IC4A 1AUCA 4QL7A 2XC2A 1K3YA 1F3AA 4K5RA 3HKRA 4MF7A 1SJ6A 1ZMAA 2AB6A 1LU4A 1B4PA 1O6JA 1OC9A 1GH2A 2I9HA 1GTBA 5ECMB 2PBJA 3F9UA 5LD0A 3HZ4A 1U3IA 3VWXA 4ISDA 2H76A 1FAAA 2YNXA 4K7IA 5LCZA 1XW9A 4L5OA 3GSSA 5INYA 5ECLB 3M3MA 4GQFA 3KEBA 1ZYEA 4O32A 4JU5A 1QFNA 2K9FA 4XCSA 4K7OA 1EP7A 5FWGA 2DJJA 4MZCA 3G7JA 3HY2A 2CVKA 3TOUA 1V2AA 4GCIA 1YKCA 4DSRA 3KTLA 1EEJA 3PGTA 1BQ7A 1TI3A 4NAXA 3R2QA 1EGOA 3G7YA 4KDYA 4X4JA 3HHVA 2GSQA 3CRTA 5E59A 3TKPA 5DQSA 4EUYA 2IJYA 2FNOA 1XFLA 2CA8A 4G10A 3VWUA 5CP1A 1K3OA 1YQ1A 3PINA 2C3NA 2H30A 2B1LA 2H1BA 3EU3A 1YKAA 1Z5YE 3I69A 4KA0A 1GTIA 4V2NA 3F3RA 3UL3A 3FKFA 2CV4A 1EV9A 3LSZA 1JZWA 2BMXA 2FA4A 3HDCA 1M0UA 5LNKe 4HDEA 2A4HA 5HFKA 1G0TA 2LTKA 2L4QA 1QMVA 1TDIA 1HYUA 3HJMA 1W4VA 1H4OA 4K7NA 4IVFA 1FVJA 4FYUA 4TN8A 3GFKA 4YQVA 5AGYA 1NHYA 1HNBA 3ZL5A 3K8NA 5GSTA 2IL3A 2X99A 6GSUA 3U6VA 3Q6OA 3QMXA 4PUAA 2OE3A 3IAS2 22GSA 2C0GA 2YV9A 2C0FA 4ULXA 2H8LA 3E3EA 4EVMA 1VRSD 3DEXA 5ID2A 3P90A 5J4UA 1AAZA 3CBUA 2V6OA 1S3AA 5ID2B 2A2SA 4KX4A 4FYBA 3VPTA 4I8BA 5D8IA 5D9VA 2YPMA 2B6MA 2ZUPA 2QA1A 2VAFA 4XRAA 1NW2A 3CSHA 4PURA 5E4WA 1YEPA 3F8UA 3F4RA 2CAIA 4O7HA 3J7Yb 4ECBA 1QGVA 1G6WA 2RM5A 1NM3A 2I4AA 3LXTA 2DBCA 3Q19A 1TP9A 2LQQA 2F8FA 4ZL7A 4FQUA 1Q98A 4KCEA 3CTFA 2X8GA 3VWVA 3F6DA 1E2YA 1XWBA 1ZL9A 3CRUA 1XOAA 4NXIA 5ECKB 2J23A 4Z2RA 4A5PA 4NWYA 3DXBA 3C7MA 4PXOA 3KGKA 2PERA 2OBKA 3RHBA 1LBKA 1VF4A 2AHEA 1V98A 1TW9A 10GSA 1WOUA 3F6FA 3EINA 1FHEA 1XBSA 2QA2A 2VOCA 4FH8A 3MWHA 5G31A 3TJKA 1ERWA 3EURA 4K0GA 2VL2C 2GGTA 2WS2A 3TRPA 4IKHA 2HLSA 2L59A 3P7XA 2B7KA 2M80A 1XWGA 1U3AA 3DKSA 1JZOA 1MDJA 3EE2A 3M8NA 2NTOA 5KN3A 2QKEA 3UVHA 4EIPA 3GUSA 4TXOA 3V1WA 4K6XA 4ML1A 5ECSA 3LG6A 2YP6A 2RIIA 2VM1A 2K8SA 1PN0A 1JLVA 3QDNA 4POLA 4D73A 3FZ5A 4N11A 4D73B 1TXXA 1XPVA 4KDUA 1GUHA 3IV4A 1M99A 3ZVJA 1NSWA 2O8VB 3ZREA 1K0CA 1WPIA 5J41A 2XHFA 3LYPA 4N30A 4KH7A 4TR3A 1SK1A 3OR5A 4MJBA 3A2WA 2DKIA 3E9JB 4EIQA 3QAVA 3GV1A 5JWQB 5G1KA 4KE3A 3UMAA 4AJ6A 3KMNA 4BWQA 1WE0A 3LEFA 2WCIA 5HR0A 2ZCTA 3TJFA 4ZXGA 2EIQA 4IJIA 3ERFA 5C00A 2OBIA 5BRTA 1PL2A 4IN0A 1WP0A 3H1NA 4PNGA 3RPPA 2FCHA 4WEYA 1ST9A 4NPBA 4IJ3A 3FYGA 3WT1A 2IN3A 2DIZA 4TR4A 5J9BA 1DSBA 1YJ6A 1OC3A 4DSSB 1NHOA 2YWMA 3RBTA 2K8VA 2YJHA 2A4VA 4CY6A 2FA8A 5EPFA 1MD4A 4AF2A 5A4UA 3D0ZA 3H4KA 3GH6A 3WGEA 2G0FA 4Z2TA 2DMLA 2CZ3A 3TOTA 3UEMA 1I9DA 3CXGA 4OO4A 3GKMA 4LMVA 3BJ5A 1O8WA 1BYEA 1HD2A 5F8BA 2H1GA 3GTUA 1T7PB 2G2QA 2VD0A 4FO5A 1ERVA 2VL9A 1E6BA 1PX6A 3E0UA 1ERTA 2AUVA 3US3A 1SD8A 1R26A 4BWSA 4MA9A 1SYRA 2OACA 2C3QA 5EL8A 1A24A 2QC7A 4K5SA 3BD2A 3MYDA 2RLIA 3GA4A 3EVIA 1MTCA 1FOVA 1ZYQB 1M9BA 1GUKA 6GSYA 4GXZA 4Z2UA 1Q4JA 3FRCA 3A3TA 3TB2A 4IQAA 5H5RA 3ERWA 4HU7A 2JU5A 3C1RA 3ZMKA 1DE2A 6GSXA 3KZQA 4EDYA 2V2GA 3GSTA 3KXOA 4EL1A 2HXKA 4DEJA 4KUNA 1X0RA 1A8YA 1GLQA 1JHBA 1TK0B 4YKFA 4TOPA 3FMWA 2IMDA 2QGVA 5IOXA 4TR1A 4PQHA 4GSSA 1SK0A 5ELGA 1YF1A 3PPUA 4YAPA 5DJLA 2B3SA 2X49A 2OE0A 4MDCA 5COHA 1WMJA 5DCHA 2K18A 3KIJA 2L57A 3FR3A 3GKKA 4G19A 4PQ1A 5GAPD 2PN8A 2MBTA 4JZQA 4MLYA 1ABAA 2NDOA 4EC0A 2GTUA 1MDKA 5IO2A 4MJAA 2XPDA 4BPYA 2O85A 4X1UA 1IYIA 1CQHA 5B7CA 2F51A 3CYNA 5F0GA 5AN1A 4ML6A 3CMIA 1OVNA 2GLRA 2H6XA 3F0IA 3GYKA 2HZEB 2DJ1A 4MABA 7GSSA 2IMIA 3H79A 1TOFA 1SKRB 3QFBC 2OE1A 2XBIA 3DVXA 1M2DA 4HZ4A 3QAGA 2L5OA 5ECQB 4XIHA 1BG5A 2JSZA 4ZBDA 2I1UA 3IRAA 5FHIA 2H66A 3O3TA 4JE1A 1RW1A 4OD7A 1AC1A 2B5XA 3M0FA 5JCGA 2YJ7A 2HRAA 2VL2A 2WGRA 3HXSA 3QD9A 1V58A 3GKNA 1SKWB 2L6CA 4GTUA 5G5EA 4ECIA 1B9YC 2H71A 1T00A 3F4SA 3GX0A 4OCFA 3MDKA 3GH9A 3PR8A 4CY8A 5BMUA 2C3TA 1R5AA 4MPFA 2ALBA 4K8MA 4N0ZA 1QQ2A 2OKAA 1PA3A 2GSTA 3QFAC 5IMDA 3ZRDA 1SU9A 1VF3A 1XWAA 2KP1A 4RQRA 4RUVA 2GVPA 4MK3A 4WETA 4JR4A 2X64A 2AAWA 1R5PA 5IMCA 3QR6A 1W89A 2LKUA 4ZBBA 1LJRA 5G2ZA 4MNNA 5IMVA 2DJ2A 2R0CA 3FR9A 2UZ8A 5D9WA 1MDIA 1SYXA 1SKSB 3IK9A 2H19A 1HQOA 5CRHA 4K9ZA 19GSA 4WR5A 1ACVA 5D96A 2LRTA 1ILOA 2ES7A 1EP8A 3G7IA 4HJMA 2X4AA 3HYPA 3ME8A 3VI5A 4CHSA 4X0XA 2NBSA 5JWOB 4YQMA 3H93A 3DIEA 2C1YA 1XW5A 2HZFA 3ZTLA 1DBYA 3F3QA 1XW6A 1GTAA 3SBCA 3KJYA 4IP6A 4GSTA 5DJMA 3IHQA 1GSQA 5DAKA 5AIVA 4ZL9A 1FG4A 3GKXA 2J9HA 4KB3A 3IE3A 5DAKB 1A2MA 2FD3A 1TKDB 1X9MB 5D9XA 1PSQA 5DVBA 4V1Ag 5HR2A 1AQVA 2ON7A 2WRTA 3HJPA 4MH2A 3IXRA 2YWIA 1SL2B 3VLNA 1BEDA 2N5FA 2XBQA 5EY6A 1FB0A 3GURA 2IMEA 4PUFC 4FYCA 2H1AA 4YQUA 1J9BA 4ZIJA 2CVDA 3UJ1A 3JCML 2M46A 1YZXA 4J56E 1ZCPA 4PX1A 2HRNA 2L6DA 5J5NA 2LRNA 2LNTA 1GSSA 1Z3EA 5IM9A 3D5JA 3M1GA 3ZYWA 1SL1B 4TKYA 2VLUA 1GL8A 2DC5A 3I43A 3ZMLA 3N9JA 2H6ZA 2R0GA 1EWXA 2M72A 3F63A 2DLXA 4OMVA 1ZYNA 3VWWA 4IELA 3GN3A 1F37A 5EVOA 3J7Yk 1B9XC 1SK2A 4KW6A 4BVYB 1TI1A 2C0DA 2HSYA 1XVQA 4ICYA 3GRXA 3Q18A 2YN1A 4NV2A 4GLTA 3A5WA 2H70A 3APSA 3FW2A 3UOMA 1M9AA 2PU9C 3I9V2 5KN0A 4WF5A 1EGRA 2VCWA 4MPGA 2HRKA 1MD3A 1GP1A 1GNEA 4BVXB 3KH9A 3ZZXA 2C8UA 1K3LA 3DGQA 3C1SA 2DMMA 1GULA 2FLSA 5G5FA 1YF0A 1OKTA 2TIRA 4I5QA 4MF5A 5GAND 4IBPA 3IC8A 2IFQB 1PL1A 3HVXA 2F9SA 2IIYA 4KF9A 4L8EA 1TTZA 4MZWA 2TRCP 1TK8B 4USSA 2JADA 4ID0A 1A2LA 2H1DA 4F82A 4WF4A 5ELAA 4I2TA 1G6YA 1WRYA 2VCTA 4DSQA 1K0MA 2H01A 1H75A 3EWLA 4LMWA 1X5CA 2OJLA 2D2ZA 3FEUA 1VGLA 2RUEA 1JZDA 3TRXA 3O6TA 1K0BA 1B48A 5AISA 1XZOA 3QCPA 1PKZA 2B5YA 2B5EA 2VO4A 3TDGA 1KTEA 3GX8A 4BL7B 1EOGA 2VCQA 5KN2A 4KAEA 4ZB9A 1O8XA 3KMOA 4OO5A 3UVTA 3DD3A 3SWLA 4L0WA 1OYJA 2PPTA 3W8JA 3L0HA 1X5EA 4KSOA 2E0QA 5DQYA 1RK4A 1A23A 2JZTA 1F3BA 3L9UA 2WJUA 1XWKA 3FY7A 1T1VA 3A2XA 1UVZA 4N10A 6GSTA 5IQYA 1O7UA 2CVBA 3WT2A 3ZFLA 18GSA 3ERGA 2BTOT 3IOSA 1UA5A 3GHAA 4TXVA 5HR3A 2DJ3A 2H73A 1J08A 3ZITA 2CX3A 3KD0A 4V1Ap 2F3MA 1USBA 2HRFA 3KP9A 1PRXA 5DALB 4P3YB 1UN2A 4DSSA 4EE0A 4HOJA 1I5GA 4OFTA 1QUWA 4HEA2 5IMFA 2KP2A 3BCIA 2PUKC 2KOKA 1TRWA 4V2LA 4IW9A 1YDKA 2WZ9A 4V2MA 2YWOA 5IO0A 4ECCA 3KCMA 2B7JA 1PN9A 1XIYA 4KCAA 4E8EA 1YEXA 1KEBA 2IPAA 3LGCA 5A4VA 1TRSA 2B1KA 2FWHA 4YKGA 2C0EA 1GSDA 3FK8A 1M2AA 2AV4A 3IPZA 2ON5A 1Z7RA 4WBRD 1VF1A 3TKRA 8GSSA 1JZRA 4MCUA 4G0IA 3HZ8A 1XOBA 3AY8A 4LL4B 3PH9A 2PVOC 3IK7A 4ILFA 4PGTA 4HJ2A 5GZZB 2C80A 2IMKA 3DYRA 2A2PA 2GT5A 2WULA 3L9SA 2I3YA 1GLPA 3KP8A 4GQCA 4TVEA 1OKDA 4MJEA 2WFCA 6GSVA 1TU8A 2GS3A 3VFIA 3CSIA 1XCCA 4RI6A 2CAQA 3D6IA 4MJCA 5A4WA 2YWNA 4EO3A 2H74A 4JR6A 4QL9A 1KNGA 3HVVA 2C4JA 2RM6A 1WWJA 2JZSA 2O7KA 2R5GA 3UARA 2NVLA 3VI7A 2LRCA 4F9ZA 2E7PA 5CO3A 2R0PA 1EOHA 5G1LA 3FZAA 2MZCA 1OE8A 5AIXA 4OCEA 1BJXA 2LNSA 3FR6A 2DKHA 4XS4B 4L5LA 1PMTA 2DIYA 3LXZA 4K2XA 3GNJA 3FZ4A 3HJOA 5GSSA 4YH2A 20GSA 4Q5FA 1SJIA 2P5QA 2CX4A 3NZNA 3TJJA 3HA9A 5B8AA 2FGXA 3IAM2 1U88A 3LW9A 1GSFA 3TRQA 5JCWA 3TKQA 1QK8A 3I6AA 2HZEA 4OFMA 1ML6A 2KHPA 3LJRA 4RI7A 1DE1A 3TGZA 4K0NA 3CTGA 2JACA 2WB9A 1SJZA 4EKZA 5ABRA 5JWRB 3BCKA 5J9CA 3DVWA 2VIMA 2YZHA 4Z7XA 2NPBA 2K6VA 5H5QA 2YV7A 2FWGA 3C73A 1OC9B 3ISOA 2V1MA 4G2EA 3R3EA 1KBNA 2R2JA 1B4QA 4YAVA 2VL3A 4XRDA 3IA1A 4Q5RA 12GSA 4O5UA 2X8CA 2L4CA 4IS0A 2N5AA 1A0FA 2YCDA 3TKSC 2MMOA 5HQPA 3FHKA 2HFDA 4O5QA 5IMAA 5HFGA 3D22A 4EDZA 4ZILA 2LEGA 4IP1A 1HNAA 1U87A 2LJKA 3QPMA 4I6XA 4ZB6A 3RHCA 1EV4A 4AGSA 2HT9A 1O81A 4AJ8A 1Z9HA 3LYKA 4NMUA 5KN1A 4LL1B 4JBBA 4F0BA 1GNWA 3WD6A 3WGDA 1X9SB 3TJBA 3WYWA 3BBYA 1V40A 3H8QA 4O5RA 2HYXA 1T4YA 1O85A 2O89A 2VCXA 5CREA 1F2EA 3GMFA 4ECJA 3NOFA 4Q5NA 2JZRA 3ED3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X5D A;  1Z6M A;  2LUS A;  2DJK A;  3HCZ A;  5ECH B;  4EF0 A;  1AW9 A;  2PMT A;  4ZBA A;  4JRR A;  1M7T A;  4HI7 A;  4HQZ A;  2FY6 A;  1N8J A;  5D73 A;  3GL5 A;  3TCO A;  4HZ2 A;  4BA7 A;  2XPE A;  4XS1 A;  1CQG A;  2V32 A;  5IOW A;  5DDL A;  2FHE A;  3LWA A;  3EMX A;  3EU4 A;  3A2V A;  4RQX A;  5D9T A;  3IBH A;  3M9J A;  1T3B A;  4LA1 A;  5L71 A;  1GRX A;  2LJA A;  1EZK A;  4MMM A;  1PD2 1;  5B8B A;  2R3X A;  2L5L A;  3P8W A;  1FB6 A;  2P31 A;  2Z9S A;  2ZNM A;  2E2G A;  1Z6N A;  2MMZ A;  6GSW A;  4F0C A;  2KLX A;  2H6Y A;  1PKW A;  3GL3 A;  3L4N A;  2MBS A;  2DJ0 A;  2JSY A;  5D93 A;  4HS1 A;  1PX7 A;  2PWJ A;  4TW5 A;  1ZZY A;  2VM2 A;  2JL4 A;  17GS A;  3APO A;  1Y25 A;  1J0F A;  4NHZ A;  4XHM A;  2N5B A;  5IPG A;  2O87 A;  2GDR A;  2X8H A;  4GWR A;  2GQM A;  4OFN A;  5F05 A;  1THX A;  4BVY A;  2OAD A;  2H72 A;  1A0R P;  1UC7 A;  4GRF A;  5HFI A;  13GS A;  4FIW A;  1T4Z A;  3ZLP A;  2YZU A;  1YY7 A;  3S9F A;  3CSJ A;  1AIU A;  4DVC A;  1S3D A;  3EC3 A;  3RPN A;  4E8H A;  1G7E A;  1T8E B;  3M9K A;  2V41 A;  2DSA A;  4I2U A;  4BVX A;  3ZVJ D;  3EYT A;  3KTB A;  2QSI A;  1XXU A;  3NIV A;  3IDV A;  3O76 A;  11GS A;  5DCG A;  4OWY A;  1QXH A;  2GQK A;  1SD9 A;  1RQM A;  2GQL A;  1GSY A;  1ZOF A;  2IFQ A;  5H5S A;  2BJX A;  2H0I A;  2VLV A;  4PNF A;  3D4M A;  2R4V A;  1ZGN A;  3DRN A;  4GF0 A;  3UAP A;  4Q5Q A;  3ZFB A;  1X9W B;  4AJ7 A;  4JED A;  4CW9 A;  1R7H A;  5CRD A;  1EEM A;  1AQX A;  1GSE A;  2YAN A;  3P2A A;  2YOI A;  4WBJ A;  1FW1 A;  1AXD A;  3W6G A;  2HE3 A;  5B6N A;  1C72 A;  2VD1 A;  2EC4 A;  2GSS A;  4I97 A;  1ERU A;  1K0D A;  5IIZ A;  14GS A;  2KUC A;  4J2F A;  3Q74 A;  2VCV A;  2HSH A;  5F06 A;  5A5K A;  5FT3 A;  1FVK A;  4POB A;  4POM A;  4POK A;  4KDX A;  3HVS A;  4BL7 A;  5J3R A;  1TK5 B;  4TXO B;  3ZIJ A;  3GIX A;  2V6K A;  4HUA A;  3TJG A;  4PQI A;  2I81 A;  4ACS A;  5B6M A;  4G9H A;  1WIK A;  4X43 A;  3U5R E;  3C8E A;  2LQO A;  3HD5 A;  4N0V A;  4LLR A;  1GUM A;  4K1F A;  3UBL A;  2GZZ A;  4KGI A;  2LST A;  1N2A A;  2VCZ A;  3UIW A;  1PGT A;  1VF2 A;  1Z7P A;  5CRG A;  1B8X A;  4GSN A;  2MYG A;  3MSZ A;  2R6K A;  1TU7 A;  2H0G A;  4NV5 A;  3L9V A;  3APQ A;  4KND A;  2VLT A;  3W8S A;  3MAK A;  1OC8 A;  3RDW A;  3ME7 A;  4NHW A;  1HNC A;  1GTU A;  1U6T A;  3IR4 A;  1GSU A;  5DAL A;  16GS A;  4MZB A;  3C71 A;  2AJQ B;  4IHU A;  1V57 A;  4EXJ A;  1TJD A;  3TKS A;  2CZ2 A;  2H75 A;  1ON4 A;  2GZY A;  3EMP A;  1K0A A;  2GSR A;  2FWF A;  1BAY A;  1F9M A;  4TR0 A;  5C04 A;  1XVW A;  1URM A;  2PVQ A;  2HI7 A;  4WKW A;  3BOA A;  1MEK A;  2F8A A;  2LJR A;  2P0G A;  4KSM A;  4F03 A;  2WDU A;  2OA7 A;  1XWC A;  5F07 A;  1TRU A;  1DUG A;  1OE7 A;  3F4T A;  1GWC A;  1THO A;  5CRW A;  3QOU A;  5ECP B;  2RUF A;  1WJK A;  4ZL8 A;  2MMN A;  5DBQ A;  1BX9 A;  2A2R A;  1R4W A;  3GTU B;  1SEN A;  1OAZ A;  4HQS A;  3VUR A;  4TRX A;  3KM6 A;  4ZB8 A;  5ENU A;  3TUE A;  2IMF A;  2TRX A;  1S3C A;  4XTS A;  1V9W A;  1AQW A;  4K2D A;  4CDO A;  4IQ1 A;  5ECI B;  3TKS E;  3L78 A;  2R37 A;  4WR4 A;  3LFL A;  5HR1 A;  4WXT A;  3LOR A;  3VPQ A;  5CNW A;  3VK9 A;  1K0O A;  1SL0 B;  2AYT A;  2P5R A;  1A2J A;  1JLW A;  4J57 E;  2LV3 A;  5CAX A;  2REM A;  5ECN B;  4HU9 A;  1JFU A;  3RAZ A;  4IGJ A;  2CT6 A;  3KH7 A;  4XS6 A;  3DML A;  2EIR A;  3DWV A;  5JCU A;  4MP4 A;  2CQ9 A;  2FUG 2;  2PGT A;  2IWT A;  2GT6 A;  3LQ7 A;  1TRV A;  4QQ7 A;  1O73 A;  2GZP A;  6GSS A;  2VUP A;  3WGX A;  3MNG A;  4MF6 A;  4XS4 A;  2HNL A;  4O92 A;  5KEJ A;  1Y6E A;  2H0H A;  3ZIV A;  1IYH A;  5G30 A;  5CYY A;  4H86 A;  1K0N A;  3D4T A;  5IMZ A;  5IPH A;  5ECO B;  3D21 A;  1M2B A;  2EIO A;  2E2M A;  2MMA A;  4TR1 B;  2LS5 A;  1F6M C;  4L0U A;  3N5O A;  9GSS A;  2FWE A;  1FO5 A;  3G9B A;  1A8L A;  5ECR B;  1G7O A;  3FZ9 A;  1PQN A;  4F2I A;  4MH3 A;  3UBK A;  3QAW A;  3IC4 A;  1AUC A;  4QL7 A;  2XC2 A;  1K3Y A;  1F3A A;  3HKR A;  4MF7 A;  1SJ6 A;  1ZMA A;  2AB6 A;  1LU4 A;  1B4P A;  1O6J A;  1OC9 A;  1GH2 A;  2I9H A;  1GTB A;  5ECM B;  2PBJ A;  3F9U A;  5LD0 A;  3HZ4 A;  1U3I A;  3VWX A;  4ISD A;  2H76 A;  1FAA A;  2YNX A;  4K7I A;  5LCZ A;  1XW9 A;  4L5O A;  3GSS A;  5INY A;  5ECL B;  3M3M A;  4GQF A;  3KEB A;  1ZYE A;  4O32 A;  4JU5 A;  1QFN A;  2K9F A;  4XCS A;  4K7O A;  1EP7 A;  5FWG A;  2DJJ A;  4MZC A;  3G7J A;  3HY2 A;  2CVK A;  3TOU A;  1V2A A;  4GCI A;  1YKC A;  4DSR A;  3KTL A;  1EEJ A;  3PGT A;  1BQ7 A;  1TI3 A;  4NAX A;  3R2Q A;  1EGO A;  3G7Y A;  4KDY A;  3HHV A;  2GSQ A;  3CRT A;  5E59 A;  3TKP A;  5DQS A;  4EUY A;  2IJY A;  2FNO A;  1XFL A;  2CA8 A;  4G10 A;  3VWU A;  5CP1 A;  1K3O A;  1YQ1 A;  3PIN A;  2C3N A;  2H30 A;  2B1L A;  2H1B A;  3EU3 A;  1YKA A;  1Z5Y E;  3I69 A;  4KA0 A;  1GTI A;  4V2N A;  3F3R A;  3UL3 A;  3FKF A;  2CV4 A;  1EV9 A;  3LSZ A;  1JZW A;  2BMX A;  2FA4 A;  3HDC A;  1M0U A;  5LNK e;  4HDE A;  5HFK A;  1G0T A;  2LTK A;  2L4Q A;  1QMV A;  1TDI A;  1HYU A;  3HJM A;  1W4V A;  1H4O A;  4K7N A;  4IVF A;  1FVJ A;  4FYU A;  4TN8 A;  3GFK A;  4YQV A;  5AGY A;  1NHY A;  1HNB A;  3ZL5 A;  3K8N A;  5GST A;  2IL3 A;  2X99 A;  6GSU A;  3U6V A;  3Q6O A;  3QMX A;  4PUA A;  2OE3 A;  3IAS 2;  22GS A;  2C0G A;  2YV9 A;  2C0F A;  4ULX A;  2H8L A;  3E3E A;  4EVM A;  1VRS D;  3DEX A;  5ID2 A;  3P90 A;  5J4U A;  1AAZ A;  3CBU A;  2V6O A;  1S3A A;  5ID2 B;  2A2S A;  4KX4 A;  4FYB A;  3VPT A;  4I8B A;  5D8I A;  5D9V A;  2YPM A;  2B6M A;  2ZUP A;  2VAF A;  4XRA A;  1NW2 A;  3CSH A;  4PUR A;  5E4W A;  1YEP A;  3F8U A;  3F4R A;  2CAI A;  4O7H A;  3J7Y b;  4ECB A;  1QGV A;  1G6W A;  2RM5 A;  1NM3 A;  2I4A A;  3LXT A;  2DBC A;  3Q19 A;  1TP9 A;  2LQQ A;  2F8F A;  4ZL7 A;  1Q98 A;  4KCE A;  3CTF A;  2X8G A;  3VWV A;  3F6D A;  1E2Y A;  1XWB A;  1ZL9 A;  3CRU A;  1XOA A;  4NXI A;  5ECK B;  2J23 A;  4NWY A;  3DXB A;  3C7M A;  4PXO A;  3KGK A;  2PER A;  2OBK A;  3RHB A;  1LBK A;  1VF4 A;  2AHE A;  1V98 A;  1TW9 A;  10GS A;  1WOU A;  3F6F A;  3EIN A;  1FHE A;  1XBS A;  2VOC A;  4FH8 A;  3MWH A;  5G31 A;  3TJK A;  1ERW A;  3EUR A;  4K0G A;  2VL2 C;  2GGT A;  2WS2 A;  3TRP A;  4IKH A;  2HLS A;  2L59 A;  3P7X A;  2B7K A;  2M80 A;  1XWG A;  1U3A A;  3DKS A;  1JZO A;  1MDJ A;  3EE2 A;  3M8N A;  2NTO A;  5KN3 A;  2QKE A;  3UVH A;  3GUS A;  4TXO A;  3V1W A;  4K6X A;  4ML1 A;  5ECS A;  3LG6 A;  2YP6 A;  2RII A;  2VM1 A;  2K8S A;  1JLV A;  3QDN A;  4POL A;  4D73 A;  3FZ5 A;  4N11 A;  4D73 B;  1TXX A;  1XPV A;  4KDU A;  1GUH A;  3IV4 A;  1M99 A;  3ZVJ A;  1NSW A;  2O8V B;  3ZRE A;  1K0C A;  1WPI A;  5J41 A;  2XHF A;  3LYP A;  4N30 A;  4KH7 A;  4TR3 A;  1SK1 A;  3OR5 A;  4MJB A;  3A2W A;  3E9J B;  3QAV A;  3GV1 A;  5JWQ B;  5G1K A;  4KE3 A;  3UMA A;  4AJ6 A;  3KMN A;  4BWQ A;  1WE0 A;  3LEF A;  2WCI A;  5HR0 A;  2ZCT A;  3TJF A;  4ZXG A;  2EIQ A;  4IJI A;  3ERF A;  5C00 A;  2OBI A;  1PL2 A;  4IN0 A;  1WP0 A;  3H1N A;  4PNG A;  3RPP A;  2FCH A;  4WEY A;  1ST9 A;  4NPB A;  4IJ3 A;  3FYG A;  3WT1 A;  2IN3 A;  2DIZ A;  4TR4 A;  5J9B A;  1DSB A;  1YJ6 A;  1OC3 A;  4DSS B;  1NHO A;  2YWM A;  3RBT A;  2K8V A;  2YJH A;  2A4V A;  2FA8 A;  5EPF A;  1MD4 A;  4AF2 A;  5A4U A;  3D0Z A;  3H4K A;  3GH6 A;  3WGE A;  2G0F A;  2DML A;  2CZ3 A;  3TOT A;  3UEM A;  1I9D A;  3CXG A;  4OO4 A;  3GKM A;  4LMV A;  3BJ5 A;  1O8W A;  1BYE A;  1HD2 A;  5F8B A;  2H1G A;  3GTU A;  1T7P B;  2G2Q A;  2VD0 A;  4FO5 A;  1ERV A;  2VL9 A;  1E6B A;  1PX6 A;  3E0U A;  1ERT A;  2AUV A;  3US3 A;  1SD8 A;  1R26 A;  4BWS A;  4MA9 A;  1SYR A;  2OAC A;  2C3Q A;  5EL8 A;  1A24 A;  2QC7 A;  3BD2 A;  2RLI A;  3GA4 A;  3EVI A;  1MTC A;  1FOV A;  1ZYQ B;  1M9B A;  1GUK A;  6GSY A;  4GXZ A;  1Q4J A;  3FRC A;  3A3T A;  3TB2 A;  4IQA A;  5H5R A;  3ERW A;  4HU7 A;  2JU5 A;  3C1R A;  3ZMK A;  1DE2 A;  6GSX A;  3KZQ A;  4EDY A;  2V2G A;  3GST A;  3KXO A;  4EL1 A;  2HXK A;  4DEJ A;  4KUN A;  1X0R A;  1A8Y A;  1GLQ A;  1JHB A;  1TK0 B;  4TOP A;  2IMD A;  2QGV A;  5IOX A;  4TR1 A;  4PQH A;  4GSS A;  1SK0 A;  5ELG A;  1YF1 A;  4YAP A;  5DJL A;  2B3S A;  2OE0 A;  4MDC A;  5COH A;  1WMJ A;  5DCH A;  2K18 A;  3KIJ A;  2L57 A;  3FR3 A;  3GKK A;  4G19 A;  4PQ1 A;  5GAP D;  2PN8 A;  2MBT A;  4JZQ A;  4MLY A;  1ABA A;  2NDO A;  4EC0 A;  2GTU A;  1MDK A;  5IO2 A;  4MJA A;  2XPD A;  4BPY A;  2O85 A;  4X1U A;  1IYI A;  1CQH A;  5B7C A;  2F51 A;  3CYN A;  5F0G A;  5AN1 A;  4ML6 A;  3CMI A;  1OVN A;  2GLR A;  2H6X A;  3F0I A;  3GYK A;  2HZE B;  2DJ1 A;  4MAB A;  7GSS A;  2IMI A;  3H79 A;  1TOF A;  1SKR B;  3QFB C;  2OE1 A;  2XBI A;  3DVX A;  1M2D A;  4HZ4 A;  3QAG A;  2L5O A;  5ECQ B;  4XIH A;  1BG5 A;  2JSZ A;  4ZBD A;  2I1U A;  3IRA A;  5FHI A;  2H66 A;  3O3T A;  4JE1 A;  1RW1 A;  4OD7 A;  1AC1 A;  2B5X A;  3M0F A;  5JCG A;  2YJ7 A;  2VL2 A;  2WGR A;  3HXS A;  3QD9 A;  1V58 A;  3GKN A;  1SKW B;  2L6C A;  4GTU A;  5G5E A;  4ECI A;  1B9Y C;  2H71 A;  1T00 A;  3F4S A;  3GX0 A;  4OCF A;  3MDK A;  3GH9 A;  3PR8 A;  2C3T A;  1R5A A;  4MPF A;  2ALB A;  4K8M A;  4N0Z A;  1QQ2 A;  2OKA A;  1PA3 A;  2GST A;  3QFA C;  5IMD A;  3ZRD A;  1SU9 A;  1VF3 A;  1XWA A;  2KP1 A;  4RQR A;  4RUV A;  2GVP A;  4MK3 A;  4WET A;  4JR4 A;  2X64 A;  2AAW A;  1R5P A;  5IMC A;  3QR6 A;  1W89 A;  2LKU A;  4ZBB A;  1LJR A;  5G2Z A;  5IMV A;  2DJ2 A;  3FR9 A;  5D9W A;  1MDI A;  1SYX A;  1SKS B;  3IK9 A;  2H19 A;  1HQO A;  5CRH A;  4K9Z A;  19GS A;  4WR5 A;  1ACV A;  5D96 A;  2LRT A;  1ILO A;  2ES7 A;  1EP8 A;  3G7I A;  4HJM A;  3HYP A;  3ME8 A;  3VI5 A;  4CHS A;  4X0X A;  2NBS A;  5JWO B;  4YQM A;  3H93 A;  3DIE A;  2C1Y A;  1XW5 A;  2HZF A;  3ZTL A;  1DBY A;  3F3Q A;  1XW6 A;  1GTA A;  3SBC A;  3KJY A;  4IP6 A;  4GST A;  5DJM A;  3IHQ A;  1GSQ A;  5DAK A;  5AIV A;  4ZL9 A;  1FG4 A;  3GKX A;  2J9H A;  4KB3 A;  3IE3 A;  5DAK B;  1A2M A;  2FD3 A;  1TKD B;  1X9M B;  5D9X A;  1PSQ A;  5DVB A;  4V1A g;  5HR2 A;  1AQV A;  2ON7 A;  2WRT A;  3HJP A;  4MH2 A;  3IXR A;  2YWI A;  1SL2 B;  3VLN A;  1BED A;  2N5F A;  5EY6 A;  2XBQ A;  1FB0 A;  3GUR A;  2IME A;  4PUF C;  4FYC A;  2H1A A;  4YQU A;  1J9B A;  4ZIJ A;  2CVD A;  3UJ1 A;  3JCM L;  2M46 A;  1YZX A;  4J56 E;  1ZCP A;  4PX1 A;  2HRN A;  2L6D A;  5J5N A;  2LRN A;  2LNT A;  1GSS A;  1Z3E A;  5IM9 A;  3D5J A;  3M1G A;  3ZYW A;  1SL1 B;  4TKY A;  2VLU A;  1GL8 A;  2DC5 A;  3I43 A;  3ZML A;  3N9J A;  2H6Z A;  1EWX A;  2M72 A;  3F63 A;  2DLX A;  4OMV A;  3VWW A;  4IEL A;  3GN3 A;  1F37 A;  5EVO A;  3J7Y k;  1B9X C;  1SK2 A;  4KW6 A;  1TI1 A;  2C0D A;  2HSY A;  1XVQ A;  3GRX A;  3Q18 A;  2YN1 A;  4NV2 A;  4GLT A;  3A5W A;  2H70 A;  3APS A;  3FW2 A;  3UOM A;  1M9A A;  2PU9 C;  3I9V 2;  5KN0 A;  4WF5 A;  1EGR A;  2VCW A;  4MPG A;  1MD3 A;  1GP1 A;  1GNE A;  3KH9 A;  3ZZX A;  2C8U A;  1K3L A;  3DGQ A;  3C1S A;  2DMM A;  1GUL A;  2FLS A;  5G5F A;  1YF0 A;  1OKT A;  2TIR A;  4I5Q A;  4MF5 A;  5GAN D;  4IBP A;  2IFQ B;  1PL1 A;  3HVX A;  2F9S A;  2IIY A;  4L8E A;  1TTZ A;  4MZW A;  2TRC P;  1TK8 B;  2JAD A;  4ID0 A;  1A2L A;  2H1D A;  4F82 A;  4WF4 A;  5ELA A;  4I2T A;  1G6Y A;  1WRY A;  2VCT A;  4DSQ A;  1K0M A;  2H01 A;  1H75 A;  3EWL A;  4LMW A;  1X5C A;  2OJL A;  2D2Z A;  3FEU A;  1VGL A;  2RUE A;  1JZD A;  3TRX A;  3O6T A;  1K0B A;  1B48 A;  5AIS A;  1XZO A;  3QCP A;  1PKZ A;  2B5Y A;  2B5E A;  2VO4 A;  3TDG A;  1KTE A;  3GX8 A;  1EOG A;  2VCQ A;  5KN2 A;  4KAE A;  4ZB9 A;  1O8X A;  3KMO A;  4OO5 A;  3UVT A;  3DD3 A;  3SWL A;  4L0W A;  1OYJ A;  2PPT A;  3W8J A;  3L0H A;  1X5E A;  4KSO A;  2E0Q A;  5DQY A;  1RK4 A;  1A23 A;  2JZT A;  1F3B A;  3L9U A;  2WJU A;  1XWK A;  3FY7 A;  1T1V A;  3A2X A;  1UVZ A;  4N10 A;  6GST A;  5IQY A;  1O7U A;  2CVB A;  3WT2 A;  3ZFL A;  18GS A;  3ERG A;  2BTO T;  3IOS A;  1UA5 A;  3GHA A;  4TXV A;  5HR3 A;  2DJ3 A;  2H73 A;  1J08 A;  3ZIT A;  2CX3 A;  3KD0 A;  4V1A p;  2F3M A;  1USB A;  2HRF A;  3KP9 A;  1PRX A;  5DAL B;  4P3Y B;  1UN2 A;  4DSS A;  4EE0 A;  4HOJ A;  1I5G A;  4OFT A;  1QUW A;  4HEA 2;  5IMF A;  2KP2 A;  3BCI A;  2PUK C;  2KOK A;  1TRW A;  4V2L A;  4IW9 A;  1YDK A;  2WZ9 A;  4V2M A;  2YWO A;  5IO0 A;  4ECC A;  3KCM A;  2B7J A;  1PN9 A;  1XIY A;  4KCA A;  4E8E A;  1YEX A;  1KEB A;  2IPA A;  3LGC A;  5A4V A;  1TRS A;  2B1K A;  2FWH A;  2C0E A;  1GSD A;  3FK8 A;  1M2A A;  2AV4 A;  3IPZ A;  2ON5 A;  1Z7R A;  4WBR D;  1VF1 A;  3TKR A;  8GSS A;  1JZR A;  4MCU A;  3HZ8 A;  1XOB A;  3AY8 A;  4LL4 B;  3PH9 A;  2PVO C;  3IK7 A;  4ILF A;  4PGT A;  4HJ2 A;  5GZZ B;  2C80 A;  2IMK A;  3DYR A;  2GT5 A;  2WUL A;  3L9S A;  2I3Y A;  1GLP A;  3KP8 A;  4GQC A;  4TVE A;  1OKD A;  4MJE A;  2WFC A;  6GSV A;  1TU8 A;  2GS3 A;  3VFI A;  3CSI A;  1XCC A;  4RI6 A;  2CAQ A;  3D6I A;  4MJC A;  5A4W A;  2YWN A;  4EO3 A;  2H74 A;  4JR6 A;  4QL9 A;  1KNG A;  3HVV A;  2C4J A;  2RM6 A;  1WWJ A;  2JZS A;  2O7K A;  2R5G A;  3UAR A;  2NVL A;  3VI7 A;  2LRC A;  4F9Z A;  2E7P A;  5CO3 A;  1EOH A;  5G1L A;  3FZA A;  2MZC A;  1OE8 A;  5AIX A;  4OCE A;  1BJX A;  2LNS A;  3FR6 A;  4XS4 B;  4L5L A;  1PMT A;  2DIY A;  3LXZ A;  3GNJ A;  3FZ4 A;  3HJO A;  5GSS A;  4YH2 A;  20GS A;  4Q5F A;  1SJI A;  2P5Q A;  2CX4 A;  3NZN A;  3TJJ A;  3HA9 A;  5B8A A;  2FGX A;  3IAM 2;  1U88 A;  1GSF A;  3TRQ A;  5JCW A;  3TKQ A;  1QK8 A;  3I6A A;  2HZE A;  4OFM A;  1ML6 A;  2KHP A;  3LJR A;  4RI7 A;  1DE1 A;  3TGZ A;  4K0N A;  3CTG A;  2JAC A;  2WB9 A;  1SJZ A;  4EKZ A;  5ABR A;  5JWR B;  3BCK A;  5J9C A;  3DVW A;  2VIM A;  2YZH A;  4Z7X A;  2NPB A;  2K6V A;  5H5Q A;  2YV7 A;  2FWG A;  3C73 A;  1OC9 B;  3ISO A;  2V1M A;  4G2E A;  1KBN A;  2R2J A;  1B4Q A;  4YAV A;  2VL3 A;  4XRD A;  3IA1 A;  4Q5R A;  12GS A;  2X8C A;  2L4C A;  4IS0 A;  2N5A A;  1A0F A;  2YCD A;  3TKS C;  2MMO A;  5HQP A;  3FHK A;  2HFD A;  5IMA A;  5HFG A;  3D22 A;  4EDZ A;  4ZIL A;  2LEG A;  4IP1 A;  1HNA A;  1U87 A;  2LJK A;  3QPM A;  4I6X A;  4ZB6 A;  3RHC A;  1EV4 A;  4AGS A;  2HT9 A;  1O81 A;  4AJ8 A;  1Z9H A;  3LYK A;  4NMU A;  5KN1 A;  4LL1 B;  4JBB A;  4F0B A;  1GNW A;  3WD6 A;  3WGD A;  1X9S B;  3TJB A;  3WYW A;  3BBY A;  1V40 A;  3H8Q A;  4O5R A;  2HYX A;  1T4Y A;  1O85 A;  2O89 A;  2VCX A;  5CRE A;  1F2E A;  3GMF A;  4ECJ A;  3NOF A;  4Q5N A;  2JZR A;  3ED3 A; 
#chains in the Genus database with same CATH topology
 1X5D A;  1Z6M A;  2LUS A;  2DJK A;  3HCZ A;  5ECH B;  4EF0 A;  1AW9 A;  2PMT A;  4ZBA A;  4JRR A;  1M7T A;  4HI7 A;  4HQZ A;  2FY6 A;  1N8J A;  5D73 A;  3GL5 A;  3TCO A;  4HZ2 A;  4BA7 A;  2XPE A;  4XS1 A;  1CQG A;  2V32 A;  5IOW A;  5DDL A;  2FHE A;  3LWA A;  3EMX A;  3EU4 A;  3A2V A;  4RQX A;  5D9T A;  3IBH A;  3M9J A;  1T3B A;  4LA1 A;  5L71 A;  1GRX A;  2LJA A;  1EZK A;  4MMM A;  1PD2 1;  5B8B A;  2R3X A;  2L5L A;  3P8W A;  1FB6 A;  2P31 A;  2Z9S A;  2ZNM A;  2E2G A;  1Z6N A;  2MMZ A;  6GSW A;  4F0C A;  2KLX A;  2H6Y A;  1PKW A;  4HSC X;  3GL3 A;  3L4N A;  2MBS A;  2DJ0 A;  2JSY A;  5D93 A;  4HS1 A;  1PX7 A;  2PWJ A;  4TW5 A;  1ZZY A;  2VM2 A;  2JL4 A;  5KOW A;  17GS A;  3APO A;  1Y25 A;  1J0F A;  4NHZ A;  4XHM A;  2N5B A;  5IPG A;  2O87 A;  2GDR A;  2X8H A;  4GWR A;  2GQM A;  4OFN A;  5F05 A;  1THX A;  4BVY A;  2OAD A;  2H72 A;  1A0R P;  1UC7 A;  3MIX A;  4GRF A;  5HFI A;  13GS A;  4FIW A;  1T4Z A;  3ZLP A;  2YZU A;  1YY7 A;  3S9F A;  3CSJ A;  1AIU A;  4DVC A;  1S3D A;  3EC3 A;  3RPN A;  4E8H A;  1G7E A;  4PTS A;  1T8E B;  3M9K A;  2V41 A;  2DSA A;  4I2U A;  4BVX A;  3ZVJ D;  3EYT A;  1FOH A;  3KTB A;  2QSI A;  1XXU A;  3NIV A;  3IDV A;  3O76 A;  11GS A;  5DCG A;  4OWY A;  1QXH A;  2GQK A;  1SD9 A;  1RQM A;  2GQL A;  1GSY A;  1ZOF A;  2IFQ A;  5H5S A;  2BJX A;  2H0I A;  2VLV A;  4PNF A;  3D4M A;  2R4V A;  1ZGN A;  3DRN A;  4GF0 A;  3UAP A;  4Q5Q A;  3ZFB A;  1X9W B;  4AJ7 A;  4JED A;  4CW9 A;  1R7H A;  5CRD A;  1EEM A;  1AQX A;  1GSE A;  2YAN A;  3P2A A;  2YOI A;  4WBJ A;  1FW1 A;  1AXD A;  3W6G A;  2HE3 A;  5B6N A;  1C72 A;  2VD1 A;  2EC4 A;  2GSS A;  4I97 A;  1ERU A;  1K0D A;  5IIZ A;  14GS A;  2KUC A;  4J2F A;  3Q74 A;  2VCV A;  2HSH A;  5F06 A;  5A5K A;  5FT3 A;  1FVK A;  4POB A;  4POM A;  4POK A;  4KDX A;  3HVS A;  4BL7 A;  5J3R A;  1TK5 B;  4TXO B;  3ZIJ A;  4G0L A;  3GIX A;  2V6K A;  4HUA A;  3TJG A;  4PQI A;  2I81 A;  4ACS A;  5B6M A;  4G9H A;  1WIK A;  4X43 A;  3U5R E;  3C8E A;  2LQO A;  3HD5 A;  4N0V A;  4LLR A;  1GUM A;  4K1F A;  3UBL A;  2GZZ A;  4KGI A;  2LST A;  1N2A A;  2VCZ A;  3UIW A;  1PGT A;  1VF2 A;  1Z7P A;  5CRG A;  1B8X A;  4GSN A;  2MYG A;  3MSZ A;  2R6K A;  4G0K A;  1TU7 A;  2H0G A;  4NV5 A;  3L9V A;  3APQ A;  4KND A;  2HSM A;  2VLT A;  3W8S A;  3MAK A;  1OC8 A;  3RDW A;  3ME7 A;  4NHW A;  1HNC A;  1GTU A;  1U6T A;  3IR4 A;  1GSU A;  5DAL A;  16GS A;  4MZB A;  3C71 A;  2AJQ B;  4IHU A;  1V57 A;  4EXJ A;  1TJD A;  3TKS A;  2CZ2 A;  2H75 A;  1ZYP A;  1ON4 A;  2GZY A;  3EMP A;  1K0A A;  2GSR A;  2FWF A;  1BAY A;  1F9M A;  4TR0 A;  5C04 A;  1XVW A;  1URM A;  2PVQ A;  2HI7 A;  4WKW A;  3BOA A;  5KOX A;  1MEK A;  2F8A A;  2LJR A;  2P0G A;  4KSM A;  4F03 A;  2WDU A;  2OA7 A;  1XWC A;  5F07 A;  1TRU A;  1DUG A;  1OE7 A;  3F4T A;  1GWC A;  1THO A;  3A5I A;  5CRW A;  3QOU A;  5ECP B;  2RUF A;  1WJK A;  4ZL8 A;  2MMN A;  5DBQ A;  1BX9 A;  2A2R A;  1R4W A;  3GTU B;  1SEN A;  1OAZ A;  4HQS A;  3VUR A;  4TRX A;  3KM6 A;  4ZB8 A;  5ENU A;  3TUE A;  2IMF A;  2TRX A;  1S3C A;  4XTS A;  1V9W A;  1AQW A;  4K2D A;  4CDO A;  4IQ1 A;  5ECI B;  3TKS E;  3L78 A;  3EPT A;  2R37 A;  4WR4 A;  3LFL A;  5HR1 A;  4WXT A;  3LOR A;  3VPQ A;  5CNW A;  3VK9 A;  1K0O A;  1SL0 B;  2AYT A;  2P5R A;  1A2J A;  1JLW A;  4J57 E;  2LV3 A;  5CAX A;  2REM A;  5ECN B;  4HU9 A;  1JFU A;  3RAZ A;  4IGJ A;  2CT6 A;  3KH7 A;  4XS6 A;  3DML A;  2EIR A;  3DWV A;  5JCU A;  4MP4 A;  2CQ9 A;  2FUG 2;  2PGT A;  2IWT A;  2GT6 A;  3LQ7 A;  1TRV A;  4QQ7 A;  1O73 A;  2GZP A;  6GSS A;  2VUP A;  3WGX A;  3IHG A;  3MNG A;  4MF6 A;  4XS4 A;  2HNL A;  4O92 A;  5KEJ A;  1Y6E A;  2H0H A;  3ZIV A;  1IYH A;  5G30 A;  5CYY A;  4H86 A;  1K0N A;  3D4T A;  5IMZ A;  5IPH A;  5ECO B;  3D21 A;  1M2B A;  2EIO A;  2E2M A;  2MMA A;  4TR1 B;  2LS5 A;  1F6M C;  4L0U A;  3N5O A;  9GSS A;  2FWE A;  1FO5 A;  3G9B A;  1A8L A;  5ECR B;  1G7O A;  3FZ9 A;  1PQN A;  4F2I A;  4MH3 A;  3UBK A;  3QAW A;  3IC4 A;  1AUC A;  4QL7 A;  2XC2 A;  1K3Y A;  1F3A A;  4K5R A;  3HKR A;  4MF7 A;  1SJ6 A;  1ZMA A;  2AB6 A;  1LU4 A;  1B4P A;  1O6J A;  1OC9 A;  1GH2 A;  2I9H A;  1GTB A;  5ECM B;  2PBJ A;  3F9U A;  5LD0 A;  3HZ4 A;  1U3I A;  3VWX A;  4ISD A;  2H76 A;  1FAA A;  2YNX A;  4K7I A;  5LCZ A;  1XW9 A;  4L5O A;  3GSS A;  5INY A;  5ECL B;  3M3M A;  4GQF A;  3KEB A;  1ZYE A;  4O32 A;  4JU5 A;  1QFN A;  2K9F A;  4XCS A;  4K7O A;  1EP7 A;  5FWG A;  2DJJ A;  4MZC A;  3G7J A;  3HY2 A;  2CVK A;  3TOU A;  1V2A A;  4GCI A;  1YKC A;  4DSR A;  3KTL A;  1EEJ A;  3PGT A;  1BQ7 A;  1TI3 A;  4NAX A;  3R2Q A;  1EGO A;  3G7Y A;  4KDY A;  4X4J A;  3HHV A;  2GSQ A;  3CRT A;  5E59 A;  3TKP A;  5DQS A;  4EUY A;  2IJY A;  2FNO A;  1XFL A;  2CA8 A;  4G10 A;  3VWU A;  5CP1 A;  1K3O A;  1YQ1 A;  3PIN A;  2C3N A;  2H30 A;  2B1L A;  2H1B A;  3EU3 A;  1YKA A;  1Z5Y E;  3I69 A;  4KA0 A;  1GTI A;  4V2N A;  3F3R A;  3UL3 A;  3FKF A;  2CV4 A;  1EV9 A;  3LSZ A;  1JZW A;  2BMX A;  2FA4 A;  3HDC A;  1M0U A;  5LNK e;  4HDE A;  2A4H A;  5HFK A;  1G0T A;  2LTK A;  2L4Q A;  1QMV A;  1TDI A;  1HYU A;  3HJM A;  1W4V A;  1H4O A;  4K7N A;  4IVF A;  1FVJ A;  4FYU A;  4TN8 A;  3GFK A;  4YQV A;  5AGY A;  1NHY A;  1HNB A;  3ZL5 A;  3K8N A;  5GST A;  2IL3 A;  2X99 A;  6GSU A;  3U6V A;  3Q6O A;  3QMX A;  4PUA A;  2OE3 A;  3IAS 2;  22GS A;  2C0G A;  2YV9 A;  2C0F A;  4ULX A;  2H8L A;  3E3E A;  4EVM A;  1VRS D;  3DEX A;  5ID2 A;  3P90 A;  5J4U A;  1AAZ A;  3CBU A;  2V6O A;  1S3A A;  5ID2 B;  2A2S A;  4KX4 A;  4FYB A;  3VPT A;  4I8B A;  5D8I A;  5D9V A;  2YPM A;  2B6M A;  2ZUP A;  2QA1 A;  2VAF A;  4XRA A;  1NW2 A;  3CSH A;  4PUR A;  5E4W A;  1YEP A;  3F8U A;  3F4R A;  2CAI A;  4O7H A;  3J7Y b;  4ECB A;  1QGV A;  1G6W A;  2RM5 A;  1NM3 A;  2I4A A;  3LXT A;  2DBC A;  3Q19 A;  1TP9 A;  2LQQ A;  2F8F A;  4ZL7 A;  4FQU A;  1Q98 A;  4KCE A;  3CTF A;  2X8G A;  3VWV A;  3F6D A;  1E2Y A;  1XWB A;  1ZL9 A;  3CRU A;  1XOA A;  4NXI A;  5ECK B;  2J23 A;  4Z2R A;  4A5P A;  4NWY A;  3DXB A;  3C7M A;  4PXO A;  3KGK A;  2PER A;  2OBK A;  3RHB A;  3HVN A;  1LBK A;  1VF4 A;  2AHE A;  1V98 A;  1TW9 A;  10GS A;  1WOU A;  3F6F A;  3EIN A;  1FHE A;  1XBS A;  2QA2 A;  2VOC A;  4FH8 A;  3MWH A;  5G31 A;  3TJK A;  1ERW A;  3EUR A;  4K0G A;  2VL2 C;  2GGT A;  2WS2 A;  3TRP A;  4IKH A;  2HLS A;  2L59 A;  3P7X A;  2B7K A;  2M80 A;  1XWG A;  1U3A A;  3DKS A;  1JZO A;  1MDJ A;  3EE2 A;  3M8N A;  2NTO A;  5KN3 A;  2QKE A;  3UVH A;  4EIP A;  3GUS A;  4TXO A;  3V1W A;  4K6X A;  4ML1 A;  5ECS A;  3LG6 A;  2YP6 A;  2RII A;  2VM1 A;  2K8S A;  1PN0 A;  1JLV A;  3QDN A;  4POL A;  4D73 A;  3FZ5 A;  4N11 A;  4D73 B;  1TXX A;  1XPV A;  4KDU A;  1GUH A;  3IV4 A;  1M99 A;  3ZVJ A;  1NSW A;  2O8V B;  3ZRE A;  1K0C A;  1WPI A;  5J41 A;  2XHF A;  3LYP A;  4N30 A;  4KH7 A;  4TR3 A;  1SK1 A;  3OR5 A;  4MJB A;  3A2W A;  2DKI A;  3E9J B;  4EIQ A;  3QAV A;  3GV1 A;  5JWQ B;  5G1K A;  4KE3 A;  3UMA A;  4AJ6 A;  3KMN A;  4BWQ A;  1WE0 A;  3LEF A;  2WCI A;  5HR0 A;  2ZCT A;  3TJF A;  4ZXG A;  2EIQ A;  4IJI A;  3ERF A;  5C00 A;  2OBI A;  5BRT A;  1PL2 A;  4IN0 A;  1WP0 A;  3H1N A;  4PNG A;  3RPP A;  2FCH A;  4WEY A;  1ST9 A;  4NPB A;  4IJ3 A;  3FYG A;  3WT1 A;  2IN3 A;  2DIZ A;  4TR4 A;  5J9B A;  1DSB A;  1YJ6 A;  1OC3 A;  4DSS B;  1NHO A;  1S3R A;  2YWM A;  3RBT A;  2K8V A;  2YJH A;  2A4V A;  4CY6 A;  2FA8 A;  5EPF A;  1MD4 A;  4AF2 A;  5A4U A;  3D0Z A;  3H4K A;  3GH6 A;  3WGE A;  2G0F A;  4Z2T A;  2DML A;  2CZ3 A;  3TOT A;  3UEM A;  1I9D A;  3CXG A;  4OO4 A;  3GKM A;  4LMV A;  3BJ5 A;  1O8W A;  1BYE A;  1HD2 A;  5F8B A;  2H1G A;  3GTU A;  1T7P B;  2G2Q A;  2VD0 A;  4FO5 A;  1ERV A;  2VL9 A;  1E6B A;  1PX6 A;  3E0U A;  1ERT A;  2AUV A;  3US3 A;  1SD8 A;  1R26 A;  4BWS A;  4MA9 A;  1SYR A;  2OAC A;  2C3Q A;  5EL8 A;  1A24 A;  2QC7 A;  4K5S A;  3BD2 A;  3MYD A;  2RLI A;  3GA4 A;  3EVI A;  1MTC A;  1FOV A;  1ZYQ B;  1M9B A;  1GUK A;  6GSY A;  4GXZ A;  4Z2U A;  1Q4J A;  3FRC A;  3A3T A;  3TB2 A;  4IQA A;  5H5R A;  3ERW A;  4HU7 A;  2JU5 A;  3C1R A;  3ZMK A;  1DE2 A;  6GSX A;  3KZQ A;  4EDY A;  2V2G A;  3GST A;  3KXO A;  4EL1 A;  2HXK A;  4DEJ A;  4KUN A;  1X0R A;  1A8Y A;  1GLQ A;  1JHB A;  1TK0 B;  4YKF A;  4TOP A;  3FMW A;  2IMD A;  2QGV A;  5IOX A;  4TR1 A;  4PQH A;  4GSS A;  1SK0 A;  5ELG A;  1YF1 A;  3PPU A;  4YAP A;  5DJL A;  2B3S A;  2X49 A;  2OE0 A;  4MDC A;  5COH A;  1WMJ A;  5DCH A;  2K18 A;  3KIJ A;  2L57 A;  3FR3 A;  3GKK A;  4G19 A;  4PQ1 A;  5GAP D;  2PN8 A;  2MBT A;  4JZQ A;  4MLY A;  1ABA A;  2NDO A;  4EC0 A;  2GTU A;  1MDK A;  5IO2 A;  4MJA A;  2XPD A;  4BPY A;  2O85 A;  4X1U A;  1IYI A;  1CQH A;  5B7C A;  2F51 A;  3CYN A;  5F0G A;  5AN1 A;  4ML6 A;  3CMI A;  1OVN A;  2GLR A;  2H6X A;  3F0I A;  3GYK A;  2HZE B;  2DJ1 A;  4MAB A;  7GSS A;  2IMI A;  3H79 A;  1TOF A;  1SKR B;  3QFB C;  2OE1 A;  2XBI A;  3DVX A;  1M2D A;  4HZ4 A;  3QAG A;  2L5O A;  5ECQ B;  4XIH A;  1BG5 A;  2JSZ A;  4ZBD A;  2I1U A;  3IRA A;  5FHI A;  2H66 A;  3O3T A;  4JE1 A;  1RW1 A;  4OD7 A;  1AC1 A;  2B5X A;  3M0F A;  5JCG A;  2YJ7 A;  2HRA A;  2VL2 A;  2WGR A;  3HXS A;  3QD9 A;  1V58 A;  3GKN A;  1SKW B;  2L6C A;  4GTU A;  5G5E A;  4ECI A;  1B9Y C;  2H71 A;  1T00 A;  3F4S A;  3GX0 A;  4OCF A;  3MDK A;  3GH9 A;  3PR8 A;  4CY8 A;  5BMU A;  2C3T A;  1R5A A;  4MPF A;  2ALB A;  4K8M A;  4N0Z A;  1QQ2 A;  2OKA A;  1PA3 A;  2GST A;  3QFA C;  5IMD A;  3ZRD A;  1SU9 A;  1VF3 A;  1XWA A;  2KP1 A;  4RQR A;  4RUV A;  2GVP A;  4MK3 A;  4WET A;  4JR4 A;  2X64 A;  2AAW A;  1R5P A;  5IMC A;  3QR6 A;  1W89 A;  2LKU A;  4ZBB A;  1LJR A;  5G2Z A;  4MNN A;  5IMV A;  2DJ2 A;  2R0C A;  3FR9 A;  2UZ8 A;  5D9W A;  1MDI A;  1SYX A;  1SKS B;  3IK9 A;  2H19 A;  1HQO A;  5CRH A;  4K9Z A;  19GS A;  4WR5 A;  1ACV A;  5D96 A;  2LRT A;  1ILO A;  2ES7 A;  1EP8 A;  3G7I A;  4HJM A;  2X4A A;  3HYP A;  3ME8 A;  3VI5 A;  4CHS A;  4X0X A;  2NBS A;  5JWO B;  4YQM A;  3H93 A;  3DIE A;  2C1Y A;  1XW5 A;  2HZF A;  3ZTL A;  1DBY A;  3F3Q A;  1XW6 A;  1GTA A;  3SBC A;  3KJY A;  4IP6 A;  4GST A;  5DJM A;  3IHQ A;  1GSQ A;  5DAK A;  5AIV A;  4ZL9 A;  1FG4 A;  3GKX A;  2J9H A;  4KB3 A;  3IE3 A;  5DAK B;  1A2M A;  2FD3 A;  1TKD B;  1X9M B;  5D9X A;  1PSQ A;  5DVB A;  4V1A g;  5HR2 A;  1AQV A;  2ON7 A;  2WRT A;  3HJP A;  4MH2 A;  3IXR A;  2YWI A;  1SL2 B;  3VLN A;  1BED A;  2N5F A;  2XBQ A;  5EY6 A;  1FB0 A;  3GUR A;  2IME A;  4PUF C;  4FYC A;  2H1A A;  4YQU A;  1J9B A;  4ZIJ A;  2CVD A;  3UJ1 A;  3JCM L;  2M46 A;  1YZX A;  4J56 E;  1ZCP A;  4PX1 A;  2HRN A;  2L6D A;  5J5N A;  2LRN A;  2LNT A;  1GSS A;  1Z3E A;  5IM9 A;  3D5J A;  3M1G A;  3ZYW A;  1SL1 B;  4TKY A;  2VLU A;  1GL8 A;  2DC5 A;  3I43 A;  3ZML A;  3N9J A;  2H6Z A;  2R0G A;  1EWX A;  2M72 A;  3F63 A;  2DLX A;  4OMV A;  1ZYN A;  3VWW A;  1M3I A;  4IEL A;  3GN3 A;  1F37 A;  5EVO A;  3J7Y k;  1B9X C;  1SK2 A;  4KW6 A;  4BVY B;  1TI1 A;  2C0D A;  2HSY A;  1XVQ A;  4ICY A;  3GRX A;  3Q18 A;  2YN1 A;  4NV2 A;  4GLT A;  3A5W A;  2H70 A;  3APS A;  3FW2 A;  3UOM A;  1M9A A;  2PU9 C;  3I9V 2;  5KN0 A;  4WF5 A;  1EGR A;  2VCW A;  4MPG A;  2HRK A;  1MD3 A;  1GP1 A;  1GNE A;  4BVX B;  3KH9 A;  3ZZX A;  2C8U A;  1K3L A;  3DGQ A;  3C1S A;  2DMM A;  1GUL A;  2FLS A;  5G5F A;  1YF0 A;  1OKT A;  2TIR A;  4I5Q A;  4MF5 A;  5GAN D;  4IBP A;  3IC8 A;  2IFQ B;  1PL1 A;  3HVX A;  2F9S A;  2IIY A;  4KF9 A;  4L8E A;  1TTZ A;  4MZW A;  2TRC P;  1TK8 B;  4USS A;  2JAD A;  4ID0 A;  1A2L A;  2H1D A;  4F82 A;  4WF4 A;  5ELA A;  4I2T A;  1G6Y A;  1WRY A;  2VCT A;  4DSQ A;  1K0M A;  2H01 A;  1H75 A;  3EWL A;  4LMW A;  1X5C A;  2OJL A;  2D2Z A;  3FEU A;  1VGL A;  2RUE A;  1JZD A;  3TRX A;  3O6T A;  1K0B A;  1B48 A;  5AIS A;  1XZO A;  3QCP A;  1PKZ A;  2B5Y A;  2B5E A;  2VO4 A;  3TDG A;  1KTE A;  3GX8 A;  4BL7 B;  1EOG A;  2VCQ A;  5KN2 A;  4KAE A;  4ZB9 A;  1O8X A;  3KMO A;  4OO5 A;  3UVT A;  3DD3 A;  3SWL A;  4L0W A;  1OYJ A;  2PPT A;  3W8J A;  3L0H A;  1X5E A;  4KSO A;  2E0Q A;  5DQY A;  1RK4 A;  1A23 A;  2JZT A;  1F3B A;  3L9U A;  2WJU A;  1XWK A;  3FY7 A;  1T1V A;  3A2X A;  1UVZ A;  4N10 A;  6GST A;  5IQY A;  1O7U A;  2CVB A;  3WT2 A;  3ZFL A;  18GS A;  3ERG A;  2BTO T;  3IOS A;  1UA5 A;  3GHA A;  4TXV A;  5HR3 A;  2DJ3 A;  2H73 A;  1J08 A;  3ZIT A;  2CX3 A;  3KD0 A;  4V1A p;  2F3M A;  1USB A;  2HRF A;  3KP9 A;  1PRX A;  5DAL B;  4P3Y B;  1UN2 A;  4DSS A;  4EE0 A;  4HOJ A;  1I5G A;  4OFT A;  1QUW A;  4HEA 2;  5IMF A;  2KP2 A;  3BCI A;  2PUK C;  2KOK A;  1TRW A;  4V2L A;  4IW9 A;  1YDK A;  2WZ9 A;  4V2M A;  2YWO A;  5IO0 A;  4ECC A;  3KCM A;  2B7J A;  1PN9 A;  1XIY A;  4KCA A;  4E8E A;  1XG8 A;  1YEX A;  1KEB A;  2IPA A;  3LGC A;  5A4V A;  1TRS A;  2B1K A;  2FWH A;  4YKG A;  2C0E A;  1GSD A;  3FK8 A;  1M2A A;  4BIK A;  2AV4 A;  3IPZ A;  2ON5 A;  1Z7R A;  4WBR D;  1VF1 A;  3TKR A;  8GSS A;  1JZR A;  4MCU A;  4G0I A;  3HZ8 A;  1XOB A;  3AY8 A;  4LL4 B;  3PH9 A;  2PVO C;  3IK7 A;  4ILF A;  4PGT A;  4HJ2 A;  5GZZ B;  2C80 A;  2IMK A;  3DYR A;  2A2P A;  2GT5 A;  2WUL A;  3L9S A;  2I3Y A;  1GLP A;  3KP8 A;  4GQC A;  4TVE A;  1OKD A;  4MJE A;  2WFC A;  6GSV A;  1TU8 A;  2GS3 A;  3VFI A;  3CSI A;  1XCC A;  4RI6 A;  2CAQ A;  3D6I A;  4MJC A;  5A4W A;  2YWN A;  4EO3 A;  2H74 A;  4JR6 A;  4QL9 A;  1KNG A;  3HVV A;  2C4J A;  2RM6 A;  1WWJ A;  2JZS A;  2O7K A;  2R5G A;  3UAR A;  2NVL A;  3VI7 A;  2LRC A;  4F9Z A;  2E7P A;  5CO3 A;  2R0P A;  1EOH A;  5G1L A;  3FZA A;  2MZC A;  1OE8 A;  5AIX A;  4OCE A;  1BJX A;  2LNS A;  3FR6 A;  2DKH A;  4XS4 B;  4L5L A;  1PMT A;  2DIY A;  3LXZ A;  4K2X A;  3GNJ A;  3FZ4 A;  3HJO A;  5GSS A;  4YH2 A;  20GS A;  4Q5F A;  1SJI A;  2P5Q A;  2CX4 A;  3NZN A;  3TJJ A;  3HA9 A;  5B8A A;  2FGX A;  3IAM 2;  1U88 A;  3LW9 A;  1GSF A;  3TRQ A;  5JCW A;  3TKQ A;  3CQF A;  1QK8 A;  3I6A A;  2HZE A;  4OFM A;  1M3J A;  1ML6 A;  2KHP A;  3LJR A;  4RI7 A;  1DE1 A;  1PFO A;  3TGZ A;  4K0N A;  3CTG A;  2JAC A;  2WB9 A;  1SJZ A;  4EKZ A;  5ABR A;  5JWR B;  3BCK A;  5J9C A;  3DVW A;  2VIM A;  2YZH A;  4Z7X A;  2NPB A;  2K6V A;  5H5Q A;  2YV7 A;  2FWG A;  3C73 A;  1OC9 B;  3ISO A;  2V1M A;  4G2E A;  3R3E A;  1KBN A;  2R2J A;  1B4Q A;  4YAV A;  2VL3 A;  4XRD A;  3IA1 A;  4Q5R A;  12GS A;  4O5U A;  2X8C A;  2L4C A;  4IS0 A;  2N5A A;  1A0F A;  2YCD A;  3TKS C;  2MMO A;  5HQP A;  3FHK A;  2HFD A;  4O5Q A;  5IMA A;  5HFG A;  3D22 A;  4EDZ A;  4ZIL A;  2LEG A;  4IP1 A;  1HNA A;  1U87 A;  2LJK A;  3QPM A;  4I6X A;  4ZB6 A;  3RHC A;  1EV4 A;  4AGS A;  2HT9 A;  1O81 A;  4AJ8 A;  1Z9H A;  3LYK A;  4NMU A;  5KN1 A;  4LL1 B;  4JBB A;  4F0B A;  1GNW A;  3WD6 A;  3WGD A;  1X9S B;  3TJB A;  3WYW A;  3BBY A;  1V40 A;  3H8Q A;  4O5R A;  2HYX A;  1T4Y A;  1O85 A;  2O89 A;  2VCX A;  5CRE A;  1F2E A;  3GMF A;  4ECJ A;  3NOF A;  4Q5N A;  2JZR A;  3ED3 A; 
#chains in the Genus database with same CATH homology
 1X5D A;  1Z6M A;  2LUS A;  2DJK A;  3HCZ A;  5ECH B;  4EF0 A;  1AW9 A;  2PMT A;  4ZBA A;  4JRR A;  1M7T A;  4HI7 A;  4HQZ A;  2FY6 A;  1N8J A;  5D73 A;  3GL5 A;  3TCO A;  4HZ2 A;  4BA7 A;  2XPE A;  4XS1 A;  1CQG A;  2V32 A;  5IOW A;  5DDL A;  2FHE A;  3LWA A;  3EMX A;  3EU4 A;  3A2V A;  4RQX A;  5D9T A;  3IBH A;  3M9J A;  1T3B A;  4LA1 A;  5L71 A;  1GRX A;  2LJA A;  1EZK A;  4MMM A;  1PD2 1;  5B8B A;  2R3X A;  2L5L A;  3P8W A;  1FB6 A;  2P31 A;  2Z9S A;  2ZNM A;  2E2G A;  1Z6N A;  2MMZ A;  6GSW A;  4F0C A;  2KLX A;  2H6Y A;  1PKW A;  3GL3 A;  3L4N A;  2MBS A;  2DJ0 A;  2JSY A;  5D93 A;  4HS1 A;  1PX7 A;  2PWJ A;  4TW5 A;  1ZZY A;  2VM2 A;  2JL4 A;  5KOW A;  17GS A;  3APO A;  1Y25 A;  1J0F A;  4NHZ A;  4XHM A;  2N5B A;  5IPG A;  2O87 A;  2GDR A;  2X8H A;  4GWR A;  2GQM A;  4OFN A;  5F05 A;  1THX A;  4BVY A;  2OAD A;  2H72 A;  1A0R P;  1UC7 A;  3MIX A;  4GRF A;  5HFI A;  13GS A;  4FIW A;  1T4Z A;  3ZLP A;  2YZU A;  1YY7 A;  3S9F A;  3CSJ A;  1AIU A;  4DVC A;  1S3D A;  3EC3 A;  3RPN A;  4E8H A;  1G7E A;  4PTS A;  1T8E B;  3M9K A;  2V41 A;  2DSA A;  4I2U A;  4BVX A;  3ZVJ D;  3EYT A;  1FOH A;  3KTB A;  2QSI A;  1XXU A;  3NIV A;  3IDV A;  3O76 A;  11GS A;  5DCG A;  4OWY A;  1QXH A;  2GQK A;  1SD9 A;  1RQM A;  2GQL A;  1GSY A;  1ZOF A;  2IFQ A;  5H5S A;  2BJX A;  2H0I A;  2VLV A;  4PNF A;  3D4M A;  2R4V A;  1ZGN A;  3DRN A;  4GF0 A;  3UAP A;  4Q5Q A;  3ZFB A;  1X9W B;  4AJ7 A;  4JED A;  4CW9 A;  1R7H A;  5CRD A;  1EEM A;  1AQX A;  1GSE A;  2YAN A;  3P2A A;  2YOI A;  4WBJ A;  1FW1 A;  1AXD A;  3W6G A;  2HE3 A;  5B6N A;  1C72 A;  2VD1 A;  2EC4 A;  2GSS A;  4I97 A;  1ERU A;  1K0D A;  5IIZ A;  14GS A;  2KUC A;  4J2F A;  3Q74 A;  2VCV A;  2HSH A;  5F06 A;  5A5K A;  5FT3 A;  1FVK A;  4POB A;  4POM A;  4POK A;  4KDX A;  3HVS A;  4BL7 A;  5J3R A;  1TK5 B;  4TXO B;  3ZIJ A;  4G0L A;  3GIX A;  2V6K A;  4HUA A;  3TJG A;  4PQI A;  2I81 A;  4ACS A;  5B6M A;  4G9H A;  1WIK A;  4X43 A;  3U5R E;  3C8E A;  2LQO A;  3HD5 A;  4N0V A;  4LLR A;  1GUM A;  4K1F A;  3UBL A;  2GZZ A;  4KGI A;  2LST A;  1N2A A;  2VCZ A;  3UIW A;  1PGT A;  1VF2 A;  1Z7P A;  5CRG A;  1B8X A;  4GSN A;  2MYG A;  3MSZ A;  2R6K A;  4G0K A;  1TU7 A;  2H0G A;  4NV5 A;  3L9V A;  3APQ A;  4KND A;  2HSM A;  2VLT A;  3W8S A;  3MAK A;  1OC8 A;  3RDW A;  3ME7 A;  4NHW A;  1HNC A;  1GTU A;  1U6T A;  3IR4 A;  1GSU A;  5DAL A;  16GS A;  4MZB A;  3C71 A;  2AJQ B;  4IHU A;  1V57 A;  4EXJ A;  1TJD A;  3TKS A;  2CZ2 A;  2H75 A;  1ZYP A;  1ON4 A;  2GZY A;  3EMP A;  1K0A A;  2GSR A;  2FWF A;  1BAY A;  1F9M A;  4TR0 A;  5C04 A;  1XVW A;  1URM A;  2PVQ A;  2HI7 A;  4WKW A;  3BOA A;  5KOX A;  1MEK A;  2F8A A;  2LJR A;  2P0G A;  4KSM A;  4F03 A;  2WDU A;  2OA7 A;  1XWC A;  5F07 A;  1TRU A;  1DUG A;  1OE7 A;  3F4T A;  1GWC A;  1THO A;  3A5I A;  5CRW A;  3QOU A;  5ECP B;  2RUF A;  1WJK A;  4ZL8 A;  2MMN A;  5DBQ A;  1BX9 A;  2A2R A;  1R4W A;  3GTU B;  1SEN A;  1OAZ A;  4HQS A;  3VUR A;  4TRX A;  3KM6 A;  4ZB8 A;  5ENU A;  3TUE A;  2IMF A;  2TRX A;  1S3C A;  4XTS A;  1V9W A;  1AQW A;  4K2D A;  4CDO A;  4IQ1 A;  5ECI B;  3TKS E;  3L78 A;  3EPT A;  2R37 A;  4WR4 A;  3LFL A;  5HR1 A;  4WXT A;  3LOR A;  3VPQ A;  5CNW A;  3VK9 A;  1K0O A;  1SL0 B;  2AYT A;  2P5R A;  1A2J A;  1JLW A;  4J57 E;  2LV3 A;  5CAX A;  2REM A;  5ECN B;  4HU9 A;  1JFU A;  3RAZ A;  4IGJ A;  2CT6 A;  3KH7 A;  4XS6 A;  3DML A;  2EIR A;  3DWV A;  5JCU A;  4MP4 A;  2CQ9 A;  2FUG 2;  2PGT A;  2IWT A;  2GT6 A;  3LQ7 A;  1TRV A;  4QQ7 A;  1O73 A;  2GZP A;  6GSS A;  2VUP A;  3WGX A;  3IHG A;  3MNG A;  4MF6 A;  4XS4 A;  2HNL A;  4O92 A;  5KEJ A;  1Y6E A;  2H0H A;  3ZIV A;  1IYH A;  5G30 A;  5CYY A;  4H86 A;  1K0N A;  3D4T A;  5IMZ A;  5IPH A;  5ECO B;  3D21 A;  1M2B A;  2EIO A;  2E2M A;  2MMA A;  4TR1 B;  2LS5 A;  1F6M C;  4L0U A;  3N5O A;  9GSS A;  2FWE A;  1FO5 A;  3G9B A;  1A8L A;  5ECR B;  1G7O A;  3FZ9 A;  1PQN A;  4F2I A;  4MH3 A;  3UBK A;  3QAW A;  3IC4 A;  1AUC A;  4QL7 A;  2XC2 A;  1K3Y A;  1F3A A;  4K5R A;  3HKR A;  4MF7 A;  1SJ6 A;  1ZMA A;  2AB6 A;  1LU4 A;  1B4P A;  1O6J A;  1OC9 A;  1GH2 A;  2I9H A;  1GTB A;  5ECM B;  2PBJ A;  3F9U A;  5LD0 A;  3HZ4 A;  1U3I A;  3VWX A;  4ISD A;  2H76 A;  1FAA A;  2YNX A;  4K7I A;  5LCZ A;  1XW9 A;  4L5O A;  3GSS A;  5INY A;  5ECL B;  3M3M A;  4GQF A;  3KEB A;  1ZYE A;  4O32 A;  4JU5 A;  1QFN A;  2K9F A;  4XCS A;  4K7O A;  1EP7 A;  5FWG A;  2DJJ A;  4MZC A;  3G7J A;  3HY2 A;  2CVK A;  3TOU A;  1V2A A;  4GCI A;  1YKC A;  4DSR A;  3KTL A;  1EEJ A;  3PGT A;  1BQ7 A;  1TI3 A;  4NAX A;  3R2Q A;  1EGO A;  3G7Y A;  4KDY A;  4X4J A;  3HHV A;  2GSQ A;  3CRT A;  5E59 A;  3TKP A;  5DQS A;  4EUY A;  2IJY A;  2FNO A;  1XFL A;  2CA8 A;  4G10 A;  3VWU A;  5CP1 A;  1K3O A;  1YQ1 A;  3PIN A;  2C3N A;  2H30 A;  2B1L A;  2H1B A;  3EU3 A;  1YKA A;  1Z5Y E;  3I69 A;  4KA0 A;  1GTI A;  4V2N A;  3F3R A;  3UL3 A;  3FKF A;  2CV4 A;  1EV9 A;  3LSZ A;  1JZW A;  2BMX A;  2FA4 A;  3HDC A;  1M0U A;  5LNK e;  4HDE A;  2A4H A;  5HFK A;  1G0T A;  2LTK A;  2L4Q A;  1QMV A;  1TDI A;  1HYU A;  3HJM A;  1W4V A;  1H4O A;  4K7N A;  4IVF A;  1FVJ A;  4FYU A;  4TN8 A;  3GFK A;  4YQV A;  5AGY A;  1NHY A;  1HNB A;  3ZL5 A;  3K8N A;  5GST A;  2IL3 A;  2X99 A;  6GSU A;  3U6V A;  3Q6O A;  3QMX A;  4PUA A;  2OE3 A;  3IAS 2;  22GS A;  2C0G A;  2YV9 A;  2C0F A;  4ULX A;  2H8L A;  3E3E A;  4EVM A;  1VRS D;  3DEX A;  5ID2 A;  3P90 A;  5J4U A;  1AAZ A;  3CBU A;  2V6O A;  1S3A A;  5ID2 B;  2A2S A;  4KX4 A;  4FYB A;  3VPT A;  4I8B A;  5D8I A;  5D9V A;  2YPM A;  2B6M A;  2ZUP A;  2QA1 A;  2VAF A;  4XRA A;  1NW2 A;  3CSH A;  4PUR A;  5E4W A;  1YEP A;  3F8U A;  3F4R A;  2CAI A;  4O7H A;  3J7Y b;  4ECB A;  1QGV A;  1G6W A;  2RM5 A;  1NM3 A;  2I4A A;  3LXT A;  2DBC A;  3Q19 A;  1TP9 A;  2LQQ A;  2F8F A;  4ZL7 A;  4FQU A;  1Q98 A;  4KCE A;  3CTF A;  2X8G A;  3VWV A;  3F6D A;  1E2Y A;  1XWB A;  1ZL9 A;  3CRU A;  1XOA A;  4NXI A;  5ECK B;  2J23 A;  4Z2R A;  4A5P A;  4NWY A;  3DXB A;  3C7M A;  4PXO A;  3KGK A;  2PER A;  2OBK A;  3RHB A;  1LBK A;  1VF4 A;  2AHE A;  1V98 A;  1TW9 A;  10GS A;  1WOU A;  3F6F A;  3EIN A;  1FHE A;  1XBS A;  2QA2 A;  2VOC A;  4FH8 A;  3MWH A;  5G31 A;  3TJK A;  1ERW A;  3EUR A;  4K0G A;  2VL2 C;  2GGT A;  2WS2 A;  3TRP A;  4IKH A;  2HLS A;  2L59 A;  3P7X A;  2B7K A;  2M80 A;  1XWG A;  1U3A A;  3DKS A;  1JZO A;  1MDJ A;  3EE2 A;  3M8N A;  2NTO A;  5KN3 A;  2QKE A;  3UVH A;  4EIP A;  3GUS A;  4TXO A;  3V1W A;  4K6X A;  4ML1 A;  5ECS A;  3LG6 A;  2YP6 A;  2RII A;  2VM1 A;  2K8S A;  1PN0 A;  1JLV A;  3QDN A;  4POL A;  4D73 A;  3FZ5 A;  4N11 A;  4D73 B;  1TXX A;  1XPV A;  4KDU A;  1GUH A;  3IV4 A;  1M99 A;  3ZVJ A;  1NSW A;  2O8V B;  3ZRE A;  1K0C A;  1WPI A;  5J41 A;  2XHF A;  3LYP A;  4N30 A;  4KH7 A;  4TR3 A;  1SK1 A;  3OR5 A;  4MJB A;  3A2W A;  2DKI A;  3E9J B;  4EIQ A;  3QAV A;  3GV1 A;  5JWQ B;  5G1K A;  4KE3 A;  3UMA A;  4AJ6 A;  3KMN A;  4BWQ A;  1WE0 A;  3LEF A;  2WCI A;  5HR0 A;  2ZCT A;  3TJF A;  4ZXG A;  2EIQ A;  4IJI A;  3ERF A;  5C00 A;  2OBI A;  5BRT A;  1PL2 A;  4IN0 A;  1WP0 A;  3H1N A;  4PNG A;  3RPP A;  2FCH A;  4WEY A;  1ST9 A;  4NPB A;  4IJ3 A;  3FYG A;  3WT1 A;  2IN3 A;  2DIZ A;  4TR4 A;  5J9B A;  1DSB A;  1YJ6 A;  1OC3 A;  4DSS B;  1NHO A;  2YWM A;  3RBT A;  2K8V A;  2YJH A;  2A4V A;  4CY6 A;  2FA8 A;  5EPF A;  1MD4 A;  4AF2 A;  5A4U A;  3D0Z A;  3H4K A;  3GH6 A;  3WGE A;  2G0F A;  4Z2T A;  2DML A;  2CZ3 A;  3TOT A;  3UEM A;  1I9D A;  3CXG A;  4OO4 A;  3GKM A;  4LMV A;  3BJ5 A;  1O8W A;  1BYE A;  1HD2 A;  5F8B A;  2H1G A;  3GTU A;  1T7P B;  2G2Q A;  2VD0 A;  4FO5 A;  1ERV A;  2VL9 A;  1E6B A;  1PX6 A;  3E0U A;  1ERT A;  2AUV A;  3US3 A;  1SD8 A;  1R26 A;  4BWS A;  4MA9 A;  1SYR A;  2OAC A;  2C3Q A;  5EL8 A;  1A24 A;  2QC7 A;  4K5S A;  3BD2 A;  3MYD A;  2RLI A;  3GA4 A;  3EVI A;  1MTC A;  1FOV A;  1ZYQ B;  1M9B A;  1GUK A;  6GSY A;  4GXZ A;  4Z2U A;  1Q4J A;  3FRC A;  3A3T A;  3TB2 A;  4IQA A;  5H5R A;  3ERW A;  4HU7 A;  2JU5 A;  3C1R A;  3ZMK A;  1DE2 A;  6GSX A;  3KZQ A;  4EDY A;  2V2G A;  3GST A;  3KXO A;  4EL1 A;  2HXK A;  4DEJ A;  4KUN A;  1X0R A;  1A8Y A;  1GLQ A;  1JHB A;  1TK0 B;  4YKF A;  4TOP A;  3FMW A;  2IMD A;  2QGV A;  5IOX A;  4TR1 A;  4PQH A;  4GSS A;  1SK0 A;  5ELG A;  1YF1 A;  3PPU A;  4YAP A;  5DJL A;  2B3S A;  2X49 A;  2OE0 A;  4MDC A;  5COH A;  1WMJ A;  5DCH A;  2K18 A;  3KIJ A;  2L57 A;  3FR3 A;  3GKK A;  4G19 A;  4PQ1 A;  5GAP D;  2PN8 A;  2MBT A;  4JZQ A;  4MLY A;  1ABA A;  2NDO A;  4EC0 A;  2GTU A;  1MDK A;  5IO2 A;  4MJA A;  2XPD A;  4BPY A;  2O85 A;  4X1U A;  1IYI A;  1CQH A;  5B7C A;  2F51 A;  3CYN A;  5F0G A;  5AN1 A;  4ML6 A;  3CMI A;  1OVN A;  2GLR A;  2H6X A;  3F0I A;  3GYK A;  2HZE B;  2DJ1 A;  4MAB A;  7GSS A;  2IMI A;  3H79 A;  1TOF A;  1SKR B;  3QFB C;  2OE1 A;  2XBI A;  3DVX A;  1M2D A;  4HZ4 A;  3QAG A;  2L5O A;  5ECQ B;  4XIH A;  1BG5 A;  2JSZ A;  4ZBD A;  2I1U A;  3IRA A;  5FHI A;  2H66 A;  3O3T A;  4JE1 A;  1RW1 A;  4OD7 A;  1AC1 A;  2B5X A;  3M0F A;  5JCG A;  2YJ7 A;  2HRA A;  2VL2 A;  2WGR A;  3HXS A;  3QD9 A;  1V58 A;  3GKN A;  1SKW B;  2L6C A;  4GTU A;  5G5E A;  4ECI A;  1B9Y C;  2H71 A;  1T00 A;  3F4S A;  3GX0 A;  4OCF A;  3MDK A;  3GH9 A;  3PR8 A;  4CY8 A;  5BMU A;  2C3T A;  1R5A A;  4MPF A;  2ALB A;  4K8M A;  4N0Z A;  1QQ2 A;  2OKA A;  1PA3 A;  2GST A;  3QFA C;  5IMD A;  3ZRD A;  1SU9 A;  1VF3 A;  1XWA A;  2KP1 A;  4RQR A;  4RUV A;  2GVP A;  4MK3 A;  4WET A;  4JR4 A;  2X64 A;  2AAW A;  1R5P A;  5IMC A;  3QR6 A;  1W89 A;  2LKU A;  4ZBB A;  1LJR A;  5G2Z A;  4MNN A;  5IMV A;  2DJ2 A;  2R0C A;  3FR9 A;  2UZ8 A;  5D9W A;  1MDI A;  1SYX A;  1SKS B;  3IK9 A;  2H19 A;  1HQO A;  5CRH A;  4K9Z A;  19GS A;  4WR5 A;  1ACV A;  5D96 A;  2LRT A;  1ILO A;  2ES7 A;  1EP8 A;  3G7I A;  4HJM A;  2X4A A;  3HYP A;  3ME8 A;  3VI5 A;  4CHS A;  4X0X A;  2NBS A;  5JWO B;  4YQM A;  3H93 A;  3DIE A;  2C1Y A;  1XW5 A;  2HZF A;  3ZTL A;  1DBY A;  3F3Q A;  1XW6 A;  1GTA A;  3SBC A;  3KJY A;  4IP6 A;  4GST A;  5DJM A;  3IHQ A;  1GSQ A;  5DAK A;  5AIV A;  4ZL9 A;  1FG4 A;  3GKX A;  2J9H A;  4KB3 A;  3IE3 A;  5DAK B;  1A2M A;  2FD3 A;  1TKD B;  1X9M B;  5D9X A;  1PSQ A;  5DVB A;  4V1A g;  5HR2 A;  1AQV A;  2ON7 A;  2WRT A;  3HJP A;  4MH2 A;  3IXR A;  2YWI A;  1SL2 B;  3VLN A;  1BED A;  2N5F A;  2XBQ A;  5EY6 A;  1FB0 A;  3GUR A;  2IME A;  4PUF C;  4FYC A;  2H1A A;  4YQU A;  1J9B A;  4ZIJ A;  2CVD A;  3UJ1 A;  3JCM L;  2M46 A;  1YZX A;  4J56 E;  1ZCP A;  4PX1 A;  2HRN A;  2L6D A;  5J5N A;  2LRN A;  2LNT A;  1GSS A;  1Z3E A;  5IM9 A;  3D5J A;  3M1G A;  3ZYW A;  1SL1 B;  4TKY A;  2VLU A;  1GL8 A;  2DC5 A;  3I43 A;  3ZML A;  3N9J A;  2H6Z A;  2R0G A;  1EWX A;  2M72 A;  3F63 A;  2DLX A;  4OMV A;  1ZYN A;  3VWW A;  4IEL A;  3GN3 A;  1F37 A;  5EVO A;  3J7Y k;  1B9X C;  1SK2 A;  4KW6 A;  4BVY B;  1TI1 A;  2C0D A;  2HSY A;  1XVQ A;  4ICY A;  3GRX A;  3Q18 A;  2YN1 A;  4NV2 A;  4GLT A;  3A5W A;  2H70 A;  3APS A;  3FW2 A;  3UOM A;  1M9A A;  2PU9 C;  3I9V 2;  5KN0 A;  4WF5 A;  1EGR A;  2VCW A;  4MPG A;  2HRK A;  1MD3 A;  1GP1 A;  1GNE A;  4BVX B;  3KH9 A;  3ZZX A;  2C8U A;  1K3L A;  3DGQ A;  3C1S A;  2DMM A;  1GUL A;  2FLS A;  5G5F A;  1YF0 A;  1OKT A;  2TIR A;  4I5Q A;  4MF5 A;  5GAN D;  4IBP A;  3IC8 A;  2IFQ B;  1PL1 A;  3HVX A;  2F9S A;  2IIY A;  4KF9 A;  4L8E A;  1TTZ A;  4MZW A;  2TRC P;  1TK8 B;  4USS A;  2JAD A;  4ID0 A;  1A2L A;  2H1D A;  4F82 A;  4WF4 A;  5ELA A;  4I2T A;  1G6Y A;  1WRY A;  2VCT A;  4DSQ A;  1K0M A;  2H01 A;  1H75 A;  3EWL A;  4LMW A;  1X5C A;  2OJL A;  2D2Z A;  3FEU A;  1VGL A;  2RUE A;  1JZD A;  3TRX A;  3O6T A;  1K0B A;  1B48 A;  5AIS A;  1XZO A;  3QCP A;  1PKZ A;  2B5Y A;  2B5E A;  2VO4 A;  3TDG A;  1KTE A;  3GX8 A;  4BL7 B;  1EOG A;  2VCQ A;  5KN2 A;  4KAE A;  4ZB9 A;  1O8X A;  3KMO A;  4OO5 A;  3UVT A;  3DD3 A;  3SWL A;  4L0W A;  1OYJ A;  2PPT A;  3W8J A;  3L0H A;  1X5E A;  4KSO A;  2E0Q A;  5DQY A;  1RK4 A;  1A23 A;  2JZT A;  1F3B A;  3L9U A;  2WJU A;  1XWK A;  3FY7 A;  1T1V A;  3A2X A;  1UVZ A;  4N10 A;  6GST A;  5IQY A;  1O7U A;  2CVB A;  3WT2 A;  3ZFL A;  18GS A;  3ERG A;  2BTO T;  3IOS A;  1UA5 A;  3GHA A;  4TXV A;  5HR3 A;  2DJ3 A;  2H73 A;  1J08 A;  3ZIT A;  2CX3 A;  3KD0 A;  4V1A p;  2F3M A;  1USB A;  2HRF A;  3KP9 A;  1PRX A;  5DAL B;  4P3Y B;  1UN2 A;  4DSS A;  4EE0 A;  4HOJ A;  1I5G A;  4OFT A;  1QUW A;  4HEA 2;  5IMF A;  2KP2 A;  3BCI A;  2PUK C;  2KOK A;  1TRW A;  4V2L A;  4IW9 A;  1YDK A;  2WZ9 A;  4V2M A;  2YWO A;  5IO0 A;  4ECC A;  3KCM A;  2B7J A;  1PN9 A;  1XIY A;  4KCA A;  4E8E A;  1YEX A;  1KEB A;  2IPA A;  3LGC A;  5A4V A;  1TRS A;  2B1K A;  2FWH A;  4YKG A;  2C0E A;  1GSD A;  3FK8 A;  1M2A A;  2AV4 A;  3IPZ A;  2ON5 A;  1Z7R A;  4WBR D;  1VF1 A;  3TKR A;  8GSS A;  1JZR A;  4MCU A;  4G0I A;  3HZ8 A;  1XOB A;  3AY8 A;  4LL4 B;  3PH9 A;  2PVO C;  3IK7 A;  4ILF A;  4PGT A;  4HJ2 A;  5GZZ B;  2C80 A;  2IMK A;  3DYR A;  2A2P A;  2GT5 A;  2WUL A;  3L9S A;  2I3Y A;  1GLP A;  3KP8 A;  4GQC A;  4TVE A;  1OKD A;  4MJE A;  2WFC A;  6GSV A;  1TU8 A;  2GS3 A;  3VFI A;  3CSI A;  1XCC A;  4RI6 A;  2CAQ A;  3D6I A;  4MJC A;  5A4W A;  2YWN A;  4EO3 A;  2H74 A;  4JR6 A;  4QL9 A;  1KNG A;  3HVV A;  2C4J A;  2RM6 A;  1WWJ A;  2JZS A;  2O7K A;  2R5G A;  3UAR A;  2NVL A;  3VI7 A;  2LRC A;  4F9Z A;  2E7P A;  5CO3 A;  2R0P A;  1EOH A;  5G1L A;  3FZA A;  2MZC A;  1OE8 A;  5AIX A;  4OCE A;  1BJX A;  2LNS A;  3FR6 A;  2DKH A;  4XS4 B;  4L5L A;  1PMT A;  2DIY A;  3LXZ A;  4K2X A;  3GNJ A;  3FZ4 A;  3HJO A;  5GSS A;  4YH2 A;  20GS A;  4Q5F A;  1SJI A;  2P5Q A;  2CX4 A;  3NZN A;  3TJJ A;  3HA9 A;  5B8A A;  2FGX A;  3IAM 2;  1U88 A;  3LW9 A;  1GSF A;  3TRQ A;  5JCW A;  3TKQ A;  1QK8 A;  3I6A A;  2HZE A;  4OFM A;  1ML6 A;  2KHP A;  3LJR A;  4RI7 A;  1DE1 A;  3TGZ A;  4K0N A;  3CTG A;  2JAC A;  2WB9 A;  1SJZ A;  4EKZ A;  5ABR A;  5JWR B;  3BCK A;  5J9C A;  3DVW A;  2VIM A;  2YZH A;  4Z7X A;  2NPB A;  2K6V A;  5H5Q A;  2YV7 A;  2FWG A;  3C73 A;  1OC9 B;  3ISO A;  2V1M A;  4G2E A;  3R3E A;  1KBN A;  2R2J A;  1B4Q A;  4YAV A;  2VL3 A;  4XRD A;  3IA1 A;  4Q5R A;  12GS A;  4O5U A;  2X8C A;  2L4C A;  4IS0 A;  2N5A A;  1A0F A;  2YCD A;  3TKS C;  2MMO A;  5HQP A;  3FHK A;  2HFD A;  4O5Q A;  5IMA A;  5HFG A;  3D22 A;  4EDZ A;  4ZIL A;  2LEG A;  4IP1 A;  1HNA A;  1U87 A;  2LJK A;  3QPM A;  4I6X A;  4ZB6 A;  3RHC A;  1EV4 A;  4AGS A;  2HT9 A;  1O81 A;  4AJ8 A;  1Z9H A;  3LYK A;  4NMU A;  5KN1 A;  4LL1 B;  4JBB A;  4F0B A;  1GNW A;  3WD6 A;  3WGD A;  1X9S B;  3TJB A;  3WYW A;  3BBY A;  1V40 A;  3H8Q A;  4O5R A;  2HYX A;  1T4Y A;  1O85 A;  2O89 A;  2VCX A;  5CRE A;  1F2E A;  3GMF A;  4ECJ A;  3NOF A;  4Q5N A;  2JZR A;  3ED3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...