4DVCA

Structural and functional studies of tcpg, the vibrio cholerae dsba disulfide-forming protein required for pilus and cholera toxin production
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
184
structure length
184
Chain Sequence
SNAAQFKEGEHYQVLKTPASSSPVVSEFFSFYCPHCNTFEPIIAQLKQQLPEGAKFQKNHVSFMGGNMGQAMSKAYATMIALEVEDKMVPVMFNRIHTLRKPPKDEQELRQIFLDEGIDAAKFDAAYNGFAVDSMVHRFDKQFQDSGLTGVPAVVVNNRYLVQGQSAKSLDEYFDLVNYLLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein DsbA
publication title The 1.2 A resolution crystal structure of TcpG, the Vibrio cholerae DsbA disulfide-forming protein required for pilus and cholera-toxin production
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 61
structure length 184
sequence length 184
ec nomenclature
pdb deposition date 2012-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4dvcA00
4F0BA 1T1VA 4N0ZA 2CV4A 3TJFA 2F51A 1U88A 3TDGA 2C80A 2JU5A 4CHSA 3D4TA 1TRUA 1XWGA 1TKDB 5DAKA 3I43A 3HHVA 2AAWA 1HYUA 1S3AA 3FKFA 3PR8A 1AQXA 4JR4A 4G10A 4WF5A 2B1LA 4KDXA 5IOWA 4YQVA 3IRAA 1WWJA 5HFKA 2CAQA 3LFLA 3FZ5A 3TUEA 3ZMLA 5IPGA 4HS1A 4WBJA 1SL1B 4IP6A 3RDWA 1Q98A 2CVKA 4HQZA 4ILFA 1M99A 2VL2C 4K0GA 4WEYA 4AJ8A 2RIIA 7GSSA 2OA7A 4AGSA 2PU9C 3ZIVA 3BCKA 1LU4A 2NVLA 2V2GA 4J57E 2LRCA 3ZTLA 5KEJA 4IN0A 1I9DA 3HVXA 4L5OA 5ENUA 1JFUA 1WJKA 2DMLA 1QQ2A 5D9TA 3TJBA 2DBCA 1ERVA 2L6CA 1Z3EA 1E6BA 1GUMA 1MTCA 12GSA 2L6DA 3FZ9A 1U87A 4NXIA 1XVWA 2HRNA 5JCGA 3VWVA 2VCWA 4ZL7A 4HUAA 4ML1A 1O85A 3W8JA 5DBQA 2FUG2 2O7KA 3IHQA 4XTSA 5B6NA 2MBSA 2QGVA 4MZCA 4WR5A 1YF1A 1BG5A 1K0DA 1URMA 1K0NA 1WMJA 1VF3A 4KDUA 4G9HA 5IQYA 4IQAA 2WS2A 2H72A 2GZYA 2P31A 2RUFA 1HD2A 3KJYA 4KDYA 4AJ7A 2B1KA 1OE7A 3F63A 4QQ7A 1K3LA 1V57A 3IBHA 3D6IA 3V1WA 3Q74A 1FO5A 1B9YC 3GSSA 3GHAA 3DKSA 1ZOFA 4E8EA 4GSNA 14GSA 4MH3A 1O6JA 2YZUA 5ID2B 2JZSA 3LORA 2IPAA 3DYRA 5IO0A 5GAPD 4BA7A 1SU9A 3C1SA 3BBYA 2X8CA 1UA5A 1K0OA 2E0QA 2IMEA 4QL9A 3GMFA 3J7Yb 5AN1A 3EINA 4NMUA 5F0GA 1SKRB 5D93A 3VWWA 3EYTA 2MMOA 3P2AA 4PNGA 6GSXA 1KEBA 4LL1B 5IM9A 4KSOA 3VURA 2X8HA 1WP0A 4TR1A 1YDKA 2K6VA 1USBA 4OFTA 2JSYA 4DSSB 1JZDA 2FCHA 4TRXA 4BVXA 3D21A 3G7JA 1X9SB 4MF6A 3TCOA 1X5CA 2MZCA 3WT2A 5JCWA 1XXUA 2B5EA 4F0CA 1GNEA 3A2WA 3GURA 1JZOA 3KIJA 2GVPA 2PERA 4I97A 1KTEA 2L57A 4IP1A 2PVOC 4GSSA 2H70A 1FW1A 4KB3A 2C8UA 3FYGA 2HZFA 1ST9A 2V1MA 2HZEA 3WD6A 1GNWA 1NM3A 2KOKA 4OMVA 3TRXA 6GSSA 2PPTA 4ZL8A 2XHFA 2IMFA 3C73A 3DEXA 3HCZA 3HJOA 2H74A 2R2JA 1PQNA 5DALA 1R5AA 1DUGA 3F0IA 2VL3A 4MDCA 1TU8A 2B6MA 1PL1A 2XBIA 4O32A 4Q5FA 4GF0A 5H5QA 5CRGA 2PVQA 2NPBA 5ECQB 4L5LA 3HJMA 5J3RA 2L4CA 2C0DA 4IBPA 2FWGA 3VK9A 1LJRA 2LUSA 1T7PB 2X99A 3TKSA 5G30A 4HJMA 5IPHA 4JU5A 4XS6A 4TW5A 4YH2A 1TXXA 4CDOA 3UEMA 1F6MC 2YP6A 2L59A 1SJIA 3HVSA 4WR4A 1O7UA 2R3XA 3TB2A 4GQCA 1S3DA 2F9SA 4TR0A 5INYA 2EIOA 3IE3A 3CMIA 3LEFA 4LMWA 2YWNA 3UJ1A 5DVBA 1M2BA 2REMA 2OE0A 3FZAA 4RQXA 3KGKA 4O92A 1MD3A 1SD8A 2ES7A 4ZB9A 4GLTA 4XCSA 18GSA 2B7KA 1F9MA 2R6KA 5CRHA 5G2ZA 4OFMA 4I6XA 2VLUA 3GIXA 3L4NA 3N9JA 4ZILA 1TOFA 5ECMB 2PWJA 2V6OA 3M0FA 3WGXA 1OC8A 3M9KA 3QCPA 5DJLA 1TTZA 5B7CA 3J7Yk 3RPNA 3E9JB 1BQ7A 4PX1A 1AIUA 4WXTA 2XC2A 1OKTA 3GH6A 1GH2A 2RUEA 2WULA 2KP2A 4OWYA 4FYCA 1YJ6A 2WFCA 4POKA 4J56E 3AY8A 1N2AA 3KMNA 3GKXA 4Q5RA 3HVVA 5D73A 3HY2A 2IJYA 3L78A 1VF2A 3QAWA 3GL3A 3DRNA 1T8EB 1ZYQB 4WF4A 4DSQA 3F9UA 1JZWA 3QAVA 4ZL9A 1M9BA 3C7MA 3H1NA 1DE2A 2OADA 3CBUA 3F4RA 3H8QA 2WRTA 4PQ1A 2CVBA 2LQQA 3QAGA 3UBKA 1OC3A 2J23A 4F9ZA 2G0FA 4FIWA 3RHBA 4BL7A 2OE1A 1PGTA 6GSYA 2P0GA 2RM6A 3CSIA 5IMDA 5CNWA 2Z9SA 3IAS2 4OCFA 4MZWA 1A0FA 3ZLPA 1EEJA 2KLXA 2NDOA 4ACSA 1V40A 2I4AA 2CZ2A 2LJRA 3GN3A 1HNBA 3UVHA 1EOGA 1RW1A 5HR1A 3DVXA 1XWKA 2C0FA 4HJ2A 1SENA 3ZIJA 5AIVA 1SYRA 3CTGA 5GAND 4MF7A 3C1RA 2DC5A 1HNAA 1J08A 1M2AA 4TR1B 1G7EA 3VI7A 2YV9A 3SBCA 1TK0B 4JEDA 1F3AA 1JZRA 4NHZA 1EWXA 1WPIA 2P5QA 4NV2A 5D96A 3DVWA 2D2ZA 1F37A 3IK9A 4MPGA 1PKZA 4G2EA 4KA0A 1ABAA 1FB6A 1GLQA 4EC0A 5LNKe 5DCHA 3GTUA 4NPBA 3LQ7A 1DE1A 4TR3A 2VLTA 2XPEA 3DMLA 2H73A 2VCZA 2GT6A 3APSA 3CSJA 3QD9A 2HYXA 4I2TA 1GTIA 5G1KA 2YNXA 3FZ4A 1E2YA 1YKAA 2HZEB 2OBKA 4MJAA 5D9WA 2KUCA 4MA9A 2DJ1A 2HRFA 4KW6A 3KCMA 5CAXA 2RLIA 1TDIA 2O89A 4KCEA 3ZZXA 4V2NA 3ZL5A 1A0RP 4TXOA 4V2MA 2I9HA 5DALB 4HQSA 4BVYA 4MABA 4TXVA 2F8AA 1OC9A 1FVKA 2V41A 1YZXA 3GKKA 2V32A 3RAZA 2H8LA 4KH7A 4DSRA 4ULXA 5KN0A 11GSA 3RPPA 1IYHA 3L0HA 5ELGA 1CQGA 4GRFA 1T4ZA 3HKRA 5IMFA 4YAVA 1Y6EA 2X8GA 4L0UA 4DVCA 4MMMA 3GYKA 2A4VA 3PINA 3ZRDA 4N30A 3IR4A 1T00A 4MZBA 2C4JA 2GZPA 4RI6A 3CXGA 3FRCA 4YQUA 1T3BA 1Z7PA 3ED3A 4NHWA 3KD0A 3G7YA 1EV9A 1O73A 2DJ2A 3EMPA 1OAZA 2HFDA 4JE1A 2OBIA 1FAAA 3QPMA 5FWGA 3LYPA 1K3YA 4MK3A 4D73A 5HR3A 5HFIA 4E8HA 1GTUA 5IO2A 1YY7A 5ECSA 2GQLA 5EL8A 3ZVJA 1J0FA 1M0UA 2VAFA 3CRTA 3R2QA 4XRAA 1XIYA 5E4WA 3BJ5A 3KXOA 2R4VA 3FR3A 1EOHA 1A8YA 1XW6A 4OCEA 1Z9HA 1YEXA 2A2SA 3EURA 5ECNB 5A4VA 2OKAA 1MDIA 1QK8A 2CAIA 2B5XA 4IJ3A 1V98A 1PKWA 4HU7A 2A2RA 3HA9A 4MJCA 4IS0A 2AUVA 4PURA 1GUHA 3GA4A 3TGZA 2C3NA 4KGIA 2JADA 4ECJA 2H1BA 2YV7A 2YWMA 3TOTA 1GSDA 1TJDA 2K8SA 4ZIJA 2BJXA 3FK8A 5HQPA 2LS5A 5ECLB 4CW9A 2H1GA 1TW9A 5IMVA 1XW9A 3ZYWA 4KAEA 3DIEA 2AV4A 4P3YB 5LCZA 2TRXA 3G7IA 3GRXA 1K0AA 2VL2A 1HNCA 1ERUA 1A8LA 3M1GA 4IGJA 1BJXA 2R37A 2WDUA 1EP8A 3HZ8A 17GSA 2KHPA 3IDVA 3QDNA 6GSWA 2WZ9A 2M72A 3FR6A 1XFLA 1ZGNA 1CQHA 4QL7A 2F3MA 1XWCA 3KP8A 4MCUA 1YF0A 3G9BA 3E0UA 5COHA 2ZUPA 4K7OA 3GNJA 3KZQA 2HNLA 2YPMA 1B9XC 2J9HA 3ZITA 5IMZA 3VPQA 4G19A 1RK4A 2YWOA 5KN1A 3HDCA 2GQKA 3F3RA 1SL2B 4PQIA 2LSTA 2CQ9A 2FWHA 5J9CA 1VF4A 2EC4A 4XS4A 4WKWA 5ECKB 2EIRA 4PUAA 2MBTA 3F4TA 3I69A 5JWRB 3N5OA 5J9BA 1R26A 3ME8A 4XS1A 3CYNA 2K18A 3CRUA 3LGCA 3W6GA 2XPDA 4KSMA 1A23A 1SKSB 1GUKA 4K7IA 1O81A 2LJAA 1SK2A 1ZMAA 5G5FA 2AHEA 4KCAA 2NBSA 1OE8A 4I8BA 3TKQA 3KH9A 3O76A 4K2DA 4EF0A 4ZBBA 4K9ZA 3MDKA 2H6YA 2QC7A 2IFQA 3FY7A 5IOXA 2MYGA 4XIHA 2YN1A 1XPVA 5B8BA 3GTUB 2C0EA 3DWVA 1ILOA 1AQWA 3W8SA 4FO5A 2C3TA 1M7TA 5G5EA 4JZQA 1XOBA 4F2IA 1A2JA 1NHOA 5DQSA 5IMAA 5DAKB 1KNGA 2H76A 1ACVA 4MJBA 2LTKA 1GSSA 3PGTA 2IIYA 1R4WA 3EWLA 2VIMA 1K3OA 5AIXA 2DIZA 3ZFBA 3LJRA 4LA1A 4MH2A 3Q6OA 3UOMA 4ZB8A 2OJLA 2IMDA 9GSSA 1WRYA 3RBTA 4BWQA 2GDRA 2K9FA 1KBNA 5IIZA 4TXOB 1PD21 2FHEA 3MNGA 1XVQA 1NSWA 1AQVA 1OC9B 4ZBDA 1A2LA 1Y25A 3FR9A 4V1Ag 4K7NA 3NOFA 2H0IA 3KP9A 4POLA 4BPYA 3TJKA 4LL4B 2VUPA 5JWQB 1DSBA 3GV1A 1W89A 1QXHA 2DJKA 1GP1A 2YCDA 4POBA 4Q5QA 3KEBA 1JLWA 4V2LA 3VWUA 2GSRA 1PN9A 3EVIA 1B8XA 1W4VA 3KH7A 5ECPB 2LNSA 2VCXA 2E7PA 4D73B 1MDJA 3TRQA 1H4OA 3IK7A 4EVMA 2JZTA 5JWOB 3KM6A 2LJKA 5DQYA 2CX4A 2ALBA 3PH9A 2GS3A 5EVOA 3BOAA 1GULA 1SKWB 1XWBA 2WCIA 1GSUA 4IW9A 1K0CA 3ZFLA 1V9WA 1ON4A 3IC4A 1O8XA 1WIKA 3LWAA 3SWLA 5J41A 2I3YA 3E3EA 3S9FA 5CRDA 2LQOA 2MMZA 3GUSA 2JZRA 4PNFA 3TKSE 1THOA 3F4SA 2ZNMA 3QFBC 4XHMA 3ISOA 4NV5A 5FHIA 1YEPA 1NHYA 2LRNA 2L5LA 3UMAA 5ECIB 4GWRA 1GSFA 5HR2A 2GQMA 1OYJA 2FD3A 3TJJA 3VFIA 2B3SA 2VLVA 4IKHA 5D9VA 5CYYA 1LBKA 4NAXA 1Z5YE 2P5RA 3HYPA 3P8WA 2VO4A 4XRDA 1N8JA 4DSSA 4ZBAA 5AGYA 5JCUA 4I5QA 2F8FA 2HE3A 4H86A 1J9BA 4MJEA 3QOUA 4TN8A 2I1UA 1GSEA 1X9MB 1FVJA 2ON5A 4GSTA 1K0BA 1ZL9A 2IL3A 3A2VA 1TK5B 1TI1A 3ERWA 5DCGA 3WGEA 3O3TA 3CTFA 3LXTA 2H66A 3UBLA 2B5YA 1Z6MA 4ML6A 4EL1A 4XS4B 1F2EA 3F6FA 5F8BA 1K0MA 2LNTA 1UN2A 4Z7XA 2R5GA 5CREA 5AISA 3TOUA 2GLRA 1B4QA 4OFNA 1G7OA 2PN8A 3HJPA 2ON7A 5KN2A 20GSA 2E2GA 3FHKA 2CT6A 2AB6A 1VGLA 1WOUA 2NTOA 2IN3A 2PUKC 19GSA 1ERWA 2VM2A 4RI7A 4EO3A 2YWIA 4KE3A 4X43A 1NW2A 4F03A 2LRTA 5F05A 3H93A 1X5DA 4YAPA 3NZNA 4K8MA 2IFQB 4OD7A 5KN3A 5A5KA 4I2UA 2WGRA 1C72A 3CSHA 1X9WB 1DBYA 4HOJA 2H1DA 1MD4A 3OR5A 2GTUA 4Q5NA 3F6DA 2LEGA 3JCML 1GTAA 3WYWA 2IMIA 2YJHA 2B7JA 2FWEA 3ERFA 6GSVA 4OO5A 4DEJA 4TOPA 2PGTA 3VPTA 3P7XA 1TP9A 2O87A 5A4UA 4NWYA 3D5JA 2C3QA 1M2DA 5E59A 4EKZA 2H19A 1H75A 2WB9A 1OVNA 4EDYA 1FOVA 3NIVA 2X64A 1PX7A 2MMNA 3KTBA 1T4YA 4ECCA 5DDLA 1ML6A 3EMXA 2LKUA 3IAM2 1AW9A 2CA8A 3M9JA 5GZZB 2FA4A 1YKCA 1XCCA 4HZ2A 1G0TA 1MEKA 1I5GA 5DJMA 1ZCPA 2H30A 2XBQA 5J5NA 4TR4A 2IMKA 1BEDA 4POMA 1YQ1A 3UARA 4X0XA 4HZ4A 3RHCA 3VWXA 4TKYA 1AUCA 4PQHA 2CVDA 2KP1A 2C1YA 4EUYA 2M80A 1S3CA 4EE0A 4EDZA 1TRSA 5C00A 1THXA 4FH8A 1GLPA 4KX4A 1ZZYA 3H79A 4ECIA 4WETA 1OKDA 1SJ6A 3EE2A 1A2MA 4J2FA 1Z6NA 2TRCP 5CO3A 1BAYA 1O8WA 4V1Ap 3U6VA 4GCIA 3WT1A 2FNOA 1UC7A 2JACA 2OACA 1G6WA 2DIYA 4JRRA 2VCQA 3IOSA 4KNDA 4TVEA 1XZOA 2M46A 4AF2A 2YANA 3M8NA 5LD0A 3HXSA 1MDKA 2GSQA 5HFGA 1A24A 4MF5A 2ZCTA 5L71A 4K0NA 3TKSC 22GSA 3HZ4A 3GX8A 3MAKA 2QKEA 3H4KA 1IYIA 1BYEA 1UVZA 4K1FA 3US3A 3ZMKA 4PGTA 2DSAA 1U6TA 2O8VB 1X5EA 2MMAA 2HLSA 1R7HA 5ECRB 3ME7A 2L5OA 3L9VA 1BX9A 1X0RA 4ZB6A 3FW2A 1GRXA 5FT3A 1XWAA 2I81A 1ZYEA 1SK1A 3Q19A 4GTUA 5HR0A 1EV4A 2GSSA 3GFKA 3BCIA 3EU4A 1PL2A 4IELA 4GQFA 3GKNA 3GL5A 3IV4A 4IJIA 1JLVA 4O7HA 4EXJA 1PMTA 1GL8A 2VM1A 2BTOT 2H6ZA 4OO4A 2YOIA 3QFAC 3TJGA 3MWHA 2BMXA 1AXDA 3Q18A 1U3IA 3K8NA 4N10A 4HI7A 2TIRA 3APOA 5GSSA 2EIQA 3F8UA 3LXZA 1FG4A 1QFNA 4ID0A 5D8IA 3I6AA 1SYXA 1U3AA 3VLNA 4FYUA 3APQA 3KTLA 3GH9A 4LMVA 5H5SA 2QSIA 3TKPA 4L0WA 3QMXA 1PSQA 2O85A 2PMTA 1F3BA 3C71A 2HSYA 2L4QA 5EPFA 1PX6A 4BWSA 2HT9A 3DD3A 2N5AA 2HSHA 3ZREA 8GSSA 2H6XA 1TK8B 1XOAA 2H0GA 2H1AA 4IHUA 1QUWA 3D4MA 5F07A 2H71A 3D0ZA 3KMOA 2FA8A 4MPFA 2V6KA 3FEUA 2N5BA 2PBJA 2CZ3A 1PRXA 5A4WA 3EC3A 5ECOB 2JSZA 2YZHA 6GSUA 3UVTA 2VD0A 4IVFA 3O6TA 3A5WA 4HU9A 2GZZA 5ELAA 4LLRA 1GSYA 1TRWA 2HI7A 5D9XA 1R5PA 2VD1A 1G6YA 2AYTA 3DXBA 1TU7A 2K8VA 13GSA 1SL0B 1V2AA 3U5RE 3EU3A 4K6XA 6GSTA 3UIWA 4MP4A 3TRPA 5GSTA 5EY6A 1Z7RA 5B8AA 4PUFC 3D22A 3LG6A 3M3MA 3GX0A 1AAZA 2FGXA 3A3TA 3P90A 2H75A 1GWCA 3QR6A 5H5RA 1XW5A 4ECBA 16GSA 2WJUA 2H01A 5ID2A 1SK0A 3C8EA 4F82A 1EEMA 4YQMA 3LSZA 2C0GA 2DMMA 3LYKA 3WGDA 4FYBA 5IMCA 1VRSD 3I9V2 2DJJA 3DGQA 3ERGA 2GT5A 4HDEA 3ZVJD 1EP7A 1B4PA 5J4UA 1RQMA 1HQOA 1QMVA 2CX3A 4JR6A 3TKRA 3UL3A 4RQRA 2IWTA 4ZXGA 1M9AA 2DJ0A 10GSA 4HEA2 2FWFA 5G1LA 4IQ1A 2RM5A 1GSQA 3GKMA 1AC1A 2E2MA 2VCTA 1QGVA 5CP1A 4N11A 1ERTA 4RUVA 3UAPA 1V58A 3HD5A 3IXRA 4L8EA 1FB0A 1EGOA 2H0HA 1WE0A 2G2QA 2DLXA 1SJZA 2YJ7A 2FLSA 4O5RA 1TI3A 2N5FA 3L9SA 4MLYA 3L9UA 2VL9A 2GGTA 2GSTA 3BD2A 2JL4A 1EGRA 4KUNA 1PA3A 2HXKA 5B6MA 4WBRD 1FHEA 5C04A 5ECHB 1JHBA 2OE3A 3IA1A 3VI5A 3F3QA 1XBSA 1VF1A 5ABRA 1B48A 1GTBA 4AJ6A 2VOCA 4GXZA 4PXOA 1EZKA 4X1UA 5CRWA 4ISDA 2AJQB 3IPZA 5G31A 2FY6A 3MSZA 5F06A 4JBBA 1TRVA 2VCVA 1Q4JA 1SD9A 3A2XA 2LV3A 2DJ3A 4N0VA 3GSTA
chains in the Genus database with same CATH superfamily
4F0BA 1T1VA 4N0ZA 2CV4A 3TJFA 2F51A 1U88A 3TDGA 2C80A 2JU5A 4CHSA 3D4TA 1TRUA 1XWGA 1TKDB 5DAKA 3I43A 3HHVA 2AAWA 1HYUA 1S3AA 3FKFA 3PR8A 1AQXA 4JR4A 4G10A 4WF5A 2B1LA 4KDXA 5IOWA 4YQVA 3IRAA 1WWJA 5HFKA 2CAQA 3LFLA 3FZ5A 3TUEA 3ZMLA 5IPGA 4HS1A 4WBJA 1SL1B 4ICYA 4IP6A 3RDWA 1Q98A 2CVKA 4HQZA 4ILFA 1M99A 2VL2C 4K0GA 4WEYA 4AJ8A 2RIIA 7GSSA 2OA7A 4AGSA 2PU9C 3ZIVA 3BCKA 1LU4A 2NVLA 2V2GA 4J57E 2LRCA 3ZTLA 5KEJA 4IN0A 4FQUA 1I9DA 3HVXA 4HSCX 4L5OA 5ENUA 1JFUA 1WJKA 2DMLA 2R0CA 1QQ2A 5D9TA 3TJBA 2DBCA 1ERVA 2L6CA 1Z3EA 1E6BA 1GUMA 1MTCA 2DKHA 12GSA 2L6DA 3FZ9A 1U87A 4NXIA 1XVWA 2HRNA 5JCGA 3VWVA 2VCWA 4ZL7A 4HUAA 2QA2A 1O85A 4ML1A 3W8JA 5DBQA 2FUG2 2O7KA 3IHQA 4XTSA 3IC8A 5B6NA 2MBSA 2QGVA 3R3EA 4MZCA 4WR5A 1YF1A 1BG5A 1K0DA 1URMA 1K0NA 1WMJA 1VF3A 4KDUA 4G9HA 5IQYA 4IQAA 2WS2A 2H72A 2GZYA 2P31A 2RUFA 1HD2A 3KJYA 4KDYA 4AJ7A 2B1KA 1OE7A 3F63A 4QQ7A 1K3LA 1V57A 3IBHA 3D6IA 3V1WA 3Q74A 1FO5A 1B9YC 3GSSA 3GHAA 5KOWA 3DKSA 1ZOFA 4E8EA 4GSNA 14GSA 4MH3A 1O6JA 2YZUA 5ID2B 2JZSA 3LORA 2IPAA 3DYRA 5IO0A 5GAPD 4BA7A 1SU9A 3C1SA 3BBYA 2X8CA 1UA5A 1K0OA 2E0QA 2IMEA 4QL9A 3GMFA 3J7Yb 5AN1A 3EINA 4NMUA 5F0GA 1SKRB 5D93A 3VWWA 3EYTA 2MMOA 3P2AA 4PNGA 6GSXA 1KEBA 2X4AA 4LL1B 1S3RA 5IM9A 4KSOA 3VURA 2X8HA 1WP0A 4TR1A 1YDKA 2K6VA 1USBA 4OFTA 2JSYA 4DSSB 1JZDA 2FCHA 4TRXA 5BRTA 4BVXA 3D21A 3A5IA 3G7JA 1X9SB 4MF6A 3TCOA 1X5CA 2MZCA 3WT2A 5JCWA 1XXUA 2B5EA 4F0CA 1GNEA 3A2WA 3GURA 1JZOA 4G0IA 3KIJA 2GVPA 2PERA 4I97A 1KTEA 2L57A 4IP1A 2PVOC 4GSSA 2H70A 1FW1A 4KB3A 2C8UA 3FYGA 2HZFA 1ST9A 2V1MA 2HZEA 3WD6A 1GNWA 1NM3A 2KOKA 4OMVA 3TRXA 6GSSA 2PPTA 4ZL8A 2XHFA 2IMFA 3C73A 3DEXA 3HCZA 3HJOA 2H74A 2R2JA 1PQNA 5DALA 1R5AA 1DUGA 3F0IA 2VL3A 4MDCA 1TU8A 2B6MA 1PL1A 2XBIA 4O32A 4Q5FA 4Z2RA 4GF0A 5H5QA 5CRGA 2PVQA 2NPBA 5ECQB 4L5LA 3HJMA 5J3RA 2L4CA 2C0DA 4IBPA 2FWGA 4K5RA 3VK9A 1LJRA 2LUSA 1T7PB 2X99A 4CY8A 3TKSA 5G30A 4HJMA 5IPHA 4JU5A 4XS6A 4TW5A 4YH2A 1TXXA 4CDOA 3UEMA 1F6MC 2YP6A 1PN0A 2L59A 1SJIA 3HVSA 4WR4A 1O7UA 2R3XA 3TB2A 4Z2UA 4GQCA 1S3DA 2F9SA 4TR0A 5INYA 2EIOA 3IE3A 3CMIA 3LEFA 4LMWA 2YWNA 3UJ1A 5DVBA 1M2BA 2REMA 2OE0A 3FZAA 4RQXA 3KGKA 4O92A 1MD3A 1SD8A 2ES7A 4ZB9A 4GLTA 4XCSA 1ZYNA 18GSA 2B7KA 1F9MA 2R6KA 5CRHA 5G2ZA 4OFMA 4I6XA 2VLUA 3GIXA 3L4NA 3N9JA 4ZILA 1TOFA 5ECMB 2PWJA 2V6OA 3M0FA 3WGXA 1OC8A 3M9KA 3QCPA 5DJLA 1TTZA 5B7CA 3J7Yk 3RPNA 3E9JB 1BQ7A 4PX1A 1AIUA 4WXTA 2XC2A 1OKTA 3GH6A 1GH2A 2RUEA 2WULA 2KP2A 4OWYA 4FYCA 1YJ6A 2WFCA 3EPTA 4POKA 4J56E 3AY8A 1N2AA 3KMNA 3GKXA 4Q5RA 3HVVA 5D73A 3HY2A 2IJYA 3L78A 1VF2A 3QAWA 3GL3A 3DRNA 1T8EB 1ZYQB 4WF4A 4DSQA 3F9UA 1JZWA 3QAVA 4ZL9A 1M9BA 3C7MA 3H1NA 1DE2A 2OADA 2QA1A 3CBUA 3F4RA 3H8QA 2WRTA 4PQ1A 2CVBA 2LQQA 3QAGA 3UBKA 1OC3A 2J23A 4F9ZA 2G0FA 4FIWA 3RHBA 4BL7A 2OE1A 1PGTA 6GSYA 2P0GA 2RM6A 3CSIA 5IMDA 5CNWA 2Z9SA 3IAS2 4OCFA 4MZWA 1A0FA 3ZLPA 1EEJA 2KLXA 2NDOA 4ACSA 1V40A 2I4AA 2CZ2A 4X4JA 2LJRA 3GN3A 1HNBA 3UVHA 1EOGA 1RW1A 4K5SA 5HR1A 3DVXA 1XWKA 2C0FA 4HJ2A 1SENA 3ZIJA 5AIVA 1SYRA 3CTGA 5GAND 4MF7A 3C1RA 2DC5A 1HNAA 1M3JA 1J08A 1M2AA 4TR1B 1G7EA 3VI7A 2YV9A 3SBCA 1TK0B 4BVXB 4O5QA 4JEDA 1F3AA 1JZRA 4NHZA 1EWXA 1WPIA 2P5QA 4NV2A 5D96A 3DVWA 2D2ZA 1F37A 3IK9A 4MPGA 1PKZA 4G2EA 4KA0A 1ABAA 1FB6A 1GLQA 4EC0A 5LNKe 5DCHA 3GTUA 4NPBA 3LQ7A 1DE1A 4TR3A 2VLTA 2XPEA 2R0GA 3DMLA 2H73A 2VCZA 2GT6A 3APSA 3CSJA 3QD9A 2HYXA 4I2TA 1GTIA 5G1KA 2YNXA 3FZ4A 1E2YA 1YKAA 2HZEB 2OBKA 4MJAA 5D9WA 2KUCA 4MA9A 2DJ1A 2HRFA 4KW6A 3KCMA 5CAXA 1M3IA 2RLIA 1TDIA 2O89A 4KCEA 3ZZXA 4V2NA 3ZL5A 1A0RP 4TXOA 4V2MA 2I9HA 5DALB 4HQSA 4BVYA 4MABA 4TXVA 2F8AA 1OC9A 1FVKA 2V41A 1YZXA 3GKKA 2V32A 3RAZA 2H8LA 4KH7A 4DSRA 4ULXA 5KN0A 11GSA 3RPPA 1IYHA 3L0HA 5ELGA 1CQGA 4GRFA 1T4ZA 3HKRA 5IMFA 4YAVA 1Y6EA 2X8GA 4L0UA 4DVCA 4MMMA 3GYKA 2A4VA 3PINA 3ZRDA 4N30A 3IR4A 1T00A 4MZBA 2C4JA 2GZPA 4RI6A 3CXGA 3FRCA 4YQUA 1T3BA 1Z7PA 3ED3A 4NHWA 3KD0A 3G7YA 1EV9A 1O73A 2DJ2A 3EMPA 1OAZA 2HFDA 4JE1A 2OBIA 1FAAA 3QPMA 5FWGA 3LYPA 1K3YA 4MK3A 4D73A 5HR3A 5HFIA 4E8HA 1GTUA 5IO2A 1YY7A 5ECSA 2GQLA 5EL8A 3ZVJA 1J0FA 1M0UA 2VAFA 3CRTA 3R2QA 4XRAA 1XIYA 5E4WA 3BJ5A 3KXOA 2R4VA 3FR3A 1EOHA 1A8YA 1XW6A 4OCEA 1Z9HA 1YEXA 2A2SA 3EURA 5ECNB 5A4VA 2OKAA 1MDIA 1QK8A 2CAIA 2B5XA 4IJ3A 1V98A 1PKWA 4HU7A 2A2RA 3HA9A 4MJCA 4IS0A 2AUVA 4PURA 1GUHA 3GA4A 3LW9A 3TGZA 2C3NA 4KGIA 2JADA 4ECJA 2H1BA 2YV7A 2YWMA 3TOTA 1GSDA 1TJDA 2K8SA 4ZIJA 2BJXA 3FK8A 5HQPA 2LS5A 5ECLB 4CW9A 2H1GA 1TW9A 1FOHA 5IMVA 1XW9A 3ZYWA 4KAEA 3DIEA 2AV4A 4P3YB 5LCZA 2TRXA 3G7IA 3GRXA 1K0AA 2VL2A 1HNCA 1ERUA 1A8LA 3M1GA 4IGJA 1BJXA 2R37A 2WDUA 1EP8A 3HZ8A 17GSA 2KHPA 3IDVA 3QDNA 6GSWA 2WZ9A 2M72A 3FR6A 1XFLA 1ZGNA 4Z2TA 1CQHA 4QL7A 1XG8A 2F3MA 1XWCA 3KP8A 4BL7B 4MCUA 1YF0A 3G9BA 3E0UA 5COHA 2ZUPA 4K7OA 3GNJA 3KZQA 2HNLA 2YPMA 1B9XC 2J9HA 3ZITA 5IMZA 3VPQA 4G19A 1RK4A 2YWOA 5KN1A 3HDCA 2GQKA 3F3RA 1SL2B 4PQIA 2LSTA 2CQ9A 2FWHA 5J9CA 1VF4A 2EC4A 4XS4A 4WKWA 5ECKB 2EIRA 4PUAA 2MBTA 3F4TA 3I69A 5JWRB 3N5OA 5J9BA 1R26A 3ME8A 4XS1A 3CYNA 2K18A 3CRUA 3LGCA 3W6GA 2XPDA 4KSMA 1A23A 1SKSB 1GUKA 4K7IA 1O81A 2LJAA 1SK2A 1ZMAA 5G5FA 4O5UA 2AHEA 4KCAA 2NBSA 1OE8A 4I8BA 4USSA 3TKQA 3KH9A 3O76A 4K2DA 4EF0A 4ZBBA 4K9ZA 3MDKA 2H6YA 2QC7A 2IFQA 3FY7A 5IOXA 2MYGA 4XIHA 2YN1A 1XPVA 5B8BA 3GTUB 2C0EA 3DWVA 1ILOA 1AQWA 3W8SA 4FO5A 2C3TA 1M7TA 5G5EA 4JZQA 1XOBA 4F2IA 1A2JA 1NHOA 5DQSA 5IMAA 5DAKB 1KNGA 2H76A 1ACVA 4MJBA 2LTKA 1GSSA 3PGTA 2IIYA 1R4WA 3EWLA 2VIMA 1K3OA 5AIXA 2DIZA 3ZFBA 3LJRA 4LA1A 4MH2A 3Q6OA 3UOMA 4ZB8A 2OJLA 2IMDA 9GSSA 1WRYA 3RBTA 4BWQA 2GDRA 2K9FA 1KBNA 5IIZA 4TXOB 1PD21 2FHEA 3MNGA 4BVYB 1XVQA 1NSWA 4A5PA 1AQVA 1OC9B 4ZBDA 1A2LA 1Y25A 3FR9A 4V1Ag 4K7NA 3NOFA 2H0IA 3KP9A 4POLA 4BPYA 3TJKA 4LL4B 2VUPA 5JWQB 1DSBA 3GV1A 1W89A 1QXHA 2A4HA 2DJKA 1GP1A 2YCDA 4POBA 4Q5QA 3KEBA 1JLWA 4V2LA 3VWUA 2GSRA 1PN9A 4K2XA 3MYDA 3EVIA 1B8XA 1W4VA 4EIQA 3KH7A 5ECPB 2LNSA 2VCXA 2E7PA 4D73B 1MDJA 3TRQA 1H4OA 3IK7A 4EVMA 2JZTA 5JWOB 3KM6A 2LJKA 5DQYA 2CX4A 2ALBA 3PH9A 2GS3A 5KOXA 5EVOA 3BOAA 1GULA 1SKWB 1XWBA 2WCIA 1GSUA 4IW9A 1K0CA 3ZFLA 1V9WA 1ON4A 3IC4A 1O8XA 1WIKA 3LWAA 3SWLA 5J41A 2I3YA 3E3EA 3S9FA 5CRDA 2LQOA 2MMZA 3GUSA 2JZRA 4PNFA 3TKSE 1THOA 3F4SA 2ZNMA 3QFBC 4XHMA 3ISOA 4YKFA 4NV5A 5FHIA 4EIPA 1YEPA 1NHYA 2LRNA 2L5LA 3UMAA 5ECIB 4GWRA 2UZ8A 1GSFA 5HR2A 2GQMA 1OYJA 2FD3A 3TJJA 4G0LA 3VFIA 2B3SA 2HSMA 2VLVA 4IKHA 5D9VA 5CYYA 1LBKA 4NAXA 1Z5YE 2P5RA 3HYPA 3P8WA 2VO4A 4XRDA 1N8JA 4DSSA 4ZBAA 3CQFA 5AGYA 5JCUA 4I5QA 2F8FA 2HE3A 4H86A 1J9BA 2A2PA 4MJEA 3QOUA 4TN8A 2I1UA 3HVNA 1GSEA 1X9MB 1FVJA 2ON5A 4GSTA 1K0BA 1ZL9A 2IL3A 3A2VA 1TK5B 1TI1A 3ERWA 5DCGA 3WGEA 3O3TA 3CTFA 3LXTA 2H66A 3UBLA 2B5YA 1Z6MA 4ML6A 4EL1A 4XS4B 1F2EA 3F6FA 5F8BA 1K0MA 2LNTA 1UN2A 4Z7XA 2R5GA 5CREA 5AISA 3TOUA 4CY6A 2GLRA 1B4QA 4OFNA 1G7OA 2PN8A 3HJPA 2ON7A 5KN2A 20GSA 2E2GA 3FHKA 2CT6A 2AB6A 1VGLA 1WOUA 2NTOA 2IN3A 2PUKC 19GSA 1ERWA 2VM2A 4RI7A 4EO3A 2YWIA 4KE3A 4X43A 1NW2A 4F03A 2LRTA 5F05A 3H93A 1X5DA 4YAPA 3NZNA 1ZYPA 4K8MA 2IFQB 4OD7A 5KN3A 5A5KA 4I2UA 2WGRA 1C72A 3CSHA 1X9WB 1DBYA 4HOJA 2H1DA 1MD4A 3OR5A 2GTUA 4Q5NA 3F6DA 2LEGA 3JCML 1GTAA 3WYWA 2IMIA 2YJHA 2B7JA 2FWEA 3ERFA 6GSVA 4OO5A 4DEJA 4TOPA 2PGTA 3VPTA 3P7XA 1TP9A 2O87A 5A4UA 4NWYA 3D5JA 2C3QA 1M2DA 5E59A 4EKZA 2H19A 1H75A 2WB9A 1OVNA 4EDYA 1FOVA 3NIVA 2X64A 1PX7A 2MMNA 3KTBA 1T4YA 3FMWA 4ECCA 5DDLA 1ML6A 3EMXA 2LKUA 3IAM2 1AW9A 2CA8A 3M9JA 5GZZB 3MIXA 2FA4A 1YKCA 1XCCA 4HZ2A 1G0TA 1MEKA 1I5GA 5DJMA 1ZCPA 2H30A 2XBQA 5J5NA 4TR4A 2IMKA 1BEDA 2HRKA 4POMA 1YQ1A 3UARA 4YKGA 4X0XA 4HZ4A 3RHCA 4G0KA 3VWXA 4TKYA 1AUCA 4PQHA 2CVDA 2KP1A 2C1YA 2R0PA 2M80A 4EUYA 1S3CA 4EE0A 4EDZA 1TRSA 5C00A 1THXA 4FH8A 1GLPA 4KX4A 1ZZYA 3H79A 4ECIA 4WETA 1OKDA 1SJ6A 3EE2A 1A2MA 4J2FA 1Z6NA 2TRCP 5CO3A 1BAYA 1O8WA 4V1Ap 3U6VA 4GCIA 3WT1A 2FNOA 1UC7A 2JACA 2OACA 1G6WA 2DIYA 4JRRA 2VCQA 3IOSA 4KNDA 4TVEA 1XZOA 2M46A 4AF2A 2YANA 3M8NA 5LD0A 3HXSA 1MDKA 2GSQA 5HFGA 4PTSA 1A24A 4MF5A 2ZCTA 5L71A 4K0NA 2X49A 3TKSC 22GSA 3HZ4A 3GX8A 3MAKA 2QKEA 3H4KA 1IYIA 1BYEA 1UVZA 4K1FA 3US3A 3ZMKA 4PGTA 2DSAA 1U6TA 2O8VB 1X5EA 2MMAA 2HLSA 1R7HA 5ECRB 3ME7A 2L5OA 3IHGA 3L9VA 1BX9A 1X0RA 4ZB6A 3FW2A 1GRXA 5FT3A 1XWAA 2I81A 1ZYEA 1SK1A 3Q19A 4GTUA 5HR0A 1EV4A 4KF9A 2GSSA 3GFKA 3BCIA 3EU4A 1PL2A 4IELA 4GQFA 3GKNA 3GL5A 3IV4A 4IJIA 1JLVA 4O7HA 4EXJA 1PMTA 1GL8A 2VM1A 2BTOT 2H6ZA 4OO4A 2YOIA 3QFAC 3TJGA 3MWHA 2BMXA 1AXDA 3Q18A 1U3IA 3K8NA 4N10A 4HI7A 2TIRA 3APOA 5GSSA 2EIQA 3F8UA 3LXZA 1FG4A 1QFNA 4ID0A 5D8IA 3I6AA 1SYXA 1U3AA 3VLNA 4FYUA 3APQA 3KTLA 3GH9A 4LMVA 5H5SA 2QSIA 3TKPA 4L0WA 3QMXA 1PSQA 2O85A 2PMTA 1F3BA 3C71A 2HSYA 2L4QA 5EPFA 1PX6A 4BWSA 2HT9A 3DD3A 2N5AA 2HSHA 3ZREA 8GSSA 2H6XA 1TK8B 1XOAA 2H0GA 2H1AA 4IHUA 1QUWA 3D4MA 5F07A 2H71A 3D0ZA 3KMOA 2FA8A 4MPFA 2V6KA 3FEUA 2N5BA 2PBJA 2CZ3A 1PRXA 5A4WA 3EC3A 5ECOB 2JSZA 2YZHA 6GSUA 3UVTA 2VD0A 4IVFA 3O6TA 3A5WA 4HU9A 2GZZA 5ELAA 4LLRA 1GSYA 1TRWA 2HI7A 5D9XA 1R5PA 2VD1A 1G6YA 2AYTA 2HRAA 3DXBA 1TU7A 2K8VA 13GSA 1SL0B 4BIKA 1V2AA 3U5RE 3EU3A 4K6XA 6GSTA 3UIWA 4MP4A 3TRPA 5GSTA 5EY6A 1Z7RA 5B8AA 4PUFC 3D22A 3LG6A 3M3MA 3GX0A 1AAZA 2FGXA 3A3TA 3P90A 2H75A 1GWCA 3QR6A 5H5RA 1XW5A 4ECBA 5BMUA 16GSA 1PFOA 2WJUA 2H01A 5ID2A 1SK0A 3C8EA 4F82A 1EEMA 4YQMA 3LSZA 2C0GA 2DMMA 3LYKA 4MNNA 3WGDA 4FYBA 5IMCA 1VRSD 3I9V2 2DJJA 3DGQA 3ERGA 2GT5A 4HDEA 3ZVJD 1EP7A 1B4PA 5J4UA 1RQMA 1HQOA 1QMVA 2CX3A 4JR6A 3TKRA 3UL3A 4RQRA 2IWTA 4ZXGA 1M9AA 2DJ0A 10GSA 4HEA2 2FWFA 5G1LA 4IQ1A 2RM5A 1GSQA 3GKMA 1AC1A 2E2MA 2VCTA 1QGVA 5CP1A 4N11A 1ERTA 4RUVA 3UAPA 1V58A 3HD5A 3IXRA 4L8EA 1FB0A 1EGOA 2H0HA 1WE0A 2G2QA 2DLXA 3PPUA 1SJZA 2YJ7A 2FLSA 4O5RA 1TI3A 2N5FA 3L9SA 4MLYA 3L9UA 2VL9A 2GGTA 2GSTA 3BD2A 2JL4A 1EGRA 4KUNA 1PA3A 2HXKA 2DKIA 5B6MA 4WBRD 1FHEA 5C04A 5ECHB 1JHBA 2OE3A 3IA1A 3VI5A 3F3QA 1XBSA 1VF1A 5ABRA 1B48A 1GTBA 4AJ6A 2VOCA 4GXZA 4PXOA 1EZKA 4X1UA 5CRWA 4ISDA 2AJQB 3IPZA 5G31A 2FY6A 3MSZA 5F06A 4JBBA 1TRVA 2VCVA 1Q4JA 1SD9A 3A2XA 2LV3A 2DJ3A 4N0VA 3GSTA
chains in the Genus database with same CATH topology
4F0BA 1T1VA 4N0ZA 2CV4A 3TJFA 2F51A 1U88A 3TDGA 2C80A 2JU5A 4CHSA 3D4TA 1TRUA 1XWGA 1TKDB 5DAKA 3I43A 3HHVA 2AAWA 1HYUA 1S3AA 3FKFA 3PR8A 1AQXA 4JR4A 4G10A 4WF5A 2B1LA 4KDXA 5IOWA 4YQVA 3IRAA 1WWJA 5HFKA 2CAQA 3LFLA 3FZ5A 3TUEA 3ZMLA 5IPGA 4HS1A 4WBJA 1SL1B 4ICYA 4IP6A 3RDWA 1Q98A 2CVKA 4HQZA 4ILFA 1M99A 2VL2C 4K0GA 4WEYA 4AJ8A 2RIIA 7GSSA 2OA7A 4AGSA 2PU9C 3ZIVA 3BCKA 1LU4A 2NVLA 2V2GA 4J57E 2LRCA 3ZTLA 5KEJA 4IN0A 4FQUA 1I9DA 3HVXA 4L5OA 5ENUA 1JFUA 1WJKA 2DMLA 2R0CA 1QQ2A 5D9TA 3TJBA 2DBCA 1ERVA 2L6CA 1Z3EA 1E6BA 1GUMA 1MTCA 2DKHA 12GSA 2L6DA 3FZ9A 1U87A 4NXIA 1XVWA 2HRNA 5JCGA 3VWVA 2VCWA 4ZL7A 4HUAA 2QA2A 1O85A 4ML1A 3W8JA 5DBQA 2FUG2 2O7KA 3IHQA 4XTSA 3IC8A 5B6NA 2MBSA 2QGVA 3R3EA 4MZCA 4WR5A 1YF1A 1BG5A 1K0DA 1URMA 1K0NA 1WMJA 1VF3A 4KDUA 4G9HA 5IQYA 4IQAA 2WS2A 2H72A 2GZYA 2P31A 2RUFA 1HD2A 3KJYA 4KDYA 4AJ7A 2B1KA 1OE7A 3F63A 4QQ7A 1K3LA 1V57A 3IBHA 3D6IA 3V1WA 3Q74A 1FO5A 1B9YC 3GSSA 3GHAA 5KOWA 3DKSA 1ZOFA 4E8EA 4GSNA 14GSA 4MH3A 1O6JA 2YZUA 5ID2B 2JZSA 3LORA 2IPAA 3DYRA 5IO0A 5GAPD 4BA7A 1SU9A 3C1SA 3BBYA 2X8CA 1UA5A 1K0OA 2E0QA 2IMEA 4QL9A 3GMFA 3J7Yb 5AN1A 3EINA 4NMUA 5F0GA 1SKRB 5D93A 3VWWA 3EYTA 2MMOA 3P2AA 4PNGA 6GSXA 1KEBA 2X4AA 4LL1B 5IM9A 4KSOA 3VURA 2X8HA 1WP0A 4TR1A 1YDKA 2K6VA 1USBA 4OFTA 2JSYA 4DSSB 1JZDA 2FCHA 4TRXA 5BRTA 4BVXA 3D21A 3A5IA 3G7JA 1X9SB 4MF6A 3TCOA 1X5CA 2MZCA 3WT2A 5JCWA 1XXUA 2B5EA 4F0CA 1GNEA 3A2WA 3GURA 1JZOA 4G0IA 3KIJA 2GVPA 2PERA 4I97A 1KTEA 2L57A 4IP1A 2PVOC 4GSSA 2H70A 1FW1A 4KB3A 2C8UA 3FYGA 2HZFA 1ST9A 2V1MA 2HZEA 3WD6A 1GNWA 1NM3A 2KOKA 4OMVA 3TRXA 6GSSA 2PPTA 4ZL8A 2XHFA 2IMFA 3C73A 3DEXA 3HCZA 3HJOA 2H74A 2R2JA 1PQNA 5DALA 1R5AA 1DUGA 3F0IA 2VL3A 4MDCA 1TU8A 2B6MA 1PL1A 2XBIA 4O32A 4Q5FA 4Z2RA 4GF0A 5H5QA 5CRGA 2PVQA 2NPBA 5ECQB 4L5LA 3HJMA 5J3RA 2L4CA 2C0DA 4IBPA 2FWGA 4K5RA 3VK9A 1LJRA 2LUSA 1T7PB 2X99A 4CY8A 3TKSA 5G30A 4HJMA 5IPHA 4JU5A 4XS6A 4TW5A 4YH2A 1TXXA 4CDOA 3UEMA 1F6MC 2YP6A 1PN0A 2L59A 1SJIA 3HVSA 4WR4A 1O7UA 2R3XA 3TB2A 4Z2UA 4GQCA 1S3DA 2F9SA 4TR0A 5INYA 2EIOA 3IE3A 3CMIA 3LEFA 4LMWA 2YWNA 3UJ1A 5DVBA 1M2BA 2REMA 2OE0A 3FZAA 4RQXA 3KGKA 4O92A 1MD3A 1SD8A 2ES7A 4ZB9A 4GLTA 4XCSA 1ZYNA 18GSA 2B7KA 1F9MA 2R6KA 5CRHA 5G2ZA 4OFMA 4I6XA 2VLUA 3GIXA 3L4NA 3N9JA 4ZILA 1TOFA 5ECMB 2PWJA 2V6OA 3M0FA 3WGXA 1OC8A 3M9KA 3QCPA 5DJLA 1TTZA 5B7CA 3J7Yk 3RPNA 3E9JB 1BQ7A 4PX1A 1AIUA 4WXTA 2XC2A 1OKTA 3GH6A 1GH2A 2RUEA 2WULA 2KP2A 4OWYA 4FYCA 1YJ6A 2WFCA 3EPTA 4POKA 4J56E 3AY8A 1N2AA 3KMNA 3GKXA 4Q5RA 3HVVA 5D73A 3HY2A 2IJYA 3L78A 1VF2A 3QAWA 3GL3A 3DRNA 1T8EB 1ZYQB 4WF4A 4DSQA 3F9UA 1JZWA 3QAVA 4ZL9A 1M9BA 3C7MA 3H1NA 1DE2A 2OADA 2QA1A 3CBUA 3F4RA 3H8QA 2WRTA 4PQ1A 2CVBA 2LQQA 3QAGA 3UBKA 1OC3A 2J23A 4F9ZA 2G0FA 4FIWA 3RHBA 4BL7A 2OE1A 1PGTA 6GSYA 2P0GA 2RM6A 3CSIA 5IMDA 5CNWA 2Z9SA 3IAS2 4OCFA 4MZWA 1A0FA 3ZLPA 1EEJA 2KLXA 2NDOA 4ACSA 1V40A 2I4AA 2CZ2A 4X4JA 2LJRA 3GN3A 1HNBA 3UVHA 1EOGA 1RW1A 4K5SA 5HR1A 3DVXA 1XWKA 2C0FA 4HJ2A 1SENA 3ZIJA 5AIVA 1SYRA 3CTGA 5GAND 4MF7A 3C1RA 2DC5A 1HNAA 1J08A 1M2AA 4TR1B 1G7EA 3VI7A 2YV9A 3SBCA 1TK0B 4BVXB 4O5QA 4JEDA 1F3AA 1JZRA 4NHZA 1EWXA 1WPIA 2P5QA 4NV2A 5D96A 3DVWA 2D2ZA 1F37A 3IK9A 4MPGA 1PKZA 4G2EA 4KA0A 1ABAA 1FB6A 1GLQA 4EC0A 5LNKe 5DCHA 3GTUA 4NPBA 3LQ7A 1DE1A 4TR3A 2VLTA 2XPEA 2R0GA 3DMLA 2H73A 2VCZA 2GT6A 3APSA 3CSJA 3QD9A 2HYXA 4I2TA 1GTIA 5G1KA 2YNXA 3FZ4A 1E2YA 1YKAA 2HZEB 2OBKA 4MJAA 5D9WA 2KUCA 4MA9A 2DJ1A 2HRFA 4KW6A 3KCMA 5CAXA 2RLIA 1TDIA 2O89A 4KCEA 3ZZXA 4V2NA 3ZL5A 1A0RP 4TXOA 4V2MA 2I9HA 5DALB 4HQSA 4BVYA 4MABA 4TXVA 2F8AA 1OC9A 1FVKA 2V41A 1YZXA 3GKKA 2V32A 3RAZA 2H8LA 4KH7A 4DSRA 4ULXA 5KN0A 11GSA 3RPPA 1IYHA 3L0HA 5ELGA 1CQGA 4GRFA 1T4ZA 3HKRA 5IMFA 4YAVA 1Y6EA 2X8GA 4L0UA 4DVCA 4MMMA 3GYKA 2A4VA 3PINA 3ZRDA 4N30A 3IR4A 1T00A 4MZBA 2C4JA 2GZPA 4RI6A 3CXGA 3FRCA 4YQUA 1T3BA 1Z7PA 3ED3A 4NHWA 3KD0A 3G7YA 1EV9A 1O73A 2DJ2A 3EMPA 1OAZA 2HFDA 4JE1A 2OBIA 1FAAA 3QPMA 5FWGA 3LYPA 1K3YA 4MK3A 4D73A 5HR3A 5HFIA 4E8HA 1GTUA 5IO2A 1YY7A 5ECSA 2GQLA 5EL8A 3ZVJA 1J0FA 1M0UA 2VAFA 3CRTA 3R2QA 4XRAA 1XIYA 5E4WA 3BJ5A 3KXOA 2R4VA 3FR3A 1EOHA 1A8YA 1XW6A 4OCEA 1Z9HA 1YEXA 2A2SA 3EURA 5ECNB 5A4VA 2OKAA 1MDIA 1QK8A 2CAIA 2B5XA 4IJ3A 1V98A 1PKWA 4HU7A 2A2RA 3HA9A 4MJCA 4IS0A 2AUVA 4PURA 1GUHA 3GA4A 3LW9A 3TGZA 2C3NA 4KGIA 2JADA 4ECJA 2H1BA 2YV7A 2YWMA 3TOTA 1GSDA 1TJDA 2K8SA 4ZIJA 2BJXA 3FK8A 5HQPA 2LS5A 5ECLB 4CW9A 2H1GA 1TW9A 1FOHA 5IMVA 1XW9A 3ZYWA 4KAEA 3DIEA 2AV4A 4P3YB 5LCZA 2TRXA 3G7IA 3GRXA 1K0AA 2VL2A 1HNCA 1ERUA 1A8LA 3M1GA 4IGJA 1BJXA 2R37A 2WDUA 1EP8A 3HZ8A 17GSA 2KHPA 3IDVA 3QDNA 6GSWA 2WZ9A 2M72A 3FR6A 1XFLA 1ZGNA 4Z2TA 1CQHA 4QL7A 2F3MA 1XWCA 3KP8A 4BL7B 4MCUA 1YF0A 3G9BA 3E0UA 5COHA 2ZUPA 4K7OA 3GNJA 3KZQA 2HNLA 2YPMA 1B9XC 2J9HA 3ZITA 5IMZA 3VPQA 4G19A 1RK4A 2YWOA 5KN1A 3HDCA 2GQKA 3F3RA 1SL2B 4PQIA 2LSTA 2CQ9A 2FWHA 5J9CA 1VF4A 2EC4A 4XS4A 4WKWA 5ECKB 2EIRA 4PUAA 2MBTA 3F4TA 3I69A 5JWRB 3N5OA 5J9BA 1R26A 3ME8A 4XS1A 3CYNA 2K18A 3CRUA 3LGCA 3W6GA 2XPDA 4KSMA 1A23A 1SKSB 1GUKA 4K7IA 1O81A 2LJAA 1SK2A 1ZMAA 5G5FA 4O5UA 2AHEA 4KCAA 2NBSA 1OE8A 4I8BA 4USSA 3TKQA 3KH9A 3O76A 4K2DA 4EF0A 4ZBBA 4K9ZA 3MDKA 2H6YA 2QC7A 2IFQA 3FY7A 5IOXA 2MYGA 4XIHA 2YN1A 1XPVA 5B8BA 3GTUB 2C0EA 3DWVA 1ILOA 1AQWA 3W8SA 4FO5A 2C3TA 1M7TA 5G5EA 4JZQA 1XOBA 4F2IA 1A2JA 1NHOA 5DQSA 5IMAA 5DAKB 1KNGA 2H76A 1ACVA 4MJBA 2LTKA 1GSSA 3PGTA 2IIYA 1R4WA 3EWLA 2VIMA 1K3OA 5AIXA 2DIZA 3ZFBA 3LJRA 4LA1A 4MH2A 3Q6OA 3UOMA 4ZB8A 2OJLA 2IMDA 9GSSA 1WRYA 3RBTA 4BWQA 2GDRA 2K9FA 1KBNA 5IIZA 4TXOB 1PD21 2FHEA 3MNGA 4BVYB 1XVQA 1NSWA 4A5PA 1AQVA 1OC9B 4ZBDA 1A2LA 1Y25A 3FR9A 4V1Ag 4K7NA 3NOFA 2H0IA 3KP9A 4POLA 4BPYA 3TJKA 4LL4B 2VUPA 5JWQB 1DSBA 3GV1A 1W89A 1QXHA 2A4HA 2DJKA 1GP1A 2YCDA 4POBA 4Q5QA 3KEBA 1JLWA 4V2LA 3VWUA 2GSRA 1PN9A 4K2XA 3MYDA 3EVIA 1B8XA 1W4VA 4EIQA 3KH7A 5ECPB 2LNSA 2VCXA 2E7PA 4D73B 1MDJA 3TRQA 1H4OA 3IK7A 4EVMA 2JZTA 5JWOB 3KM6A 2LJKA 5DQYA 2CX4A 2ALBA 3PH9A 2GS3A 5KOXA 5EVOA 3BOAA 1GULA 1SKWB 1XWBA 2WCIA 1GSUA 4IW9A 1K0CA 3ZFLA 1V9WA 1ON4A 3IC4A 1O8XA 1WIKA 3LWAA 3SWLA 5J41A 2I3YA 3E3EA 3S9FA 5CRDA 2LQOA 2MMZA 3GUSA 2JZRA 4PNFA 3TKSE 1THOA 3F4SA 2ZNMA 3QFBC 4XHMA 3ISOA 4YKFA 4NV5A 5FHIA 4EIPA 1YEPA 1NHYA 2LRNA 2L5LA 3UMAA 5ECIB 4GWRA 2UZ8A 1GSFA 5HR2A 2GQMA 1OYJA 2FD3A 3TJJA 4G0LA 3VFIA 2B3SA 2HSMA 2VLVA 4IKHA 5D9VA 5CYYA 1LBKA 4NAXA 1Z5YE 2P5RA 3HYPA 3P8WA 2VO4A 4XRDA 1N8JA 4DSSA 4ZBAA 5AGYA 5JCUA 4I5QA 2F8FA 2HE3A 4H86A 1J9BA 2A2PA 4MJEA 3QOUA 4TN8A 2I1UA 1GSEA 1X9MB 1FVJA 2ON5A 4GSTA 1K0BA 1ZL9A 2IL3A 3A2VA 1TK5B 1TI1A 3ERWA 5DCGA 3WGEA 3O3TA 3CTFA 3LXTA 2H66A 3UBLA 2B5YA 1Z6MA 4ML6A 4EL1A 4XS4B 1F2EA 3F6FA 5F8BA 1K0MA 2LNTA 1UN2A 4Z7XA 2R5GA 5CREA 5AISA 3TOUA 4CY6A 2GLRA 1B4QA 4OFNA 1G7OA 2PN8A 3HJPA 2ON7A 5KN2A 20GSA 2E2GA 3FHKA 2CT6A 2AB6A 1VGLA 1WOUA 2NTOA 2IN3A 2PUKC 19GSA 1ERWA 2VM2A 4RI7A 4EO3A 2YWIA 4KE3A 4X43A 1NW2A 4F03A 2LRTA 5F05A 3H93A 1X5DA 4YAPA 3NZNA 1ZYPA 4K8MA 2IFQB 4OD7A 5KN3A 5A5KA 4I2UA 2WGRA 1C72A 3CSHA 1X9WB 1DBYA 4HOJA 2H1DA 1MD4A 3OR5A 2GTUA 4Q5NA 3F6DA 2LEGA 3JCML 1GTAA 3WYWA 2IMIA 2YJHA 2B7JA 2FWEA 3ERFA 6GSVA 4OO5A 4DEJA 4TOPA 2PGTA 3VPTA 3P7XA 1TP9A 2O87A 5A4UA 4NWYA 3D5JA 2C3QA 1M2DA 5E59A 4EKZA 2H19A 1H75A 2WB9A 1OVNA 4EDYA 1FOVA 3NIVA 2X64A 1PX7A 2MMNA 3KTBA 1T4YA 3FMWA 4ECCA 5DDLA 1ML6A 3EMXA 2LKUA 3IAM2 1AW9A 2CA8A 3M9JA 5GZZB 3MIXA 2FA4A 1YKCA 1XCCA 4HZ2A 1G0TA 1MEKA 1I5GA 5DJMA 1ZCPA 2H30A 2XBQA 5J5NA 4TR4A 2IMKA 1BEDA 2HRKA 4POMA 1YQ1A 3UARA 4YKGA 4X0XA 4HZ4A 3RHCA 4G0KA 3VWXA 4TKYA 1AUCA 4PQHA 2CVDA 2KP1A 2C1YA 2R0PA 2M80A 4EUYA 1S3CA 4EE0A 4EDZA 1TRSA 5C00A 1THXA 4FH8A 1GLPA 4KX4A 1ZZYA 3H79A 4ECIA 4WETA 1OKDA 1SJ6A 3EE2A 1A2MA 4J2FA 1Z6NA 2TRCP 5CO3A 1BAYA 1O8WA 4V1Ap 3U6VA 4GCIA 3WT1A 2FNOA 1UC7A 2JACA 2OACA 1G6WA 2DIYA 4JRRA 2VCQA 3IOSA 4KNDA 4TVEA 1XZOA 2M46A 4AF2A 2YANA 3M8NA 5LD0A 3HXSA 1MDKA 2GSQA 5HFGA 4PTSA 1A24A 4MF5A 2ZCTA 5L71A 4K0NA 2X49A 3TKSC 22GSA 3HZ4A 3GX8A 3MAKA 2QKEA 3H4KA 1IYIA 1BYEA 1UVZA 4K1FA 3US3A 3ZMKA 4PGTA 2DSAA 1U6TA 2O8VB 1X5EA 2MMAA 2HLSA 1R7HA 5ECRB 3ME7A 2L5OA 3IHGA 3L9VA 1BX9A 1X0RA 4ZB6A 3FW2A 1GRXA 5FT3A 1XWAA 2I81A 1ZYEA 1SK1A 3Q19A 4GTUA 5HR0A 1EV4A 4KF9A 2GSSA 3GFKA 3BCIA 3EU4A 1PL2A 4IELA 4GQFA 3GKNA 3GL5A 3IV4A 4IJIA 1JLVA 4O7HA 4EXJA 1PMTA 1GL8A 2VM1A 2BTOT 2H6ZA 4OO4A 2YOIA 3QFAC 3TJGA 3MWHA 2BMXA 1AXDA 3Q18A 1U3IA 3K8NA 4N10A 4HI7A 2TIRA 3APOA 5GSSA 2EIQA 3F8UA 3LXZA 1FG4A 1QFNA 4ID0A 5D8IA 3I6AA 1SYXA 1U3AA 3VLNA 4FYUA 3APQA 3KTLA 3GH9A 4LMVA 5H5SA 2QSIA 3TKPA 4L0WA 3QMXA 1PSQA 2O85A 2PMTA 1F3BA 3C71A 2HSYA 2L4QA 5EPFA 1PX6A 4BWSA 2HT9A 3DD3A 2N5AA 2HSHA 3ZREA 8GSSA 2H6XA 1TK8B 1XOAA 2H0GA 2H1AA 4IHUA 1QUWA 3D4MA 5F07A 2H71A 3D0ZA 3KMOA 2FA8A 4MPFA 2V6KA 3FEUA 2N5BA 2PBJA 2CZ3A 1PRXA 5A4WA 3EC3A 5ECOB 2JSZA 2YZHA 6GSUA 3UVTA 2VD0A 4IVFA 3O6TA 3A5WA 4HU9A 2GZZA 5ELAA 4LLRA 1GSYA 1TRWA 2HI7A 5D9XA 1R5PA 2VD1A 1G6YA 2AYTA 2HRAA 3DXBA 1TU7A 2K8VA 13GSA 1SL0B 1V2AA 3U5RE 3EU3A 4K6XA 6GSTA 3UIWA 4MP4A 3TRPA 5GSTA 5EY6A 1Z7RA 5B8AA 4PUFC 3D22A 3LG6A 3M3MA 3GX0A 1AAZA 2FGXA 3A3TA 3P90A 2H75A 1GWCA 3QR6A 5H5RA 1XW5A 4ECBA 5BMUA 16GSA 2WJUA 2H01A 5ID2A 1SK0A 3C8EA 4F82A 1EEMA 4YQMA 3LSZA 2C0GA 2DMMA 3LYKA 4MNNA 3WGDA 4FYBA 5IMCA 1VRSD 3I9V2 2DJJA 3DGQA 3ERGA 2GT5A 4HDEA 3ZVJD 1EP7A 1B4PA 5J4UA 1RQMA 1HQOA 1QMVA 2CX3A 4JR6A 3TKRA 3UL3A 4RQRA 2IWTA 4ZXGA 1M9AA 2DJ0A 10GSA 4HEA2 2FWFA 5G1LA 4IQ1A 2RM5A 1GSQA 3GKMA 1AC1A 2E2MA 2VCTA 1QGVA 5CP1A 4N11A 1ERTA 4RUVA 3UAPA 1V58A 3HD5A 3IXRA 4L8EA 1FB0A 1EGOA 2H0HA 1WE0A 2G2QA 2DLXA 3PPUA 1SJZA 2YJ7A 2FLSA 4O5RA 1TI3A 2N5FA 3L9SA 4MLYA 3L9UA 2VL9A 2GGTA 2GSTA 3BD2A 2JL4A 1EGRA 4KUNA 1PA3A 2HXKA 2DKIA 5B6MA 4WBRD 1FHEA 5C04A 5ECHB 1JHBA 2OE3A 3IA1A 3VI5A 3F3QA 1XBSA 1VF1A 5ABRA 1B48A 1GTBA 4AJ6A 2VOCA 4GXZA 4PXOA 1EZKA 4X1UA 5CRWA 4ISDA 2AJQB 3IPZA 5G31A 2FY6A 3MSZA 5F06A 4JBBA 1TRVA 2VCVA 1Q4JA 1SD9A 3A2XA 2LV3A 2DJ3A 4N0VA 3GSTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F0B A;  1T1V A;  4N0Z A;  2CV4 A;  3TJF A;  2F51 A;  1U88 A;  3TDG A;  2C80 A;  2JU5 A;  4CHS A;  3D4T A;  1TRU A;  1XWG A;  1TKD B;  5DAK A;  3I43 A;  3HHV A;  2AAW A;  1HYU A;  1S3A A;  3FKF A;  3PR8 A;  1AQX A;  4JR4 A;  4G10 A;  4WF5 A;  2B1L A;  4KDX A;  5IOW A;  4YQV A;  3IRA A;  1WWJ A;  5HFK A;  2CAQ A;  3LFL A;  3FZ5 A;  3TUE A;  3ZML A;  5IPG A;  4HS1 A;  4WBJ A;  1SL1 B;  4IP6 A;  3RDW A;  1Q98 A;  2CVK A;  4HQZ A;  4ILF A;  1M99 A;  2VL2 C;  4K0G A;  4WEY A;  4AJ8 A;  2RII A;  7GSS A;  2OA7 A;  4AGS A;  2PU9 C;  3ZIV A;  3BCK A;  1LU4 A;  2NVL A;  2V2G A;  4J57 E;  2LRC A;  3ZTL A;  5KEJ A;  4IN0 A;  1I9D A;  3HVX A;  4L5O A;  5ENU A;  1JFU A;  1WJK A;  2DML A;  1QQ2 A;  5D9T A;  3TJB A;  2DBC A;  1ERV A;  2L6C A;  1Z3E A;  1E6B A;  1GUM A;  1MTC A;  12GS A;  2L6D A;  3FZ9 A;  1U87 A;  4NXI A;  1XVW A;  2HRN A;  5JCG A;  3VWV A;  2VCW A;  4ZL7 A;  4HUA A;  4ML1 A;  1O85 A;  3W8J A;  5DBQ A;  2FUG 2;  2O7K A;  3IHQ A;  4XTS A;  5B6N A;  2MBS A;  2QGV A;  4MZC A;  4WR5 A;  1YF1 A;  1BG5 A;  1K0D A;  1URM A;  1K0N A;  1WMJ A;  1VF3 A;  4KDU A;  4G9H A;  5IQY A;  4IQA A;  2WS2 A;  2H72 A;  2GZY A;  2P31 A;  2RUF A;  1HD2 A;  3KJY A;  4KDY A;  4AJ7 A;  2B1K A;  1OE7 A;  3F63 A;  4QQ7 A;  1K3L A;  1V57 A;  3IBH A;  3D6I A;  3V1W A;  3Q74 A;  1FO5 A;  1B9Y C;  3GSS A;  3GHA A;  3DKS A;  1ZOF A;  4E8E A;  4GSN A;  14GS A;  4MH3 A;  1O6J A;  2YZU A;  5ID2 B;  2JZS A;  3LOR A;  2IPA A;  3DYR A;  5IO0 A;  5GAP D;  4BA7 A;  1SU9 A;  3C1S A;  3BBY A;  2X8C A;  1UA5 A;  1K0O A;  2E0Q A;  2IME A;  4QL9 A;  3GMF A;  3J7Y b;  5AN1 A;  3EIN A;  4NMU A;  5F0G A;  1SKR B;  5D93 A;  3VWW A;  3EYT A;  2MMO A;  3P2A A;  4PNG A;  6GSX A;  1KEB A;  4LL1 B;  5IM9 A;  4KSO A;  3VUR A;  2X8H A;  1WP0 A;  4TR1 A;  1YDK A;  2K6V A;  1USB A;  4OFT A;  2JSY A;  4DSS B;  1JZD A;  2FCH A;  4TRX A;  4BVX A;  3D21 A;  3G7J A;  1X9S B;  4MF6 A;  3TCO A;  1X5C A;  2MZC A;  3WT2 A;  5JCW A;  1XXU A;  2B5E A;  4F0C A;  1GNE A;  3A2W A;  3GUR A;  1JZO A;  3KIJ A;  2GVP A;  2PER A;  4I97 A;  1KTE A;  2L57 A;  4IP1 A;  2PVO C;  4GSS A;  2H70 A;  1FW1 A;  4KB3 A;  2C8U A;  3FYG A;  2HZF A;  1ST9 A;  2V1M A;  2HZE A;  3WD6 A;  1GNW A;  1NM3 A;  2KOK A;  4OMV A;  3TRX A;  6GSS A;  2PPT A;  4ZL8 A;  2XHF A;  2IMF A;  3C73 A;  3DEX A;  3HCZ A;  3HJO A;  2H74 A;  2R2J A;  1PQN A;  5DAL A;  1R5A A;  1DUG A;  3F0I A;  2VL3 A;  4MDC A;  1TU8 A;  2B6M A;  1PL1 A;  2XBI A;  4O32 A;  4Q5F A;  4GF0 A;  5H5Q A;  5CRG A;  2PVQ A;  2NPB A;  5ECQ B;  4L5L A;  3HJM A;  5J3R A;  2L4C A;  2C0D A;  4IBP A;  2FWG A;  3VK9 A;  1LJR A;  2LUS A;  1T7P B;  2X99 A;  3TKS A;  5G30 A;  4HJM A;  5IPH A;  4JU5 A;  4XS6 A;  4TW5 A;  4YH2 A;  1TXX A;  4CDO A;  3UEM A;  1F6M C;  2YP6 A;  2L59 A;  1SJI A;  3HVS A;  4WR4 A;  1O7U A;  2R3X A;  3TB2 A;  4GQC A;  1S3D A;  2F9S A;  4TR0 A;  5INY A;  2EIO A;  3IE3 A;  3CMI A;  3LEF A;  4LMW A;  2YWN A;  3UJ1 A;  5DVB A;  1M2B A;  2REM A;  2OE0 A;  3FZA A;  4RQX A;  3KGK A;  4O92 A;  1MD3 A;  1SD8 A;  2ES7 A;  4ZB9 A;  4GLT A;  4XCS A;  18GS A;  2B7K A;  1F9M A;  2R6K A;  5CRH A;  5G2Z A;  4OFM A;  4I6X A;  2VLU A;  3GIX A;  3L4N A;  3N9J A;  4ZIL A;  1TOF A;  5ECM B;  2PWJ A;  2V6O A;  3M0F A;  3WGX A;  1OC8 A;  3M9K A;  3QCP A;  5DJL A;  1TTZ A;  5B7C A;  3J7Y k;  3RPN A;  3E9J B;  1BQ7 A;  4PX1 A;  1AIU A;  4WXT A;  2XC2 A;  1OKT A;  3GH6 A;  1GH2 A;  2RUE A;  2WUL A;  2KP2 A;  4OWY A;  4FYC A;  1YJ6 A;  2WFC A;  4POK A;  4J56 E;  3AY8 A;  1N2A A;  3KMN A;  3GKX A;  4Q5R A;  3HVV A;  5D73 A;  3HY2 A;  2IJY A;  3L78 A;  1VF2 A;  3QAW A;  3GL3 A;  3DRN A;  1T8E B;  1ZYQ B;  4WF4 A;  4DSQ A;  3F9U A;  1JZW A;  3QAV A;  4ZL9 A;  1M9B A;  3C7M A;  3H1N A;  1DE2 A;  2OAD A;  3CBU A;  3F4R A;  3H8Q A;  2WRT A;  4PQ1 A;  2CVB A;  2LQQ A;  3QAG A;  3UBK A;  1OC3 A;  2J23 A;  4F9Z A;  2G0F A;  4FIW A;  3RHB A;  4BL7 A;  2OE1 A;  1PGT A;  6GSY A;  2P0G A;  2RM6 A;  3CSI A;  5IMD A;  5CNW A;  2Z9S A;  3IAS 2;  4OCF A;  4MZW A;  1A0F A;  3ZLP A;  1EEJ A;  2KLX A;  2NDO A;  4ACS A;  1V40 A;  2I4A A;  2CZ2 A;  2LJR A;  3GN3 A;  1HNB A;  3UVH A;  1EOG A;  1RW1 A;  5HR1 A;  3DVX A;  1XWK A;  2C0F A;  4HJ2 A;  1SEN A;  3ZIJ A;  5AIV A;  1SYR A;  3CTG A;  5GAN D;  4MF7 A;  3C1R A;  2DC5 A;  1HNA A;  1J08 A;  1M2A A;  4TR1 B;  1G7E A;  3VI7 A;  2YV9 A;  3SBC A;  1TK0 B;  4JED A;  1F3A A;  1JZR A;  4NHZ A;  1EWX A;  1WPI A;  2P5Q A;  4NV2 A;  5D96 A;  3DVW A;  2D2Z A;  1F37 A;  3IK9 A;  4MPG A;  1PKZ A;  4G2E A;  4KA0 A;  1ABA A;  1FB6 A;  1GLQ A;  4EC0 A;  5LNK e;  5DCH A;  3GTU A;  4NPB A;  3LQ7 A;  1DE1 A;  4TR3 A;  2VLT A;  2XPE A;  3DML A;  2H73 A;  2VCZ A;  2GT6 A;  3APS A;  3CSJ A;  3QD9 A;  2HYX A;  4I2T A;  1GTI A;  5G1K A;  2YNX A;  3FZ4 A;  1E2Y A;  1YKA A;  2HZE B;  2OBK A;  4MJA A;  5D9W A;  2KUC A;  4MA9 A;  2DJ1 A;  2HRF A;  4KW6 A;  3KCM A;  5CAX A;  2RLI A;  1TDI A;  2O89 A;  4KCE A;  3ZZX A;  4V2N A;  3ZL5 A;  1A0R P;  4TXO A;  4V2M A;  2I9H A;  5DAL B;  4HQS A;  4BVY A;  4MAB A;  4TXV A;  2F8A A;  1OC9 A;  1FVK A;  2V41 A;  1YZX A;  3GKK A;  2V32 A;  3RAZ A;  2H8L A;  4KH7 A;  4DSR A;  4ULX A;  5KN0 A;  11GS A;  3RPP A;  1IYH A;  3L0H A;  5ELG A;  1CQG A;  4GRF A;  1T4Z A;  3HKR A;  5IMF A;  4YAV A;  1Y6E A;  2X8G A;  4L0U A;  4DVC A;  4MMM A;  3GYK A;  2A4V A;  3PIN A;  3ZRD A;  4N30 A;  3IR4 A;  1T00 A;  4MZB A;  2C4J A;  2GZP A;  4RI6 A;  3CXG A;  3FRC A;  4YQU A;  1T3B A;  1Z7P A;  3ED3 A;  4NHW A;  3KD0 A;  3G7Y A;  1EV9 A;  1O73 A;  2DJ2 A;  3EMP A;  1OAZ A;  2HFD A;  4JE1 A;  2OBI A;  1FAA A;  3QPM A;  5FWG A;  3LYP A;  1K3Y A;  4MK3 A;  4D73 A;  5HR3 A;  5HFI A;  4E8H A;  1GTU A;  5IO2 A;  1YY7 A;  5ECS A;  2GQL A;  5EL8 A;  3ZVJ A;  1J0F A;  1M0U A;  2VAF A;  3CRT A;  3R2Q A;  4XRA A;  1XIY A;  5E4W A;  3BJ5 A;  3KXO A;  2R4V A;  3FR3 A;  1EOH A;  1A8Y A;  1XW6 A;  4OCE A;  1Z9H A;  1YEX A;  2A2S A;  3EUR A;  5ECN B;  5A4V A;  2OKA A;  1MDI A;  1QK8 A;  2CAI A;  2B5X A;  4IJ3 A;  1V98 A;  1PKW A;  4HU7 A;  2A2R A;  3HA9 A;  4MJC A;  4IS0 A;  2AUV A;  4PUR A;  1GUH A;  3GA4 A;  3TGZ A;  2C3N A;  4KGI A;  2JAD A;  4ECJ A;  2H1B A;  2YV7 A;  2YWM A;  3TOT A;  1GSD A;  1TJD A;  2K8S A;  4ZIJ A;  2BJX A;  3FK8 A;  5HQP A;  2LS5 A;  5ECL B;  4CW9 A;  2H1G A;  1TW9 A;  5IMV A;  1XW9 A;  3ZYW A;  4KAE A;  3DIE A;  2AV4 A;  4P3Y B;  5LCZ A;  2TRX A;  3G7I A;  3GRX A;  1K0A A;  2VL2 A;  1HNC A;  1ERU A;  1A8L A;  3M1G A;  4IGJ A;  1BJX A;  2R37 A;  2WDU A;  1EP8 A;  3HZ8 A;  17GS A;  2KHP A;  3IDV A;  3QDN A;  6GSW A;  2WZ9 A;  2M72 A;  3FR6 A;  1XFL A;  1ZGN A;  1CQH A;  4QL7 A;  2F3M A;  1XWC A;  3KP8 A;  4MCU A;  1YF0 A;  3G9B A;  3E0U A;  5COH A;  2ZUP A;  4K7O A;  3GNJ A;  3KZQ A;  2HNL A;  2YPM A;  1B9X C;  2J9H A;  3ZIT A;  5IMZ A;  3VPQ A;  4G19 A;  1RK4 A;  2YWO A;  5KN1 A;  3HDC A;  2GQK A;  3F3R A;  1SL2 B;  4PQI A;  2LST A;  2CQ9 A;  2FWH A;  5J9C A;  1VF4 A;  2EC4 A;  4XS4 A;  4WKW A;  5ECK B;  2EIR A;  4PUA A;  2MBT A;  3F4T A;  3I69 A;  5JWR B;  3N5O A;  5J9B A;  1R26 A;  3ME8 A;  4XS1 A;  3CYN A;  2K18 A;  3CRU A;  3LGC A;  3W6G A;  2XPD A;  4KSM A;  1A23 A;  1SKS B;  1GUK A;  4K7I A;  1O81 A;  2LJA A;  1SK2 A;  1ZMA A;  5G5F A;  2AHE A;  4KCA A;  2NBS A;  1OE8 A;  4I8B A;  3TKQ A;  3KH9 A;  3O76 A;  4K2D A;  4EF0 A;  4ZBB A;  4K9Z A;  3MDK A;  2H6Y A;  2QC7 A;  2IFQ A;  3FY7 A;  5IOX A;  2MYG A;  4XIH A;  2YN1 A;  1XPV A;  5B8B A;  3GTU B;  2C0E A;  3DWV A;  1ILO A;  1AQW A;  3W8S A;  4FO5 A;  2C3T A;  1M7T A;  5G5E A;  4JZQ A;  1XOB A;  4F2I A;  1A2J A;  1NHO A;  5DQS A;  5IMA A;  5DAK B;  1KNG A;  2H76 A;  1ACV A;  4MJB A;  2LTK A;  1GSS A;  3PGT A;  2IIY A;  1R4W A;  3EWL A;  2VIM A;  1K3O A;  5AIX A;  2DIZ A;  3ZFB A;  3LJR A;  4LA1 A;  4MH2 A;  3Q6O A;  3UOM A;  4ZB8 A;  2OJL A;  2IMD A;  9GSS A;  1WRY A;  3RBT A;  4BWQ A;  2GDR A;  2K9F A;  1KBN A;  5IIZ A;  4TXO B;  1PD2 1;  2FHE A;  3MNG A;  1XVQ A;  1NSW A;  1AQV A;  1OC9 B;  4ZBD A;  1A2L A;  1Y25 A;  3FR9 A;  4V1A g;  4K7N A;  3NOF A;  2H0I A;  3KP9 A;  4POL A;  4BPY A;  3TJK A;  4LL4 B;  2VUP A;  5JWQ B;  1DSB A;  3GV1 A;  1W89 A;  1QXH A;  2DJK A;  1GP1 A;  2YCD A;  4POB A;  4Q5Q A;  3KEB A;  1JLW A;  4V2L A;  3VWU A;  2GSR A;  1PN9 A;  3EVI A;  1B8X A;  1W4V A;  3KH7 A;  5ECP B;  2LNS A;  2VCX A;  2E7P A;  4D73 B;  1MDJ A;  3TRQ A;  1H4O A;  3IK7 A;  4EVM A;  2JZT A;  5JWO B;  3KM6 A;  2LJK A;  5DQY A;  2CX4 A;  2ALB A;  3PH9 A;  2GS3 A;  5EVO A;  3BOA A;  1GUL A;  1SKW B;  1XWB A;  2WCI A;  1GSU A;  4IW9 A;  1K0C A;  3ZFL A;  1V9W A;  1ON4 A;  3IC4 A;  1O8X A;  1WIK A;  3LWA A;  3SWL A;  5J41 A;  2I3Y A;  3E3E A;  3S9F A;  5CRD A;  2LQO A;  2MMZ A;  3GUS A;  2JZR A;  4PNF A;  3TKS E;  1THO A;  3F4S A;  2ZNM A;  3QFB C;  4XHM A;  3ISO A;  4NV5 A;  5FHI A;  1YEP A;  1NHY A;  2LRN A;  2L5L A;  3UMA A;  5ECI B;  4GWR A;  1GSF A;  5HR2 A;  2GQM A;  1OYJ A;  2FD3 A;  3TJJ A;  3VFI A;  2B3S A;  2VLV A;  4IKH A;  5D9V A;  5CYY A;  1LBK A;  4NAX A;  1Z5Y E;  2P5R A;  3HYP A;  3P8W A;  2VO4 A;  4XRD A;  1N8J A;  4DSS A;  4ZBA A;  5AGY A;  5JCU A;  4I5Q A;  2F8F A;  2HE3 A;  4H86 A;  1J9B A;  4MJE A;  3QOU A;  4TN8 A;  2I1U A;  1GSE A;  1X9M B;  1FVJ A;  2ON5 A;  4GST A;  1K0B A;  1ZL9 A;  2IL3 A;  3A2V A;  1TK5 B;  1TI1 A;  3ERW A;  5DCG A;  3WGE A;  3O3T A;  3CTF A;  3LXT A;  2H66 A;  3UBL A;  2B5Y A;  1Z6M A;  4ML6 A;  4EL1 A;  4XS4 B;  1F2E A;  3F6F A;  5F8B A;  1K0M A;  2LNT A;  1UN2 A;  4Z7X A;  2R5G A;  5CRE A;  5AIS A;  3TOU A;  2GLR A;  1B4Q A;  4OFN A;  1G7O A;  2PN8 A;  3HJP A;  2ON7 A;  5KN2 A;  20GS A;  2E2G A;  3FHK A;  2CT6 A;  2AB6 A;  1VGL A;  1WOU A;  2NTO A;  2IN3 A;  2PUK C;  19GS A;  1ERW A;  2VM2 A;  4RI7 A;  4EO3 A;  2YWI A;  4KE3 A;  4X43 A;  1NW2 A;  4F03 A;  2LRT A;  5F05 A;  3H93 A;  1X5D A;  4YAP A;  3NZN A;  4K8M A;  2IFQ B;  4OD7 A;  5KN3 A;  5A5K A;  4I2U A;  2WGR A;  1C72 A;  3CSH A;  1X9W B;  1DBY A;  4HOJ A;  2H1D A;  1MD4 A;  3OR5 A;  2GTU A;  4Q5N A;  3F6D A;  2LEG A;  3JCM L;  1GTA A;  3WYW A;  2IMI A;  2YJH A;  2B7J A;  2FWE A;  3ERF A;  6GSV A;  4OO5 A;  4DEJ A;  4TOP A;  2PGT A;  3VPT A;  3P7X A;  1TP9 A;  2O87 A;  5A4U A;  4NWY A;  3D5J A;  2C3Q A;  1M2D A;  5E59 A;  4EKZ A;  2H19 A;  1H75 A;  2WB9 A;  1OVN A;  4EDY A;  1FOV A;  3NIV A;  2X64 A;  1PX7 A;  2MMN A;  3KTB A;  1T4Y A;  4ECC A;  5DDL A;  1ML6 A;  3EMX A;  2LKU A;  3IAM 2;  1AW9 A;  2CA8 A;  3M9J A;  5GZZ B;  2FA4 A;  1YKC A;  1XCC A;  4HZ2 A;  1G0T A;  1MEK A;  1I5G A;  5DJM A;  1ZCP A;  2H30 A;  2XBQ A;  5J5N A;  4TR4 A;  2IMK A;  1BED A;  4POM A;  1YQ1 A;  3UAR A;  4X0X A;  4HZ4 A;  3RHC A;  3VWX A;  4TKY A;  1AUC A;  4PQH A;  2CVD A;  2KP1 A;  2C1Y A;  4EUY A;  2M80 A;  1S3C A;  4EE0 A;  4EDZ A;  1TRS A;  5C00 A;  1THX A;  4FH8 A;  1GLP A;  4KX4 A;  1ZZY A;  3H79 A;  4ECI A;  4WET A;  1OKD A;  1SJ6 A;  3EE2 A;  1A2M A;  4J2F A;  1Z6N A;  2TRC P;  5CO3 A;  1BAY A;  1O8W A;  4V1A p;  3U6V A;  4GCI A;  3WT1 A;  2FNO A;  1UC7 A;  2JAC A;  2OAC A;  1G6W A;  2DIY A;  4JRR A;  2VCQ A;  3IOS A;  4KND A;  4TVE A;  1XZO A;  2M46 A;  4AF2 A;  2YAN A;  3M8N A;  5LD0 A;  3HXS A;  1MDK A;  2GSQ A;  5HFG A;  1A24 A;  4MF5 A;  2ZCT A;  5L71 A;  4K0N A;  3TKS C;  22GS A;  3HZ4 A;  3GX8 A;  3MAK A;  2QKE A;  3H4K A;  1IYI A;  1BYE A;  1UVZ A;  4K1F A;  3US3 A;  3ZMK A;  4PGT A;  2DSA A;  1U6T A;  2O8V B;  1X5E A;  2MMA A;  2HLS A;  1R7H A;  5ECR B;  3ME7 A;  2L5O A;  3L9V A;  1BX9 A;  1X0R A;  4ZB6 A;  3FW2 A;  1GRX A;  5FT3 A;  1XWA A;  2I81 A;  1ZYE A;  1SK1 A;  3Q19 A;  4GTU A;  5HR0 A;  1EV4 A;  2GSS A;  3GFK A;  3BCI A;  3EU4 A;  1PL2 A;  4IEL A;  4GQF A;  3GKN A;  3GL5 A;  3IV4 A;  4IJI A;  1JLV A;  4O7H A;  4EXJ A;  1PMT A;  1GL8 A;  2VM1 A;  2BTO T;  2H6Z A;  4OO4 A;  2YOI A;  3QFA C;  3TJG A;  3MWH A;  2BMX A;  1AXD A;  3Q18 A;  1U3I A;  3K8N A;  4N10 A;  4HI7 A;  2TIR A;  3APO A;  5GSS A;  2EIQ A;  3F8U A;  3LXZ A;  1FG4 A;  1QFN A;  4ID0 A;  5D8I A;  3I6A A;  1SYX A;  1U3A A;  3VLN A;  4FYU A;  3APQ A;  3KTL A;  3GH9 A;  4LMV A;  5H5S A;  2QSI A;  3TKP A;  4L0W A;  3QMX A;  1PSQ A;  2O85 A;  2PMT A;  1F3B A;  3C71 A;  2HSY A;  2L4Q A;  5EPF A;  1PX6 A;  4BWS A;  2HT9 A;  3DD3 A;  2N5A A;  2HSH A;  3ZRE A;  8GSS A;  2H6X A;  1TK8 B;  1XOA A;  2H0G A;  2H1A A;  4IHU A;  1QUW A;  3D4M A;  5F07 A;  2H71 A;  3D0Z A;  3KMO A;  2FA8 A;  4MPF A;  2V6K A;  3FEU A;  2N5B A;  2PBJ A;  2CZ3 A;  1PRX A;  5A4W A;  3EC3 A;  5ECO B;  2JSZ A;  2YZH A;  6GSU A;  3UVT A;  2VD0 A;  4IVF A;  3O6T A;  3A5W A;  4HU9 A;  2GZZ A;  5ELA A;  4LLR A;  1GSY A;  1TRW A;  2HI7 A;  5D9X A;  1R5P A;  2VD1 A;  1G6Y A;  2AYT A;  3DXB A;  1TU7 A;  2K8V A;  13GS A;  1SL0 B;  1V2A A;  3U5R E;  3EU3 A;  4K6X A;  6GST A;  3UIW A;  4MP4 A;  3TRP A;  5GST A;  5EY6 A;  1Z7R A;  5B8A A;  4PUF C;  3D22 A;  3LG6 A;  3M3M A;  3GX0 A;  1AAZ A;  2FGX A;  3A3T A;  3P90 A;  2H75 A;  1GWC A;  3QR6 A;  5H5R A;  1XW5 A;  4ECB A;  16GS A;  2WJU A;  2H01 A;  5ID2 A;  1SK0 A;  3C8E A;  4F82 A;  1EEM A;  4YQM A;  3LSZ A;  2C0G A;  2DMM A;  3LYK A;  3WGD A;  4FYB A;  5IMC A;  1VRS D;  3I9V 2;  2DJJ A;  3DGQ A;  3ERG A;  2GT5 A;  4HDE A;  3ZVJ D;  1EP7 A;  1B4P A;  5J4U A;  1RQM A;  1HQO A;  1QMV A;  2CX3 A;  4JR6 A;  3TKR A;  3UL3 A;  4RQR A;  2IWT A;  4ZXG A;  1M9A A;  2DJ0 A;  10GS A;  4HEA 2;  2FWF A;  5G1L A;  4IQ1 A;  2RM5 A;  1GSQ A;  3GKM A;  1AC1 A;  2E2M A;  2VCT A;  1QGV A;  5CP1 A;  4N11 A;  1ERT A;  4RUV A;  3UAP A;  1V58 A;  3HD5 A;  3IXR A;  4L8E A;  1FB0 A;  1EGO A;  2H0H A;  1WE0 A;  2G2Q A;  2DLX A;  1SJZ A;  2YJ7 A;  2FLS A;  4O5R A;  1TI3 A;  2N5F A;  3L9S A;  4MLY A;  3L9U A;  2VL9 A;  2GGT A;  2GST A;  3BD2 A;  2JL4 A;  1EGR A;  4KUN A;  1PA3 A;  2HXK A;  5B6M A;  4WBR D;  1FHE A;  5C04 A;  5ECH B;  1JHB A;  2OE3 A;  3IA1 A;  3VI5 A;  3F3Q A;  1XBS A;  1VF1 A;  5ABR A;  1B48 A;  1GTB A;  4AJ6 A;  2VOC A;  4GXZ A;  4PXO A;  1EZK A;  4X1U A;  5CRW A;  4ISD A;  2AJQ B;  3IPZ A;  5G31 A;  2FY6 A;  3MSZ A;  5F06 A;  4JBB A;  1TRV A;  2VCV A;  1Q4J A;  1SD9 A;  3A2X A;  2LV3 A;  2DJ3 A;  4N0V A;  3GST A; 
#chains in the Genus database with same CATH topology
 4F0B A;  1T1V A;  4N0Z A;  2CV4 A;  3TJF A;  2F51 A;  1U88 A;  3TDG A;  2C80 A;  2JU5 A;  4CHS A;  3D4T A;  1TRU A;  1XWG A;  1TKD B;  5DAK A;  3I43 A;  3HHV A;  2AAW A;  1HYU A;  1S3A A;  3FKF A;  3PR8 A;  1AQX A;  4JR4 A;  4G10 A;  4WF5 A;  2B1L A;  4KDX A;  5IOW A;  4YQV A;  3IRA A;  1WWJ A;  5HFK A;  2CAQ A;  3LFL A;  3FZ5 A;  3TUE A;  3ZML A;  5IPG A;  4HS1 A;  4WBJ A;  1SL1 B;  4ICY A;  4IP6 A;  3RDW A;  1Q98 A;  2CVK A;  4HQZ A;  4ILF A;  1M99 A;  2VL2 C;  4K0G A;  4WEY A;  4AJ8 A;  2RII A;  7GSS A;  2OA7 A;  4AGS A;  2PU9 C;  3ZIV A;  3BCK A;  1LU4 A;  2NVL A;  2V2G A;  4J57 E;  2LRC A;  3ZTL A;  5KEJ A;  4IN0 A;  4FQU A;  1I9D A;  3HVX A;  4HSC X;  4L5O A;  5ENU A;  1JFU A;  1WJK A;  2DML A;  2R0C A;  1QQ2 A;  5D9T A;  3TJB A;  2DBC A;  1ERV A;  2L6C A;  1Z3E A;  1E6B A;  1GUM A;  1MTC A;  2DKH A;  12GS A;  2L6D A;  3FZ9 A;  1U87 A;  4NXI A;  1XVW A;  2HRN A;  5JCG A;  3VWV A;  2VCW A;  4ZL7 A;  4HUA A;  2QA2 A;  1O85 A;  4ML1 A;  3W8J A;  5DBQ A;  2FUG 2;  2O7K A;  3IHQ A;  4XTS A;  3IC8 A;  5B6N A;  2MBS A;  2QGV A;  3R3E A;  4MZC A;  4WR5 A;  1YF1 A;  1BG5 A;  1K0D A;  1URM A;  1K0N A;  1WMJ A;  1VF3 A;  4KDU A;  4G9H A;  5IQY A;  4IQA A;  2WS2 A;  2H72 A;  2GZY A;  2P31 A;  2RUF A;  1HD2 A;  3KJY A;  4KDY A;  4AJ7 A;  2B1K A;  1OE7 A;  3F63 A;  4QQ7 A;  1K3L A;  1V57 A;  3IBH A;  3D6I A;  3V1W A;  3Q74 A;  1FO5 A;  1B9Y C;  3GSS A;  3GHA A;  5KOW A;  3DKS A;  1ZOF A;  4E8E A;  4GSN A;  14GS A;  4MH3 A;  1O6J A;  2YZU A;  5ID2 B;  2JZS A;  3LOR A;  2IPA A;  3DYR A;  5IO0 A;  5GAP D;  4BA7 A;  1SU9 A;  3C1S A;  3BBY A;  2X8C A;  1UA5 A;  1K0O A;  2E0Q A;  2IME A;  4QL9 A;  3GMF A;  3J7Y b;  5AN1 A;  3EIN A;  4NMU A;  5F0G A;  1SKR B;  5D93 A;  3VWW A;  3EYT A;  2MMO A;  3P2A A;  4PNG A;  6GSX A;  1KEB A;  2X4A A;  4LL1 B;  1S3R A;  5IM9 A;  4KSO A;  3VUR A;  2X8H A;  1WP0 A;  4TR1 A;  1YDK A;  2K6V A;  1USB A;  4OFT A;  2JSY A;  4DSS B;  1JZD A;  2FCH A;  4TRX A;  5BRT A;  4BVX A;  3D21 A;  3A5I A;  3G7J A;  1X9S B;  4MF6 A;  3TCO A;  1X5C A;  2MZC A;  3WT2 A;  5JCW A;  1XXU A;  2B5E A;  4F0C A;  1GNE A;  3A2W A;  3GUR A;  1JZO A;  4G0I A;  3KIJ A;  2GVP A;  2PER A;  4I97 A;  1KTE A;  2L57 A;  4IP1 A;  2PVO C;  4GSS A;  2H70 A;  1FW1 A;  4KB3 A;  2C8U A;  3FYG A;  2HZF A;  1ST9 A;  2V1M A;  2HZE A;  3WD6 A;  1GNW A;  1NM3 A;  2KOK A;  4OMV A;  3TRX A;  6GSS A;  2PPT A;  4ZL8 A;  2XHF A;  2IMF A;  3C73 A;  3DEX A;  3HCZ A;  3HJO A;  2H74 A;  2R2J A;  1PQN A;  5DAL A;  1R5A A;  1DUG A;  3F0I A;  2VL3 A;  4MDC A;  1TU8 A;  2B6M A;  1PL1 A;  2XBI A;  4O32 A;  4Q5F A;  4Z2R A;  4GF0 A;  5H5Q A;  5CRG A;  2PVQ A;  2NPB A;  5ECQ B;  4L5L A;  3HJM A;  5J3R A;  2L4C A;  2C0D A;  4IBP A;  2FWG A;  4K5R A;  3VK9 A;  1LJR A;  2LUS A;  1T7P B;  2X99 A;  4CY8 A;  3TKS A;  5G30 A;  4HJM A;  5IPH A;  4JU5 A;  4XS6 A;  4TW5 A;  4YH2 A;  1TXX A;  4CDO A;  3UEM A;  1F6M C;  2YP6 A;  1PN0 A;  2L59 A;  1SJI A;  3HVS A;  4WR4 A;  1O7U A;  2R3X A;  3TB2 A;  4Z2U A;  4GQC A;  1S3D A;  2F9S A;  4TR0 A;  5INY A;  2EIO A;  3IE3 A;  3CMI A;  3LEF A;  4LMW A;  2YWN A;  3UJ1 A;  5DVB A;  1M2B A;  2REM A;  2OE0 A;  3FZA A;  4RQX A;  3KGK A;  4O92 A;  1MD3 A;  1SD8 A;  2ES7 A;  4ZB9 A;  4GLT A;  4XCS A;  1ZYN A;  18GS A;  2B7K A;  1F9M A;  2R6K A;  5CRH A;  5G2Z A;  4OFM A;  4I6X A;  2VLU A;  3GIX A;  3L4N A;  3N9J A;  4ZIL A;  1TOF A;  5ECM B;  2PWJ A;  2V6O A;  3M0F A;  3WGX A;  1OC8 A;  3M9K A;  3QCP A;  5DJL A;  1TTZ A;  5B7C A;  3J7Y k;  3RPN A;  3E9J B;  1BQ7 A;  4PX1 A;  1AIU A;  4WXT A;  2XC2 A;  1OKT A;  3GH6 A;  1GH2 A;  2RUE A;  2WUL A;  2KP2 A;  4OWY A;  4FYC A;  1YJ6 A;  2WFC A;  3EPT A;  4POK A;  4J56 E;  3AY8 A;  1N2A A;  3KMN A;  3GKX A;  4Q5R A;  3HVV A;  5D73 A;  3HY2 A;  2IJY A;  3L78 A;  1VF2 A;  3QAW A;  3GL3 A;  3DRN A;  1T8E B;  1ZYQ B;  4WF4 A;  4DSQ A;  3F9U A;  1JZW A;  3QAV A;  4ZL9 A;  1M9B A;  3C7M A;  3H1N A;  1DE2 A;  2OAD A;  2QA1 A;  3CBU A;  3F4R A;  3H8Q A;  2WRT A;  4PQ1 A;  2CVB A;  2LQQ A;  3QAG A;  3UBK A;  1OC3 A;  2J23 A;  4F9Z A;  2G0F A;  4FIW A;  3RHB A;  4BL7 A;  2OE1 A;  1PGT A;  6GSY A;  2P0G A;  2RM6 A;  3CSI A;  5IMD A;  5CNW A;  2Z9S A;  3IAS 2;  4OCF A;  4MZW A;  1A0F A;  3ZLP A;  1EEJ A;  2KLX A;  2NDO A;  4ACS A;  1V40 A;  2I4A A;  2CZ2 A;  4X4J A;  2LJR A;  3GN3 A;  1HNB A;  3UVH A;  1EOG A;  1RW1 A;  4K5S A;  5HR1 A;  3DVX A;  1XWK A;  2C0F A;  4HJ2 A;  1SEN A;  3ZIJ A;  5AIV A;  1SYR A;  3CTG A;  5GAN D;  4MF7 A;  3C1R A;  2DC5 A;  1HNA A;  1M3J A;  1J08 A;  1M2A A;  4TR1 B;  1G7E A;  3VI7 A;  2YV9 A;  3SBC A;  1TK0 B;  4BVX B;  4O5Q A;  4JED A;  1F3A A;  1JZR A;  4NHZ A;  1EWX A;  1WPI A;  2P5Q A;  4NV2 A;  5D96 A;  3DVW A;  2D2Z A;  1F37 A;  3IK9 A;  4MPG A;  1PKZ A;  4G2E A;  4KA0 A;  1ABA A;  1FB6 A;  1GLQ A;  4EC0 A;  5LNK e;  5DCH A;  3GTU A;  4NPB A;  3LQ7 A;  1DE1 A;  4TR3 A;  2VLT A;  2XPE A;  2R0G A;  3DML A;  2H73 A;  2VCZ A;  2GT6 A;  3APS A;  3CSJ A;  3QD9 A;  2HYX A;  4I2T A;  1GTI A;  5G1K A;  2YNX A;  3FZ4 A;  1E2Y A;  1YKA A;  2HZE B;  2OBK A;  4MJA A;  5D9W A;  2KUC A;  4MA9 A;  2DJ1 A;  2HRF A;  4KW6 A;  3KCM A;  5CAX A;  1M3I A;  2RLI A;  1TDI A;  2O89 A;  4KCE A;  3ZZX A;  4V2N A;  3ZL5 A;  1A0R P;  4TXO A;  4V2M A;  2I9H A;  5DAL B;  4HQS A;  4BVY A;  4MAB A;  4TXV A;  2F8A A;  1OC9 A;  1FVK A;  2V41 A;  1YZX A;  3GKK A;  2V32 A;  3RAZ A;  2H8L A;  4KH7 A;  4DSR A;  4ULX A;  5KN0 A;  11GS A;  3RPP A;  1IYH A;  3L0H A;  5ELG A;  1CQG A;  4GRF A;  1T4Z A;  3HKR A;  5IMF A;  4YAV A;  1Y6E A;  2X8G A;  4L0U A;  4DVC A;  4MMM A;  3GYK A;  2A4V A;  3PIN A;  3ZRD A;  4N30 A;  3IR4 A;  1T00 A;  4MZB A;  2C4J A;  2GZP A;  4RI6 A;  3CXG A;  3FRC A;  4YQU A;  1T3B A;  1Z7P A;  3ED3 A;  4NHW A;  3KD0 A;  3G7Y A;  1EV9 A;  1O73 A;  2DJ2 A;  3EMP A;  1OAZ A;  2HFD A;  4JE1 A;  2OBI A;  1FAA A;  3QPM A;  5FWG A;  3LYP A;  1K3Y A;  4MK3 A;  4D73 A;  5HR3 A;  5HFI A;  4E8H A;  1GTU A;  5IO2 A;  1YY7 A;  5ECS A;  2GQL A;  5EL8 A;  3ZVJ A;  1J0F A;  1M0U A;  2VAF A;  3CRT A;  3R2Q A;  4XRA A;  1XIY A;  5E4W A;  3BJ5 A;  3KXO A;  2R4V A;  3FR3 A;  1EOH A;  1A8Y A;  1XW6 A;  4OCE A;  1Z9H A;  1YEX A;  2A2S A;  3EUR A;  5ECN B;  5A4V A;  2OKA A;  1MDI A;  1QK8 A;  2CAI A;  2B5X A;  4IJ3 A;  1V98 A;  1PKW A;  4HU7 A;  2A2R A;  3HA9 A;  4MJC A;  4IS0 A;  2AUV A;  4PUR A;  1GUH A;  3GA4 A;  3LW9 A;  3TGZ A;  2C3N A;  4KGI A;  2JAD A;  4ECJ A;  2H1B A;  2YV7 A;  2YWM A;  3TOT A;  1GSD A;  1TJD A;  2K8S A;  4ZIJ A;  2BJX A;  3FK8 A;  5HQP A;  2LS5 A;  5ECL B;  4CW9 A;  2H1G A;  1TW9 A;  1FOH A;  5IMV A;  1XW9 A;  3ZYW A;  4KAE A;  3DIE A;  2AV4 A;  4P3Y B;  5LCZ A;  2TRX A;  3G7I A;  3GRX A;  1K0A A;  2VL2 A;  1HNC A;  1ERU A;  1A8L A;  3M1G A;  4IGJ A;  1BJX A;  2R37 A;  2WDU A;  1EP8 A;  3HZ8 A;  17GS A;  2KHP A;  3IDV A;  3QDN A;  6GSW A;  2WZ9 A;  2M72 A;  3FR6 A;  1XFL A;  1ZGN A;  4Z2T A;  1CQH A;  4QL7 A;  1XG8 A;  2F3M A;  1XWC A;  3KP8 A;  4BL7 B;  4MCU A;  1YF0 A;  3G9B A;  3E0U A;  5COH A;  2ZUP A;  4K7O A;  3GNJ A;  3KZQ A;  2HNL A;  2YPM A;  1B9X C;  2J9H A;  3ZIT A;  5IMZ A;  3VPQ A;  4G19 A;  1RK4 A;  2YWO A;  5KN1 A;  3HDC A;  2GQK A;  3F3R A;  1SL2 B;  4PQI A;  2LST A;  2CQ9 A;  2FWH A;  5J9C A;  1VF4 A;  2EC4 A;  4XS4 A;  4WKW A;  5ECK B;  2EIR A;  4PUA A;  2MBT A;  3F4T A;  3I69 A;  5JWR B;  3N5O A;  5J9B A;  1R26 A;  3ME8 A;  4XS1 A;  3CYN A;  2K18 A;  3CRU A;  3LGC A;  3W6G A;  2XPD A;  4KSM A;  1A23 A;  1SKS B;  1GUK A;  4K7I A;  1O81 A;  2LJA A;  1SK2 A;  1ZMA A;  5G5F A;  4O5U A;  2AHE A;  4KCA A;  2NBS A;  1OE8 A;  4I8B A;  4USS A;  3TKQ A;  3KH9 A;  3O76 A;  4K2D A;  4EF0 A;  4ZBB A;  4K9Z A;  3MDK A;  2H6Y A;  2QC7 A;  2IFQ A;  3FY7 A;  5IOX A;  2MYG A;  4XIH A;  2YN1 A;  1XPV A;  5B8B A;  3GTU B;  2C0E A;  3DWV A;  1ILO A;  1AQW A;  3W8S A;  4FO5 A;  2C3T A;  1M7T A;  5G5E A;  4JZQ A;  1XOB A;  4F2I A;  1A2J A;  1NHO A;  5DQS A;  5IMA A;  5DAK B;  1KNG A;  2H76 A;  1ACV A;  4MJB A;  2LTK A;  1GSS A;  3PGT A;  2IIY A;  1R4W A;  3EWL A;  2VIM A;  1K3O A;  5AIX A;  2DIZ A;  3ZFB A;  3LJR A;  4LA1 A;  4MH2 A;  3Q6O A;  3UOM A;  4ZB8 A;  2OJL A;  2IMD A;  9GSS A;  1WRY A;  3RBT A;  4BWQ A;  2GDR A;  2K9F A;  1KBN A;  5IIZ A;  4TXO B;  1PD2 1;  2FHE A;  3MNG A;  4BVY B;  1XVQ A;  1NSW A;  4A5P A;  1AQV A;  1OC9 B;  4ZBD A;  1A2L A;  1Y25 A;  3FR9 A;  4V1A g;  4K7N A;  3NOF A;  2H0I A;  3KP9 A;  4POL A;  4BPY A;  3TJK A;  4LL4 B;  2VUP A;  5JWQ B;  1DSB A;  3GV1 A;  1W89 A;  1QXH A;  2A4H A;  2DJK A;  1GP1 A;  2YCD A;  4POB A;  4Q5Q A;  3KEB A;  1JLW A;  4V2L A;  3VWU A;  2GSR A;  1PN9 A;  4K2X A;  3MYD A;  3EVI A;  1B8X A;  1W4V A;  4EIQ A;  3KH7 A;  5ECP B;  2LNS A;  2VCX A;  2E7P A;  4D73 B;  1MDJ A;  3TRQ A;  1H4O A;  3IK7 A;  4EVM A;  2JZT A;  5JWO B;  3KM6 A;  2LJK A;  5DQY A;  2CX4 A;  2ALB A;  3PH9 A;  2GS3 A;  5KOX A;  5EVO A;  3BOA A;  1GUL A;  1SKW B;  1XWB A;  2WCI A;  1GSU A;  4IW9 A;  1K0C A;  3ZFL A;  1V9W A;  1ON4 A;  3IC4 A;  1O8X A;  1WIK A;  3LWA A;  3SWL A;  5J41 A;  2I3Y A;  3E3E A;  3S9F A;  5CRD A;  2LQO A;  2MMZ A;  3GUS A;  2JZR A;  4PNF A;  3TKS E;  1THO A;  3F4S A;  2ZNM A;  3QFB C;  4XHM A;  3ISO A;  4YKF A;  4NV5 A;  5FHI A;  4EIP A;  1YEP A;  1NHY A;  2LRN A;  2L5L A;  3UMA A;  5ECI B;  4GWR A;  2UZ8 A;  1GSF A;  5HR2 A;  2GQM A;  1OYJ A;  2FD3 A;  3TJJ A;  4G0L A;  3VFI A;  2B3S A;  2HSM A;  2VLV A;  4IKH A;  5D9V A;  5CYY A;  1LBK A;  4NAX A;  1Z5Y E;  2P5R A;  3HYP A;  3P8W A;  2VO4 A;  4XRD A;  1N8J A;  4DSS A;  4ZBA A;  3CQF A;  5AGY A;  5JCU A;  4I5Q A;  2F8F A;  2HE3 A;  4H86 A;  1J9B A;  2A2P A;  4MJE A;  3QOU A;  4TN8 A;  2I1U A;  3HVN A;  1GSE A;  1X9M B;  1FVJ A;  2ON5 A;  4GST A;  1K0B A;  1ZL9 A;  2IL3 A;  3A2V A;  1TK5 B;  1TI1 A;  3ERW A;  5DCG A;  3WGE A;  3O3T A;  3CTF A;  3LXT A;  2H66 A;  3UBL A;  2B5Y A;  1Z6M A;  4ML6 A;  4EL1 A;  4XS4 B;  1F2E A;  3F6F A;  5F8B A;  1K0M A;  2LNT A;  1UN2 A;  4Z7X A;  2R5G A;  5CRE A;  5AIS A;  3TOU A;  4CY6 A;  2GLR A;  1B4Q A;  4OFN A;  1G7O A;  2PN8 A;  3HJP A;  2ON7 A;  5KN2 A;  20GS A;  2E2G A;  3FHK A;  2CT6 A;  2AB6 A;  1VGL A;  1WOU A;  2NTO A;  2IN3 A;  2PUK C;  19GS A;  1ERW A;  2VM2 A;  4RI7 A;  4EO3 A;  2YWI A;  4KE3 A;  4X43 A;  1NW2 A;  4F03 A;  2LRT A;  5F05 A;  3H93 A;  1X5D A;  4YAP A;  3NZN A;  1ZYP A;  4K8M A;  2IFQ B;  4OD7 A;  5KN3 A;  5A5K A;  4I2U A;  2WGR A;  1C72 A;  3CSH A;  1X9W B;  1DBY A;  4HOJ A;  2H1D A;  1MD4 A;  3OR5 A;  2GTU A;  4Q5N A;  3F6D A;  2LEG A;  3JCM L;  1GTA A;  3WYW A;  2IMI A;  2YJH A;  2B7J A;  2FWE A;  3ERF A;  6GSV A;  4OO5 A;  4DEJ A;  4TOP A;  2PGT A;  3VPT A;  3P7X A;  1TP9 A;  2O87 A;  5A4U A;  4NWY A;  3D5J A;  2C3Q A;  1M2D A;  5E59 A;  4EKZ A;  2H19 A;  1H75 A;  2WB9 A;  1OVN A;  4EDY A;  1FOV A;  3NIV A;  2X64 A;  1PX7 A;  2MMN A;  3KTB A;  1T4Y A;  3FMW A;  4ECC A;  5DDL A;  1ML6 A;  3EMX A;  2LKU A;  3IAM 2;  1AW9 A;  2CA8 A;  3M9J A;  5GZZ B;  3MIX A;  2FA4 A;  1YKC A;  1XCC A;  4HZ2 A;  1G0T A;  1MEK A;  1I5G A;  5DJM A;  1ZCP A;  2H30 A;  2XBQ A;  5J5N A;  4TR4 A;  2IMK A;  1BED A;  2HRK A;  4POM A;  1YQ1 A;  3UAR A;  4YKG A;  4X0X A;  4HZ4 A;  3RHC A;  4G0K A;  3VWX A;  4TKY A;  1AUC A;  4PQH A;  2CVD A;  2KP1 A;  2C1Y A;  2R0P A;  2M80 A;  4EUY A;  1S3C A;  4EE0 A;  4EDZ A;  1TRS A;  5C00 A;  1THX A;  4FH8 A;  1GLP A;  4KX4 A;  1ZZY A;  3H79 A;  4ECI A;  4WET A;  1OKD A;  1SJ6 A;  3EE2 A;  1A2M A;  4J2F A;  1Z6N A;  2TRC P;  5CO3 A;  1BAY A;  1O8W A;  4V1A p;  3U6V A;  4GCI A;  3WT1 A;  2FNO A;  1UC7 A;  2JAC A;  2OAC A;  1G6W A;  2DIY A;  4JRR A;  2VCQ A;  3IOS A;  4KND A;  4TVE A;  1XZO A;  2M46 A;  4AF2 A;  2YAN A;  3M8N A;  5LD0 A;  3HXS A;  1MDK A;  2GSQ A;  5HFG A;  4PTS A;  1A24 A;  4MF5 A;  2ZCT A;  5L71 A;  4K0N A;  2X49 A;  3TKS C;  22GS A;  3HZ4 A;  3GX8 A;  3MAK A;  2QKE A;  3H4K A;  1IYI A;  1BYE A;  1UVZ A;  4K1F A;  3US3 A;  3ZMK A;  4PGT A;  2DSA A;  1U6T A;  2O8V B;  1X5E A;  2MMA A;  2HLS A;  1R7H A;  5ECR B;  3ME7 A;  2L5O A;  3IHG A;  3L9V A;  1BX9 A;  1X0R A;  4ZB6 A;  3FW2 A;  1GRX A;  5FT3 A;  1XWA A;  2I81 A;  1ZYE A;  1SK1 A;  3Q19 A;  4GTU A;  5HR0 A;  1EV4 A;  4KF9 A;  2GSS A;  3GFK A;  3BCI A;  3EU4 A;  1PL2 A;  4IEL A;  4GQF A;  3GKN A;  3GL5 A;  3IV4 A;  4IJI A;  1JLV A;  4O7H A;  4EXJ A;  1PMT A;  1GL8 A;  2VM1 A;  2BTO T;  2H6Z A;  4OO4 A;  2YOI A;  3QFA C;  3TJG A;  3MWH A;  2BMX A;  1AXD A;  3Q18 A;  1U3I A;  3K8N A;  4N10 A;  4HI7 A;  2TIR A;  3APO A;  5GSS A;  2EIQ A;  3F8U A;  3LXZ A;  1FG4 A;  1QFN A;  4ID0 A;  5D8I A;  3I6A A;  1SYX A;  1U3A A;  3VLN A;  4FYU A;  3APQ A;  3KTL A;  3GH9 A;  4LMV A;  5H5S A;  2QSI A;  3TKP A;  4L0W A;  3QMX A;  1PSQ A;  2O85 A;  2PMT A;  1F3B A;  3C71 A;  2HSY A;  2L4Q A;  5EPF A;  1PX6 A;  4BWS A;  2HT9 A;  3DD3 A;  2N5A A;  2HSH A;  3ZRE A;  8GSS A;  2H6X A;  1TK8 B;  1XOA A;  2H0G A;  2H1A A;  4IHU A;  1QUW A;  3D4M A;  5F07 A;  2H71 A;  3D0Z A;  3KMO A;  2FA8 A;  4MPF A;  2V6K A;  3FEU A;  2N5B A;  2PBJ A;  2CZ3 A;  1PRX A;  5A4W A;  3EC3 A;  5ECO B;  2JSZ A;  2YZH A;  6GSU A;  3UVT A;  2VD0 A;  4IVF A;  3O6T A;  3A5W A;  4HU9 A;  2GZZ A;  5ELA A;  4LLR A;  1GSY A;  1TRW A;  2HI7 A;  5D9X A;  1R5P A;  2VD1 A;  1G6Y A;  2AYT A;  2HRA A;  3DXB A;  1TU7 A;  2K8V A;  13GS A;  1SL0 B;  4BIK A;  1V2A A;  3U5R E;  3EU3 A;  4K6X A;  6GST A;  3UIW A;  4MP4 A;  3TRP A;  5GST A;  5EY6 A;  1Z7R A;  5B8A A;  4PUF C;  3D22 A;  3LG6 A;  3M3M A;  3GX0 A;  1AAZ A;  2FGX A;  3A3T A;  3P90 A;  2H75 A;  1GWC A;  3QR6 A;  5H5R A;  1XW5 A;  4ECB A;  5BMU A;  16GS A;  1PFO A;  2WJU A;  2H01 A;  5ID2 A;  1SK0 A;  3C8E A;  4F82 A;  1EEM A;  4YQM A;  3LSZ A;  2C0G A;  2DMM A;  3LYK A;  4MNN A;  3WGD A;  4FYB A;  5IMC A;  1VRS D;  3I9V 2;  2DJJ A;  3DGQ A;  3ERG A;  2GT5 A;  4HDE A;  3ZVJ D;  1EP7 A;  1B4P A;  5J4U A;  1RQM A;  1HQO A;  1QMV A;  2CX3 A;  4JR6 A;  3TKR A;  3UL3 A;  4RQR A;  2IWT A;  4ZXG A;  1M9A A;  2DJ0 A;  10GS A;  4HEA 2;  2FWF A;  5G1L A;  4IQ1 A;  2RM5 A;  1GSQ A;  3GKM A;  1AC1 A;  2E2M A;  2VCT A;  1QGV A;  5CP1 A;  4N11 A;  1ERT A;  4RUV A;  3UAP A;  1V58 A;  3HD5 A;  3IXR A;  4L8E A;  1FB0 A;  1EGO A;  2H0H A;  1WE0 A;  2G2Q A;  2DLX A;  3PPU A;  1SJZ A;  2YJ7 A;  2FLS A;  4O5R A;  1TI3 A;  2N5F A;  3L9S A;  4MLY A;  3L9U A;  2VL9 A;  2GGT A;  2GST A;  3BD2 A;  2JL4 A;  1EGR A;  4KUN A;  1PA3 A;  2HXK A;  2DKI A;  5B6M A;  4WBR D;  1FHE A;  5C04 A;  5ECH B;  1JHB A;  2OE3 A;  3IA1 A;  3VI5 A;  3F3Q A;  1XBS A;  1VF1 A;  5ABR A;  1B48 A;  1GTB A;  4AJ6 A;  2VOC A;  4GXZ A;  4PXO A;  1EZK A;  4X1U A;  5CRW A;  4ISD A;  2AJQ B;  3IPZ A;  5G31 A;  2FY6 A;  3MSZ A;  5F06 A;  4JBB A;  1TRV A;  2VCV A;  1Q4J A;  1SD9 A;  3A2X A;  2LV3 A;  2DJ3 A;  4N0V A;  3GST A; 
#chains in the Genus database with same CATH homology
 4F0B A;  1T1V A;  4N0Z A;  2CV4 A;  3TJF A;  2F51 A;  1U88 A;  3TDG A;  2C80 A;  2JU5 A;  4CHS A;  3D4T A;  1TRU A;  1XWG A;  1TKD B;  5DAK A;  3I43 A;  3HHV A;  2AAW A;  1HYU A;  1S3A A;  3FKF A;  3PR8 A;  1AQX A;  4JR4 A;  4G10 A;  4WF5 A;  2B1L A;  4KDX A;  5IOW A;  4YQV A;  3IRA A;  1WWJ A;  5HFK A;  2CAQ A;  3LFL A;  3FZ5 A;  3TUE A;  3ZML A;  5IPG A;  4HS1 A;  4WBJ A;  1SL1 B;  4ICY A;  4IP6 A;  3RDW A;  1Q98 A;  2CVK A;  4HQZ A;  4ILF A;  1M99 A;  2VL2 C;  4K0G A;  4WEY A;  4AJ8 A;  2RII A;  7GSS A;  2OA7 A;  4AGS A;  2PU9 C;  3ZIV A;  3BCK A;  1LU4 A;  2NVL A;  2V2G A;  4J57 E;  2LRC A;  3ZTL A;  5KEJ A;  4IN0 A;  4FQU A;  1I9D A;  3HVX A;  4L5O A;  5ENU A;  1JFU A;  1WJK A;  2DML A;  2R0C A;  1QQ2 A;  5D9T A;  3TJB A;  2DBC A;  1ERV A;  2L6C A;  1Z3E A;  1E6B A;  1GUM A;  1MTC A;  2DKH A;  12GS A;  2L6D A;  3FZ9 A;  1U87 A;  4NXI A;  1XVW A;  2HRN A;  5JCG A;  3VWV A;  2VCW A;  4ZL7 A;  4HUA A;  2QA2 A;  1O85 A;  4ML1 A;  3W8J A;  5DBQ A;  2FUG 2;  2O7K A;  3IHQ A;  4XTS A;  3IC8 A;  5B6N A;  2MBS A;  2QGV A;  3R3E A;  4MZC A;  4WR5 A;  1YF1 A;  1BG5 A;  1K0D A;  1URM A;  1K0N A;  1WMJ A;  1VF3 A;  4KDU A;  4G9H A;  5IQY A;  4IQA A;  2WS2 A;  2H72 A;  2GZY A;  2P31 A;  2RUF A;  1HD2 A;  3KJY A;  4KDY A;  4AJ7 A;  2B1K A;  1OE7 A;  3F63 A;  4QQ7 A;  1K3L A;  1V57 A;  3IBH A;  3D6I A;  3V1W A;  3Q74 A;  1FO5 A;  1B9Y C;  3GSS A;  3GHA A;  5KOW A;  3DKS A;  1ZOF A;  4E8E A;  4GSN A;  14GS A;  4MH3 A;  1O6J A;  2YZU A;  5ID2 B;  2JZS A;  3LOR A;  2IPA A;  3DYR A;  5IO0 A;  5GAP D;  4BA7 A;  1SU9 A;  3C1S A;  3BBY A;  2X8C A;  1UA5 A;  1K0O A;  2E0Q A;  2IME A;  4QL9 A;  3GMF A;  3J7Y b;  5AN1 A;  3EIN A;  4NMU A;  5F0G A;  1SKR B;  5D93 A;  3VWW A;  3EYT A;  2MMO A;  3P2A A;  4PNG A;  6GSX A;  1KEB A;  2X4A A;  4LL1 B;  5IM9 A;  4KSO A;  3VUR A;  2X8H A;  1WP0 A;  4TR1 A;  1YDK A;  2K6V A;  1USB A;  4OFT A;  2JSY A;  4DSS B;  1JZD A;  2FCH A;  4TRX A;  5BRT A;  4BVX A;  3D21 A;  3A5I A;  3G7J A;  1X9S B;  4MF6 A;  3TCO A;  1X5C A;  2MZC A;  3WT2 A;  5JCW A;  1XXU A;  2B5E A;  4F0C A;  1GNE A;  3A2W A;  3GUR A;  1JZO A;  4G0I A;  3KIJ A;  2GVP A;  2PER A;  4I97 A;  1KTE A;  2L57 A;  4IP1 A;  2PVO C;  4GSS A;  2H70 A;  1FW1 A;  4KB3 A;  2C8U A;  3FYG A;  2HZF A;  1ST9 A;  2V1M A;  2HZE A;  3WD6 A;  1GNW A;  1NM3 A;  2KOK A;  4OMV A;  3TRX A;  6GSS A;  2PPT A;  4ZL8 A;  2XHF A;  2IMF A;  3C73 A;  3DEX A;  3HCZ A;  3HJO A;  2H74 A;  2R2J A;  1PQN A;  5DAL A;  1R5A A;  1DUG A;  3F0I A;  2VL3 A;  4MDC A;  1TU8 A;  2B6M A;  1PL1 A;  2XBI A;  4O32 A;  4Q5F A;  4Z2R A;  4GF0 A;  5H5Q A;  5CRG A;  2PVQ A;  2NPB A;  5ECQ B;  4L5L A;  3HJM A;  5J3R A;  2L4C A;  2C0D A;  4IBP A;  2FWG A;  4K5R A;  3VK9 A;  1LJR A;  2LUS A;  1T7P B;  2X99 A;  4CY8 A;  3TKS A;  5G30 A;  4HJM A;  5IPH A;  4JU5 A;  4XS6 A;  4TW5 A;  4YH2 A;  1TXX A;  4CDO A;  3UEM A;  1F6M C;  2YP6 A;  1PN0 A;  2L59 A;  1SJI A;  3HVS A;  4WR4 A;  1O7U A;  2R3X A;  3TB2 A;  4Z2U A;  4GQC A;  1S3D A;  2F9S A;  4TR0 A;  5INY A;  2EIO A;  3IE3 A;  3CMI A;  3LEF A;  4LMW A;  2YWN A;  3UJ1 A;  5DVB A;  1M2B A;  2REM A;  2OE0 A;  3FZA A;  4RQX A;  3KGK A;  4O92 A;  1MD3 A;  1SD8 A;  2ES7 A;  4ZB9 A;  4GLT A;  4XCS A;  1ZYN A;  18GS A;  2B7K A;  1F9M A;  2R6K A;  5CRH A;  5G2Z A;  4OFM A;  4I6X A;  2VLU A;  3GIX A;  3L4N A;  3N9J A;  4ZIL A;  1TOF A;  5ECM B;  2PWJ A;  2V6O A;  3M0F A;  3WGX A;  1OC8 A;  3M9K A;  3QCP A;  5DJL A;  1TTZ A;  5B7C A;  3J7Y k;  3RPN A;  3E9J B;  1BQ7 A;  4PX1 A;  1AIU A;  4WXT A;  2XC2 A;  1OKT A;  3GH6 A;  1GH2 A;  2RUE A;  2WUL A;  2KP2 A;  4OWY A;  4FYC A;  1YJ6 A;  2WFC A;  3EPT A;  4POK A;  4J56 E;  3AY8 A;  1N2A A;  3KMN A;  3GKX A;  4Q5R A;  3HVV A;  5D73 A;  3HY2 A;  2IJY A;  3L78 A;  1VF2 A;  3QAW A;  3GL3 A;  3DRN A;  1T8E B;  1ZYQ B;  4WF4 A;  4DSQ A;  3F9U A;  1JZW A;  3QAV A;  4ZL9 A;  1M9B A;  3C7M A;  3H1N A;  1DE2 A;  2OAD A;  2QA1 A;  3CBU A;  3F4R A;  3H8Q A;  2WRT A;  4PQ1 A;  2CVB A;  2LQQ A;  3QAG A;  3UBK A;  1OC3 A;  2J23 A;  4F9Z A;  2G0F A;  4FIW A;  3RHB A;  4BL7 A;  2OE1 A;  1PGT A;  6GSY A;  2P0G A;  2RM6 A;  3CSI A;  5IMD A;  5CNW A;  2Z9S A;  3IAS 2;  4OCF A;  4MZW A;  1A0F A;  3ZLP A;  1EEJ A;  2KLX A;  2NDO A;  4ACS A;  1V40 A;  2I4A A;  2CZ2 A;  4X4J A;  2LJR A;  3GN3 A;  1HNB A;  3UVH A;  1EOG A;  1RW1 A;  4K5S A;  5HR1 A;  3DVX A;  1XWK A;  2C0F A;  4HJ2 A;  1SEN A;  3ZIJ A;  5AIV A;  1SYR A;  3CTG A;  5GAN D;  4MF7 A;  3C1R A;  2DC5 A;  1HNA A;  1J08 A;  1M2A A;  4TR1 B;  1G7E A;  3VI7 A;  2YV9 A;  3SBC A;  1TK0 B;  4BVX B;  4O5Q A;  4JED A;  1F3A A;  1JZR A;  4NHZ A;  1EWX A;  1WPI A;  2P5Q A;  4NV2 A;  5D96 A;  3DVW A;  2D2Z A;  1F37 A;  3IK9 A;  4MPG A;  1PKZ A;  4G2E A;  4KA0 A;  1ABA A;  1FB6 A;  1GLQ A;  4EC0 A;  5LNK e;  5DCH A;  3GTU A;  4NPB A;  3LQ7 A;  1DE1 A;  4TR3 A;  2VLT A;  2XPE A;  2R0G A;  3DML A;  2H73 A;  2VCZ A;  2GT6 A;  3APS A;  3CSJ A;  3QD9 A;  2HYX A;  4I2T A;  1GTI A;  5G1K A;  2YNX A;  3FZ4 A;  1E2Y A;  1YKA A;  2HZE B;  2OBK A;  4MJA A;  5D9W A;  2KUC A;  4MA9 A;  2DJ1 A;  2HRF A;  4KW6 A;  3KCM A;  5CAX A;  2RLI A;  1TDI A;  2O89 A;  4KCE A;  3ZZX A;  4V2N A;  3ZL5 A;  1A0R P;  4TXO A;  4V2M A;  2I9H A;  5DAL B;  4HQS A;  4BVY A;  4MAB A;  4TXV A;  2F8A A;  1OC9 A;  1FVK A;  2V41 A;  1YZX A;  3GKK A;  2V32 A;  3RAZ A;  2H8L A;  4KH7 A;  4DSR A;  4ULX A;  5KN0 A;  11GS A;  3RPP A;  1IYH A;  3L0H A;  5ELG A;  1CQG A;  4GRF A;  1T4Z A;  3HKR A;  5IMF A;  4YAV A;  1Y6E A;  2X8G A;  4L0U A;  4DVC A;  4MMM A;  3GYK A;  2A4V A;  3PIN A;  3ZRD A;  4N30 A;  3IR4 A;  1T00 A;  4MZB A;  2C4J A;  2GZP A;  4RI6 A;  3CXG A;  3FRC A;  4YQU A;  1T3B A;  1Z7P A;  3ED3 A;  4NHW A;  3KD0 A;  3G7Y A;  1EV9 A;  1O73 A;  2DJ2 A;  3EMP A;  1OAZ A;  2HFD A;  4JE1 A;  2OBI A;  1FAA A;  3QPM A;  5FWG A;  3LYP A;  1K3Y A;  4MK3 A;  4D73 A;  5HR3 A;  5HFI A;  4E8H A;  1GTU A;  5IO2 A;  1YY7 A;  5ECS A;  2GQL A;  5EL8 A;  3ZVJ A;  1J0F A;  1M0U A;  2VAF A;  3CRT A;  3R2Q A;  4XRA A;  1XIY A;  5E4W A;  3BJ5 A;  3KXO A;  2R4V A;  3FR3 A;  1EOH A;  1A8Y A;  1XW6 A;  4OCE A;  1Z9H A;  1YEX A;  2A2S A;  3EUR A;  5ECN B;  5A4V A;  2OKA A;  1MDI A;  1QK8 A;  2CAI A;  2B5X A;  4IJ3 A;  1V98 A;  1PKW A;  4HU7 A;  2A2R A;  3HA9 A;  4MJC A;  4IS0 A;  2AUV A;  4PUR A;  1GUH A;  3GA4 A;  3LW9 A;  3TGZ A;  2C3N A;  4KGI A;  2JAD A;  4ECJ A;  2H1B A;  2YV7 A;  2YWM A;  3TOT A;  1GSD A;  1TJD A;  2K8S A;  4ZIJ A;  2BJX A;  3FK8 A;  5HQP A;  2LS5 A;  5ECL B;  4CW9 A;  2H1G A;  1TW9 A;  1FOH A;  5IMV A;  1XW9 A;  3ZYW A;  4KAE A;  3DIE A;  2AV4 A;  4P3Y B;  5LCZ A;  2TRX A;  3G7I A;  3GRX A;  1K0A A;  2VL2 A;  1HNC A;  1ERU A;  1A8L A;  3M1G A;  4IGJ A;  1BJX A;  2R37 A;  2WDU A;  1EP8 A;  3HZ8 A;  17GS A;  2KHP A;  3IDV A;  3QDN A;  6GSW A;  2WZ9 A;  2M72 A;  3FR6 A;  1XFL A;  1ZGN A;  4Z2T A;  1CQH A;  4QL7 A;  2F3M A;  1XWC A;  3KP8 A;  4BL7 B;  4MCU A;  1YF0 A;  3G9B A;  3E0U A;  5COH A;  2ZUP A;  4K7O A;  3GNJ A;  3KZQ A;  2HNL A;  2YPM A;  1B9X C;  2J9H A;  3ZIT A;  5IMZ A;  3VPQ A;  4G19 A;  1RK4 A;  2YWO A;  5KN1 A;  3HDC A;  2GQK A;  3F3R A;  1SL2 B;  4PQI A;  2LST A;  2CQ9 A;  2FWH A;  5J9C A;  1VF4 A;  2EC4 A;  4XS4 A;  4WKW A;  5ECK B;  2EIR A;  4PUA A;  2MBT A;  3F4T A;  3I69 A;  5JWR B;  3N5O A;  5J9B A;  1R26 A;  3ME8 A;  4XS1 A;  3CYN A;  2K18 A;  3CRU A;  3LGC A;  3W6G A;  2XPD A;  4KSM A;  1A23 A;  1SKS B;  1GUK A;  4K7I A;  1O81 A;  2LJA A;  1SK2 A;  1ZMA A;  5G5F A;  4O5U A;  2AHE A;  4KCA A;  2NBS A;  1OE8 A;  4I8B A;  4USS A;  3TKQ A;  3KH9 A;  3O76 A;  4K2D A;  4EF0 A;  4ZBB A;  4K9Z A;  3MDK A;  2H6Y A;  2QC7 A;  2IFQ A;  3FY7 A;  5IOX A;  2MYG A;  4XIH A;  2YN1 A;  1XPV A;  5B8B A;  3GTU B;  2C0E A;  3DWV A;  1ILO A;  1AQW A;  3W8S A;  4FO5 A;  2C3T A;  1M7T A;  5G5E A;  4JZQ A;  1XOB A;  4F2I A;  1A2J A;  1NHO A;  5DQS A;  5IMA A;  5DAK B;  1KNG A;  2H76 A;  1ACV A;  4MJB A;  2LTK A;  1GSS A;  3PGT A;  2IIY A;  1R4W A;  3EWL A;  2VIM A;  1K3O A;  5AIX A;  2DIZ A;  3ZFB A;  3LJR A;  4LA1 A;  4MH2 A;  3Q6O A;  3UOM A;  4ZB8 A;  2OJL A;  2IMD A;  9GSS A;  1WRY A;  3RBT A;  4BWQ A;  2GDR A;  2K9F A;  1KBN A;  5IIZ A;  4TXO B;  1PD2 1;  2FHE A;  3MNG A;  4BVY B;  1XVQ A;  1NSW A;  4A5P A;  1AQV A;  1OC9 B;  4ZBD A;  1A2L A;  1Y25 A;  3FR9 A;  4V1A g;  4K7N A;  3NOF A;  2H0I A;  3KP9 A;  4POL A;  4BPY A;  3TJK A;  4LL4 B;  2VUP A;  5JWQ B;  1DSB A;  3GV1 A;  1W89 A;  1QXH A;  2A4H A;  2DJK A;  1GP1 A;  2YCD A;  4POB A;  4Q5Q A;  3KEB A;  1JLW A;  4V2L A;  3VWU A;  2GSR A;  1PN9 A;  4K2X A;  3MYD A;  3EVI A;  1B8X A;  1W4V A;  4EIQ A;  3KH7 A;  5ECP B;  2LNS A;  2VCX A;  2E7P A;  4D73 B;  1MDJ A;  3TRQ A;  1H4O A;  3IK7 A;  4EVM A;  2JZT A;  5JWO B;  3KM6 A;  2LJK A;  5DQY A;  2CX4 A;  2ALB A;  3PH9 A;  2GS3 A;  5KOX A;  5EVO A;  3BOA A;  1GUL A;  1SKW B;  1XWB A;  2WCI A;  1GSU A;  4IW9 A;  1K0C A;  3ZFL A;  1V9W A;  1ON4 A;  3IC4 A;  1O8X A;  1WIK A;  3LWA A;  3SWL A;  5J41 A;  2I3Y A;  3E3E A;  3S9F A;  5CRD A;  2LQO A;  2MMZ A;  3GUS A;  2JZR A;  4PNF A;  3TKS E;  1THO A;  3F4S A;  2ZNM A;  3QFB C;  4XHM A;  3ISO A;  4YKF A;  4NV5 A;  5FHI A;  4EIP A;  1YEP A;  1NHY A;  2LRN A;  2L5L A;  3UMA A;  5ECI B;  4GWR A;  2UZ8 A;  1GSF A;  5HR2 A;  2GQM A;  1OYJ A;  2FD3 A;  3TJJ A;  4G0L A;  3VFI A;  2B3S A;  2HSM A;  2VLV A;  4IKH A;  5D9V A;  5CYY A;  1LBK A;  4NAX A;  1Z5Y E;  2P5R A;  3HYP A;  3P8W A;  2VO4 A;  4XRD A;  1N8J A;  4DSS A;  4ZBA A;  5AGY A;  5JCU A;  4I5Q A;  2F8F A;  2HE3 A;  4H86 A;  1J9B A;  2A2P A;  4MJE A;  3QOU A;  4TN8 A;  2I1U A;  1GSE A;  1X9M B;  1FVJ A;  2ON5 A;  4GST A;  1K0B A;  1ZL9 A;  2IL3 A;  3A2V A;  1TK5 B;  1TI1 A;  3ERW A;  5DCG A;  3WGE A;  3O3T A;  3CTF A;  3LXT A;  2H66 A;  3UBL A;  2B5Y A;  1Z6M A;  4ML6 A;  4EL1 A;  4XS4 B;  1F2E A;  3F6F A;  5F8B A;  1K0M A;  2LNT A;  1UN2 A;  4Z7X A;  2R5G A;  5CRE A;  5AIS A;  3TOU A;  4CY6 A;  2GLR A;  1B4Q A;  4OFN A;  1G7O A;  2PN8 A;  3HJP A;  2ON7 A;  5KN2 A;  20GS A;  2E2G A;  3FHK A;  2CT6 A;  2AB6 A;  1VGL A;  1WOU A;  2NTO A;  2IN3 A;  2PUK C;  19GS A;  1ERW A;  2VM2 A;  4RI7 A;  4EO3 A;  2YWI A;  4KE3 A;  4X43 A;  1NW2 A;  4F03 A;  2LRT A;  5F05 A;  3H93 A;  1X5D A;  4YAP A;  3NZN A;  1ZYP A;  4K8M A;  2IFQ B;  4OD7 A;  5KN3 A;  5A5K A;  4I2U A;  2WGR A;  1C72 A;  3CSH A;  1X9W B;  1DBY A;  4HOJ A;  2H1D A;  1MD4 A;  3OR5 A;  2GTU A;  4Q5N A;  3F6D A;  2LEG A;  3JCM L;  1GTA A;  3WYW A;  2IMI A;  2YJH A;  2B7J A;  2FWE A;  3ERF A;  6GSV A;  4OO5 A;  4DEJ A;  4TOP A;  2PGT A;  3VPT A;  3P7X A;  1TP9 A;  2O87 A;  5A4U A;  4NWY A;  3D5J A;  2C3Q A;  1M2D A;  5E59 A;  4EKZ A;  2H19 A;  1H75 A;  2WB9 A;  1OVN A;  4EDY A;  1FOV A;  3NIV A;  2X64 A;  1PX7 A;  2MMN A;  3KTB A;  1T4Y A;  3FMW A;  4ECC A;  5DDL A;  1ML6 A;  3EMX A;  2LKU A;  3IAM 2;  1AW9 A;  2CA8 A;  3M9J A;  5GZZ B;  3MIX A;  2FA4 A;  1YKC A;  1XCC A;  4HZ2 A;  1G0T A;  1MEK A;  1I5G A;  5DJM A;  1ZCP A;  2H30 A;  2XBQ A;  5J5N A;  4TR4 A;  2IMK A;  1BED A;  2HRK A;  4POM A;  1YQ1 A;  3UAR A;  4YKG A;  4X0X A;  4HZ4 A;  3RHC A;  4G0K A;  3VWX A;  4TKY A;  1AUC A;  4PQH A;  2CVD A;  2KP1 A;  2C1Y A;  2R0P A;  2M80 A;  4EUY A;  1S3C A;  4EE0 A;  4EDZ A;  1TRS A;  5C00 A;  1THX A;  4FH8 A;  1GLP A;  4KX4 A;  1ZZY A;  3H79 A;  4ECI A;  4WET A;  1OKD A;  1SJ6 A;  3EE2 A;  1A2M A;  4J2F A;  1Z6N A;  2TRC P;  5CO3 A;  1BAY A;  1O8W A;  4V1A p;  3U6V A;  4GCI A;  3WT1 A;  2FNO A;  1UC7 A;  2JAC A;  2OAC A;  1G6W A;  2DIY A;  4JRR A;  2VCQ A;  3IOS A;  4KND A;  4TVE A;  1XZO A;  2M46 A;  4AF2 A;  2YAN A;  3M8N A;  5LD0 A;  3HXS A;  1MDK A;  2GSQ A;  5HFG A;  4PTS A;  1A24 A;  4MF5 A;  2ZCT A;  5L71 A;  4K0N A;  2X49 A;  3TKS C;  22GS A;  3HZ4 A;  3GX8 A;  3MAK A;  2QKE A;  3H4K A;  1IYI A;  1BYE A;  1UVZ A;  4K1F A;  3US3 A;  3ZMK A;  4PGT A;  2DSA A;  1U6T A;  2O8V B;  1X5E A;  2MMA A;  2HLS A;  1R7H A;  5ECR B;  3ME7 A;  2L5O A;  3IHG A;  3L9V A;  1BX9 A;  1X0R A;  4ZB6 A;  3FW2 A;  1GRX A;  5FT3 A;  1XWA A;  2I81 A;  1ZYE A;  1SK1 A;  3Q19 A;  4GTU A;  5HR0 A;  1EV4 A;  4KF9 A;  2GSS A;  3GFK A;  3BCI A;  3EU4 A;  1PL2 A;  4IEL A;  4GQF A;  3GKN A;  3GL5 A;  3IV4 A;  4IJI A;  1JLV A;  4O7H A;  4EXJ A;  1PMT A;  1GL8 A;  2VM1 A;  2BTO T;  2H6Z A;  4OO4 A;  2YOI A;  3QFA C;  3TJG A;  3MWH A;  2BMX A;  1AXD A;  3Q18 A;  1U3I A;  3K8N A;  4N10 A;  4HI7 A;  2TIR A;  3APO A;  5GSS A;  2EIQ A;  3F8U A;  3LXZ A;  1FG4 A;  1QFN A;  4ID0 A;  5D8I A;  3I6A A;  1SYX A;  1U3A A;  3VLN A;  4FYU A;  3APQ A;  3KTL A;  3GH9 A;  4LMV A;  5H5S A;  2QSI A;  3TKP A;  4L0W A;  3QMX A;  1PSQ A;  2O85 A;  2PMT A;  1F3B A;  3C71 A;  2HSY A;  2L4Q A;  5EPF A;  1PX6 A;  4BWS A;  2HT9 A;  3DD3 A;  2N5A A;  2HSH A;  3ZRE A;  8GSS A;  2H6X A;  1TK8 B;  1XOA A;  2H0G A;  2H1A A;  4IHU A;  1QUW A;  3D4M A;  5F07 A;  2H71 A;  3D0Z A;  3KMO A;  2FA8 A;  4MPF A;  2V6K A;  3FEU A;  2N5B A;  2PBJ A;  2CZ3 A;  1PRX A;  5A4W A;  3EC3 A;  5ECO B;  2JSZ A;  2YZH A;  6GSU A;  3UVT A;  2VD0 A;  4IVF A;  3O6T A;  3A5W A;  4HU9 A;  2GZZ A;  5ELA A;  4LLR A;  1GSY A;  1TRW A;  2HI7 A;  5D9X A;  1R5P A;  2VD1 A;  1G6Y A;  2AYT A;  2HRA A;  3DXB A;  1TU7 A;  2K8V A;  13GS A;  1SL0 B;  1V2A A;  3U5R E;  3EU3 A;  4K6X A;  6GST A;  3UIW A;  4MP4 A;  3TRP A;  5GST A;  5EY6 A;  1Z7R A;  5B8A A;  4PUF C;  3D22 A;  3LG6 A;  3M3M A;  3GX0 A;  1AAZ A;  2FGX A;  3A3T A;  3P90 A;  2H75 A;  1GWC A;  3QR6 A;  5H5R A;  1XW5 A;  4ECB A;  5BMU A;  16GS A;  2WJU A;  2H01 A;  5ID2 A;  1SK0 A;  3C8E A;  4F82 A;  1EEM A;  4YQM A;  3LSZ A;  2C0G A;  2DMM A;  3LYK A;  4MNN A;  3WGD A;  4FYB A;  5IMC A;  1VRS D;  3I9V 2;  2DJJ A;  3DGQ A;  3ERG A;  2GT5 A;  4HDE A;  3ZVJ D;  1EP7 A;  1B4P A;  5J4U A;  1RQM A;  1HQO A;  1QMV A;  2CX3 A;  4JR6 A;  3TKR A;  3UL3 A;  4RQR A;  2IWT A;  4ZXG A;  1M9A A;  2DJ0 A;  10GS A;  4HEA 2;  2FWF A;  5G1L A;  4IQ1 A;  2RM5 A;  1GSQ A;  3GKM A;  1AC1 A;  2E2M A;  2VCT A;  1QGV A;  5CP1 A;  4N11 A;  1ERT A;  4RUV A;  3UAP A;  1V58 A;  3HD5 A;  3IXR A;  4L8E A;  1FB0 A;  1EGO A;  2H0H A;  1WE0 A;  2G2Q A;  2DLX A;  3PPU A;  1SJZ A;  2YJ7 A;  2FLS A;  4O5R A;  1TI3 A;  2N5F A;  3L9S A;  4MLY A;  3L9U A;  2VL9 A;  2GGT A;  2GST A;  3BD2 A;  2JL4 A;  1EGR A;  4KUN A;  1PA3 A;  2HXK A;  2DKI A;  5B6M A;  4WBR D;  1FHE A;  5C04 A;  5ECH B;  1JHB A;  2OE3 A;  3IA1 A;  3VI5 A;  3F3Q A;  1XBS A;  1VF1 A;  5ABR A;  1B48 A;  1GTB A;  4AJ6 A;  2VOC A;  4GXZ A;  4PXO A;  1EZK A;  4X1U A;  5CRW A;  4ISD A;  2AJQ B;  3IPZ A;  5G31 A;  2FY6 A;  3MSZ A;  5F06 A;  4JBB A;  1TRV A;  2VCV A;  1Q4J A;  1SD9 A;  3A2X A;  2LV3 A;  2DJ3 A;  4N0V A;  3GST A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...