3UJ1A

Crystal structure of the third thioredoxin domain of human erp46
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
106
structure length
99
Chain Sequence
TVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTWEELSKGVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHRFVLSQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Thioredoxin domain-containing protein 5
publication title Peptide Binding by Catalytic Domains of the Protein Disulfide Isomerase-Related Protein ERp46.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 99
sequence length 106
ec nomenclature
pdb deposition date 2011-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3uj1A00
3L4NA 4NAXA 3O6TA 1YF0A 2CT6A 4L8EA 4DSQA 3CBUA 4MJCA 4RI7A 4HS1A 2F51A 2WJUA 2X8HA 3IXRA 5DCGA 4L5OA 5IOWA 4ZB6A 1EP8A 5ECHB 3F8UA 1GSFA 1V2AA 2DC5A 1DBYA 3C1RA 5HR1A 1KNGA 1NSWA 3K8NA 4ZBAA 2CAQA 4ID0A 1PKWA 4JBBA 3GIXA 2GSRA 4Q5NA 2GQKA 4PNFA 1PMTA 1O73A 4RQRA 2JACA 3Q19A 5L71A 1GNEA 2N5AA 3GL5A 5ECOB 1OE7A 2P31A 2PGTA 2NTOA 1HNBA 4LA1A 2DJJA 4XS4A 3KEBA 2B5XA 4ZBBA 3E9JB 4PUFC 1UVZA 3ERWA 4K8MA 2V41A 4EDZA 3EINA 1AIUA 4X43A 3GA4A 5DQYA 3KMNA 2CZ3A 1SU9A 3CSHA 4WR4A 5G5FA 3C71A 3BJ5A 3UOMA 2IMEA 3VPQA 1XOAA 2BMXA 4EE0A 2PMTA 1G6WA 4TXVA 1RQMA 1AUCA 3KXOA 5AN1A 1XW9A 2EIOA 2YJ7A 2GSSA 1EV4A 2DIZA 5A5KA 2JSZA 3P8WA 4GXZA 18GSA 3ZITA 2R2JA 1OVNA 2FWFA 5DQSA 3EU3A 2F9SA 2H30A 3IPZA 2LSTA 4DSSB 1M0UA 2O8VB 2C0EA 1WPIA 2H70A 2EIQA 4MJEA 3HYPA 2FD3A 1YF1A 1W4VA 3EYTA 2AAWA 2YNXA 3FZ4A 1SL0B 5CRDA 2A4VA 4BVYA 4GSSA 4YQVA 1TU8A 2CV4A 4OFTA 5DDLA 1Z9HA 2AYTA 3VK9A 4RUVA 2E2GA 5ELGA 3D0ZA 3BCKA 1F2EA 1G7EA 2B6MA 1Z6NA 1ERVA 4ML6A 4FYBA 4QQ7A 1I5GA 2B7KA 2FUG2 4ECIA 1QXHA 2LRNA 2QKEA 4MDCA 1B48A 3C7MA 1YDKA 4MZBA 3VI5A 4HOJA 4F03A 1K0NA 1FO5A 3JCML 1GUHA 4YAPA 2YANA 4Q5QA 5IQYA 4WXTA 2DJ1A 3M1GA 4HJ2A 2MBTA 4EC0A 4JRRA 2XPEA 2R3XA 3LG6A 3HZ8A 2HZEA 4I8BA 2TIRA 4EUYA 2LS5A 3TKQA 4GWRA 1MD4A 3FZ9A 3HA9A 3LXTA 3ZZXA 2GQLA 3HJOA 5KN1A 1PQNA 2LNTA 3ZFBA 2R6KA 1QK8A 3W8JA 1PSQA 3GX0A 4ECJA 1SJZA 3S9FA 1X0RA 3H1NA 5HR0A 4JR6A 3C1SA 2LKUA 3E0UA 2IN3A 1JZDA 3M9JA 3GKKA 3QPMA 4K9ZA 2XBIA 1EEJA 3GTUA 1TK0B 3GL3A 2CVDA 1MDJA 1KBNA 1YY7A 1Z3EA 4YQMA 5KN0A 2HNLA 2J23A 4WR5A 3APQA 3Q6OA 3IA1A 2L4CA 4MK3A 1ZYEA 6GSXA 3GH6A 4HUAA 1T4ZA 1SK2A 1TI1A 1AQXA 2C3QA 3FW2A 3HCZA 1Z5YE 1MDIA 5GAND 2ALBA 4WEYA 2NVLA 4KUNA 1J0FA 1XFLA 1O81A 4HQZA 5J41A 3F9UA 1AXDA 4TR3A 5CP1A 4ZIJA 4CW9A 5DBQA 3TOUA 3WGDA 2XPDA 1N8JA 1T00A 2OE0A 1BAYA 5F0GA 5ECRB 1DE1A 1IYHA 3QFBC 3IK7A 4K7OA 1J9BA 1GH2A 2B5EA 2KUCA 3EMPA 2E0QA 4H86A 4IQAA 3L78A 2VCWA 5ECLB 1OC8A 19GSA 3TRXA 1K0BA 4RI6A 2O89A 4X1UA 1YEPA 2MMNA 3KH9A 4MZCA 5IO0A 3QMXA 3TJKA 1B8XA 1XIYA 5JCWA 1G0TA 3HZ4A 4D73B 4MF6A 1GSUA 5CYYA 1GTUA 4NHWA 2KHPA 4LMVA 3LORA 1PKZA 4FO5A 2VCZA 2JZRA 3HD5A 1HNAA 4NV5A 2DJ3A 2YN1A 2C4JA 2GDRA 2RIIA 5H5RA 4KA0A 4K1FA 1SL1B 4K0NA 1EP7A 1FB6A 1A24A 3KM6A 2PUKC 5IO2A 3IBHA 2C3NA 1M2BA 2L5OA 2DJKA 4WF5A 4HU9A 1G7OA 2DMLA 2GQMA 2B3SA 2DIYA 1F37A 1ML6A 2IFQA 1SKSB 2TRXA 3FY7A 4IKHA 2FNOA 1V58A 5G30A 3UBLA 5C00A 1DSBA 2VL9A 1Z7PA 2K9FA 2ON7A 3HDCA 5D8IA 3M8NA 1R26A 1TP9A 5KN3A 2F8FA 2IMDA 2LRCA 2L5LA 5ECQB 4TXOB 4OD7A 2JL4A 1PX7A 1K0AA 14GSA 3L9UA 2FWHA 2I81A 3RPPA 1X5EA 3VLNA 4K6XA 1ERUA 3I6AA 2KOKA 3GNJA 1KEBA 2QGVA 5ECSA 3TB2A 5KEJA 3A3TA 1ZGNA 4TN8A 3KP8A 3J7Yb 4HDEA 1WJKA 4GLTA 3FRCA 1PL1A 1JZRA 3GHAA 2WRTA 4MJAA 2NBSA 1BG5A 1VGLA 2XBQA 1SD9A 4WF4A 2YWOA 1USBA 3PH9A 3D4TA 4ISDA 2H75A 4BVXA 2D2ZA 2H0HA 2H76A 2HYXA 5G31A 3US3A 3W8SA 3TKPA 4ZILA 2CVKA 1O85A 3V1WA 3F63A 5B7CA 1GULA 2JZSA 3MNGA 2HSYA 1S3AA 4TR1A 6GSUA 1Q4JA 2ON5A 3NOFA 3KH7A 6GSWA 3VPTA 4BWQA 4POLA 3GSSA 3HKRA 1TJDA 2E7PA 2OACA 5LD0A 1X5CA 2YJHA 2OJLA 5H5QA 4EO3A 1MD3A 3A2WA 3APOA 3QDNA 3QR6A 4XS6A 3CYNA 4MF5A 5A4WA 4MZWA 2XC2A 2OA7A 4I6XA 1YKCA 2VD0A 3D21A 1HD2A 4G10A 4HU7A 4POMA 4TRXA 4TXOA 5J5NA 1EOGA 3BCIA 2VCTA 3F4RA 1K0DA 2PVQA 2TRCP 2K18A 1BQ7A 3GUSA 1PRXA 2IIYA 3DIEA 2YWMA 3QOUA 4DSRA 2RUEA 3UVHA 1B9YC 3PINA 3WGXA 2O7KA 4KDXA 1K3OA 3TKSC 5GAPD 1TDIA 4WETA 5ECMB 4JU5A 1ON4A 3GMFA 2HT9A 2WULA 3I9V2 2H01A 2PERA 5A4VA 4YQUA 5J9CA 2VUPA 1EZKA 2E2MA 1LBKA 3ZLPA 5ID2B 1G6YA 1KTEA 3UL3A 3GURA 2VL3A 3TKRA 2HRNA 3MWHA 1AAZA 4QL9A 17GSA 1SYXA 3UEMA 3RDWA 4ZB8A 1FHEA 3GKXA 3WYWA 4HZ2A 3L9SA 4HJMA 2LJRA 1EWXA 4PQHA 2H1AA 2K6VA 5CRWA 3GN3A 2WGRA 4K2DA 4G9HA 3TKSA 4ZB9A 6GSVA 4KDUA 3LJRA 5LCZA 1XW5A 2AUVA 4HZ4A 1GWCA 1SENA 4IHUA 4Z7XA 4KSOA 4PNGA 1FG4A 4AJ8A 3ZYWA 1TW9A 2GGTA 4OFMA 5G5EA 2LUSA 2C3TA 3RHCA 3P90A 1T7PB 5COHA 4WKWA 2LEGA 3H4KA 1SYRA 1ST9A 4N0ZA 2GZZA 4GF0A 4K7IA 3TDGA 3F4SA 3HJPA 4HQSA 3HXSA 4KDYA 3VWUA 3ISOA 3ZIJA 4POKA 1TI3A 2PWJA 2R4VA 1XBSA 2H1GA 3HVSA 2LQQA 2X8CA 1EGRA 4MP4A 5E59A 3A2XA 2L6DA 5A4UA 2OADA 3FR9A 4WBRD 1A2LA 3F3RA 3DMLA 4L5LA 5FWGA 3PR8A 2CZ2A 1A0FA 3GX8A 4O32A 1TKDB 5IM9A 5B8AA 2WS2A 1A0RP 1OC9B 1RW1A 5DCHA 2MYGA 1I9DA 3GH9A 4YAVA 1TK5B 1GSSA 5CAXA 2YWNA 5D9WA 3LYPA 1TOFA 1OYJA 3OR5A 1TRSA 1VF3A 3HVVA 4IP1A 4EDYA 2H1BA 1T4YA 1R5AA 3EC3A 1PD21 4K7NA 2KP2A 4PUAA 3IAS2 8GSSA 2C80A 1ABAA 4KNDA 3APSA 1NW2A 1O7UA 2H0IA 1ACVA 5FT3A 5INYA 3FK8A 3DVXA 4KW6A 2HI7A 2DBCA 2O85A 5J3RA 2DJ0A 4XCSA 3N9JA 1CQGA 1HQOA 2OE1A 2IPAA 4LMWA 2M80A 4XHMA 1OKDA 1GSDA 4GQFA 2B7JA 3FZAA 5ELAA 3RHBA 4NXIA 3CTFA 4EVMA 4DSSA 2Z9SA 1GP1A 5CREA 4ECBA 1HNCA 22GSA 2K8SA 2RM5A 3LWAA 3L0HA 2C1YA 2VO4A 1YEXA 3DVWA 3QAVA 2FGXA 3GKMA 4K0GA 2H6ZA 1JFUA 2H71A 3QFAC 2WZ9A 1FW1A 3H93A 3BOAA 3CMIA 4IW9A 3VI7A 1AW9A 4IBPA 1M2DA 3ME7A 5ECIB 3ERFA 2DSAA 2FHEA 1GUKA 5DAKB 1BJXA 2EIRA 2HRFA 2I9HA 3TCOA 2X64A 4Q5FA 2G2QA 2H0GA 4F0CA 4V2MA 4IJIA 2HSHA 5HFGA 4XRAA 2FY6A 3NIVA 2OBKA 2FWGA 2DJ2A 2NPBA 2C0GA 3EU4A 2IMKA 1XVWA 4ILFA 1LJRA 5IPHA 2VCQA 2HZFA 2JSYA 2IMFA 3R2QA 2GT6A 4I5QA 5IMCA 3KJYA 2H19A 1SJIA 4ECCA 1Y25A 3LSZA 1M99A 1R7HA 3FR6A 4Q5RA 2P5RA 1K0OA 1GRXA 4J56E 4EF0A 4KB3A 1J08A 2LQOA 1O8XA 4RQXA 3VWXA 1WMJA 4BPYA 4KH7A 2GS3A 3DYRA 3F0IA 4XS1A 3TOTA 4IN0A 2PPTA 2VLVA 5EY6A 5D9TA 2GSQA 3GRXA 4GSTA 4MLYA 5DVBA 4PQ1A 3C8EA 2GZPA 2QC7A 1SK1A 3EVIA 4TW5A 1U3AA 1E2YA 1Q98A 5HFIA 3UMAA 1JLVA 2VAFA 3DXBA 2G0FA 3TJGA 1JHBA 1ZYQB 2C0DA 3IHQA 5CRHA 3RAZA 1XOBA 3BD2A 1THXA 1XXUA 4N11A 2GTUA 4TR0A 3MSZA 3IOSA 2H1DA 2YP6A 3ZVJD 1TRUA 2YOIA 3EMXA 2A2SA 3I43A 2ES7A 3KTLA 3E3EA 2JU5A 1V9WA 1V98A 1JZOA 4FYUA 4NWYA 2M72A 3IDVA 2V6KA 5B8BA 1MTCA 1AC1A 1V40A 4GSNA 2OKAA 2YV7A 4PGTA 5CO3A 3Q18A 4GQCA 4JR4A 3IK9A 3EE2A 3CTGA 4D73A 4KAEA 5IIZA 5G2ZA 2IL3A 5ECPB 3U5RE 2V32A 3IRAA 1SL2B 3DWVA 1GSEA 3D6IA 4WBJA 1X9MB 1QQ2A 4EL1A 2VCVA 2VLUA 1R5PA 4NV2A 1E6BA 2ZNMA 1S3DA 5J9BA 1GTAA 1XWAA 4V2NA 1U3IA 1JLWA 3VWWA 1BX9A 3LQ7A 3DGQA 3Q74A 3IE3A 4OO4A 4HEA2 2I3YA 5H5SA 3ZRDA 1W89A 4F0BA 4AJ6A 2ZCTA 1VF1A 4X0XA 2CQ9A 5HR2A 2X8GA 3MDKA 4F9ZA 1YZXA 4LL1B 5HFKA 3QD9A 1TXXA 2AB6A 2CVBA 2I4AA 3TGZA 2YPMA 1ZZYA 3IR4A 2LV3A 2L4QA 4NMUA 4OO5A 4G2EA 2YV9A 4POBA 3ZMKA 4XS4B 5IMAA 4TVEA 3KD0A 2IJYA 4G19A 2R37A 1XWBA 1OC3A 4GTUA 2H73A 3IAM2 4OCFA 2P0GA 4KE3A 1F3BA 9GSSA 2FLSA 3RBTA 1T8EB 2YZHA 3KMOA 2HXKA 3TRPA 4LLRA 5D93A 5DJLA 5D73A 1WE0A 1Z7RA 3SWLA 1GL8A 2FA4A 4FIWA 4MA9A 3LGCA 1XWCA 2H6YA 2VM1A 1F6MC 2VM2A 2LTKA 1TU7A 4IS0A 3G9BA 5ECNB 1M9AA 4BWSA 2MMAA 1K3YA 1FOVA 3EWLA 1ERTA 3GV1A 2BJXA 5JCUA 3VWVA 6GSTA 3A2VA 1RK4A 4PURA 2KP1A 4XRDA 1O8WA 1X9SB 3HJMA 2VLTA 2HE3A 2LNSA 3CSJA 7GSSA 2JZTA 1GSQA 2FA8A 1O6JA 5AGYA 1ERWA 1JZWA 4NHZA 4PQIA 2N5FA 2PBJA 3WT2A 4V1Ag 1X9WB 1N2AA 3P7XA 3ERGA 2H8LA 2WCIA 1A2JA 1A8LA 3D5JA 3KCMA 1UC7A 1K3LA 3WGEA 4N10A 5GSSA 2IWTA 2K8VA 2XHFA 4JZQA 1U6TA 2CX4A 2VL2C 5IMVA 2HZEB 5HQPA 5AIXA 3I69A 1GLQA 2V6OA 1C72A 3UBKA 2CAIA 2QSIA 1A2MA 3HVXA 1PN9A 2LRTA 5J4UA 1XWGA 1VF2A 2B5YA 4PXOA 3GYKA 3D22A 1WRYA 4PX1A 1ILOA 4EXJA 1SKWB 3ZMLA 5F07A 4HI7A 5D9XA 4P3YB 1GTIA 3AY8A 4MJBA 4OFNA 2A2RA 1B4PA 2HLSA 5F8BA 3PGTA 3F4TA 16GSA 5DALB 3TJBA 1YJ6A 1XZOA 3O76A 1S3CA 1ZOFA 1GNWA 4I97A 1MDKA 3GTUB 1PX6A 12GSA 2KLXA 1Z6MA 1R4WA 4IP6A 4N0VA 4KCEA 1WWJA 3LXZA 2REMA 4DVCA 4KCAA 1GUMA 5ID2A 1FVJA 2PVOC 4MH3A 1OAZA 4O5RA 2P5QA 2VL2A 5IPGA 3TUEA 5ABRA 5LNKe 4OWYA 3DD3A 5JWOB 3N5OA 2V1MA 4MPGA 4BA7A 4F2IA 3M3MA 5EL8A 4FYCA 1PGTA 2JADA 3M0FA 1XW6A 1ZMAA 4YH2A 4DEJA 1EEMA 1BEDA 3G7IA 1AQWA 3H79A 5ECKB 1UA5A 1ZL9A 3TKSE 1B4QA 3G7JA 5E4WA 2B1LA 4KX4A 2LJAA 3D4MA 3M9KA 3KIJA 3KZQA 4IQ1A 1URMA 1A23A 4LL4B 3KTBA 5CRGA 3QAWA 2AJQB 4MABA 3NZNA 2GT5A 2ZUPA 5IOXA 2MBSA 2DLXA 2RM6A 3GSTA 2EC4A 4ML1A 1QFNA 1AQVA 3F6FA 6GSSA 4ZL7A 4ULXA 2V2GA 2O87A 2GZYA 20GSA 2OE3A 3LYKA 3CSIA 2L57A 1ZCPA 3G7YA 5GSTA 5IMDA 3A5WA 2BTOT 4J2FA 3W6GA 1TTZA 10GSA 3VFIA 5DALA 2PU9C 4TR4A 2F3MA 3WD6A 2H74A 3WT1A 4EKZA 4GRFA 3DKSA 5AISA 2MZCA 2IMIA 3LFLA 3F3QA 1EV9A 1K0MA 4JE1A 1GSYA 1GTBA 4AF2A 1F3AA 4QL7A 1NHOA 1OC9A 3TJJA 2I1UA 1EOHA 2B1KA 3J7Yk 2H72A 1K0CA 1OE8A 2N5BA 4J57E 4ACSA 5G1LA 4MCUA 4V2LA 2OBIA 2WFCA 3GFKA 1PA3A 5CNWA 2IFQB 1X5DA 3TJFA 3O3TA 1IYIA 2VIMA 3MAKA 1YKAA 3TRQA 4CDOA 4F82A 1SD8A 4ZL8A 3CRUA 1F9MA 5HR3A 4V1Ap 3ED3A 4O92A 1SKRB 3QAGA 1QUWA 4CHSA 2H66A 1VF4A 1TRWA 4IJ3A 2NDOA 4KSMA 4L0WA 1XWKA 1WIKA 4ZL9A 2FCHA 1WOUA 3BBYA 4XTSA 5FHIA 1FVKA 1M2AA 3UJ1A 11GSA 1DE2A 3CXGA 5EPFA 5JCGA 1UN2A 5IMFA 1NM3A 1T3BA 3FZ5A 3IV4A 3GKNA 1XPVA 1TK8B 3UARA 5GZZB 2CA8A 5B6NA 3UAPA 3ME8A 1XCCA 4OCEA 2RUFA 2RLIA 2VCXA 5DAKA 3IC4A 5IMZA 2VD1A 2MMOA 1SK0A 3VURA 2J9HA 3P2AA 2L59A 4IELA 4TR1B 4AJ7A 3ZFLA 2GSTA 3HY2A 4KGIA 3ZREA 1H4OA 4ZXGA 4E8EA 2PN8A 2YZUA 1M9BA 4BL7A 5F05A 2VOCA 5D96A 5D9VA 2WB9A 2GLRA 1TRVA 1LU4A 4IVFA 4NPBA 5ENUA 3FEUA 3UIWA 5C04A 4ZBDA 5B6MA 1SJ6A 1PL2A 1M7TA 1VRSD 13GSA 1CQHA 2YWIA 5DJMA 5G1KA 1QMVA 3EURA 2H6XA 3H8QA 3FHKA 4MF7A 1B9XC 3FKFA 1V57A 1U88A 3HHVA 4O7HA 5EVOA 1YQ1A 4FH8A 1Y6EA 4OMVA 4MPFA 3ZIVA 3U6VA 4TOPA 1EGOA 4N30A 4GCIA 5JWQB 1THOA 1QGVA 1A8YA 2DMMA 3L9VA 2HFDA 2CX3A 2LJKA 2F8AA 3RPNA 3FYGA 1NHYA 3FR3A 4MH2A 1XVQA 1GLPA 3F6DA 1U87A 2C0FA 2L6CA 3DRNA 3ZTLA 2C8UA 6GSYA 4IGJA 2R5GA 3CRTA 2X99A 3KP9A 4JEDA 3C73A 3DEXA 2WDUA 1FB0A 4TKYA 1T1VA 2AHEA 3UVTA 1DUGA 4E8HA 4I2TA 5KN2A 4XIHA 1HYUA 2AV4A 1OKTA 2FWEA 3LEFA 1BYEA 1FAAA 3KGKA 5AIVA 3SBCA 5JWRB 3QCPA 4MMMA 5F06A 1WP0A 2GVPA 2M46A 4AGSA 1MEKA 2MMZA 1H75A 4L0UA 2YCDA 3ZVJA 4I2UA 3ZL5A
chains in the Genus database with same CATH superfamily
3L4NA 4NAXA 3O6TA 1YF0A 2CT6A 4L8EA 4DSQA 3CBUA 4MJCA 4RI7A 4HS1A 2F51A 2WJUA 2X8HA 3IXRA 5DCGA 4L5OA 5IOWA 4ZB6A 1EP8A 5ECHB 3F8UA 1GSFA 1V2AA 2DC5A 1DBYA 3C1RA 5HR1A 1KNGA 1NSWA 3K8NA 4ZBAA 2CAQA 4ID0A 1PKWA 4JBBA 3GIXA 2GSRA 4Q5NA 2GQKA 4PNFA 1PMTA 1O73A 4RQRA 2JACA 3R3EA 3Q19A 2R0PA 5L71A 1GNEA 2N5AA 3GL5A 5ECOB 1OE7A 2P31A 2PGTA 2NTOA 1HNBA 4LA1A 2DJJA 4XS4A 3KEBA 2B5XA 4ZBBA 3E9JB 4PUFC 1UVZA 3ERWA 4K8MA 2V41A 4EDZA 3EINA 1AIUA 4X43A 3GA4A 5DQYA 3KMNA 2CZ3A 1SU9A 3CSHA 4WR4A 5BMUA 5G5FA 3C71A 3BJ5A 3UOMA 2IMEA 3VPQA 1XOAA 2BMXA 4EE0A 2PMTA 1G6WA 4TXVA 1RQMA 1AUCA 3KXOA 5AN1A 1XW9A 2EIOA 2YJ7A 2GSSA 1EV4A 2DIZA 5A5KA 2JSZA 3P8WA 4GXZA 18GSA 3ZITA 2R2JA 1OVNA 2FWFA 5DQSA 3EU3A 2F9SA 2H30A 3IPZA 2LSTA 4DSSB 1M0UA 2O8VB 2C0EA 1WPIA 2H70A 2EIQA 4MJEA 3HYPA 2FD3A 1YF1A 1W4VA 3EYTA 2AAWA 2YNXA 3FZ4A 1SL0B 5CRDA 2A4VA 4BVYA 4GSSA 4YQVA 1TU8A 2CV4A 4OFTA 5DDLA 1Z9HA 2AYTA 3VK9A 4RUVA 2E2GA 5ELGA 3D0ZA 3BCKA 1F2EA 1G7EA 2B6MA 1Z6NA 1ERVA 4ML6A 4FYBA 4QQ7A 1I5GA 2B7KA 2FUG2 4ECIA 1QXHA 2LRNA 2QKEA 4MDCA 1B48A 3C7MA 1YDKA 4MZBA 3VI5A 4HOJA 4F03A 1K0NA 1FO5A 3JCML 1GUHA 4YAPA 2YANA 4Q5QA 5IQYA 4WXTA 2DJ1A 3M1GA 4HJ2A 2MBTA 4EC0A 4JRRA 2XPEA 2R0CA 2R3XA 3LG6A 3HZ8A 1S3RA 2HZEA 4I8BA 2TIRA 4EUYA 2LS5A 3TKQA 4GWRA 1MD4A 3FZ9A 3HA9A 3LXTA 3ZZXA 2GQLA 3HJOA 5KN1A 1PQNA 2LNTA 3ZFBA 2R6KA 2UZ8A 1QK8A 3W8JA 1PSQA 3GX0A 4ECJA 1SJZA 2DKIA 3S9FA 1X0RA 3H1NA 5HR0A 4JR6A 3C1SA 2LKUA 3E0UA 2IN3A 1JZDA 3M9JA 3CQFA 3GKKA 3QPMA 4K9ZA 2XBIA 1EEJA 3GTUA 1TK0B 3GL3A 2CVDA 1MDJA 1KBNA 1YY7A 1Z3EA 4YQMA 5KN0A 2HNLA 2J23A 4WR5A 3APQA 3Q6OA 3IA1A 2L4CA 4MK3A 1ZYEA 6GSXA 3GH6A 4HUAA 1T4ZA 1SK2A 1TI1A 1AQXA 2C3QA 3FW2A 3HCZA 1Z5YE 1MDIA 5GAND 2ALBA 4EIQA 4WEYA 2NVLA 4KUNA 1J0FA 1XFLA 1O81A 4HQZA 5J41A 3F9UA 1AXDA 4TR3A 5CP1A 4ZIJA 5BRTA 4CW9A 5DBQA 3TOUA 3WGDA 2XPDA 1N8JA 1T00A 2OE0A 1BAYA 5F0GA 5ECRB 1DE1A 1IYHA 3QFBC 3IK7A 4K7OA 1J9BA 1GH2A 2B5EA 2KUCA 3EMPA 2E0QA 4H86A 4IQAA 3L78A 2VCWA 5ECLB 1OC8A 19GSA 3TRXA 1K0BA 4RI6A 2O89A 4X1UA 1YEPA 2MMNA 3KH9A 4MZCA 5IO0A 3A5IA 3QMXA 3TJKA 1B8XA 1XIYA 5JCWA 1G0TA 3HZ4A 4D73B 4MF6A 1GSUA 5CYYA 1GTUA 4NHWA 2KHPA 4Z2TA 4LMVA 3LORA 1PKZA 4FO5A 2VCZA 2JZRA 3HD5A 1HNAA 4NV5A 2DJ3A 2YN1A 2C4JA 2GDRA 2RIIA 5H5RA 4KA0A 4K1FA 1SL1B 4K0NA 1EP7A 1FB6A 1A24A 3KM6A 2PUKC 5IO2A 3IBHA 2C3NA 2R0GA 1M2BA 4FQUA 2L5OA 2DJKA 4WF5A 4HU9A 1G7OA 2DMLA 2GQMA 2B3SA 4A5PA 2DIYA 1F37A 1ML6A 2IFQA 1SKSB 2TRXA 3FY7A 4IKHA 2FNOA 1V58A 4K5RA 5G30A 3UBLA 5C00A 1DSBA 2VL9A 1Z7PA 2K9FA 2ON7A 3HDCA 5D8IA 3M8NA 1R26A 1TP9A 5KN3A 2F8FA 2IMDA 2LRCA 2L5LA 5ECQB 4TXOB 2HRKA 4OD7A 5KOXA 2JL4A 1PX7A 1K0AA 14GSA 3L9UA 2FWHA 2I81A 3RPPA 1X5EA 3VLNA 4K6XA 1ERUA 3I6AA 2KOKA 2QA2A 3GNJA 1KEBA 2QGVA 5ECSA 3TB2A 5KEJA 3A3TA 4YKFA 1ZGNA 4TN8A 5KOWA 4USSA 3KP8A 3J7Yb 4HDEA 1WJKA 4GLTA 3FRCA 1PL1A 1JZRA 3GHAA 2WRTA 4MJAA 2NBSA 1BG5A 1VGLA 2XBQA 1SD9A 4WF4A 2YWOA 1USBA 3PH9A 3D4TA 4ISDA 2H75A 4BVXA 2D2ZA 2H0HA 2H76A 2HYXA 5G31A 3US3A 3W8SA 3TKPA 4ZILA 2CVKA 1O85A 3V1WA 3F63A 5B7CA 1GULA 2JZSA 3MNGA 2HSYA 1S3AA 4TR1A 6GSUA 1Q4JA 2ON5A 3NOFA 3KH7A 6GSWA 3VPTA 4BWQA 4POLA 3GSSA 3HKRA 1TJDA 2E7PA 2OACA 5LD0A 1X5CA 2YJHA 2OJLA 5H5QA 4EO3A 1MD3A 3A2WA 3APOA 3QDNA 3QR6A 4XS6A 3CYNA 4MF5A 5A4WA 4MZWA 2XC2A 2OA7A 4I6XA 1YKCA 2VD0A 3D21A 1HD2A 4G10A 4HU7A 4POMA 4TRXA 4TXOA 5J5NA 1EOGA 3BCIA 2VCTA 3F4RA 1K0DA 2PVQA 2TRCP 2K18A 1BQ7A 3GUSA 1PRXA 2IIYA 3DIEA 2YWMA 3QOUA 4DSRA 2RUEA 3UVHA 4G0LA 1B9YC 3PINA 3WGXA 2O7KA 4KDXA 4O5QA 1K3OA 3TKSC 5GAPD 1TDIA 4WETA 5ECMB 4JU5A 1ON4A 3GMFA 2HT9A 2WULA 3I9V2 2H01A 2PERA 5A4VA 4YQUA 5J9CA 2VUPA 1EZKA 2E2MA 1LBKA 3ZLPA 5ID2B 1G6YA 1KTEA 3UL3A 3GURA 2VL3A 3TKRA 2HRNA 3MWHA 1AAZA 4QL9A 17GSA 1SYXA 3PPUA 3UEMA 3RDWA 4ZB8A 1FHEA 3GKXA 3WYWA 4HZ2A 3L9SA 4HJMA 2LJRA 1EWXA 4PQHA 2H1AA 2K6VA 5CRWA 3GN3A 2WGRA 4K2DA 4G9HA 3TKSA 4ZB9A 6GSVA 4KDUA 3LJRA 5LCZA 1XW5A 2AUVA 4HZ4A 1GWCA 1SENA 4IHUA 4Z7XA 4KSOA 4PNGA 1FG4A 4AJ8A 3ZYWA 1TW9A 2GGTA 4OFMA 5G5EA 2LUSA 2C3TA 3RHCA 3P90A 1T7PB 5COHA 1XG8A 4WKWA 2LEGA 3H4KA 1SYRA 1ST9A 4N0ZA 2GZZA 4GF0A 4K7IA 3TDGA 3F4SA 3HJPA 4HQSA 3HXSA 4KDYA 3VWUA 3ISOA 3ZIJA 4POKA 1TI3A 2PWJA 2R4VA 1XBSA 2H1GA 3HVSA 2LQQA 2X8CA 4HSCX 1EGRA 4MP4A 5E59A 3A2XA 2L6DA 5A4UA 2OADA 3FR9A 4WBRD 1A2LA 3F3RA 3DMLA 4L5LA 5FWGA 3PR8A 2CZ2A 1A0FA 3GX8A 4O32A 1TKDB 5IM9A 5B8AA 2WS2A 1A0RP 1OC9B 1RW1A 5DCHA 2MYGA 1I9DA 3GH9A 4YAVA 1TK5B 1GSSA 5CAXA 2YWNA 5D9WA 3LYPA 1TOFA 1OYJA 3OR5A 1TRSA 1VF3A 3HVVA 4IP1A 4KF9A 4EDYA 2H1BA 1T4YA 1R5AA 3EC3A 1PD21 4K7NA 2KP2A 4PUAA 2X49A 3IAS2 8GSSA 2C80A 1ABAA 4KNDA 3APSA 1NW2A 1O7UA 2H0IA 1ACVA 5FT3A 5INYA 3FK8A 3DVXA 4KW6A 2HI7A 2DBCA 2O85A 5J3RA 2DJ0A 4XCSA 3N9JA 1CQGA 4PTSA 1HQOA 2OE1A 2IPAA 4LMWA 2M80A 4XHMA 1OKDA 1GSDA 4GQFA 2B7JA 3FZAA 5ELAA 3RHBA 4NXIA 3CTFA 4EVMA 4DSSA 2Z9SA 1GP1A 5CREA 4ECBA 1HNCA 22GSA 2K8SA 2RM5A 3LWAA 3L0HA 2C1YA 2VO4A 1YEXA 3DVWA 3QAVA 2FGXA 3GKMA 4K0GA 2H6ZA 1JFUA 2H71A 4YKGA 3QFAC 2WZ9A 1FW1A 3H93A 3IC8A 4CY8A 3BOAA 3CMIA 4BIKA 4IW9A 3VI7A 1AW9A 4IBPA 1M2DA 3ME7A 5ECIB 4K2XA 3ERFA 2DSAA 2FHEA 1GUKA 5DAKB 1BJXA 2EIRA 2HRFA 2I9HA 4CY6A 3TCOA 2X64A 4Q5FA 2G2QA 2H0GA 4F0CA 4V2MA 4IJIA 3FMWA 2HSHA 5HFGA 4XRAA 2FY6A 3NIVA 2OBKA 2FWGA 2DJ2A 2NPBA 2C0GA 3EU4A 2IMKA 1XVWA 4ILFA 4X4JA 1LJRA 5IPHA 2VCQA 2HZFA 2JSYA 2IMFA 3R2QA 2GT6A 4I5QA 5IMCA 4BL7B 3KJYA 2H19A 1SJIA 4ECCA 1Y25A 3LSZA 1M99A 1R7HA 3FR6A 4Q5RA 2P5RA 1K0OA 1GRXA 4J56E 4EF0A 2A4HA 4KB3A 1J08A 2LQOA 3MIXA 1O8XA 4RQXA 3VWXA 1WMJA 4BPYA 4KH7A 2GS3A 3DYRA 3F0IA 4XS1A 3TOTA 4IN0A 2PPTA 2VLVA 5EY6A 5D9TA 2HSMA 2GSQA 3GRXA 4GSTA 4MLYA 5DVBA 4PQ1A 3C8EA 2GZPA 2QC7A 1SK1A 3EVIA 2DKHA 4TW5A 1U3AA 1E2YA 1Q98A 5HFIA 3UMAA 1JLVA 2VAFA 3DXBA 2G0FA 3TJGA 1JHBA 1ZYQB 2C0DA 3IHQA 5CRHA 3RAZA 1XOBA 3BD2A 1THXA 1XXUA 4N11A 2GTUA 4TR0A 3MSZA 3IOSA 2H1DA 2YP6A 3ZVJD 1TRUA 2YOIA 3EMXA 2A2SA 3I43A 2ES7A 3KTLA 3E3EA 2JU5A 1V9WA 1V98A 1JZOA 4FYUA 4NWYA 2M72A 3IDVA 2V6KA 5B8BA 1MTCA 1AC1A 1V40A 4EIPA 4GSNA 2OKAA 2YV7A 4PGTA 5CO3A 3Q18A 4GQCA 4JR4A 3IK9A 3EE2A 3CTGA 4D73A 4KAEA 4O5UA 5IIZA 5G2ZA 2IL3A 5ECPB 3U5RE 2V32A 3IRAA 1SL2B 3DWVA 1GSEA 3D6IA 4WBJA 1X9MB 1QQ2A 4EL1A 2VCVA 2VLUA 1R5PA 4NV2A 1E6BA 2ZNMA 1S3DA 5J9BA 1GTAA 1XWAA 4V2NA 1U3IA 1JLWA 3VWWA 1BX9A 3LQ7A 3DGQA 3Q74A 3IE3A 4OO4A 4HEA2 2I3YA 5H5SA 3ZRDA 1W89A 4F0BA 4AJ6A 2ZCTA 1VF1A 4X0XA 2CQ9A 5HR2A 2X8GA 3MDKA 4K5SA 4F9ZA 1PN0A 1YZXA 4LL1B 5HFKA 3QD9A 1TXXA 2AB6A 2CVBA 2I4AA 3TGZA 2YPMA 1ZZYA 3IR4A 2LV3A 2L4QA 4NMUA 4OO5A 4G2EA 2YV9A 4POBA 3ZMKA 4XS4B 5IMAA 4TVEA 3KD0A 2IJYA 4G19A 2R37A 1XWBA 1OC3A 4GTUA 2H73A 3IAM2 4OCFA 2P0GA 4KE3A 1F3BA 3LW9A 9GSSA 2FLSA 3RBTA 1T8EB 2YZHA 3KMOA 2HXKA 3TRPA 4LLRA 5D93A 5DJLA 5D73A 1WE0A 1Z7RA 3SWLA 1GL8A 2FA4A 4FIWA 4MA9A 3LGCA 1XWCA 2H6YA 2VM1A 1F6MC 2VM2A 2LTKA 1TU7A 4IS0A 3G9BA 5ECNB 1M9AA 4Z2RA 4BWSA 2MMAA 1K3YA 1FOVA 3EWLA 1ERTA 1FOHA 3GV1A 2BJXA 5JCUA 3VWVA 6GSTA 4G0IA 3A2VA 1RK4A 4PURA 2KP1A 4XRDA 1O8WA 1X9SB 3HJMA 2VLTA 2HE3A 2LNSA 3CSJA 4BVYB 7GSSA 2JZTA 1GSQA 2FA8A 1O6JA 5AGYA 1ERWA 1JZWA 4NHZA 4PQIA 2N5FA 2PBJA 3WT2A 4V1Ag 1X9WB 1N2AA 3P7XA 3ERGA 2H8LA 2WCIA 1A2JA 1A8LA 3D5JA 3KCMA 1UC7A 1K3LA 3WGEA 4N10A 5GSSA 2IWTA 2K8VA 2XHFA 4JZQA 1U6TA 2CX4A 2VL2C 5IMVA 2QA1A 2HZEB 5HQPA 5AIXA 3I69A 1GLQA 2V6OA 1C72A 3UBKA 2CAIA 2QSIA 4Z2UA 1A2MA 3HVXA 1PN9A 2LRTA 5J4UA 1XWGA 1VF2A 2B5YA 4PXOA 3GYKA 3D22A 1WRYA 4PX1A 1ILOA 4EXJA 1SKWB 3ZMLA 5F07A 4HI7A 5D9XA 4P3YB 1GTIA 3AY8A 4MJBA 4OFNA 2A2RA 1B4PA 4ICYA 2HLSA 5F8BA 3PGTA 3F4TA 16GSA 5DALB 3TJBA 1YJ6A 1XZOA 3O76A 1S3CA 1ZOFA 1GNWA 4I97A 1MDKA 3GTUB 1PX6A 12GSA 2KLXA 1Z6MA 1R4WA 4IP6A 4N0VA 4KCEA 1WWJA 3LXZA 2REMA 4DVCA 4KCAA 1GUMA 5ID2A 1FVJA 2PVOC 4MH3A 1OAZA 4O5RA 2P5QA 2VL2A 5IPGA 3TUEA 5ABRA 5LNKe 4OWYA 3DD3A 5JWOB 3N5OA 2V1MA 4MPGA 4BA7A 4F2IA 3M3MA 5EL8A 4FYCA 1PGTA 2JADA 3M0FA 1XW6A 1ZMAA 4YH2A 4DEJA 1EEMA 1BEDA 3G7IA 1AQWA 3H79A 5ECKB 1UA5A 1ZL9A 3TKSE 1B4QA 3G7JA 5E4WA 2B1LA 4KX4A 2LJAA 3D4MA 3M9KA 3KIJA 3KZQA 4IQ1A 1URMA 1A23A 4LL4B 3KTBA 5CRGA 3QAWA 2AJQB 3EPTA 4MABA 3NZNA 2GT5A 2ZUPA 5IOXA 2MBSA 2DLXA 2RM6A 3GSTA 3MYDA 2EC4A 3IHGA 4ML1A 1QFNA 1AQVA 3F6FA 6GSSA 4ZL7A 4ULXA 2V2GA 2O87A 2GZYA 20GSA 2OE3A 3LYKA 3CSIA 2A2PA 2L57A 1ZCPA 3G7YA 5GSTA 5IMDA 3A5WA 1ZYPA 2BTOT 4J2FA 3W6GA 1TTZA 10GSA 3VFIA 5DALA 2PU9C 4TR4A 2F3MA 3WD6A 2H74A 3WT1A 4EKZA 4GRFA 3DKSA 5AISA 2MZCA 2IMIA 3LFLA 3F3QA 1EV9A 1K0MA 4JE1A 1GSYA 1GTBA 4AF2A 1F3AA 4QL7A 1NHOA 1OC9A 1M3JA 3TJJA 2I1UA 1EOHA 2B1KA 3J7Yk 2H72A 1K0CA 1OE8A 2N5BA 4J57E 4ACSA 5G1LA 4MCUA 4V2LA 2OBIA 2HRAA 2WFCA 3GFKA 1M3IA 1PA3A 5CNWA 2IFQB 1X5DA 3TJFA 3O3TA 1IYIA 2VIMA 3MAKA 1YKAA 3TRQA 4CDOA 4F82A 1SD8A 4ZL8A 3CRUA 1F9MA 5HR3A 4V1Ap 3ED3A 4O92A 1SKRB 3QAGA 1QUWA 4CHSA 2H66A 1VF4A 1TRWA 4IJ3A 2NDOA 2X4AA 4KSMA 4L0WA 1XWKA 1WIKA 4ZL9A 2FCHA 1WOUA 3BBYA 4XTSA 5FHIA 1FVKA 1M2AA 3UJ1A 11GSA 1DE2A 4G0KA 3CXGA 5EPFA 5JCGA 1UN2A 5IMFA 1NM3A 1T3BA 3FZ5A 1PFOA 3IV4A 3GKNA 1XPVA 1TK8B 3UARA 5GZZB 2CA8A 5B6NA 3UAPA 3ME8A 1XCCA 4OCEA 2RUFA 4BVXB 2RLIA 2VCXA 5DAKA 3IC4A 5IMZA 2VD1A 2MMOA 1SK0A 3VURA 2J9HA 3P2AA 2L59A 4IELA 4TR1B 4AJ7A 3ZFLA 2GSTA 3HY2A 4KGIA 3ZREA 1H4OA 4ZXGA 4E8EA 2PN8A 2YZUA 1M9BA 4BL7A 1ZYNA 5F05A 2VOCA 5D96A 5D9VA 2WB9A 2GLRA 1TRVA 1LU4A 4IVFA 4NPBA 5ENUA 3FEUA 3UIWA 5C04A 4ZBDA 5B6MA 1SJ6A 1PL2A 1M7TA 1VRSD 13GSA 1CQHA 2YWIA 5DJMA 5G1KA 3HVNA 1QMVA 3EURA 2H6XA 3H8QA 3FHKA 4MF7A 1B9XC 3FKFA 1V57A 1U88A 3HHVA 4O7HA 5EVOA 1YQ1A 4FH8A 1Y6EA 4OMVA 4MPFA 3ZIVA 3U6VA 4TOPA 4MNNA 1EGOA 4N30A 4GCIA 5JWQB 1THOA 1QGVA 1A8YA 2DMMA 3L9VA 2HFDA 2CX3A 2LJKA 2F8AA 3RPNA 3FYGA 1NHYA 3FR3A 4MH2A 1XVQA 1GLPA 3F6DA 1U87A 2C0FA 2L6CA 3DRNA 3ZTLA 2C8UA 6GSYA 4IGJA 2R5GA 3CRTA 2X99A 3KP9A 4JEDA 3C73A 3DEXA 2WDUA 1FB0A 4TKYA 1T1VA 2AHEA 3UVTA 1DUGA 4E8HA 4I2TA 5KN2A 4XIHA 1HYUA 2AV4A 1OKTA 2FWEA 3LEFA 1BYEA 1FAAA 3KGKA 5AIVA 3SBCA 5JWRB 3QCPA 4MMMA 5F06A 1WP0A 2GVPA 2M46A 4AGSA 1MEKA 2MMZA 1H75A 4L0UA 2YCDA 3ZVJA 4I2UA 3ZL5A
chains in the Genus database with same CATH topology
3L4NA 4NAXA 3O6TA 1YF0A 2CT6A 4L8EA 4DSQA 3CBUA 4MJCA 4RI7A 4HS1A 2F51A 2WJUA 2X8HA 3IXRA 5DCGA 4L5OA 5IOWA 4ZB6A 1EP8A 5ECHB 3F8UA 1GSFA 1V2AA 2DC5A 1DBYA 3C1RA 5HR1A 1KNGA 1NSWA 3K8NA 4ZBAA 2CAQA 4ID0A 1PKWA 4JBBA 3GIXA 2GSRA 4Q5NA 2GQKA 4PNFA 1PMTA 1O73A 4RQRA 2JACA 3R3EA 3Q19A 2R0PA 5L71A 1GNEA 2N5AA 3GL5A 5ECOB 1OE7A 2P31A 2PGTA 2NTOA 1HNBA 4LA1A 2DJJA 4XS4A 3KEBA 2B5XA 4ZBBA 3E9JB 4PUFC 1UVZA 3ERWA 4K8MA 2V41A 4EDZA 3EINA 1AIUA 4X43A 3GA4A 5DQYA 3KMNA 2CZ3A 1SU9A 3CSHA 4WR4A 5BMUA 5G5FA 3C71A 3BJ5A 3UOMA 2IMEA 3VPQA 1XOAA 2BMXA 4EE0A 2PMTA 1G6WA 4TXVA 1RQMA 1AUCA 3KXOA 5AN1A 1XW9A 2EIOA 2YJ7A 2GSSA 1EV4A 2DIZA 5A5KA 2JSZA 3P8WA 4GXZA 18GSA 3ZITA 2R2JA 1OVNA 2FWFA 5DQSA 3EU3A 2F9SA 2H30A 3IPZA 2LSTA 4DSSB 1M0UA 2O8VB 2C0EA 1WPIA 2H70A 2EIQA 4MJEA 3HYPA 2FD3A 1YF1A 1W4VA 3EYTA 2AAWA 2YNXA 3FZ4A 1SL0B 5CRDA 2A4VA 4BVYA 4GSSA 4YQVA 1TU8A 2CV4A 4OFTA 5DDLA 1Z9HA 2AYTA 3VK9A 4RUVA 2E2GA 5ELGA 3D0ZA 3BCKA 1F2EA 1G7EA 2B6MA 1Z6NA 1ERVA 4ML6A 4FYBA 4QQ7A 1I5GA 2B7KA 2FUG2 4ECIA 1QXHA 2LRNA 2QKEA 4MDCA 1B48A 3C7MA 1YDKA 4MZBA 3VI5A 4HOJA 4F03A 1K0NA 1FO5A 3JCML 1GUHA 4YAPA 2YANA 4Q5QA 5IQYA 4WXTA 2DJ1A 3M1GA 4HJ2A 2MBTA 4EC0A 4JRRA 2XPEA 2R0CA 2R3XA 3LG6A 3HZ8A 2HZEA 4I8BA 2TIRA 4EUYA 2LS5A 3TKQA 4GWRA 1MD4A 3FZ9A 3HA9A 3LXTA 3ZZXA 2GQLA 3HJOA 5KN1A 1PQNA 2LNTA 3ZFBA 2R6KA 2UZ8A 1QK8A 3W8JA 1PSQA 3GX0A 4ECJA 1SJZA 2DKIA 3S9FA 1X0RA 3H1NA 5HR0A 4JR6A 3C1SA 2LKUA 3E0UA 2IN3A 1JZDA 3M9JA 3GKKA 3QPMA 4K9ZA 2XBIA 1EEJA 3GTUA 1TK0B 3GL3A 2CVDA 1MDJA 1KBNA 1YY7A 1Z3EA 4YQMA 5KN0A 2HNLA 2J23A 4WR5A 3APQA 3Q6OA 3IA1A 2L4CA 4MK3A 1ZYEA 6GSXA 3GH6A 4HUAA 1T4ZA 1SK2A 1TI1A 1AQXA 2C3QA 3FW2A 3HCZA 1Z5YE 1MDIA 5GAND 2ALBA 4EIQA 4WEYA 2NVLA 4KUNA 1J0FA 1XFLA 1O81A 4HQZA 5J41A 3F9UA 1AXDA 4TR3A 5CP1A 4ZIJA 5BRTA 4CW9A 5DBQA 3TOUA 3WGDA 2XPDA 1N8JA 1T00A 2OE0A 1BAYA 5F0GA 5ECRB 1DE1A 1IYHA 3QFBC 3IK7A 4K7OA 1J9BA 1GH2A 2B5EA 2KUCA 3EMPA 2E0QA 4H86A 4IQAA 3L78A 2VCWA 5ECLB 1OC8A 19GSA 3TRXA 1K0BA 4RI6A 2O89A 4X1UA 1YEPA 2MMNA 3KH9A 4MZCA 5IO0A 3A5IA 3QMXA 3TJKA 1B8XA 1XIYA 5JCWA 1G0TA 3HZ4A 4D73B 4MF6A 1GSUA 5CYYA 1GTUA 4NHWA 2KHPA 4Z2TA 4LMVA 3LORA 1PKZA 4FO5A 2VCZA 2JZRA 3HD5A 1HNAA 4NV5A 2DJ3A 2YN1A 2C4JA 2GDRA 2RIIA 5H5RA 4KA0A 4K1FA 1SL1B 4K0NA 1EP7A 1FB6A 1A24A 3KM6A 2PUKC 5IO2A 3IBHA 2C3NA 2R0GA 1M2BA 4FQUA 2L5OA 2DJKA 4WF5A 4HU9A 1G7OA 2DMLA 2GQMA 2B3SA 4A5PA 2DIYA 1F37A 1ML6A 2IFQA 1SKSB 2TRXA 3FY7A 4IKHA 2FNOA 1V58A 4K5RA 5G30A 3UBLA 5C00A 1DSBA 2VL9A 1Z7PA 2K9FA 2ON7A 3HDCA 5D8IA 3M8NA 1R26A 1TP9A 5KN3A 2F8FA 2IMDA 2LRCA 2L5LA 5ECQB 4TXOB 2HRKA 4OD7A 5KOXA 2JL4A 1PX7A 1K0AA 14GSA 3L9UA 2FWHA 2I81A 3RPPA 1X5EA 3VLNA 4K6XA 1ERUA 3I6AA 2KOKA 2QA2A 3GNJA 1KEBA 2QGVA 5ECSA 3TB2A 5KEJA 3A3TA 4YKFA 1ZGNA 4TN8A 5KOWA 4USSA 3KP8A 3J7Yb 4HDEA 1WJKA 4GLTA 3FRCA 1PL1A 1JZRA 3GHAA 2WRTA 4MJAA 2NBSA 1BG5A 1VGLA 2XBQA 1SD9A 4WF4A 2YWOA 1USBA 3PH9A 3D4TA 4ISDA 2H75A 4BVXA 2D2ZA 2H0HA 2H76A 2HYXA 5G31A 3US3A 3W8SA 3TKPA 4ZILA 2CVKA 1O85A 3V1WA 3F63A 5B7CA 1GULA 2JZSA 3MNGA 2HSYA 1S3AA 4TR1A 6GSUA 1Q4JA 2ON5A 3NOFA 3KH7A 6GSWA 3VPTA 4BWQA 4POLA 3GSSA 3HKRA 1TJDA 2E7PA 2OACA 5LD0A 1X5CA 2YJHA 2OJLA 5H5QA 4EO3A 1MD3A 3A2WA 3APOA 3QDNA 3QR6A 4XS6A 3CYNA 4MF5A 5A4WA 4MZWA 2XC2A 2OA7A 4I6XA 1YKCA 2VD0A 3D21A 1HD2A 4G10A 4HU7A 4POMA 4TRXA 4TXOA 5J5NA 1EOGA 3BCIA 2VCTA 3F4RA 1K0DA 2PVQA 2TRCP 2K18A 1BQ7A 3GUSA 1PRXA 2IIYA 3DIEA 2YWMA 3QOUA 4DSRA 2RUEA 3UVHA 4G0LA 1B9YC 3PINA 3WGXA 2O7KA 4KDXA 4O5QA 1K3OA 3TKSC 5GAPD 1TDIA 4WETA 5ECMB 4JU5A 1ON4A 3GMFA 2HT9A 2WULA 3I9V2 2H01A 2PERA 5A4VA 4YQUA 5J9CA 2VUPA 1EZKA 2E2MA 1LBKA 3ZLPA 5ID2B 1G6YA 1KTEA 3UL3A 3GURA 2VL3A 3TKRA 2HRNA 3MWHA 1AAZA 4QL9A 17GSA 1SYXA 3PPUA 3UEMA 3RDWA 4ZB8A 1FHEA 3GKXA 3WYWA 4HZ2A 3L9SA 4HJMA 2LJRA 1EWXA 4PQHA 2H1AA 2K6VA 5CRWA 3GN3A 2WGRA 4K2DA 4G9HA 3TKSA 4ZB9A 6GSVA 4KDUA 3LJRA 5LCZA 1XW5A 2AUVA 4HZ4A 1GWCA 1SENA 4IHUA 4Z7XA 4KSOA 4PNGA 1FG4A 4AJ8A 3ZYWA 1TW9A 2GGTA 4OFMA 5G5EA 2LUSA 2C3TA 3RHCA 3P90A 1T7PB 5COHA 4WKWA 2LEGA 3H4KA 1SYRA 1ST9A 4N0ZA 2GZZA 4GF0A 4K7IA 3TDGA 3F4SA 3HJPA 4HQSA 3HXSA 4KDYA 3VWUA 3ISOA 3ZIJA 4POKA 1TI3A 2PWJA 2R4VA 1XBSA 2H1GA 3HVSA 2LQQA 2X8CA 1EGRA 4MP4A 5E59A 3A2XA 2L6DA 5A4UA 2OADA 3FR9A 4WBRD 1A2LA 3F3RA 3DMLA 4L5LA 5FWGA 3PR8A 2CZ2A 1A0FA 3GX8A 4O32A 1TKDB 5IM9A 5B8AA 2WS2A 1A0RP 1OC9B 1RW1A 5DCHA 2MYGA 1I9DA 3GH9A 4YAVA 1TK5B 1GSSA 5CAXA 2YWNA 5D9WA 3LYPA 1TOFA 1OYJA 3OR5A 1TRSA 1VF3A 3HVVA 4IP1A 4KF9A 4EDYA 2H1BA 1T4YA 1R5AA 3EC3A 1PD21 4K7NA 2KP2A 4PUAA 2X49A 3IAS2 8GSSA 2C80A 1ABAA 4KNDA 3APSA 1NW2A 1O7UA 2H0IA 1ACVA 5FT3A 5INYA 3FK8A 3DVXA 4KW6A 2HI7A 2DBCA 2O85A 5J3RA 2DJ0A 4XCSA 3N9JA 1CQGA 4PTSA 1HQOA 2OE1A 2IPAA 4LMWA 2M80A 4XHMA 1OKDA 1GSDA 4GQFA 2B7JA 3FZAA 5ELAA 3RHBA 4NXIA 3CTFA 4EVMA 4DSSA 2Z9SA 1GP1A 5CREA 4ECBA 1HNCA 22GSA 2K8SA 2RM5A 3LWAA 3L0HA 2C1YA 2VO4A 1YEXA 3DVWA 3QAVA 2FGXA 3GKMA 4K0GA 2H6ZA 1JFUA 2H71A 4YKGA 3QFAC 2WZ9A 1FW1A 3H93A 3IC8A 4CY8A 3BOAA 3CMIA 4IW9A 3VI7A 1AW9A 4IBPA 1M2DA 3ME7A 5ECIB 4K2XA 3ERFA 2DSAA 2FHEA 1GUKA 5DAKB 1BJXA 2EIRA 2HRFA 2I9HA 4CY6A 3TCOA 2X64A 4Q5FA 2G2QA 2H0GA 4F0CA 4V2MA 4IJIA 3FMWA 2HSHA 5HFGA 4XRAA 2FY6A 3NIVA 2OBKA 2FWGA 2DJ2A 2NPBA 2C0GA 3EU4A 2IMKA 1XVWA 4ILFA 4X4JA 1LJRA 5IPHA 2VCQA 2HZFA 2JSYA 2IMFA 3R2QA 2GT6A 4I5QA 5IMCA 4BL7B 3KJYA 2H19A 1SJIA 4ECCA 1Y25A 3LSZA 1M99A 1R7HA 3FR6A 4Q5RA 2P5RA 1K0OA 1GRXA 4J56E 4EF0A 2A4HA 4KB3A 1J08A 2LQOA 3MIXA 1O8XA 4RQXA 3VWXA 1WMJA 4BPYA 4KH7A 2GS3A 3DYRA 3F0IA 4XS1A 3TOTA 4IN0A 2PPTA 2VLVA 5EY6A 5D9TA 2HSMA 2GSQA 3GRXA 4GSTA 4MLYA 5DVBA 4PQ1A 3C8EA 2GZPA 2QC7A 1SK1A 3EVIA 2DKHA 4TW5A 1U3AA 1E2YA 1Q98A 5HFIA 3UMAA 1JLVA 2VAFA 3DXBA 2G0FA 3TJGA 1JHBA 1ZYQB 2C0DA 3IHQA 5CRHA 3RAZA 1XOBA 3BD2A 1THXA 1XXUA 4N11A 2GTUA 4TR0A 3MSZA 3IOSA 2H1DA 2YP6A 3ZVJD 1TRUA 2YOIA 3EMXA 2A2SA 3I43A 2ES7A 3KTLA 3E3EA 2JU5A 1V9WA 1V98A 1JZOA 4FYUA 4NWYA 2M72A 3IDVA 2V6KA 5B8BA 1MTCA 1AC1A 1V40A 4EIPA 4GSNA 2OKAA 2YV7A 4PGTA 5CO3A 3Q18A 4GQCA 4JR4A 3IK9A 3EE2A 3CTGA 4D73A 4KAEA 4O5UA 5IIZA 5G2ZA 2IL3A 5ECPB 3U5RE 2V32A 3IRAA 1SL2B 3DWVA 1GSEA 3D6IA 4WBJA 1X9MB 1QQ2A 4EL1A 2VCVA 2VLUA 1R5PA 4NV2A 1E6BA 2ZNMA 1S3DA 5J9BA 1GTAA 1XWAA 4V2NA 1U3IA 1JLWA 3VWWA 1BX9A 3LQ7A 3DGQA 3Q74A 3IE3A 4OO4A 4HEA2 2I3YA 5H5SA 3ZRDA 1W89A 4F0BA 4AJ6A 2ZCTA 1VF1A 4X0XA 2CQ9A 5HR2A 2X8GA 3MDKA 4K5SA 4F9ZA 1PN0A 1YZXA 4LL1B 5HFKA 3QD9A 1TXXA 2AB6A 2CVBA 2I4AA 3TGZA 2YPMA 1ZZYA 3IR4A 2LV3A 2L4QA 4NMUA 4OO5A 4G2EA 2YV9A 4POBA 3ZMKA 4XS4B 5IMAA 4TVEA 3KD0A 2IJYA 4G19A 2R37A 1XWBA 1OC3A 4GTUA 2H73A 3IAM2 4OCFA 2P0GA 4KE3A 1F3BA 3LW9A 9GSSA 2FLSA 3RBTA 1T8EB 2YZHA 3KMOA 2HXKA 3TRPA 4LLRA 5D93A 5DJLA 5D73A 1WE0A 1Z7RA 3SWLA 1GL8A 2FA4A 4FIWA 4MA9A 3LGCA 1XWCA 2H6YA 2VM1A 1F6MC 2VM2A 2LTKA 1TU7A 4IS0A 3G9BA 5ECNB 1M9AA 4Z2RA 4BWSA 2MMAA 1K3YA 1FOVA 3EWLA 1ERTA 1FOHA 3GV1A 2BJXA 5JCUA 3VWVA 6GSTA 4G0IA 3A2VA 1RK4A 4PURA 2KP1A 4XRDA 1O8WA 1X9SB 3HJMA 2VLTA 2HE3A 2LNSA 3CSJA 4BVYB 7GSSA 2JZTA 1GSQA 2FA8A 1O6JA 5AGYA 1ERWA 1JZWA 4NHZA 4PQIA 2N5FA 2PBJA 3WT2A 4V1Ag 1X9WB 1N2AA 3P7XA 3ERGA 2H8LA 2WCIA 1A2JA 1A8LA 3D5JA 3KCMA 1UC7A 1K3LA 3WGEA 4N10A 5GSSA 2IWTA 2K8VA 2XHFA 4JZQA 1U6TA 2CX4A 2VL2C 5IMVA 2QA1A 2HZEB 5HQPA 5AIXA 3I69A 1GLQA 2V6OA 1C72A 3UBKA 2CAIA 2QSIA 4Z2UA 1A2MA 3HVXA 1PN9A 2LRTA 5J4UA 1XWGA 1VF2A 2B5YA 4PXOA 3GYKA 3D22A 1WRYA 4PX1A 1ILOA 4EXJA 1SKWB 3ZMLA 5F07A 4HI7A 5D9XA 4P3YB 1GTIA 3AY8A 4MJBA 4OFNA 2A2RA 1B4PA 4ICYA 2HLSA 5F8BA 3PGTA 3F4TA 16GSA 5DALB 3TJBA 1YJ6A 1XZOA 3O76A 1S3CA 1ZOFA 1GNWA 4I97A 1MDKA 3GTUB 1PX6A 12GSA 2KLXA 1Z6MA 1R4WA 4IP6A 4N0VA 4KCEA 1WWJA 3LXZA 2REMA 4DVCA 4KCAA 1GUMA 5ID2A 1FVJA 2PVOC 4MH3A 1OAZA 4O5RA 2P5QA 2VL2A 5IPGA 3TUEA 5ABRA 5LNKe 4OWYA 3DD3A 5JWOB 3N5OA 2V1MA 4MPGA 4BA7A 4F2IA 3M3MA 5EL8A 4FYCA 1PGTA 2JADA 3M0FA 1XW6A 1ZMAA 4YH2A 4DEJA 1EEMA 1BEDA 3G7IA 1AQWA 3H79A 5ECKB 1UA5A 1ZL9A 3TKSE 1B4QA 3G7JA 5E4WA 2B1LA 4KX4A 2LJAA 3D4MA 3M9KA 3KIJA 3KZQA 4IQ1A 1URMA 1A23A 4LL4B 3KTBA 5CRGA 3QAWA 2AJQB 3EPTA 4MABA 3NZNA 2GT5A 2ZUPA 5IOXA 2MBSA 2DLXA 2RM6A 3GSTA 3MYDA 2EC4A 3IHGA 4ML1A 1QFNA 1AQVA 3F6FA 6GSSA 4ZL7A 4ULXA 2V2GA 2O87A 2GZYA 20GSA 2OE3A 3LYKA 3CSIA 2A2PA 2L57A 1ZCPA 3G7YA 5GSTA 5IMDA 3A5WA 1ZYPA 2BTOT 4J2FA 3W6GA 1TTZA 10GSA 3VFIA 5DALA 2PU9C 4TR4A 2F3MA 3WD6A 2H74A 3WT1A 4EKZA 4GRFA 3DKSA 5AISA 2MZCA 2IMIA 3LFLA 3F3QA 1EV9A 1K0MA 4JE1A 1GSYA 1GTBA 4AF2A 1F3AA 4QL7A 1NHOA 1OC9A 3TJJA 2I1UA 1EOHA 2B1KA 3J7Yk 2H72A 1K0CA 1OE8A 2N5BA 4J57E 4ACSA 5G1LA 4MCUA 4V2LA 2OBIA 2HRAA 2WFCA 3GFKA 1PA3A 5CNWA 2IFQB 1X5DA 3TJFA 3O3TA 1IYIA 2VIMA 3MAKA 1YKAA 3TRQA 4CDOA 4F82A 1SD8A 4ZL8A 3CRUA 1F9MA 5HR3A 4V1Ap 3ED3A 4O92A 1SKRB 3QAGA 1QUWA 4CHSA 2H66A 1VF4A 1TRWA 4IJ3A 2NDOA 2X4AA 4KSMA 4L0WA 1XWKA 1WIKA 4ZL9A 2FCHA 1WOUA 3BBYA 4XTSA 5FHIA 1FVKA 1M2AA 3UJ1A 11GSA 1DE2A 4G0KA 3CXGA 5EPFA 5JCGA 1UN2A 5IMFA 1NM3A 1T3BA 3FZ5A 3IV4A 3GKNA 1XPVA 1TK8B 3UARA 5GZZB 2CA8A 5B6NA 3UAPA 3ME8A 1XCCA 4OCEA 2RUFA 4BVXB 2RLIA 2VCXA 5DAKA 3IC4A 5IMZA 2VD1A 2MMOA 1SK0A 3VURA 2J9HA 3P2AA 2L59A 4IELA 4TR1B 4AJ7A 3ZFLA 2GSTA 3HY2A 4KGIA 3ZREA 1H4OA 4ZXGA 4E8EA 2PN8A 2YZUA 1M9BA 4BL7A 1ZYNA 5F05A 2VOCA 5D96A 5D9VA 2WB9A 2GLRA 1TRVA 1LU4A 4IVFA 4NPBA 5ENUA 3FEUA 3UIWA 5C04A 4ZBDA 5B6MA 1SJ6A 1PL2A 1M7TA 1VRSD 13GSA 1CQHA 2YWIA 5DJMA 5G1KA 1QMVA 3EURA 2H6XA 3H8QA 3FHKA 4MF7A 1B9XC 3FKFA 1V57A 1U88A 3HHVA 4O7HA 5EVOA 1YQ1A 4FH8A 1Y6EA 4OMVA 4MPFA 3ZIVA 3U6VA 4TOPA 4MNNA 1EGOA 4N30A 4GCIA 5JWQB 1THOA 1QGVA 1A8YA 2DMMA 3L9VA 2HFDA 2CX3A 2LJKA 2F8AA 3RPNA 3FYGA 1NHYA 3FR3A 4MH2A 1XVQA 1GLPA 3F6DA 1U87A 2C0FA 2L6CA 3DRNA 3ZTLA 2C8UA 6GSYA 4IGJA 2R5GA 3CRTA 2X99A 3KP9A 4JEDA 3C73A 3DEXA 2WDUA 1FB0A 4TKYA 1T1VA 2AHEA 3UVTA 1DUGA 4E8HA 4I2TA 5KN2A 4XIHA 1HYUA 2AV4A 1OKTA 2FWEA 3LEFA 1BYEA 1FAAA 3KGKA 5AIVA 3SBCA 5JWRB 3QCPA 4MMMA 5F06A 1WP0A 2GVPA 2M46A 4AGSA 1MEKA 2MMZA 1H75A 4L0UA 2YCDA 3ZVJA 4I2UA 3ZL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L4N A;  4NAX A;  3O6T A;  1YF0 A;  2CT6 A;  4L8E A;  4DSQ A;  3CBU A;  4MJC A;  4RI7 A;  4HS1 A;  2F51 A;  2WJU A;  2X8H A;  3IXR A;  5DCG A;  4L5O A;  5IOW A;  4ZB6 A;  1EP8 A;  5ECH B;  3F8U A;  1GSF A;  1V2A A;  2DC5 A;  1DBY A;  3C1R A;  5HR1 A;  1KNG A;  1NSW A;  3K8N A;  4ZBA A;  2CAQ A;  4ID0 A;  1PKW A;  4JBB A;  3GIX A;  2GSR A;  4Q5N A;  2GQK A;  4PNF A;  1PMT A;  1O73 A;  4RQR A;  2JAC A;  3Q19 A;  5L71 A;  1GNE A;  2N5A A;  3GL5 A;  5ECO B;  1OE7 A;  2P31 A;  2PGT A;  2NTO A;  1HNB A;  4LA1 A;  2DJJ A;  4XS4 A;  3KEB A;  2B5X A;  4ZBB A;  3E9J B;  4PUF C;  1UVZ A;  3ERW A;  4K8M A;  2V41 A;  4EDZ A;  3EIN A;  1AIU A;  4X43 A;  3GA4 A;  5DQY A;  3KMN A;  2CZ3 A;  1SU9 A;  3CSH A;  4WR4 A;  5G5F A;  3C71 A;  3BJ5 A;  3UOM A;  2IME A;  3VPQ A;  1XOA A;  2BMX A;  4EE0 A;  2PMT A;  1G6W A;  4TXV A;  1RQM A;  1AUC A;  3KXO A;  5AN1 A;  1XW9 A;  2EIO A;  2YJ7 A;  2GSS A;  1EV4 A;  2DIZ A;  5A5K A;  2JSZ A;  3P8W A;  4GXZ A;  18GS A;  3ZIT A;  2R2J A;  1OVN A;  2FWF A;  5DQS A;  3EU3 A;  2F9S A;  2H30 A;  3IPZ A;  2LST A;  4DSS B;  1M0U A;  2O8V B;  2C0E A;  1WPI A;  2H70 A;  2EIQ A;  4MJE A;  3HYP A;  2FD3 A;  1YF1 A;  1W4V A;  3EYT A;  2AAW A;  2YNX A;  3FZ4 A;  1SL0 B;  5CRD A;  2A4V A;  4BVY A;  4GSS A;  4YQV A;  1TU8 A;  2CV4 A;  4OFT A;  5DDL A;  1Z9H A;  2AYT A;  3VK9 A;  4RUV A;  2E2G A;  5ELG A;  3D0Z A;  3BCK A;  1F2E A;  1G7E A;  2B6M A;  1Z6N A;  1ERV A;  4ML6 A;  4FYB A;  4QQ7 A;  1I5G A;  2B7K A;  2FUG 2;  4ECI A;  1QXH A;  2LRN A;  2QKE A;  4MDC A;  1B48 A;  3C7M A;  1YDK A;  4MZB A;  3VI5 A;  4HOJ A;  4F03 A;  1K0N A;  1FO5 A;  3JCM L;  1GUH A;  4YAP A;  2YAN A;  4Q5Q A;  5IQY A;  4WXT A;  2DJ1 A;  3M1G A;  4HJ2 A;  2MBT A;  4EC0 A;  4JRR A;  2XPE A;  2R3X A;  3LG6 A;  3HZ8 A;  2HZE A;  4I8B A;  2TIR A;  4EUY A;  2LS5 A;  3TKQ A;  4GWR A;  1MD4 A;  3FZ9 A;  3HA9 A;  3LXT A;  3ZZX A;  2GQL A;  3HJO A;  5KN1 A;  1PQN A;  2LNT A;  3ZFB A;  2R6K A;  1QK8 A;  3W8J A;  1PSQ A;  3GX0 A;  4ECJ A;  1SJZ A;  3S9F A;  1X0R A;  3H1N A;  5HR0 A;  4JR6 A;  3C1S A;  2LKU A;  3E0U A;  2IN3 A;  1JZD A;  3M9J A;  3GKK A;  3QPM A;  4K9Z A;  2XBI A;  1EEJ A;  3GTU A;  1TK0 B;  3GL3 A;  2CVD A;  1MDJ A;  1KBN A;  1YY7 A;  1Z3E A;  4YQM A;  5KN0 A;  2HNL A;  2J23 A;  4WR5 A;  3APQ A;  3Q6O A;  3IA1 A;  2L4C A;  4MK3 A;  1ZYE A;  6GSX A;  3GH6 A;  4HUA A;  1T4Z A;  1SK2 A;  1TI1 A;  1AQX A;  2C3Q A;  3FW2 A;  3HCZ A;  1Z5Y E;  1MDI A;  5GAN D;  2ALB A;  4WEY A;  2NVL A;  4KUN A;  1J0F A;  1XFL A;  1O81 A;  4HQZ A;  5J41 A;  3F9U A;  1AXD A;  4TR3 A;  5CP1 A;  4ZIJ A;  4CW9 A;  5DBQ A;  3TOU A;  3WGD A;  2XPD A;  1N8J A;  1T00 A;  2OE0 A;  1BAY A;  5F0G A;  5ECR B;  1DE1 A;  1IYH A;  3QFB C;  3IK7 A;  4K7O A;  1J9B A;  1GH2 A;  2B5E A;  2KUC A;  3EMP A;  2E0Q A;  4H86 A;  4IQA A;  3L78 A;  2VCW A;  5ECL B;  1OC8 A;  19GS A;  3TRX A;  1K0B A;  4RI6 A;  2O89 A;  4X1U A;  1YEP A;  2MMN A;  3KH9 A;  4MZC A;  5IO0 A;  3QMX A;  3TJK A;  1B8X A;  1XIY A;  5JCW A;  1G0T A;  3HZ4 A;  4D73 B;  4MF6 A;  1GSU A;  5CYY A;  1GTU A;  4NHW A;  2KHP A;  4LMV A;  3LOR A;  1PKZ A;  4FO5 A;  2VCZ A;  2JZR A;  3HD5 A;  1HNA A;  4NV5 A;  2DJ3 A;  2YN1 A;  2C4J A;  2GDR A;  2RII A;  5H5R A;  4KA0 A;  4K1F A;  1SL1 B;  4K0N A;  1EP7 A;  1FB6 A;  1A24 A;  3KM6 A;  2PUK C;  5IO2 A;  3IBH A;  2C3N A;  1M2B A;  2L5O A;  2DJK A;  4WF5 A;  4HU9 A;  1G7O A;  2DML A;  2GQM A;  2B3S A;  2DIY A;  1F37 A;  1ML6 A;  2IFQ A;  1SKS B;  2TRX A;  3FY7 A;  4IKH A;  2FNO A;  1V58 A;  5G30 A;  3UBL A;  5C00 A;  1DSB A;  2VL9 A;  1Z7P A;  2K9F A;  2ON7 A;  3HDC A;  5D8I A;  3M8N A;  1R26 A;  1TP9 A;  5KN3 A;  2F8F A;  2IMD A;  2LRC A;  2L5L A;  5ECQ B;  4TXO B;  4OD7 A;  2JL4 A;  1PX7 A;  1K0A A;  14GS A;  3L9U A;  2FWH A;  2I81 A;  3RPP A;  1X5E A;  3VLN A;  4K6X A;  1ERU A;  3I6A A;  2KOK A;  3GNJ A;  1KEB A;  2QGV A;  5ECS A;  3TB2 A;  5KEJ A;  3A3T A;  1ZGN A;  4TN8 A;  3KP8 A;  3J7Y b;  4HDE A;  1WJK A;  4GLT A;  3FRC A;  1PL1 A;  1JZR A;  3GHA A;  2WRT A;  4MJA A;  2NBS A;  1BG5 A;  1VGL A;  2XBQ A;  1SD9 A;  4WF4 A;  2YWO A;  1USB A;  3PH9 A;  3D4T A;  4ISD A;  2H75 A;  4BVX A;  2D2Z A;  2H0H A;  2H76 A;  2HYX A;  5G31 A;  3US3 A;  3W8S A;  3TKP A;  4ZIL A;  2CVK A;  1O85 A;  3V1W A;  3F63 A;  5B7C A;  1GUL A;  2JZS A;  3MNG A;  2HSY A;  1S3A A;  4TR1 A;  6GSU A;  1Q4J A;  2ON5 A;  3NOF A;  3KH7 A;  6GSW A;  3VPT A;  4BWQ A;  4POL A;  3GSS A;  3HKR A;  1TJD A;  2E7P A;  2OAC A;  5LD0 A;  1X5C A;  2YJH A;  2OJL A;  5H5Q A;  4EO3 A;  1MD3 A;  3A2W A;  3APO A;  3QDN A;  3QR6 A;  4XS6 A;  3CYN A;  4MF5 A;  5A4W A;  4MZW A;  2XC2 A;  2OA7 A;  4I6X A;  1YKC A;  2VD0 A;  3D21 A;  1HD2 A;  4G10 A;  4HU7 A;  4POM A;  4TRX A;  4TXO A;  5J5N A;  1EOG A;  3BCI A;  2VCT A;  3F4R A;  1K0D A;  2PVQ A;  2TRC P;  2K18 A;  1BQ7 A;  3GUS A;  1PRX A;  2IIY A;  3DIE A;  2YWM A;  3QOU A;  4DSR A;  2RUE A;  3UVH A;  1B9Y C;  3PIN A;  3WGX A;  2O7K A;  4KDX A;  1K3O A;  3TKS C;  5GAP D;  1TDI A;  4WET A;  5ECM B;  4JU5 A;  1ON4 A;  3GMF A;  2HT9 A;  2WUL A;  3I9V 2;  2H01 A;  2PER A;  5A4V A;  4YQU A;  5J9C A;  2VUP A;  1EZK A;  2E2M A;  1LBK A;  3ZLP A;  5ID2 B;  1G6Y A;  1KTE A;  3UL3 A;  3GUR A;  2VL3 A;  3TKR A;  2HRN A;  3MWH A;  1AAZ A;  4QL9 A;  17GS A;  1SYX A;  3UEM A;  3RDW A;  4ZB8 A;  1FHE A;  3GKX A;  3WYW A;  4HZ2 A;  3L9S A;  4HJM A;  2LJR A;  1EWX A;  4PQH A;  2H1A A;  2K6V A;  5CRW A;  3GN3 A;  2WGR A;  4K2D A;  4G9H A;  3TKS A;  4ZB9 A;  6GSV A;  4KDU A;  3LJR A;  5LCZ A;  1XW5 A;  2AUV A;  4HZ4 A;  1GWC A;  1SEN A;  4IHU A;  4Z7X A;  4KSO A;  4PNG A;  1FG4 A;  4AJ8 A;  3ZYW A;  1TW9 A;  2GGT A;  4OFM A;  5G5E A;  2LUS A;  2C3T A;  3RHC A;  3P90 A;  1T7P B;  5COH A;  4WKW A;  2LEG A;  3H4K A;  1SYR A;  1ST9 A;  4N0Z A;  2GZZ A;  4GF0 A;  4K7I A;  3TDG A;  3F4S A;  3HJP A;  4HQS A;  3HXS A;  4KDY A;  3VWU A;  3ISO A;  3ZIJ A;  4POK A;  1TI3 A;  2PWJ A;  2R4V A;  1XBS A;  2H1G A;  3HVS A;  2LQQ A;  2X8C A;  1EGR A;  4MP4 A;  5E59 A;  3A2X A;  2L6D A;  5A4U A;  2OAD A;  3FR9 A;  4WBR D;  1A2L A;  3F3R A;  3DML A;  4L5L A;  5FWG A;  3PR8 A;  2CZ2 A;  1A0F A;  3GX8 A;  4O32 A;  1TKD B;  5IM9 A;  5B8A A;  2WS2 A;  1A0R P;  1OC9 B;  1RW1 A;  5DCH A;  2MYG A;  1I9D A;  3GH9 A;  4YAV A;  1TK5 B;  1GSS A;  5CAX A;  2YWN A;  5D9W A;  3LYP A;  1TOF A;  1OYJ A;  3OR5 A;  1TRS A;  1VF3 A;  3HVV A;  4IP1 A;  4EDY A;  2H1B A;  1T4Y A;  1R5A A;  3EC3 A;  1PD2 1;  4K7N A;  2KP2 A;  4PUA A;  3IAS 2;  8GSS A;  2C80 A;  1ABA A;  4KND A;  3APS A;  1NW2 A;  1O7U A;  2H0I A;  1ACV A;  5FT3 A;  5INY A;  3FK8 A;  3DVX A;  4KW6 A;  2HI7 A;  2DBC A;  2O85 A;  5J3R A;  2DJ0 A;  4XCS A;  3N9J A;  1CQG A;  1HQO A;  2OE1 A;  2IPA A;  4LMW A;  2M80 A;  4XHM A;  1OKD A;  1GSD A;  4GQF A;  2B7J A;  3FZA A;  5ELA A;  3RHB A;  4NXI A;  3CTF A;  4EVM A;  4DSS A;  2Z9S A;  1GP1 A;  5CRE A;  4ECB A;  1HNC A;  22GS A;  2K8S A;  2RM5 A;  3LWA A;  3L0H A;  2C1Y A;  2VO4 A;  1YEX A;  3DVW A;  3QAV A;  2FGX A;  3GKM A;  4K0G A;  2H6Z A;  1JFU A;  2H71 A;  3QFA C;  2WZ9 A;  1FW1 A;  3H93 A;  3BOA A;  3CMI A;  4IW9 A;  3VI7 A;  1AW9 A;  4IBP A;  1M2D A;  3ME7 A;  5ECI B;  3ERF A;  2DSA A;  2FHE A;  1GUK A;  5DAK B;  1BJX A;  2EIR A;  2HRF A;  2I9H A;  3TCO A;  2X64 A;  4Q5F A;  2G2Q A;  2H0G A;  4F0C A;  4V2M A;  4IJI A;  2HSH A;  5HFG A;  4XRA A;  2FY6 A;  3NIV A;  2OBK A;  2FWG A;  2DJ2 A;  2NPB A;  2C0G A;  3EU4 A;  2IMK A;  1XVW A;  4ILF A;  1LJR A;  5IPH A;  2VCQ A;  2HZF A;  2JSY A;  2IMF A;  3R2Q A;  2GT6 A;  4I5Q A;  5IMC A;  3KJY A;  2H19 A;  1SJI A;  4ECC A;  1Y25 A;  3LSZ A;  1M99 A;  1R7H A;  3FR6 A;  4Q5R A;  2P5R A;  1K0O A;  1GRX A;  4J56 E;  4EF0 A;  4KB3 A;  1J08 A;  2LQO A;  1O8X A;  4RQX A;  3VWX A;  1WMJ A;  4BPY A;  4KH7 A;  2GS3 A;  3DYR A;  3F0I A;  4XS1 A;  3TOT A;  4IN0 A;  2PPT A;  2VLV A;  5EY6 A;  5D9T A;  2GSQ A;  3GRX A;  4GST A;  4MLY A;  5DVB A;  4PQ1 A;  3C8E A;  2GZP A;  2QC7 A;  1SK1 A;  3EVI A;  4TW5 A;  1U3A A;  1E2Y A;  1Q98 A;  5HFI A;  3UMA A;  1JLV A;  2VAF A;  3DXB A;  2G0F A;  3TJG A;  1JHB A;  1ZYQ B;  2C0D A;  3IHQ A;  5CRH A;  3RAZ A;  1XOB A;  3BD2 A;  1THX A;  1XXU A;  4N11 A;  2GTU A;  4TR0 A;  3MSZ A;  3IOS A;  2H1D A;  2YP6 A;  3ZVJ D;  1TRU A;  2YOI A;  3EMX A;  2A2S A;  3I43 A;  2ES7 A;  3KTL A;  3E3E A;  2JU5 A;  1V9W A;  1V98 A;  1JZO A;  4FYU A;  4NWY A;  2M72 A;  3IDV A;  2V6K A;  5B8B A;  1MTC A;  1AC1 A;  1V40 A;  4GSN A;  2OKA A;  2YV7 A;  4PGT A;  5CO3 A;  3Q18 A;  4GQC A;  4JR4 A;  3IK9 A;  3EE2 A;  3CTG A;  4D73 A;  4KAE A;  5IIZ A;  5G2Z A;  2IL3 A;  5ECP B;  3U5R E;  2V32 A;  3IRA A;  1SL2 B;  3DWV A;  1GSE A;  3D6I A;  4WBJ A;  1X9M B;  1QQ2 A;  4EL1 A;  2VCV A;  2VLU A;  1R5P A;  4NV2 A;  1E6B A;  2ZNM A;  1S3D A;  5J9B A;  1GTA A;  1XWA A;  4V2N A;  1U3I A;  1JLW A;  3VWW A;  1BX9 A;  3LQ7 A;  3DGQ A;  3Q74 A;  3IE3 A;  4OO4 A;  4HEA 2;  2I3Y A;  5H5S A;  3ZRD A;  1W89 A;  4F0B A;  4AJ6 A;  2ZCT A;  1VF1 A;  4X0X A;  2CQ9 A;  5HR2 A;  2X8G A;  3MDK A;  4F9Z A;  1YZX A;  4LL1 B;  5HFK A;  3QD9 A;  1TXX A;  2AB6 A;  2CVB A;  2I4A A;  3TGZ A;  2YPM A;  1ZZY A;  3IR4 A;  2LV3 A;  2L4Q A;  4NMU A;  4OO5 A;  4G2E A;  2YV9 A;  4POB A;  3ZMK A;  4XS4 B;  5IMA A;  4TVE A;  3KD0 A;  2IJY A;  4G19 A;  2R37 A;  1XWB A;  1OC3 A;  4GTU A;  2H73 A;  3IAM 2;  4OCF A;  2P0G A;  4KE3 A;  1F3B A;  9GSS A;  2FLS A;  3RBT A;  1T8E B;  2YZH A;  3KMO A;  2HXK A;  3TRP A;  4LLR A;  5D93 A;  5DJL A;  5D73 A;  1WE0 A;  1Z7R A;  3SWL A;  1GL8 A;  2FA4 A;  4FIW A;  4MA9 A;  3LGC A;  1XWC A;  2H6Y A;  2VM1 A;  1F6M C;  2VM2 A;  2LTK A;  1TU7 A;  4IS0 A;  3G9B A;  5ECN B;  1M9A A;  4BWS A;  2MMA A;  1K3Y A;  1FOV A;  3EWL A;  1ERT A;  3GV1 A;  2BJX A;  5JCU A;  3VWV A;  6GST A;  3A2V A;  1RK4 A;  4PUR A;  2KP1 A;  4XRD A;  1O8W A;  1X9S B;  3HJM A;  2VLT A;  2HE3 A;  2LNS A;  3CSJ A;  7GSS A;  2JZT A;  1GSQ A;  2FA8 A;  1O6J A;  5AGY A;  1ERW A;  1JZW A;  4NHZ A;  4PQI A;  2N5F A;  2PBJ A;  3WT2 A;  4V1A g;  1X9W B;  1N2A A;  3P7X A;  3ERG A;  2H8L A;  2WCI A;  1A2J A;  1A8L A;  3D5J A;  3KCM A;  1UC7 A;  1K3L A;  3WGE A;  4N10 A;  5GSS A;  2IWT A;  2K8V A;  2XHF A;  4JZQ A;  1U6T A;  2CX4 A;  2VL2 C;  5IMV A;  2HZE B;  5HQP A;  5AIX A;  3I69 A;  1GLQ A;  2V6O A;  1C72 A;  3UBK A;  2CAI A;  2QSI A;  1A2M A;  3HVX A;  1PN9 A;  2LRT A;  5J4U A;  1XWG A;  1VF2 A;  2B5Y A;  4PXO A;  3GYK A;  3D22 A;  1WRY A;  4PX1 A;  1ILO A;  4EXJ A;  1SKW B;  3ZML A;  5F07 A;  4HI7 A;  5D9X A;  4P3Y B;  1GTI A;  3AY8 A;  4MJB A;  4OFN A;  2A2R A;  1B4P A;  2HLS A;  5F8B A;  3PGT A;  3F4T A;  16GS A;  5DAL B;  3TJB A;  1YJ6 A;  1XZO A;  3O76 A;  1S3C A;  1ZOF A;  1GNW A;  4I97 A;  1MDK A;  3GTU B;  1PX6 A;  12GS A;  2KLX A;  1Z6M A;  1R4W A;  4IP6 A;  4N0V A;  4KCE A;  1WWJ A;  3LXZ A;  2REM A;  4DVC A;  4KCA A;  1GUM A;  5ID2 A;  1FVJ A;  2PVO C;  4MH3 A;  1OAZ A;  4O5R A;  2P5Q A;  2VL2 A;  5IPG A;  3TUE A;  5ABR A;  5LNK e;  4OWY A;  3DD3 A;  5JWO B;  3N5O A;  2V1M A;  4MPG A;  4BA7 A;  4F2I A;  3M3M A;  5EL8 A;  4FYC A;  1PGT A;  2JAD A;  3M0F A;  1XW6 A;  1ZMA A;  4YH2 A;  4DEJ A;  1EEM A;  1BED A;  3G7I A;  1AQW A;  3H79 A;  5ECK B;  1UA5 A;  1ZL9 A;  3TKS E;  1B4Q A;  3G7J A;  5E4W A;  2B1L A;  4KX4 A;  2LJA A;  3D4M A;  3M9K A;  3KIJ A;  3KZQ A;  4IQ1 A;  1URM A;  1A23 A;  4LL4 B;  3KTB A;  5CRG A;  3QAW A;  2AJQ B;  4MAB A;  3NZN A;  2GT5 A;  2ZUP A;  5IOX A;  2MBS A;  2DLX A;  2RM6 A;  3GST A;  2EC4 A;  4ML1 A;  1QFN A;  1AQV A;  3F6F A;  6GSS A;  4ZL7 A;  4ULX A;  2V2G A;  2O87 A;  2GZY A;  20GS A;  2OE3 A;  3LYK A;  3CSI A;  2L57 A;  1ZCP A;  3G7Y A;  5GST A;  5IMD A;  3A5W A;  2BTO T;  4J2F A;  3W6G A;  1TTZ A;  10GS A;  3VFI A;  5DAL A;  2PU9 C;  4TR4 A;  2F3M A;  3WD6 A;  2H74 A;  3WT1 A;  4EKZ A;  4GRF A;  3DKS A;  5AIS A;  2MZC A;  2IMI A;  3LFL A;  3F3Q A;  1EV9 A;  1K0M A;  4JE1 A;  1GSY A;  1GTB A;  4AF2 A;  1F3A A;  4QL7 A;  1NHO A;  1OC9 A;  3TJJ A;  2I1U A;  1EOH A;  2B1K A;  3J7Y k;  2H72 A;  1K0C A;  1OE8 A;  2N5B A;  4J57 E;  4ACS A;  5G1L A;  4MCU A;  4V2L A;  2OBI A;  2WFC A;  3GFK A;  1PA3 A;  5CNW A;  2IFQ B;  1X5D A;  3TJF A;  3O3T A;  1IYI A;  2VIM A;  3MAK A;  1YKA A;  3TRQ A;  4CDO A;  4F82 A;  1SD8 A;  4ZL8 A;  3CRU A;  1F9M A;  5HR3 A;  4V1A p;  3ED3 A;  4O92 A;  1SKR B;  3QAG A;  1QUW A;  4CHS A;  2H66 A;  1VF4 A;  1TRW A;  4IJ3 A;  2NDO A;  4KSM A;  4L0W A;  1XWK A;  1WIK A;  4ZL9 A;  2FCH A;  1WOU A;  3BBY A;  4XTS A;  5FHI A;  1FVK A;  1M2A A;  3UJ1 A;  11GS A;  1DE2 A;  3CXG A;  5EPF A;  5JCG A;  1UN2 A;  5IMF A;  1NM3 A;  1T3B A;  3FZ5 A;  3IV4 A;  3GKN A;  1XPV A;  1TK8 B;  3UAR A;  5GZZ B;  2CA8 A;  5B6N A;  3UAP A;  3ME8 A;  1XCC A;  4OCE A;  2RUF A;  2RLI A;  2VCX A;  5DAK A;  3IC4 A;  5IMZ A;  2VD1 A;  2MMO A;  1SK0 A;  3VUR A;  2J9H A;  3P2A A;  2L59 A;  4IEL A;  4TR1 B;  4AJ7 A;  3ZFL A;  2GST A;  3HY2 A;  4KGI A;  3ZRE A;  1H4O A;  4ZXG A;  4E8E A;  2PN8 A;  2YZU A;  1M9B A;  4BL7 A;  5F05 A;  2VOC A;  5D96 A;  5D9V A;  2WB9 A;  2GLR A;  1TRV A;  1LU4 A;  4IVF A;  4NPB A;  5ENU A;  3FEU A;  3UIW A;  5C04 A;  4ZBD A;  5B6M A;  1SJ6 A;  1PL2 A;  1M7T A;  1VRS D;  13GS A;  1CQH A;  2YWI A;  5DJM A;  5G1K A;  1QMV A;  3EUR A;  2H6X A;  3H8Q A;  3FHK A;  4MF7 A;  1B9X C;  3FKF A;  1V57 A;  1U88 A;  3HHV A;  4O7H A;  5EVO A;  1YQ1 A;  4FH8 A;  1Y6E A;  4OMV A;  4MPF A;  3ZIV A;  3U6V A;  4TOP A;  1EGO A;  4N30 A;  4GCI A;  5JWQ B;  1THO A;  1QGV A;  1A8Y A;  2DMM A;  3L9V A;  2HFD A;  2CX3 A;  2LJK A;  2F8A A;  3RPN A;  3FYG A;  1NHY A;  3FR3 A;  4MH2 A;  1XVQ A;  1GLP A;  3F6D A;  1U87 A;  2C0F A;  2L6C A;  3DRN A;  3ZTL A;  2C8U A;  6GSY A;  4IGJ A;  2R5G A;  3CRT A;  2X99 A;  3KP9 A;  4JED A;  3C73 A;  3DEX A;  2WDU A;  1FB0 A;  4TKY A;  1T1V A;  2AHE A;  3UVT A;  1DUG A;  4E8H A;  4I2T A;  5KN2 A;  4XIH A;  1HYU A;  2AV4 A;  1OKT A;  2FWE A;  3LEF A;  1BYE A;  1FAA A;  3KGK A;  5AIV A;  3SBC A;  5JWR B;  3QCP A;  4MMM A;  5F06 A;  1WP0 A;  2GVP A;  2M46 A;  4AGS A;  1MEK A;  2MMZ A;  1H75 A;  4L0U A;  2YCD A;  3ZVJ A;  4I2U A;  3ZL5 A; 
#chains in the Genus database with same CATH topology
 3L4N A;  4NAX A;  3O6T A;  1YF0 A;  2CT6 A;  4L8E A;  4DSQ A;  3CBU A;  4MJC A;  4RI7 A;  4HS1 A;  2F51 A;  2WJU A;  2X8H A;  3IXR A;  5DCG A;  4L5O A;  5IOW A;  4ZB6 A;  1EP8 A;  5ECH B;  3F8U A;  1GSF A;  1V2A A;  2DC5 A;  1DBY A;  3C1R A;  5HR1 A;  1KNG A;  1NSW A;  3K8N A;  4ZBA A;  2CAQ A;  4ID0 A;  1PKW A;  4JBB A;  3GIX A;  2GSR A;  4Q5N A;  2GQK A;  4PNF A;  1PMT A;  1O73 A;  4RQR A;  2JAC A;  3R3E A;  3Q19 A;  2R0P A;  5L71 A;  1GNE A;  2N5A A;  3GL5 A;  5ECO B;  1OE7 A;  2P31 A;  2PGT A;  2NTO A;  1HNB A;  4LA1 A;  2DJJ A;  4XS4 A;  3KEB A;  2B5X A;  4ZBB A;  3E9J B;  4PUF C;  1UVZ A;  3ERW A;  4K8M A;  2V41 A;  4EDZ A;  3EIN A;  1AIU A;  4X43 A;  3GA4 A;  5DQY A;  3KMN A;  2CZ3 A;  1SU9 A;  3CSH A;  4WR4 A;  5BMU A;  5G5F A;  3C71 A;  3BJ5 A;  3UOM A;  2IME A;  3VPQ A;  1XOA A;  2BMX A;  4EE0 A;  2PMT A;  1G6W A;  4TXV A;  1RQM A;  1AUC A;  3KXO A;  5AN1 A;  1XW9 A;  2EIO A;  2YJ7 A;  2GSS A;  1EV4 A;  2DIZ A;  5A5K A;  2JSZ A;  3P8W A;  4GXZ A;  18GS A;  3ZIT A;  2R2J A;  1OVN A;  2FWF A;  5DQS A;  3EU3 A;  2F9S A;  2H30 A;  3IPZ A;  2LST A;  4DSS B;  1M0U A;  2O8V B;  2C0E A;  1WPI A;  2H70 A;  2EIQ A;  4MJE A;  3HYP A;  2FD3 A;  1YF1 A;  1W4V A;  3EYT A;  2AAW A;  2YNX A;  3FZ4 A;  1SL0 B;  5CRD A;  2A4V A;  4BVY A;  4GSS A;  4YQV A;  1TU8 A;  2CV4 A;  4OFT A;  5DDL A;  1Z9H A;  2AYT A;  3VK9 A;  4RUV A;  2E2G A;  5ELG A;  3D0Z A;  3BCK A;  1F2E A;  1G7E A;  2B6M A;  1Z6N A;  1ERV A;  4ML6 A;  4FYB A;  4QQ7 A;  1I5G A;  2B7K A;  2FUG 2;  4ECI A;  1QXH A;  2LRN A;  2QKE A;  4MDC A;  1B48 A;  3C7M A;  1YDK A;  4MZB A;  3VI5 A;  4HOJ A;  4F03 A;  1K0N A;  1FO5 A;  3JCM L;  1GUH A;  4YAP A;  2YAN A;  4Q5Q A;  5IQY A;  4WXT A;  2DJ1 A;  3M1G A;  4HJ2 A;  2MBT A;  4EC0 A;  4JRR A;  2XPE A;  2R0C A;  2R3X A;  3LG6 A;  3HZ8 A;  1S3R A;  2HZE A;  4I8B A;  2TIR A;  4EUY A;  2LS5 A;  3TKQ A;  4GWR A;  1MD4 A;  3FZ9 A;  3HA9 A;  3LXT A;  3ZZX A;  2GQL A;  3HJO A;  5KN1 A;  1PQN A;  2LNT A;  3ZFB A;  2R6K A;  2UZ8 A;  1QK8 A;  3W8J A;  1PSQ A;  3GX0 A;  4ECJ A;  1SJZ A;  2DKI A;  3S9F A;  1X0R A;  3H1N A;  5HR0 A;  4JR6 A;  3C1S A;  2LKU A;  3E0U A;  2IN3 A;  1JZD A;  3M9J A;  3CQF A;  3GKK A;  3QPM A;  4K9Z A;  2XBI A;  1EEJ A;  3GTU A;  1TK0 B;  3GL3 A;  2CVD A;  1MDJ A;  1KBN A;  1YY7 A;  1Z3E A;  4YQM A;  5KN0 A;  2HNL A;  2J23 A;  4WR5 A;  3APQ A;  3Q6O A;  3IA1 A;  2L4C A;  4MK3 A;  1ZYE A;  6GSX A;  3GH6 A;  4HUA A;  1T4Z A;  1SK2 A;  1TI1 A;  1AQX A;  2C3Q A;  3FW2 A;  3HCZ A;  1Z5Y E;  1MDI A;  5GAN D;  2ALB A;  4EIQ A;  4WEY A;  2NVL A;  4KUN A;  1J0F A;  1XFL A;  1O81 A;  4HQZ A;  5J41 A;  3F9U A;  1AXD A;  4TR3 A;  5CP1 A;  4ZIJ A;  5BRT A;  4CW9 A;  5DBQ A;  3TOU A;  3WGD A;  2XPD A;  1N8J A;  1T00 A;  2OE0 A;  1BAY A;  5F0G A;  5ECR B;  1DE1 A;  1IYH A;  3QFB C;  3IK7 A;  4K7O A;  1J9B A;  1GH2 A;  2B5E A;  2KUC A;  3EMP A;  2E0Q A;  4H86 A;  4IQA A;  3L78 A;  2VCW A;  5ECL B;  1OC8 A;  19GS A;  3TRX A;  1K0B A;  4RI6 A;  2O89 A;  4X1U A;  1YEP A;  2MMN A;  3KH9 A;  4MZC A;  5IO0 A;  3A5I A;  3QMX A;  3TJK A;  1B8X A;  1XIY A;  5JCW A;  1G0T A;  3HZ4 A;  4D73 B;  4MF6 A;  1GSU A;  5CYY A;  1GTU A;  4NHW A;  2KHP A;  4Z2T A;  4LMV A;  3LOR A;  1PKZ A;  4FO5 A;  2VCZ A;  2JZR A;  3HD5 A;  1HNA A;  4NV5 A;  2DJ3 A;  2YN1 A;  2C4J A;  2GDR A;  2RII A;  5H5R A;  4KA0 A;  4K1F A;  1SL1 B;  4K0N A;  1EP7 A;  1FB6 A;  1A24 A;  3KM6 A;  2PUK C;  5IO2 A;  3IBH A;  2C3N A;  2R0G A;  1M2B A;  4FQU A;  2L5O A;  2DJK A;  4WF5 A;  4HU9 A;  1G7O A;  2DML A;  2GQM A;  2B3S A;  4A5P A;  2DIY A;  1F37 A;  1ML6 A;  2IFQ A;  1SKS B;  2TRX A;  3FY7 A;  4IKH A;  2FNO A;  1V58 A;  4K5R A;  5G30 A;  3UBL A;  5C00 A;  1DSB A;  2VL9 A;  1Z7P A;  2K9F A;  2ON7 A;  3HDC A;  5D8I A;  3M8N A;  1R26 A;  1TP9 A;  5KN3 A;  2F8F A;  2IMD A;  2LRC A;  2L5L A;  5ECQ B;  4TXO B;  2HRK A;  4OD7 A;  5KOX A;  2JL4 A;  1PX7 A;  1K0A A;  14GS A;  3L9U A;  2FWH A;  2I81 A;  3RPP A;  1X5E A;  3VLN A;  4K6X A;  1ERU A;  3I6A A;  2KOK A;  2QA2 A;  3GNJ A;  1KEB A;  2QGV A;  5ECS A;  3TB2 A;  5KEJ A;  3A3T A;  4YKF A;  1ZGN A;  4TN8 A;  5KOW A;  4USS A;  3KP8 A;  3J7Y b;  4HDE A;  1WJK A;  4GLT A;  3FRC A;  1PL1 A;  1JZR A;  3GHA A;  2WRT A;  4MJA A;  2NBS A;  1BG5 A;  1VGL A;  2XBQ A;  1SD9 A;  4WF4 A;  2YWO A;  1USB A;  3PH9 A;  3D4T A;  4ISD A;  2H75 A;  4BVX A;  2D2Z A;  2H0H A;  2H76 A;  2HYX A;  5G31 A;  3US3 A;  3W8S A;  3TKP A;  4ZIL A;  2CVK A;  1O85 A;  3V1W A;  3F63 A;  5B7C A;  1GUL A;  2JZS A;  3MNG A;  2HSY A;  1S3A A;  4TR1 A;  6GSU A;  1Q4J A;  2ON5 A;  3NOF A;  3KH7 A;  6GSW A;  3VPT A;  4BWQ A;  4POL A;  3GSS A;  3HKR A;  1TJD A;  2E7P A;  2OAC A;  5LD0 A;  1X5C A;  2YJH A;  2OJL A;  5H5Q A;  4EO3 A;  1MD3 A;  3A2W A;  3APO A;  3QDN A;  3QR6 A;  4XS6 A;  3CYN A;  4MF5 A;  5A4W A;  4MZW A;  2XC2 A;  2OA7 A;  4I6X A;  1YKC A;  2VD0 A;  3D21 A;  1HD2 A;  4G10 A;  4HU7 A;  4POM A;  4TRX A;  4TXO A;  5J5N A;  1EOG A;  3BCI A;  2VCT A;  3F4R A;  1K0D A;  2PVQ A;  2TRC P;  2K18 A;  1BQ7 A;  3GUS A;  1PRX A;  2IIY A;  3DIE A;  2YWM A;  3QOU A;  4DSR A;  2RUE A;  3UVH A;  4G0L A;  1B9Y C;  3PIN A;  3WGX A;  2O7K A;  4KDX A;  4O5Q A;  1K3O A;  3TKS C;  5GAP D;  1TDI A;  4WET A;  5ECM B;  4JU5 A;  1ON4 A;  3GMF A;  2HT9 A;  2WUL A;  3I9V 2;  2H01 A;  2PER A;  5A4V A;  4YQU A;  5J9C A;  2VUP A;  1EZK A;  2E2M A;  1LBK A;  3ZLP A;  5ID2 B;  1G6Y A;  1KTE A;  3UL3 A;  3GUR A;  2VL3 A;  3TKR A;  2HRN A;  3MWH A;  1AAZ A;  4QL9 A;  17GS A;  1SYX A;  3PPU A;  3UEM A;  3RDW A;  4ZB8 A;  1FHE A;  3GKX A;  3WYW A;  4HZ2 A;  3L9S A;  4HJM A;  2LJR A;  1EWX A;  4PQH A;  2H1A A;  2K6V A;  5CRW A;  3GN3 A;  2WGR A;  4K2D A;  4G9H A;  3TKS A;  4ZB9 A;  6GSV A;  4KDU A;  3LJR A;  5LCZ A;  1XW5 A;  2AUV A;  4HZ4 A;  1GWC A;  1SEN A;  4IHU A;  4Z7X A;  4KSO A;  4PNG A;  1FG4 A;  4AJ8 A;  3ZYW A;  1TW9 A;  2GGT A;  4OFM A;  5G5E A;  2LUS A;  2C3T A;  3RHC A;  3P90 A;  1T7P B;  5COH A;  1XG8 A;  4WKW A;  2LEG A;  3H4K A;  1SYR A;  1ST9 A;  4N0Z A;  2GZZ A;  4GF0 A;  4K7I A;  3TDG A;  3F4S A;  3HJP A;  4HQS A;  3HXS A;  4KDY A;  3VWU A;  3ISO A;  3ZIJ A;  4POK A;  1TI3 A;  2PWJ A;  2R4V A;  1XBS A;  2H1G A;  3HVS A;  2LQQ A;  2X8C A;  4HSC X;  1EGR A;  4MP4 A;  5E59 A;  3A2X A;  2L6D A;  5A4U A;  2OAD A;  3FR9 A;  4WBR D;  1A2L A;  3F3R A;  3DML A;  4L5L A;  5FWG A;  3PR8 A;  2CZ2 A;  1A0F A;  3GX8 A;  4O32 A;  1TKD B;  5IM9 A;  5B8A A;  2WS2 A;  1A0R P;  1OC9 B;  1RW1 A;  5DCH A;  2MYG A;  1I9D A;  3GH9 A;  4YAV A;  1TK5 B;  1GSS A;  5CAX A;  2YWN A;  5D9W A;  3LYP A;  1TOF A;  1OYJ A;  3OR5 A;  1TRS A;  1VF3 A;  3HVV A;  4IP1 A;  4KF9 A;  4EDY A;  2H1B A;  1T4Y A;  1R5A A;  3EC3 A;  1PD2 1;  4K7N A;  2KP2 A;  4PUA A;  2X49 A;  3IAS 2;  8GSS A;  2C80 A;  1ABA A;  4KND A;  3APS A;  1NW2 A;  1O7U A;  2H0I A;  1ACV A;  5FT3 A;  5INY A;  3FK8 A;  3DVX A;  4KW6 A;  2HI7 A;  2DBC A;  2O85 A;  5J3R A;  2DJ0 A;  4XCS A;  3N9J A;  1CQG A;  4PTS A;  1HQO A;  2OE1 A;  2IPA A;  4LMW A;  2M80 A;  4XHM A;  1OKD A;  1GSD A;  4GQF A;  2B7J A;  3FZA A;  5ELA A;  3RHB A;  4NXI A;  3CTF A;  4EVM A;  4DSS A;  2Z9S A;  1GP1 A;  5CRE A;  4ECB A;  1HNC A;  22GS A;  2K8S A;  2RM5 A;  3LWA A;  3L0H A;  2C1Y A;  2VO4 A;  1YEX A;  3DVW A;  3QAV A;  2FGX A;  3GKM A;  4K0G A;  2H6Z A;  1JFU A;  2H71 A;  4YKG A;  3QFA C;  2WZ9 A;  1FW1 A;  3H93 A;  3IC8 A;  4CY8 A;  3BOA A;  3CMI A;  4BIK A;  4IW9 A;  3VI7 A;  1AW9 A;  4IBP A;  1M2D A;  3ME7 A;  5ECI B;  4K2X A;  3ERF A;  2DSA A;  2FHE A;  1GUK A;  5DAK B;  1BJX A;  2EIR A;  2HRF A;  2I9H A;  4CY6 A;  3TCO A;  2X64 A;  4Q5F A;  2G2Q A;  2H0G A;  4F0C A;  4V2M A;  4IJI A;  3FMW A;  2HSH A;  5HFG A;  4XRA A;  2FY6 A;  3NIV A;  2OBK A;  2FWG A;  2DJ2 A;  2NPB A;  2C0G A;  3EU4 A;  2IMK A;  1XVW A;  4ILF A;  4X4J A;  1LJR A;  5IPH A;  2VCQ A;  2HZF A;  2JSY A;  2IMF A;  3R2Q A;  2GT6 A;  4I5Q A;  5IMC A;  4BL7 B;  3KJY A;  2H19 A;  1SJI A;  4ECC A;  1Y25 A;  3LSZ A;  1M99 A;  1R7H A;  3FR6 A;  4Q5R A;  2P5R A;  1K0O A;  1GRX A;  4J56 E;  4EF0 A;  2A4H A;  4KB3 A;  1J08 A;  2LQO A;  3MIX A;  1O8X A;  4RQX A;  3VWX A;  1WMJ A;  4BPY A;  4KH7 A;  2GS3 A;  3DYR A;  3F0I A;  4XS1 A;  3TOT A;  4IN0 A;  2PPT A;  2VLV A;  5EY6 A;  5D9T A;  2HSM A;  2GSQ A;  3GRX A;  4GST A;  4MLY A;  5DVB A;  4PQ1 A;  3C8E A;  2GZP A;  2QC7 A;  1SK1 A;  3EVI A;  2DKH A;  4TW5 A;  1U3A A;  1E2Y A;  1Q98 A;  5HFI A;  3UMA A;  1JLV A;  2VAF A;  3DXB A;  2G0F A;  3TJG A;  1JHB A;  1ZYQ B;  2C0D A;  3IHQ A;  5CRH A;  3RAZ A;  1XOB A;  3BD2 A;  1THX A;  1XXU A;  4N11 A;  2GTU A;  4TR0 A;  3MSZ A;  3IOS A;  2H1D A;  2YP6 A;  3ZVJ D;  1TRU A;  2YOI A;  3EMX A;  2A2S A;  3I43 A;  2ES7 A;  3KTL A;  3E3E A;  2JU5 A;  1V9W A;  1V98 A;  1JZO A;  4FYU A;  4NWY A;  2M72 A;  3IDV A;  2V6K A;  5B8B A;  1MTC A;  1AC1 A;  1V40 A;  4EIP A;  4GSN A;  2OKA A;  2YV7 A;  4PGT A;  5CO3 A;  3Q18 A;  4GQC A;  4JR4 A;  3IK9 A;  3EE2 A;  3CTG A;  4D73 A;  4KAE A;  4O5U A;  5IIZ A;  5G2Z A;  2IL3 A;  5ECP B;  3U5R E;  2V32 A;  3IRA A;  1SL2 B;  3DWV A;  1GSE A;  3D6I A;  4WBJ A;  1X9M B;  1QQ2 A;  4EL1 A;  2VCV A;  2VLU A;  1R5P A;  4NV2 A;  1E6B A;  2ZNM A;  1S3D A;  5J9B A;  1GTA A;  1XWA A;  4V2N A;  1U3I A;  1JLW A;  3VWW A;  1BX9 A;  3LQ7 A;  3DGQ A;  3Q74 A;  3IE3 A;  4OO4 A;  4HEA 2;  2I3Y A;  5H5S A;  3ZRD A;  1W89 A;  4F0B A;  4AJ6 A;  2ZCT A;  1VF1 A;  4X0X A;  2CQ9 A;  5HR2 A;  2X8G A;  3MDK A;  4K5S A;  4F9Z A;  1PN0 A;  1YZX A;  4LL1 B;  5HFK A;  3QD9 A;  1TXX A;  2AB6 A;  2CVB A;  2I4A A;  3TGZ A;  2YPM A;  1ZZY A;  3IR4 A;  2LV3 A;  2L4Q A;  4NMU A;  4OO5 A;  4G2E A;  2YV9 A;  4POB A;  3ZMK A;  4XS4 B;  5IMA A;  4TVE A;  3KD0 A;  2IJY A;  4G19 A;  2R37 A;  1XWB A;  1OC3 A;  4GTU A;  2H73 A;  3IAM 2;  4OCF A;  2P0G A;  4KE3 A;  1F3B A;  3LW9 A;  9GSS A;  2FLS A;  3RBT A;  1T8E B;  2YZH A;  3KMO A;  2HXK A;  3TRP A;  4LLR A;  5D93 A;  5DJL A;  5D73 A;  1WE0 A;  1Z7R A;  3SWL A;  1GL8 A;  2FA4 A;  4FIW A;  4MA9 A;  3LGC A;  1XWC A;  2H6Y A;  2VM1 A;  1F6M C;  2VM2 A;  2LTK A;  1TU7 A;  4IS0 A;  3G9B A;  5ECN B;  1M9A A;  4Z2R A;  4BWS A;  2MMA A;  1K3Y A;  1FOV A;  3EWL A;  1ERT A;  1FOH A;  3GV1 A;  2BJX A;  5JCU A;  3VWV A;  6GST A;  4G0I A;  3A2V A;  1RK4 A;  4PUR A;  2KP1 A;  4XRD A;  1O8W A;  1X9S B;  3HJM A;  2VLT A;  2HE3 A;  2LNS A;  3CSJ A;  4BVY B;  7GSS A;  2JZT A;  1GSQ A;  2FA8 A;  1O6J A;  5AGY A;  1ERW A;  1JZW A;  4NHZ A;  4PQI A;  2N5F A;  2PBJ A;  3WT2 A;  4V1A g;  1X9W B;  1N2A A;  3P7X A;  3ERG A;  2H8L A;  2WCI A;  1A2J A;  1A8L A;  3D5J A;  3KCM A;  1UC7 A;  1K3L A;  3WGE A;  4N10 A;  5GSS A;  2IWT A;  2K8V A;  2XHF A;  4JZQ A;  1U6T A;  2CX4 A;  2VL2 C;  5IMV A;  2QA1 A;  2HZE B;  5HQP A;  5AIX A;  3I69 A;  1GLQ A;  2V6O A;  1C72 A;  3UBK A;  2CAI A;  2QSI A;  4Z2U A;  1A2M A;  3HVX A;  1PN9 A;  2LRT A;  5J4U A;  1XWG A;  1VF2 A;  2B5Y A;  4PXO A;  3GYK A;  3D22 A;  1WRY A;  4PX1 A;  1ILO A;  4EXJ A;  1SKW B;  3ZML A;  5F07 A;  4HI7 A;  5D9X A;  4P3Y B;  1GTI A;  3AY8 A;  4MJB A;  4OFN A;  2A2R A;  1B4P A;  4ICY A;  2HLS A;  5F8B A;  3PGT A;  3F4T A;  16GS A;  5DAL B;  3TJB A;  1YJ6 A;  1XZO A;  3O76 A;  1S3C A;  1ZOF A;  1GNW A;  4I97 A;  1MDK A;  3GTU B;  1PX6 A;  12GS A;  2KLX A;  1Z6M A;  1R4W A;  4IP6 A;  4N0V A;  4KCE A;  1WWJ A;  3LXZ A;  2REM A;  4DVC A;  4KCA A;  1GUM A;  5ID2 A;  1FVJ A;  2PVO C;  4MH3 A;  1OAZ A;  4O5R A;  2P5Q A;  2VL2 A;  5IPG A;  3TUE A;  5ABR A;  5LNK e;  4OWY A;  3DD3 A;  5JWO B;  3N5O A;  2V1M A;  4MPG A;  4BA7 A;  4F2I A;  3M3M A;  5EL8 A;  4FYC A;  1PGT A;  2JAD A;  3M0F A;  1XW6 A;  1ZMA A;  4YH2 A;  4DEJ A;  1EEM A;  1BED A;  3G7I A;  1AQW A;  3H79 A;  5ECK B;  1UA5 A;  1ZL9 A;  3TKS E;  1B4Q A;  3G7J A;  5E4W A;  2B1L A;  4KX4 A;  2LJA A;  3D4M A;  3M9K A;  3KIJ A;  3KZQ A;  4IQ1 A;  1URM A;  1A23 A;  4LL4 B;  3KTB A;  5CRG A;  3QAW A;  2AJQ B;  3EPT A;  4MAB A;  3NZN A;  2GT5 A;  2ZUP A;  5IOX A;  2MBS A;  2DLX A;  2RM6 A;  3GST A;  3MYD A;  2EC4 A;  3IHG A;  4ML1 A;  1QFN A;  1AQV A;  3F6F A;  6GSS A;  4ZL7 A;  4ULX A;  2V2G A;  2O87 A;  2GZY A;  20GS A;  2OE3 A;  3LYK A;  3CSI A;  2A2P A;  2L57 A;  1ZCP A;  3G7Y A;  5GST A;  5IMD A;  3A5W A;  1ZYP A;  2BTO T;  4J2F A;  3W6G A;  1TTZ A;  10GS A;  3VFI A;  5DAL A;  2PU9 C;  4TR4 A;  2F3M A;  3WD6 A;  2H74 A;  3WT1 A;  4EKZ A;  4GRF A;  3DKS A;  5AIS A;  2MZC A;  2IMI A;  3LFL A;  3F3Q A;  1EV9 A;  1K0M A;  4JE1 A;  1GSY A;  1GTB A;  4AF2 A;  1F3A A;  4QL7 A;  1NHO A;  1OC9 A;  1M3J A;  3TJJ A;  2I1U A;  1EOH A;  2B1K A;  3J7Y k;  2H72 A;  1K0C A;  1OE8 A;  2N5B A;  4J57 E;  4ACS A;  5G1L A;  4MCU A;  4V2L A;  2OBI A;  2HRA A;  2WFC A;  3GFK A;  1M3I A;  1PA3 A;  5CNW A;  2IFQ B;  1X5D A;  3TJF A;  3O3T A;  1IYI A;  2VIM A;  3MAK A;  1YKA A;  3TRQ A;  4CDO A;  4F82 A;  1SD8 A;  4ZL8 A;  3CRU A;  1F9M A;  5HR3 A;  4V1A p;  3ED3 A;  4O92 A;  1SKR B;  3QAG A;  1QUW A;  4CHS A;  2H66 A;  1VF4 A;  1TRW A;  4IJ3 A;  2NDO A;  2X4A A;  4KSM A;  4L0W A;  1XWK A;  1WIK A;  4ZL9 A;  2FCH A;  1WOU A;  3BBY A;  4XTS A;  5FHI A;  1FVK A;  1M2A A;  3UJ1 A;  11GS A;  1DE2 A;  4G0K A;  3CXG A;  5EPF A;  5JCG A;  1UN2 A;  5IMF A;  1NM3 A;  1T3B A;  3FZ5 A;  1PFO A;  3IV4 A;  3GKN A;  1XPV A;  1TK8 B;  3UAR A;  5GZZ B;  2CA8 A;  5B6N A;  3UAP A;  3ME8 A;  1XCC A;  4OCE A;  2RUF A;  4BVX B;  2RLI A;  2VCX A;  5DAK A;  3IC4 A;  5IMZ A;  2VD1 A;  2MMO A;  1SK0 A;  3VUR A;  2J9H A;  3P2A A;  2L59 A;  4IEL A;  4TR1 B;  4AJ7 A;  3ZFL A;  2GST A;  3HY2 A;  4KGI A;  3ZRE A;  1H4O A;  4ZXG A;  4E8E A;  2PN8 A;  2YZU A;  1M9B A;  4BL7 A;  1ZYN A;  5F05 A;  2VOC A;  5D96 A;  5D9V A;  2WB9 A;  2GLR A;  1TRV A;  1LU4 A;  4IVF A;  4NPB A;  5ENU A;  3FEU A;  3UIW A;  5C04 A;  4ZBD A;  5B6M A;  1SJ6 A;  1PL2 A;  1M7T A;  1VRS D;  13GS A;  1CQH A;  2YWI A;  5DJM A;  5G1K A;  3HVN A;  1QMV A;  3EUR A;  2H6X A;  3H8Q A;  3FHK A;  4MF7 A;  1B9X C;  3FKF A;  1V57 A;  1U88 A;  3HHV A;  4O7H A;  5EVO A;  1YQ1 A;  4FH8 A;  1Y6E A;  4OMV A;  4MPF A;  3ZIV A;  3U6V A;  4TOP A;  4MNN A;  1EGO A;  4N30 A;  4GCI A;  5JWQ B;  1THO A;  1QGV A;  1A8Y A;  2DMM A;  3L9V A;  2HFD A;  2CX3 A;  2LJK A;  2F8A A;  3RPN A;  3FYG A;  1NHY A;  3FR3 A;  4MH2 A;  1XVQ A;  1GLP A;  3F6D A;  1U87 A;  2C0F A;  2L6C A;  3DRN A;  3ZTL A;  2C8U A;  6GSY A;  4IGJ A;  2R5G A;  3CRT A;  2X99 A;  3KP9 A;  4JED A;  3C73 A;  3DEX A;  2WDU A;  1FB0 A;  4TKY A;  1T1V A;  2AHE A;  3UVT A;  1DUG A;  4E8H A;  4I2T A;  5KN2 A;  4XIH A;  1HYU A;  2AV4 A;  1OKT A;  2FWE A;  3LEF A;  1BYE A;  1FAA A;  3KGK A;  5AIV A;  3SBC A;  5JWR B;  3QCP A;  4MMM A;  5F06 A;  1WP0 A;  2GVP A;  2M46 A;  4AGS A;  1MEK A;  2MMZ A;  1H75 A;  4L0U A;  2YCD A;  3ZVJ A;  4I2U A;  3ZL5 A; 
#chains in the Genus database with same CATH homology
 3L4N A;  4NAX A;  3O6T A;  1YF0 A;  2CT6 A;  4L8E A;  4DSQ A;  3CBU A;  4MJC A;  4RI7 A;  4HS1 A;  2F51 A;  2WJU A;  2X8H A;  3IXR A;  5DCG A;  4L5O A;  5IOW A;  4ZB6 A;  1EP8 A;  5ECH B;  3F8U A;  1GSF A;  1V2A A;  2DC5 A;  1DBY A;  3C1R A;  5HR1 A;  1KNG A;  1NSW A;  3K8N A;  4ZBA A;  2CAQ A;  4ID0 A;  1PKW A;  4JBB A;  3GIX A;  2GSR A;  4Q5N A;  2GQK A;  4PNF A;  1PMT A;  1O73 A;  4RQR A;  2JAC A;  3R3E A;  3Q19 A;  2R0P A;  5L71 A;  1GNE A;  2N5A A;  3GL5 A;  5ECO B;  1OE7 A;  2P31 A;  2PGT A;  2NTO A;  1HNB A;  4LA1 A;  2DJJ A;  4XS4 A;  3KEB A;  2B5X A;  4ZBB A;  3E9J B;  4PUF C;  1UVZ A;  3ERW A;  4K8M A;  2V41 A;  4EDZ A;  3EIN A;  1AIU A;  4X43 A;  3GA4 A;  5DQY A;  3KMN A;  2CZ3 A;  1SU9 A;  3CSH A;  4WR4 A;  5BMU A;  5G5F A;  3C71 A;  3BJ5 A;  3UOM A;  2IME A;  3VPQ A;  1XOA A;  2BMX A;  4EE0 A;  2PMT A;  1G6W A;  4TXV A;  1RQM A;  1AUC A;  3KXO A;  5AN1 A;  1XW9 A;  2EIO A;  2YJ7 A;  2GSS A;  1EV4 A;  2DIZ A;  5A5K A;  2JSZ A;  3P8W A;  4GXZ A;  18GS A;  3ZIT A;  2R2J A;  1OVN A;  2FWF A;  5DQS A;  3EU3 A;  2F9S A;  2H30 A;  3IPZ A;  2LST A;  4DSS B;  1M0U A;  2O8V B;  2C0E A;  1WPI A;  2H70 A;  2EIQ A;  4MJE A;  3HYP A;  2FD3 A;  1YF1 A;  1W4V A;  3EYT A;  2AAW A;  2YNX A;  3FZ4 A;  1SL0 B;  5CRD A;  2A4V A;  4BVY A;  4GSS A;  4YQV A;  1TU8 A;  2CV4 A;  4OFT A;  5DDL A;  1Z9H A;  2AYT A;  3VK9 A;  4RUV A;  2E2G A;  5ELG A;  3D0Z A;  3BCK A;  1F2E A;  1G7E A;  2B6M A;  1Z6N A;  1ERV A;  4ML6 A;  4FYB A;  4QQ7 A;  1I5G A;  2B7K A;  2FUG 2;  4ECI A;  1QXH A;  2LRN A;  2QKE A;  4MDC A;  1B48 A;  3C7M A;  1YDK A;  4MZB A;  3VI5 A;  4HOJ A;  4F03 A;  1K0N A;  1FO5 A;  3JCM L;  1GUH A;  4YAP A;  2YAN A;  4Q5Q A;  5IQY A;  4WXT A;  2DJ1 A;  3M1G A;  4HJ2 A;  2MBT A;  4EC0 A;  4JRR A;  2XPE A;  2R0C A;  2R3X A;  3LG6 A;  3HZ8 A;  2HZE A;  4I8B A;  2TIR A;  4EUY A;  2LS5 A;  3TKQ A;  4GWR A;  1MD4 A;  3FZ9 A;  3HA9 A;  3LXT A;  3ZZX A;  2GQL A;  3HJO A;  5KN1 A;  1PQN A;  2LNT A;  3ZFB A;  2R6K A;  2UZ8 A;  1QK8 A;  3W8J A;  1PSQ A;  3GX0 A;  4ECJ A;  1SJZ A;  2DKI A;  3S9F A;  1X0R A;  3H1N A;  5HR0 A;  4JR6 A;  3C1S A;  2LKU A;  3E0U A;  2IN3 A;  1JZD A;  3M9J A;  3GKK A;  3QPM A;  4K9Z A;  2XBI A;  1EEJ A;  3GTU A;  1TK0 B;  3GL3 A;  2CVD A;  1MDJ A;  1KBN A;  1YY7 A;  1Z3E A;  4YQM A;  5KN0 A;  2HNL A;  2J23 A;  4WR5 A;  3APQ A;  3Q6O A;  3IA1 A;  2L4C A;  4MK3 A;  1ZYE A;  6GSX A;  3GH6 A;  4HUA A;  1T4Z A;  1SK2 A;  1TI1 A;  1AQX A;  2C3Q A;  3FW2 A;  3HCZ A;  1Z5Y E;  1MDI A;  5GAN D;  2ALB A;  4EIQ A;  4WEY A;  2NVL A;  4KUN A;  1J0F A;  1XFL A;  1O81 A;  4HQZ A;  5J41 A;  3F9U A;  1AXD A;  4TR3 A;  5CP1 A;  4ZIJ A;  5BRT A;  4CW9 A;  5DBQ A;  3TOU A;  3WGD A;  2XPD A;  1N8J A;  1T00 A;  2OE0 A;  1BAY A;  5F0G A;  5ECR B;  1DE1 A;  1IYH A;  3QFB C;  3IK7 A;  4K7O A;  1J9B A;  1GH2 A;  2B5E A;  2KUC A;  3EMP A;  2E0Q A;  4H86 A;  4IQA A;  3L78 A;  2VCW A;  5ECL B;  1OC8 A;  19GS A;  3TRX A;  1K0B A;  4RI6 A;  2O89 A;  4X1U A;  1YEP A;  2MMN A;  3KH9 A;  4MZC A;  5IO0 A;  3A5I A;  3QMX A;  3TJK A;  1B8X A;  1XIY A;  5JCW A;  1G0T A;  3HZ4 A;  4D73 B;  4MF6 A;  1GSU A;  5CYY A;  1GTU A;  4NHW A;  2KHP A;  4Z2T A;  4LMV A;  3LOR A;  1PKZ A;  4FO5 A;  2VCZ A;  2JZR A;  3HD5 A;  1HNA A;  4NV5 A;  2DJ3 A;  2YN1 A;  2C4J A;  2GDR A;  2RII A;  5H5R A;  4KA0 A;  4K1F A;  1SL1 B;  4K0N A;  1EP7 A;  1FB6 A;  1A24 A;  3KM6 A;  2PUK C;  5IO2 A;  3IBH A;  2C3N A;  2R0G A;  1M2B A;  4FQU A;  2L5O A;  2DJK A;  4WF5 A;  4HU9 A;  1G7O A;  2DML A;  2GQM A;  2B3S A;  4A5P A;  2DIY A;  1F37 A;  1ML6 A;  2IFQ A;  1SKS B;  2TRX A;  3FY7 A;  4IKH A;  2FNO A;  1V58 A;  4K5R A;  5G30 A;  3UBL A;  5C00 A;  1DSB A;  2VL9 A;  1Z7P A;  2K9F A;  2ON7 A;  3HDC A;  5D8I A;  3M8N A;  1R26 A;  1TP9 A;  5KN3 A;  2F8F A;  2IMD A;  2LRC A;  2L5L A;  5ECQ B;  4TXO B;  2HRK A;  4OD7 A;  5KOX A;  2JL4 A;  1PX7 A;  1K0A A;  14GS A;  3L9U A;  2FWH A;  2I81 A;  3RPP A;  1X5E A;  3VLN A;  4K6X A;  1ERU A;  3I6A A;  2KOK A;  2QA2 A;  3GNJ A;  1KEB A;  2QGV A;  5ECS A;  3TB2 A;  5KEJ A;  3A3T A;  4YKF A;  1ZGN A;  4TN8 A;  5KOW A;  4USS A;  3KP8 A;  3J7Y b;  4HDE A;  1WJK A;  4GLT A;  3FRC A;  1PL1 A;  1JZR A;  3GHA A;  2WRT A;  4MJA A;  2NBS A;  1BG5 A;  1VGL A;  2XBQ A;  1SD9 A;  4WF4 A;  2YWO A;  1USB A;  3PH9 A;  3D4T A;  4ISD A;  2H75 A;  4BVX A;  2D2Z A;  2H0H A;  2H76 A;  2HYX A;  5G31 A;  3US3 A;  3W8S A;  3TKP A;  4ZIL A;  2CVK A;  1O85 A;  3V1W A;  3F63 A;  5B7C A;  1GUL A;  2JZS A;  3MNG A;  2HSY A;  1S3A A;  4TR1 A;  6GSU A;  1Q4J A;  2ON5 A;  3NOF A;  3KH7 A;  6GSW A;  3VPT A;  4BWQ A;  4POL A;  3GSS A;  3HKR A;  1TJD A;  2E7P A;  2OAC A;  5LD0 A;  1X5C A;  2YJH A;  2OJL A;  5H5Q A;  4EO3 A;  1MD3 A;  3A2W A;  3APO A;  3QDN A;  3QR6 A;  4XS6 A;  3CYN A;  4MF5 A;  5A4W A;  4MZW A;  2XC2 A;  2OA7 A;  4I6X A;  1YKC A;  2VD0 A;  3D21 A;  1HD2 A;  4G10 A;  4HU7 A;  4POM A;  4TRX A;  4TXO A;  5J5N A;  1EOG A;  3BCI A;  2VCT A;  3F4R A;  1K0D A;  2PVQ A;  2TRC P;  2K18 A;  1BQ7 A;  3GUS A;  1PRX A;  2IIY A;  3DIE A;  2YWM A;  3QOU A;  4DSR A;  2RUE A;  3UVH A;  4G0L A;  1B9Y C;  3PIN A;  3WGX A;  2O7K A;  4KDX A;  4O5Q A;  1K3O A;  3TKS C;  5GAP D;  1TDI A;  4WET A;  5ECM B;  4JU5 A;  1ON4 A;  3GMF A;  2HT9 A;  2WUL A;  3I9V 2;  2H01 A;  2PER A;  5A4V A;  4YQU A;  5J9C A;  2VUP A;  1EZK A;  2E2M A;  1LBK A;  3ZLP A;  5ID2 B;  1G6Y A;  1KTE A;  3UL3 A;  3GUR A;  2VL3 A;  3TKR A;  2HRN A;  3MWH A;  1AAZ A;  4QL9 A;  17GS A;  1SYX A;  3PPU A;  3UEM A;  3RDW A;  4ZB8 A;  1FHE A;  3GKX A;  3WYW A;  4HZ2 A;  3L9S A;  4HJM A;  2LJR A;  1EWX A;  4PQH A;  2H1A A;  2K6V A;  5CRW A;  3GN3 A;  2WGR A;  4K2D A;  4G9H A;  3TKS A;  4ZB9 A;  6GSV A;  4KDU A;  3LJR A;  5LCZ A;  1XW5 A;  2AUV A;  4HZ4 A;  1GWC A;  1SEN A;  4IHU A;  4Z7X A;  4KSO A;  4PNG A;  1FG4 A;  4AJ8 A;  3ZYW A;  1TW9 A;  2GGT A;  4OFM A;  5G5E A;  2LUS A;  2C3T A;  3RHC A;  3P90 A;  1T7P B;  5COH A;  4WKW A;  2LEG A;  3H4K A;  1SYR A;  1ST9 A;  4N0Z A;  2GZZ A;  4GF0 A;  4K7I A;  3TDG A;  3F4S A;  3HJP A;  4HQS A;  3HXS A;  4KDY A;  3VWU A;  3ISO A;  3ZIJ A;  4POK A;  1TI3 A;  2PWJ A;  2R4V A;  1XBS A;  2H1G A;  3HVS A;  2LQQ A;  2X8C A;  1EGR A;  4MP4 A;  5E59 A;  3A2X A;  2L6D A;  5A4U A;  2OAD A;  3FR9 A;  4WBR D;  1A2L A;  3F3R A;  3DML A;  4L5L A;  5FWG A;  3PR8 A;  2CZ2 A;  1A0F A;  3GX8 A;  4O32 A;  1TKD B;  5IM9 A;  5B8A A;  2WS2 A;  1A0R P;  1OC9 B;  1RW1 A;  5DCH A;  2MYG A;  1I9D A;  3GH9 A;  4YAV A;  1TK5 B;  1GSS A;  5CAX A;  2YWN A;  5D9W A;  3LYP A;  1TOF A;  1OYJ A;  3OR5 A;  1TRS A;  1VF3 A;  3HVV A;  4IP1 A;  4KF9 A;  4EDY A;  2H1B A;  1T4Y A;  1R5A A;  3EC3 A;  1PD2 1;  4K7N A;  2KP2 A;  4PUA A;  2X49 A;  3IAS 2;  8GSS A;  2C80 A;  1ABA A;  4KND A;  3APS A;  1NW2 A;  1O7U A;  2H0I A;  1ACV A;  5FT3 A;  5INY A;  3FK8 A;  3DVX A;  4KW6 A;  2HI7 A;  2DBC A;  2O85 A;  5J3R A;  2DJ0 A;  4XCS A;  3N9J A;  1CQG A;  4PTS A;  1HQO A;  2OE1 A;  2IPA A;  4LMW A;  2M80 A;  4XHM A;  1OKD A;  1GSD A;  4GQF A;  2B7J A;  3FZA A;  5ELA A;  3RHB A;  4NXI A;  3CTF A;  4EVM A;  4DSS A;  2Z9S A;  1GP1 A;  5CRE A;  4ECB A;  1HNC A;  22GS A;  2K8S A;  2RM5 A;  3LWA A;  3L0H A;  2C1Y A;  2VO4 A;  1YEX A;  3DVW A;  3QAV A;  2FGX A;  3GKM A;  4K0G A;  2H6Z A;  1JFU A;  2H71 A;  4YKG A;  3QFA C;  2WZ9 A;  1FW1 A;  3H93 A;  3IC8 A;  4CY8 A;  3BOA A;  3CMI A;  4IW9 A;  3VI7 A;  1AW9 A;  4IBP A;  1M2D A;  3ME7 A;  5ECI B;  4K2X A;  3ERF A;  2DSA A;  2FHE A;  1GUK A;  5DAK B;  1BJX A;  2EIR A;  2HRF A;  2I9H A;  4CY6 A;  3TCO A;  2X64 A;  4Q5F A;  2G2Q A;  2H0G A;  4F0C A;  4V2M A;  4IJI A;  3FMW A;  2HSH A;  5HFG A;  4XRA A;  2FY6 A;  3NIV A;  2OBK A;  2FWG A;  2DJ2 A;  2NPB A;  2C0G A;  3EU4 A;  2IMK A;  1XVW A;  4ILF A;  4X4J A;  1LJR A;  5IPH A;  2VCQ A;  2HZF A;  2JSY A;  2IMF A;  3R2Q A;  2GT6 A;  4I5Q A;  5IMC A;  4BL7 B;  3KJY A;  2H19 A;  1SJI A;  4ECC A;  1Y25 A;  3LSZ A;  1M99 A;  1R7H A;  3FR6 A;  4Q5R A;  2P5R A;  1K0O A;  1GRX A;  4J56 E;  4EF0 A;  2A4H A;  4KB3 A;  1J08 A;  2LQO A;  3MIX A;  1O8X A;  4RQX A;  3VWX A;  1WMJ A;  4BPY A;  4KH7 A;  2GS3 A;  3DYR A;  3F0I A;  4XS1 A;  3TOT A;  4IN0 A;  2PPT A;  2VLV A;  5EY6 A;  5D9T A;  2HSM A;  2GSQ A;  3GRX A;  4GST A;  4MLY A;  5DVB A;  4PQ1 A;  3C8E A;  2GZP A;  2QC7 A;  1SK1 A;  3EVI A;  2DKH A;  4TW5 A;  1U3A A;  1E2Y A;  1Q98 A;  5HFI A;  3UMA A;  1JLV A;  2VAF A;  3DXB A;  2G0F A;  3TJG A;  1JHB A;  1ZYQ B;  2C0D A;  3IHQ A;  5CRH A;  3RAZ A;  1XOB A;  3BD2 A;  1THX A;  1XXU A;  4N11 A;  2GTU A;  4TR0 A;  3MSZ A;  3IOS A;  2H1D A;  2YP6 A;  3ZVJ D;  1TRU A;  2YOI A;  3EMX A;  2A2S A;  3I43 A;  2ES7 A;  3KTL A;  3E3E A;  2JU5 A;  1V9W A;  1V98 A;  1JZO A;  4FYU A;  4NWY A;  2M72 A;  3IDV A;  2V6K A;  5B8B A;  1MTC A;  1AC1 A;  1V40 A;  4EIP A;  4GSN A;  2OKA A;  2YV7 A;  4PGT A;  5CO3 A;  3Q18 A;  4GQC A;  4JR4 A;  3IK9 A;  3EE2 A;  3CTG A;  4D73 A;  4KAE A;  4O5U A;  5IIZ A;  5G2Z A;  2IL3 A;  5ECP B;  3U5R E;  2V32 A;  3IRA A;  1SL2 B;  3DWV A;  1GSE A;  3D6I A;  4WBJ A;  1X9M B;  1QQ2 A;  4EL1 A;  2VCV A;  2VLU A;  1R5P A;  4NV2 A;  1E6B A;  2ZNM A;  1S3D A;  5J9B A;  1GTA A;  1XWA A;  4V2N A;  1U3I A;  1JLW A;  3VWW A;  1BX9 A;  3LQ7 A;  3DGQ A;  3Q74 A;  3IE3 A;  4OO4 A;  4HEA 2;  2I3Y A;  5H5S A;  3ZRD A;  1W89 A;  4F0B A;  4AJ6 A;  2ZCT A;  1VF1 A;  4X0X A;  2CQ9 A;  5HR2 A;  2X8G A;  3MDK A;  4K5S A;  4F9Z A;  1PN0 A;  1YZX A;  4LL1 B;  5HFK A;  3QD9 A;  1TXX A;  2AB6 A;  2CVB A;  2I4A A;  3TGZ A;  2YPM A;  1ZZY A;  3IR4 A;  2LV3 A;  2L4Q A;  4NMU A;  4OO5 A;  4G2E A;  2YV9 A;  4POB A;  3ZMK A;  4XS4 B;  5IMA A;  4TVE A;  3KD0 A;  2IJY A;  4G19 A;  2R37 A;  1XWB A;  1OC3 A;  4GTU A;  2H73 A;  3IAM 2;  4OCF A;  2P0G A;  4KE3 A;  1F3B A;  3LW9 A;  9GSS A;  2FLS A;  3RBT A;  1T8E B;  2YZH A;  3KMO A;  2HXK A;  3TRP A;  4LLR A;  5D93 A;  5DJL A;  5D73 A;  1WE0 A;  1Z7R A;  3SWL A;  1GL8 A;  2FA4 A;  4FIW A;  4MA9 A;  3LGC A;  1XWC A;  2H6Y A;  2VM1 A;  1F6M C;  2VM2 A;  2LTK A;  1TU7 A;  4IS0 A;  3G9B A;  5ECN B;  1M9A A;  4Z2R A;  4BWS A;  2MMA A;  1K3Y A;  1FOV A;  3EWL A;  1ERT A;  1FOH A;  3GV1 A;  2BJX A;  5JCU A;  3VWV A;  6GST A;  4G0I A;  3A2V A;  1RK4 A;  4PUR A;  2KP1 A;  4XRD A;  1O8W A;  1X9S B;  3HJM A;  2VLT A;  2HE3 A;  2LNS A;  3CSJ A;  4BVY B;  7GSS A;  2JZT A;  1GSQ A;  2FA8 A;  1O6J A;  5AGY A;  1ERW A;  1JZW A;  4NHZ A;  4PQI A;  2N5F A;  2PBJ A;  3WT2 A;  4V1A g;  1X9W B;  1N2A A;  3P7X A;  3ERG A;  2H8L A;  2WCI A;  1A2J A;  1A8L A;  3D5J A;  3KCM A;  1UC7 A;  1K3L A;  3WGE A;  4N10 A;  5GSS A;  2IWT A;  2K8V A;  2XHF A;  4JZQ A;  1U6T A;  2CX4 A;  2VL2 C;  5IMV A;  2QA1 A;  2HZE B;  5HQP A;  5AIX A;  3I69 A;  1GLQ A;  2V6O A;  1C72 A;  3UBK A;  2CAI A;  2QSI A;  4Z2U A;  1A2M A;  3HVX A;  1PN9 A;  2LRT A;  5J4U A;  1XWG A;  1VF2 A;  2B5Y A;  4PXO A;  3GYK A;  3D22 A;  1WRY A;  4PX1 A;  1ILO A;  4EXJ A;  1SKW B;  3ZML A;  5F07 A;  4HI7 A;  5D9X A;  4P3Y B;  1GTI A;  3AY8 A;  4MJB A;  4OFN A;  2A2R A;  1B4P A;  4ICY A;  2HLS A;  5F8B A;  3PGT A;  3F4T A;  16GS A;  5DAL B;  3TJB A;  1YJ6 A;  1XZO A;  3O76 A;  1S3C A;  1ZOF A;  1GNW A;  4I97 A;  1MDK A;  3GTU B;  1PX6 A;  12GS A;  2KLX A;  1Z6M A;  1R4W A;  4IP6 A;  4N0V A;  4KCE A;  1WWJ A;  3LXZ A;  2REM A;  4DVC A;  4KCA A;  1GUM A;  5ID2 A;  1FVJ A;  2PVO C;  4MH3 A;  1OAZ A;  4O5R A;  2P5Q A;  2VL2 A;  5IPG A;  3TUE A;  5ABR A;  5LNK e;  4OWY A;  3DD3 A;  5JWO B;  3N5O A;  2V1M A;  4MPG A;  4BA7 A;  4F2I A;  3M3M A;  5EL8 A;  4FYC A;  1PGT A;  2JAD A;  3M0F A;  1XW6 A;  1ZMA A;  4YH2 A;  4DEJ A;  1EEM A;  1BED A;  3G7I A;  1AQW A;  3H79 A;  5ECK B;  1UA5 A;  1ZL9 A;  3TKS E;  1B4Q A;  3G7J A;  5E4W A;  2B1L A;  4KX4 A;  2LJA A;  3D4M A;  3M9K A;  3KIJ A;  3KZQ A;  4IQ1 A;  1URM A;  1A23 A;  4LL4 B;  3KTB A;  5CRG A;  3QAW A;  2AJQ B;  3EPT A;  4MAB A;  3NZN A;  2GT5 A;  2ZUP A;  5IOX A;  2MBS A;  2DLX A;  2RM6 A;  3GST A;  3MYD A;  2EC4 A;  3IHG A;  4ML1 A;  1QFN A;  1AQV A;  3F6F A;  6GSS A;  4ZL7 A;  4ULX A;  2V2G A;  2O87 A;  2GZY A;  20GS A;  2OE3 A;  3LYK A;  3CSI A;  2A2P A;  2L57 A;  1ZCP A;  3G7Y A;  5GST A;  5IMD A;  3A5W A;  1ZYP A;  2BTO T;  4J2F A;  3W6G A;  1TTZ A;  10GS A;  3VFI A;  5DAL A;  2PU9 C;  4TR4 A;  2F3M A;  3WD6 A;  2H74 A;  3WT1 A;  4EKZ A;  4GRF A;  3DKS A;  5AIS A;  2MZC A;  2IMI A;  3LFL A;  3F3Q A;  1EV9 A;  1K0M A;  4JE1 A;  1GSY A;  1GTB A;  4AF2 A;  1F3A A;  4QL7 A;  1NHO A;  1OC9 A;  3TJJ A;  2I1U A;  1EOH A;  2B1K A;  3J7Y k;  2H72 A;  1K0C A;  1OE8 A;  2N5B A;  4J57 E;  4ACS A;  5G1L A;  4MCU A;  4V2L A;  2OBI A;  2HRA A;  2WFC A;  3GFK A;  1PA3 A;  5CNW A;  2IFQ B;  1X5D A;  3TJF A;  3O3T A;  1IYI A;  2VIM A;  3MAK A;  1YKA A;  3TRQ A;  4CDO A;  4F82 A;  1SD8 A;  4ZL8 A;  3CRU A;  1F9M A;  5HR3 A;  4V1A p;  3ED3 A;  4O92 A;  1SKR B;  3QAG A;  1QUW A;  4CHS A;  2H66 A;  1VF4 A;  1TRW A;  4IJ3 A;  2NDO A;  2X4A A;  4KSM A;  4L0W A;  1XWK A;  1WIK A;  4ZL9 A;  2FCH A;  1WOU A;  3BBY A;  4XTS A;  5FHI A;  1FVK A;  1M2A A;  3UJ1 A;  11GS A;  1DE2 A;  4G0K A;  3CXG A;  5EPF A;  5JCG A;  1UN2 A;  5IMF A;  1NM3 A;  1T3B A;  3FZ5 A;  3IV4 A;  3GKN A;  1XPV A;  1TK8 B;  3UAR A;  5GZZ B;  2CA8 A;  5B6N A;  3UAP A;  3ME8 A;  1XCC A;  4OCE A;  2RUF A;  4BVX B;  2RLI A;  2VCX A;  5DAK A;  3IC4 A;  5IMZ A;  2VD1 A;  2MMO A;  1SK0 A;  3VUR A;  2J9H A;  3P2A A;  2L59 A;  4IEL A;  4TR1 B;  4AJ7 A;  3ZFL A;  2GST A;  3HY2 A;  4KGI A;  3ZRE A;  1H4O A;  4ZXG A;  4E8E A;  2PN8 A;  2YZU A;  1M9B A;  4BL7 A;  1ZYN A;  5F05 A;  2VOC A;  5D96 A;  5D9V A;  2WB9 A;  2GLR A;  1TRV A;  1LU4 A;  4IVF A;  4NPB A;  5ENU A;  3FEU A;  3UIW A;  5C04 A;  4ZBD A;  5B6M A;  1SJ6 A;  1PL2 A;  1M7T A;  1VRS D;  13GS A;  1CQH A;  2YWI A;  5DJM A;  5G1K A;  1QMV A;  3EUR A;  2H6X A;  3H8Q A;  3FHK A;  4MF7 A;  1B9X C;  3FKF A;  1V57 A;  1U88 A;  3HHV A;  4O7H A;  5EVO A;  1YQ1 A;  4FH8 A;  1Y6E A;  4OMV A;  4MPF A;  3ZIV A;  3U6V A;  4TOP A;  4MNN A;  1EGO A;  4N30 A;  4GCI A;  5JWQ B;  1THO A;  1QGV A;  1A8Y A;  2DMM A;  3L9V A;  2HFD A;  2CX3 A;  2LJK A;  2F8A A;  3RPN A;  3FYG A;  1NHY A;  3FR3 A;  4MH2 A;  1XVQ A;  1GLP A;  3F6D A;  1U87 A;  2C0F A;  2L6C A;  3DRN A;  3ZTL A;  2C8U A;  6GSY A;  4IGJ A;  2R5G A;  3CRT A;  2X99 A;  3KP9 A;  4JED A;  3C73 A;  3DEX A;  2WDU A;  1FB0 A;  4TKY A;  1T1V A;  2AHE A;  3UVT A;  1DUG A;  4E8H A;  4I2T A;  5KN2 A;  4XIH A;  1HYU A;  2AV4 A;  1OKT A;  2FWE A;  3LEF A;  1BYE A;  1FAA A;  3KGK A;  5AIV A;  3SBC A;  5JWR B;  3QCP A;  4MMM A;  5F06 A;  1WP0 A;  2GVP A;  2M46 A;  4AGS A;  1MEK A;  2MMZ A;  1H75 A;  4L0U A;  2YCD A;  3ZVJ A;  4I2U A;  3ZL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...