2DIYA

The solution structure of the thioredoxin domain of human thioredoxin-like protein 2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
130
structure length
130
Chain Sequence
GSSGSSGMAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEAEGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Thioredoxin-like protein 2
publication title The solution structure of the thioredoxin domain of human Thioredoxin-like protein 2
rcsb
source organism Homo sapiens
total genus 27
structure length 130
sequence length 130
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2diyA01
2QSIA 2PU9C 3FR6A 3VPTA 2O7KA 1GSSA 3D22A 1R4WA 4Q5RA 1ST9A 2LSTA 4J2FA 2CAQA 2L5OA 4K0GA 3W6GA 1MD3A 4N0VA 2VCZA 2MMAA 4K7OA 1NW2A 1UC7A 3KMNA 4PNGA 2TRCP 2VM1A 4TR1A 3A2WA 3KJYA 4I8BA 3ZFLA 1JHBA 4Z7XA 4IVFA 5F05A 3K8NA 2DJ2A 5CAXA 1OAZA 1PX6A 1SL1B 1WMJA 14GSA 3G7IA 2CV4A 2DBCA 2CVKA 4OWYA 1TDIA 3TJGA 4FYBA 3KIJA 4GSNA 3KP8A 4ID0A 5DBQA 3QAWA 4O5RA 3DGQA 3TJBA 1M9BA 1OYJA 4G19A 1O81A 3GKMA 4HS1A 5ENUA 3F3QA 1ERUA 1XPVA 1B9YC 1AAZA 2L59A 4HU9A 2FCHA 2HRFA 1AUCA 3GL5A 4DSRA 2H76A 1SJZA 5EL8A 3EMXA 4NMUA 1AC1A 4EDYA 4MP4A 2JSZA 2OE0A 1SKRB 4WEYA 4K7IA 2YWNA 1BAYA 2R3XA 5B6MA 1MTCA 4GWRA 3M3MA 1AQVA 3A3TA 1PX7A 2DC5A 2V2GA 3TKSC 3UL3A 1VF1A 2GZPA 2HZFA 1LBKA 2K8SA 4BWQA 2HZEB 6GSUA 2VL3A 2LS5A 1B8XA 1V57A 2L57A 2P31A 5JCGA 17GSA 9GSSA 1E6BA 1PKZA 2LTKA 3EINA 1PMTA 4KSMA 2YANA 1XOAA 3GFKA 2G2QA 1YEXA 4XTSA 2OBKA 3ERWA 5F07A 2H30A 1GSYA 1SL2B 3U5RE 3BOAA 5JCWA 1SL0B 2GVPA 11GSA 2YWMA 3QOUA 4BVXA 6GSXA 3TKPA 2HZEA 3OR5A 3Q19A 2C3NA 1GWCA 3FW2A 2L5LA 4V2LA 3RHBA 5D9VA 4OD7A 1X9SB 3I69A 5H5SA 3HXSA 2N5FA 4L0WA 1BX9A 5IMDA 4MF6A 3IBHA 1FVKA 2H6XA 4KCEA 3W8JA 2H8LA 5IOWA 5D9WA 3D4MA 2QC7A 1R5AA 1TU8A 2YWIA 3LXZA 4WXTA 2OKAA 1OC9A 1X5CA 5G2ZA 2CVDA 3ZIJA 2C0GA 4N0ZA 4GF0A 4HZ4A 1K0CA 4E8HA 4DVCA 1SYXA 2JACA 3PR8A 3RBTA 5ECHB 1PSQA 1M2DA 1MDIA 1EGRA 3TRPA 2MYGA 5IIZA 2R4VA 1TRSA 2VOCA 1TJDA 3RAZA 3TKSE 2MBTA 1N2AA 1WJKA 5COHA 3CTFA 3P7XA 1G6YA 4I2UA 4JBBA 3US3A 3KTBA 1GLPA 2B7KA 3N5OA 4LA1A 2H1AA 1YY7A 2X8GA 2D2ZA 1YKCA 2L6CA 3F4SA 2DSAA 2GT6A 2YJ7A 2DJKA 3DWVA 3VURA 2Z9SA 1O73A 3GMFA 2LRCA 4XIHA 2H1DA 1WIKA 1I5GA 3NZNA 5CYYA 2QGVA 3KXOA 1QK8A 3UMAA 2B5EA 3ME8A 1O8XA 3UAPA 5CRWA 1FB0A 2C3QA 5ELGA 2OJLA 1DE2A 3HVSA 3F0IA 4EE0A 1YEPA 3HVVA 3UVHA 1KNGA 2FNOA 1GTBA 1T4YA 6GSYA 4V2MA 3LGCA 3TOTA 1Q98A 1JZOA 3C1RA 8GSSA 1KEBA 2VD0A 2IWTA 1XWCA 5KN2A 4JEDA 1S3CA 2MMNA 4MLYA 4IN0A 2XC2A 3GNJA 4TR3A 3NOFA 2GT5A 5AIVA 1TI3A 3LXTA 2IN3A 2PVQA 1K3LA 1BG5A 2FD3A 3I43A 1SK0A 3M8NA 3IAS2 4GSSA 4KDXA 1GRXA 5JWOB 4JE1A 3RDWA 2C0DA 3CXGA 1SKWB 3DRNA 2HFDA 2R37A 1ZL9A 3HJPA 4V2NA 3UBLA 5CREA 1GTUA 2LUSA 2N5AA 4LMWA 3ZL5A 2PGTA 4K0NA 1TOFA 2I4AA 3KTLA 1H75A 3APSA 4POBA 5EPFA 4JU5A 1F6MC 4TR0A 3QFAC 3CBUA 1THOA 1EZKA 1HNAA 2XPEA 2J23A 1TRWA 2VL9A 2F8AA 2HNLA 4MF7A 2DMMA 1JZWA 3IRAA 4KSOA 4WF5A 7GSSA 5C00A 3H8QA 3WT2A 3QFBC 2E7PA 2C3TA 4DSQA 2XPDA 2YZHA 2PWJA 3FR3A 3UOMA 3S9FA 4JR6A 4WETA 2WGRA 1PRXA 5CO3A 5DJMA 2O85A 1XWAA 2AV4A 2J9HA 3IK9A 3HJMA 4MDCA 5L71A 1Z7PA 2R2JA 3QD9A 3V1WA 4P3YB 4F2IA 3J7Yk 5ELAA 2A2RA 5AISA 2V41A 4F0CA 2C8UA 5DAKA 5AN1A 3HY2A 4Q5NA 2AUVA 3HHVA 2F3MA 1GUMA 4NV5A 2H1GA 5JWQB 2IJYA 3SBCA 1I9DA 3TJJA 2RM5A 16GSA 3VI7A 4L5OA 1TRUA 4XRAA 3TUEA 1YKAA 4EKZA 5HR2A 5D96A 3UVTA 1GUKA 3EVIA 3PH9A 2IMDA 3TGZA 1WRYA 3IK7A 1FB6A 3F8UA 13GSA 4EO3A 3C71A 1Y6EA 2F51A 4YQUA 1J0FA 1XVWA 2YWOA 2M80A 3WYWA 5IMFA 1DSBA 3QR6A 2PUKC 4Q5FA 2AYTA 1TP9A 4N30A 4I97A 1YF1A 1EOHA 1G7EA 1ZMAA 2PVOC 2AB6A 3ED3A 5ECOB 2CZ2A 5FT3A 2EIQA 1RW1A 1XVQA 2X99A 4YAVA 4CHSA 1B4QA 2RUFA 4OFMA 4BWSA 4IP1A 1QUWA 2H66A 1BQ7A 2HE3A 3QAVA 2ZUPA 1M99A 2ALBA 1GH2A 2X8CA 2H75A 1EOGA 2N5BA 2C1YA 2F8FA 1QGVA 4NPBA 5INYA 4RQRA 2H6YA 3L0HA 2LJAA 3WGXA 1EEMA 1ERVA 3CTGA 3QPMA 4GTUA 1R26A 2HSHA 5LCZA 1JFUA 2GDRA 2G0FA 4WR4A 5ECPB 5IPHA 2ES7A 1ERWA 5ECNB 2GTUA 3I6AA 3Q18A 3RPPA 2LRTA 1R5PA 5D73A 4MZBA 4ACSA 4OCEA 2JZTA 4HQSA 3HZ4A 2E2MA 3CYNA 5LNKe 1EV4A 5CNWA 1EP7A 3GURA 4ISDA 3H4KA 6GSVA 3GYKA 2FA4A 1PA3A 3TJKA 3KZQA 2OADA 4ML1A 5GAPD 2GZYA 1DE1A 4QL9A 2LQOA 2EIOA 2HXKA 4OO5A 4PURA 4PQHA 3ZFBA 1TKDB 4QQ7A 5D8IA 4EC0A 3HCZA 2CZ3A 3E0UA 1YJ6A 4ZL8A 2C0FA 1GNWA 1SU9A 5G1KA 1A2MA 3I9V2 1FW1A 2FUG2 2VD1A 2JZRA 2GGTA 3QCPA 1SD9A 2KP1A 5DDLA 5LD0A 1M7TA 1O85A 3Q6OA 2LEGA 2E2GA 4ZBBA 1MEKA 2IFQB 4TRXA 4RQXA 2IL3A 2WJUA 2VCXA 1EEJA 5ECLB 1VF2A 4X1UA 4YH2A 3GL3A 2OACA 3EMPA 1V40A 5AIXA 2HT9A 1FO5A 1CQGA 5B8BA 3TKRA 1K0DA 2YCDA 5IO2A 2B6MA 4MJAA 3KEBA 2VLUA 3F6DA 1Q4JA 1K3YA 5E4WA 3VWXA 3KM6A 1W89A 1VGLA 4MH3A 2IFQA 2NDOA 1IYIA 5JWRB 1X0RA 3MSZA 5HFKA 3WT1A 5J9BA 1DBYA 1E2YA 3MAKA 2IIYA 1GSDA 2R6KA 4AJ6A 1V98A 1YDKA 2YV7A 2TRXA 2V32A 4BL7A 3BD2A 2HRNA 2I81A 2O8VB 4OFTA 3L78A 4MCUA 4ZB9A 5D9TA 4TXOB 1HQOA 2WB9A 3CRUA 1J08A 1GP1A 4NV2A 2KP2A 3FR9A 3KH7A 3LQ7A 2B5YA 2BTOT 4GRFA 5ID2B 3LG6A 2GSQA 3WGDA 1AW9A 3TJFA 2H73A 3VWUA 4F82A 4H86A 4O92A 2NPBA 4KB3A 1X5DA 5EY6A 5HFIA 1UN2A 2VCVA 1XXUA 4HU7A 1NSWA 4ZBDA 1XWGA 2H0HA 1G7OA 4HI7A 1OC8A 1EP8A 3KH9A 3L9UA 2ON7A 2RM6A 2TIRA 5IOXA 1T7PB 4WF4A 4KW6A 1T3BA 1YF0A 4I2TA 2AAWA 4PGTA 2MMZA 5G30A 4IHUA 5E59A 2YOIA 5HR0A 1FHEA 5DCHA 3CMIA 3TRQA 3LFLA 5IMAA 2OBIA 5ID2A 5G5FA 3P8WA 1B9XC 1K0OA 5HQPA 3H79A 2PERA 2M72A 4POMA 3BBYA 3GSSA 1GTAA 3EURA 1T8EB 1XW6A 1HYUA 2LKUA 3IE3A 4EF0A 5HFGA 1GSQA 1TK0B 3IA1A 4PXOA 3FZ9A 3G7YA 3O76A 2NTOA 3A2VA 3GUSA 1MDJA 1A8LA 5F0GA 1PL2A 4IKHA 5EVOA 1SK1A 2PPTA 4XHMA 1OE8A 2EC4A 3RPNA 3TDGA 2OA7A 5G1LA 4FIWA 2WFCA 2GSTA 4MK3A 2YV9A 1JLWA 1FG4A 3GKKA 1EGOA 3R2QA 2NBSA 2GLRA 3FZ4A 3ZZXA 4NXIA 5ECMB 2DJ1A 1GTIA 2CA8A 2LNSA 3O3TA 1PQNA 3E3EA 1C72A 2WCIA 3SWLA 4ZB6A 3Q74A 4XRDA 1G0TA 1QFNA 4K2DA 1BYEA 2H19A 1NM3A 2YP6A 4NHZA 4WBRD 2CX4A 2DLXA 2H6ZA 1FVJA 2JSYA 2LJKA 1K0NA 1OE7A 4F0BA 1THXA 6GSTA 2I1UA 2PBJA 4MMMA 1O7UA 2O89A 2FWEA 5DALB 2VL2A 5A4UA 5H5QA 1GL8A 1V2AA 4FYCA 4IS0A 3CSHA 4GQFA 2IPAA 2YN1A 3EU3A 2L6DA 3EE2A 1ZYEA 1FOVA 3F6FA 2RUEA 1W4VA 1WE0A 3WGEA 4EL1A 4BA7A 1XCCA 5GSSA 3GV1A 2H74A 5GZZB 2CAIA 1O6JA 4CW9A 5D93A 3H1NA 1AQWA 5ECRB 3UBKA 5DALA 1M2AA 4K9ZA 1TK5B 4ILFA 2P5QA 4OMVA 2FA8A 3W8SA 2A4VA 1CQHA 1F3BA 2HSYA 3LORA 3VI5A 4BVYA 4XS1A 1TTZA 4WR5A 5KEJA 2GSRA 5J9CA 1A23A 1RK4A 1UA5A 4KX4A 4OFNA 1N8JA 4ZXGA 19GSA 22GSA 2BMXA 4N11A 2V1MA 4GXZA 5GSTA 4ZBAA 3FHKA 3FY7A 4HJ2A 4K8MA 1T1VA 2LQQA 4RUVA 1DUGA 1XIYA 2FWHA 4EDZA 3EU4A 2QKEA 4IW9A 3TKQA 5A5KA 1TI1A 1GUHA 3D6IA 5G5EA 4FO5A 4MJCA 3HDCA 1EV9A 2FY6A 2YZUA 2L4CA 4K6XA 1Z3EA 2GS3A 4KA0A 3HKRA 1XBSA 3FK8A 5KN3A 2VCQA 3FZAA 4G10A 5B7CA 2B7JA 2I3YA 4L0UA 3GA4A 1M2BA 5CP1A 2B1LA 2YPMA 1R7HA 3ZVJD 1ACVA 2P0GA 2P5RA 3FRCA 4XS6A 4AGSA 3DD3A 3VWWA 5IM9A 4HQZA 3VK9A 5H5RA 1VF4A 1QQ2A 3NIVA 1U3AA 4TW5A 10GSA 1USBA 1A0FA 4MJEA 2C80A 2C0EA 4ECBA 1F3AA 4POKA 2A2SA 3PGTA 4PUFC 2H1BA 5CRHA 5DVBA 1QMVA 2HLSA 3KD0A 3ZRDA 3LYKA 1U87A 3ZTLA 3L9SA 1Z9HA 4Q5QA 3LEFA 4IQ1A 1A2LA 3GRXA 3IAM2 3HZ8A 5F06A 1F9MA 4MPFA 2K8VA 1NHYA 1GNEA 1OKTA 3EYTA 3GKXA 3DYRA 4TOPA 3GX0A 2EIRA 1SENA 4KDUA 4ZIJA 1URMA 3D21A 4N10A 3M1GA 1K0AA 4POLA 2JL4A 4XS4B 1S3AA 1KBNA 1K0BA 1JZDA 1XW5A 2KUCA 5J3RA 5C04A 2YNXA 4ZILA 2V6OA 2H70A 2GQMA 5FHIA 2B1KA 2FLSA 1HD2A 3TOUA 1UVZA 4AJ8A 3D4TA 1OKDA 2B3SA 1GULA 3D0ZA 2H01A 5J4UA 4PNFA 1ZCPA 4D73B 3G9BA 1ON4A 3GSTA 20GSA 2B5XA 2VLTA 3JCML 1HNBA 4JRRA 1HNCA 4IJ3A 3F63A 4XS4A 4DEJA 3HVXA 5IMVA 2AJQB 3FEUA 1ZGNA 1ZOFA 1ZZYA 2GSSA 1WP0A 1B4PA 3FZ5A 3P90A 3A5WA 2C4JA 4GLTA 4NHWA 2LRNA 4L8EA 4G9HA 2JZSA 4GSTA 1V58A 4D73A 5B6NA 4KE3A 1X9WB 2VCWA 1ERTA 1BJXA 2E0QA 4KAEA 2CT6A 4HEA2 3F4TA 4KGIA 3ZREA 4AF2A 1J9BA 1BEDA 1TRVA 4ZL9A 3U6VA 4PX1A 3IDVA 4OO4A 4IP6A 4KUNA 5ECKB 3KP9A 2ZCTA 1Z7RA 4V1Ap 2IMKA 3DVXA 1YZXA 2PMTA 4KNDA 5J5NA 4MABA 1MDKA 1MD4A 1Y25A 4QL7A 4F9ZA 3MNGA 4MPGA 1K0MA 2KOKA 1SD8A 3TKSA 1SKSB 3QMXA 3CSIA 1PN9A 2KLXA 4TXVA 2L4QA 1OC9B 3F3RA 1Z6MA 1OC3A 2VM2A 4TN8A 4MA9A 4LL1B 3ERFA 4K7NA 5KN0A 1TW9A 3J7Yb 1WOUA 5FWGA 4PUAA 3RHCA 2K18A 3AY8A 2H0IA 2WS2A 1X9MB 1SYRA 2DIZA 2CVBA 4IQAA 2CX3A 3DIEA 2VLVA 3HYPA 4MF5A 1WPIA 1XW9A 2FHEA 2NVLA 2F9SA 3VPQA 3GH9A 3TRXA 3MDKA 5ABRA 1PKWA 5CRDA 3GIXA 1QXHA 3DMLA 2MBSA 4KCAA 1B48A 2O87A 3FKFA 4MZWA 3C8EA 2YJHA 1AQXA 1F37A 2WULA 4X43A 1U6TA 1XOBA 1JLVA 2RIIA 4MH2A 1M9AA 4AJ7A 2K6VA 3ZMLA 4GQCA 5IMZA 1ILOA 2OE1A 3IOSA 4TXOA 2ZNMA 1EWXA 4ZL7A 2JADA 5J41A 4I6XA 4YQVA 2IMEA 3C7MA 2VIMA 3LSZA 1O8WA 4NAXA 5A4VA 4WBJA 5IO0A 4WKWA 2DJ0A 3TB2A 2LV3A 1SJIA 2X64A 2WRTA 2FWGA 3O6TA 4EVMA 3FYGA 2IMIA 1GSUA 1Z5YE 3L9VA 1K3OA 5IQYA 3LJRA 2XBIA 3F9UA 5G31A 4O7HA 4TVEA 3GN3A 1XZOA 3BCKA 1Z6NA 4X0XA 5DJLA 4EXJA 3DVWA 3N9JA 5IPGA 4TKYA 3ERGA 1GSFA 3UJ1A 3ZLPA 1PL1A 3WD6A 6GSWA 4HDEA 5ECQB 3DKSA 3DXBA 3GX8A 4LLRA 5B8AA 2IMFA 2LJRA 3IR4A 4PQ1A 3BCIA 2MMOA 5DQSA 1SJ6A 3LWAA 4EUYA 5HR1A 2VL2C 2CQ9A 1VRSD 3LYPA 3VLNA 6GSSA 1IYHA 1S3DA 2AHEA 3C73A 2BJXA 4G2EA 3UIWA 2VO4A 4JR4A 1TK8B 3DEXA 4ECIA 4RI6A 1F2EA 4J57E 1XWKA 2HYXA 2DJJA 4L5LA 3M0FA 1G6WA 1OVNA 5DCGA 1AXDA 1RQMA 1XWBA 1M0UA 3KCMA 4CDOA 1ZYQB 1FAAA 2VAFA 3IHQA 3KMOA 4MJBA 4K1FA 2XBQA 4J56E 1VF3A 1T00A 1PGTA 1A8YA 3APOA 2DJ3A 3QAGA 4ML6A 4TR4A 1AIUA 4ECCA 4ECJA 3CRTA 3GHAA 2FGXA 3IXRA 3F4RA 4E8EA 4PQIA 5JCUA 1YQ1A 2GQLA 4RI7A 1NHOA 5GAND 5DAKB 3ZVJA 3IC4A 3ZIVA 3A2XA 4KH7A 2K9FA 3QDNA 3ZYWA 1X5EA 1A0RP 2DMLA 4V1Ag 1A24A 4ZB8A 2V6KA 3UEMA 2ON5A 1LU4A 2FWFA 3GTUB 3D5JA 4OCFA 2H72A 18GSA 3C1SA 5F8BA 1A2JA 2HI7A 2GQKA 3HD5A 5CRGA 3IPZA 1JZRA 4BPYA 4MZCA 3M9JA 1TU7A 12GSA 1SK2A 3VWVA 5D9XA 2PN8A 3BJ5A 1U3IA 4NWYA 2I9HA 3PINA 1KTEA 3ZITA 2XHFA 5A4WA 2MZCA 2H71A 1V9WA 4FYUA 2RLIA 4IBPA 3E9JB 4LL4B 2REMA 3GTUA 3H93A 5HR3A 4FH8A 1WWJA 1U88A 3ME7A 3VFIA 4GCIA 3HJOA 2LNTA 2VCTA 4HZ2A 2VUPA 3GH6A 3M9KA 4YQMA 4IJIA 3TCOA 3MWHA 3P2AA 4ULXA 5KN1A 4IGJA 1LJRA 4LMVA 1H4OA 4DSSB 1GLQA 4HUAA 2GZZA 3ISOA 3UARA 3EWLA 3G7JA 4F03A 3EC3A 1GSEA 3HA9A 4XCSA 2R5GA 1ML6A 1TXXA 2X8HA 1PD21 2H0GA 5ECSA 5ECIB 5AGYA 4O32A 4IELA 4HOJA 2OE3A 4TR1B 5DQYA 1XFLA 3L4NA 2KHPA 1T4ZA 4KDYA 2JU5A 4YAPA 1ABAA 2WZ9A 2DIYA 5IMCA 3IV4A 3CSJA 4DSSA 3GKNA 4HJMA 2WDUA 2M46A 3KGKA 4JZQA 3ZMKA 3APQA 4I5QA
chains in the Genus database with same CATH superfamily
2QSIA 2PU9C 3FR6A 3VPTA 2O7KA 1GSSA 3D22A 1R4WA 4Q5RA 1ST9A 2LSTA 4J2FA 2CAQA 2L5OA 4K0GA 3W6GA 1MD3A 4N0VA 2VCZA 2MMAA 4K7OA 1NW2A 1UC7A 3KMNA 4PNGA 2TRCP 2VM1A 4TR1A 3A2WA 3KJYA 4I8BA 3ZFLA 1JHBA 4Z7XA 4IVFA 5F05A 3K8NA 2DJ2A 5CAXA 1OAZA 1PX6A 1SL1B 1WMJA 14GSA 3G7IA 2CV4A 2DBCA 2CVKA 4OWYA 1TDIA 3TJGA 4FYBA 3KIJA 4GSNA 3KP8A 4ID0A 5DBQA 3QAWA 4O5RA 3DGQA 3TJBA 1M9BA 1OYJA 4G19A 1O81A 3GKMA 4HS1A 5ENUA 3F3QA 1ERUA 2X49A 1XPVA 1B9YC 1AAZA 2L59A 4HU9A 4KF9A 2HRAA 2FCHA 2HRFA 1AUCA 3GL5A 3IC8A 4DSRA 2H76A 1SJZA 5EL8A 3EMXA 4NMUA 1AC1A 4EDYA 4MP4A 2JSZA 2OE0A 1SKRB 4WEYA 4K7IA 2YWNA 1BAYA 2R3XA 5B6MA 1MTCA 4GWRA 3M3MA 1AQVA 3A3TA 1PX7A 2DC5A 2V2GA 3TKSC 3UL3A 1VF1A 2GZPA 2HZFA 1LBKA 4BVXB 2K8SA 4BWQA 2HZEB 6GSUA 2VL3A 2LS5A 1B8XA 1V57A 2L57A 2P31A 5JCGA 17GSA 9GSSA 1E6BA 1PKZA 2LTKA 1FOHA 3EINA 4EIPA 1PMTA 4KSMA 2YANA 4O5UA 3EPTA 1XOAA 3GFKA 2G2QA 1YEXA 4XTSA 2OBKA 3ERWA 5F07A 2H30A 1GSYA 1SL2B 3U5RE 3BOAA 5JCWA 1SL0B 2GVPA 11GSA 2YWMA 3QOUA 4BVXA 6GSXA 3TKPA 2HZEA 3OR5A 3Q19A 2C3NA 1GWCA 3FW2A 2X4AA 2L5LA 4V2LA 3RHBA 4BL7B 5D9VA 4OD7A 1X9SB 3I69A 4MNNA 5H5SA 3HXSA 4O5QA 2N5FA 1PN0A 1BX9A 4L0WA 5IMDA 4MF6A 3IBHA 1FVKA 2H6XA 4KCEA 3W8JA 2H8LA 5IOWA 5D9WA 3D4MA 2QC7A 2R0CA 1R5AA 1TU8A 2YWIA 3LXZA 4WXTA 2OKAA 1OC9A 1X5CA 5G2ZA 2CVDA 3ZIJA 2C0GA 4N0ZA 4GF0A 4HZ4A 1K0CA 4E8HA 4DVCA 1SYXA 2JACA 3PR8A 3RBTA 5ECHB 1PSQA 1M2DA 1MDIA 1EGRA 3TRPA 2MYGA 5IIZA 2R4VA 1TRSA 2VOCA 1TJDA 3RAZA 3TKSE 2MBTA 1N2AA 1WJKA 5COHA 3CTFA 3P7XA 1G6YA 4I2UA 4JBBA 3US3A 3KTBA 1GLPA 2B7KA 3N5OA 4LA1A 2H1AA 1YY7A 2X8GA 2D2ZA 1YKCA 2L6CA 3F4SA 2DSAA 2GT6A 2YJ7A 2DJKA 3DWVA 3VURA 2Z9SA 1O73A 3GMFA 2LRCA 4XIHA 2H1DA 1WIKA 1I5GA 3NZNA 5CYYA 2QGVA 3KXOA 1QK8A 3UMAA 2B5EA 3ME8A 1O8XA 3UAPA 5CRWA 1FB0A 2C3QA 5ELGA 1S3RA 2OJLA 1PFOA 1DE2A 3HVSA 3F0IA 4EE0A 1YEPA 3HVVA 3UVHA 1KNGA 2FNOA 1GTBA 1T4YA 6GSYA 4V2MA 3LGCA 3TOTA 1Q98A 1JZOA 3C1RA 8GSSA 1KEBA 4HSCX 2VD0A 2IWTA 1XWCA 5KN2A 4JEDA 1S3CA 2MMNA 4MLYA 4IN0A 2XC2A 3GNJA 4TR3A 3NOFA 2GT5A 1TI3A 3LXTA 5AIVA 2IN3A 2PVQA 1K3LA 1BG5A 2FD3A 3I43A 1SK0A 3M8NA 3IAS2 4GSSA 4KDXA 1GRXA 5JWOB 4JE1A 3RDWA 2C0DA 3CXGA 1SKWB 3DRNA 2HFDA 2R37A 1ZL9A 3HJPA 4V2NA 3UBLA 5CREA 1GTUA 2LUSA 2N5AA 4LMWA 3ZL5A 2PGTA 4K0NA 1TOFA 2I4AA 3KTLA 1H75A 3APSA 4POBA 5EPFA 4JU5A 1F6MC 4TR0A 3QFAC 3CBUA 1THOA 4Z2RA 1EZKA 1HNAA 2XPEA 4K5SA 2J23A 1TRWA 2VL9A 2F8AA 2HNLA 4MF7A 4A5PA 2DMMA 1JZWA 3IRAA 4KSOA 4WF5A 7GSSA 3LW9A 5C00A 3H8QA 3WT2A 3QFBC 2E7PA 2C3TA 4DSQA 2XPDA 2YZHA 2PWJA 3FR3A 3UOMA 3S9FA 4JR6A 4WETA 2WGRA 1PRXA 5CO3A 5DJMA 2O85A 1XWAA 2AV4A 2J9HA 3IK9A 3HJMA 4MDCA 5L71A 1Z7PA 2R2JA 3QD9A 3V1WA 4P3YB 4F2IA 3J7Yk 5ELAA 2A2RA 5AISA 2V41A 4F0CA 2C8UA 5DAKA 5KOXA 5AN1A 3HY2A 4Q5NA 2AUVA 3HHVA 2F3MA 1GUMA 4NV5A 2H1GA 5JWQB 2IJYA 3SBCA 1I9DA 3TJJA 2RM5A 16GSA 3VI7A 4L5OA 1TRUA 4XRAA 3TUEA 1YKAA 4EKZA 5HR2A 5D96A 3UVTA 1GUKA 1ZYPA 3EVIA 3PH9A 2IMDA 3TGZA 1XG8A 1WRYA 3IK7A 1FB6A 3F8UA 13GSA 4EO3A 3C71A 1Y6EA 2F51A 4YQUA 1J0FA 1XVWA 2YWOA 2M80A 3WYWA 5IMFA 1DSBA 3QR6A 2PUKC 4Q5FA 2AYTA 1TP9A 4N30A 4I97A 1YF1A 1EOHA 1G7EA 1ZMAA 2PVOC 2AB6A 3ED3A 5ECOB 2CZ2A 5FT3A 2EIQA 1RW1A 1XVQA 2X99A 4YAVA 4CHSA 1B4QA 2RUFA 4OFMA 4BWSA 4IP1A 1QUWA 2H66A 1BQ7A 2HE3A 3QAVA 2ZUPA 1M99A 2ALBA 1GH2A 2X8CA 2H75A 1EOGA 2N5BA 2C1YA 2F8FA 1QGVA 4NPBA 5INYA 4RQRA 2H6YA 3L0HA 2LJAA 3WGXA 1EEMA 1ERVA 3CTGA 3QPMA 4GTUA 1R26A 2HSHA 5LCZA 1JFUA 2GDRA 2G0FA 4WR4A 5ECPB 5IPHA 2ES7A 1ERWA 5ECNB 2GTUA 3I6AA 3Q18A 3RPPA 2LRTA 1R5PA 5D73A 4MZBA 4ACSA 4OCEA 2JZTA 4HQSA 4YKGA 3HZ4A 2E2MA 4Z2UA 3CYNA 5LNKe 1EV4A 5CNWA 1EP7A 3GURA 4ISDA 3H4KA 6GSVA 3GYKA 2FA4A 1PA3A 3TJKA 3KZQA 2OADA 4ML1A 5GAPD 2GZYA 1DE1A 4QL9A 2LQOA 2EIOA 2HXKA 4OO5A 4PURA 4PQHA 3ZFBA 1TKDB 4QQ7A 5D8IA 4EC0A 3HCZA 2CZ3A 3E0UA 1YJ6A 4ZL8A 2C0FA 1GNWA 1SU9A 5G1KA 1A2MA 3I9V2 1FW1A 2FUG2 2VD1A 2JZRA 2GGTA 3QCPA 4K2XA 1SD9A 2KP1A 5DDLA 5LD0A 1M7TA 4G0KA 1O85A 3Q6OA 2LEGA 2E2GA 4ZBBA 1MEKA 2IFQB 4TRXA 4RQXA 2IL3A 2WJUA 2VCXA 1EEJA 5ECLB 1VF2A 4X1UA 4YH2A 3GL3A 2OACA 3EMPA 1V40A 5AIXA 2HT9A 1FO5A 1CQGA 5B8BA 3TKRA 1K0DA 2YCDA 5IO2A 2B6MA 4MJAA 3KEBA 2VLUA 3F6DA 1Q4JA 1K3YA 5E4WA 3VWXA 3KM6A 1W89A 1VGLA 4MH3A 2IFQA 2NDOA 1IYIA 5JWRB 1X0RA 3MSZA 5HFKA 3WT1A 4X4JA 5J9BA 1DBYA 1E2YA 3MAKA 5BMUA 2IIYA 1GSDA 2R6KA 4AJ6A 1V98A 1YDKA 2YV7A 2TRXA 2V32A 4BL7A 3BD2A 2HRNA 2I81A 2O8VB 4OFTA 4ICYA 2A4HA 3L78A 4MCUA 4ZB9A 5D9TA 4TXOB 1HQOA 2WB9A 3CRUA 1J08A 2A2PA 1GP1A 4NV2A 2KP2A 2DKIA 3FR9A 3KH7A 3LQ7A 2B5YA 2BTOT 4GRFA 5ID2B 3LG6A 2GSQA 3WGDA 1AW9A 3TJFA 2H73A 3VWUA 4F82A 4H86A 4O92A 2NPBA 3IHGA 4KB3A 1X5DA 5EY6A 5HFIA 1UN2A 2VCVA 1XXUA 4HU7A 1NSWA 4ZBDA 1XWGA 2H0HA 1G7OA 4HI7A 1OC8A 1EP8A 3KH9A 3L9UA 2ON7A 2RM6A 2TIRA 5IOXA 1T7PB 4WF4A 4KW6A 3HVNA 1T3BA 1YF0A 4I2TA 2AAWA 4PGTA 2MMZA 5G30A 4IHUA 5E59A 2YOIA 5HR0A 1FHEA 5DCHA 1M3JA 3CMIA 3TRQA 3LFLA 5IMAA 2OBIA 5ID2A 5G5FA 3P8WA 1B9XC 1K0OA 5HQPA 3H79A 2PERA 2M72A 4POMA 3BBYA 3GSSA 4Z2TA 1GTAA 3EURA 1T8EB 1XW6A 1HYUA 2LKUA 3IE3A 4EF0A 5HFGA 1GSQA 1TK0B 3IA1A 4PXOA 3FZ9A 3G7YA 3O76A 2NTOA 3A2VA 3GUSA 1MDJA 1A8LA 5F0GA 1PL2A 4IKHA 5EVOA 1SK1A 2PPTA 4XHMA 1OE8A 4USSA 2EC4A 3RPNA 3TDGA 2OA7A 5G1LA 3CQFA 4FIWA 2WFCA 2GSTA 4MK3A 2YV9A 1JLWA 1FG4A 3GKKA 1EGOA 3R2QA 2NBSA 2GLRA 4PTSA 3FZ4A 3ZZXA 4NXIA 5ECMB 2DJ1A 1GTIA 2CA8A 2LNSA 3O3TA 1PQNA 3E3EA 1C72A 2WCIA 3R3EA 3SWLA 4ZB6A 3Q74A 4XRDA 1G0TA 1QFNA 4K2DA 1BYEA 2H19A 1NM3A 2YP6A 4NHZA 4WBRD 2CX4A 4CY8A 2DLXA 2H6ZA 1FVJA 2JSYA 2LJKA 1K0NA 1OE7A 4G0LA 4F0BA 1THXA 6GSTA 2I1UA 2PBJA 4MMMA 1O7UA 2O89A 2FWEA 5DALB 2VL2A 5A4UA 5H5QA 1GL8A 1V2AA 4FYCA 4IS0A 3CSHA 4GQFA 4BVYB 2IPAA 2YN1A 3EU3A 2L6DA 3EE2A 1ZYEA 1FOVA 3F6FA 2RUEA 1W4VA 1WE0A 3WGEA 4EL1A 4BA7A 1XCCA 5GSSA 3GV1A 2H74A 5GZZB 2CAIA 1O6JA 4CW9A 5D93A 3H1NA 1AQWA 5ECRB 3UBKA 5DALA 2QA2A 1M2AA 4K9ZA 1TK5B 4ILFA 2P5QA 4OMVA 2FA8A 3W8SA 2A4VA 1CQHA 1F3BA 2HSYA 3LORA 3VI5A 4BVYA 4XS1A 1TTZA 4WR5A 5KEJA 2GSRA 5J9CA 1A23A 3MIXA 1RK4A 1UA5A 4KX4A 4OFNA 1N8JA 4ZXGA 19GSA 22GSA 2BMXA 4N11A 2V1MA 4GXZA 5GSTA 4ZBAA 3FHKA 3FY7A 4HJ2A 4K8MA 1T1VA 2LQQA 4RUVA 1DUGA 1XIYA 2FWHA 4EDZA 3EU4A 2QKEA 4IW9A 3TKQA 5A5KA 1TI1A 1GUHA 3D6IA 5G5EA 4FO5A 4MJCA 3HDCA 1EV9A 2FY6A 2YZUA 2L4CA 4K6XA 1Z3EA 2GS3A 4KA0A 3HKRA 1XBSA 3FK8A 5KN3A 2VCQA 3FZAA 2R0GA 4G10A 5B7CA 2B7JA 2I3YA 4L0UA 3GA4A 1M2BA 5CP1A 2B1LA 2YPMA 1R7HA 3ZVJD 1ACVA 2P0GA 2P5RA 3FRCA 4XS6A 4AGSA 3DD3A 3VWWA 5IM9A 4HQZA 3VK9A 5H5RA 1VF4A 1QQ2A 3NIVA 1U3AA 4TW5A 10GSA 1M3IA 1USBA 1A0FA 4MJEA 2C80A 2C0EA 4ECBA 1F3AA 4POKA 2A2SA 3PGTA 4PUFC 2H1BA 5CRHA 5DVBA 1QMVA 2HLSA 3KD0A 3ZRDA 3LYKA 1U87A 3ZTLA 3L9SA 4EIQA 1Z9HA 4Q5QA 3LEFA 4IQ1A 1A2LA 3GRXA 3IAM2 3HZ8A 1F9MA 5F06A 4MPFA 2K8VA 1NHYA 1GNEA 1OKTA 3EYTA 3GKXA 3DYRA 1ZYNA 4TOPA 3A5IA 3GX0A 2EIRA 1SENA 4KDUA 4ZIJA 1URMA 3D21A 4N10A 3M1GA 1K0AA 4POLA 2JL4A 4XS4B 5KOWA 1S3AA 1KBNA 1K0BA 1JZDA 1XW5A 2KUCA 5J3RA 5C04A 2YNXA 4ZILA 2V6OA 2H70A 2GQMA 5FHIA 2B1KA 2FLSA 1HD2A 3MYDA 3TOUA 1UVZA 4AJ8A 3D4TA 1OKDA 2B3SA 1GULA 3D0ZA 2H01A 5J4UA 4PNFA 1ZCPA 4D73B 2HRKA 3G9BA 2HSMA 1ON4A 3GSTA 20GSA 2B5XA 2VLTA 3JCML 1HNBA 4JRRA 1HNCA 4IJ3A 3F63A 4XS4A 4DEJA 3HVXA 5IMVA 2AJQB 3FEUA 1ZGNA 1ZOFA 1ZZYA 2GSSA 1WP0A 1B4PA 3FZ5A 3P90A 3A5WA 2C4JA 4GLTA 4NHWA 2LRNA 4L8EA 4G9HA 2JZSA 4GSTA 1V58A 4D73A 5B6NA 4KE3A 1X9WB 2VCWA 1ERTA 1BJXA 2E0QA 4KAEA 2CT6A 4HEA2 3F4TA 4KGIA 3ZREA 4AF2A 1J9BA 1BEDA 1TRVA 4ZL9A 3U6VA 4PX1A 3IDVA 4OO4A 4IP6A 4KUNA 5ECKB 3KP9A 2ZCTA 1Z7RA 4V1Ap 2IMKA 3DVXA 1YZXA 2PMTA 4KNDA 5J5NA 4MABA 1MDKA 1MD4A 1Y25A 4QL7A 4F9ZA 3MNGA 4MPGA 1K0MA 2KOKA 1SD8A 3TKSA 1SKSB 3QMXA 3CSIA 1PN9A 2KLXA 4TXVA 2L4QA 1OC9B 3F3RA 1Z6MA 1OC3A 2VM2A 4TN8A 4MA9A 4LL1B 3ERFA 4K7NA 5KN0A 1TW9A 3J7Yb 1WOUA 5FWGA 4PUAA 3RHCA 2K18A 3AY8A 2H0IA 2WS2A 1X9MB 1SYRA 2DIZA 2CVBA 4IQAA 2CX3A 3DIEA 2VLVA 3HYPA 4MF5A 1WPIA 1XW9A 2FHEA 2NVLA 2F9SA 3VPQA 3GH9A 3TRXA 3MDKA 5ABRA 1PKWA 5CRDA 3GIXA 1QXHA 3DMLA 2MBSA 4KCAA 1B48A 2O87A 3FKFA 4MZWA 3C8EA 2YJHA 1AQXA 1F37A 2WULA 4X43A 1U6TA 1XOBA 1JLVA 2RIIA 4MH2A 1M9AA 4AJ7A 2K6VA 3ZMLA 4GQCA 5IMZA 1ILOA 2OE1A 3IOSA 4TXOA 4G0IA 2ZNMA 1EWXA 4ZL7A 2JADA 5J41A 4I6XA 4YQVA 2IMEA 3C7MA 2VIMA 3LSZA 1O8WA 4NAXA 5A4VA 4WBJA 5IO0A 4WKWA 2DJ0A 3TB2A 2QA1A 2LV3A 1SJIA 2X64A 2WRTA 2FWGA 3O6TA 2UZ8A 4EVMA 3FYGA 2IMIA 1GSUA 1Z5YE 3L9VA 1K3OA 5IQYA 3LJRA 2XBIA 3F9UA 5G31A 4O7HA 4TVEA 3GN3A 1XZOA 3BCKA 1Z6NA 4X0XA 5DJLA 4EXJA 4FQUA 3DVWA 3N9JA 5IPGA 4TKYA 3ERGA 1GSFA 4BIKA 3UJ1A 3ZLPA 1PL1A 3WD6A 6GSWA 4HDEA 5ECQB 3DKSA 3DXBA 3GX8A 4LLRA 5B8AA 2IMFA 2LJRA 3IR4A 4PQ1A 3BCIA 2MMOA 5DQSA 1SJ6A 3LWAA 4EUYA 5HR1A 2VL2C 2CQ9A 1VRSD 3LYPA 3VLNA 6GSSA 1IYHA 1S3DA 2AHEA 3C73A 2BJXA 4G2EA 3FMWA 3UIWA 2VO4A 4JR4A 1TK8B 3DEXA 4ECIA 4RI6A 1F2EA 4J57E 1XWKA 2HYXA 2DJJA 4L5LA 3M0FA 1G6WA 1OVNA 4CY6A 5DCGA 1AXDA 1RQMA 1XWBA 1M0UA 3KCMA 4CDOA 1ZYQB 1FAAA 2VAFA 3IHQA 3KMOA 4MJBA 4K1FA 2XBQA 4J56E 1VF3A 1T00A 1PGTA 1A8YA 3PPUA 3APOA 2DJ3A 3QAGA 4ML6A 4TR4A 1AIUA 4ECCA 4ECJA 3CRTA 3GHAA 2FGXA 3IXRA 3F4RA 4E8EA 4PQIA 5JCUA 1YQ1A 2GQLA 4RI7A 1NHOA 5GAND 5DAKB 3ZVJA 3IC4A 3ZIVA 3A2XA 4KH7A 2K9FA 3QDNA 3ZYWA 1X5EA 1A0RP 2DMLA 4V1Ag 1A24A 4ZB8A 2V6KA 3UEMA 2ON5A 1LU4A 2FWFA 3GTUB 5BRTA 3D5JA 2DKHA 4OCFA 2H72A 18GSA 3C1SA 5F8BA 1A2JA 2HI7A 2GQKA 3HD5A 5CRGA 3IPZA 1JZRA 4BPYA 4MZCA 3M9JA 1TU7A 12GSA 1SK2A 3VWVA 5D9XA 2PN8A 3BJ5A 1U3IA 4NWYA 2I9HA 3PINA 1KTEA 3ZITA 2XHFA 5A4WA 2MZCA 2H71A 1V9WA 4FYUA 4YKFA 2RLIA 4IBPA 3E9JB 4LL4B 2REMA 3GTUA 3H93A 5HR3A 4FH8A 1WWJA 1U88A 3ME7A 3VFIA 4GCIA 3HJOA 2LNTA 4K5RA 2VCTA 4HZ2A 2VUPA 3GH6A 3M9KA 4YQMA 4IJIA 3TCOA 3MWHA 3P2AA 4ULXA 5KN1A 4IGJA 1LJRA 4LMVA 1H4OA 4DSSB 1GLQA 4HUAA 2GZZA 3ISOA 3UARA 3EWLA 3G7JA 4F03A 3EC3A 1GSEA 3HA9A 4XCSA 2R5GA 1ML6A 1TXXA 2X8HA 1PD21 2H0GA 5ECSA 5ECIB 5AGYA 4O32A 4IELA 4HOJA 2OE3A 4TR1B 5DQYA 1XFLA 3L4NA 2R0PA 2KHPA 1T4ZA 4KDYA 2JU5A 4YAPA 1ABAA 2WZ9A 2DIYA 5IMCA 3IV4A 3CSJA 4DSSA 3GKNA 4HJMA 2WDUA 2M46A 3KGKA 4JZQA 3ZMKA 3APQA 4I5QA
chains in the Genus database with same CATH topology
2QSIA 2PU9C 3FR6A 3VPTA 2O7KA 1GSSA 3D22A 1R4WA 4Q5RA 1ST9A 2LSTA 4J2FA 2CAQA 2L5OA 4K0GA 3W6GA 1MD3A 4N0VA 2VCZA 2MMAA 4K7OA 1NW2A 1UC7A 3KMNA 4PNGA 2TRCP 2VM1A 4TR1A 3A2WA 3KJYA 4I8BA 3ZFLA 1JHBA 4Z7XA 4IVFA 5F05A 3K8NA 2DJ2A 5CAXA 1OAZA 1PX6A 1SL1B 1WMJA 14GSA 3G7IA 2CV4A 2DBCA 2CVKA 4OWYA 1TDIA 3TJGA 4FYBA 3KIJA 4GSNA 3KP8A 4ID0A 5DBQA 3QAWA 4O5RA 3DGQA 3TJBA 1M9BA 1OYJA 4G19A 1O81A 3GKMA 4HS1A 5ENUA 3F3QA 1ERUA 2X49A 1XPVA 1B9YC 1AAZA 2L59A 4HU9A 4KF9A 2HRAA 2FCHA 2HRFA 1AUCA 3GL5A 3IC8A 4DSRA 2H76A 1SJZA 5EL8A 3EMXA 4NMUA 1AC1A 4EDYA 4MP4A 2JSZA 2OE0A 1SKRB 4WEYA 4K7IA 2YWNA 1BAYA 2R3XA 5B6MA 1MTCA 4GWRA 3M3MA 1AQVA 3A3TA 1PX7A 2DC5A 2V2GA 3TKSC 3UL3A 1VF1A 2GZPA 2HZFA 1LBKA 4BVXB 2K8SA 4BWQA 2HZEB 6GSUA 2VL3A 2LS5A 1B8XA 1V57A 2L57A 2P31A 5JCGA 17GSA 9GSSA 1E6BA 1PKZA 2LTKA 1FOHA 3EINA 4EIPA 1PMTA 4KSMA 2YANA 4O5UA 3EPTA 1XOAA 3GFKA 2G2QA 1YEXA 4XTSA 2OBKA 3ERWA 5F07A 2H30A 1GSYA 1SL2B 3U5RE 3BOAA 5JCWA 1SL0B 2GVPA 11GSA 2YWMA 3QOUA 4BVXA 6GSXA 3TKPA 2HZEA 3OR5A 3Q19A 2C3NA 1GWCA 3FW2A 2X4AA 2L5LA 4V2LA 3RHBA 4BL7B 5D9VA 4OD7A 1X9SB 3I69A 4MNNA 5H5SA 3HXSA 4O5QA 2N5FA 1PN0A 1BX9A 4L0WA 5IMDA 4MF6A 3IBHA 1FVKA 2H6XA 4KCEA 3W8JA 2H8LA 5IOWA 5D9WA 3D4MA 2QC7A 2R0CA 1R5AA 1TU8A 2YWIA 3LXZA 4WXTA 2OKAA 1OC9A 1X5CA 5G2ZA 2CVDA 3ZIJA 2C0GA 4N0ZA 4GF0A 4HZ4A 1K0CA 4E8HA 4DVCA 1SYXA 2JACA 3PR8A 3RBTA 5ECHB 1PSQA 1M2DA 1MDIA 1EGRA 3TRPA 2MYGA 5IIZA 2R4VA 1TRSA 2VOCA 1TJDA 3RAZA 3TKSE 2MBTA 1N2AA 1WJKA 5COHA 3CTFA 3P7XA 1G6YA 4I2UA 4JBBA 3US3A 3KTBA 1GLPA 2B7KA 3N5OA 4LA1A 2H1AA 1YY7A 2X8GA 2D2ZA 1YKCA 2L6CA 3F4SA 2DSAA 2GT6A 2YJ7A 2DJKA 3DWVA 3VURA 2Z9SA 1O73A 3GMFA 2LRCA 4XIHA 2H1DA 1WIKA 1I5GA 3NZNA 5CYYA 2QGVA 3KXOA 1QK8A 3UMAA 2B5EA 3ME8A 1O8XA 3UAPA 5CRWA 1FB0A 2C3QA 5ELGA 2OJLA 1DE2A 3HVSA 3F0IA 4EE0A 1YEPA 3HVVA 3UVHA 1KNGA 2FNOA 1GTBA 1T4YA 6GSYA 4V2MA 3LGCA 3TOTA 1Q98A 1JZOA 3C1RA 8GSSA 1KEBA 2VD0A 2IWTA 1XWCA 5KN2A 4JEDA 1S3CA 2MMNA 4MLYA 4IN0A 2XC2A 3GNJA 4TR3A 3NOFA 2GT5A 5AIVA 1TI3A 3LXTA 2IN3A 2PVQA 1K3LA 1BG5A 2FD3A 3I43A 1SK0A 3M8NA 3IAS2 4GSSA 4KDXA 1GRXA 5JWOB 4JE1A 3RDWA 2C0DA 3CXGA 1SKWB 3DRNA 2HFDA 2R37A 1ZL9A 3HJPA 4V2NA 3UBLA 5CREA 1GTUA 2LUSA 2N5AA 4LMWA 3ZL5A 2PGTA 4K0NA 1TOFA 2I4AA 3KTLA 1H75A 3APSA 4POBA 5EPFA 4JU5A 1F6MC 4TR0A 3QFAC 3CBUA 1THOA 4Z2RA 1EZKA 1HNAA 2XPEA 4K5SA 2J23A 1TRWA 2VL9A 2F8AA 2HNLA 4MF7A 4A5PA 2DMMA 1JZWA 3IRAA 4KSOA 4WF5A 7GSSA 3LW9A 5C00A 3H8QA 3WT2A 3QFBC 2E7PA 2C3TA 4DSQA 2XPDA 2YZHA 2PWJA 3FR3A 3UOMA 3S9FA 4JR6A 4WETA 2WGRA 1PRXA 5CO3A 5DJMA 2O85A 1XWAA 2AV4A 2J9HA 3IK9A 3HJMA 4MDCA 5L71A 1Z7PA 2R2JA 3QD9A 3V1WA 4P3YB 4F2IA 3J7Yk 5ELAA 2A2RA 5AISA 2V41A 4F0CA 2C8UA 5DAKA 5KOXA 5AN1A 3HY2A 4Q5NA 2AUVA 3HHVA 2F3MA 1GUMA 4NV5A 2H1GA 5JWQB 2IJYA 3SBCA 1I9DA 3TJJA 2RM5A 16GSA 3VI7A 4L5OA 1TRUA 4XRAA 3TUEA 1YKAA 4EKZA 5HR2A 5D96A 3UVTA 1GUKA 1ZYPA 3EVIA 3PH9A 2IMDA 3TGZA 1WRYA 3IK7A 1FB6A 3F8UA 13GSA 4EO3A 3C71A 1Y6EA 2F51A 4YQUA 1J0FA 1XVWA 2YWOA 2M80A 3WYWA 5IMFA 1DSBA 3QR6A 2PUKC 4Q5FA 2AYTA 1TP9A 4N30A 4I97A 1YF1A 1EOHA 1G7EA 1ZMAA 2PVOC 2AB6A 3ED3A 5ECOB 2CZ2A 5FT3A 2EIQA 1RW1A 1XVQA 2X99A 4YAVA 4CHSA 1B4QA 2RUFA 4OFMA 4BWSA 4IP1A 1QUWA 2H66A 1BQ7A 2HE3A 3QAVA 2ZUPA 1M99A 2ALBA 1GH2A 2X8CA 2H75A 1EOGA 2N5BA 2C1YA 2F8FA 1QGVA 4NPBA 5INYA 4RQRA 2H6YA 3L0HA 2LJAA 3WGXA 1EEMA 1ERVA 3CTGA 3QPMA 4GTUA 1R26A 2HSHA 5LCZA 1JFUA 2GDRA 2G0FA 4WR4A 5ECPB 5IPHA 2ES7A 1ERWA 5ECNB 2GTUA 3I6AA 3Q18A 3RPPA 2LRTA 1R5PA 5D73A 4MZBA 4ACSA 4OCEA 2JZTA 4HQSA 4YKGA 3HZ4A 2E2MA 4Z2UA 3CYNA 5LNKe 1EV4A 5CNWA 1EP7A 3GURA 4ISDA 3H4KA 6GSVA 3GYKA 2FA4A 1PA3A 3TJKA 3KZQA 2OADA 4ML1A 5GAPD 2GZYA 1DE1A 4QL9A 2LQOA 2EIOA 2HXKA 4OO5A 4PURA 4PQHA 3ZFBA 1TKDB 4QQ7A 5D8IA 4EC0A 3HCZA 2CZ3A 3E0UA 1YJ6A 4ZL8A 2C0FA 1GNWA 1SU9A 5G1KA 1A2MA 3I9V2 1FW1A 2FUG2 2VD1A 2JZRA 2GGTA 3QCPA 4K2XA 1SD9A 2KP1A 5DDLA 5LD0A 1M7TA 4G0KA 1O85A 3Q6OA 2LEGA 2E2GA 4ZBBA 1MEKA 2IFQB 4TRXA 4RQXA 2IL3A 2WJUA 2VCXA 1EEJA 5ECLB 1VF2A 4X1UA 4YH2A 3GL3A 2OACA 3EMPA 1V40A 5AIXA 2HT9A 1FO5A 1CQGA 5B8BA 3TKRA 1K0DA 2YCDA 5IO2A 2B6MA 4MJAA 3KEBA 2VLUA 3F6DA 1Q4JA 1K3YA 5E4WA 3VWXA 3KM6A 1W89A 1VGLA 4MH3A 2IFQA 2NDOA 1IYIA 5JWRB 1X0RA 3MSZA 5HFKA 3WT1A 4X4JA 5J9BA 1DBYA 1E2YA 3MAKA 5BMUA 2IIYA 1GSDA 2R6KA 4AJ6A 1V98A 1YDKA 2YV7A 2TRXA 2V32A 4BL7A 3BD2A 2HRNA 2I81A 2O8VB 4OFTA 4ICYA 2A4HA 3L78A 4MCUA 4ZB9A 5D9TA 4TXOB 1HQOA 2WB9A 3CRUA 1J08A 2A2PA 1GP1A 4NV2A 2KP2A 2DKIA 3FR9A 3KH7A 3LQ7A 2B5YA 2BTOT 4GRFA 5ID2B 3LG6A 2GSQA 3WGDA 1AW9A 3TJFA 2H73A 3VWUA 4F82A 4H86A 4O92A 2NPBA 3IHGA 4KB3A 1X5DA 5EY6A 5HFIA 1UN2A 2VCVA 1XXUA 4HU7A 1NSWA 4ZBDA 1XWGA 2H0HA 1G7OA 4HI7A 1OC8A 1EP8A 3KH9A 3L9UA 2ON7A 2RM6A 2TIRA 5IOXA 1T7PB 4WF4A 4KW6A 1T3BA 1YF0A 4I2TA 2AAWA 4PGTA 2MMZA 5G30A 4IHUA 5E59A 2YOIA 5HR0A 1FHEA 5DCHA 3CMIA 3TRQA 3LFLA 5IMAA 2OBIA 5ID2A 5G5FA 3P8WA 1B9XC 1K0OA 5HQPA 3H79A 2PERA 2M72A 4POMA 3BBYA 3GSSA 4Z2TA 1GTAA 3EURA 1T8EB 1XW6A 1HYUA 2LKUA 3IE3A 4EF0A 5HFGA 1GSQA 1TK0B 3IA1A 4PXOA 3FZ9A 3G7YA 3O76A 2NTOA 3A2VA 3GUSA 1MDJA 1A8LA 5F0GA 1PL2A 4IKHA 5EVOA 1SK1A 2PPTA 4XHMA 1OE8A 4USSA 2EC4A 3RPNA 3TDGA 2OA7A 5G1LA 4FIWA 2WFCA 2GSTA 4MK3A 2YV9A 1JLWA 1FG4A 3GKKA 1EGOA 3R2QA 2NBSA 2GLRA 4PTSA 3FZ4A 3ZZXA 4NXIA 5ECMB 2DJ1A 1GTIA 2CA8A 2LNSA 3O3TA 1PQNA 3E3EA 1C72A 2WCIA 3R3EA 3SWLA 4ZB6A 3Q74A 4XRDA 1G0TA 1QFNA 4K2DA 1BYEA 2H19A 1NM3A 2YP6A 4NHZA 4WBRD 2CX4A 4CY8A 2DLXA 2H6ZA 1FVJA 2JSYA 2LJKA 1K0NA 1OE7A 4G0LA 4F0BA 1THXA 6GSTA 2I1UA 2PBJA 4MMMA 1O7UA 2O89A 2FWEA 5DALB 2VL2A 5A4UA 5H5QA 1GL8A 1V2AA 4FYCA 4IS0A 3CSHA 4GQFA 4BVYB 2IPAA 2YN1A 3EU3A 2L6DA 3EE2A 1ZYEA 1FOVA 3F6FA 2RUEA 1W4VA 1WE0A 3WGEA 4EL1A 4BA7A 1XCCA 5GSSA 3GV1A 2H74A 5GZZB 2CAIA 1O6JA 4CW9A 5D93A 3H1NA 1AQWA 5ECRB 3UBKA 5DALA 2QA2A 1M2AA 4K9ZA 1TK5B 4ILFA 2P5QA 4OMVA 2FA8A 3W8SA 2A4VA 1CQHA 1F3BA 2HSYA 3LORA 3VI5A 4BVYA 4XS1A 1TTZA 4WR5A 5KEJA 2GSRA 5J9CA 1A23A 3MIXA 1RK4A 1UA5A 4KX4A 4OFNA 1N8JA 4ZXGA 19GSA 22GSA 2BMXA 4N11A 2V1MA 4GXZA 5GSTA 4ZBAA 3FHKA 3FY7A 4HJ2A 4K8MA 1T1VA 2LQQA 4RUVA 1DUGA 1XIYA 2FWHA 4EDZA 3EU4A 2QKEA 4IW9A 3TKQA 5A5KA 1TI1A 1GUHA 3D6IA 5G5EA 4FO5A 4MJCA 3HDCA 1EV9A 2FY6A 2YZUA 2L4CA 4K6XA 1Z3EA 2GS3A 4KA0A 3HKRA 1XBSA 3FK8A 5KN3A 2VCQA 3FZAA 2R0GA 4G10A 5B7CA 2B7JA 2I3YA 4L0UA 3GA4A 1M2BA 5CP1A 2B1LA 2YPMA 1R7HA 3ZVJD 1ACVA 2P0GA 2P5RA 3FRCA 4XS6A 4AGSA 3DD3A 3VWWA 5IM9A 4HQZA 3VK9A 5H5RA 1VF4A 1QQ2A 3NIVA 1U3AA 4TW5A 10GSA 1USBA 1A0FA 4MJEA 2C80A 2C0EA 4ECBA 1F3AA 4POKA 2A2SA 3PGTA 4PUFC 2H1BA 5CRHA 5DVBA 1QMVA 2HLSA 3KD0A 3ZRDA 3LYKA 1U87A 3ZTLA 3L9SA 4EIQA 1Z9HA 4Q5QA 3LEFA 4IQ1A 1A2LA 3GRXA 3IAM2 3HZ8A 1F9MA 5F06A 4MPFA 2K8VA 1NHYA 1GNEA 1OKTA 3EYTA 3GKXA 3DYRA 1ZYNA 4TOPA 3A5IA 3GX0A 2EIRA 1SENA 4KDUA 4ZIJA 1URMA 3D21A 4N10A 3M1GA 1K0AA 4POLA 2JL4A 4XS4B 5KOWA 1S3AA 1KBNA 1K0BA 1JZDA 1XW5A 2KUCA 5J3RA 5C04A 2YNXA 4ZILA 2V6OA 2H70A 2GQMA 5FHIA 2B1KA 2FLSA 1HD2A 3MYDA 3TOUA 1UVZA 4AJ8A 3D4TA 1OKDA 2B3SA 1GULA 3D0ZA 2H01A 5J4UA 4PNFA 1ZCPA 4D73B 2HRKA 3G9BA 2HSMA 1ON4A 3GSTA 20GSA 2B5XA 2VLTA 3JCML 1HNBA 4JRRA 1HNCA 4IJ3A 3F63A 4XS4A 4DEJA 3HVXA 5IMVA 2AJQB 3FEUA 1ZGNA 1ZOFA 1ZZYA 2GSSA 1WP0A 1B4PA 3FZ5A 3P90A 3A5WA 2C4JA 4GLTA 4NHWA 2LRNA 4L8EA 4G9HA 2JZSA 4GSTA 1V58A 4D73A 5B6NA 4KE3A 1X9WB 2VCWA 1ERTA 1BJXA 2E0QA 4KAEA 2CT6A 4HEA2 3F4TA 4KGIA 3ZREA 4AF2A 1J9BA 1BEDA 1TRVA 4ZL9A 3U6VA 4PX1A 3IDVA 4OO4A 4IP6A 4KUNA 5ECKB 3KP9A 2ZCTA 1Z7RA 4V1Ap 2IMKA 3DVXA 1YZXA 2PMTA 4KNDA 5J5NA 4MABA 1MDKA 1MD4A 1Y25A 4QL7A 4F9ZA 3MNGA 4MPGA 1K0MA 2KOKA 1SD8A 3TKSA 1SKSB 3QMXA 3CSIA 1PN9A 2KLXA 4TXVA 2L4QA 1OC9B 3F3RA 1Z6MA 1OC3A 2VM2A 4TN8A 4MA9A 4LL1B 3ERFA 4K7NA 5KN0A 1TW9A 3J7Yb 1WOUA 5FWGA 4PUAA 3RHCA 2K18A 3AY8A 2H0IA 2WS2A 1X9MB 1SYRA 2DIZA 2CVBA 4IQAA 2CX3A 3DIEA 2VLVA 3HYPA 4MF5A 1WPIA 1XW9A 2FHEA 2NVLA 2F9SA 3VPQA 3GH9A 3TRXA 3MDKA 5ABRA 1PKWA 5CRDA 3GIXA 1QXHA 3DMLA 2MBSA 4KCAA 1B48A 2O87A 3FKFA 4MZWA 3C8EA 2YJHA 1AQXA 1F37A 2WULA 4X43A 1U6TA 1XOBA 1JLVA 2RIIA 4MH2A 1M9AA 4AJ7A 2K6VA 3ZMLA 4GQCA 5IMZA 1ILOA 2OE1A 3IOSA 4TXOA 4G0IA 2ZNMA 1EWXA 4ZL7A 2JADA 5J41A 4I6XA 4YQVA 2IMEA 3C7MA 2VIMA 3LSZA 1O8WA 4NAXA 5A4VA 4WBJA 5IO0A 4WKWA 2DJ0A 3TB2A 2QA1A 2LV3A 1SJIA 2X64A 2WRTA 2FWGA 3O6TA 2UZ8A 4EVMA 3FYGA 2IMIA 1GSUA 1Z5YE 3L9VA 1K3OA 5IQYA 3LJRA 2XBIA 3F9UA 5G31A 4O7HA 4TVEA 3GN3A 1XZOA 3BCKA 1Z6NA 4X0XA 5DJLA 4EXJA 4FQUA 3DVWA 3N9JA 5IPGA 4TKYA 3ERGA 1GSFA 3UJ1A 3ZLPA 1PL1A 3WD6A 6GSWA 4HDEA 5ECQB 3DKSA 3DXBA 3GX8A 4LLRA 5B8AA 2IMFA 2LJRA 3IR4A 4PQ1A 3BCIA 2MMOA 5DQSA 1SJ6A 3LWAA 4EUYA 5HR1A 2VL2C 2CQ9A 1VRSD 3LYPA 3VLNA 6GSSA 1IYHA 1S3DA 2AHEA 3C73A 2BJXA 4G2EA 3FMWA 3UIWA 2VO4A 4JR4A 1TK8B 3DEXA 4ECIA 4RI6A 1F2EA 4J57E 1XWKA 2HYXA 2DJJA 4L5LA 3M0FA 1G6WA 1OVNA 4CY6A 5DCGA 1AXDA 1RQMA 1XWBA 1M0UA 3KCMA 4CDOA 1ZYQB 1FAAA 2VAFA 3IHQA 3KMOA 4MJBA 4K1FA 2XBQA 4J56E 1VF3A 1T00A 1PGTA 1A8YA 3PPUA 3APOA 2DJ3A 3QAGA 4ML6A 4TR4A 1AIUA 4ECCA 4ECJA 3CRTA 3GHAA 2FGXA 3IXRA 3F4RA 4E8EA 4PQIA 5JCUA 1YQ1A 2GQLA 4RI7A 1NHOA 5GAND 5DAKB 3ZVJA 3IC4A 3ZIVA 3A2XA 4KH7A 2K9FA 3QDNA 3ZYWA 1X5EA 1A0RP 2DMLA 4V1Ag 1A24A 4ZB8A 2V6KA 3UEMA 2ON5A 1LU4A 2FWFA 3GTUB 5BRTA 3D5JA 2DKHA 4OCFA 2H72A 18GSA 3C1SA 5F8BA 1A2JA 2HI7A 2GQKA 3HD5A 5CRGA 3IPZA 1JZRA 4BPYA 4MZCA 3M9JA 1TU7A 12GSA 1SK2A 3VWVA 5D9XA 2PN8A 3BJ5A 1U3IA 4NWYA 2I9HA 3PINA 1KTEA 3ZITA 2XHFA 5A4WA 2MZCA 2H71A 1V9WA 4FYUA 4YKFA 2RLIA 4IBPA 3E9JB 4LL4B 2REMA 3GTUA 3H93A 5HR3A 4FH8A 1WWJA 1U88A 3ME7A 3VFIA 4GCIA 3HJOA 2LNTA 4K5RA 2VCTA 4HZ2A 2VUPA 3GH6A 3M9KA 4YQMA 4IJIA 3TCOA 3MWHA 3P2AA 4ULXA 5KN1A 4IGJA 1LJRA 4LMVA 1H4OA 4DSSB 1GLQA 4HUAA 2GZZA 3ISOA 3UARA 3EWLA 3G7JA 4F03A 3EC3A 1GSEA 3HA9A 4XCSA 2R5GA 1ML6A 1TXXA 2X8HA 1PD21 2H0GA 5ECSA 5ECIB 5AGYA 4O32A 4IELA 4HOJA 2OE3A 4TR1B 5DQYA 1XFLA 3L4NA 2R0PA 2KHPA 1T4ZA 4KDYA 2JU5A 4YAPA 1ABAA 2WZ9A 2DIYA 5IMCA 3IV4A 3CSJA 4DSSA 3GKNA 4HJMA 2WDUA 2M46A 3KGKA 4JZQA 3ZMKA 3APQA 4I5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QSI A;  2PU9 C;  3FR6 A;  3VPT A;  2O7K A;  1GSS A;  3D22 A;  1R4W A;  4Q5R A;  1ST9 A;  2LST A;  4J2F A;  2CAQ A;  2L5O A;  4K0G A;  3W6G A;  1MD3 A;  4N0V A;  2VCZ A;  2MMA A;  4K7O A;  1NW2 A;  1UC7 A;  3KMN A;  4PNG A;  2TRC P;  2VM1 A;  4TR1 A;  3A2W A;  3KJY A;  4I8B A;  3ZFL A;  1JHB A;  4Z7X A;  4IVF A;  5F05 A;  3K8N A;  2DJ2 A;  5CAX A;  1OAZ A;  1PX6 A;  1SL1 B;  1WMJ A;  14GS A;  3G7I A;  2CV4 A;  2DBC A;  2CVK A;  4OWY A;  1TDI A;  3TJG A;  4FYB A;  3KIJ A;  4GSN A;  3KP8 A;  4ID0 A;  5DBQ A;  3QAW A;  4O5R A;  3DGQ A;  3TJB A;  1M9B A;  1OYJ A;  4G19 A;  1O81 A;  3GKM A;  4HS1 A;  5ENU A;  3F3Q A;  1ERU A;  1XPV A;  1B9Y C;  1AAZ A;  2L59 A;  4HU9 A;  2FCH A;  2HRF A;  1AUC A;  3GL5 A;  4DSR A;  2H76 A;  1SJZ A;  5EL8 A;  3EMX A;  4NMU A;  1AC1 A;  4EDY A;  4MP4 A;  2JSZ A;  2OE0 A;  1SKR B;  4WEY A;  4K7I A;  2YWN A;  1BAY A;  2R3X A;  5B6M A;  1MTC A;  4GWR A;  3M3M A;  1AQV A;  3A3T A;  1PX7 A;  2DC5 A;  2V2G A;  3TKS C;  3UL3 A;  1VF1 A;  2GZP A;  2HZF A;  1LBK A;  2K8S A;  4BWQ A;  2HZE B;  6GSU A;  2VL3 A;  2LS5 A;  1B8X A;  1V57 A;  2L57 A;  2P31 A;  5JCG A;  17GS A;  9GSS A;  1E6B A;  1PKZ A;  2LTK A;  3EIN A;  1PMT A;  4KSM A;  2YAN A;  1XOA A;  3GFK A;  2G2Q A;  1YEX A;  4XTS A;  2OBK A;  3ERW A;  5F07 A;  2H30 A;  1GSY A;  1SL2 B;  3U5R E;  3BOA A;  5JCW A;  1SL0 B;  2GVP A;  11GS A;  2YWM A;  3QOU A;  4BVX A;  6GSX A;  3TKP A;  2HZE A;  3OR5 A;  3Q19 A;  2C3N A;  1GWC A;  3FW2 A;  2L5L A;  4V2L A;  3RHB A;  5D9V A;  4OD7 A;  1X9S B;  3I69 A;  5H5S A;  3HXS A;  2N5F A;  4L0W A;  1BX9 A;  5IMD A;  4MF6 A;  3IBH A;  1FVK A;  2H6X A;  4KCE A;  3W8J A;  2H8L A;  5IOW A;  5D9W A;  3D4M A;  2QC7 A;  1R5A A;  1TU8 A;  2YWI A;  3LXZ A;  4WXT A;  2OKA A;  1OC9 A;  1X5C A;  5G2Z A;  2CVD A;  3ZIJ A;  2C0G A;  4N0Z A;  4GF0 A;  4HZ4 A;  1K0C A;  4E8H A;  4DVC A;  1SYX A;  2JAC A;  3PR8 A;  3RBT A;  5ECH B;  1PSQ A;  1M2D A;  1MDI A;  1EGR A;  3TRP A;  2MYG A;  5IIZ A;  2R4V A;  1TRS A;  2VOC A;  1TJD A;  3RAZ A;  3TKS E;  2MBT A;  1N2A A;  1WJK A;  5COH A;  3CTF A;  3P7X A;  1G6Y A;  4I2U A;  4JBB A;  3US3 A;  3KTB A;  1GLP A;  2B7K A;  3N5O A;  4LA1 A;  2H1A A;  1YY7 A;  2X8G A;  2D2Z A;  1YKC A;  2L6C A;  3F4S A;  2DSA A;  2GT6 A;  2YJ7 A;  2DJK A;  3DWV A;  3VUR A;  2Z9S A;  1O73 A;  3GMF A;  2LRC A;  4XIH A;  2H1D A;  1WIK A;  1I5G A;  3NZN A;  5CYY A;  2QGV A;  3KXO A;  1QK8 A;  3UMA A;  2B5E A;  3ME8 A;  1O8X A;  3UAP A;  5CRW A;  1FB0 A;  2C3Q A;  5ELG A;  2OJL A;  1DE2 A;  3HVS A;  3F0I A;  4EE0 A;  1YEP A;  3HVV A;  3UVH A;  1KNG A;  2FNO A;  1GTB A;  1T4Y A;  6GSY A;  4V2M A;  3LGC A;  3TOT A;  1Q98 A;  1JZO A;  3C1R A;  8GSS A;  1KEB A;  2VD0 A;  2IWT A;  1XWC A;  5KN2 A;  4JED A;  1S3C A;  2MMN A;  4MLY A;  4IN0 A;  2XC2 A;  3GNJ A;  4TR3 A;  3NOF A;  2GT5 A;  5AIV A;  1TI3 A;  3LXT A;  2IN3 A;  2PVQ A;  1K3L A;  1BG5 A;  2FD3 A;  3I43 A;  1SK0 A;  3M8N A;  3IAS 2;  4GSS A;  4KDX A;  1GRX A;  5JWO B;  4JE1 A;  3RDW A;  2C0D A;  3CXG A;  1SKW B;  3DRN A;  2HFD A;  2R37 A;  1ZL9 A;  3HJP A;  4V2N A;  3UBL A;  5CRE A;  1GTU A;  2LUS A;  2N5A A;  4LMW A;  3ZL5 A;  2PGT A;  4K0N A;  1TOF A;  2I4A A;  3KTL A;  1H75 A;  3APS A;  4POB A;  5EPF A;  4JU5 A;  1F6M C;  4TR0 A;  3QFA C;  3CBU A;  1THO A;  1EZK A;  1HNA A;  2XPE A;  2J23 A;  1TRW A;  2VL9 A;  2F8A A;  2HNL A;  4MF7 A;  2DMM A;  1JZW A;  3IRA A;  4KSO A;  4WF5 A;  7GSS A;  5C00 A;  3H8Q A;  3WT2 A;  3QFB C;  2E7P A;  2C3T A;  4DSQ A;  2XPD A;  2YZH A;  2PWJ A;  3FR3 A;  3UOM A;  3S9F A;  4JR6 A;  4WET A;  2WGR A;  1PRX A;  5CO3 A;  5DJM A;  2O85 A;  1XWA A;  2AV4 A;  2J9H A;  3IK9 A;  3HJM A;  4MDC A;  5L71 A;  1Z7P A;  2R2J A;  3QD9 A;  3V1W A;  4P3Y B;  4F2I A;  3J7Y k;  5ELA A;  2A2R A;  5AIS A;  2V41 A;  4F0C A;  2C8U A;  5DAK A;  5AN1 A;  3HY2 A;  4Q5N A;  2AUV A;  3HHV A;  2F3M A;  1GUM A;  4NV5 A;  2H1G A;  5JWQ B;  2IJY A;  3SBC A;  1I9D A;  3TJJ A;  2RM5 A;  16GS A;  3VI7 A;  4L5O A;  1TRU A;  4XRA A;  3TUE A;  1YKA A;  4EKZ A;  5HR2 A;  5D96 A;  3UVT A;  1GUK A;  3EVI A;  3PH9 A;  2IMD A;  3TGZ A;  1WRY A;  3IK7 A;  1FB6 A;  3F8U A;  13GS A;  4EO3 A;  3C71 A;  1Y6E A;  2F51 A;  4YQU A;  1J0F A;  1XVW A;  2YWO A;  2M80 A;  3WYW A;  5IMF A;  1DSB A;  3QR6 A;  2PUK C;  4Q5F A;  2AYT A;  1TP9 A;  4N30 A;  4I97 A;  1YF1 A;  1EOH A;  1G7E A;  1ZMA A;  2PVO C;  2AB6 A;  3ED3 A;  5ECO B;  2CZ2 A;  5FT3 A;  2EIQ A;  1RW1 A;  1XVQ A;  2X99 A;  4YAV A;  4CHS A;  1B4Q A;  2RUF A;  4OFM A;  4BWS A;  4IP1 A;  1QUW A;  2H66 A;  1BQ7 A;  2HE3 A;  3QAV A;  2ZUP A;  1M99 A;  2ALB A;  1GH2 A;  2X8C A;  2H75 A;  1EOG A;  2N5B A;  2C1Y A;  2F8F A;  1QGV A;  4NPB A;  5INY A;  4RQR A;  2H6Y A;  3L0H A;  2LJA A;  3WGX A;  1EEM A;  1ERV A;  3CTG A;  3QPM A;  4GTU A;  1R26 A;  2HSH A;  5LCZ A;  1JFU A;  2GDR A;  2G0F A;  4WR4 A;  5ECP B;  5IPH A;  2ES7 A;  1ERW A;  5ECN B;  2GTU A;  3I6A A;  3Q18 A;  3RPP A;  2LRT A;  1R5P A;  5D73 A;  4MZB A;  4ACS A;  4OCE A;  2JZT A;  4HQS A;  3HZ4 A;  2E2M A;  3CYN A;  5LNK e;  1EV4 A;  5CNW A;  1EP7 A;  3GUR A;  4ISD A;  3H4K A;  6GSV A;  3GYK A;  2FA4 A;  1PA3 A;  3TJK A;  3KZQ A;  2OAD A;  4ML1 A;  5GAP D;  2GZY A;  1DE1 A;  4QL9 A;  2LQO A;  2EIO A;  2HXK A;  4OO5 A;  4PUR A;  4PQH A;  3ZFB A;  1TKD B;  4QQ7 A;  5D8I A;  4EC0 A;  3HCZ A;  2CZ3 A;  3E0U A;  1YJ6 A;  4ZL8 A;  2C0F A;  1GNW A;  1SU9 A;  5G1K A;  1A2M A;  3I9V 2;  1FW1 A;  2FUG 2;  2VD1 A;  2JZR A;  2GGT A;  3QCP A;  1SD9 A;  2KP1 A;  5DDL A;  5LD0 A;  1M7T A;  1O85 A;  3Q6O A;  2LEG A;  2E2G A;  4ZBB A;  1MEK A;  2IFQ B;  4TRX A;  4RQX A;  2IL3 A;  2WJU A;  2VCX A;  1EEJ A;  5ECL B;  1VF2 A;  4X1U A;  4YH2 A;  3GL3 A;  2OAC A;  3EMP A;  1V40 A;  5AIX A;  2HT9 A;  1FO5 A;  1CQG A;  5B8B A;  3TKR A;  1K0D A;  2YCD A;  5IO2 A;  2B6M A;  4MJA A;  3KEB A;  2VLU A;  3F6D A;  1Q4J A;  1K3Y A;  5E4W A;  3VWX A;  3KM6 A;  1W89 A;  1VGL A;  4MH3 A;  2IFQ A;  2NDO A;  1IYI A;  5JWR B;  1X0R A;  3MSZ A;  5HFK A;  3WT1 A;  5J9B A;  1DBY A;  1E2Y A;  3MAK A;  2IIY A;  1GSD A;  2R6K A;  4AJ6 A;  1V98 A;  1YDK A;  2YV7 A;  2TRX A;  2V32 A;  4BL7 A;  3BD2 A;  2HRN A;  2I81 A;  2O8V B;  4OFT A;  3L78 A;  4MCU A;  4ZB9 A;  5D9T A;  4TXO B;  1HQO A;  2WB9 A;  3CRU A;  1J08 A;  1GP1 A;  4NV2 A;  2KP2 A;  3FR9 A;  3KH7 A;  3LQ7 A;  2B5Y A;  2BTO T;  4GRF A;  5ID2 B;  3LG6 A;  2GSQ A;  3WGD A;  1AW9 A;  3TJF A;  2H73 A;  3VWU A;  4F82 A;  4H86 A;  4O92 A;  2NPB A;  4KB3 A;  1X5D A;  5EY6 A;  5HFI A;  1UN2 A;  2VCV A;  1XXU A;  4HU7 A;  1NSW A;  4ZBD A;  1XWG A;  2H0H A;  1G7O A;  4HI7 A;  1OC8 A;  1EP8 A;  3KH9 A;  3L9U A;  2ON7 A;  2RM6 A;  2TIR A;  5IOX A;  1T7P B;  4WF4 A;  4KW6 A;  1T3B A;  1YF0 A;  4I2T A;  2AAW A;  4PGT A;  2MMZ A;  5G30 A;  4IHU A;  5E59 A;  2YOI A;  5HR0 A;  1FHE A;  5DCH A;  3CMI A;  3TRQ A;  3LFL A;  5IMA A;  2OBI A;  5ID2 A;  5G5F A;  3P8W A;  1B9X C;  1K0O A;  5HQP A;  3H79 A;  2PER A;  2M72 A;  4POM A;  3BBY A;  3GSS A;  1GTA A;  3EUR A;  1T8E B;  1XW6 A;  1HYU A;  2LKU A;  3IE3 A;  4EF0 A;  5HFG A;  1GSQ A;  1TK0 B;  3IA1 A;  4PXO A;  3FZ9 A;  3G7Y A;  3O76 A;  2NTO A;  3A2V A;  3GUS A;  1MDJ A;  1A8L A;  5F0G A;  1PL2 A;  4IKH A;  5EVO A;  1SK1 A;  2PPT A;  4XHM A;  1OE8 A;  2EC4 A;  3RPN A;  3TDG A;  2OA7 A;  5G1L A;  4FIW A;  2WFC A;  2GST A;  4MK3 A;  2YV9 A;  1JLW A;  1FG4 A;  3GKK A;  1EGO A;  3R2Q A;  2NBS A;  2GLR A;  3FZ4 A;  3ZZX A;  4NXI A;  5ECM B;  2DJ1 A;  1GTI A;  2CA8 A;  2LNS A;  3O3T A;  1PQN A;  3E3E A;  1C72 A;  2WCI A;  3SWL A;  4ZB6 A;  3Q74 A;  4XRD A;  1G0T A;  1QFN A;  4K2D A;  1BYE A;  2H19 A;  1NM3 A;  2YP6 A;  4NHZ A;  4WBR D;  2CX4 A;  2DLX A;  2H6Z A;  1FVJ A;  2JSY A;  2LJK A;  1K0N A;  1OE7 A;  4F0B A;  1THX A;  6GST A;  2I1U A;  2PBJ A;  4MMM A;  1O7U A;  2O89 A;  2FWE A;  5DAL B;  2VL2 A;  5A4U A;  5H5Q A;  1GL8 A;  1V2A A;  4FYC A;  4IS0 A;  3CSH A;  4GQF A;  2IPA A;  2YN1 A;  3EU3 A;  2L6D A;  3EE2 A;  1ZYE A;  1FOV A;  3F6F A;  2RUE A;  1W4V A;  1WE0 A;  3WGE A;  4EL1 A;  4BA7 A;  1XCC A;  5GSS A;  3GV1 A;  2H74 A;  5GZZ B;  2CAI A;  1O6J A;  4CW9 A;  5D93 A;  3H1N A;  1AQW A;  5ECR B;  3UBK A;  5DAL A;  1M2A A;  4K9Z A;  1TK5 B;  4ILF A;  2P5Q A;  4OMV A;  2FA8 A;  3W8S A;  2A4V A;  1CQH A;  1F3B A;  2HSY A;  3LOR A;  3VI5 A;  4BVY A;  4XS1 A;  1TTZ A;  4WR5 A;  5KEJ A;  2GSR A;  5J9C A;  1A23 A;  1RK4 A;  1UA5 A;  4KX4 A;  4OFN A;  1N8J A;  4ZXG A;  19GS A;  22GS A;  2BMX A;  4N11 A;  2V1M A;  4GXZ A;  5GST A;  4ZBA A;  3FHK A;  3FY7 A;  4HJ2 A;  4K8M A;  1T1V A;  2LQQ A;  4RUV A;  1DUG A;  1XIY A;  2FWH A;  4EDZ A;  3EU4 A;  2QKE A;  4IW9 A;  3TKQ A;  5A5K A;  1TI1 A;  1GUH A;  3D6I A;  5G5E A;  4FO5 A;  4MJC A;  3HDC A;  1EV9 A;  2FY6 A;  2YZU A;  2L4C A;  4K6X A;  1Z3E A;  2GS3 A;  4KA0 A;  3HKR A;  1XBS A;  3FK8 A;  5KN3 A;  2VCQ A;  3FZA A;  4G10 A;  5B7C A;  2B7J A;  2I3Y A;  4L0U A;  3GA4 A;  1M2B A;  5CP1 A;  2B1L A;  2YPM A;  1R7H A;  3ZVJ D;  1ACV A;  2P0G A;  2P5R A;  3FRC A;  4XS6 A;  4AGS A;  3DD3 A;  3VWW A;  5IM9 A;  4HQZ A;  3VK9 A;  5H5R A;  1VF4 A;  1QQ2 A;  3NIV A;  1U3A A;  4TW5 A;  10GS A;  1USB A;  1A0F A;  4MJE A;  2C80 A;  2C0E A;  4ECB A;  1F3A A;  4POK A;  2A2S A;  3PGT A;  4PUF C;  2H1B A;  5CRH A;  5DVB A;  1QMV A;  2HLS A;  3KD0 A;  3ZRD A;  3LYK A;  1U87 A;  3ZTL A;  3L9S A;  1Z9H A;  4Q5Q A;  3LEF A;  4IQ1 A;  1A2L A;  3GRX A;  3IAM 2;  3HZ8 A;  5F06 A;  1F9M A;  4MPF A;  2K8V A;  1NHY A;  1GNE A;  1OKT A;  3EYT A;  3GKX A;  3DYR A;  4TOP A;  3GX0 A;  2EIR A;  1SEN A;  4KDU A;  4ZIJ A;  1URM A;  3D21 A;  4N10 A;  3M1G A;  1K0A A;  4POL A;  2JL4 A;  4XS4 B;  1S3A A;  1KBN A;  1K0B A;  1JZD A;  1XW5 A;  2KUC A;  5J3R A;  5C04 A;  2YNX A;  4ZIL A;  2V6O A;  2H70 A;  2GQM A;  5FHI A;  2B1K A;  2FLS A;  1HD2 A;  3TOU A;  1UVZ A;  4AJ8 A;  3D4T A;  1OKD A;  2B3S A;  1GUL A;  3D0Z A;  2H01 A;  5J4U A;  4PNF A;  1ZCP A;  4D73 B;  3G9B A;  1ON4 A;  3GST A;  20GS A;  2B5X A;  2VLT A;  3JCM L;  1HNB A;  4JRR A;  1HNC A;  4IJ3 A;  3F63 A;  4XS4 A;  4DEJ A;  3HVX A;  5IMV A;  2AJQ B;  3FEU A;  1ZGN A;  1ZOF A;  1ZZY A;  2GSS A;  1WP0 A;  1B4P A;  3FZ5 A;  3P90 A;  3A5W A;  2C4J A;  4GLT A;  4NHW A;  2LRN A;  4L8E A;  4G9H A;  2JZS A;  4GST A;  1V58 A;  4D73 A;  5B6N A;  4KE3 A;  1X9W B;  2VCW A;  1ERT A;  1BJX A;  2E0Q A;  4KAE A;  2CT6 A;  4HEA 2;  3F4T A;  4KGI A;  3ZRE A;  4AF2 A;  1J9B A;  1BED A;  1TRV A;  4ZL9 A;  3U6V A;  4PX1 A;  3IDV A;  4OO4 A;  4IP6 A;  4KUN A;  5ECK B;  3KP9 A;  2ZCT A;  1Z7R A;  4V1A p;  2IMK A;  3DVX A;  1YZX A;  2PMT A;  4KND A;  5J5N A;  4MAB A;  1MDK A;  1MD4 A;  1Y25 A;  4QL7 A;  4F9Z A;  3MNG A;  4MPG A;  1K0M A;  2KOK A;  1SD8 A;  3TKS A;  1SKS B;  3QMX A;  3CSI A;  1PN9 A;  2KLX A;  4TXV A;  2L4Q A;  1OC9 B;  3F3R A;  1Z6M A;  1OC3 A;  2VM2 A;  4TN8 A;  4MA9 A;  4LL1 B;  3ERF A;  4K7N A;  5KN0 A;  1TW9 A;  3J7Y b;  1WOU A;  5FWG A;  4PUA A;  3RHC A;  2K18 A;  3AY8 A;  2H0I A;  2WS2 A;  1X9M B;  1SYR A;  2DIZ A;  2CVB A;  4IQA A;  2CX3 A;  3DIE A;  2VLV A;  3HYP A;  4MF5 A;  1WPI A;  1XW9 A;  2FHE A;  2NVL A;  2F9S A;  3VPQ A;  3GH9 A;  3TRX A;  3MDK A;  5ABR A;  1PKW A;  5CRD A;  3GIX A;  1QXH A;  3DML A;  2MBS A;  4KCA A;  1B48 A;  2O87 A;  3FKF A;  4MZW A;  3C8E A;  2YJH A;  1AQX A;  1F37 A;  2WUL A;  4X43 A;  1U6T A;  1XOB A;  1JLV A;  2RII A;  4MH2 A;  1M9A A;  4AJ7 A;  2K6V A;  3ZML A;  4GQC A;  5IMZ A;  1ILO A;  2OE1 A;  3IOS A;  4TXO A;  2ZNM A;  1EWX A;  4ZL7 A;  2JAD A;  5J41 A;  4I6X A;  4YQV A;  2IME A;  3C7M A;  2VIM A;  3LSZ A;  1O8W A;  4NAX A;  5A4V A;  4WBJ A;  5IO0 A;  4WKW A;  2DJ0 A;  3TB2 A;  2LV3 A;  1SJI A;  2X64 A;  2WRT A;  2FWG A;  3O6T A;  4EVM A;  3FYG A;  2IMI A;  1GSU A;  1Z5Y E;  3L9V A;  1K3O A;  5IQY A;  3LJR A;  2XBI A;  3F9U A;  5G31 A;  4O7H A;  4TVE A;  3GN3 A;  1XZO A;  3BCK A;  1Z6N A;  4X0X A;  5DJL A;  4EXJ A;  3DVW A;  3N9J A;  5IPG A;  4TKY A;  3ERG A;  1GSF A;  3UJ1 A;  3ZLP A;  1PL1 A;  3WD6 A;  6GSW A;  4HDE A;  5ECQ B;  3DKS A;  3DXB A;  3GX8 A;  4LLR A;  5B8A A;  2IMF A;  2LJR A;  3IR4 A;  4PQ1 A;  3BCI A;  2MMO A;  5DQS A;  1SJ6 A;  3LWA A;  4EUY A;  5HR1 A;  2VL2 C;  2CQ9 A;  1VRS D;  3LYP A;  3VLN A;  6GSS A;  1IYH A;  1S3D A;  2AHE A;  3C73 A;  2BJX A;  4G2E A;  3UIW A;  2VO4 A;  4JR4 A;  1TK8 B;  3DEX A;  4ECI A;  4RI6 A;  1F2E A;  4J57 E;  1XWK A;  2HYX A;  2DJJ A;  4L5L A;  3M0F A;  1G6W A;  1OVN A;  5DCG A;  1AXD A;  1RQM A;  1XWB A;  1M0U A;  3KCM A;  4CDO A;  1ZYQ B;  1FAA A;  2VAF A;  3IHQ A;  3KMO A;  4MJB A;  4K1F A;  2XBQ A;  4J56 E;  1VF3 A;  1T00 A;  1PGT A;  1A8Y A;  3APO A;  2DJ3 A;  3QAG A;  4ML6 A;  4TR4 A;  1AIU A;  4ECC A;  4ECJ A;  3CRT A;  3GHA A;  2FGX A;  3IXR A;  3F4R A;  4E8E A;  4PQI A;  5JCU A;  1YQ1 A;  2GQL A;  4RI7 A;  1NHO A;  5GAN D;  5DAK B;  3ZVJ A;  3IC4 A;  3ZIV A;  3A2X A;  4KH7 A;  2K9F A;  3QDN A;  3ZYW A;  1X5E A;  1A0R P;  2DML A;  4V1A g;  1A24 A;  4ZB8 A;  2V6K A;  3UEM A;  2ON5 A;  1LU4 A;  2FWF A;  3GTU B;  3D5J A;  4OCF A;  2H72 A;  18GS A;  3C1S A;  5F8B A;  1A2J A;  2HI7 A;  2GQK A;  3HD5 A;  5CRG A;  3IPZ A;  1JZR A;  4BPY A;  4MZC A;  3M9J A;  1TU7 A;  12GS A;  1SK2 A;  3VWV A;  5D9X A;  2PN8 A;  3BJ5 A;  1U3I A;  4NWY A;  2I9H A;  3PIN A;  1KTE A;  3ZIT A;  2XHF A;  5A4W A;  2MZC A;  2H71 A;  1V9W A;  4FYU A;  2RLI A;  4IBP A;  3E9J B;  4LL4 B;  2REM A;  3GTU A;  3H93 A;  5HR3 A;  4FH8 A;  1WWJ A;  1U88 A;  3ME7 A;  3VFI A;  4GCI A;  3HJO A;  2LNT A;  2VCT A;  4HZ2 A;  2VUP A;  3GH6 A;  3M9K A;  4YQM A;  4IJI A;  3TCO A;  3MWH A;  3P2A A;  4ULX A;  5KN1 A;  4IGJ A;  1LJR A;  4LMV A;  1H4O A;  4DSS B;  1GLQ A;  4HUA A;  2GZZ A;  3ISO A;  3UAR A;  3EWL A;  3G7J A;  4F03 A;  3EC3 A;  1GSE A;  3HA9 A;  4XCS A;  2R5G A;  1ML6 A;  1TXX A;  2X8H A;  1PD2 1;  2H0G A;  5ECS A;  5ECI B;  5AGY A;  4O32 A;  4IEL A;  4HOJ A;  2OE3 A;  4TR1 B;  5DQY A;  1XFL A;  3L4N A;  2KHP A;  1T4Z A;  4KDY A;  2JU5 A;  4YAP A;  1ABA A;  2WZ9 A;  2DIY A;  5IMC A;  3IV4 A;  3CSJ A;  4DSS A;  3GKN A;  4HJM A;  2WDU A;  2M46 A;  3KGK A;  4JZQ A;  3ZMK A;  3APQ A;  4I5Q A; 
#chains in the Genus database with same CATH topology
 2QSI A;  2PU9 C;  3FR6 A;  3VPT A;  2O7K A;  1GSS A;  3D22 A;  1R4W A;  4Q5R A;  1ST9 A;  2LST A;  4J2F A;  2CAQ A;  2L5O A;  4K0G A;  3W6G A;  1MD3 A;  4N0V A;  2VCZ A;  2MMA A;  4K7O A;  1NW2 A;  1UC7 A;  3KMN A;  4PNG A;  2TRC P;  2VM1 A;  4TR1 A;  3A2W A;  3KJY A;  4I8B A;  3ZFL A;  1JHB A;  4Z7X A;  4IVF A;  5F05 A;  3K8N A;  2DJ2 A;  5CAX A;  1OAZ A;  1PX6 A;  1SL1 B;  1WMJ A;  14GS A;  3G7I A;  2CV4 A;  2DBC A;  2CVK A;  4OWY A;  1TDI A;  3TJG A;  4FYB A;  3KIJ A;  4GSN A;  3KP8 A;  4ID0 A;  5DBQ A;  3QAW A;  4O5R A;  3DGQ A;  3TJB A;  1M9B A;  1OYJ A;  4G19 A;  1O81 A;  3GKM A;  4HS1 A;  5ENU A;  3F3Q A;  1ERU A;  2X49 A;  1XPV A;  1B9Y C;  1AAZ A;  2L59 A;  4HU9 A;  4KF9 A;  2HRA A;  2FCH A;  2HRF A;  1AUC A;  3GL5 A;  3IC8 A;  4DSR A;  2H76 A;  1SJZ A;  5EL8 A;  3EMX A;  4NMU A;  1AC1 A;  4EDY A;  4MP4 A;  2JSZ A;  2OE0 A;  1SKR B;  4WEY A;  4K7I A;  2YWN A;  1BAY A;  2R3X A;  5B6M A;  1MTC A;  4GWR A;  3M3M A;  1AQV A;  3A3T A;  1PX7 A;  2DC5 A;  2V2G A;  3TKS C;  3UL3 A;  1VF1 A;  2GZP A;  2HZF A;  1LBK A;  4BVX B;  2K8S A;  4BWQ A;  2HZE B;  6GSU A;  2VL3 A;  2LS5 A;  1B8X A;  1V57 A;  2L57 A;  2P31 A;  5JCG A;  17GS A;  9GSS A;  1E6B A;  1PKZ A;  2LTK A;  1FOH A;  3EIN A;  4EIP A;  1PMT A;  4KSM A;  2YAN A;  4O5U A;  3EPT A;  1XOA A;  3GFK A;  2G2Q A;  1YEX A;  4XTS A;  2OBK A;  3ERW A;  5F07 A;  2H30 A;  1GSY A;  1SL2 B;  3U5R E;  3BOA A;  5JCW A;  1SL0 B;  2GVP A;  11GS A;  2YWM A;  3QOU A;  4BVX A;  6GSX A;  3TKP A;  2HZE A;  3OR5 A;  3Q19 A;  2C3N A;  1GWC A;  3FW2 A;  2X4A A;  2L5L A;  4V2L A;  3RHB A;  4BL7 B;  5D9V A;  4OD7 A;  1X9S B;  3I69 A;  4MNN A;  5H5S A;  3HXS A;  4O5Q A;  2N5F A;  1PN0 A;  1BX9 A;  4L0W A;  5IMD A;  4MF6 A;  3IBH A;  1FVK A;  2H6X A;  4KCE A;  3W8J A;  2H8L A;  5IOW A;  5D9W A;  3D4M A;  2QC7 A;  2R0C A;  1R5A A;  1TU8 A;  2YWI A;  3LXZ A;  4WXT A;  2OKA A;  1OC9 A;  1X5C A;  5G2Z A;  2CVD A;  3ZIJ A;  2C0G A;  4N0Z A;  4GF0 A;  4HZ4 A;  1K0C A;  4E8H A;  4DVC A;  1SYX A;  2JAC A;  3PR8 A;  3RBT A;  5ECH B;  1PSQ A;  1M2D A;  1MDI A;  1EGR A;  3TRP A;  2MYG A;  5IIZ A;  2R4V A;  1TRS A;  2VOC A;  1TJD A;  3RAZ A;  3TKS E;  2MBT A;  1N2A A;  1WJK A;  5COH A;  3CTF A;  3P7X A;  1G6Y A;  4I2U A;  4JBB A;  3US3 A;  3KTB A;  1GLP A;  2B7K A;  3N5O A;  4LA1 A;  2H1A A;  1YY7 A;  2X8G A;  2D2Z A;  1YKC A;  2L6C A;  3F4S A;  2DSA A;  2GT6 A;  2YJ7 A;  2DJK A;  3DWV A;  3VUR A;  2Z9S A;  1O73 A;  3GMF A;  2LRC A;  4XIH A;  2H1D A;  1WIK A;  1I5G A;  3NZN A;  5CYY A;  2QGV A;  3KXO A;  1QK8 A;  3UMA A;  2B5E A;  3ME8 A;  1O8X A;  3UAP A;  5CRW A;  1FB0 A;  2C3Q A;  5ELG A;  1S3R A;  2OJL A;  1PFO A;  1DE2 A;  3HVS A;  3F0I A;  4EE0 A;  1YEP A;  3HVV A;  3UVH A;  1KNG A;  2FNO A;  1GTB A;  1T4Y A;  6GSY A;  4V2M A;  3LGC A;  3TOT A;  1Q98 A;  1JZO A;  3C1R A;  8GSS A;  1KEB A;  4HSC X;  2VD0 A;  2IWT A;  1XWC A;  5KN2 A;  4JED A;  1S3C A;  2MMN A;  4MLY A;  4IN0 A;  2XC2 A;  3GNJ A;  4TR3 A;  3NOF A;  2GT5 A;  1TI3 A;  3LXT A;  5AIV A;  2IN3 A;  2PVQ A;  1K3L A;  1BG5 A;  2FD3 A;  3I43 A;  1SK0 A;  3M8N A;  3IAS 2;  4GSS A;  4KDX A;  1GRX A;  5JWO B;  4JE1 A;  3RDW A;  2C0D A;  3CXG A;  1SKW B;  3DRN A;  2HFD A;  2R37 A;  1ZL9 A;  3HJP A;  4V2N A;  3UBL A;  5CRE A;  1GTU A;  2LUS A;  2N5A A;  4LMW A;  3ZL5 A;  2PGT A;  4K0N A;  1TOF A;  2I4A A;  3KTL A;  1H75 A;  3APS A;  4POB A;  5EPF A;  4JU5 A;  1F6M C;  4TR0 A;  3QFA C;  3CBU A;  1THO A;  4Z2R A;  1EZK A;  1HNA A;  2XPE A;  4K5S A;  2J23 A;  1TRW A;  2VL9 A;  2F8A A;  2HNL A;  4MF7 A;  4A5P A;  2DMM A;  1JZW A;  3IRA A;  4KSO A;  4WF5 A;  7GSS A;  3LW9 A;  5C00 A;  3H8Q A;  3WT2 A;  3QFB C;  2E7P A;  2C3T A;  4DSQ A;  2XPD A;  2YZH A;  2PWJ A;  3FR3 A;  3UOM A;  3S9F A;  4JR6 A;  4WET A;  2WGR A;  1PRX A;  5CO3 A;  5DJM A;  2O85 A;  1XWA A;  2AV4 A;  2J9H A;  3IK9 A;  3HJM A;  4MDC A;  5L71 A;  1Z7P A;  2R2J A;  3QD9 A;  3V1W A;  4P3Y B;  4F2I A;  3J7Y k;  5ELA A;  2A2R A;  5AIS A;  2V41 A;  4F0C A;  2C8U A;  5DAK A;  5KOX A;  5AN1 A;  3HY2 A;  4Q5N A;  2AUV A;  3HHV A;  2F3M A;  1GUM A;  4NV5 A;  2H1G A;  5JWQ B;  2IJY A;  3SBC A;  1I9D A;  3TJJ A;  2RM5 A;  16GS A;  3VI7 A;  4L5O A;  1TRU A;  4XRA A;  3TUE A;  1YKA A;  4EKZ A;  5HR2 A;  5D96 A;  3UVT A;  1GUK A;  1ZYP A;  3EVI A;  3PH9 A;  2IMD A;  3TGZ A;  1XG8 A;  1WRY A;  3IK7 A;  1FB6 A;  3F8U A;  13GS A;  4EO3 A;  3C71 A;  1Y6E A;  2F51 A;  4YQU A;  1J0F A;  1XVW A;  2YWO A;  2M80 A;  3WYW A;  5IMF A;  1DSB A;  3QR6 A;  2PUK C;  4Q5F A;  2AYT A;  1TP9 A;  4N30 A;  4I97 A;  1YF1 A;  1EOH A;  1G7E A;  1ZMA A;  2PVO C;  2AB6 A;  3ED3 A;  5ECO B;  2CZ2 A;  5FT3 A;  2EIQ A;  1RW1 A;  1XVQ A;  2X99 A;  4YAV A;  4CHS A;  1B4Q A;  2RUF A;  4OFM A;  4BWS A;  4IP1 A;  1QUW A;  2H66 A;  1BQ7 A;  2HE3 A;  3QAV A;  2ZUP A;  1M99 A;  2ALB A;  1GH2 A;  2X8C A;  2H75 A;  1EOG A;  2N5B A;  2C1Y A;  2F8F A;  1QGV A;  4NPB A;  5INY A;  4RQR A;  2H6Y A;  3L0H A;  2LJA A;  3WGX A;  1EEM A;  1ERV A;  3CTG A;  3QPM A;  4GTU A;  1R26 A;  2HSH A;  5LCZ A;  1JFU A;  2GDR A;  2G0F A;  4WR4 A;  5ECP B;  5IPH A;  2ES7 A;  1ERW A;  5ECN B;  2GTU A;  3I6A A;  3Q18 A;  3RPP A;  2LRT A;  1R5P A;  5D73 A;  4MZB A;  4ACS A;  4OCE A;  2JZT A;  4HQS A;  4YKG A;  3HZ4 A;  2E2M A;  4Z2U A;  3CYN A;  5LNK e;  1EV4 A;  5CNW A;  1EP7 A;  3GUR A;  4ISD A;  3H4K A;  6GSV A;  3GYK A;  2FA4 A;  1PA3 A;  3TJK A;  3KZQ A;  2OAD A;  4ML1 A;  5GAP D;  2GZY A;  1DE1 A;  4QL9 A;  2LQO A;  2EIO A;  2HXK A;  4OO5 A;  4PUR A;  4PQH A;  3ZFB A;  1TKD B;  4QQ7 A;  5D8I A;  4EC0 A;  3HCZ A;  2CZ3 A;  3E0U A;  1YJ6 A;  4ZL8 A;  2C0F A;  1GNW A;  1SU9 A;  5G1K A;  1A2M A;  3I9V 2;  1FW1 A;  2FUG 2;  2VD1 A;  2JZR A;  2GGT A;  3QCP A;  4K2X A;  1SD9 A;  2KP1 A;  5DDL A;  5LD0 A;  1M7T A;  4G0K A;  1O85 A;  3Q6O A;  2LEG A;  2E2G A;  4ZBB A;  1MEK A;  2IFQ B;  4TRX A;  4RQX A;  2IL3 A;  2WJU A;  2VCX A;  1EEJ A;  5ECL B;  1VF2 A;  4X1U A;  4YH2 A;  3GL3 A;  2OAC A;  3EMP A;  1V40 A;  5AIX A;  2HT9 A;  1FO5 A;  1CQG A;  5B8B A;  3TKR A;  1K0D A;  2YCD A;  5IO2 A;  2B6M A;  4MJA A;  3KEB A;  2VLU A;  3F6D A;  1Q4J A;  1K3Y A;  5E4W A;  3VWX A;  3KM6 A;  1W89 A;  1VGL A;  4MH3 A;  2IFQ A;  2NDO A;  1IYI A;  5JWR B;  1X0R A;  3MSZ A;  5HFK A;  3WT1 A;  4X4J A;  5J9B A;  1DBY A;  1E2Y A;  3MAK A;  5BMU A;  2IIY A;  1GSD A;  2R6K A;  4AJ6 A;  1V98 A;  1YDK A;  2YV7 A;  2TRX A;  2V32 A;  4BL7 A;  3BD2 A;  2HRN A;  2I81 A;  2O8V B;  4OFT A;  4ICY A;  2A4H A;  3L78 A;  4MCU A;  4ZB9 A;  5D9T A;  4TXO B;  1HQO A;  2WB9 A;  3CRU A;  1J08 A;  2A2P A;  1GP1 A;  4NV2 A;  2KP2 A;  2DKI A;  3FR9 A;  3KH7 A;  3LQ7 A;  2B5Y A;  2BTO T;  4GRF A;  5ID2 B;  3LG6 A;  2GSQ A;  3WGD A;  1AW9 A;  3TJF A;  2H73 A;  3VWU A;  4F82 A;  4H86 A;  4O92 A;  2NPB A;  3IHG A;  4KB3 A;  1X5D A;  5EY6 A;  5HFI A;  1UN2 A;  2VCV A;  1XXU A;  4HU7 A;  1NSW A;  4ZBD A;  1XWG A;  2H0H A;  1G7O A;  4HI7 A;  1OC8 A;  1EP8 A;  3KH9 A;  3L9U A;  2ON7 A;  2RM6 A;  2TIR A;  5IOX A;  1T7P B;  4WF4 A;  4KW6 A;  3HVN A;  1T3B A;  1YF0 A;  4I2T A;  2AAW A;  4PGT A;  2MMZ A;  5G30 A;  4IHU A;  5E59 A;  2YOI A;  5HR0 A;  1FHE A;  5DCH A;  1M3J A;  3CMI A;  3TRQ A;  3LFL A;  5IMA A;  2OBI A;  5ID2 A;  5G5F A;  3P8W A;  1B9X C;  1K0O A;  5HQP A;  3H79 A;  2PER A;  2M72 A;  4POM A;  3BBY A;  3GSS A;  4Z2T A;  1GTA A;  3EUR A;  1T8E B;  1XW6 A;  1HYU A;  2LKU A;  3IE3 A;  4EF0 A;  5HFG A;  1GSQ A;  1TK0 B;  3IA1 A;  4PXO A;  3FZ9 A;  3G7Y A;  3O76 A;  2NTO A;  3A2V A;  3GUS A;  1MDJ A;  1A8L A;  5F0G A;  1PL2 A;  4IKH A;  5EVO A;  1SK1 A;  2PPT A;  4XHM A;  1OE8 A;  4USS A;  2EC4 A;  3RPN A;  3TDG A;  2OA7 A;  5G1L A;  3CQF A;  4FIW A;  2WFC A;  2GST A;  4MK3 A;  2YV9 A;  1JLW A;  1FG4 A;  3GKK A;  1EGO A;  3R2Q A;  2NBS A;  2GLR A;  4PTS A;  3FZ4 A;  3ZZX A;  4NXI A;  5ECM B;  2DJ1 A;  1GTI A;  2CA8 A;  2LNS A;  3O3T A;  1PQN A;  3E3E A;  1C72 A;  2WCI A;  3R3E A;  3SWL A;  4ZB6 A;  3Q74 A;  4XRD A;  1G0T A;  1QFN A;  4K2D A;  1BYE A;  2H19 A;  1NM3 A;  2YP6 A;  4NHZ A;  4WBR D;  2CX4 A;  4CY8 A;  2DLX A;  2H6Z A;  1FVJ A;  2JSY A;  2LJK A;  1K0N A;  1OE7 A;  4G0L A;  4F0B A;  1THX A;  6GST A;  2I1U A;  2PBJ A;  4MMM A;  1O7U A;  2O89 A;  2FWE A;  5DAL B;  2VL2 A;  5A4U A;  5H5Q A;  1GL8 A;  1V2A A;  4FYC A;  4IS0 A;  3CSH A;  4GQF A;  4BVY B;  2IPA A;  2YN1 A;  3EU3 A;  2L6D A;  3EE2 A;  1ZYE A;  1FOV A;  3F6F A;  2RUE A;  1W4V A;  1WE0 A;  3WGE A;  4EL1 A;  4BA7 A;  1XCC A;  5GSS A;  3GV1 A;  2H74 A;  5GZZ B;  2CAI A;  1O6J A;  4CW9 A;  5D93 A;  3H1N A;  1AQW A;  5ECR B;  3UBK A;  5DAL A;  2QA2 A;  1M2A A;  4K9Z A;  1TK5 B;  4ILF A;  2P5Q A;  4OMV A;  2FA8 A;  3W8S A;  2A4V A;  1CQH A;  1F3B A;  2HSY A;  3LOR A;  3VI5 A;  4BVY A;  4XS1 A;  1TTZ A;  4WR5 A;  5KEJ A;  2GSR A;  5J9C A;  1A23 A;  3MIX A;  1RK4 A;  1UA5 A;  4KX4 A;  4OFN A;  1N8J A;  4ZXG A;  19GS A;  22GS A;  2BMX A;  4N11 A;  2V1M A;  4GXZ A;  5GST A;  4ZBA A;  3FHK A;  3FY7 A;  4HJ2 A;  4K8M A;  1T1V A;  2LQQ A;  4RUV A;  1DUG A;  1XIY A;  2FWH A;  4EDZ A;  3EU4 A;  2QKE A;  4IW9 A;  3TKQ A;  5A5K A;  1TI1 A;  1GUH A;  3D6I A;  5G5E A;  4FO5 A;  4MJC A;  3HDC A;  1EV9 A;  2FY6 A;  2YZU A;  2L4C A;  4K6X A;  1Z3E A;  2GS3 A;  4KA0 A;  3HKR A;  1XBS A;  3FK8 A;  5KN3 A;  2VCQ A;  3FZA A;  2R0G A;  4G10 A;  5B7C A;  2B7J A;  2I3Y A;  4L0U A;  3GA4 A;  1M2B A;  5CP1 A;  2B1L A;  2YPM A;  1R7H A;  3ZVJ D;  1ACV A;  2P0G A;  2P5R A;  3FRC A;  4XS6 A;  4AGS A;  3DD3 A;  3VWW A;  5IM9 A;  4HQZ A;  3VK9 A;  5H5R A;  1VF4 A;  1QQ2 A;  3NIV A;  1U3A A;  4TW5 A;  10GS A;  1M3I A;  1USB A;  1A0F A;  4MJE A;  2C80 A;  2C0E A;  4ECB A;  1F3A A;  4POK A;  2A2S A;  3PGT A;  4PUF C;  2H1B A;  5CRH A;  5DVB A;  1QMV A;  2HLS A;  3KD0 A;  3ZRD A;  3LYK A;  1U87 A;  3ZTL A;  3L9S A;  4EIQ A;  1Z9H A;  4Q5Q A;  3LEF A;  4IQ1 A;  1A2L A;  3GRX A;  3IAM 2;  3HZ8 A;  1F9M A;  5F06 A;  4MPF A;  2K8V A;  1NHY A;  1GNE A;  1OKT A;  3EYT A;  3GKX A;  3DYR A;  1ZYN A;  4TOP A;  3A5I A;  3GX0 A;  2EIR A;  1SEN A;  4KDU A;  4ZIJ A;  1URM A;  3D21 A;  4N10 A;  3M1G A;  1K0A A;  4POL A;  2JL4 A;  4XS4 B;  5KOW A;  1S3A A;  1KBN A;  1K0B A;  1JZD A;  1XW5 A;  2KUC A;  5J3R A;  5C04 A;  2YNX A;  4ZIL A;  2V6O A;  2H70 A;  2GQM A;  5FHI A;  2B1K A;  2FLS A;  1HD2 A;  3MYD A;  3TOU A;  1UVZ A;  4AJ8 A;  3D4T A;  1OKD A;  2B3S A;  1GUL A;  3D0Z A;  2H01 A;  5J4U A;  4PNF A;  1ZCP A;  4D73 B;  2HRK A;  3G9B A;  2HSM A;  1ON4 A;  3GST A;  20GS A;  2B5X A;  2VLT A;  3JCM L;  1HNB A;  4JRR A;  1HNC A;  4IJ3 A;  3F63 A;  4XS4 A;  4DEJ A;  3HVX A;  5IMV A;  2AJQ B;  3FEU A;  1ZGN A;  1ZOF A;  1ZZY A;  2GSS A;  1WP0 A;  1B4P A;  3FZ5 A;  3P90 A;  3A5W A;  2C4J A;  4GLT A;  4NHW A;  2LRN A;  4L8E A;  4G9H A;  2JZS A;  4GST A;  1V58 A;  4D73 A;  5B6N A;  4KE3 A;  1X9W B;  2VCW A;  1ERT A;  1BJX A;  2E0Q A;  4KAE A;  2CT6 A;  4HEA 2;  3F4T A;  4KGI A;  3ZRE A;  4AF2 A;  1J9B A;  1BED A;  1TRV A;  4ZL9 A;  3U6V A;  4PX1 A;  3IDV A;  4OO4 A;  4IP6 A;  4KUN A;  5ECK B;  3KP9 A;  2ZCT A;  1Z7R A;  4V1A p;  2IMK A;  3DVX A;  1YZX A;  2PMT A;  4KND A;  5J5N A;  4MAB A;  1MDK A;  1MD4 A;  1Y25 A;  4QL7 A;  4F9Z A;  3MNG A;  4MPG A;  1K0M A;  2KOK A;  1SD8 A;  3TKS A;  1SKS B;  3QMX A;  3CSI A;  1PN9 A;  2KLX A;  4TXV A;  2L4Q A;  1OC9 B;  3F3R A;  1Z6M A;  1OC3 A;  2VM2 A;  4TN8 A;  4MA9 A;  4LL1 B;  3ERF A;  4K7N A;  5KN0 A;  1TW9 A;  3J7Y b;  1WOU A;  5FWG A;  4PUA A;  3RHC A;  2K18 A;  3AY8 A;  2H0I A;  2WS2 A;  1X9M B;  1SYR A;  2DIZ A;  2CVB A;  4IQA A;  2CX3 A;  3DIE A;  2VLV A;  3HYP A;  4MF5 A;  1WPI A;  1XW9 A;  2FHE A;  2NVL A;  2F9S A;  3VPQ A;  3GH9 A;  3TRX A;  3MDK A;  5ABR A;  1PKW A;  5CRD A;  3GIX A;  1QXH A;  3DML A;  2MBS A;  4KCA A;  1B48 A;  2O87 A;  3FKF A;  4MZW A;  3C8E A;  2YJH A;  1AQX A;  1F37 A;  2WUL A;  4X43 A;  1U6T A;  1XOB A;  1JLV A;  2RII A;  4MH2 A;  1M9A A;  4AJ7 A;  2K6V A;  3ZML A;  4GQC A;  5IMZ A;  1ILO A;  2OE1 A;  3IOS A;  4TXO A;  4G0I A;  2ZNM A;  1EWX A;  4ZL7 A;  2JAD A;  5J41 A;  4I6X A;  4YQV A;  2IME A;  3C7M A;  2VIM A;  3LSZ A;  1O8W A;  4NAX A;  5A4V A;  4WBJ A;  5IO0 A;  4WKW A;  2DJ0 A;  3TB2 A;  2QA1 A;  2LV3 A;  1SJI A;  2X64 A;  2WRT A;  2FWG A;  3O6T A;  2UZ8 A;  4EVM A;  3FYG A;  2IMI A;  1GSU A;  1Z5Y E;  3L9V A;  1K3O A;  5IQY A;  3LJR A;  2XBI A;  3F9U A;  5G31 A;  4O7H A;  4TVE A;  3GN3 A;  1XZO A;  3BCK A;  1Z6N A;  4X0X A;  5DJL A;  4EXJ A;  4FQU A;  3DVW A;  3N9J A;  5IPG A;  4TKY A;  3ERG A;  1GSF A;  4BIK A;  3UJ1 A;  3ZLP A;  1PL1 A;  3WD6 A;  6GSW A;  4HDE A;  5ECQ B;  3DKS A;  3DXB A;  3GX8 A;  4LLR A;  5B8A A;  2IMF A;  2LJR A;  3IR4 A;  4PQ1 A;  3BCI A;  2MMO A;  5DQS A;  1SJ6 A;  3LWA A;  4EUY A;  5HR1 A;  2VL2 C;  2CQ9 A;  1VRS D;  3LYP A;  3VLN A;  6GSS A;  1IYH A;  1S3D A;  2AHE A;  3C73 A;  2BJX A;  4G2E A;  3FMW A;  3UIW A;  2VO4 A;  4JR4 A;  1TK8 B;  3DEX A;  4ECI A;  4RI6 A;  1F2E A;  4J57 E;  1XWK A;  2HYX A;  2DJJ A;  4L5L A;  3M0F A;  1G6W A;  1OVN A;  4CY6 A;  5DCG A;  1AXD A;  1RQM A;  1XWB A;  1M0U A;  3KCM A;  4CDO A;  1ZYQ B;  1FAA A;  2VAF A;  3IHQ A;  3KMO A;  4MJB A;  4K1F A;  2XBQ A;  4J56 E;  1VF3 A;  1T00 A;  1PGT A;  1A8Y A;  3PPU A;  3APO A;  2DJ3 A;  3QAG A;  4ML6 A;  4TR4 A;  1AIU A;  4ECC A;  4ECJ A;  3CRT A;  3GHA A;  2FGX A;  3IXR A;  3F4R A;  4E8E A;  4PQI A;  5JCU A;  1YQ1 A;  2GQL A;  4RI7 A;  1NHO A;  5GAN D;  5DAK B;  3ZVJ A;  3IC4 A;  3ZIV A;  3A2X A;  4KH7 A;  2K9F A;  3QDN A;  3ZYW A;  1X5E A;  1A0R P;  2DML A;  4V1A g;  1A24 A;  4ZB8 A;  2V6K A;  3UEM A;  2ON5 A;  1LU4 A;  2FWF A;  3GTU B;  5BRT A;  3D5J A;  2DKH A;  4OCF A;  2H72 A;  18GS A;  3C1S A;  5F8B A;  1A2J A;  2HI7 A;  2GQK A;  3HD5 A;  5CRG A;  3IPZ A;  1JZR A;  4BPY A;  4MZC A;  3M9J A;  1TU7 A;  12GS A;  1SK2 A;  3VWV A;  5D9X A;  2PN8 A;  3BJ5 A;  1U3I A;  4NWY A;  2I9H A;  3PIN A;  1KTE A;  3ZIT A;  2XHF A;  5A4W A;  2MZC A;  2H71 A;  1V9W A;  4FYU A;  4YKF A;  2RLI A;  4IBP A;  3E9J B;  4LL4 B;  2REM A;  3GTU A;  3H93 A;  5HR3 A;  4FH8 A;  1WWJ A;  1U88 A;  3ME7 A;  3VFI A;  4GCI A;  3HJO A;  2LNT A;  4K5R A;  2VCT A;  4HZ2 A;  2VUP A;  3GH6 A;  3M9K A;  4YQM A;  4IJI A;  3TCO A;  3MWH A;  3P2A A;  4ULX A;  5KN1 A;  4IGJ A;  1LJR A;  4LMV A;  1H4O A;  4DSS B;  1GLQ A;  4HUA A;  2GZZ A;  3ISO A;  3UAR A;  3EWL A;  3G7J A;  4F03 A;  3EC3 A;  1GSE A;  3HA9 A;  4XCS A;  2R5G A;  1ML6 A;  1TXX A;  2X8H A;  1PD2 1;  2H0G A;  5ECS A;  5ECI B;  5AGY A;  4O32 A;  4IEL A;  4HOJ A;  2OE3 A;  4TR1 B;  5DQY A;  1XFL A;  3L4N A;  2R0P A;  2KHP A;  1T4Z A;  4KDY A;  2JU5 A;  4YAP A;  1ABA A;  2WZ9 A;  2DIY A;  5IMC A;  3IV4 A;  3CSJ A;  4DSS A;  3GKN A;  4HJM A;  2WDU A;  2M46 A;  3KGK A;  4JZQ A;  3ZMK A;  3APQ A;  4I5Q A; 
#chains in the Genus database with same CATH homology
 2QSI A;  2PU9 C;  3FR6 A;  3VPT A;  2O7K A;  1GSS A;  3D22 A;  1R4W A;  4Q5R A;  1ST9 A;  2LST A;  4J2F A;  2CAQ A;  2L5O A;  4K0G A;  3W6G A;  1MD3 A;  4N0V A;  2VCZ A;  2MMA A;  4K7O A;  1NW2 A;  1UC7 A;  3KMN A;  4PNG A;  2TRC P;  2VM1 A;  4TR1 A;  3A2W A;  3KJY A;  4I8B A;  3ZFL A;  1JHB A;  4Z7X A;  4IVF A;  5F05 A;  3K8N A;  2DJ2 A;  5CAX A;  1OAZ A;  1PX6 A;  1SL1 B;  1WMJ A;  14GS A;  3G7I A;  2CV4 A;  2DBC A;  2CVK A;  4OWY A;  1TDI A;  3TJG A;  4FYB A;  3KIJ A;  4GSN A;  3KP8 A;  4ID0 A;  5DBQ A;  3QAW A;  4O5R A;  3DGQ A;  3TJB A;  1M9B A;  1OYJ A;  4G19 A;  1O81 A;  3GKM A;  4HS1 A;  5ENU A;  3F3Q A;  1ERU A;  2X49 A;  1XPV A;  1B9Y C;  1AAZ A;  2L59 A;  4HU9 A;  4KF9 A;  2HRA A;  2FCH A;  2HRF A;  1AUC A;  3GL5 A;  3IC8 A;  4DSR A;  2H76 A;  1SJZ A;  5EL8 A;  3EMX A;  4NMU A;  1AC1 A;  4EDY A;  4MP4 A;  2JSZ A;  2OE0 A;  1SKR B;  4WEY A;  4K7I A;  2YWN A;  1BAY A;  2R3X A;  5B6M A;  1MTC A;  4GWR A;  3M3M A;  1AQV A;  3A3T A;  1PX7 A;  2DC5 A;  2V2G A;  3TKS C;  3UL3 A;  1VF1 A;  2GZP A;  2HZF A;  1LBK A;  4BVX B;  2K8S A;  4BWQ A;  2HZE B;  6GSU A;  2VL3 A;  2LS5 A;  1B8X A;  1V57 A;  2L57 A;  2P31 A;  5JCG A;  17GS A;  9GSS A;  1E6B A;  1PKZ A;  2LTK A;  1FOH A;  3EIN A;  4EIP A;  1PMT A;  4KSM A;  2YAN A;  4O5U A;  3EPT A;  1XOA A;  3GFK A;  2G2Q A;  1YEX A;  4XTS A;  2OBK A;  3ERW A;  5F07 A;  2H30 A;  1GSY A;  1SL2 B;  3U5R E;  3BOA A;  5JCW A;  1SL0 B;  2GVP A;  11GS A;  2YWM A;  3QOU A;  4BVX A;  6GSX A;  3TKP A;  2HZE A;  3OR5 A;  3Q19 A;  2C3N A;  1GWC A;  3FW2 A;  2X4A A;  2L5L A;  4V2L A;  3RHB A;  4BL7 B;  5D9V A;  4OD7 A;  1X9S B;  3I69 A;  4MNN A;  5H5S A;  3HXS A;  4O5Q A;  2N5F A;  1PN0 A;  1BX9 A;  4L0W A;  5IMD A;  4MF6 A;  3IBH A;  1FVK A;  2H6X A;  4KCE A;  3W8J A;  2H8L A;  5IOW A;  5D9W A;  3D4M A;  2QC7 A;  2R0C A;  1R5A A;  1TU8 A;  2YWI A;  3LXZ A;  4WXT A;  2OKA A;  1OC9 A;  1X5C A;  5G2Z A;  2CVD A;  3ZIJ A;  2C0G A;  4N0Z A;  4GF0 A;  4HZ4 A;  1K0C A;  4E8H A;  4DVC A;  1SYX A;  2JAC A;  3PR8 A;  3RBT A;  5ECH B;  1PSQ A;  1M2D A;  1MDI A;  1EGR A;  3TRP A;  2MYG A;  5IIZ A;  2R4V A;  1TRS A;  2VOC A;  1TJD A;  3RAZ A;  3TKS E;  2MBT A;  1N2A A;  1WJK A;  5COH A;  3CTF A;  3P7X A;  1G6Y A;  4I2U A;  4JBB A;  3US3 A;  3KTB A;  1GLP A;  2B7K A;  3N5O A;  4LA1 A;  2H1A A;  1YY7 A;  2X8G A;  2D2Z A;  1YKC A;  2L6C A;  3F4S A;  2DSA A;  2GT6 A;  2YJ7 A;  2DJK A;  3DWV A;  3VUR A;  2Z9S A;  1O73 A;  3GMF A;  2LRC A;  4XIH A;  2H1D A;  1WIK A;  1I5G A;  3NZN A;  5CYY A;  2QGV A;  3KXO A;  1QK8 A;  3UMA A;  2B5E A;  3ME8 A;  1O8X A;  3UAP A;  5CRW A;  1FB0 A;  2C3Q A;  5ELG A;  2OJL A;  1DE2 A;  3HVS A;  3F0I A;  4EE0 A;  1YEP A;  3HVV A;  3UVH A;  1KNG A;  2FNO A;  1GTB A;  1T4Y A;  6GSY A;  4V2M A;  3LGC A;  3TOT A;  1Q98 A;  1JZO A;  3C1R A;  8GSS A;  1KEB A;  2VD0 A;  2IWT A;  1XWC A;  5KN2 A;  4JED A;  1S3C A;  2MMN A;  4MLY A;  4IN0 A;  2XC2 A;  3GNJ A;  4TR3 A;  3NOF A;  2GT5 A;  5AIV A;  1TI3 A;  3LXT A;  2IN3 A;  2PVQ A;  1K3L A;  1BG5 A;  2FD3 A;  3I43 A;  1SK0 A;  3M8N A;  3IAS 2;  4GSS A;  4KDX A;  1GRX A;  5JWO B;  4JE1 A;  3RDW A;  2C0D A;  3CXG A;  1SKW B;  3DRN A;  2HFD A;  2R37 A;  1ZL9 A;  3HJP A;  4V2N A;  3UBL A;  5CRE A;  1GTU A;  2LUS A;  2N5A A;  4LMW A;  3ZL5 A;  2PGT A;  4K0N A;  1TOF A;  2I4A A;  3KTL A;  1H75 A;  3APS A;  4POB A;  5EPF A;  4JU5 A;  1F6M C;  4TR0 A;  3QFA C;  3CBU A;  1THO A;  4Z2R A;  1EZK A;  1HNA A;  2XPE A;  4K5S A;  2J23 A;  1TRW A;  2VL9 A;  2F8A A;  2HNL A;  4MF7 A;  4A5P A;  2DMM A;  1JZW A;  3IRA A;  4KSO A;  4WF5 A;  7GSS A;  3LW9 A;  5C00 A;  3H8Q A;  3WT2 A;  3QFB C;  2E7P A;  2C3T A;  4DSQ A;  2XPD A;  2YZH A;  2PWJ A;  3FR3 A;  3UOM A;  3S9F A;  4JR6 A;  4WET A;  2WGR A;  1PRX A;  5CO3 A;  5DJM A;  2O85 A;  1XWA A;  2AV4 A;  2J9H A;  3IK9 A;  3HJM A;  4MDC A;  5L71 A;  1Z7P A;  2R2J A;  3QD9 A;  3V1W A;  4P3Y B;  4F2I A;  3J7Y k;  5ELA A;  2A2R A;  5AIS A;  2V41 A;  4F0C A;  2C8U A;  5DAK A;  5KOX A;  5AN1 A;  3HY2 A;  4Q5N A;  2AUV A;  3HHV A;  2F3M A;  1GUM A;  4NV5 A;  2H1G A;  5JWQ B;  2IJY A;  3SBC A;  1I9D A;  3TJJ A;  2RM5 A;  16GS A;  3VI7 A;  4L5O A;  1TRU A;  4XRA A;  3TUE A;  1YKA A;  4EKZ A;  5HR2 A;  5D96 A;  3UVT A;  1GUK A;  1ZYP A;  3EVI A;  3PH9 A;  2IMD A;  3TGZ A;  1WRY A;  3IK7 A;  1FB6 A;  3F8U A;  13GS A;  4EO3 A;  3C71 A;  1Y6E A;  2F51 A;  4YQU A;  1J0F A;  1XVW A;  2YWO A;  2M80 A;  3WYW A;  5IMF A;  1DSB A;  3QR6 A;  2PUK C;  4Q5F A;  2AYT A;  1TP9 A;  4N30 A;  4I97 A;  1YF1 A;  1EOH A;  1G7E A;  1ZMA A;  2PVO C;  2AB6 A;  3ED3 A;  5ECO B;  2CZ2 A;  5FT3 A;  2EIQ A;  1RW1 A;  1XVQ A;  2X99 A;  4YAV A;  4CHS A;  1B4Q A;  2RUF A;  4OFM A;  4BWS A;  4IP1 A;  1QUW A;  2H66 A;  1BQ7 A;  2HE3 A;  3QAV A;  2ZUP A;  1M99 A;  2ALB A;  1GH2 A;  2X8C A;  2H75 A;  1EOG A;  2N5B A;  2C1Y A;  2F8F A;  1QGV A;  4NPB A;  5INY A;  4RQR A;  2H6Y A;  3L0H A;  2LJA A;  3WGX A;  1EEM A;  1ERV A;  3CTG A;  3QPM A;  4GTU A;  1R26 A;  2HSH A;  5LCZ A;  1JFU A;  2GDR A;  2G0F A;  4WR4 A;  5ECP B;  5IPH A;  2ES7 A;  1ERW A;  5ECN B;  2GTU A;  3I6A A;  3Q18 A;  3RPP A;  2LRT A;  1R5P A;  5D73 A;  4MZB A;  4ACS A;  4OCE A;  2JZT A;  4HQS A;  4YKG A;  3HZ4 A;  2E2M A;  4Z2U A;  3CYN A;  5LNK e;  1EV4 A;  5CNW A;  1EP7 A;  3GUR A;  4ISD A;  3H4K A;  6GSV A;  3GYK A;  2FA4 A;  1PA3 A;  3TJK A;  3KZQ A;  2OAD A;  4ML1 A;  5GAP D;  2GZY A;  1DE1 A;  4QL9 A;  2LQO A;  2EIO A;  2HXK A;  4OO5 A;  4PUR A;  4PQH A;  3ZFB A;  1TKD B;  4QQ7 A;  5D8I A;  4EC0 A;  3HCZ A;  2CZ3 A;  3E0U A;  1YJ6 A;  4ZL8 A;  2C0F A;  1GNW A;  1SU9 A;  5G1K A;  1A2M A;  3I9V 2;  1FW1 A;  2FUG 2;  2VD1 A;  2JZR A;  2GGT A;  3QCP A;  4K2X A;  1SD9 A;  2KP1 A;  5DDL A;  5LD0 A;  1M7T A;  4G0K A;  1O85 A;  3Q6O A;  2LEG A;  2E2G A;  4ZBB A;  1MEK A;  2IFQ B;  4TRX A;  4RQX A;  2IL3 A;  2WJU A;  2VCX A;  1EEJ A;  5ECL B;  1VF2 A;  4X1U A;  4YH2 A;  3GL3 A;  2OAC A;  3EMP A;  1V40 A;  5AIX A;  2HT9 A;  1FO5 A;  1CQG A;  5B8B A;  3TKR A;  1K0D A;  2YCD A;  5IO2 A;  2B6M A;  4MJA A;  3KEB A;  2VLU A;  3F6D A;  1Q4J A;  1K3Y A;  5E4W A;  3VWX A;  3KM6 A;  1W89 A;  1VGL A;  4MH3 A;  2IFQ A;  2NDO A;  1IYI A;  5JWR B;  1X0R A;  3MSZ A;  5HFK A;  3WT1 A;  4X4J A;  5J9B A;  1DBY A;  1E2Y A;  3MAK A;  5BMU A;  2IIY A;  1GSD A;  2R6K A;  4AJ6 A;  1V98 A;  1YDK A;  2YV7 A;  2TRX A;  2V32 A;  4BL7 A;  3BD2 A;  2HRN A;  2I81 A;  2O8V B;  4OFT A;  4ICY A;  2A4H A;  3L78 A;  4MCU A;  4ZB9 A;  5D9T A;  4TXO B;  1HQO A;  2WB9 A;  3CRU A;  1J08 A;  2A2P A;  1GP1 A;  4NV2 A;  2KP2 A;  2DKI A;  3FR9 A;  3KH7 A;  3LQ7 A;  2B5Y A;  2BTO T;  4GRF A;  5ID2 B;  3LG6 A;  2GSQ A;  3WGD A;  1AW9 A;  3TJF A;  2H73 A;  3VWU A;  4F82 A;  4H86 A;  4O92 A;  2NPB A;  3IHG A;  4KB3 A;  1X5D A;  5EY6 A;  5HFI A;  1UN2 A;  2VCV A;  1XXU A;  4HU7 A;  1NSW A;  4ZBD A;  1XWG A;  2H0H A;  1G7O A;  4HI7 A;  1OC8 A;  1EP8 A;  3KH9 A;  3L9U A;  2ON7 A;  2RM6 A;  2TIR A;  5IOX A;  1T7P B;  4WF4 A;  4KW6 A;  1T3B A;  1YF0 A;  4I2T A;  2AAW A;  4PGT A;  2MMZ A;  5G30 A;  4IHU A;  5E59 A;  2YOI A;  5HR0 A;  1FHE A;  5DCH A;  3CMI A;  3TRQ A;  3LFL A;  5IMA A;  2OBI A;  5ID2 A;  5G5F A;  3P8W A;  1B9X C;  1K0O A;  5HQP A;  3H79 A;  2PER A;  2M72 A;  4POM A;  3BBY A;  3GSS A;  4Z2T A;  1GTA A;  3EUR A;  1T8E B;  1XW6 A;  1HYU A;  2LKU A;  3IE3 A;  4EF0 A;  5HFG A;  1GSQ A;  1TK0 B;  3IA1 A;  4PXO A;  3FZ9 A;  3G7Y A;  3O76 A;  2NTO A;  3A2V A;  3GUS A;  1MDJ A;  1A8L A;  5F0G A;  1PL2 A;  4IKH A;  5EVO A;  1SK1 A;  2PPT A;  4XHM A;  1OE8 A;  4USS A;  2EC4 A;  3RPN A;  3TDG A;  2OA7 A;  5G1L A;  4FIW A;  2WFC A;  2GST A;  4MK3 A;  2YV9 A;  1JLW A;  1FG4 A;  3GKK A;  1EGO A;  3R2Q A;  2NBS A;  2GLR A;  4PTS A;  3FZ4 A;  3ZZX A;  4NXI A;  5ECM B;  2DJ1 A;  1GTI A;  2CA8 A;  2LNS A;  3O3T A;  1PQN A;  3E3E A;  1C72 A;  2WCI A;  3R3E A;  3SWL A;  4ZB6 A;  3Q74 A;  4XRD A;  1G0T A;  1QFN A;  4K2D A;  1BYE A;  2H19 A;  1NM3 A;  2YP6 A;  4NHZ A;  4WBR D;  2CX4 A;  4CY8 A;  2DLX A;  2H6Z A;  1FVJ A;  2JSY A;  2LJK A;  1K0N A;  1OE7 A;  4G0L A;  4F0B A;  1THX A;  6GST A;  2I1U A;  2PBJ A;  4MMM A;  1O7U A;  2O89 A;  2FWE A;  5DAL B;  2VL2 A;  5A4U A;  5H5Q A;  1GL8 A;  1V2A A;  4FYC A;  4IS0 A;  3CSH A;  4GQF A;  4BVY B;  2IPA A;  2YN1 A;  3EU3 A;  2L6D A;  3EE2 A;  1ZYE A;  1FOV A;  3F6F A;  2RUE A;  1W4V A;  1WE0 A;  3WGE A;  4EL1 A;  4BA7 A;  1XCC A;  5GSS A;  3GV1 A;  2H74 A;  5GZZ B;  2CAI A;  1O6J A;  4CW9 A;  5D93 A;  3H1N A;  1AQW A;  5ECR B;  3UBK A;  5DAL A;  2QA2 A;  1M2A A;  4K9Z A;  1TK5 B;  4ILF A;  2P5Q A;  4OMV A;  2FA8 A;  3W8S A;  2A4V A;  1CQH A;  1F3B A;  2HSY A;  3LOR A;  3VI5 A;  4BVY A;  4XS1 A;  1TTZ A;  4WR5 A;  5KEJ A;  2GSR A;  5J9C A;  1A23 A;  3MIX A;  1RK4 A;  1UA5 A;  4KX4 A;  4OFN A;  1N8J A;  4ZXG A;  19GS A;  22GS A;  2BMX A;  4N11 A;  2V1M A;  4GXZ A;  5GST A;  4ZBA A;  3FHK A;  3FY7 A;  4HJ2 A;  4K8M A;  1T1V A;  2LQQ A;  4RUV A;  1DUG A;  1XIY A;  2FWH A;  4EDZ A;  3EU4 A;  2QKE A;  4IW9 A;  3TKQ A;  5A5K A;  1TI1 A;  1GUH A;  3D6I A;  5G5E A;  4FO5 A;  4MJC A;  3HDC A;  1EV9 A;  2FY6 A;  2YZU A;  2L4C A;  4K6X A;  1Z3E A;  2GS3 A;  4KA0 A;  3HKR A;  1XBS A;  3FK8 A;  5KN3 A;  2VCQ A;  3FZA A;  2R0G A;  4G10 A;  5B7C A;  2B7J A;  2I3Y A;  4L0U A;  3GA4 A;  1M2B A;  5CP1 A;  2B1L A;  2YPM A;  1R7H A;  3ZVJ D;  1ACV A;  2P0G A;  2P5R A;  3FRC A;  4XS6 A;  4AGS A;  3DD3 A;  3VWW A;  5IM9 A;  4HQZ A;  3VK9 A;  5H5R A;  1VF4 A;  1QQ2 A;  3NIV A;  1U3A A;  4TW5 A;  10GS A;  1USB A;  1A0F A;  4MJE A;  2C80 A;  2C0E A;  4ECB A;  1F3A A;  4POK A;  2A2S A;  3PGT A;  4PUF C;  2H1B A;  5CRH A;  5DVB A;  1QMV A;  2HLS A;  3KD0 A;  3ZRD A;  3LYK A;  1U87 A;  3ZTL A;  3L9S A;  4EIQ A;  1Z9H A;  4Q5Q A;  3LEF A;  4IQ1 A;  1A2L A;  3GRX A;  3IAM 2;  3HZ8 A;  1F9M A;  5F06 A;  4MPF A;  2K8V A;  1NHY A;  1GNE A;  1OKT A;  3EYT A;  3GKX A;  3DYR A;  1ZYN A;  4TOP A;  3A5I A;  3GX0 A;  2EIR A;  1SEN A;  4KDU A;  4ZIJ A;  1URM A;  3D21 A;  4N10 A;  3M1G A;  1K0A A;  4POL A;  2JL4 A;  4XS4 B;  5KOW A;  1S3A A;  1KBN A;  1K0B A;  1JZD A;  1XW5 A;  2KUC A;  5J3R A;  5C04 A;  2YNX A;  4ZIL A;  2V6O A;  2H70 A;  2GQM A;  5FHI A;  2B1K A;  2FLS A;  1HD2 A;  3MYD A;  3TOU A;  1UVZ A;  4AJ8 A;  3D4T A;  1OKD A;  2B3S A;  1GUL A;  3D0Z A;  2H01 A;  5J4U A;  4PNF A;  1ZCP A;  4D73 B;  2HRK A;  3G9B A;  2HSM A;  1ON4 A;  3GST A;  20GS A;  2B5X A;  2VLT A;  3JCM L;  1HNB A;  4JRR A;  1HNC A;  4IJ3 A;  3F63 A;  4XS4 A;  4DEJ A;  3HVX A;  5IMV A;  2AJQ B;  3FEU A;  1ZGN A;  1ZOF A;  1ZZY A;  2GSS A;  1WP0 A;  1B4P A;  3FZ5 A;  3P90 A;  3A5W A;  2C4J A;  4GLT A;  4NHW A;  2LRN A;  4L8E A;  4G9H A;  2JZS A;  4GST A;  1V58 A;  4D73 A;  5B6N A;  4KE3 A;  1X9W B;  2VCW A;  1ERT A;  1BJX A;  2E0Q A;  4KAE A;  2CT6 A;  4HEA 2;  3F4T A;  4KGI A;  3ZRE A;  4AF2 A;  1J9B A;  1BED A;  1TRV A;  4ZL9 A;  3U6V A;  4PX1 A;  3IDV A;  4OO4 A;  4IP6 A;  4KUN A;  5ECK B;  3KP9 A;  2ZCT A;  1Z7R A;  4V1A p;  2IMK A;  3DVX A;  1YZX A;  2PMT A;  4KND A;  5J5N A;  4MAB A;  1MDK A;  1MD4 A;  1Y25 A;  4QL7 A;  4F9Z A;  3MNG A;  4MPG A;  1K0M A;  2KOK A;  1SD8 A;  3TKS A;  1SKS B;  3QMX A;  3CSI A;  1PN9 A;  2KLX A;  4TXV A;  2L4Q A;  1OC9 B;  3F3R A;  1Z6M A;  1OC3 A;  2VM2 A;  4TN8 A;  4MA9 A;  4LL1 B;  3ERF A;  4K7N A;  5KN0 A;  1TW9 A;  3J7Y b;  1WOU A;  5FWG A;  4PUA A;  3RHC A;  2K18 A;  3AY8 A;  2H0I A;  2WS2 A;  1X9M B;  1SYR A;  2DIZ A;  2CVB A;  4IQA A;  2CX3 A;  3DIE A;  2VLV A;  3HYP A;  4MF5 A;  1WPI A;  1XW9 A;  2FHE A;  2NVL A;  2F9S A;  3VPQ A;  3GH9 A;  3TRX A;  3MDK A;  5ABR A;  1PKW A;  5CRD A;  3GIX A;  1QXH A;  3DML A;  2MBS A;  4KCA A;  1B48 A;  2O87 A;  3FKF A;  4MZW A;  3C8E A;  2YJH A;  1AQX A;  1F37 A;  2WUL A;  4X43 A;  1U6T A;  1XOB A;  1JLV A;  2RII A;  4MH2 A;  1M9A A;  4AJ7 A;  2K6V A;  3ZML A;  4GQC A;  5IMZ A;  1ILO A;  2OE1 A;  3IOS A;  4TXO A;  4G0I A;  2ZNM A;  1EWX A;  4ZL7 A;  2JAD A;  5J41 A;  4I6X A;  4YQV A;  2IME A;  3C7M A;  2VIM A;  3LSZ A;  1O8W A;  4NAX A;  5A4V A;  4WBJ A;  5IO0 A;  4WKW A;  2DJ0 A;  3TB2 A;  2QA1 A;  2LV3 A;  1SJI A;  2X64 A;  2WRT A;  2FWG A;  3O6T A;  2UZ8 A;  4EVM A;  3FYG A;  2IMI A;  1GSU A;  1Z5Y E;  3L9V A;  1K3O A;  5IQY A;  3LJR A;  2XBI A;  3F9U A;  5G31 A;  4O7H A;  4TVE A;  3GN3 A;  1XZO A;  3BCK A;  1Z6N A;  4X0X A;  5DJL A;  4EXJ A;  4FQU A;  3DVW A;  3N9J A;  5IPG A;  4TKY A;  3ERG A;  1GSF A;  3UJ1 A;  3ZLP A;  1PL1 A;  3WD6 A;  6GSW A;  4HDE A;  5ECQ B;  3DKS A;  3DXB A;  3GX8 A;  4LLR A;  5B8A A;  2IMF A;  2LJR A;  3IR4 A;  4PQ1 A;  3BCI A;  2MMO A;  5DQS A;  1SJ6 A;  3LWA A;  4EUY A;  5HR1 A;  2VL2 C;  2CQ9 A;  1VRS D;  3LYP A;  3VLN A;  6GSS A;  1IYH A;  1S3D A;  2AHE A;  3C73 A;  2BJX A;  4G2E A;  3FMW A;  3UIW A;  2VO4 A;  4JR4 A;  1TK8 B;  3DEX A;  4ECI A;  4RI6 A;  1F2E A;  4J57 E;  1XWK A;  2HYX A;  2DJJ A;  4L5L A;  3M0F A;  1G6W A;  1OVN A;  4CY6 A;  5DCG A;  1AXD A;  1RQM A;  1XWB A;  1M0U A;  3KCM A;  4CDO A;  1ZYQ B;  1FAA A;  2VAF A;  3IHQ A;  3KMO A;  4MJB A;  4K1F A;  2XBQ A;  4J56 E;  1VF3 A;  1T00 A;  1PGT A;  1A8Y A;  3PPU A;  3APO A;  2DJ3 A;  3QAG A;  4ML6 A;  4TR4 A;  1AIU A;  4ECC A;  4ECJ A;  3CRT A;  3GHA A;  2FGX A;  3IXR A;  3F4R A;  4E8E A;  4PQI A;  5JCU A;  1YQ1 A;  2GQL A;  4RI7 A;  1NHO A;  5GAN D;  5DAK B;  3ZVJ A;  3IC4 A;  3ZIV A;  3A2X A;  4KH7 A;  2K9F A;  3QDN A;  3ZYW A;  1X5E A;  1A0R P;  2DML A;  4V1A g;  1A24 A;  4ZB8 A;  2V6K A;  3UEM A;  2ON5 A;  1LU4 A;  2FWF A;  3GTU B;  5BRT A;  3D5J A;  2DKH A;  4OCF A;  2H72 A;  18GS A;  3C1S A;  5F8B A;  1A2J A;  2HI7 A;  2GQK A;  3HD5 A;  5CRG A;  3IPZ A;  1JZR A;  4BPY A;  4MZC A;  3M9J A;  1TU7 A;  12GS A;  1SK2 A;  3VWV A;  5D9X A;  2PN8 A;  3BJ5 A;  1U3I A;  4NWY A;  2I9H A;  3PIN A;  1KTE A;  3ZIT A;  2XHF A;  5A4W A;  2MZC A;  2H71 A;  1V9W A;  4FYU A;  4YKF A;  2RLI A;  4IBP A;  3E9J B;  4LL4 B;  2REM A;  3GTU A;  3H93 A;  5HR3 A;  4FH8 A;  1WWJ A;  1U88 A;  3ME7 A;  3VFI A;  4GCI A;  3HJO A;  2LNT A;  4K5R A;  2VCT A;  4HZ2 A;  2VUP A;  3GH6 A;  3M9K A;  4YQM A;  4IJI A;  3TCO A;  3MWH A;  3P2A A;  4ULX A;  5KN1 A;  4IGJ A;  1LJR A;  4LMV A;  1H4O A;  4DSS B;  1GLQ A;  4HUA A;  2GZZ A;  3ISO A;  3UAR A;  3EWL A;  3G7J A;  4F03 A;  3EC3 A;  1GSE A;  3HA9 A;  4XCS A;  2R5G A;  1ML6 A;  1TXX A;  2X8H A;  1PD2 1;  2H0G A;  5ECS A;  5ECI B;  5AGY A;  4O32 A;  4IEL A;  4HOJ A;  2OE3 A;  4TR1 B;  5DQY A;  1XFL A;  3L4N A;  2R0P A;  2KHP A;  1T4Z A;  4KDY A;  2JU5 A;  4YAP A;  1ABA A;  2WZ9 A;  2DIY A;  5IMC A;  3IV4 A;  3CSJ A;  4DSS A;  3GKN A;  4HJM A;  2WDU A;  2M46 A;  3KGK A;  4JZQ A;  3ZMK A;  3APQ A;  4I5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...