1SKSB

Binary 3' complex of t7 dna polymerase with a dna primer/template containing a cis-syn thymine dimer on the template
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*C*GP*GP*CP*CP*AP*GP*TP*GP*C
publication title Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase/electron transport/dna
total genus 27
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1sksB00
2J23A 4JEDA 3E9JB 2J9HA 1TK5B 3OR5A 1WIKA 1TRVA 5ECHB 2RM5A 3IR4A 3KD0A 2VLTA 3V1WA 3TKSA 2DLXA 2B5YA 2LUSA 4K9ZA 4KCAA 1Z6MA 3TJJA 1KTEA 2ON7A 3BJ5A 2WRTA 3TDGA 2VD1A 2WZ9A 4XHMA 4KW6A 5HFKA 2IFQA 2JZSA 1B48A 5HFIA 3VLNA 4JR4A 4KDUA 3I43A 3EU4A 3UOMA 4PUFC 2H1AA 5DQSA 4HEA2 1PD21 4TR4A 3LWAA 4I2UA 2MMNA 4OD7A 2TRCP 4IQAA 2AJQB 3CMIA 2QC7A 2VAFA 5ID2A 1M99A 1AQVA 2VOCA 4WETA 2ZUPA 4HQSA 5D73A 1Q98A 1O85A 4NXIA 2YN1A 4KGIA 3UIWA 5G1KA 2F9SA 2QGVA 1LU4A 2I81A 3A2WA 4E8EA 2H0GA 1EV9A 2B1LA 2L4QA 3J7Yb 1GSFA 5HFGA 1DE2A 5HR3A 2DJ2A 3I6AA 3IBHA 1OKDA 3A3TA 4J57E 2VCZA 3KTLA 3F4SA 1FB6A 1T4YA 3Q18A 3ZFLA 2FLSA 1OYJA 3KH9A 3E3EA 2DMLA 1OKTA 3W8SA 2V6OA 3DEXA 4ZIJA 4GSSA 4TXOA 2GTUA 3D21A 2L6DA 1ERWA 4BA7A 4NHWA 4XS4A 5B8BA 4NV2A 2HSYA 3IA1A 1PQNA 1K0AA 2M46A 3HCZA 2C0FA 4IQ1A 1OVNA 4ILFA 4KNDA 2GZYA 4DSSB 2C0DA 4ZL7A 2MYGA 1PMTA 1F2EA 1JZDA 3H79A 3EC3A 3HA9A 1J9BA 5ABRA 5J3RA 3D6IA 3IAS2 2JL4A 1ZGNA 3HZ8A 3O6TA 3EMPA 1GNWA 2A2RA 2LRCA 1QK8A 4IN0A 4EVMA 4MF6A 3IHQA 5EL8A 4MLYA 3HVXA 2LJKA 2WCIA 1A8YA 1XOBA 1E2YA 11GSA 2HSHA 2LKUA 4I5QA 3KH7A 2D2ZA 1XZOA 2DJJA 3GH9A 4MJCA 1VF3A 3ZMLA 3GKMA 1A2MA 4F2IA 3RPPA 1MD3A 3ZVJD 3KP8A 4H86A 1DE1A 1F9MA 1A24A 3FZ4A 4FYBA 3TCOA 1MDJA 1ERTA 2CQ9A 1SJZA 1TRSA 5J9CA 1BX9A 1A23A 2HI7A 1YQ1A 1MDIA 4F82A 2PU9C 3IRAA 2WB9A 5G30A 2FA4A 2BJXA 5E59A 3EURA 1TKDB 20GSA 1WWJA 1QUWA 2H76A 2LRTA 4WXTA 1X5CA 2P31A 1TRUA 3VWWA 1S3AA 2O87A 1PGTA 4AJ7A 4GTUA 4F0CA 2KUCA 4JZQA 2WDUA 2KP1A 1THOA 19GSA 3O3TA 3EWLA 3ZIJA 2DSAA 4TOPA 2I9HA 1GUMA 4I8BA 1PRXA 3LYKA 1GP1A 4HUAA 1B4PA 4NWYA 1NSWA 1WP0A 6GSUA 5HR1A 4TR3A 2C3NA 1FAAA 3HVSA 4FO5A 4XRDA 2B3SA 4MJBA 3LFLA 1WPIA 4X0XA 1K0OA 2JACA 1ST9A 4WEYA 4IHUA 4O92A 3NZNA 4V2MA 2LV3A 2CA8A 22GSA 1JZWA 1MD4A 5LCZA 3HJPA 2IMIA 2LJRA 4MA9A 1VF4A 2FGXA 5KN1A 3LGCA 1HD2A 4GQFA 1NM3A 4N30A 4PX1A 1XVWA 1VGLA 1O81A 4PGTA 1R26A 2H72A 4RI6A 1AIUA 5IO0A 2E2MA 4ML6A 2HXKA 4POKA 5C00A 3MSZA 1WRYA 2REMA 3BCKA 1ERUA 2IN3A 5B7CA 1OE8A 3NIVA 3C1RA 2HLSA 4TR0A 3TGZA 1Z9HA 1QFNA 1Z7PA 3M3MA 3FRCA 3GSSA 2HE3A 3GN3A 1KEBA 1UA5A 2E0QA 3GX0A 4ULXA 2ES7A 2H6ZA 1BYEA 4ZBDA 4TW5A 4CW9A 1E6BA 1ZZYA 1XWBA 4KUNA 1U87A 1ZYEA 2X8CA 1Z5YE 2H1BA 2IWTA 2JSZA 4MABA 4O32A 1Z3EA 3F0IA 2GLRA 1YZXA 4ZXGA 4KX4A 2YWIA 3LSZA 2FA8A 3D4MA 2HZEA 2IMDA 3G7IA 5F05A 1PKZA 4EDYA 2FWHA 2JZRA 2YV9A 4TR1B 3TRXA 2CVBA 4MDCA 1SKWB 3GRXA 2FNOA 1XFLA 3FW2A 2WJUA 1SYXA 3VI5A 1ZYQB 2VCTA 2RUFA 2P5QA 1KNGA 1GNEA 2H1DA 5FT3A 5G31A 4F9ZA 2V41A 2MBSA 1PSQA 3F8UA 4BVXA 1GTAA 4FYUA 1T8EB 1TK8B 1DBYA 4YQUA 5JCWA 1HNAA 4BPYA 2HRNA 3APOA 1V40A 2H71A 5FHIA 2V1MA 2RUEA 3HXSA 2FWGA 3KP9A 1ZOFA 2YWMA 4RQXA 3WYWA 2B1KA 4K0GA 5GSSA 2O89A 2H01A 3HZ4A 1YF0A 5ECNB 2PVQA 3HKRA 3CSIA 2B7JA 3D22A 4GRFA 2OA7A 4ECBA 2R5GA 5CRWA 2NTOA 2TRXA 4L0WA 1S3CA 2LS5A 3F4TA 1TK0B 1N8JA 2L59A 3ZREA 3AY8A 2V6KA 2I1UA 4TN8A 4PQIA 2O7KA 1SU9A 1PKWA 3QCPA 3A2VA 4F03A 2VUPA 3LQ7A 3KM6A 3NOFA 5IOWA 6GSSA 4NV5A 4AGSA 2H75A 4X43A 2PERA 2KHPA 10GSA 5AIVA 4Q5RA 2LQQA 2FCHA 4L8EA 1GSUA 4DSSA 1VF1A 1ZL9A 3FYGA 3UJ1A 4Z7XA 2FD3A 1GLPA 4DSQA 3S9FA 3WGEA 16GSA 5ECSA 3GL5A 3GURA 2DJ1A 4X1UA 3VPQA 2L5LA 3M8NA 2YWNA 2H0HA 2B7KA 4GLTA 1F3AA 4EL1A 3DMLA 2GGTA 4IS0A 2L4CA 5A4VA 5F07A 4GCIA 12GSA 1QQ2A 4N11A 2R6KA 4XS6A 1FVKA 1M0UA 2K8VA 4ECCA 2MBTA 1GSYA 2VCXA 4Q5QA 1IYHA 1W89A 3UAPA 4V2NA 1TJDA 1PX6A 2HYXA 1YDKA 3CTGA 3ERGA 18GSA 1T3BA 2LNSA 1K3LA 1O6JA 2IIYA 4K1FA 1W4VA 2IPAA 3TUEA 4N10A 1ON4A 3H4KA 3UARA 4DEJA 1V2AA 3HJMA 3P7XA 2C3TA 3M9KA 5H5RA 1QGVA 4K7OA 3RHBA 2FY6A 3EMXA 2F8FA 2ON5A 2ZNMA 1MDKA 4MH3A 3HYPA 1F6MC 1FG4A 3DIEA 4GF0A 3L9VA 2MMZA 2XBIA 5G2ZA 2XPDA 5ECMB 3CSJA 2N5BA 4BVYA 2DC5A 1NW2A 3GL3A 3ZRDA 2VL2C 1M9AA 1OE7A 3US3A 6GSXA 2GQMA 3GUSA 2OACA 4OCFA 2QSIA 4PQHA 1LBKA 4IP1A 2DBCA 1YKCA 1SKRB 2LRNA 3CTFA 2OBKA 4KSOA 2DJKA 3EU3A 1CQHA 4WBRD 2LJAA 5DCHA 1A0FA 3PR8A 1OC9A 1B4QA 3QFBC 4OWYA 3ZTLA 2FUG2 4JR6A 2C3QA 4QQ7A 5JWRB 5EPFA 5HQPA 2GS3A 3KGKA 3QMXA 5EY6A 1IYIA 1JLWA 1X9MB 3LG6A 3IE3A 1SK1A 2PUKC 1M2DA 2PGTA 3DRNA 1SL0B 1EZKA 3BCIA 4KDXA 2E2GA 1USBA 1KBNA 1SYRA 5DDLA 4Q5NA 4IJ3A 2A2SA 5E4WA 5IMVA 5HR2A 3BOAA 2YJ7A 1M7TA 2R4VA 3M1GA 3H1NA 1H75A 2G2QA 2KLXA 1FW1A 4JRRA 3M0FA 2HT9A 3TB2A 1T1VA 1UN2A 4MPGA 1AQXA 3O76A 1OC3A 3WGXA 3FEUA 3MNGA 3FHKA 1O8XA 1AC1A 2YZHA 4OFNA 4MZCA 3Q6OA 3GSTA 1JZOA 1FHEA 2YZUA 1WJKA 1AQWA 5B6NA 1U88A 6GSWA 4L5LA 2NVLA 2IMKA 1B9YC 2VL3A 3I9V2 3ZIVA 1K0CA 4N0VA 5IMDA 2E7PA 4HDEA 1GTIA 2FHEA 4ACSA 2H74A 4XTSA 4RQRA 2G0FA 4YQVA 2RLIA 4HU7A 5F8BA 1FB0A 4CHSA 1WOUA 4IBPA 2C8UA 3U6VA 2CZ3A 3L9SA 3CBUA 5G1LA 1ZCPA 4KA0A 1GL8A 1RQMA 4Q5FA 4F0BA 2WS2A 4JU5A 3CSHA 3ERWA 5CO3A 3JCML 4TR1A 1TTZA 1SJ6A 2C0GA 2H8LA 7GSSA 2R2JA 5LNKe 1JHBA 2HRFA 2XC2A 5G5FA 1XW9A 1PA3A 3G7YA 3LXTA 3DKSA 4V1Ap 2X64A 1FOVA 4TXOB 3R2QA 3G7JA 3QD9A 4HOJA 1A2JA 4MJAA 3GH6A 3P8WA 2PBJA 3DVWA 5KN0A 3D5JA 1XWAA 1Y6EA 1XWCA 4PURA 4IVFA 3DGQA 2WGRA 3RHCA 5ECPB 3L78A 1BEDA 3Q74A 3N9JA 3FR9A 4HQZA 4BWQA 2HZFA 4ZB6A 4XCSA 2AHEA 3TOTA 2H1GA 1SD8A 4IW9A 2VIMA 4EXJA 3MAKA 2MMAA 3QOUA 1YY7A 1THXA 2DMMA 2YNXA 4J2FA 2VCVA 3GTUA 3LORA 4NMUA 3HVVA 1YEPA 3DYRA 5CYYA 3UVHA 3IAM2 3IXRA 1V58A 4D73A 1AXDA 2M72A 5DJMA 4EO3A 3CRTA 2FWFA 5COHA 5KEJA 4GQCA 5CRDA 4WR5A 2M80A 2C80A 1GUHA 2F8AA 6GSYA 5IMCA 1NHOA 1GSEA 3HD5A 4EC0A 1AUCA 3C73A 4V1Ag 2R37A 3P2AA 2YJHA 2N5FA 3ERFA 4HZ2A 2VM1A 5D93A 2GZPA 3E0UA 2C4JA 4HU9A 4TVEA 5CNWA 4EF0A 3EVIA 5AISA 1YKAA 4KH7A 5D96A 3LEFA 1FO5A 4TKYA 1NHYA 4I97A 1K3OA 1K3YA 2LQOA 4ISDA 3SBCA 2L5OA 3KZQA 4I6XA 2K6VA 3N5OA 2OE3A 2WFCA 1EEJA 3LJRA 4K7NA 2YOIA 1PL1A 1TI3A 4ZB8A 4ML1A 5F0GA 3TKSC 1MTCA 2CT6A 4WR4A 3VWVA 5DALB 1ERVA 3QAGA 2OBIA 4PXOA 2WULA 2VLUA 2P5RA 4IKHA 5HR0A 2CAQA 3ME7A 3ZZXA 4DVCA 2OE0A 3QAVA 4HI7A 1F37A 9GSSA 3DD3A 3L0HA 1XW6A 3RDWA 3F3QA 3TRPA 4IGJA 4AJ8A 4HJ2A 1RK4A 4LA1A 1EWXA 2CV4A 3F6DA 3P90A 2XBQA 2AYTA 1XBSA 2MZCA 4G10A 1HQOA 1U6TA 1CQGA 3QR6A 5ECOB 3FKFA 1A8LA 1SL1B 1GULA 3UMAA 2PPTA 1HNBA 4WF5A 2TIRA 1LJRA 1VF2A 1PL2A 2LTKA 1O73A 3FZ5A 2JZTA 1MEKA 2A4VA 2OJLA 4HZ4A 5JCGA 4AJ6A 3APQA 4XRAA 2H66A 2LNTA 3DVXA 2GZZA 4ECIA 3RPNA 5ECLB 2X8HA 2OKAA 3U5RE 2K18A 1TOFA 1HNCA 4TRXA 1EOGA 2OADA 3GFKA 4MK3A 5CAXA 3UL3A 1Q4JA 3W6GA 2L57A 3C1SA 3HDCA 3TJFA 1TI1A 2GSTA 3TJGA 1GLQA 4HJMA 4LL1B 5EVOA 3DWVA 1GWCA 3F63A 3UVTA 2XHFA 5IPGA 3ISOA 17GSA 4ZL8A 2B5XA 2PWJA 1UVZA 2ALBA 3QFAC 5ECRB 5D9WA 4K0NA 4FIWA 4MH2A 5B8AA 1XVQA 1G7OA 4ZB9A 2VM2A 5D8IA 3TKRA 4CDOA 3TKQA 1AW9A 2ZCTA 1XXUA 1GH2A 2GT5A 4GSTA 5DVBA 3VURA 4BL7A 5G5EA 3ZMKA 4PQ1A 2PVOC 3GYKA 1EEMA 1XIYA 4KCEA 1OC8A 4ECJA 1ZMAA 2EIQA 1PX7A 2HZEB 1SKSB 4POBA 1QXHA 1FVJA 1XOAA 5GAND 4ID0A 2VLVA 3ME8A 4K6XA 4BWSA 2IMFA 5CREA 1GUKA 5AGYA 1I5GA 5ECIB 3GX8A 3FR6A 1Z6NA 2GQKA 5L71A 2GSSA 2P0GA 2K8SA 1O7UA 2R3XA 2H30A 3IK9A 2OE1A 1T4ZA 3VI7A 5IOXA 3HJOA 4KSMA 4J56E 2IMEA 3ZYWA 4YAPA 3WGDA 4ZBAA 1A2LA 4OCEA 1SENA 14GSA 4FH8A 3F9UA 2DIYA 5DCGA 4JBBA 2V2GA 3CRUA 1N2AA 1SD9A 5FWGA 1PN9A 3GKNA 1X0RA 2CVDA 3EE2A 4KAEA 3WT2A 1R5PA 3CYNA 2H0IA 2NDOA 2X99A 4GWRA 4QL9A 3A5WA 4RUVA 3KJYA 4PNFA 3TKPA 1SJIA 4EKZA 2GDRA 3BBYA 2GVPA 2PN8A 5CRHA 3KMNA 5JWOB 1F3BA 1RW1A 2V32A 5J5NA 1EP7A 2RM6A 4LL4B 1R4WA 4V2LA 3IV4A 5GZZB 4MPFA 2AB6A 1EV4A 1R5AA 5A5KA 5KN2A 3KEBA 3MDKA 5DAKB 3LYPA 1K0MA 3PINA 3H8QA 3C71A 3FZ9A 2CVKA 1WMJA 1ABAA 3HHVA 4K2DA 4DSRA 3KMOA 5A4WA 4QL7A 2VO4A 3PGTA 4OO5A 1Z7RA 1X9WB 4MZWA 4LMVA 1B9XC 3ZVJA 4WBJA 2YP6A 2GSRA 3QPMA 2JSYA 1XCCA 2JU5A 5KN3A 1EGOA 3PH9A 2YCDA 4FYCA 4O5RA 4L0UA 1M2BA 2YPMA 1GSQA 2I4AA 1XPVA 2Z9SA 3F4RA 2H19A 3HY2A 1SK0A 1TRWA 1K0NA 1GRXA 2AUVA 2IFQB 3CXGA 4WF4A 2VCQA 2H6XA 2B5EA 5D9XA 5GAPD 4JE1A 4TXVA 4EE0A 3FK8A 4OMVA 4K8MA 2GQLA 2YWOA 1V9WA 2PMTA 4KB3A 2QKEA 5INYA 4LLRA 4KDYA 5ID2B 2LEGA 3LXZA 5J9BA 3SWLA 1B8XA 1GTUA 5H5SA 2VL2A 2XPEA 4XIHA 2VD0A 3EYTA 1TP9A 4G9HA 4MZBA 4POMA 4HS1A 5D9TA 1A0RP 5IMZA 3F3RA 2H6YA 1G7EA 3GKXA 2F51A 3ZLPA 3GV1A 2CX4A 3VFIA 2RIIA 3W8JA 5IO2A 1J0FA 2EC4A 1HYUA 3MWHA 5AIXA 3UEMA 3KIJA 5J4UA 5DALA 2DJ3A 1XWKA 2O8VB 5GSTA 5JCUA 2K9FA 5IQYA 3RAZA 1I9DA 2B6MA 1SK2A 1R7HA 2AV4A 1YF1A 2JADA 1Y25A 5ECKB 2I3YA 5B6MA 6GSVA 1ACVA 3L4NA 4XS4B 2HFDA 4IELA 13GSA 2CAIA 5ECQB 3H93A 4G19A 5JWQB 3RBTA 5F06A 1J08A 4O7HA 2GT6A 1H4OA 5IIZA 4ZILA 2H70A 2N5AA 2DIZA 4NHZA 4G2EA 3GHAA 3WD6A 5IMAA 1BJXA 1G0TA 1GTBA 1OC9B 4AF2A 1DUGA 3GMFA 1BAYA 3TKSE 1WE0A 4PNGA 1UC7A 2X8GA 4YH2A 1M9BA 2GSQA 5DBQA 3VWXA 3BD2A 3GNJA 5A4UA 3KTBA 1V57A 1V98A 4RI7A 3FZAA 2C1YA 3VK9A 5H5QA 6GSTA 3IPZA 1DSBA 4ZBBA 1ILOA 2DJ0A 3FR3A 4IP6A 1TU7A 1TU8A 4LMWA 5C04A 2EIOA 3IC4A 5J41A 2BMXA 2CX3A 3QDNA 1TDIA 3QAWA 1O8WA 3VPTA 3IK7A 5DJLA 4IJIA 3FY7A 4KE3A 4MF5A 5IMFA 1G6WA 5D9VA 3C8EA 2LSTA 3EINA 3UBLA 1JLVA 1GSDA 5IPHA 4L5OA 1ML6A 3I69A 3UBKA 3TJKA 4MJEA 3DXBA 3GA4A 4MMMA 1EP8A 1K0DA 3A2XA 1JZRA 1OAZA 3ZL5A 4OFMA 1JFUA 4PUAA 3L9UA 4YQMA 2KP2A 3TRQA 3D4TA 3WT1A 1G6YA 1QMVA 1VRSD 2C0EA 2L6CA 2H73A 1M2AA 4P3YB 2VL9A 5ELAA 3ED3A 2KOKA 3M9JA 3Q19A 1X5DA 3APSA 3C7MA 1AAZA 5LD0A 1XWGA 3GKKA 1EOHA 3ZFBA 1TXXA 1TW9A 4NAXA 4I2TA 5CRGA 1EGRA 1K0BA 8GSSA 4GXZA 1XW5A 4XS1A 1X9SB 1YJ6A 2AAWA 4NPBA 4WKWA 3F6FA 2YV7A 3IOSA 1S3DA 2NPBA 5DQYA 1X5EA 3KCMA 5AN1A 2NBSA 2BTOT 1C72A 3VWUA 2F3MA 1YEXA 4MP4A 3D0ZA 1U3IA 3K8NA 3TOUA 2EIRA 1BG5A 2O85A 4GSNA 3G9BA 5ELGA 3KXOA 2IJYA 2YANA 1SL2B 1T00A 1URMA 2HNLA 3IDVA 4MF7A 3GTUB 2IL3A 4ZL9A 4K7IA 4MCUA 3GIXA 1GSSA 1BQ7A 5IM9A 4OFTA 4E8HA 4YAVA 3TJBA 2FWEA 1T7PB 4N0ZA 5CP1A 4POLA 5DAKA 4D73B 3ZITA 2CZ2A 2VCWA 5ENUA 4EDZA 4EUYA 1U3AA 3J7Yk 4OO4A 2MMOA
chains in the Genus database with same CATH superfamily
2J23A 4JEDA 3E9JB 2J9HA 1TK5B 3OR5A 1WIKA 1TRVA 5ECHB 2RM5A 3IR4A 3KD0A 2VLTA 3V1WA 3TKSA 2DLXA 2B5YA 2LUSA 4K9ZA 4KCAA 1Z6MA 3TJJA 1KTEA 2ON7A 3BJ5A 2WRTA 3TDGA 2VD1A 2WZ9A 4XHMA 4KW6A 5HFKA 2IFQA 2JZSA 1B48A 5HFIA 3VLNA 4JR4A 4KDUA 3I43A 3EU4A 3UOMA 4PUFC 2H1AA 5DQSA 4HEA2 4O5UA 1PD21 4TR4A 1M3IA 3LWAA 4I2UA 2MMNA 4Z2UA 4OD7A 2TRCP 4IQAA 2AJQB 3CMIA 2QC7A 2VAFA 5ID2A 1M99A 1AQVA 2VOCA 4WETA 2ZUPA 4HQSA 5D73A 1Q98A 4USSA 1O85A 4NXIA 2YN1A 4KGIA 3UIWA 5G1KA 2F9SA 2QGVA 1LU4A 2I81A 3A2WA 4E8EA 4BVXB 2H0GA 1EV9A 2B1LA 2L4QA 3J7Yb 1GSFA 5HFGA 1DE2A 5HR3A 2DJ2A 3I6AA 3IBHA 1ZYNA 1OKDA 3A3TA 4J57E 2VCZA 3KTLA 3F4SA 1FB6A 1T4YA 3Q18A 3ZFLA 2FLSA 1OYJA 3KH9A 3E3EA 2DMLA 1OKTA 3W8SA 2V6OA 3DEXA 4ZIJA 4GSSA 4TXOA 2GTUA 3D21A 2L6DA 1ERWA 4BA7A 4NHWA 4XS4A 5B8BA 4NV2A 2HSYA 3IA1A 1PQNA 1K0AA 2M46A 3HCZA 2C0FA 4IQ1A 1OVNA 4ILFA 4KNDA 2GZYA 4DSSB 2C0DA 4ZL7A 2MYGA 1PMTA 1F2EA 1JZDA 2R0PA 3H79A 3EC3A 3HA9A 1J9BA 5ABRA 5J3RA 3D6IA 2QA1A 3IAS2 2JL4A 1ZGNA 3HZ8A 3O6TA 3EMPA 1GNWA 4BL7B 2A2RA 2LRCA 1QK8A 4IN0A 4EVMA 4MF6A 3IHQA 5EL8A 4MLYA 4O5QA 3HVXA 2LJKA 2WCIA 1A8YA 1XOBA 1E2YA 11GSA 2HSHA 2LKUA 4I5QA 3KH7A 2D2ZA 1XZOA 2DJJA 3GH9A 4MJCA 1VF3A 3ZMLA 3GKMA 1A2MA 4F2IA 3RPPA 1MD3A 3ZVJD 3KP8A 4H86A 1DE1A 1F9MA 1A24A 3FZ4A 4FYBA 3TCOA 1MDJA 1ERTA 2CQ9A 1SJZA 1TRSA 5J9CA 1BX9A 1A23A 2HI7A 1YQ1A 1MDIA 4F82A 2PU9C 3IRAA 2WB9A 5G30A 2FA4A 2BJXA 5E59A 3EURA 1TKDB 20GSA 3PPUA 1WWJA 1QUWA 2H76A 2LRTA 4BVYB 4WXTA 1X5CA 3MIXA 2P31A 1TRUA 3VWWA 1S3AA 2O87A 1PGTA 4AJ7A 4GTUA 4F0CA 2KUCA 4JZQA 2WDUA 2KP1A 1THOA 19GSA 3O3TA 3EWLA 3ZIJA 2DSAA 4TOPA 2I9HA 1GUMA 4I8BA 1PRXA 3LYKA 1GP1A 4HUAA 1B4PA 4NWYA 1NSWA 1WP0A 6GSUA 5HR1A 4TR3A 2C3NA 1FAAA 3HVSA 4FO5A 4XRDA 2B3SA 4MJBA 3LFLA 1WPIA 4X0XA 1K0OA 2JACA 1ST9A 4WEYA 4IHUA 4O92A 3NZNA 4V2MA 2LV3A 2CA8A 22GSA 1JZWA 1MD4A 5LCZA 3HJPA 2IMIA 2LJRA 4MA9A 1VF4A 2FGXA 5KN1A 3LGCA 1HD2A 4GQFA 1NM3A 4N30A 4PX1A 1XVWA 1VGLA 1O81A 4PGTA 1R26A 2H72A 4RI6A 1AIUA 5IO0A 4YKGA 2E2MA 4ML6A 2HXKA 4POKA 5C00A 3MSZA 1WRYA 2REMA 3BCKA 1ERUA 2IN3A 5B7CA 1OE8A 3NIVA 3C1RA 2HLSA 4TR0A 3TGZA 1Z9HA 1QFNA 1Z7PA 3M3MA 3FRCA 3GSSA 2HE3A 3GN3A 4CY6A 1KEBA 1UA5A 2E0QA 3GX0A 4ULXA 2ES7A 2H6ZA 1BYEA 4ZBDA 1ZYPA 4TW5A 4CW9A 1E6BA 1ZZYA 1XWBA 2A4HA 4KUNA 1U87A 1ZYEA 2X8CA 1Z5YE 2H1BA 2IWTA 2JSZA 4MABA 4O32A 1Z3EA 3F0IA 2GLRA 1YZXA 4ZXGA 4KX4A 4HSCX 2YWIA 3LSZA 2FA8A 3D4MA 2HZEA 2IMDA 3G7IA 5F05A 1PKZA 4G0LA 4EDYA 2FWHA 2JZRA 2YV9A 4TR1B 3TRXA 2CVBA 4MDCA 1SKWB 3GRXA 4BIKA 2FNOA 1XFLA 3FW2A 2WJUA 1SYXA 3VI5A 1ZYQB 2VCTA 2RUFA 2P5QA 1KNGA 2DKIA 1GNEA 2H1DA 5FT3A 5G31A 4F9ZA 2V41A 2MBSA 2A2PA 1PSQA 3F8UA 4BVXA 1GTAA 4FYUA 1T8EB 1TK8B 1DBYA 4YQUA 5JCWA 1HNAA 4BPYA 2HRNA 3CQFA 3APOA 1V40A 2H71A 4MNNA 5FHIA 2V1MA 2RUEA 3HXSA 2FWGA 3KP9A 1ZOFA 2YWMA 4RQXA 3WYWA 2B1KA 3A5IA 4K0GA 5GSSA 2O89A 2H01A 3HZ4A 1YF0A 5ECNB 2PVQA 3HKRA 3CSIA 4YKFA 2B7JA 3D22A 4GRFA 2OA7A 4ECBA 2R5GA 5CRWA 2NTOA 2TRXA 4L0WA 1S3CA 2LS5A 3F4TA 1TK0B 1N8JA 2L59A 3ZREA 3AY8A 2V6KA 2I1UA 4TN8A 4PQIA 2O7KA 1SU9A 1PKWA 3QCPA 3A2VA 4F03A 2VUPA 3LQ7A 3KM6A 3NOFA 5IOWA 6GSSA 4NV5A 4AGSA 2H75A 4X43A 2PERA 2KHPA 10GSA 5AIVA 4Q5RA 2LQQA 2FCHA 4L8EA 1GSUA 4DSSA 1VF1A 1ZL9A 3FYGA 2DKHA 3UJ1A 4Z7XA 2FD3A 1GLPA 4DSQA 3S9FA 3WGEA 16GSA 5ECSA 3GL5A 3GURA 2DJ1A 4X1UA 3VPQA 2L5LA 3M8NA 2YWNA 2H0HA 2B7KA 4GLTA 2X4AA 1F3AA 4EL1A 3DMLA 2GGTA 4IS0A 2L4CA 5A4VA 5F07A 4GCIA 12GSA 1QQ2A 4N11A 2R6KA 4XS6A 1FVKA 1M0UA 2K8VA 3IC8A 4ECCA 2MBTA 1GSYA 2VCXA 4Q5QA 1IYHA 1W89A 3UAPA 4V2NA 1TJDA 1PX6A 2HYXA 1YDKA 3CTGA 3ERGA 18GSA 1T3BA 2LNSA 1K3LA 1O6JA 2IIYA 4K1FA 1W4VA 2IPAA 3TUEA 4N10A 1ON4A 3H4KA 3UARA 5KOWA 4DEJA 1V2AA 3HJMA 2HRKA 3P7XA 2C3TA 3M9KA 5H5RA 1QGVA 4K7OA 3RHBA 2FY6A 3EMXA 2F8FA 2ON5A 2ZNMA 1MDKA 4MH3A 3HYPA 1F6MC 1FG4A 3DIEA 4GF0A 3L9VA 2MMZA 2XBIA 5G2ZA 2XPDA 5ECMB 3CSJA 2N5BA 4BVYA 2DC5A 1NW2A 3GL3A 3ZRDA 2VL2C 1M9AA 1OE7A 3US3A 6GSXA 2GQMA 3GUSA 2OACA 4OCFA 4ICYA 2QSIA 4PQHA 1LBKA 4IP1A 2DBCA 1YKCA 1SKRB 2LRNA 3CTFA 2OBKA 4KSOA 2DJKA 3EU3A 1CQHA 4WBRD 2LJAA 5DCHA 1A0FA 3PR8A 1OC9A 1B4QA 3QFBC 4OWYA 3ZTLA 2FUG2 4JR6A 2C3QA 4QQ7A 5JWRB 5EPFA 5HQPA 2GS3A 3KGKA 3QMXA 5EY6A 1IYIA 1JLWA 1X9MB 3LG6A 3IE3A 1SK1A 2PUKC 1M2DA 2PGTA 3DRNA 1SL0B 1EZKA 3BCIA 4KDXA 2E2GA 1USBA 1KBNA 1SYRA 5DDLA 4Q5NA 4IJ3A 2A2SA 5E4WA 5IMVA 5HR2A 3BOAA 2YJ7A 1M7TA 2R4VA 4G0IA 3M1GA 3H1NA 1H75A 2G2QA 2KLXA 1FW1A 4JRRA 3M0FA 2HT9A 3TB2A 1T1VA 1UN2A 4MPGA 1AQXA 3O76A 1OC3A 3WGXA 3FEUA 3MNGA 3FHKA 1O8XA 1AC1A 2YZHA 4OFNA 4MZCA 3Q6OA 3GSTA 1JZOA 1FHEA 2YZUA 1WJKA 1AQWA 5B6NA 1U88A 6GSWA 4L5LA 2NVLA 2IMKA 1B9YC 2VL3A 3I9V2 3ZIVA 1K0CA 4N0VA 5IMDA 2E7PA 4HDEA 1GTIA 2FHEA 4ACSA 2H74A 1PFOA 4XTSA 4RQRA 2G0FA 4YQVA 5BMUA 2RLIA 4HU7A 1FB0A 5F8BA 4CHSA 1WOUA 4IBPA 2C8UA 3IHGA 3U6VA 2CZ3A 3L9SA 3CBUA 5G1LA 1ZCPA 3R3EA 4KA0A 1GL8A 1RQMA 4Q5FA 4F0BA 2WS2A 4JU5A 3CSHA 3ERWA 5CO3A 3JCML 4TR1A 1TTZA 1SJ6A 2C0GA 2H8LA 7GSSA 2R2JA 5LNKe 1JHBA 2HRFA 2XC2A 5G5FA 1XW9A 1PA3A 3G7YA 3LXTA 3DKSA 4V1Ap 2X64A 1FOVA 4TXOB 3R2QA 3G7JA 3QD9A 4HOJA 1A2JA 4MJAA 3GH6A 3P8WA 2PBJA 3DVWA 5KN0A 3D5JA 1XWAA 1Y6EA 1XWCA 4PURA 4IVFA 3DGQA 2WGRA 3RHCA 5ECPB 3L78A 1BEDA 3Q74A 3N9JA 3FR9A 4HQZA 4BWQA 2HZFA 4ZB6A 4XCSA 2AHEA 3TOTA 3MYDA 2H1GA 1SD8A 4IW9A 2VIMA 4EXJA 3MAKA 2MMAA 3QOUA 1YY7A 1THXA 2DMMA 2YNXA 4J2FA 2VCVA 3GTUA 3LORA 4NMUA 3HVVA 1YEPA 3DYRA 5CYYA 3UVHA 3IAM2 3IXRA 1V58A 4D73A 1AXDA 2M72A 5DJMA 4EO3A 3CRTA 2FWFA 5COHA 5KEJA 4GQCA 5CRDA 4WR5A 2M80A 2C80A 1GUHA 2F8AA 6GSYA 5IMCA 1NHOA 1GSEA 3HD5A 4EC0A 1AUCA 3C73A 4V1Ag 2R37A 3P2AA 2YJHA 2N5FA 3ERFA 4HZ2A 2VM1A 5D93A 2GZPA 3E0UA 2C4JA 4HU9A 4TVEA 5CNWA 4EF0A 3EVIA 5AISA 1YKAA 4KH7A 5D96A 3LEFA 1FO5A 4TKYA 1NHYA 4I97A 1K3OA 1K3YA 2LQOA 4ISDA 3SBCA 2L5OA 3KZQA 4I6XA 2K6VA 3N5OA 2OE3A 2WFCA 1EEJA 3LJRA 4K7NA 2YOIA 1PL1A 1TI3A 4ZB8A 4ML1A 5F0GA 3TKSC 1MTCA 2CT6A 4WR4A 3VWVA 5DALB 1ERVA 3QAGA 2OBIA 4PXOA 2WULA 2VLUA 2P5RA 4IKHA 5HR0A 2CAQA 3ME7A 3ZZXA 4DVCA 2OE0A 3QAVA 4HI7A 1F37A 9GSSA 3DD3A 3L0HA 1XW6A 3RDWA 3F3QA 3TRPA 4IGJA 4AJ8A 4HJ2A 1RK4A 4EIQA 4LA1A 1EWXA 2CV4A 3F6DA 3P90A 2R0GA 2XBQA 2AYTA 1XBSA 2MZCA 4G10A 1HQOA 1U6TA 1CQGA 3QR6A 5ECOB 3FKFA 1A8LA 1SL1B 1GULA 3UMAA 2PPTA 1HNBA 3LW9A 4WF5A 2TIRA 1LJRA 1VF2A 1PL2A 2LTKA 1O73A 3FZ5A 2JZTA 1MEKA 2A4VA 2OJLA 4HZ4A 5JCGA 4AJ6A 3APQA 4XRAA 2H66A 2LNTA 3DVXA 2GZZA 4ECIA 3RPNA 5ECLB 2X8HA 2OKAA 3U5RE 2K18A 1TOFA 1HNCA 4TRXA 1EOGA 2OADA 3GFKA 4MK3A 5CAXA 3UL3A 1Q4JA 3W6GA 2L57A 3C1SA 3HDCA 3TJFA 1TI1A 2GSTA 3TJGA 1GLQA 4HJMA 4LL1B 5EVOA 3DWVA 1GWCA 3F63A 3UVTA 2XHFA 5IPGA 3ISOA 17GSA 4ZL8A 2B5XA 2PWJA 1UVZA 2ALBA 3QFAC 5ECRB 5D9WA 4K0NA 4FIWA 4MH2A 5B8AA 1XVQA 1G7OA 4ZB9A 2VM2A 5D8IA 3TKRA 4CDOA 3TKQA 1AW9A 2ZCTA 1XXUA 1GH2A 2GT5A 4GSTA 5DVBA 3VURA 4BL7A 5G5EA 3ZMKA 4PQ1A 2PVOC 3GYKA 1EEMA 1XIYA 4KCEA 1OC8A 4ECJA 1ZMAA 2EIQA 1PX7A 2HZEB 1SKSB 4POBA 1QXHA 1FVJA 1XOAA 4A5PA 5GAND 4ID0A 2VLVA 5KOXA 3ME8A 4K6XA 4BWSA 2IMFA 5CREA 1GUKA 5AGYA 1I5GA 3GX8A 5ECIB 4X4JA 3FR6A 1Z6NA 2GQKA 5L71A 2X49A 2GSSA 2P0GA 2K8SA 1O7UA 2R3XA 2H30A 3IK9A 2OE1A 1T4ZA 3VI7A 1S3RA 5IOXA 3HJOA 4KSMA 4J56E 2IMEA 3ZYWA 4YAPA 3WGDA 4ZBAA 1A2LA 4OCEA 1SENA 14GSA 4FH8A 3F9UA 2DIYA 5DCGA 4JBBA 2V2GA 3CRUA 1N2AA 1SD9A 5FWGA 1PN9A 3GKNA 1X0RA 2CVDA 3EE2A 4KAEA 3WT2A 1R5PA 3CYNA 2H0IA 2NDOA 2X99A 4GWRA 4QL9A 3A5WA 4RUVA 3KJYA 4PNFA 3TKPA 1SJIA 4EKZA 2GDRA 3BBYA 2GVPA 2PN8A 5CRHA 3KMNA 5JWOB 1F3BA 2R0CA 1RW1A 2V32A 5J5NA 1EP7A 2RM6A 4LL4B 1R4WA 4V2LA 3IV4A 5GZZB 4MPFA 2AB6A 1EV4A 1R5AA 5A5KA 5KN2A 3KEBA 3MDKA 5DAKB 3LYPA 1K0MA 3PINA 3H8QA 3C71A 3FZ9A 2CVKA 3HVNA 1WMJA 1ABAA 3HHVA 4K2DA 4DSRA 3KMOA 2QA2A 5A4WA 4QL7A 2VO4A 3PGTA 4OO5A 1Z7RA 1X9WB 4MZWA 4FQUA 4LMVA 1B9XC 3ZVJA 4WBJA 2YP6A 2GSRA 3QPMA 2JSYA 1XCCA 2JU5A 5KN3A 1EGOA 3PH9A 2YCDA 4FYCA 4O5RA 4L0UA 1M2BA 2YPMA 1GSQA 2I4AA 1XPVA 2Z9SA 3F4RA 2H19A 3HY2A 1SK0A 1PN0A 1TRWA 1K0NA 1GRXA 2AUVA 2IFQB 3CXGA 4WF4A 2VCQA 2H6XA 2B5EA 5D9XA 4K5RA 5GAPD 4JE1A 4TXVA 4EE0A 3FK8A 4OMVA 4K8MA 2GQLA 2YWOA 1V9WA 2PMTA 4KB3A 2QKEA 5INYA 4LLRA 4KDYA 5ID2B 2LEGA 3LXZA 5J9BA 3SWLA 1B8XA 1GTUA 5H5SA 2VL2A 2XPEA 4XIHA 2VD0A 3EYTA 1TP9A 4G9HA 4MZBA 4POMA 4HS1A 5D9TA 1A0RP 5IMZA 3F3RA 2H6YA 1G7EA 3GKXA 2F51A 3ZLPA 3GV1A 2CX4A 3VFIA 2RIIA 3W8JA 5IO2A 1J0FA 2EC4A 1HYUA 3MWHA 5AIXA 3UEMA 3KIJA 5J4UA 5DALA 2DJ3A 1XWKA 2O8VB 5GSTA 5JCUA 2K9FA 5IQYA 3RAZA 1I9DA 2B6MA 1SK2A 1R7HA 2AV4A 1YF1A 2JADA 1Y25A 5ECKB 2I3YA 5B6MA 6GSVA 1ACVA 3L4NA 4XS4B 4EIPA 4CY8A 2HFDA 4IELA 13GSA 2CAIA 5ECQB 3H93A 4G19A 5JWQB 3RBTA 5F06A 1J08A 1XG8A 4O7HA 2GT6A 2HRAA 1H4OA 4G0KA 5IIZA 4ZILA 2H70A 2N5AA 2DIZA 4NHZA 4G2EA 4Z2TA 3GHAA 3WD6A 5IMAA 1BJXA 1G0TA 1GTBA 1OC9B 4AF2A 1DUGA 3GMFA 1BAYA 3TKSE 1WE0A 4PNGA 1UC7A 2X8GA 4YH2A 1M9BA 2GSQA 5DBQA 3VWXA 3BD2A 3GNJA 5A4UA 3KTBA 1V57A 1V98A 4RI7A 3FZAA 2C1YA 3VK9A 5H5QA 6GSTA 3FMWA 1DSBA 3IPZA 4ZBBA 1ILOA 2DJ0A 2UZ8A 3FR3A 4IP6A 1TU7A 1TU8A 4LMWA 5C04A 2EIOA 3IC4A 5J41A 2BMXA 2CX3A 3QDNA 1TDIA 3QAWA 1O8WA 3VPTA 3IK7A 5DJLA 4IJIA 3FY7A 4KE3A 4MF5A 5IMFA 1G6WA 5D9VA 3C8EA 1M3JA 2LSTA 3EINA 3UBLA 1JLVA 1GSDA 4KF9A 5IPHA 4L5OA 4K2XA 1ML6A 3I69A 3UBKA 3TJKA 4MJEA 3DXBA 3GA4A 4MMMA 1EP8A 1K0DA 3A2XA 1JZRA 1OAZA 3ZL5A 4OFMA 1JFUA 4PUAA 3L9UA 4YQMA 2KP2A 3TRQA 3D4TA 3WT1A 1G6YA 1QMVA 1VRSD 2C0EA 4K5SA 2L6CA 2H73A 1M2AA 4P3YB 2VL9A 5ELAA 3ED3A 2KOKA 3M9JA 3Q19A 1X5DA 3APSA 3C7MA 1AAZA 5LD0A 1XWGA 3GKKA 1EOHA 3EPTA 3ZFBA 1TXXA 1TW9A 5BRTA 4NAXA 4I2TA 5CRGA 1EGRA 1K0BA 8GSSA 4GXZA 1XW5A 4XS1A 1X9SB 1YJ6A 2AAWA 1FOHA 4NPBA 4WKWA 4PTSA 3F6FA 2YV7A 3IOSA 1S3DA 2NPBA 5DQYA 2HSMA 1X5EA 3KCMA 5AN1A 2NBSA 2BTOT 1C72A 3VWUA 2F3MA 1YEXA 4MP4A 3D0ZA 1U3IA 3K8NA 3TOUA 2EIRA 1BG5A 2O85A 4GSNA 3G9BA 5ELGA 3KXOA 2IJYA 2YANA 1SL2B 1T00A 1URMA 2HNLA 4Z2RA 3IDVA 4MF7A 3GTUB 2IL3A 4ZL9A 4K7IA 4MCUA 3GIXA 1GSSA 1BQ7A 5IM9A 4OFTA 4E8HA 4YAVA 3TJBA 2FWEA 1T7PB 4N0ZA 5CP1A 4POLA 5DAKA 4D73B 3ZITA 2CZ2A 2VCWA 5ENUA 4EDZA 4EUYA 1U3AA 3J7Yk 4OO4A 2MMOA
chains in the Genus database with same CATH topology
2J23A 4JEDA 3E9JB 2J9HA 1TK5B 3OR5A 1WIKA 1TRVA 5ECHB 2RM5A 3IR4A 3KD0A 2VLTA 3V1WA 3TKSA 2DLXA 2B5YA 2LUSA 4K9ZA 4KCAA 1Z6MA 3TJJA 1KTEA 2ON7A 3BJ5A 2WRTA 3TDGA 2VD1A 2WZ9A 4XHMA 4KW6A 5HFKA 2IFQA 2JZSA 1B48A 5HFIA 3VLNA 4JR4A 4KDUA 3I43A 3EU4A 3UOMA 4PUFC 2H1AA 5DQSA 4HEA2 4O5UA 1PD21 4TR4A 3LWAA 4I2UA 2MMNA 4Z2UA 4OD7A 2TRCP 4IQAA 2AJQB 3CMIA 2QC7A 2VAFA 5ID2A 1M99A 1AQVA 2VOCA 4WETA 2ZUPA 4HQSA 5D73A 1Q98A 4USSA 1O85A 4NXIA 2YN1A 4KGIA 3UIWA 5G1KA 2F9SA 2QGVA 1LU4A 2I81A 3A2WA 4E8EA 4BVXB 2H0GA 1EV9A 2B1LA 2L4QA 3J7Yb 1GSFA 5HFGA 1DE2A 5HR3A 2DJ2A 3I6AA 3IBHA 1ZYNA 1OKDA 3A3TA 4J57E 2VCZA 3KTLA 3F4SA 1FB6A 1T4YA 3Q18A 3ZFLA 2FLSA 1OYJA 3KH9A 3E3EA 2DMLA 1OKTA 3W8SA 2V6OA 3DEXA 4ZIJA 4GSSA 4TXOA 2GTUA 3D21A 2L6DA 1ERWA 4BA7A 4NHWA 4XS4A 5B8BA 4NV2A 2HSYA 3IA1A 1PQNA 1K0AA 2M46A 3HCZA 2C0FA 4IQ1A 1OVNA 4ILFA 4KNDA 2GZYA 4DSSB 2C0DA 4ZL7A 2MYGA 1PMTA 1F2EA 1JZDA 2R0PA 3H79A 3EC3A 3HA9A 1J9BA 5ABRA 5J3RA 3D6IA 2QA1A 3IAS2 2JL4A 1ZGNA 3HZ8A 3O6TA 3EMPA 1GNWA 4BL7B 2A2RA 2LRCA 1QK8A 4IN0A 4EVMA 4MF6A 3IHQA 5EL8A 4MLYA 4O5QA 3HVXA 2LJKA 2WCIA 1A8YA 1XOBA 1E2YA 11GSA 2HSHA 2LKUA 4I5QA 3KH7A 2D2ZA 1XZOA 2DJJA 3GH9A 4MJCA 1VF3A 3ZMLA 3GKMA 1A2MA 4F2IA 3RPPA 1MD3A 3ZVJD 3KP8A 4H86A 1DE1A 1F9MA 1A24A 3FZ4A 4FYBA 3TCOA 1MDJA 1ERTA 2CQ9A 1SJZA 1TRSA 5J9CA 1BX9A 1A23A 2HI7A 1YQ1A 1MDIA 4F82A 2PU9C 3IRAA 2WB9A 5G30A 2FA4A 2BJXA 5E59A 3EURA 1TKDB 20GSA 3PPUA 1WWJA 1QUWA 2H76A 2LRTA 4BVYB 4WXTA 1X5CA 3MIXA 2P31A 1TRUA 3VWWA 1S3AA 2O87A 1PGTA 4AJ7A 4GTUA 4F0CA 2KUCA 4JZQA 2WDUA 2KP1A 1THOA 19GSA 3O3TA 3EWLA 3ZIJA 2DSAA 4TOPA 2I9HA 1GUMA 4I8BA 1PRXA 3LYKA 1GP1A 4HUAA 1B4PA 4NWYA 1NSWA 1WP0A 6GSUA 5HR1A 4TR3A 2C3NA 1FAAA 3HVSA 4FO5A 4XRDA 2B3SA 4MJBA 3LFLA 1WPIA 4X0XA 1K0OA 2JACA 1ST9A 4WEYA 4IHUA 4O92A 3NZNA 4V2MA 2LV3A 2CA8A 22GSA 1JZWA 1MD4A 5LCZA 3HJPA 2IMIA 2LJRA 4MA9A 1VF4A 2FGXA 5KN1A 3LGCA 1HD2A 4GQFA 1NM3A 4N30A 4PX1A 1XVWA 1VGLA 1O81A 4PGTA 1R26A 2H72A 4RI6A 1AIUA 5IO0A 4YKGA 2E2MA 4ML6A 2HXKA 4POKA 5C00A 3MSZA 1WRYA 2REMA 3BCKA 1ERUA 2IN3A 5B7CA 1OE8A 3NIVA 3C1RA 2HLSA 4TR0A 3TGZA 1Z9HA 1QFNA 1Z7PA 3M3MA 3FRCA 3GSSA 2HE3A 3GN3A 4CY6A 1KEBA 1UA5A 2E0QA 3GX0A 4ULXA 2ES7A 2H6ZA 1BYEA 4ZBDA 1ZYPA 4TW5A 4CW9A 1E6BA 1ZZYA 1XWBA 2A4HA 4KUNA 1U87A 1ZYEA 2X8CA 1Z5YE 2H1BA 2IWTA 2JSZA 4MABA 4O32A 1Z3EA 3F0IA 2GLRA 1YZXA 4ZXGA 4KX4A 2YWIA 3LSZA 2FA8A 3D4MA 2HZEA 2IMDA 3G7IA 5F05A 1PKZA 4G0LA 4EDYA 2FWHA 2JZRA 2YV9A 4TR1B 3TRXA 2CVBA 4MDCA 1SKWB 3GRXA 2FNOA 1XFLA 3FW2A 2WJUA 1SYXA 3VI5A 1ZYQB 2VCTA 2RUFA 2P5QA 1KNGA 2DKIA 1GNEA 2H1DA 5FT3A 5G31A 4F9ZA 2V41A 2MBSA 2A2PA 1PSQA 3F8UA 4BVXA 1GTAA 4FYUA 1T8EB 1TK8B 1DBYA 4YQUA 5JCWA 1HNAA 4BPYA 2HRNA 3APOA 1V40A 2H71A 4MNNA 5FHIA 2V1MA 2RUEA 3HXSA 2FWGA 3KP9A 1ZOFA 2YWMA 4RQXA 3WYWA 2B1KA 3A5IA 4K0GA 5GSSA 2O89A 2H01A 3HZ4A 1YF0A 5ECNB 2PVQA 3HKRA 3CSIA 4YKFA 2B7JA 3D22A 4GRFA 2OA7A 4ECBA 2R5GA 5CRWA 2NTOA 2TRXA 4L0WA 1S3CA 2LS5A 3F4TA 1TK0B 1N8JA 2L59A 3ZREA 3AY8A 2V6KA 2I1UA 4TN8A 4PQIA 2O7KA 1SU9A 1PKWA 3QCPA 3A2VA 4F03A 2VUPA 3LQ7A 3KM6A 3NOFA 5IOWA 6GSSA 4NV5A 4AGSA 2H75A 4X43A 2PERA 2KHPA 10GSA 5AIVA 4Q5RA 2LQQA 2FCHA 4L8EA 1GSUA 4DSSA 1VF1A 1ZL9A 3FYGA 2DKHA 3UJ1A 4Z7XA 2FD3A 1GLPA 4DSQA 3S9FA 3WGEA 16GSA 5ECSA 3GL5A 3GURA 2DJ1A 4X1UA 3VPQA 2L5LA 3M8NA 2YWNA 2H0HA 2B7KA 4GLTA 2X4AA 1F3AA 4EL1A 3DMLA 2GGTA 4IS0A 2L4CA 5A4VA 5F07A 4GCIA 12GSA 1QQ2A 4N11A 2R6KA 4XS6A 1FVKA 1M0UA 2K8VA 3IC8A 4ECCA 2MBTA 1GSYA 2VCXA 4Q5QA 1IYHA 1W89A 3UAPA 4V2NA 1TJDA 1PX6A 2HYXA 1YDKA 3CTGA 3ERGA 18GSA 1T3BA 2LNSA 1K3LA 1O6JA 2IIYA 4K1FA 1W4VA 2IPAA 3TUEA 4N10A 1ON4A 3H4KA 3UARA 5KOWA 4DEJA 1V2AA 3HJMA 2HRKA 3P7XA 2C3TA 3M9KA 5H5RA 1QGVA 4K7OA 3RHBA 2FY6A 3EMXA 2F8FA 2ON5A 2ZNMA 1MDKA 4MH3A 3HYPA 1F6MC 1FG4A 3DIEA 4GF0A 3L9VA 2MMZA 2XBIA 5G2ZA 2XPDA 5ECMB 3CSJA 2N5BA 4BVYA 2DC5A 1NW2A 3GL3A 3ZRDA 2VL2C 1M9AA 1OE7A 3US3A 6GSXA 2GQMA 3GUSA 2OACA 4OCFA 4ICYA 2QSIA 4PQHA 1LBKA 4IP1A 2DBCA 1YKCA 1SKRB 2LRNA 3CTFA 2OBKA 4KSOA 2DJKA 3EU3A 1CQHA 4WBRD 2LJAA 5DCHA 1A0FA 3PR8A 1OC9A 1B4QA 3QFBC 4OWYA 3ZTLA 2FUG2 4JR6A 2C3QA 4QQ7A 5JWRB 5EPFA 5HQPA 2GS3A 3KGKA 3QMXA 5EY6A 1IYIA 1JLWA 1X9MB 3LG6A 3IE3A 1SK1A 2PUKC 1M2DA 2PGTA 3DRNA 1SL0B 1EZKA 3BCIA 4KDXA 2E2GA 1USBA 1KBNA 1SYRA 5DDLA 4Q5NA 4IJ3A 2A2SA 5E4WA 5IMVA 5HR2A 3BOAA 2YJ7A 1M7TA 2R4VA 4G0IA 3M1GA 3H1NA 1H75A 2G2QA 2KLXA 1FW1A 4JRRA 3M0FA 2HT9A 3TB2A 1T1VA 1UN2A 4MPGA 1AQXA 3O76A 1OC3A 3WGXA 3FEUA 3MNGA 3FHKA 1O8XA 1AC1A 2YZHA 4OFNA 4MZCA 3Q6OA 3GSTA 1JZOA 1FHEA 2YZUA 1WJKA 1AQWA 5B6NA 1U88A 6GSWA 4L5LA 2NVLA 2IMKA 1B9YC 2VL3A 3I9V2 3ZIVA 1K0CA 4N0VA 5IMDA 2E7PA 4HDEA 1GTIA 2FHEA 4ACSA 2H74A 4XTSA 4RQRA 2G0FA 4YQVA 5BMUA 2RLIA 4HU7A 1FB0A 5F8BA 4CHSA 1WOUA 4IBPA 2C8UA 3IHGA 3U6VA 2CZ3A 3L9SA 3CBUA 5G1LA 1ZCPA 3R3EA 4KA0A 1GL8A 1RQMA 4Q5FA 4F0BA 2WS2A 4JU5A 3CSHA 3ERWA 5CO3A 3JCML 4TR1A 1TTZA 1SJ6A 2C0GA 2H8LA 7GSSA 2R2JA 5LNKe 1JHBA 2HRFA 2XC2A 5G5FA 1XW9A 1PA3A 3G7YA 3LXTA 3DKSA 4V1Ap 2X64A 1FOVA 4TXOB 3R2QA 3G7JA 3QD9A 4HOJA 1A2JA 4MJAA 3GH6A 3P8WA 2PBJA 3DVWA 5KN0A 3D5JA 1XWAA 1Y6EA 1XWCA 4PURA 4IVFA 3DGQA 2WGRA 3RHCA 5ECPB 3L78A 1BEDA 3Q74A 3N9JA 3FR9A 4HQZA 4BWQA 2HZFA 4ZB6A 4XCSA 2AHEA 3TOTA 3MYDA 2H1GA 1SD8A 4IW9A 2VIMA 4EXJA 3MAKA 2MMAA 3QOUA 1YY7A 1THXA 2DMMA 2YNXA 4J2FA 2VCVA 3GTUA 3LORA 4NMUA 3HVVA 1YEPA 3DYRA 5CYYA 3UVHA 3IAM2 3IXRA 1V58A 4D73A 1AXDA 2M72A 5DJMA 4EO3A 3CRTA 2FWFA 5COHA 5KEJA 4GQCA 5CRDA 4WR5A 2M80A 2C80A 1GUHA 2F8AA 6GSYA 5IMCA 1NHOA 1GSEA 3HD5A 4EC0A 1AUCA 3C73A 4V1Ag 2R37A 3P2AA 2YJHA 2N5FA 3ERFA 4HZ2A 2VM1A 5D93A 2GZPA 3E0UA 2C4JA 4HU9A 4TVEA 5CNWA 4EF0A 3EVIA 5AISA 1YKAA 4KH7A 5D96A 3LEFA 1FO5A 4TKYA 1NHYA 4I97A 1K3OA 1K3YA 2LQOA 4ISDA 3SBCA 2L5OA 3KZQA 4I6XA 2K6VA 3N5OA 2OE3A 2WFCA 1EEJA 3LJRA 4K7NA 2YOIA 1PL1A 1TI3A 4ZB8A 4ML1A 5F0GA 3TKSC 1MTCA 2CT6A 4WR4A 3VWVA 5DALB 1ERVA 3QAGA 2OBIA 4PXOA 2WULA 2VLUA 2P5RA 4IKHA 5HR0A 2CAQA 3ME7A 3ZZXA 4DVCA 2OE0A 3QAVA 4HI7A 1F37A 9GSSA 3DD3A 3L0HA 1XW6A 3RDWA 3F3QA 3TRPA 4IGJA 4AJ8A 4HJ2A 1RK4A 4EIQA 4LA1A 1EWXA 2CV4A 3F6DA 3P90A 2R0GA 2XBQA 2AYTA 1XBSA 2MZCA 4G10A 1HQOA 1U6TA 1CQGA 3QR6A 5ECOB 3FKFA 1A8LA 1SL1B 1GULA 3UMAA 2PPTA 1HNBA 3LW9A 4WF5A 2TIRA 1LJRA 1VF2A 1PL2A 2LTKA 1O73A 3FZ5A 2JZTA 1MEKA 2A4VA 2OJLA 4HZ4A 5JCGA 4AJ6A 3APQA 4XRAA 2H66A 2LNTA 3DVXA 2GZZA 4ECIA 3RPNA 5ECLB 2X8HA 2OKAA 3U5RE 2K18A 1TOFA 1HNCA 4TRXA 1EOGA 2OADA 3GFKA 4MK3A 5CAXA 3UL3A 1Q4JA 3W6GA 2L57A 3C1SA 3HDCA 3TJFA 1TI1A 2GSTA 3TJGA 1GLQA 4HJMA 4LL1B 5EVOA 3DWVA 1GWCA 3F63A 3UVTA 2XHFA 5IPGA 3ISOA 17GSA 4ZL8A 2B5XA 2PWJA 1UVZA 2ALBA 3QFAC 5ECRB 5D9WA 4K0NA 4FIWA 4MH2A 5B8AA 1XVQA 1G7OA 4ZB9A 2VM2A 5D8IA 3TKRA 4CDOA 3TKQA 1AW9A 2ZCTA 1XXUA 1GH2A 2GT5A 4GSTA 5DVBA 3VURA 4BL7A 5G5EA 3ZMKA 4PQ1A 2PVOC 3GYKA 1EEMA 1XIYA 4KCEA 1OC8A 4ECJA 1ZMAA 2EIQA 1PX7A 2HZEB 1SKSB 4POBA 1QXHA 1FVJA 1XOAA 4A5PA 5GAND 4ID0A 2VLVA 5KOXA 3ME8A 4K6XA 4BWSA 2IMFA 5CREA 1GUKA 5AGYA 1I5GA 3GX8A 5ECIB 4X4JA 3FR6A 1Z6NA 2GQKA 5L71A 2X49A 2GSSA 2P0GA 2K8SA 1O7UA 2R3XA 2H30A 3IK9A 2OE1A 1T4ZA 3VI7A 5IOXA 3HJOA 4KSMA 4J56E 2IMEA 3ZYWA 4YAPA 3WGDA 4ZBAA 1A2LA 4OCEA 1SENA 14GSA 4FH8A 3F9UA 2DIYA 5DCGA 4JBBA 2V2GA 3CRUA 1N2AA 1SD9A 5FWGA 1PN9A 3GKNA 1X0RA 2CVDA 3EE2A 4KAEA 3WT2A 1R5PA 3CYNA 2H0IA 2NDOA 2X99A 4GWRA 4QL9A 3A5WA 4RUVA 3KJYA 4PNFA 3TKPA 1SJIA 4EKZA 2GDRA 3BBYA 2GVPA 2PN8A 5CRHA 3KMNA 5JWOB 1F3BA 2R0CA 1RW1A 2V32A 5J5NA 1EP7A 2RM6A 4LL4B 1R4WA 4V2LA 3IV4A 5GZZB 4MPFA 2AB6A 1EV4A 1R5AA 5A5KA 5KN2A 3KEBA 3MDKA 5DAKB 3LYPA 1K0MA 3PINA 3H8QA 3C71A 3FZ9A 2CVKA 1WMJA 1ABAA 3HHVA 4K2DA 4DSRA 3KMOA 2QA2A 5A4WA 4QL7A 2VO4A 3PGTA 4OO5A 1Z7RA 1X9WB 4MZWA 4FQUA 4LMVA 1B9XC 3ZVJA 4WBJA 2YP6A 2GSRA 3QPMA 2JSYA 1XCCA 2JU5A 5KN3A 1EGOA 3PH9A 2YCDA 4FYCA 4O5RA 4L0UA 1M2BA 2YPMA 1GSQA 2I4AA 1XPVA 2Z9SA 3F4RA 2H19A 3HY2A 1SK0A 1PN0A 1TRWA 1K0NA 1GRXA 2AUVA 2IFQB 3CXGA 4WF4A 2VCQA 2H6XA 2B5EA 5D9XA 4K5RA 5GAPD 4JE1A 4TXVA 4EE0A 3FK8A 4OMVA 4K8MA 2GQLA 2YWOA 1V9WA 2PMTA 4KB3A 2QKEA 5INYA 4LLRA 4KDYA 5ID2B 2LEGA 3LXZA 5J9BA 3SWLA 1B8XA 1GTUA 5H5SA 2VL2A 2XPEA 4XIHA 2VD0A 3EYTA 1TP9A 4G9HA 4MZBA 4POMA 4HS1A 5D9TA 1A0RP 5IMZA 3F3RA 2H6YA 1G7EA 3GKXA 2F51A 3ZLPA 3GV1A 2CX4A 3VFIA 2RIIA 3W8JA 5IO2A 1J0FA 2EC4A 1HYUA 3MWHA 5AIXA 3UEMA 3KIJA 5J4UA 5DALA 2DJ3A 1XWKA 2O8VB 5GSTA 5JCUA 2K9FA 5IQYA 3RAZA 1I9DA 2B6MA 1SK2A 1R7HA 2AV4A 1YF1A 2JADA 1Y25A 5ECKB 2I3YA 5B6MA 6GSVA 1ACVA 3L4NA 4XS4B 4EIPA 4CY8A 2HFDA 4IELA 13GSA 2CAIA 5ECQB 3H93A 4G19A 5JWQB 3RBTA 5F06A 1J08A 4O7HA 2GT6A 2HRAA 1H4OA 4G0KA 5IIZA 4ZILA 2H70A 2N5AA 2DIZA 4NHZA 4G2EA 4Z2TA 3GHAA 3WD6A 5IMAA 1BJXA 1G0TA 1GTBA 1OC9B 4AF2A 1DUGA 3GMFA 1BAYA 3TKSE 1WE0A 4PNGA 1UC7A 2X8GA 4YH2A 1M9BA 2GSQA 5DBQA 3VWXA 3BD2A 3GNJA 5A4UA 3KTBA 1V57A 1V98A 4RI7A 3FZAA 2C1YA 3VK9A 5H5QA 6GSTA 3FMWA 1DSBA 3IPZA 4ZBBA 1ILOA 2DJ0A 2UZ8A 3FR3A 4IP6A 1TU7A 1TU8A 4LMWA 5C04A 2EIOA 3IC4A 5J41A 2BMXA 2CX3A 3QDNA 1TDIA 3QAWA 1O8WA 3VPTA 3IK7A 5DJLA 4IJIA 3FY7A 4KE3A 4MF5A 5IMFA 1G6WA 5D9VA 3C8EA 2LSTA 3EINA 3UBLA 1JLVA 1GSDA 4KF9A 5IPHA 4L5OA 4K2XA 1ML6A 3I69A 3UBKA 3TJKA 4MJEA 3DXBA 3GA4A 4MMMA 1EP8A 1K0DA 3A2XA 1JZRA 1OAZA 3ZL5A 4OFMA 1JFUA 4PUAA 3L9UA 4YQMA 2KP2A 3TRQA 3D4TA 3WT1A 1G6YA 1QMVA 1VRSD 2C0EA 4K5SA 2L6CA 2H73A 1M2AA 4P3YB 2VL9A 5ELAA 3ED3A 2KOKA 3M9JA 3Q19A 1X5DA 3APSA 3C7MA 1AAZA 5LD0A 1XWGA 3GKKA 1EOHA 3EPTA 3ZFBA 1TXXA 1TW9A 5BRTA 4NAXA 4I2TA 5CRGA 1EGRA 1K0BA 8GSSA 4GXZA 1XW5A 4XS1A 1X9SB 1YJ6A 2AAWA 1FOHA 4NPBA 4WKWA 4PTSA 3F6FA 2YV7A 3IOSA 1S3DA 2NPBA 5DQYA 2HSMA 1X5EA 3KCMA 5AN1A 2NBSA 2BTOT 1C72A 3VWUA 2F3MA 1YEXA 4MP4A 3D0ZA 1U3IA 3K8NA 3TOUA 2EIRA 1BG5A 2O85A 4GSNA 3G9BA 5ELGA 3KXOA 2IJYA 2YANA 1SL2B 1T00A 1URMA 2HNLA 4Z2RA 3IDVA 4MF7A 3GTUB 2IL3A 4ZL9A 4K7IA 4MCUA 3GIXA 1GSSA 1BQ7A 5IM9A 4OFTA 4E8HA 4YAVA 3TJBA 2FWEA 1T7PB 4N0ZA 5CP1A 4POLA 5DAKA 4D73B 3ZITA 2CZ2A 2VCWA 5ENUA 4EDZA 4EUYA 1U3AA 3J7Yk 4OO4A 2MMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J23 A;  4JED A;  3E9J B;  2J9H A;  1TK5 B;  3OR5 A;  1WIK A;  1TRV A;  5ECH B;  2RM5 A;  3IR4 A;  3KD0 A;  2VLT A;  3V1W A;  3TKS A;  2DLX A;  2B5Y A;  2LUS A;  4K9Z A;  4KCA A;  1Z6M A;  3TJJ A;  1KTE A;  2ON7 A;  3BJ5 A;  2WRT A;  3TDG A;  2VD1 A;  2WZ9 A;  4XHM A;  4KW6 A;  5HFK A;  2IFQ A;  2JZS A;  1B48 A;  5HFI A;  3VLN A;  4JR4 A;  4KDU A;  3I43 A;  3EU4 A;  3UOM A;  4PUF C;  2H1A A;  5DQS A;  4HEA 2;  1PD2 1;  4TR4 A;  3LWA A;  4I2U A;  2MMN A;  4OD7 A;  2TRC P;  4IQA A;  2AJQ B;  3CMI A;  2QC7 A;  2VAF A;  5ID2 A;  1M99 A;  1AQV A;  2VOC A;  4WET A;  2ZUP A;  4HQS A;  5D73 A;  1Q98 A;  1O85 A;  4NXI A;  2YN1 A;  4KGI A;  3UIW A;  5G1K A;  2F9S A;  2QGV A;  1LU4 A;  2I81 A;  3A2W A;  4E8E A;  2H0G A;  1EV9 A;  2B1L A;  2L4Q A;  3J7Y b;  1GSF A;  5HFG A;  1DE2 A;  5HR3 A;  2DJ2 A;  3I6A A;  3IBH A;  1OKD A;  3A3T A;  4J57 E;  2VCZ A;  3KTL A;  3F4S A;  1FB6 A;  1T4Y A;  3Q18 A;  3ZFL A;  2FLS A;  1OYJ A;  3KH9 A;  3E3E A;  2DML A;  1OKT A;  3W8S A;  2V6O A;  3DEX A;  4ZIJ A;  4GSS A;  4TXO A;  2GTU A;  3D21 A;  2L6D A;  1ERW A;  4BA7 A;  4NHW A;  4XS4 A;  5B8B A;  4NV2 A;  2HSY A;  3IA1 A;  1PQN A;  1K0A A;  2M46 A;  3HCZ A;  2C0F A;  4IQ1 A;  1OVN A;  4ILF A;  4KND A;  2GZY A;  4DSS B;  2C0D A;  4ZL7 A;  2MYG A;  1PMT A;  1F2E A;  1JZD A;  3H79 A;  3EC3 A;  3HA9 A;  1J9B A;  5ABR A;  5J3R A;  3D6I A;  3IAS 2;  2JL4 A;  1ZGN A;  3HZ8 A;  3O6T A;  3EMP A;  1GNW A;  2A2R A;  2LRC A;  1QK8 A;  4IN0 A;  4EVM A;  4MF6 A;  3IHQ A;  5EL8 A;  4MLY A;  3HVX A;  2LJK A;  2WCI A;  1A8Y A;  1XOB A;  1E2Y A;  11GS A;  2HSH A;  2LKU A;  4I5Q A;  3KH7 A;  2D2Z A;  1XZO A;  2DJJ A;  3GH9 A;  4MJC A;  1VF3 A;  3ZML A;  3GKM A;  1A2M A;  4F2I A;  3RPP A;  1MD3 A;  3ZVJ D;  3KP8 A;  4H86 A;  1DE1 A;  1F9M A;  1A24 A;  3FZ4 A;  4FYB A;  3TCO A;  1MDJ A;  1ERT A;  2CQ9 A;  1SJZ A;  1TRS A;  5J9C A;  1BX9 A;  1A23 A;  2HI7 A;  1YQ1 A;  1MDI A;  4F82 A;  2PU9 C;  3IRA A;  2WB9 A;  5G30 A;  2FA4 A;  2BJX A;  5E59 A;  3EUR A;  1TKD B;  20GS A;  1WWJ A;  1QUW A;  2H76 A;  2LRT A;  4WXT A;  1X5C A;  2P31 A;  1TRU A;  3VWW A;  1S3A A;  2O87 A;  1PGT A;  4AJ7 A;  4GTU A;  4F0C A;  2KUC A;  4JZQ A;  2WDU A;  2KP1 A;  1THO A;  19GS A;  3O3T A;  3EWL A;  3ZIJ A;  2DSA A;  4TOP A;  2I9H A;  1GUM A;  4I8B A;  1PRX A;  3LYK A;  1GP1 A;  4HUA A;  1B4P A;  4NWY A;  1NSW A;  1WP0 A;  6GSU A;  5HR1 A;  4TR3 A;  2C3N A;  1FAA A;  3HVS A;  4FO5 A;  4XRD A;  2B3S A;  4MJB A;  3LFL A;  1WPI A;  4X0X A;  1K0O A;  2JAC A;  1ST9 A;  4WEY A;  4IHU A;  4O92 A;  3NZN A;  4V2M A;  2LV3 A;  2CA8 A;  22GS A;  1JZW A;  1MD4 A;  5LCZ A;  3HJP A;  2IMI A;  2LJR A;  4MA9 A;  1VF4 A;  2FGX A;  5KN1 A;  3LGC A;  1HD2 A;  4GQF A;  1NM3 A;  4N30 A;  4PX1 A;  1XVW A;  1VGL A;  1O81 A;  4PGT A;  1R26 A;  2H72 A;  4RI6 A;  1AIU A;  5IO0 A;  2E2M A;  4ML6 A;  2HXK A;  4POK A;  5C00 A;  3MSZ A;  1WRY A;  2REM A;  3BCK A;  1ERU A;  2IN3 A;  5B7C A;  1OE8 A;  3NIV A;  3C1R A;  2HLS A;  4TR0 A;  3TGZ A;  1Z9H A;  1QFN A;  1Z7P A;  3M3M A;  3FRC A;  3GSS A;  2HE3 A;  3GN3 A;  1KEB A;  1UA5 A;  2E0Q A;  3GX0 A;  4ULX A;  2ES7 A;  2H6Z A;  1BYE A;  4ZBD A;  4TW5 A;  4CW9 A;  1E6B A;  1ZZY A;  1XWB A;  4KUN A;  1U87 A;  1ZYE A;  2X8C A;  1Z5Y E;  2H1B A;  2IWT A;  2JSZ A;  4MAB A;  4O32 A;  1Z3E A;  3F0I A;  2GLR A;  1YZX A;  4ZXG A;  4KX4 A;  2YWI A;  3LSZ A;  2FA8 A;  3D4M A;  2HZE A;  2IMD A;  3G7I A;  5F05 A;  1PKZ A;  4EDY A;  2FWH A;  2JZR A;  2YV9 A;  4TR1 B;  3TRX A;  2CVB A;  4MDC A;  1SKW B;  3GRX A;  2FNO A;  1XFL A;  3FW2 A;  2WJU A;  1SYX A;  3VI5 A;  1ZYQ B;  2VCT A;  2RUF A;  2P5Q A;  1KNG A;  1GNE A;  2H1D A;  5FT3 A;  5G31 A;  4F9Z A;  2V41 A;  2MBS A;  1PSQ A;  3F8U A;  4BVX A;  1GTA A;  4FYU A;  1T8E B;  1TK8 B;  1DBY A;  4YQU A;  5JCW A;  1HNA A;  4BPY A;  2HRN A;  3APO A;  1V40 A;  2H71 A;  5FHI A;  2V1M A;  2RUE A;  3HXS A;  2FWG A;  3KP9 A;  1ZOF A;  2YWM A;  4RQX A;  3WYW A;  2B1K A;  4K0G A;  5GSS A;  2O89 A;  2H01 A;  3HZ4 A;  1YF0 A;  5ECN B;  2PVQ A;  3HKR A;  3CSI A;  2B7J A;  3D22 A;  4GRF A;  2OA7 A;  4ECB A;  2R5G A;  5CRW A;  2NTO A;  2TRX A;  4L0W A;  1S3C A;  2LS5 A;  3F4T A;  1TK0 B;  1N8J A;  2L59 A;  3ZRE A;  3AY8 A;  2V6K A;  2I1U A;  4TN8 A;  4PQI A;  2O7K A;  1SU9 A;  1PKW A;  3QCP A;  3A2V A;  4F03 A;  2VUP A;  3LQ7 A;  3KM6 A;  3NOF A;  5IOW A;  6GSS A;  4NV5 A;  4AGS A;  2H75 A;  4X43 A;  2PER A;  2KHP A;  10GS A;  5AIV A;  4Q5R A;  2LQQ A;  2FCH A;  4L8E A;  1GSU A;  4DSS A;  1VF1 A;  1ZL9 A;  3FYG A;  3UJ1 A;  4Z7X A;  2FD3 A;  1GLP A;  4DSQ A;  3S9F A;  3WGE A;  16GS A;  5ECS A;  3GL5 A;  3GUR A;  2DJ1 A;  4X1U A;  3VPQ A;  2L5L A;  3M8N A;  2YWN A;  2H0H A;  2B7K A;  4GLT A;  1F3A A;  4EL1 A;  3DML A;  2GGT A;  4IS0 A;  2L4C A;  5A4V A;  5F07 A;  4GCI A;  12GS A;  1QQ2 A;  4N11 A;  2R6K A;  4XS6 A;  1FVK A;  1M0U A;  2K8V A;  4ECC A;  2MBT A;  1GSY A;  2VCX A;  4Q5Q A;  1IYH A;  1W89 A;  3UAP A;  4V2N A;  1TJD A;  1PX6 A;  2HYX A;  1YDK A;  3CTG A;  3ERG A;  18GS A;  1T3B A;  2LNS A;  1K3L A;  1O6J A;  2IIY A;  4K1F A;  1W4V A;  2IPA A;  3TUE A;  4N10 A;  1ON4 A;  3H4K A;  3UAR A;  4DEJ A;  1V2A A;  3HJM A;  3P7X A;  2C3T A;  3M9K A;  5H5R A;  1QGV A;  4K7O A;  3RHB A;  2FY6 A;  3EMX A;  2F8F A;  2ON5 A;  2ZNM A;  1MDK A;  4MH3 A;  3HYP A;  1F6M C;  1FG4 A;  3DIE A;  4GF0 A;  3L9V A;  2MMZ A;  2XBI A;  5G2Z A;  2XPD A;  5ECM B;  3CSJ A;  2N5B A;  4BVY A;  2DC5 A;  1NW2 A;  3GL3 A;  3ZRD A;  2VL2 C;  1M9A A;  1OE7 A;  3US3 A;  6GSX A;  2GQM A;  3GUS A;  2OAC A;  4OCF A;  2QSI A;  4PQH A;  1LBK A;  4IP1 A;  2DBC A;  1YKC A;  1SKR B;  2LRN A;  3CTF A;  2OBK A;  4KSO A;  2DJK A;  3EU3 A;  1CQH A;  4WBR D;  2LJA A;  5DCH A;  1A0F A;  3PR8 A;  1OC9 A;  1B4Q A;  3QFB C;  4OWY A;  3ZTL A;  2FUG 2;  4JR6 A;  2C3Q A;  4QQ7 A;  5JWR B;  5EPF A;  5HQP A;  2GS3 A;  3KGK A;  3QMX A;  5EY6 A;  1IYI A;  1JLW A;  1X9M B;  3LG6 A;  3IE3 A;  1SK1 A;  2PUK C;  1M2D A;  2PGT A;  3DRN A;  1SL0 B;  1EZK A;  3BCI A;  4KDX A;  2E2G A;  1USB A;  1KBN A;  1SYR A;  5DDL A;  4Q5N A;  4IJ3 A;  2A2S A;  5E4W A;  5IMV A;  5HR2 A;  3BOA A;  2YJ7 A;  1M7T A;  2R4V A;  3M1G A;  3H1N A;  1H75 A;  2G2Q A;  2KLX A;  1FW1 A;  4JRR A;  3M0F A;  2HT9 A;  3TB2 A;  1T1V A;  1UN2 A;  4MPG A;  1AQX A;  3O76 A;  1OC3 A;  3WGX A;  3FEU A;  3MNG A;  3FHK A;  1O8X A;  1AC1 A;  2YZH A;  4OFN A;  4MZC A;  3Q6O A;  3GST A;  1JZO A;  1FHE A;  2YZU A;  1WJK A;  1AQW A;  5B6N A;  1U88 A;  6GSW A;  4L5L A;  2NVL A;  2IMK A;  1B9Y C;  2VL3 A;  3I9V 2;  3ZIV A;  1K0C A;  4N0V A;  5IMD A;  2E7P A;  4HDE A;  1GTI A;  2FHE A;  4ACS A;  2H74 A;  4XTS A;  4RQR A;  2G0F A;  4YQV A;  2RLI A;  4HU7 A;  5F8B A;  1FB0 A;  4CHS A;  1WOU A;  4IBP A;  2C8U A;  3U6V A;  2CZ3 A;  3L9S A;  3CBU A;  5G1L A;  1ZCP A;  4KA0 A;  1GL8 A;  1RQM A;  4Q5F A;  4F0B A;  2WS2 A;  4JU5 A;  3CSH A;  3ERW A;  5CO3 A;  3JCM L;  4TR1 A;  1TTZ A;  1SJ6 A;  2C0G A;  2H8L A;  7GSS A;  2R2J A;  5LNK e;  1JHB A;  2HRF A;  2XC2 A;  5G5F A;  1XW9 A;  1PA3 A;  3G7Y A;  3LXT A;  3DKS A;  4V1A p;  2X64 A;  1FOV A;  4TXO B;  3R2Q A;  3G7J A;  3QD9 A;  4HOJ A;  1A2J A;  4MJA A;  3GH6 A;  3P8W A;  2PBJ A;  3DVW A;  5KN0 A;  3D5J A;  1XWA A;  1Y6E A;  1XWC A;  4PUR A;  4IVF A;  3DGQ A;  2WGR A;  3RHC A;  5ECP B;  3L78 A;  1BED A;  3Q74 A;  3N9J A;  3FR9 A;  4HQZ A;  4BWQ A;  2HZF A;  4ZB6 A;  4XCS A;  2AHE A;  3TOT A;  2H1G A;  1SD8 A;  4IW9 A;  2VIM A;  4EXJ A;  3MAK A;  2MMA A;  3QOU A;  1YY7 A;  1THX A;  2DMM A;  2YNX A;  4J2F A;  2VCV A;  3GTU A;  3LOR A;  4NMU A;  3HVV A;  1YEP A;  3DYR A;  5CYY A;  3UVH A;  3IAM 2;  3IXR A;  1V58 A;  4D73 A;  1AXD A;  2M72 A;  5DJM A;  4EO3 A;  3CRT A;  2FWF A;  5COH A;  5KEJ A;  4GQC A;  5CRD A;  4WR5 A;  2M80 A;  2C80 A;  1GUH A;  2F8A A;  6GSY A;  5IMC A;  1NHO A;  1GSE A;  3HD5 A;  4EC0 A;  1AUC A;  3C73 A;  4V1A g;  2R37 A;  3P2A A;  2YJH A;  2N5F A;  3ERF A;  4HZ2 A;  2VM1 A;  5D93 A;  2GZP A;  3E0U A;  2C4J A;  4HU9 A;  4TVE A;  5CNW A;  4EF0 A;  3EVI A;  5AIS A;  1YKA A;  4KH7 A;  5D96 A;  3LEF A;  1FO5 A;  4TKY A;  1NHY A;  4I97 A;  1K3O A;  1K3Y A;  2LQO A;  4ISD A;  3SBC A;  2L5O A;  3KZQ A;  4I6X A;  2K6V A;  3N5O A;  2OE3 A;  2WFC A;  1EEJ A;  3LJR A;  4K7N A;  2YOI A;  1PL1 A;  1TI3 A;  4ZB8 A;  4ML1 A;  5F0G A;  3TKS C;  1MTC A;  2CT6 A;  4WR4 A;  3VWV A;  5DAL B;  1ERV A;  3QAG A;  2OBI A;  4PXO A;  2WUL A;  2VLU A;  2P5R A;  4IKH A;  5HR0 A;  2CAQ A;  3ME7 A;  3ZZX A;  4DVC A;  2OE0 A;  3QAV A;  4HI7 A;  1F37 A;  9GSS A;  3DD3 A;  3L0H A;  1XW6 A;  3RDW A;  3F3Q A;  3TRP A;  4IGJ A;  4AJ8 A;  4HJ2 A;  1RK4 A;  4LA1 A;  1EWX A;  2CV4 A;  3F6D A;  3P90 A;  2XBQ A;  2AYT A;  1XBS A;  2MZC A;  4G10 A;  1HQO A;  1U6T A;  1CQG A;  3QR6 A;  5ECO B;  3FKF A;  1A8L A;  1SL1 B;  1GUL A;  3UMA A;  2PPT A;  1HNB A;  4WF5 A;  2TIR A;  1LJR A;  1VF2 A;  1PL2 A;  2LTK A;  1O73 A;  3FZ5 A;  2JZT A;  1MEK A;  2A4V A;  2OJL A;  4HZ4 A;  5JCG A;  4AJ6 A;  3APQ A;  4XRA A;  2H66 A;  2LNT A;  3DVX A;  2GZZ A;  4ECI A;  3RPN A;  5ECL B;  2X8H A;  2OKA A;  3U5R E;  2K18 A;  1TOF A;  1HNC A;  4TRX A;  1EOG A;  2OAD A;  3GFK A;  4MK3 A;  5CAX A;  3UL3 A;  1Q4J A;  3W6G A;  2L57 A;  3C1S A;  3HDC A;  3TJF A;  1TI1 A;  2GST A;  3TJG A;  1GLQ A;  4HJM A;  4LL1 B;  5EVO A;  3DWV A;  1GWC A;  3F63 A;  3UVT A;  2XHF A;  5IPG A;  3ISO A;  17GS A;  4ZL8 A;  2B5X A;  2PWJ A;  1UVZ A;  2ALB A;  3QFA C;  5ECR B;  5D9W A;  4K0N A;  4FIW A;  4MH2 A;  5B8A A;  1XVQ A;  1G7O A;  4ZB9 A;  2VM2 A;  5D8I A;  3TKR A;  4CDO A;  3TKQ A;  1AW9 A;  2ZCT A;  1XXU A;  1GH2 A;  2GT5 A;  4GST A;  5DVB A;  3VUR A;  4BL7 A;  5G5E A;  3ZMK A;  4PQ1 A;  2PVO C;  3GYK A;  1EEM A;  1XIY A;  4KCE A;  1OC8 A;  4ECJ A;  1ZMA A;  2EIQ A;  1PX7 A;  2HZE B;  1SKS B;  4POB A;  1QXH A;  1FVJ A;  1XOA A;  5GAN D;  4ID0 A;  2VLV A;  3ME8 A;  4K6X A;  4BWS A;  2IMF A;  5CRE A;  1GUK A;  5AGY A;  1I5G A;  5ECI B;  3GX8 A;  3FR6 A;  1Z6N A;  2GQK A;  5L71 A;  2GSS A;  2P0G A;  2K8S A;  1O7U A;  2R3X A;  2H30 A;  3IK9 A;  2OE1 A;  1T4Z A;  3VI7 A;  5IOX A;  3HJO A;  4KSM A;  4J56 E;  2IME A;  3ZYW A;  4YAP A;  3WGD A;  4ZBA A;  1A2L A;  4OCE A;  1SEN A;  14GS A;  4FH8 A;  3F9U A;  2DIY A;  5DCG A;  4JBB A;  2V2G A;  3CRU A;  1N2A A;  1SD9 A;  5FWG A;  1PN9 A;  3GKN A;  1X0R A;  2CVD A;  3EE2 A;  4KAE A;  3WT2 A;  1R5P A;  3CYN A;  2H0I A;  2NDO A;  2X99 A;  4GWR A;  4QL9 A;  3A5W A;  4RUV A;  3KJY A;  4PNF A;  3TKP A;  1SJI A;  4EKZ A;  2GDR A;  3BBY A;  2GVP A;  2PN8 A;  5CRH A;  3KMN A;  5JWO B;  1F3B A;  1RW1 A;  2V32 A;  5J5N A;  1EP7 A;  2RM6 A;  4LL4 B;  1R4W A;  4V2L A;  3IV4 A;  5GZZ B;  4MPF A;  2AB6 A;  1EV4 A;  1R5A A;  5A5K A;  5KN2 A;  3KEB A;  3MDK A;  5DAK B;  3LYP A;  1K0M A;  3PIN A;  3H8Q A;  3C71 A;  3FZ9 A;  2CVK A;  1WMJ A;  1ABA A;  3HHV A;  4K2D A;  4DSR A;  3KMO A;  5A4W A;  4QL7 A;  2VO4 A;  3PGT A;  4OO5 A;  1Z7R A;  1X9W B;  4MZW A;  4LMV A;  1B9X C;  3ZVJ A;  4WBJ A;  2YP6 A;  2GSR A;  3QPM A;  2JSY A;  1XCC A;  2JU5 A;  5KN3 A;  1EGO A;  3PH9 A;  2YCD A;  4FYC A;  4O5R A;  4L0U A;  1M2B A;  2YPM A;  1GSQ A;  2I4A A;  1XPV A;  2Z9S A;  3F4R A;  2H19 A;  3HY2 A;  1SK0 A;  1TRW A;  1K0N A;  1GRX A;  2AUV A;  2IFQ B;  3CXG A;  4WF4 A;  2VCQ A;  2H6X A;  2B5E A;  5D9X A;  5GAP D;  4JE1 A;  4TXV A;  4EE0 A;  3FK8 A;  4OMV A;  4K8M A;  2GQL A;  2YWO A;  1V9W A;  2PMT A;  4KB3 A;  2QKE A;  5INY A;  4LLR A;  4KDY A;  5ID2 B;  2LEG A;  3LXZ A;  5J9B A;  3SWL A;  1B8X A;  1GTU A;  5H5S A;  2VL2 A;  2XPE A;  4XIH A;  2VD0 A;  3EYT A;  1TP9 A;  4G9H A;  4MZB A;  4POM A;  4HS1 A;  5D9T A;  1A0R P;  5IMZ A;  3F3R A;  2H6Y A;  1G7E A;  3GKX A;  2F51 A;  3ZLP A;  3GV1 A;  2CX4 A;  3VFI A;  2RII A;  3W8J A;  5IO2 A;  1J0F A;  2EC4 A;  1HYU A;  3MWH A;  5AIX A;  3UEM A;  3KIJ A;  5J4U A;  5DAL A;  2DJ3 A;  1XWK A;  2O8V B;  5GST A;  5JCU A;  2K9F A;  5IQY A;  3RAZ A;  1I9D A;  2B6M A;  1SK2 A;  1R7H A;  2AV4 A;  1YF1 A;  2JAD A;  1Y25 A;  5ECK B;  2I3Y A;  5B6M A;  6GSV A;  1ACV A;  3L4N A;  4XS4 B;  2HFD A;  4IEL A;  13GS A;  2CAI A;  5ECQ B;  3H93 A;  4G19 A;  5JWQ B;  3RBT A;  5F06 A;  1J08 A;  4O7H A;  2GT6 A;  1H4O A;  5IIZ A;  4ZIL A;  2H70 A;  2N5A A;  2DIZ A;  4NHZ A;  4G2E A;  3GHA A;  3WD6 A;  5IMA A;  1BJX A;  1G0T A;  1GTB A;  1OC9 B;  4AF2 A;  1DUG A;  3GMF A;  1BAY A;  3TKS E;  1WE0 A;  4PNG A;  1UC7 A;  2X8G A;  4YH2 A;  1M9B A;  2GSQ A;  5DBQ A;  3VWX A;  3BD2 A;  3GNJ A;  5A4U A;  3KTB A;  1V57 A;  1V98 A;  4RI7 A;  3FZA A;  2C1Y A;  3VK9 A;  5H5Q A;  6GST A;  3IPZ A;  1DSB A;  4ZBB A;  1ILO A;  2DJ0 A;  3FR3 A;  4IP6 A;  1TU7 A;  1TU8 A;  4LMW A;  5C04 A;  2EIO A;  3IC4 A;  5J41 A;  2BMX A;  2CX3 A;  3QDN A;  1TDI A;  3QAW A;  1O8W A;  3VPT A;  3IK7 A;  5DJL A;  4IJI A;  3FY7 A;  4KE3 A;  4MF5 A;  5IMF A;  1G6W A;  5D9V A;  3C8E A;  2LST A;  3EIN A;  3UBL A;  1JLV A;  1GSD A;  5IPH A;  4L5O A;  1ML6 A;  3I69 A;  3UBK A;  3TJK A;  4MJE A;  3DXB A;  3GA4 A;  4MMM A;  1EP8 A;  1K0D A;  3A2X A;  1JZR A;  1OAZ A;  3ZL5 A;  4OFM A;  1JFU A;  4PUA A;  3L9U A;  4YQM A;  2KP2 A;  3TRQ A;  3D4T A;  3WT1 A;  1G6Y A;  1QMV A;  1VRS D;  2C0E A;  2L6C A;  2H73 A;  1M2A A;  4P3Y B;  2VL9 A;  5ELA A;  3ED3 A;  2KOK A;  3M9J A;  3Q19 A;  1X5D A;  3APS A;  3C7M A;  1AAZ A;  5LD0 A;  1XWG A;  3GKK A;  1EOH A;  3ZFB A;  1TXX A;  1TW9 A;  4NAX A;  4I2T A;  5CRG A;  1EGR A;  1K0B A;  8GSS A;  4GXZ A;  1XW5 A;  4XS1 A;  1X9S B;  1YJ6 A;  2AAW A;  4NPB A;  4WKW A;  3F6F A;  2YV7 A;  3IOS A;  1S3D A;  2NPB A;  5DQY A;  1X5E A;  3KCM A;  5AN1 A;  2NBS A;  2BTO T;  1C72 A;  3VWU A;  2F3M A;  1YEX A;  4MP4 A;  3D0Z A;  1U3I A;  3K8N A;  3TOU A;  2EIR A;  1BG5 A;  2O85 A;  4GSN A;  3G9B A;  5ELG A;  3KXO A;  2IJY A;  2YAN A;  1SL2 B;  1T00 A;  1URM A;  2HNL A;  3IDV A;  4MF7 A;  3GTU B;  2IL3 A;  4ZL9 A;  4K7I A;  4MCU A;  3GIX A;  1GSS A;  1BQ7 A;  5IM9 A;  4OFT A;  4E8H A;  4YAV A;  3TJB A;  2FWE A;  1T7P B;  4N0Z A;  5CP1 A;  4POL A;  5DAK A;  4D73 B;  3ZIT A;  2CZ2 A;  2VCW A;  5ENU A;  4EDZ A;  4EUY A;  1U3A A;  3J7Y k;  4OO4 A;  2MMO A; 
#chains in the Genus database with same CATH topology
 2J23 A;  4JED A;  3E9J B;  2J9H A;  1TK5 B;  3OR5 A;  1WIK A;  1TRV A;  5ECH B;  2RM5 A;  3IR4 A;  3KD0 A;  2VLT A;  3V1W A;  3TKS A;  2DLX A;  2B5Y A;  2LUS A;  4K9Z A;  4KCA A;  1Z6M A;  3TJJ A;  1KTE A;  2ON7 A;  3BJ5 A;  2WRT A;  3TDG A;  2VD1 A;  2WZ9 A;  4XHM A;  4KW6 A;  5HFK A;  2IFQ A;  2JZS A;  1B48 A;  5HFI A;  3VLN A;  4JR4 A;  4KDU A;  3I43 A;  3EU4 A;  3UOM A;  4PUF C;  2H1A A;  5DQS A;  4HEA 2;  4O5U A;  1PD2 1;  4TR4 A;  1M3I A;  3LWA A;  4I2U A;  2MMN A;  4Z2U A;  4OD7 A;  2TRC P;  4IQA A;  2AJQ B;  3CMI A;  2QC7 A;  2VAF A;  5ID2 A;  1M99 A;  1AQV A;  2VOC A;  4WET A;  2ZUP A;  4HQS A;  5D73 A;  1Q98 A;  4USS A;  1O85 A;  4NXI A;  2YN1 A;  4KGI A;  3UIW A;  5G1K A;  2F9S A;  2QGV A;  1LU4 A;  2I81 A;  3A2W A;  4E8E A;  4BVX B;  2H0G A;  1EV9 A;  2B1L A;  2L4Q A;  3J7Y b;  1GSF A;  5HFG A;  1DE2 A;  5HR3 A;  2DJ2 A;  3I6A A;  3IBH A;  1ZYN A;  1OKD A;  3A3T A;  4J57 E;  2VCZ A;  3KTL A;  3F4S A;  1FB6 A;  1T4Y A;  3Q18 A;  3ZFL A;  2FLS A;  1OYJ A;  3KH9 A;  3E3E A;  2DML A;  1OKT A;  3W8S A;  2V6O A;  3DEX A;  4ZIJ A;  4GSS A;  4TXO A;  2GTU A;  3D21 A;  2L6D A;  1ERW A;  4BA7 A;  4NHW A;  4XS4 A;  5B8B A;  4NV2 A;  2HSY A;  3IA1 A;  1PQN A;  1K0A A;  2M46 A;  3HCZ A;  2C0F A;  4IQ1 A;  1OVN A;  4ILF A;  4KND A;  2GZY A;  4DSS B;  2C0D A;  4ZL7 A;  2MYG A;  1PMT A;  1F2E A;  1JZD A;  2R0P A;  3H79 A;  3EC3 A;  3HA9 A;  1J9B A;  5ABR A;  5J3R A;  3D6I A;  2QA1 A;  3IAS 2;  2JL4 A;  1ZGN A;  3HZ8 A;  3O6T A;  3EMP A;  1GNW A;  4BL7 B;  2A2R A;  2LRC A;  1QK8 A;  4IN0 A;  4EVM A;  4MF6 A;  3IHQ A;  5EL8 A;  4MLY A;  4O5Q A;  3HVX A;  2LJK A;  2WCI A;  1A8Y A;  1XOB A;  1E2Y A;  11GS A;  2HSH A;  2LKU A;  4I5Q A;  3KH7 A;  2D2Z A;  1XZO A;  2DJJ A;  3GH9 A;  4MJC A;  1VF3 A;  3ZML A;  3GKM A;  1A2M A;  4F2I A;  3RPP A;  1MD3 A;  3ZVJ D;  3KP8 A;  4H86 A;  1DE1 A;  1F9M A;  1A24 A;  3FZ4 A;  4FYB A;  3TCO A;  1MDJ A;  1ERT A;  2CQ9 A;  1SJZ A;  1TRS A;  5J9C A;  1BX9 A;  1A23 A;  2HI7 A;  1YQ1 A;  1MDI A;  4F82 A;  2PU9 C;  3IRA A;  2WB9 A;  5G30 A;  2FA4 A;  2BJX A;  5E59 A;  3EUR A;  1TKD B;  20GS A;  3PPU A;  1WWJ A;  1QUW A;  2H76 A;  2LRT A;  4BVY B;  4WXT A;  1X5C A;  3MIX A;  2P31 A;  1TRU A;  3VWW A;  1S3A A;  2O87 A;  1PGT A;  4AJ7 A;  4GTU A;  4F0C A;  2KUC A;  4JZQ A;  2WDU A;  2KP1 A;  1THO A;  19GS A;  3O3T A;  3EWL A;  3ZIJ A;  2DSA A;  4TOP A;  2I9H A;  1GUM A;  4I8B A;  1PRX A;  3LYK A;  1GP1 A;  4HUA A;  1B4P A;  4NWY A;  1NSW A;  1WP0 A;  6GSU A;  5HR1 A;  4TR3 A;  2C3N A;  1FAA A;  3HVS A;  4FO5 A;  4XRD A;  2B3S A;  4MJB A;  3LFL A;  1WPI A;  4X0X A;  1K0O A;  2JAC A;  1ST9 A;  4WEY A;  4IHU A;  4O92 A;  3NZN A;  4V2M A;  2LV3 A;  2CA8 A;  22GS A;  1JZW A;  1MD4 A;  5LCZ A;  3HJP A;  2IMI A;  2LJR A;  4MA9 A;  1VF4 A;  2FGX A;  5KN1 A;  3LGC A;  1HD2 A;  4GQF A;  1NM3 A;  4N30 A;  4PX1 A;  1XVW A;  1VGL A;  1O81 A;  4PGT A;  1R26 A;  2H72 A;  4RI6 A;  1AIU A;  5IO0 A;  4YKG A;  2E2M A;  4ML6 A;  2HXK A;  4POK A;  5C00 A;  3MSZ A;  1WRY A;  2REM A;  3BCK A;  1ERU A;  2IN3 A;  5B7C A;  1OE8 A;  3NIV A;  3C1R A;  2HLS A;  4TR0 A;  3TGZ A;  1Z9H A;  1QFN A;  1Z7P A;  3M3M A;  3FRC A;  3GSS A;  2HE3 A;  3GN3 A;  4CY6 A;  1KEB A;  1UA5 A;  2E0Q A;  3GX0 A;  4ULX A;  2ES7 A;  2H6Z A;  1BYE A;  4ZBD A;  1ZYP A;  4TW5 A;  4CW9 A;  1E6B A;  1ZZY A;  1XWB A;  2A4H A;  4KUN A;  1U87 A;  1ZYE A;  2X8C A;  1Z5Y E;  2H1B A;  2IWT A;  2JSZ A;  4MAB A;  4O32 A;  1Z3E A;  3F0I A;  2GLR A;  1YZX A;  4ZXG A;  4KX4 A;  4HSC X;  2YWI A;  3LSZ A;  2FA8 A;  3D4M A;  2HZE A;  2IMD A;  3G7I A;  5F05 A;  1PKZ A;  4G0L A;  4EDY A;  2FWH A;  2JZR A;  2YV9 A;  4TR1 B;  3TRX A;  2CVB A;  4MDC A;  1SKW B;  3GRX A;  4BIK A;  2FNO A;  1XFL A;  3FW2 A;  2WJU A;  1SYX A;  3VI5 A;  1ZYQ B;  2VCT A;  2RUF A;  2P5Q A;  1KNG A;  2DKI A;  1GNE A;  2H1D A;  5FT3 A;  5G31 A;  4F9Z A;  2V41 A;  2MBS A;  2A2P A;  1PSQ A;  3F8U A;  4BVX A;  1GTA A;  4FYU A;  1T8E B;  1TK8 B;  1DBY A;  4YQU A;  5JCW A;  1HNA A;  4BPY A;  2HRN A;  3CQF A;  3APO A;  1V40 A;  2H71 A;  4MNN A;  5FHI A;  2V1M A;  2RUE A;  3HXS A;  2FWG A;  3KP9 A;  1ZOF A;  2YWM A;  4RQX A;  3WYW A;  2B1K A;  3A5I A;  4K0G A;  5GSS A;  2O89 A;  2H01 A;  3HZ4 A;  1YF0 A;  5ECN B;  2PVQ A;  3HKR A;  3CSI A;  4YKF A;  2B7J A;  3D22 A;  4GRF A;  2OA7 A;  4ECB A;  2R5G A;  5CRW A;  2NTO A;  2TRX A;  4L0W A;  1S3C A;  2LS5 A;  3F4T A;  1TK0 B;  1N8J A;  2L59 A;  3ZRE A;  3AY8 A;  2V6K A;  2I1U A;  4TN8 A;  4PQI A;  2O7K A;  1SU9 A;  1PKW A;  3QCP A;  3A2V A;  4F03 A;  2VUP A;  3LQ7 A;  3KM6 A;  3NOF A;  5IOW A;  6GSS A;  4NV5 A;  4AGS A;  2H75 A;  4X43 A;  2PER A;  2KHP A;  10GS A;  5AIV A;  4Q5R A;  2LQQ A;  2FCH A;  4L8E A;  1GSU A;  4DSS A;  1VF1 A;  1ZL9 A;  3FYG A;  2DKH A;  3UJ1 A;  4Z7X A;  2FD3 A;  1GLP A;  4DSQ A;  3S9F A;  3WGE A;  16GS A;  5ECS A;  3GL5 A;  3GUR A;  2DJ1 A;  4X1U A;  3VPQ A;  2L5L A;  3M8N A;  2YWN A;  2H0H A;  2B7K A;  4GLT A;  2X4A A;  1F3A A;  4EL1 A;  3DML A;  2GGT A;  4IS0 A;  2L4C A;  5A4V A;  5F07 A;  4GCI A;  12GS A;  1QQ2 A;  4N11 A;  2R6K A;  4XS6 A;  1FVK A;  1M0U A;  2K8V A;  3IC8 A;  4ECC A;  2MBT A;  1GSY A;  2VCX A;  4Q5Q A;  1IYH A;  1W89 A;  3UAP A;  4V2N A;  1TJD A;  1PX6 A;  2HYX A;  1YDK A;  3CTG A;  3ERG A;  18GS A;  1T3B A;  2LNS A;  1K3L A;  1O6J A;  2IIY A;  4K1F A;  1W4V A;  2IPA A;  3TUE A;  4N10 A;  1ON4 A;  3H4K A;  3UAR A;  5KOW A;  4DEJ A;  1V2A A;  3HJM A;  2HRK A;  3P7X A;  2C3T A;  3M9K A;  5H5R A;  1QGV A;  4K7O A;  3RHB A;  2FY6 A;  3EMX A;  2F8F A;  2ON5 A;  2ZNM A;  1MDK A;  4MH3 A;  3HYP A;  1F6M C;  1FG4 A;  3DIE A;  4GF0 A;  3L9V A;  2MMZ A;  2XBI A;  5G2Z A;  2XPD A;  5ECM B;  3CSJ A;  2N5B A;  4BVY A;  2DC5 A;  1NW2 A;  3GL3 A;  3ZRD A;  2VL2 C;  1M9A A;  1OE7 A;  3US3 A;  6GSX A;  2GQM A;  3GUS A;  2OAC A;  4OCF A;  4ICY A;  2QSI A;  4PQH A;  1LBK A;  4IP1 A;  2DBC A;  1YKC A;  1SKR B;  2LRN A;  3CTF A;  2OBK A;  4KSO A;  2DJK A;  3EU3 A;  1CQH A;  4WBR D;  2LJA A;  5DCH A;  1A0F A;  3PR8 A;  1OC9 A;  1B4Q A;  3QFB C;  4OWY A;  3ZTL A;  2FUG 2;  4JR6 A;  2C3Q A;  4QQ7 A;  5JWR B;  5EPF A;  5HQP A;  2GS3 A;  3KGK A;  3QMX A;  5EY6 A;  1IYI A;  1JLW A;  1X9M B;  3LG6 A;  3IE3 A;  1SK1 A;  2PUK C;  1M2D A;  2PGT A;  3DRN A;  1SL0 B;  1EZK A;  3BCI A;  4KDX A;  2E2G A;  1USB A;  1KBN A;  1SYR A;  5DDL A;  4Q5N A;  4IJ3 A;  2A2S A;  5E4W A;  5IMV A;  5HR2 A;  3BOA A;  2YJ7 A;  1M7T A;  2R4V A;  4G0I A;  3M1G A;  3H1N A;  1H75 A;  2G2Q A;  2KLX A;  1FW1 A;  4JRR A;  3M0F A;  2HT9 A;  3TB2 A;  1T1V A;  1UN2 A;  4MPG A;  1AQX A;  3O76 A;  1OC3 A;  3WGX A;  3FEU A;  3MNG A;  3FHK A;  1O8X A;  1AC1 A;  2YZH A;  4OFN A;  4MZC A;  3Q6O A;  3GST A;  1JZO A;  1FHE A;  2YZU A;  1WJK A;  1AQW A;  5B6N A;  1U88 A;  6GSW A;  4L5L A;  2NVL A;  2IMK A;  1B9Y C;  2VL3 A;  3I9V 2;  3ZIV A;  1K0C A;  4N0V A;  5IMD A;  2E7P A;  4HDE A;  1GTI A;  2FHE A;  4ACS A;  2H74 A;  1PFO A;  4XTS A;  4RQR A;  2G0F A;  4YQV A;  5BMU A;  2RLI A;  4HU7 A;  1FB0 A;  5F8B A;  4CHS A;  1WOU A;  4IBP A;  2C8U A;  3IHG A;  3U6V A;  2CZ3 A;  3L9S A;  3CBU A;  5G1L A;  1ZCP A;  3R3E A;  4KA0 A;  1GL8 A;  1RQM A;  4Q5F A;  4F0B A;  2WS2 A;  4JU5 A;  3CSH A;  3ERW A;  5CO3 A;  3JCM L;  4TR1 A;  1TTZ A;  1SJ6 A;  2C0G A;  2H8L A;  7GSS A;  2R2J A;  5LNK e;  1JHB A;  2HRF A;  2XC2 A;  5G5F A;  1XW9 A;  1PA3 A;  3G7Y A;  3LXT A;  3DKS A;  4V1A p;  2X64 A;  1FOV A;  4TXO B;  3R2Q A;  3G7J A;  3QD9 A;  4HOJ A;  1A2J A;  4MJA A;  3GH6 A;  3P8W A;  2PBJ A;  3DVW A;  5KN0 A;  3D5J A;  1XWA A;  1Y6E A;  1XWC A;  4PUR A;  4IVF A;  3DGQ A;  2WGR A;  3RHC A;  5ECP B;  3L78 A;  1BED A;  3Q74 A;  3N9J A;  3FR9 A;  4HQZ A;  4BWQ A;  2HZF A;  4ZB6 A;  4XCS A;  2AHE A;  3TOT A;  3MYD A;  2H1G A;  1SD8 A;  4IW9 A;  2VIM A;  4EXJ A;  3MAK A;  2MMA A;  3QOU A;  1YY7 A;  1THX A;  2DMM A;  2YNX A;  4J2F A;  2VCV A;  3GTU A;  3LOR A;  4NMU A;  3HVV A;  1YEP A;  3DYR A;  5CYY A;  3UVH A;  3IAM 2;  3IXR A;  1V58 A;  4D73 A;  1AXD A;  2M72 A;  5DJM A;  4EO3 A;  3CRT A;  2FWF A;  5COH A;  5KEJ A;  4GQC A;  5CRD A;  4WR5 A;  2M80 A;  2C80 A;  1GUH A;  2F8A A;  6GSY A;  5IMC A;  1NHO A;  1GSE A;  3HD5 A;  4EC0 A;  1AUC A;  3C73 A;  4V1A g;  2R37 A;  3P2A A;  2YJH A;  2N5F A;  3ERF A;  4HZ2 A;  2VM1 A;  5D93 A;  2GZP A;  3E0U A;  2C4J A;  4HU9 A;  4TVE A;  5CNW A;  4EF0 A;  3EVI A;  5AIS A;  1YKA A;  4KH7 A;  5D96 A;  3LEF A;  1FO5 A;  4TKY A;  1NHY A;  4I97 A;  1K3O A;  1K3Y A;  2LQO A;  4ISD A;  3SBC A;  2L5O A;  3KZQ A;  4I6X A;  2K6V A;  3N5O A;  2OE3 A;  2WFC A;  1EEJ A;  3LJR A;  4K7N A;  2YOI A;  1PL1 A;  1TI3 A;  4ZB8 A;  4ML1 A;  5F0G A;  3TKS C;  1MTC A;  2CT6 A;  4WR4 A;  3VWV A;  5DAL B;  1ERV A;  3QAG A;  2OBI A;  4PXO A;  2WUL A;  2VLU A;  2P5R A;  4IKH A;  5HR0 A;  2CAQ A;  3ME7 A;  3ZZX A;  4DVC A;  2OE0 A;  3QAV A;  4HI7 A;  1F37 A;  9GSS A;  3DD3 A;  3L0H A;  1XW6 A;  3RDW A;  3F3Q A;  3TRP A;  4IGJ A;  4AJ8 A;  4HJ2 A;  1RK4 A;  4EIQ A;  4LA1 A;  1EWX A;  2CV4 A;  3F6D A;  3P90 A;  2R0G A;  2XBQ A;  2AYT A;  1XBS A;  2MZC A;  4G10 A;  1HQO A;  1U6T A;  1CQG A;  3QR6 A;  5ECO B;  3FKF A;  1A8L A;  1SL1 B;  1GUL A;  3UMA A;  2PPT A;  1HNB A;  3LW9 A;  4WF5 A;  2TIR A;  1LJR A;  1VF2 A;  1PL2 A;  2LTK A;  1O73 A;  3FZ5 A;  2JZT A;  1MEK A;  2A4V A;  2OJL A;  4HZ4 A;  5JCG A;  4AJ6 A;  3APQ A;  4XRA A;  2H66 A;  2LNT A;  3DVX A;  2GZZ A;  4ECI A;  3RPN A;  5ECL B;  2X8H A;  2OKA A;  3U5R E;  2K18 A;  1TOF A;  1HNC A;  4TRX A;  1EOG A;  2OAD A;  3GFK A;  4MK3 A;  5CAX A;  3UL3 A;  1Q4J A;  3W6G A;  2L57 A;  3C1S A;  3HDC A;  3TJF A;  1TI1 A;  2GST A;  3TJG A;  1GLQ A;  4HJM A;  4LL1 B;  5EVO A;  3DWV A;  1GWC A;  3F63 A;  3UVT A;  2XHF A;  5IPG A;  3ISO A;  17GS A;  4ZL8 A;  2B5X A;  2PWJ A;  1UVZ A;  2ALB A;  3QFA C;  5ECR B;  5D9W A;  4K0N A;  4FIW A;  4MH2 A;  5B8A A;  1XVQ A;  1G7O A;  4ZB9 A;  2VM2 A;  5D8I A;  3TKR A;  4CDO A;  3TKQ A;  1AW9 A;  2ZCT A;  1XXU A;  1GH2 A;  2GT5 A;  4GST A;  5DVB A;  3VUR A;  4BL7 A;  5G5E A;  3ZMK A;  4PQ1 A;  2PVO C;  3GYK A;  1EEM A;  1XIY A;  4KCE A;  1OC8 A;  4ECJ A;  1ZMA A;  2EIQ A;  1PX7 A;  2HZE B;  1SKS B;  4POB A;  1QXH A;  1FVJ A;  1XOA A;  4A5P A;  5GAN D;  4ID0 A;  2VLV A;  5KOX A;  3ME8 A;  4K6X A;  4BWS A;  2IMF A;  5CRE A;  1GUK A;  5AGY A;  1I5G A;  3GX8 A;  5ECI B;  4X4J A;  3FR6 A;  1Z6N A;  2GQK A;  5L71 A;  2X49 A;  2GSS A;  2P0G A;  2K8S A;  1O7U A;  2R3X A;  2H30 A;  3IK9 A;  2OE1 A;  1T4Z A;  3VI7 A;  1S3R A;  5IOX A;  3HJO A;  4KSM A;  4J56 E;  2IME A;  3ZYW A;  4YAP A;  3WGD A;  4ZBA A;  1A2L A;  4OCE A;  1SEN A;  14GS A;  4FH8 A;  3F9U A;  2DIY A;  5DCG A;  4JBB A;  2V2G A;  3CRU A;  1N2A A;  1SD9 A;  5FWG A;  1PN9 A;  3GKN A;  1X0R A;  2CVD A;  3EE2 A;  4KAE A;  3WT2 A;  1R5P A;  3CYN A;  2H0I A;  2NDO A;  2X99 A;  4GWR A;  4QL9 A;  3A5W A;  4RUV A;  3KJY A;  4PNF A;  3TKP A;  1SJI A;  4EKZ A;  2GDR A;  3BBY A;  2GVP A;  2PN8 A;  5CRH A;  3KMN A;  5JWO B;  1F3B A;  2R0C A;  1RW1 A;  2V32 A;  5J5N A;  1EP7 A;  2RM6 A;  4LL4 B;  1R4W A;  4V2L A;  3IV4 A;  5GZZ B;  4MPF A;  2AB6 A;  1EV4 A;  1R5A A;  5A5K A;  5KN2 A;  3KEB A;  3MDK A;  5DAK B;  3LYP A;  1K0M A;  3PIN A;  3H8Q A;  3C71 A;  3FZ9 A;  2CVK A;  3HVN A;  1WMJ A;  1ABA A;  3HHV A;  4K2D A;  4DSR A;  3KMO A;  2QA2 A;  5A4W A;  4QL7 A;  2VO4 A;  3PGT A;  4OO5 A;  1Z7R A;  1X9W B;  4MZW A;  4FQU A;  4LMV A;  1B9X C;  3ZVJ A;  4WBJ A;  2YP6 A;  2GSR A;  3QPM A;  2JSY A;  1XCC A;  2JU5 A;  5KN3 A;  1EGO A;  3PH9 A;  2YCD A;  4FYC A;  4O5R A;  4L0U A;  1M2B A;  2YPM A;  1GSQ A;  2I4A A;  1XPV A;  2Z9S A;  3F4R A;  2H19 A;  3HY2 A;  1SK0 A;  1PN0 A;  1TRW A;  1K0N A;  1GRX A;  2AUV A;  2IFQ B;  3CXG A;  4WF4 A;  2VCQ A;  2H6X A;  2B5E A;  5D9X A;  4K5R A;  5GAP D;  4JE1 A;  4TXV A;  4EE0 A;  3FK8 A;  4OMV A;  4K8M A;  2GQL A;  2YWO A;  1V9W A;  2PMT A;  4KB3 A;  2QKE A;  5INY A;  4LLR A;  4KDY A;  5ID2 B;  2LEG A;  3LXZ A;  5J9B A;  3SWL A;  1B8X A;  1GTU A;  5H5S A;  2VL2 A;  2XPE A;  4XIH A;  2VD0 A;  3EYT A;  1TP9 A;  4G9H A;  4MZB A;  4POM A;  4HS1 A;  5D9T A;  1A0R P;  5IMZ A;  3F3R A;  2H6Y A;  1G7E A;  3GKX A;  2F51 A;  3ZLP A;  3GV1 A;  2CX4 A;  3VFI A;  2RII A;  3W8J A;  5IO2 A;  1J0F A;  2EC4 A;  1HYU A;  3MWH A;  5AIX A;  3UEM A;  3KIJ A;  5J4U A;  5DAL A;  2DJ3 A;  1XWK A;  2O8V B;  5GST A;  5JCU A;  2K9F A;  5IQY A;  3RAZ A;  1I9D A;  2B6M A;  1SK2 A;  1R7H A;  2AV4 A;  1YF1 A;  2JAD A;  1Y25 A;  5ECK B;  2I3Y A;  5B6M A;  6GSV A;  1ACV A;  3L4N A;  4XS4 B;  4EIP A;  4CY8 A;  2HFD A;  4IEL A;  13GS A;  2CAI A;  5ECQ B;  3H93 A;  4G19 A;  5JWQ B;  3RBT A;  5F06 A;  1J08 A;  1XG8 A;  4O7H A;  2GT6 A;  2HRA A;  1H4O A;  4G0K A;  5IIZ A;  4ZIL A;  2H70 A;  2N5A A;  2DIZ A;  4NHZ A;  4G2E A;  4Z2T A;  3GHA A;  3WD6 A;  5IMA A;  1BJX A;  1G0T A;  1GTB A;  1OC9 B;  4AF2 A;  1DUG A;  3GMF A;  1BAY A;  3TKS E;  1WE0 A;  4PNG A;  1UC7 A;  2X8G A;  4YH2 A;  1M9B A;  2GSQ A;  5DBQ A;  3VWX A;  3BD2 A;  3GNJ A;  5A4U A;  3KTB A;  1V57 A;  1V98 A;  4RI7 A;  3FZA A;  2C1Y A;  3VK9 A;  5H5Q A;  6GST A;  3FMW A;  1DSB A;  3IPZ A;  4ZBB A;  1ILO A;  2DJ0 A;  2UZ8 A;  3FR3 A;  4IP6 A;  1TU7 A;  1TU8 A;  4LMW A;  5C04 A;  2EIO A;  3IC4 A;  5J41 A;  2BMX A;  2CX3 A;  3QDN A;  1TDI A;  3QAW A;  1O8W A;  3VPT A;  3IK7 A;  5DJL A;  4IJI A;  3FY7 A;  4KE3 A;  4MF5 A;  5IMF A;  1G6W A;  5D9V A;  3C8E A;  1M3J A;  2LST A;  3EIN A;  3UBL A;  1JLV A;  1GSD A;  4KF9 A;  5IPH A;  4L5O A;  4K2X A;  1ML6 A;  3I69 A;  3UBK A;  3TJK A;  4MJE A;  3DXB A;  3GA4 A;  4MMM A;  1EP8 A;  1K0D A;  3A2X A;  1JZR A;  1OAZ A;  3ZL5 A;  4OFM A;  1JFU A;  4PUA A;  3L9U A;  4YQM A;  2KP2 A;  3TRQ A;  3D4T A;  3WT1 A;  1G6Y A;  1QMV A;  1VRS D;  2C0E A;  4K5S A;  2L6C A;  2H73 A;  1M2A A;  4P3Y B;  2VL9 A;  5ELA A;  3ED3 A;  2KOK A;  3M9J A;  3Q19 A;  1X5D A;  3APS A;  3C7M A;  1AAZ A;  5LD0 A;  1XWG A;  3GKK A;  1EOH A;  3EPT A;  3ZFB A;  1TXX A;  1TW9 A;  5BRT A;  4NAX A;  4I2T A;  5CRG A;  1EGR A;  1K0B A;  8GSS A;  4GXZ A;  1XW5 A;  4XS1 A;  1X9S B;  1YJ6 A;  2AAW A;  1FOH A;  4NPB A;  4WKW A;  4PTS A;  3F6F A;  2YV7 A;  3IOS A;  1S3D A;  2NPB A;  5DQY A;  2HSM A;  1X5E A;  3KCM A;  5AN1 A;  2NBS A;  2BTO T;  1C72 A;  3VWU A;  2F3M A;  1YEX A;  4MP4 A;  3D0Z A;  1U3I A;  3K8N A;  3TOU A;  2EIR A;  1BG5 A;  2O85 A;  4GSN A;  3G9B A;  5ELG A;  3KXO A;  2IJY A;  2YAN A;  1SL2 B;  1T00 A;  1URM A;  2HNL A;  4Z2R A;  3IDV A;  4MF7 A;  3GTU B;  2IL3 A;  4ZL9 A;  4K7I A;  4MCU A;  3GIX A;  1GSS A;  1BQ7 A;  5IM9 A;  4OFT A;  4E8H A;  4YAV A;  3TJB A;  2FWE A;  1T7P B;  4N0Z A;  5CP1 A;  4POL A;  5DAK A;  4D73 B;  3ZIT A;  2CZ2 A;  2VCW A;  5ENU A;  4EDZ A;  4EUY A;  1U3A A;  3J7Y k;  4OO4 A;  2MMO A; 
#chains in the Genus database with same CATH homology
 2J23 A;  4JED A;  3E9J B;  2J9H A;  1TK5 B;  3OR5 A;  1WIK A;  1TRV A;  5ECH B;  2RM5 A;  3IR4 A;  3KD0 A;  2VLT A;  3V1W A;  3TKS A;  2DLX A;  2B5Y A;  2LUS A;  4K9Z A;  4KCA A;  1Z6M A;  3TJJ A;  1KTE A;  2ON7 A;  3BJ5 A;  2WRT A;  3TDG A;  2VD1 A;  2WZ9 A;  4XHM A;  4KW6 A;  5HFK A;  2IFQ A;  2JZS A;  1B48 A;  5HFI A;  3VLN A;  4JR4 A;  4KDU A;  3I43 A;  3EU4 A;  3UOM A;  4PUF C;  2H1A A;  5DQS A;  4HEA 2;  4O5U A;  1PD2 1;  4TR4 A;  3LWA A;  4I2U A;  2MMN A;  4Z2U A;  4OD7 A;  2TRC P;  4IQA A;  2AJQ B;  3CMI A;  2QC7 A;  2VAF A;  5ID2 A;  1M99 A;  1AQV A;  2VOC A;  4WET A;  2ZUP A;  4HQS A;  5D73 A;  1Q98 A;  4USS A;  1O85 A;  4NXI A;  2YN1 A;  4KGI A;  3UIW A;  5G1K A;  2F9S A;  2QGV A;  1LU4 A;  2I81 A;  3A2W A;  4E8E A;  4BVX B;  2H0G A;  1EV9 A;  2B1L A;  2L4Q A;  3J7Y b;  1GSF A;  5HFG A;  1DE2 A;  5HR3 A;  2DJ2 A;  3I6A A;  3IBH A;  1ZYN A;  1OKD A;  3A3T A;  4J57 E;  2VCZ A;  3KTL A;  3F4S A;  1FB6 A;  1T4Y A;  3Q18 A;  3ZFL A;  2FLS A;  1OYJ A;  3KH9 A;  3E3E A;  2DML A;  1OKT A;  3W8S A;  2V6O A;  3DEX A;  4ZIJ A;  4GSS A;  4TXO A;  2GTU A;  3D21 A;  2L6D A;  1ERW A;  4BA7 A;  4NHW A;  4XS4 A;  5B8B A;  4NV2 A;  2HSY A;  3IA1 A;  1PQN A;  1K0A A;  2M46 A;  3HCZ A;  2C0F A;  4IQ1 A;  1OVN A;  4ILF A;  4KND A;  2GZY A;  4DSS B;  2C0D A;  4ZL7 A;  2MYG A;  1PMT A;  1F2E A;  1JZD A;  2R0P A;  3H79 A;  3EC3 A;  3HA9 A;  1J9B A;  5ABR A;  5J3R A;  3D6I A;  2QA1 A;  3IAS 2;  2JL4 A;  1ZGN A;  3HZ8 A;  3O6T A;  3EMP A;  1GNW A;  4BL7 B;  2A2R A;  2LRC A;  1QK8 A;  4IN0 A;  4EVM A;  4MF6 A;  3IHQ A;  5EL8 A;  4MLY A;  4O5Q A;  3HVX A;  2LJK A;  2WCI A;  1A8Y A;  1XOB A;  1E2Y A;  11GS A;  2HSH A;  2LKU A;  4I5Q A;  3KH7 A;  2D2Z A;  1XZO A;  2DJJ A;  3GH9 A;  4MJC A;  1VF3 A;  3ZML A;  3GKM A;  1A2M A;  4F2I A;  3RPP A;  1MD3 A;  3ZVJ D;  3KP8 A;  4H86 A;  1DE1 A;  1F9M A;  1A24 A;  3FZ4 A;  4FYB A;  3TCO A;  1MDJ A;  1ERT A;  2CQ9 A;  1SJZ A;  1TRS A;  5J9C A;  1BX9 A;  1A23 A;  2HI7 A;  1YQ1 A;  1MDI A;  4F82 A;  2PU9 C;  3IRA A;  2WB9 A;  5G30 A;  2FA4 A;  2BJX A;  5E59 A;  3EUR A;  1TKD B;  20GS A;  3PPU A;  1WWJ A;  1QUW A;  2H76 A;  2LRT A;  4BVY B;  4WXT A;  1X5C A;  3MIX A;  2P31 A;  1TRU A;  3VWW A;  1S3A A;  2O87 A;  1PGT A;  4AJ7 A;  4GTU A;  4F0C A;  2KUC A;  4JZQ A;  2WDU A;  2KP1 A;  1THO A;  19GS A;  3O3T A;  3EWL A;  3ZIJ A;  2DSA A;  4TOP A;  2I9H A;  1GUM A;  4I8B A;  1PRX A;  3LYK A;  1GP1 A;  4HUA A;  1B4P A;  4NWY A;  1NSW A;  1WP0 A;  6GSU A;  5HR1 A;  4TR3 A;  2C3N A;  1FAA A;  3HVS A;  4FO5 A;  4XRD A;  2B3S A;  4MJB A;  3LFL A;  1WPI A;  4X0X A;  1K0O A;  2JAC A;  1ST9 A;  4WEY A;  4IHU A;  4O92 A;  3NZN A;  4V2M A;  2LV3 A;  2CA8 A;  22GS A;  1JZW A;  1MD4 A;  5LCZ A;  3HJP A;  2IMI A;  2LJR A;  4MA9 A;  1VF4 A;  2FGX A;  5KN1 A;  3LGC A;  1HD2 A;  4GQF A;  1NM3 A;  4N30 A;  4PX1 A;  1XVW A;  1VGL A;  1O81 A;  4PGT A;  1R26 A;  2H72 A;  4RI6 A;  1AIU A;  5IO0 A;  4YKG A;  2E2M A;  4ML6 A;  2HXK A;  4POK A;  5C00 A;  3MSZ A;  1WRY A;  2REM A;  3BCK A;  1ERU A;  2IN3 A;  5B7C A;  1OE8 A;  3NIV A;  3C1R A;  2HLS A;  4TR0 A;  3TGZ A;  1Z9H A;  1QFN A;  1Z7P A;  3M3M A;  3FRC A;  3GSS A;  2HE3 A;  3GN3 A;  4CY6 A;  1KEB A;  1UA5 A;  2E0Q A;  3GX0 A;  4ULX A;  2ES7 A;  2H6Z A;  1BYE A;  4ZBD A;  1ZYP A;  4TW5 A;  4CW9 A;  1E6B A;  1ZZY A;  1XWB A;  2A4H A;  4KUN A;  1U87 A;  1ZYE A;  2X8C A;  1Z5Y E;  2H1B A;  2IWT A;  2JSZ A;  4MAB A;  4O32 A;  1Z3E A;  3F0I A;  2GLR A;  1YZX A;  4ZXG A;  4KX4 A;  2YWI A;  3LSZ A;  2FA8 A;  3D4M A;  2HZE A;  2IMD A;  3G7I A;  5F05 A;  1PKZ A;  4G0L A;  4EDY A;  2FWH A;  2JZR A;  2YV9 A;  4TR1 B;  3TRX A;  2CVB A;  4MDC A;  1SKW B;  3GRX A;  2FNO A;  1XFL A;  3FW2 A;  2WJU A;  1SYX A;  3VI5 A;  1ZYQ B;  2VCT A;  2RUF A;  2P5Q A;  1KNG A;  2DKI A;  1GNE A;  2H1D A;  5FT3 A;  5G31 A;  4F9Z A;  2V41 A;  2MBS A;  2A2P A;  1PSQ A;  3F8U A;  4BVX A;  1GTA A;  4FYU A;  1T8E B;  1TK8 B;  1DBY A;  4YQU A;  5JCW A;  1HNA A;  4BPY A;  2HRN A;  3APO A;  1V40 A;  2H71 A;  4MNN A;  5FHI A;  2V1M A;  2RUE A;  3HXS A;  2FWG A;  3KP9 A;  1ZOF A;  2YWM A;  4RQX A;  3WYW A;  2B1K A;  3A5I A;  4K0G A;  5GSS A;  2O89 A;  2H01 A;  3HZ4 A;  1YF0 A;  5ECN B;  2PVQ A;  3HKR A;  3CSI A;  4YKF A;  2B7J A;  3D22 A;  4GRF A;  2OA7 A;  4ECB A;  2R5G A;  5CRW A;  2NTO A;  2TRX A;  4L0W A;  1S3C A;  2LS5 A;  3F4T A;  1TK0 B;  1N8J A;  2L59 A;  3ZRE A;  3AY8 A;  2V6K A;  2I1U A;  4TN8 A;  4PQI A;  2O7K A;  1SU9 A;  1PKW A;  3QCP A;  3A2V A;  4F03 A;  2VUP A;  3LQ7 A;  3KM6 A;  3NOF A;  5IOW A;  6GSS A;  4NV5 A;  4AGS A;  2H75 A;  4X43 A;  2PER A;  2KHP A;  10GS A;  5AIV A;  4Q5R A;  2LQQ A;  2FCH A;  4L8E A;  1GSU A;  4DSS A;  1VF1 A;  1ZL9 A;  3FYG A;  2DKH A;  3UJ1 A;  4Z7X A;  2FD3 A;  1GLP A;  4DSQ A;  3S9F A;  3WGE A;  16GS A;  5ECS A;  3GL5 A;  3GUR A;  2DJ1 A;  4X1U A;  3VPQ A;  2L5L A;  3M8N A;  2YWN A;  2H0H A;  2B7K A;  4GLT A;  2X4A A;  1F3A A;  4EL1 A;  3DML A;  2GGT A;  4IS0 A;  2L4C A;  5A4V A;  5F07 A;  4GCI A;  12GS A;  1QQ2 A;  4N11 A;  2R6K A;  4XS6 A;  1FVK A;  1M0U A;  2K8V A;  3IC8 A;  4ECC A;  2MBT A;  1GSY A;  2VCX A;  4Q5Q A;  1IYH A;  1W89 A;  3UAP A;  4V2N A;  1TJD A;  1PX6 A;  2HYX A;  1YDK A;  3CTG A;  3ERG A;  18GS A;  1T3B A;  2LNS A;  1K3L A;  1O6J A;  2IIY A;  4K1F A;  1W4V A;  2IPA A;  3TUE A;  4N10 A;  1ON4 A;  3H4K A;  3UAR A;  5KOW A;  4DEJ A;  1V2A A;  3HJM A;  2HRK A;  3P7X A;  2C3T A;  3M9K A;  5H5R A;  1QGV A;  4K7O A;  3RHB A;  2FY6 A;  3EMX A;  2F8F A;  2ON5 A;  2ZNM A;  1MDK A;  4MH3 A;  3HYP A;  1F6M C;  1FG4 A;  3DIE A;  4GF0 A;  3L9V A;  2MMZ A;  2XBI A;  5G2Z A;  2XPD A;  5ECM B;  3CSJ A;  2N5B A;  4BVY A;  2DC5 A;  1NW2 A;  3GL3 A;  3ZRD A;  2VL2 C;  1M9A A;  1OE7 A;  3US3 A;  6GSX A;  2GQM A;  3GUS A;  2OAC A;  4OCF A;  4ICY A;  2QSI A;  4PQH A;  1LBK A;  4IP1 A;  2DBC A;  1YKC A;  1SKR B;  2LRN A;  3CTF A;  2OBK A;  4KSO A;  2DJK A;  3EU3 A;  1CQH A;  4WBR D;  2LJA A;  5DCH A;  1A0F A;  3PR8 A;  1OC9 A;  1B4Q A;  3QFB C;  4OWY A;  3ZTL A;  2FUG 2;  4JR6 A;  2C3Q A;  4QQ7 A;  5JWR B;  5EPF A;  5HQP A;  2GS3 A;  3KGK A;  3QMX A;  5EY6 A;  1IYI A;  1JLW A;  1X9M B;  3LG6 A;  3IE3 A;  1SK1 A;  2PUK C;  1M2D A;  2PGT A;  3DRN A;  1SL0 B;  1EZK A;  3BCI A;  4KDX A;  2E2G A;  1USB A;  1KBN A;  1SYR A;  5DDL A;  4Q5N A;  4IJ3 A;  2A2S A;  5E4W A;  5IMV A;  5HR2 A;  3BOA A;  2YJ7 A;  1M7T A;  2R4V A;  4G0I A;  3M1G A;  3H1N A;  1H75 A;  2G2Q A;  2KLX A;  1FW1 A;  4JRR A;  3M0F A;  2HT9 A;  3TB2 A;  1T1V A;  1UN2 A;  4MPG A;  1AQX A;  3O76 A;  1OC3 A;  3WGX A;  3FEU A;  3MNG A;  3FHK A;  1O8X A;  1AC1 A;  2YZH A;  4OFN A;  4MZC A;  3Q6O A;  3GST A;  1JZO A;  1FHE A;  2YZU A;  1WJK A;  1AQW A;  5B6N A;  1U88 A;  6GSW A;  4L5L A;  2NVL A;  2IMK A;  1B9Y C;  2VL3 A;  3I9V 2;  3ZIV A;  1K0C A;  4N0V A;  5IMD A;  2E7P A;  4HDE A;  1GTI A;  2FHE A;  4ACS A;  2H74 A;  4XTS A;  4RQR A;  2G0F A;  4YQV A;  5BMU A;  2RLI A;  4HU7 A;  1FB0 A;  5F8B A;  4CHS A;  1WOU A;  4IBP A;  2C8U A;  3IHG A;  3U6V A;  2CZ3 A;  3L9S A;  3CBU A;  5G1L A;  1ZCP A;  3R3E A;  4KA0 A;  1GL8 A;  1RQM A;  4Q5F A;  4F0B A;  2WS2 A;  4JU5 A;  3CSH A;  3ERW A;  5CO3 A;  3JCM L;  4TR1 A;  1TTZ A;  1SJ6 A;  2C0G A;  2H8L A;  7GSS A;  2R2J A;  5LNK e;  1JHB A;  2HRF A;  2XC2 A;  5G5F A;  1XW9 A;  1PA3 A;  3G7Y A;  3LXT A;  3DKS A;  4V1A p;  2X64 A;  1FOV A;  4TXO B;  3R2Q A;  3G7J A;  3QD9 A;  4HOJ A;  1A2J A;  4MJA A;  3GH6 A;  3P8W A;  2PBJ A;  3DVW A;  5KN0 A;  3D5J A;  1XWA A;  1Y6E A;  1XWC A;  4PUR A;  4IVF A;  3DGQ A;  2WGR A;  3RHC A;  5ECP B;  3L78 A;  1BED A;  3Q74 A;  3N9J A;  3FR9 A;  4HQZ A;  4BWQ A;  2HZF A;  4ZB6 A;  4XCS A;  2AHE A;  3TOT A;  3MYD A;  2H1G A;  1SD8 A;  4IW9 A;  2VIM A;  4EXJ A;  3MAK A;  2MMA A;  3QOU A;  1YY7 A;  1THX A;  2DMM A;  2YNX A;  4J2F A;  2VCV A;  3GTU A;  3LOR A;  4NMU A;  3HVV A;  1YEP A;  3DYR A;  5CYY A;  3UVH A;  3IAM 2;  3IXR A;  1V58 A;  4D73 A;  1AXD A;  2M72 A;  5DJM A;  4EO3 A;  3CRT A;  2FWF A;  5COH A;  5KEJ A;  4GQC A;  5CRD A;  4WR5 A;  2M80 A;  2C80 A;  1GUH A;  2F8A A;  6GSY A;  5IMC A;  1NHO A;  1GSE A;  3HD5 A;  4EC0 A;  1AUC A;  3C73 A;  4V1A g;  2R37 A;  3P2A A;  2YJH A;  2N5F A;  3ERF A;  4HZ2 A;  2VM1 A;  5D93 A;  2GZP A;  3E0U A;  2C4J A;  4HU9 A;  4TVE A;  5CNW A;  4EF0 A;  3EVI A;  5AIS A;  1YKA A;  4KH7 A;  5D96 A;  3LEF A;  1FO5 A;  4TKY A;  1NHY A;  4I97 A;  1K3O A;  1K3Y A;  2LQO A;  4ISD A;  3SBC A;  2L5O A;  3KZQ A;  4I6X A;  2K6V A;  3N5O A;  2OE3 A;  2WFC A;  1EEJ A;  3LJR A;  4K7N A;  2YOI A;  1PL1 A;  1TI3 A;  4ZB8 A;  4ML1 A;  5F0G A;  3TKS C;  1MTC A;  2CT6 A;  4WR4 A;  3VWV A;  5DAL B;  1ERV A;  3QAG A;  2OBI A;  4PXO A;  2WUL A;  2VLU A;  2P5R A;  4IKH A;  5HR0 A;  2CAQ A;  3ME7 A;  3ZZX A;  4DVC A;  2OE0 A;  3QAV A;  4HI7 A;  1F37 A;  9GSS A;  3DD3 A;  3L0H A;  1XW6 A;  3RDW A;  3F3Q A;  3TRP A;  4IGJ A;  4AJ8 A;  4HJ2 A;  1RK4 A;  4EIQ A;  4LA1 A;  1EWX A;  2CV4 A;  3F6D A;  3P90 A;  2R0G A;  2XBQ A;  2AYT A;  1XBS A;  2MZC A;  4G10 A;  1HQO A;  1U6T A;  1CQG A;  3QR6 A;  5ECO B;  3FKF A;  1A8L A;  1SL1 B;  1GUL A;  3UMA A;  2PPT A;  1HNB A;  3LW9 A;  4WF5 A;  2TIR A;  1LJR A;  1VF2 A;  1PL2 A;  2LTK A;  1O73 A;  3FZ5 A;  2JZT A;  1MEK A;  2A4V A;  2OJL A;  4HZ4 A;  5JCG A;  4AJ6 A;  3APQ A;  4XRA A;  2H66 A;  2LNT A;  3DVX A;  2GZZ A;  4ECI A;  3RPN A;  5ECL B;  2X8H A;  2OKA A;  3U5R E;  2K18 A;  1TOF A;  1HNC A;  4TRX A;  1EOG A;  2OAD A;  3GFK A;  4MK3 A;  5CAX A;  3UL3 A;  1Q4J A;  3W6G A;  2L57 A;  3C1S A;  3HDC A;  3TJF A;  1TI1 A;  2GST A;  3TJG A;  1GLQ A;  4HJM A;  4LL1 B;  5EVO A;  3DWV A;  1GWC A;  3F63 A;  3UVT A;  2XHF A;  5IPG A;  3ISO A;  17GS A;  4ZL8 A;  2B5X A;  2PWJ A;  1UVZ A;  2ALB A;  3QFA C;  5ECR B;  5D9W A;  4K0N A;  4FIW A;  4MH2 A;  5B8A A;  1XVQ A;  1G7O A;  4ZB9 A;  2VM2 A;  5D8I A;  3TKR A;  4CDO A;  3TKQ A;  1AW9 A;  2ZCT A;  1XXU A;  1GH2 A;  2GT5 A;  4GST A;  5DVB A;  3VUR A;  4BL7 A;  5G5E A;  3ZMK A;  4PQ1 A;  2PVO C;  3GYK A;  1EEM A;  1XIY A;  4KCE A;  1OC8 A;  4ECJ A;  1ZMA A;  2EIQ A;  1PX7 A;  2HZE B;  1SKS B;  4POB A;  1QXH A;  1FVJ A;  1XOA A;  4A5P A;  5GAN D;  4ID0 A;  2VLV A;  5KOX A;  3ME8 A;  4K6X A;  4BWS A;  2IMF A;  5CRE A;  1GUK A;  5AGY A;  1I5G A;  3GX8 A;  5ECI B;  4X4J A;  3FR6 A;  1Z6N A;  2GQK A;  5L71 A;  2X49 A;  2GSS A;  2P0G A;  2K8S A;  1O7U A;  2R3X A;  2H30 A;  3IK9 A;  2OE1 A;  1T4Z A;  3VI7 A;  5IOX A;  3HJO A;  4KSM A;  4J56 E;  2IME A;  3ZYW A;  4YAP A;  3WGD A;  4ZBA A;  1A2L A;  4OCE A;  1SEN A;  14GS A;  4FH8 A;  3F9U A;  2DIY A;  5DCG A;  4JBB A;  2V2G A;  3CRU A;  1N2A A;  1SD9 A;  5FWG A;  1PN9 A;  3GKN A;  1X0R A;  2CVD A;  3EE2 A;  4KAE A;  3WT2 A;  1R5P A;  3CYN A;  2H0I A;  2NDO A;  2X99 A;  4GWR A;  4QL9 A;  3A5W A;  4RUV A;  3KJY A;  4PNF A;  3TKP A;  1SJI A;  4EKZ A;  2GDR A;  3BBY A;  2GVP A;  2PN8 A;  5CRH A;  3KMN A;  5JWO B;  1F3B A;  2R0C A;  1RW1 A;  2V32 A;  5J5N A;  1EP7 A;  2RM6 A;  4LL4 B;  1R4W A;  4V2L A;  3IV4 A;  5GZZ B;  4MPF A;  2AB6 A;  1EV4 A;  1R5A A;  5A5K A;  5KN2 A;  3KEB A;  3MDK A;  5DAK B;  3LYP A;  1K0M A;  3PIN A;  3H8Q A;  3C71 A;  3FZ9 A;  2CVK A;  1WMJ A;  1ABA A;  3HHV A;  4K2D A;  4DSR A;  3KMO A;  2QA2 A;  5A4W A;  4QL7 A;  2VO4 A;  3PGT A;  4OO5 A;  1Z7R A;  1X9W B;  4MZW A;  4FQU A;  4LMV A;  1B9X C;  3ZVJ A;  4WBJ A;  2YP6 A;  2GSR A;  3QPM A;  2JSY A;  1XCC A;  2JU5 A;  5KN3 A;  1EGO A;  3PH9 A;  2YCD A;  4FYC A;  4O5R A;  4L0U A;  1M2B A;  2YPM A;  1GSQ A;  2I4A A;  1XPV A;  2Z9S A;  3F4R A;  2H19 A;  3HY2 A;  1SK0 A;  1PN0 A;  1TRW A;  1K0N A;  1GRX A;  2AUV A;  2IFQ B;  3CXG A;  4WF4 A;  2VCQ A;  2H6X A;  2B5E A;  5D9X A;  4K5R A;  5GAP D;  4JE1 A;  4TXV A;  4EE0 A;  3FK8 A;  4OMV A;  4K8M A;  2GQL A;  2YWO A;  1V9W A;  2PMT A;  4KB3 A;  2QKE A;  5INY A;  4LLR A;  4KDY A;  5ID2 B;  2LEG A;  3LXZ A;  5J9B A;  3SWL A;  1B8X A;  1GTU A;  5H5S A;  2VL2 A;  2XPE A;  4XIH A;  2VD0 A;  3EYT A;  1TP9 A;  4G9H A;  4MZB A;  4POM A;  4HS1 A;  5D9T A;  1A0R P;  5IMZ A;  3F3R A;  2H6Y A;  1G7E A;  3GKX A;  2F51 A;  3ZLP A;  3GV1 A;  2CX4 A;  3VFI A;  2RII A;  3W8J A;  5IO2 A;  1J0F A;  2EC4 A;  1HYU A;  3MWH A;  5AIX A;  3UEM A;  3KIJ A;  5J4U A;  5DAL A;  2DJ3 A;  1XWK A;  2O8V B;  5GST A;  5JCU A;  2K9F A;  5IQY A;  3RAZ A;  1I9D A;  2B6M A;  1SK2 A;  1R7H A;  2AV4 A;  1YF1 A;  2JAD A;  1Y25 A;  5ECK B;  2I3Y A;  5B6M A;  6GSV A;  1ACV A;  3L4N A;  4XS4 B;  4EIP A;  4CY8 A;  2HFD A;  4IEL A;  13GS A;  2CAI A;  5ECQ B;  3H93 A;  4G19 A;  5JWQ B;  3RBT A;  5F06 A;  1J08 A;  4O7H A;  2GT6 A;  2HRA A;  1H4O A;  4G0K A;  5IIZ A;  4ZIL A;  2H70 A;  2N5A A;  2DIZ A;  4NHZ A;  4G2E A;  4Z2T A;  3GHA A;  3WD6 A;  5IMA A;  1BJX A;  1G0T A;  1GTB A;  1OC9 B;  4AF2 A;  1DUG A;  3GMF A;  1BAY A;  3TKS E;  1WE0 A;  4PNG A;  1UC7 A;  2X8G A;  4YH2 A;  1M9B A;  2GSQ A;  5DBQ A;  3VWX A;  3BD2 A;  3GNJ A;  5A4U A;  3KTB A;  1V57 A;  1V98 A;  4RI7 A;  3FZA A;  2C1Y A;  3VK9 A;  5H5Q A;  6GST A;  3FMW A;  1DSB A;  3IPZ A;  4ZBB A;  1ILO A;  2DJ0 A;  2UZ8 A;  3FR3 A;  4IP6 A;  1TU7 A;  1TU8 A;  4LMW A;  5C04 A;  2EIO A;  3IC4 A;  5J41 A;  2BMX A;  2CX3 A;  3QDN A;  1TDI A;  3QAW A;  1O8W A;  3VPT A;  3IK7 A;  5DJL A;  4IJI A;  3FY7 A;  4KE3 A;  4MF5 A;  5IMF A;  1G6W A;  5D9V A;  3C8E A;  2LST A;  3EIN A;  3UBL A;  1JLV A;  1GSD A;  4KF9 A;  5IPH A;  4L5O A;  4K2X A;  1ML6 A;  3I69 A;  3UBK A;  3TJK A;  4MJE A;  3DXB A;  3GA4 A;  4MMM A;  1EP8 A;  1K0D A;  3A2X A;  1JZR A;  1OAZ A;  3ZL5 A;  4OFM A;  1JFU A;  4PUA A;  3L9U A;  4YQM A;  2KP2 A;  3TRQ A;  3D4T A;  3WT1 A;  1G6Y A;  1QMV A;  1VRS D;  2C0E A;  4K5S A;  2L6C A;  2H73 A;  1M2A A;  4P3Y B;  2VL9 A;  5ELA A;  3ED3 A;  2KOK A;  3M9J A;  3Q19 A;  1X5D A;  3APS A;  3C7M A;  1AAZ A;  5LD0 A;  1XWG A;  3GKK A;  1EOH A;  3EPT A;  3ZFB A;  1TXX A;  1TW9 A;  5BRT A;  4NAX A;  4I2T A;  5CRG A;  1EGR A;  1K0B A;  8GSS A;  4GXZ A;  1XW5 A;  4XS1 A;  1X9S B;  1YJ6 A;  2AAW A;  1FOH A;  4NPB A;  4WKW A;  4PTS A;  3F6F A;  2YV7 A;  3IOS A;  1S3D A;  2NPB A;  5DQY A;  2HSM A;  1X5E A;  3KCM A;  5AN1 A;  2NBS A;  2BTO T;  1C72 A;  3VWU A;  2F3M A;  1YEX A;  4MP4 A;  3D0Z A;  1U3I A;  3K8N A;  3TOU A;  2EIR A;  1BG5 A;  2O85 A;  4GSN A;  3G9B A;  5ELG A;  3KXO A;  2IJY A;  2YAN A;  1SL2 B;  1T00 A;  1URM A;  2HNL A;  4Z2R A;  3IDV A;  4MF7 A;  3GTU B;  2IL3 A;  4ZL9 A;  4K7I A;  4MCU A;  3GIX A;  1GSS A;  1BQ7 A;  5IM9 A;  4OFT A;  4E8H A;  4YAV A;  3TJB A;  2FWE A;  1T7P B;  4N0Z A;  5CP1 A;  4POL A;  5DAK A;  4D73 B;  3ZIT A;  2CZ2 A;  2VCW A;  5ENU A;  4EDZ A;  4EUY A;  1U3A A;  3J7Y k;  4OO4 A;  2MMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...