1SKSB

Binary 3' complex of t7 dna polymerase with a dna primer/template containing a cis-syn thymine dimer on the template
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
b'KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*C*GP*GP*CP*CP*AP*GP*TP*GP*C
publication title Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase/electron transport/dna
total genus 27
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1sksB00
2E2GA 2IMFA 2X64A 3QCPA 1SL0B 4WBRD 1DBYA 1ACVA 1J0FA 4GF0A 4ZL7A 5CRDA 2ZNMA 3ZFBA 1TK5B 3K8NA 3TRXA 2FWGA 3D0ZA 2M46A 1X0RA 5CYYA 3RHBA 5J9CA 3M3MA 3RPNA 2FHEA 2CX4A 2H70A 2GTUA 4POLA 2YWNA 1ERWA 2VL3A 4EL1A 4EF0A 3JCML 3UEMA 3O6TA 12GSA 5IO2A 3ME8A 4BWQA 4NHWA 4GWRA 1X9SB 1GNEA 2CVBA 1O81A 4G19A 5ECPB 4XRDA 1H75A 2E7PA 1OC9A 5KN2A 2CQ9A 2VCVA 1PN9A 3NIVA 4NAXA 1FVKA 5HR3A 2LJAA 4K0NA 2JL4A 1ZOFA 3BCIA 6GSYA 4LMVA 3ME7A 4RI6A 5F06A 5D9VA 1GSUA 5GSTA 3LXZA 2GQLA 3IA1A 2HZEA 1WIKA 5COHA 5G1KA 4BA7A 3QPMA 5A4UA 2B1LA 2B3SA 4XRAA 1TI1A 3UVHA 1HNBA 1QGVA 2PVQA 2IWTA 2I81A 3IDVA 3RDWA 4XTSA 4PNGA 1A2JA 1XOAA 5HFIA 1MDKA 3VLNA 1HNAA 3FW2A 22GSA 2VCWA 2EIOA 4IJIA 1EOHA 1XOBA 3FR9A 1GSYA 2ZCTA 3BBYA 4TKYA 3HD5A 1U88A 3IV4A 4HI7A 2J23A 3HHVA 3GKKA 5D9XA 1PKZA 4MPGA 1PA3A 2C1YA 1OKTA 1VF1A 4TN8A 3UBKA 6GSUA 2A4VA 1RQMA 3NZNA 5LNKe 3I43A 3HJOA 4KDUA 4HJ2A 4JEDA 1VRSD 5ECNB 1ML6A 1OVNA 1Z5YE 2FD3A 1VF4A 2HXKA 1ZZYA 2FGXA 1WOUA 1BAYA 3F4SA 5J3RA 5ENUA 3GV1A 2GDRA 1ZYQB 2CX3A 2JSYA 2QC7A 2LNSA 1SK0A 4LMWA 4KGIA 4TR4A 1DSBA 2RLIA 1SK1A 3LFLA 1QQ2A 4YQVA 2HT9A 5DJMA 3ZYWA 5A4WA 5DBQA 2K9FA 1ZGNA 1XXUA 3W6GA 4JE1A 1XW5A 1XFLA 3DGQA 3L0HA 5JWOB 3EC3A 5IM9A 1HYUA 1XWGA 2CVDA 2LRNA 4I97A 1NW2A 4PUAA 1J9BA 1OC9B 2YANA 1THOA 4J2FA 1Q98A 2BMXA 2DJ3A 1X9MB 1Z9HA 4POBA 1G7EA 5B8AA 3TJKA 3E3EA 3KTBA 2IMKA 2H19A 1A0RP 4OFTA 4AF2A 4XCSA 4J56E 3GKXA 5CREA 2WB9A 3QAWA 3IOSA 3HXSA 2KP1A 5G1LA 5CAXA 1XPVA 3HY2A 1Z6MA 3VFIA 1URMA 5E59A 2L4QA 1J08A 2WS2A 5H5RA 3HVXA 3RPPA 1XW9A 3ZVJA 2P31A 2CZ2A 2ZUPA 1MD4A 3C1RA 2FA4A 1B8XA 3NOFA 1F9MA 1FVJA 1ABAA 4WF4A 4DEJA 2DBCA 4N30A 3UIWA 1EOGA 3VI7A 2L6DA 3QR6A 1M2BA 3TB2A 3ZMKA 4ZL8A 2CV4A 1YEPA 2DJ1A 4WF5A 1TU8A 4MDCA 2IIYA 2H1BA 1V57A 3PR8A 1ZMAA 3Q18A 1KTEA 3UOMA 2HYXA 4GLTA 2LRCA 4MH2A 4Z7XA 2VL2A 2JSZA 4GCIA 4EVMA 5JWRB 4ULXA 2MBSA 2MMOA 4XIHA 2B6MA 2VO4A 1Z7RA 4YAPA 3F8UA 3CSIA 5IMFA 5IOWA 2IPAA 4D73A 4HEA2 2OACA 1TU7A 1HD2A 4MZCA 2YPMA 2PMTA 4PQ1A 1JLWA 5ECMB 4BWSA 1SKRB 1GWCA 5GZZB 1B9YC 1TRVA 4FYCA 3ZREA 5F05A 2H76A 4V2LA 2R3XA 3FZ4A 1FHEA 2H01A 4TR1B 3EU3A 4LL4B 2E0QA 1OC3A 1OE8A 4EE0A 4F03A 1PMTA 4OCEA 1A8YA 1E6BA 3PGTA 2FA8A 2PU9C 4IJ3A 5IMCA 3A2XA 4ZBAA 4G10A 2QKEA 2CZ3A 3LWAA 2GZZA 1G7OA 3TKSC 1GLPA 2B1KA 5ELAA 1PGTA 4AJ7A 3CBUA 2C4JA 3FK8A 4MMMA 2YN1A 2CAQA 2O7KA 2L4CA 4K7OA 2H0IA 1AQVA 4TR0A 1R5PA 3F0IA 16GSA 5AN1A 1JZRA 2EC4A 4P3YB 1PD21 4MF5A 3HJMA 5EL8A 2JU5A 4YAVA 5IMZA 2PUKC 3KCMA 3ERGA 4AJ6A 1IYIA 1O6JA 1W89A 3J7Yk 2IFQA 1F3AA 4Q5QA 4F2IA 3H8QA 3TCOA 2WDUA 1XVQA 4POMA 4XHMA 1U87A 2FNOA 3F6FA 3L9VA 4JR6A 1GULA 1O8WA 1RK4A 2YWOA 4RI7A 2LQOA 1I9DA 1PL1A 4MLYA 2RIIA 1LU4A 4LLRA 3TDGA 1T1VA 2FWEA 1A2LA 4MABA 1GSQA 3HZ8A 4L5OA 3E0UA 4MF7A 4F9ZA 1Z6NA 2C3NA 4NV2A 3FY7A 3HYPA 1TRSA 5INYA 1VF3A 3APSA 3S9FA 4V1Ag 3PH9A 4ZIJA 1GTBA 3EE2A 2RM5A 2HLSA 4Q5FA 4GQFA 4PURA 3TKRA 4CDOA 2B5XA 3FEUA 5HR1A 3M9KA 1DUGA 2DJ0A 1PSQA 3GL5A 5J5NA 5EY6A 1XIYA 4KB3A 2AB6A 3C73A 1GRXA 3EMPA 3A2WA 4ECJA 1JFUA 4IS0A 4OFNA 3M8NA 1TTZA 3D6IA 2O8VB 2N5BA 4MA9A 2IL3A 2OBKA 3EWLA 3EURA 2LS5A 5GAND 2KUCA 1M7TA 1MDJA 2ON5A 3ZIJA 4L8EA 1PQNA 1B9XC 2GZPA 2HRNA 5DJLA 1OAZA 1K0MA 3GFKA 3GN3A 2GSSA 4MJEA 1T8EB 18GSA 11GSA 3BD2A 1ON4A 2XPEA 2LNTA 1FOVA 3UJ1A 1EZKA 3TKPA 5F0GA 2AHEA 5AGYA 1VF2A 1EEMA 2LQQA 4MF6A 4X0XA 1BQ7A 2H30A 2CVKA 2DMMA 2IFQB 2A2SA 2QGVA 1K0CA 3DEXA 4QQ7A 2H73A 2HSYA 1YKCA 1K3OA 1NM3A 3H4KA 1GL8A 5E4WA 4IBPA 1UN2A 3F6DA 1V2AA 4MZBA 2AYTA 3UARA 4PQHA 4K7NA 1GSEA 1KBNA 3N5OA 1K0DA 2YV9A 3LSZA 1TP9A 3LQ7A 5IMDA 3MWHA 2GGTA 2GQKA 4GSNA 4FO5A 2GSRA 5J41A 2R37A 2GSTA 17GSA 3WT1A 3G7YA 4KCEA 3V1WA 4E8HA 2HNLA 2LJKA 4ML6A 5CRHA 5DQSA 3LEFA 2LSTA 5C00A 3IK9A 3ZFLA 4XS6A 3ZRDA 2H8LA 3I69A 4O7HA 2I9HA 3QOUA 1ERTA 4F82A 1AIUA 2G2QA 1S3DA 3LGCA 2VIMA 1GP1A 4JZQA 3I9V2 2H1AA 4Q5NA 1GUHA 3RAZA 3WYWA 5B6NA 2LJRA 1XBSA 4RQXA 5D8IA 3HVSA 2YWIA 2O85A 6GSWA 2H0GA 5JCWA 1T4YA 1O7UA 2BJXA 10GSA 4K1FA 3CXGA 1ST9A 2DC5A 1NHOA 1EEJA 3D22A 2MMNA 3DXBA 3TKQA 3HCZA 4K8MA 1TRWA 1AUCA 1R5AA 4GQCA 2PVOC 2HRFA 4V2NA 3QFBC 4RUVA 1M2AA 4LL1B 4DSSA 1N8JA 5HQPA 3FZAA 5ECRB 3I6AA 1G6YA 4GSSA 1SKWB 1YF0A 2M72A 4I2TA 1U3IA 3WT2A 2NDOA 4BPYA 2F8AA 5CNWA 5AIXA 3AY8A 4KAEA 3GH9A 3IXRA 2MYGA 2L59A 4EKZA 2JZTA 1O73A 3KH7A 3UL3A 2PERA 4JR4A 4NPBA 3P7XA 5B7CA 1GUMA 1XWCA 4TR1A 4TW5A 3GUSA 1FB0A 2H6XA 1O8XA 4Q5RA 4ML1A 2NPBA 1X5CA 2PPTA 3IRAA 1XWBA 3FZ9A 3GTUB 4IKHA 3ISOA 4IQAA 1BG5A 1SD8A 4OD7A 2V6OA 1EWXA 1JZOA 2LTKA 2OE1A 1F2EA 2HSHA 2V2GA 2IJYA 2YNXA 3KMNA 4IHUA 1AAZA 2IN3A 1WE0A 3QMXA 4TR3A 3GA4A 1XZOA 1R26A 1I5GA 1WWJA 1TW9A 1GSFA 5DQYA 2TRXA 4KNDA 2OA7A 3VPQA 1M9AA 5ECLB 3VWUA 3FR3A 2VLTA 4K7IA 1B4QA 1EGOA 4EC0A 1GSSA 4I8BA 5ECQB 2FLSA 1K0BA 4OO4A 1FB6A 2C80A 4DSRA 3O3TA 3ERFA 2C0GA 5F8BA 4G2EA 1AXDA 4IQ1A 3C7MA 1THXA 4HQZA 5DALB 1PRXA 2K6VA 3KJYA 2VAFA 2VL9A 3UVTA 1ILOA 1V98A 3SBCA 3GHAA 3J7Yb 3C1SA 3IC4A 1BEDA 4JBBA 2ES7A 2K8VA 4WR4A 3VWVA 1UC7A 2P0GA 3M9JA 3IK7A 5CP1A 4DSSB 2YZUA 1JZWA 4KSOA 1SJ6A 4BL7A 4QL7A 4NMUA 3QAGA 3DIEA 5LD0A 4YQMA 4ECIA 1ZCPA 1PKWA 2BTOT 5ECIB 4YQUA 4HDEA 1TDIA 2H72A 2C3TA 3QD9A 3DWVA 2OJLA 4KE3A 3ED3A 4ISDA 3H79A 5J4UA 3U5RE 2MBTA 3TJFA 2DIYA 1YZXA 4IW9A 3DKSA 4ZXGA 5D9TA 3H93A 3IPZA 2K18A 4PQIA 2K8SA 5AIVA 4F0CA 1A0FA 3F3RA 2IMDA 5GSSA 2FY6A 3KEBA 2EIRA 2TRCP 2MMZA 5G30A 5FT3A 5KN1A 2V1MA 2NBSA 3M1GA 1PX6A 1K3YA 5D93A 1SJZA 2VL2C 2GVPA 1SKSB 1CQHA 1OKDA 3F63A 2LV3A 5ID2B 4WR5A 2NTOA 5D9WA 4HZ2A 1TOFA 1ERUA 2A2RA 4X43A 1U3AA 2XC2A 2O87A 2PN8A 1T4ZA 4N0ZA 4H86A 1W4VA 1SYXA 3L78A 1B48A 3HA9A 3GKNA 1C72A 4HU7A 2L5LA 1Z3EA 1NHYA 1S3CA 4L0UA 1TK8B 2EIQA 3Q74A 4K9ZA 4J57E 1HQOA 3UMAA 3WGEA 3GRXA 3G7IA 6GSXA 2Z9SA 2DJJA 2GT6A 2WULA 4MJBA 3P8WA 5ECOB 1RW1A 1F37A 3LXTA 4GXZA 2GZYA 3GSTA 4OWYA 3GURA 2OKAA 3G9BA 5JCUA 1ZL9A 4KDYA 4WXTA 3M0FA 3FRCA 2YCDA 5FHIA 3ZZXA 3DYRA 4HU9A 1PL2A 4TXOB 3CSHA 4MCUA 4JU5A 4K6XA 4MJAA 2JACA 2C0FA 4XS1A 1CQGA 3LG6A 3MDKA 4YH2A 1YQ1A 2YJ7A 1N2AA 1X5EA 2ON7A 3KP8A 1SJIA 3LYPA 1B4PA 2PGTA 3HZ4A 2WRTA 2VCTA 3E9JB 3VK9A 2REMA 3A3TA 2JADA 3ZIVA 3KIJA 2I4AA 5L71A 2H71A 3APOA 3GKMA 4I2UA 1K0OA 2I3YA 1G0TA 4AJ8A 2WGRA 2H74A 2VM1A 3IAS2 4ECBA 4ACSA 1OC8A 4FYUA 4IGJA 3KMOA 2LUSA 4CW9A 3TOUA 2B5EA 4TVEA 2CAIA 3CSJA 2VM2A 3EYTA 3CYNA 4I6XA 2HI7A 1QK8A 2XBIA 3ZITA 1A23A 1S3AA 3RBTA 3CRTA 2R2JA 3KZQA 4KH7A 3WGDA 2FUG2 1R7HA 4HS1A 2VCZA 2JZSA 2X99A 3KM6A 1TRUA 9GSSA 2RUEA 2X8CA 5B8BA 1AQXA 2X8HA 3KH9A 4NHZA 3L9UA 1NSWA 1TXXA 3DVXA 3PINA 3D5JA 5CO3A 3IR4A 8GSSA 4K2DA 2AJQB 1OYJA 3CMIA 4MJCA 1WMJA 3DVWA 1FG4A 1FW1A 3VI5A 3FR6A 2AAWA 1GLQA 3US3A 2VCQA 1H4OA 3EMXA 5DAKB 1XWAA 2GQMA 3GTUA 3KP9A 4KDXA 3ZTLA 2IMEA 1X9WB 1DE2A 4ILFA 1O85A 2KLXA 1SU9A 4K0GA 5D73A 1QFNA 2XPDA 3EINA 3QAVA 5C04A 4WBJA 1LBKA 5H5QA 1YJ6A 1WPIA 1M99A 3W8JA 5B6MA 1OE7A 5IPHA 2VUPA 4MH3A 4EO3A 1JLVA 5CRGA 4ZILA 2WCIA 4XS4B 1PX7A 3D4TA 2LEGA 4TRXA 5AISA 3U6VA 1AQWA 3FKFA 1UVZA 4OCFA 3TKSE 4BVYA 1JHBA 3IBHA 6GSVA 3O76A 4WKWA 2GT5A 3F4TA 2R4VA 3WGXA 2H66A 1KNGA 2IMIA 4FH8A 2YJHA 4EUYA 1R4WA 4PUFC 5IIZA 3A2VA 3IE3A 1EP8A 3HKRA 3ZVJD 1K0NA 5DALA 3GNJA 3CTGA 1X5DA 1XCCA 3QDNA 1F3BA 3SWLA 2D2ZA 5LCZA 1A24A 3MAKA 1KEBA 4HZ4A 4MK3A 1QUWA 2H1DA 4JRRA 2V6KA 4KUNA 4RQRA 1GTIA 5ECKB 3QFAC 4EXJA 1DE1A 1SK2A 4FYBA 3DRNA 2YZHA 5IQYA 2YV7A 1SL1B 2JZRA 5IMVA 2FCHA 2RM6A 2KHPA 3C71A 1GH2A 1K0AA 4KX4A 1M2DA 4BVXA 3IAM2 1Q4JA 2C0EA 4NWYA 3KD0A 1YKAA 5GAPD 2MZCA 5ECSA 4PX1A 2R5GA 2ALBA 3BJ5A 3P90A 2DMLA 2VD0A 4TOPA 4CHSA 3P2AA 1M0UA 3C8EA 4HUAA 4FIWA 14GSA 6GSSA 1Y6EA 2LKUA 2OE3A 2R6KA 1AC1A 2KP2A 1V40A 4GSTA 5D96A 2HZFA 2WFCA 1GUKA 2AUVA 3GYKA 3GSSA 3OR5A 4L5LA 4ZB9A 5ABRA 1YF1A 3CRUA 2DSAA 1VGLA 1SL2B 3L4NA 3TRPA 4HOJA 2OE0A 1T3BA 4IP6A 5ECHB 3EVIA 2HZEB 3ZL5A 1E2YA 1YDKA 5G2ZA 3VURA 3KXOA 1UA5A 2VCXA 4O5RA 1WRYA 4KW6A 1SENA 5HFGA 3MSZA 4IVFA 3RHCA 4AGSA 3LJRA 5ID2A 2XBQA 3F9UA 4MZWA 5CRWA 3GL3A 5JWQB 4V2MA 4PXOA 2L5OA 1WP0A 3GMFA 2VOCA 2CT6A 4QL9A 5HFKA 2O89A 4IP1A 4O32A 3DD3A 4N11A 5EPFA 5G5FA 20GSA 3N9JA 5IOXA 1MD3A 1SD9A 4IELA 1MDIA 3TRQA 1SYRA 4GTUA 3KGKA 1AW9A 2N5FA 2P5RA 5G5EA 3KTLA 3D21A 4KSMA 4PNFA 1BJXA 2H6ZA 4EDYA 1EV9A 4O92A 5H5SA 3HVVA 4ID0A 2MMAA 1GSDA 1HNCA 5JCGA 1WJKA 2GS3A 4I5QA 3TKSA 2AV4A 4OMVA 5KN3A 3HDCA 3TJBA 2CA8A 3ERWA 2F3MA 4DVCA 4ZL9A 3CTFA 1TJDA 4POKA 5IO0A 3H1NA 19GSA 4TXOA 2VLUA 4OFMA 3W8SA 2C3QA 1USBA 1V58A 4GRFA 1Z7PA 1A2MA 2PWJA 5ELGA 1MEKA 7GSSA 4HQSA 2DJ2A 2G0FA 3FYGA 1QXHA 5HR0A 3GH6A 2TIRA 4MPFA 1ERVA 2XHFA 3R2QA 4N0VA 4KA0A 4ZB6A 4DSQA 1TKDB 2WZ9A 3Q19A 5IPGA 4WEYA 4ZB8A 3DMLA 2I1UA 1A8LA 2FWHA 1M9BA 1T00A 2X8GA 2HE3A 3Q6OA 5DCGA 5HR2A 13GSA 3BOAA 4NV5A 1XVWA 3TOTA 2L6CA 3L9SA 2F9SA 5J9BA 2YWMA 3GIXA 1K3LA 1BYEA 2V32A 3LYKA 1TI3A 3FZ5A 1IYHA 4ZBDA 2P5QA 3APQA 2H75A 2PBJA 2YP6A 5DDLA 5KEJA 3VPTA 5A4VA 2H0HA 2OADA 5EVOA 3TJGA 4WETA 2E2MA 2WJUA 2GSQA 1U6TA 1FO5A 1YY7A 5F07A 3ZLPA 2LRTA 4EDZA 5KN0A 3ZMLA 2KOKA 3GX0A 4PGTA 1XWKA 2HFDA 3F3QA 3EU4A 3HJPA 2J9HA 2F8FA 2GLRA 4E8EA 1GTUA 1QMVA 2DJKA 4MP4A 4IN0A 2C8UA 2V41A 4F0BA 1F6MC 3VWWA 5DVBA 1BX9A 1Y25A 2VLVA 3G7JA 4G9HA 3VWXA 2OBIA 1GNWA 2N5AA 2H1GA 2FWFA 1EGRA 3F4RA 5DAKA 1XW6A 1MTCA 2B5YA 3A5WA 4LA1A 4X1UA 1T7PB 1FAAA 4TXVA 3TGZA 3IHQA 3UBLA 1TK0B 1GTAA 3UAPA 5A5KA 1ZYEA 4ECCA 5DCHA 3BCKA 4OO5A 2L57A 2DLXA 2NVLA 2M80A 1EV4A 2B7JA 2C0DA 4NXIA 6GSTA 2B7KA 4XS4A 4D73B 4V1Ap 3WD6A 4N10A 1G6WA 5IMAA 1JZDA 1V9WA 5G31A 5FWGA 3MNGA 1YEXA 3FHKA 3LORA 3GX8A 1EP7A 2DIZA 2VD1A 4KCAA 3TUEA 2QSIA 2RUFA 4ZBBA 2H6YA 4L0WA 2YOIA 3TJJA 2F51A 3D4MA 1LJRA 4HJMA
chains in the Genus database with same CATH superfamily
2E2GA 2IMFA 2X64A 3QCPA 1SL0B 4WBRD 1DBYA 1ACVA 1J0FA 4GF0A 4ZL7A 5CRDA 2ZNMA 3ZFBA 1TK5B 3K8NA 3TRXA 2FWGA 3D0ZA 2M46A 1X0RA 5CYYA 3RHBA 5J9CA 3M3MA 3RPNA 2FHEA 2CX4A 2H70A 2GTUA 4POLA 2YWNA 1ERWA 2VL3A 4EL1A 4EF0A 3JCML 3UEMA 3O6TA 12GSA 5IO2A 3ME8A 4BWQA 4NHWA 4GWRA 4Z2UA 1X9SB 1GNEA 2CVBA 1O81A 4G19A 5ECPB 4XRDA 1H75A 2E7PA 1OC9A 5KN2A 2CQ9A 2VCVA 1PN9A 3NIVA 2HSMA 4NAXA 1FVKA 5HR3A 2LJAA 4K0NA 4A5PA 2JL4A 1ZOFA 3BCIA 6GSYA 4LMVA 3ME7A 4RI6A 5F06A 5D9VA 1GSUA 5GSTA 3LXZA 2GQLA 3IA1A 2HZEA 1WIKA 5COHA 5G1KA 4BA7A 3QPMA 5A4UA 2B1LA 2B3SA 3CQFA 4XRAA 1TI1A 3UVHA 1HNBA 1QGVA 2PVQA 2IWTA 2I81A 3IDVA 3RDWA 4XTSA 4PNGA 1A2JA 1XOAA 5HFIA 1MDKA 3VLNA 1HNAA 3FW2A 22GSA 2VCWA 2EIOA 4IJIA 1EOHA 1XOBA 3FR9A 1GSYA 2ZCTA 3BBYA 4TKYA 3HD5A 1U88A 3IV4A 4HI7A 2J23A 3HHVA 3GKKA 5D9XA 1PKZA 4MPGA 1PA3A 2C1YA 1OKTA 1VF1A 4TN8A 3UBKA 6GSUA 2A4VA 1RQMA 3NZNA 5LNKe 3I43A 3HJOA 4KDUA 4HJ2A 4JEDA 1VRSD 5ECNB 1ML6A 1OVNA 1Z5YE 2FD3A 1VF4A 2HXKA 1ZZYA 2FGXA 1WOUA 1BAYA 3F4SA 5J3RA 5ENUA 3GV1A 2GDRA 1ZYQB 2CX3A 2JSYA 2QC7A 2LNSA 1SK0A 4LMWA 4KGIA 4TR4A 2X4AA 1DSBA 2RLIA 1SK1A 3LFLA 1QQ2A 4YQVA 2HT9A 5DJMA 3ZYWA 5A4WA 5DBQA 2K9FA 1ZGNA 1XXUA 3W6GA 4JE1A 1XW5A 1XFLA 3DGQA 3L0HA 5JWOB 3EC3A 5IM9A 1HYUA 1XWGA 2CVDA 2LRNA 4I97A 1NW2A 4PUAA 1J9BA 1OC9B 2YANA 1THOA 4J2FA 1Q98A 2BMXA 2DJ3A 1X9MB 1Z9HA 4POBA 1G7EA 4EIPA 5B8AA 3TJKA 3E3EA 3KTBA 2IMKA 2H19A 1A0RP 4OFTA 4AF2A 4XCSA 4J56E 3GKXA 5CREA 2WB9A 4X4JA 3QAWA 3IOSA 3HXSA 2KP1A 5G1LA 5CAXA 1XPVA 3HY2A 1Z6MA 3VFIA 1URMA 4G0IA 5E59A 2L4QA 1J08A 2WS2A 5H5RA 3HVXA 3RPPA 1XW9A 3ZVJA 2P31A 2CZ2A 2ZUPA 1MD4A 3C1RA 2FA4A 1B8XA 3NOFA 1F9MA 1FVJA 1ABAA 4WF4A 4DEJA 2DBCA 4N30A 3UIWA 1EOGA 3VI7A 2L6DA 3QR6A 1M2BA 3TB2A 3ZMKA 4ZL8A 2CV4A 1YEPA 2DJ1A 4WF5A 1TU8A 4MDCA 4YKFA 2IIYA 2H1BA 1V57A 3PR8A 1ZMAA 3Q18A 1KTEA 3UOMA 2HYXA 4GLTA 2LRCA 4MH2A 4Z7XA 2VL2A 2JSZA 4GCIA 4EVMA 5JWRB 4ULXA 2MBSA 2MMOA 4XIHA 2B6MA 2VO4A 1Z7RA 4YAPA 3F8UA 3CSIA 5IMFA 5IOWA 2IPAA 4D73A 4HEA2 2OACA 1TU7A 1HD2A 4MZCA 4EIQA 2YPMA 2PMTA 4PQ1A 1JLWA 5ECMB 2X49A 4BWSA 1SKRB 1GWCA 5GZZB 1B9YC 1TRVA 4FYCA 3ZREA 5F05A 2H76A 4V2LA 2R3XA 3FZ4A 1FHEA 2H01A 4TR1B 3EU3A 4LL4B 2E0QA 1OC3A 1OE8A 4EE0A 4F03A 1PMTA 4OCEA 1A8YA 1E6BA 3PGTA 2FA8A 2PU9C 4IJ3A 5IMCA 3A2XA 4ZBAA 4G10A 2QKEA 2CZ3A 3LWAA 2HRKA 2GZZA 1G7OA 3TKSC 1GLPA 2B1KA 5ELAA 1PGTA 4AJ7A 3CBUA 2C4JA 3FK8A 4MMMA 2YN1A 2CAQA 2O7KA 2L4CA 4K7OA 2H0IA 1AQVA 4TR0A 1R5PA 3F0IA 16GSA 5AN1A 1JZRA 2EC4A 4P3YB 1PD21 4MF5A 3HJMA 5EL8A 2JU5A 4YAVA 5IMZA 2PUKC 3KCMA 3ERGA 4AJ6A 1IYIA 1O6JA 1W89A 3J7Yk 2IFQA 1F3AA 4Q5QA 4F2IA 3H8QA 3TCOA 2WDUA 1XVQA 4POMA 4XHMA 1U87A 2FNOA 3F6FA 3L9VA 4JR6A 1GULA 1O8WA 1RK4A 2YWOA 4RI7A 2LQOA 1I9DA 1PL1A 4MLYA 2RIIA 1LU4A 4LLRA 3TDGA 1T1VA 2FWEA 1A2LA 4MABA 1GSQA 3HZ8A 4L5OA 4BL7B 3E0UA 4MF7A 4F9ZA 1Z6NA 2C3NA 4NV2A 3FY7A 3MIXA 3HYPA 1TRSA 5INYA 1VF3A 3APSA 3S9FA 4V1Ag 3PH9A 4ZIJA 1GTBA 3EE2A 2RM5A 2HLSA 4Q5FA 4GQFA 4PURA 3TKRA 4CDOA 2B5XA 3FEUA 5HR1A 3M9KA 1DUGA 2DJ0A 1PSQA 3GL5A 5J5NA 5EY6A 1XIYA 4KB3A 2AB6A 3C73A 1GRXA 3EMPA 3A2WA 4ECJA 1JFUA 4IS0A 4OFNA 3M8NA 1TTZA 1PN0A 3D6IA 2O8VB 2N5BA 4MA9A 2IL3A 2OBKA 3EWLA 3EURA 2LS5A 5GAND 2KUCA 1M7TA 1MDJA 2ON5A 3ZIJA 4L8EA 1PQNA 1B9XC 2GZPA 2HRNA 5DJLA 1OAZA 5KOWA 1K0MA 3GFKA 3GN3A 2GSSA 3HVNA 4MJEA 1T8EB 18GSA 11GSA 3BD2A 1ON4A 2XPEA 2LNTA 1FOVA 3UJ1A 1EZKA 3TKPA 5F0GA 2AHEA 5AGYA 1VF2A 1EEMA 2LQQA 4MF6A 4X0XA 1BQ7A 2H30A 2CVKA 2DMMA 2IFQB 2A2SA 2QGVA 1K0CA 3DEXA 4QQ7A 2H73A 2HSYA 1YKCA 1K3OA 4K5RA 1NM3A 3H4KA 1GL8A 5E4WA 4IBPA 1UN2A 3F6DA 1V2AA 4MZBA 2AYTA 3UARA 4PQHA 4K7NA 1GSEA 1KBNA 3N5OA 1K0DA 2YV9A 3LSZA 1TP9A 3LQ7A 5IMDA 3MWHA 2GGTA 2GQKA 4GSNA 4FO5A 2GSRA 5J41A 2R37A 2GSTA 17GSA 3WT1A 3G7YA 4KCEA 3V1WA 4E8HA 2HNLA 2LJKA 2R0PA 4ML6A 5CRHA 5DQSA 3LEFA 2LSTA 5C00A 3IK9A 3ZFLA 4XS6A 3ZRDA 1PFOA 2H8LA 3I69A 4O7HA 2I9HA 3QOUA 1ERTA 4F82A 1AIUA 2G2QA 1S3DA 3LGCA 2VIMA 1GP1A 4JZQA 3I9V2 2H1AA 4Q5NA 3R3EA 1GUHA 3RAZA 3WYWA 5B6NA 2LJRA 1XBSA 4RQXA 5D8IA 3HVSA 2YWIA 2O85A 6GSWA 2H0GA 5JCWA 1T4YA 1O7UA 4Z2TA 2BJXA 10GSA 4K1FA 3CXGA 1ST9A 2DC5A 1NHOA 1EEJA 3D22A 2MMNA 3DXBA 3TKQA 3HCZA 4K8MA 1TRWA 4PTSA 1AUCA 1R5AA 4GQCA 2PVOC 2HRFA 4V2NA 3QFBC 4RUVA 1M2AA 4LL1B 4DSSA 4O5UA 1N8JA 2A2PA 5HQPA 3FZAA 5ECRB 3I6AA 1G6YA 4GSSA 5KOXA 1SKWB 1YF0A 2M72A 4I2TA 1U3IA 3WT2A 2NDOA 4BPYA 2F8AA 5CNWA 5AIXA 3AY8A 4KAEA 3GH9A 3IXRA 2MYGA 2L59A 4EKZA 2JZTA 1O73A 3KH7A 3UL3A 2PERA 4KF9A 4JR4A 4NPBA 3P7XA 5B7CA 1GUMA 1XWCA 1XG8A 4TR1A 4TW5A 3GUSA 1FB0A 2H6XA 1O8XA 4Q5RA 4ML1A 2NPBA 1X5CA 2PPTA 3IRAA 1XWBA 3FZ9A 3GTUB 4IKHA 3ISOA 4IQAA 1BG5A 1SD8A 4OD7A 2V6OA 1EWXA 1JZOA 2LTKA 2OE1A 1F2EA 2HSHA 2V2GA 2IJYA 2YNXA 3KMNA 4IHUA 1AAZA 2IN3A 1WE0A 3QMXA 4TR3A 3GA4A 1XZOA 1R26A 1I5GA 1WWJA 1TW9A 1GSFA 5DQYA 2TRXA 4KNDA 2OA7A 3VPQA 1M9AA 5ECLB 3VWUA 3FR3A 2VLTA 4K7IA 1B4QA 1EGOA 4EC0A 1GSSA 4I8BA 5ECQB 2FLSA 1K0BA 4OO4A 1FB6A 2C80A 4DSRA 3O3TA 3ERFA 2C0GA 5F8BA 4G2EA 1AXDA 4IQ1A 3C7MA 1THXA 4HQZA 5DALB 1PRXA 2K6VA 3KJYA 2VAFA 2VL9A 3UVTA 1ILOA 1V98A 3SBCA 3GHAA 1FOHA 3J7Yb 3C1SA 3IC4A 1BEDA 4JBBA 2ES7A 2K8VA 4WR4A 3VWVA 1UC7A 2P0GA 3M9JA 3IK7A 5CP1A 4DSSB 2YZUA 2QA1A 1JZWA 4KSOA 1SJ6A 4BL7A 4QL7A 4BVXB 4NMUA 3QAGA 3DIEA 5LD0A 4YQMA 4ECIA 1ZCPA 1PKWA 2BTOT 5ECIB 4YQUA 4HDEA 3IHGA 1TDIA 2H72A 2C3TA 3QD9A 3MYDA 3DWVA 2OJLA 4KE3A 3ED3A 4ISDA 3H79A 5J4UA 3U5RE 2MBTA 3TJFA 2DIYA 1YZXA 4IW9A 3DKSA 4ZXGA 5D9TA 3H93A 3IPZA 2K18A 4PQIA 2K8SA 5AIVA 4F0CA 1A0FA 3F3RA 2IMDA 5GSSA 2FY6A 3KEBA 2EIRA 2TRCP 2MMZA 5G30A 5FT3A 5KN1A 2V1MA 2NBSA 3M1GA 1PX6A 1K3YA 5D93A 4BIKA 1SJZA 2VL2C 2GVPA 1SKSB 1CQHA 1OKDA 3F63A 2LV3A 5ID2B 4WR5A 2NTOA 5D9WA 4HZ2A 1TOFA 1ERUA 2A2RA 4X43A 1U3AA 2XC2A 2O87A 2PN8A 1T4ZA 4N0ZA 4H86A 4HSCX 1W4VA 1SYXA 3L78A 1B48A 3HA9A 3GKNA 1C72A 4HU7A 2L5LA 1Z3EA 1NHYA 1S3CA 4L0UA 1TK8B 1ZYPA 2EIQA 3Q74A 4K9ZA 4J57E 1HQOA 3UMAA 3WGEA 3GRXA 3G7IA 1M3IA 6GSXA 2Z9SA 2DJJA 2GT6A 2WULA 4MJBA 3P8WA 4MNNA 5ECOB 1RW1A 1F37A 3LXTA 4GXZA 2GZYA 3GSTA 4OWYA 3GURA 2OKAA 3G9BA 5JCUA 1ZL9A 4KDYA 4WXTA 3LW9A 3M0FA 3FRCA 2YCDA 5FHIA 3ZZXA 3DYRA 4HU9A 1PL2A 4TXOB 3CSHA 4MCUA 4JU5A 4K6XA 4MJAA 2JACA 2C0FA 4XS1A 1CQGA 3LG6A 3MDKA 4USSA 4YH2A 1YQ1A 2YJ7A 1N2AA 1X5EA 2ON7A 3KP8A 1SJIA 3LYPA 1B4PA 2PGTA 3HZ4A 2WRTA 2VCTA 3E9JB 3VK9A 2REMA 3A3TA 2JADA 3ZIVA 3KIJA 2I4AA 5L71A 2H71A 3APOA 3EPTA 3GKMA 4I2UA 1K0OA 2I3YA 1G0TA 4AJ8A 2WGRA 2H74A 2VM1A 4K5SA 3IAS2 4ECBA 4ACSA 1OC8A 4FYUA 4IGJA 3KMOA 2LUSA 4CW9A 3TOUA 2B5EA 4TVEA 2CAIA 3CSJA 2VM2A 3EYTA 3CYNA 4I6XA 2HI7A 1QK8A 2XBIA 3ZITA 1A23A 1S3AA 3RBTA 3CRTA 2R2JA 3KZQA 4KH7A 3WGDA 2FUG2 1R7HA 4HS1A 2VCZA 2JZSA 2X99A 3KM6A 1TRUA 9GSSA 2RUEA 2X8CA 5B8BA 1AQXA 2X8HA 3KH9A 4NHZA 3L9UA 1NSWA 1TXXA 3DVXA 3PINA 3D5JA 5CO3A 3IR4A 8GSSA 4K2DA 2AJQB 1OYJA 3CMIA 4MJCA 1WMJA 3DVWA 1FG4A 1FW1A 3VI5A 3FR6A 2AAWA 1GLQA 3US3A 2VCQA 1H4OA 3EMXA 5DAKB 1XWAA 2GQMA 3GTUA 3KP9A 4KDXA 3ZTLA 2IMEA 1X9WB 1DE2A 4ILFA 1O85A 2KLXA 1SU9A 4K0GA 5D73A 1QFNA 2XPDA 3EINA 3QAVA 5C04A 4WBJA 1LBKA 5H5QA 1YJ6A 1WPIA 1M99A 3W8JA 5B6MA 1OE7A 4CY8A 5IPHA 2VUPA 4MH3A 4EO3A 1JLVA 5CRGA 4ZILA 2WCIA 4XS4B 1S3RA 1PX7A 3D4TA 2LEGA 5BMUA 4TRXA 5AISA 3FMWA 3U6VA 4K2XA 1AQWA 3FKFA 1UVZA 4OCFA 3TKSE 4BVYA 1JHBA 3IBHA 6GSVA 3O76A 4WKWA 2HRAA 2GT5A 3F4TA 2R4VA 3WGXA 2H66A 1KNGA 2IMIA 4FH8A 2R0GA 2YJHA 1M3JA 4EUYA 1R4WA 4PUFC 5IIZA 3A2VA 3IE3A 1EP8A 3HKRA 3ZVJD 1K0NA 5DALA 3GNJA 3CTGA 1X5DA 1XCCA 3QDNA 1F3BA 3SWLA 2D2ZA 5LCZA 1A24A 3MAKA 1KEBA 4HZ4A 4MK3A 1QUWA 2H1DA 4JRRA 2V6KA 4KUNA 4RQRA 1GTIA 5ECKB 3QFAC 4EXJA 1DE1A 1SK2A 4FYBA 3DRNA 4G0LA 2YZHA 5IQYA 2YV7A 1SL1B 2JZRA 5IMVA 2FCHA 2RM6A 2KHPA 3C71A 1GH2A 1K0AA 4KX4A 1M2DA 4BVXA 3IAM2 1Q4JA 2C0EA 4NWYA 3KD0A 1YKAA 5GAPD 2MZCA 5ECSA 4PX1A 2R5GA 2UZ8A 2ALBA 4G0KA 3BJ5A 3P90A 2DMLA 2VD0A 4TOPA 4CHSA 3P2AA 1M0UA 3C8EA 4HUAA 4FIWA 14GSA 6GSSA 1Y6EA 2LKUA 2OE3A 2R6KA 1AC1A 2KP2A 1V40A 4GSTA 5D96A 2HZFA 2WFCA 1GUKA 2AUVA 2QA2A 3GYKA 3GSSA 3OR5A 4L5LA 2A4HA 4ZB9A 5ABRA 1YF1A 3CRUA 2DSAA 1VGLA 1SL2B 3L4NA 3TRPA 4HOJA 2OE0A 1T3BA 4IP6A 5ECHB 3EVIA 2HZEB 3ZL5A 1E2YA 1YDKA 5G2ZA 3VURA 3KXOA 1UA5A 2VCXA 4ICYA 4O5RA 1WRYA 4KW6A 1SENA 5HFGA 3MSZA 4IVFA 3RHCA 4AGSA 3LJRA 5ID2A 2XBQA 3F9UA 4MZWA 5CRWA 3A5IA 3GL3A 5JWQB 4V2MA 4PXOA 4BVYB 2L5OA 1WP0A 3GMFA 2VOCA 2CT6A 4QL9A 5HFKA 2O89A 4IP1A 4O32A 3DD3A 4N11A 5EPFA 5G5FA 20GSA 3N9JA 5IOXA 1MD3A 1SD9A 4IELA 1MDIA 3TRQA 1SYRA 4GTUA 3KGKA 1AW9A 2N5FA 2P5RA 5G5EA 3KTLA 3D21A 4KSMA 4PNFA 1BJXA 2H6ZA 4EDYA 1EV9A 4O92A 5H5SA 3HVVA 4ID0A 2MMAA 1GSDA 1HNCA 5JCGA 1WJKA 2GS3A 4I5QA 3TKSA 2AV4A 4OMVA 5KN3A 3HDCA 3TJBA 2CA8A 3ERWA 2F3MA 4DVCA 4ZL9A 3CTFA 1TJDA 4POKA 5IO0A 3H1NA 19GSA 4TXOA 2VLUA 4OFMA 3W8SA 2C3QA 3PPUA 1USBA 1V58A 4GRFA 1Z7PA 1A2MA 2PWJA 5ELGA 1MEKA 7GSSA 4HQSA 2DJ2A 2G0FA 3FYGA 1QXHA 5HR0A 3GH6A 2TIRA 4MPFA 1ERVA 2XHFA 3R2QA 4N0VA 4KA0A 4ZB6A 4DSQA 2DKHA 1TKDB 2WZ9A 4CY6A 3Q19A 5IPGA 4WEYA 3IC8A 4ZB8A 3DMLA 2I1UA 1A8LA 2FWHA 1M9BA 1T00A 2X8GA 4YKGA 2HE3A 3Q6OA 5DCGA 4FQUA 5HR2A 13GSA 3BOAA 4NV5A 1XVWA 3TOTA 2L6CA 3L9SA 2F9SA 5J9BA 2YWMA 2R0CA 3GIXA 1K3LA 1BYEA 2V32A 3LYKA 1TI3A 3FZ5A 1IYHA 4ZBDA 2P5QA 3APQA 2H75A 2PBJA 2YP6A 5DDLA 5KEJA 3VPTA 5A4VA 2H0HA 2OADA 5EVOA 3TJGA 4WETA 2E2MA 2WJUA 2GSQA 1U6TA 1FO5A 1YY7A 5F07A 3ZLPA 2LRTA 4EDZA 5KN0A 3ZMLA 2KOKA 3GX0A 4PGTA 1XWKA 2HFDA 3F3QA 4O5QA 3EU4A 3HJPA 2J9HA 2F8FA 2GLRA 4E8EA 1GTUA 1QMVA 2DJKA 4MP4A 4IN0A 2C8UA 2V41A 4F0BA 1F6MC 3VWWA 5DVBA 1BX9A 1Y25A 2VLVA 3G7JA 4G9HA 3VWXA 2OBIA 1GNWA 2N5AA 2H1GA 2FWFA 1EGRA 3F4RA 5DAKA 1XW6A 1MTCA 2B5YA 3A5WA 4LA1A 4X1UA 1T7PB 1FAAA 4TXVA 3TGZA 3IHQA 3UBLA 1TK0B 1GTAA 1ZYNA 3UAPA 5A5KA 2DKIA 1ZYEA 4ECCA 5DCHA 3BCKA 4OO5A 2L57A 2DLXA 2NVLA 2M80A 1EV4A 2B7JA 2C0DA 4NXIA 6GSTA 2B7KA 4XS4A 4D73B 4V1Ap 5BRTA 3WD6A 4N10A 1G6WA 5IMAA 1JZDA 1V9WA 5G31A 5FWGA 3MNGA 4Z2RA 1YEXA 3FHKA 3LORA 3GX8A 1EP7A 2DIZA 2VD1A 4KCAA 3TUEA 2QSIA 2RUFA 4ZBBA 2H6YA 4L0WA 2YOIA 3TJJA 2F51A 3D4MA 1LJRA 4HJMA
chains in the Genus database with same CATH topology
2E2GA 2IMFA 2X64A 3QCPA 1SL0B 4WBRD 1DBYA 1ACVA 1J0FA 4GF0A 4ZL7A 5CRDA 2ZNMA 3ZFBA 1TK5B 3K8NA 3TRXA 2FWGA 3D0ZA 2M46A 1X0RA 5CYYA 3RHBA 5J9CA 3M3MA 3RPNA 2FHEA 2CX4A 2H70A 2GTUA 4POLA 2YWNA 1ERWA 2VL3A 4EL1A 4EF0A 3JCML 3UEMA 3O6TA 12GSA 5IO2A 3ME8A 4BWQA 4NHWA 4GWRA 4Z2UA 1X9SB 1GNEA 2CVBA 1O81A 4G19A 5ECPB 4XRDA 1H75A 2E7PA 1OC9A 5KN2A 2CQ9A 2VCVA 1PN9A 3NIVA 2HSMA 4NAXA 1FVKA 5HR3A 2LJAA 4K0NA 4A5PA 2JL4A 1ZOFA 3BCIA 6GSYA 4LMVA 3ME7A 4RI6A 5F06A 5D9VA 1GSUA 5GSTA 3LXZA 2GQLA 3IA1A 2HZEA 1WIKA 5COHA 5G1KA 4BA7A 3QPMA 5A4UA 2B1LA 2B3SA 4XRAA 1TI1A 3UVHA 1HNBA 1QGVA 2PVQA 2IWTA 2I81A 3IDVA 3RDWA 4XTSA 4PNGA 1A2JA 1XOAA 5HFIA 1MDKA 3VLNA 1HNAA 3FW2A 22GSA 2VCWA 2EIOA 4IJIA 1EOHA 1XOBA 3FR9A 1GSYA 2ZCTA 3BBYA 4TKYA 3HD5A 1U88A 3IV4A 4HI7A 2J23A 3HHVA 3GKKA 5D9XA 1PKZA 4MPGA 1PA3A 2C1YA 1OKTA 1VF1A 4TN8A 3UBKA 6GSUA 2A4VA 1RQMA 3NZNA 5LNKe 3I43A 3HJOA 4KDUA 4HJ2A 4JEDA 1VRSD 5ECNB 1ML6A 1OVNA 1Z5YE 2FD3A 1VF4A 2HXKA 1ZZYA 2FGXA 1WOUA 1BAYA 3F4SA 5J3RA 5ENUA 3GV1A 2GDRA 1ZYQB 2CX3A 2JSYA 2QC7A 2LNSA 1SK0A 4LMWA 4KGIA 4TR4A 2X4AA 1DSBA 2RLIA 1SK1A 3LFLA 1QQ2A 4YQVA 2HT9A 5DJMA 3ZYWA 5A4WA 5DBQA 2K9FA 1ZGNA 1XXUA 3W6GA 4JE1A 1XW5A 1XFLA 3DGQA 3L0HA 5JWOB 3EC3A 5IM9A 1HYUA 1XWGA 2CVDA 2LRNA 4I97A 1NW2A 4PUAA 1J9BA 1OC9B 2YANA 1THOA 4J2FA 1Q98A 2BMXA 2DJ3A 1X9MB 1Z9HA 4POBA 1G7EA 4EIPA 5B8AA 3TJKA 3E3EA 3KTBA 2IMKA 2H19A 1A0RP 4OFTA 4AF2A 4XCSA 4J56E 3GKXA 5CREA 2WB9A 4X4JA 3QAWA 3IOSA 3HXSA 2KP1A 5G1LA 5CAXA 1XPVA 3HY2A 1Z6MA 3VFIA 1URMA 4G0IA 5E59A 2L4QA 1J08A 2WS2A 5H5RA 3HVXA 3RPPA 1XW9A 3ZVJA 2P31A 2CZ2A 2ZUPA 1MD4A 3C1RA 2FA4A 1B8XA 3NOFA 1F9MA 1FVJA 1ABAA 4WF4A 4DEJA 2DBCA 4N30A 3UIWA 1EOGA 3VI7A 2L6DA 3QR6A 1M2BA 3TB2A 3ZMKA 4ZL8A 2CV4A 1YEPA 2DJ1A 4WF5A 1TU8A 4MDCA 4YKFA 2IIYA 2H1BA 1V57A 3PR8A 1ZMAA 3Q18A 1KTEA 3UOMA 2HYXA 4GLTA 2LRCA 4MH2A 4Z7XA 2VL2A 2JSZA 4GCIA 4EVMA 5JWRB 4ULXA 2MBSA 2MMOA 4XIHA 2B6MA 2VO4A 1Z7RA 4YAPA 3F8UA 3CSIA 5IMFA 5IOWA 2IPAA 4D73A 4HEA2 2OACA 1TU7A 1HD2A 4MZCA 4EIQA 2YPMA 2PMTA 4PQ1A 1JLWA 5ECMB 2X49A 4BWSA 1SKRB 1GWCA 5GZZB 1B9YC 1TRVA 4FYCA 3ZREA 5F05A 2H76A 4V2LA 2R3XA 3FZ4A 1FHEA 2H01A 4TR1B 3EU3A 4LL4B 2E0QA 1OC3A 1OE8A 4EE0A 4F03A 1PMTA 4OCEA 1A8YA 1E6BA 3PGTA 2FA8A 2PU9C 4IJ3A 5IMCA 3A2XA 4ZBAA 4G10A 2QKEA 2CZ3A 3LWAA 2HRKA 2GZZA 1G7OA 3TKSC 1GLPA 2B1KA 5ELAA 1PGTA 4AJ7A 3CBUA 2C4JA 3FK8A 4MMMA 2YN1A 2CAQA 2O7KA 2L4CA 4K7OA 2H0IA 1AQVA 4TR0A 1R5PA 3F0IA 16GSA 5AN1A 1JZRA 2EC4A 4P3YB 1PD21 4MF5A 3HJMA 5EL8A 2JU5A 4YAVA 5IMZA 2PUKC 3KCMA 3ERGA 4AJ6A 1IYIA 1O6JA 1W89A 3J7Yk 2IFQA 1F3AA 4Q5QA 4F2IA 3H8QA 3TCOA 2WDUA 1XVQA 4POMA 4XHMA 1U87A 2FNOA 3F6FA 3L9VA 4JR6A 1GULA 1O8WA 1RK4A 2YWOA 4RI7A 2LQOA 1I9DA 1PL1A 4MLYA 2RIIA 1LU4A 4LLRA 3TDGA 1T1VA 2FWEA 1A2LA 4MABA 1GSQA 3HZ8A 4L5OA 4BL7B 3E0UA 4MF7A 4F9ZA 1Z6NA 2C3NA 4NV2A 3FY7A 3MIXA 3HYPA 1TRSA 5INYA 1VF3A 3APSA 3S9FA 4V1Ag 3PH9A 4ZIJA 1GTBA 3EE2A 2RM5A 2HLSA 4Q5FA 4GQFA 4PURA 3TKRA 4CDOA 2B5XA 3FEUA 5HR1A 3M9KA 1DUGA 2DJ0A 1PSQA 3GL5A 5J5NA 5EY6A 1XIYA 4KB3A 2AB6A 3C73A 1GRXA 3EMPA 3A2WA 4ECJA 1JFUA 4IS0A 4OFNA 3M8NA 1TTZA 1PN0A 3D6IA 2O8VB 2N5BA 4MA9A 2IL3A 2OBKA 3EWLA 3EURA 2LS5A 5GAND 2KUCA 1M7TA 1MDJA 2ON5A 3ZIJA 4L8EA 1PQNA 1B9XC 2GZPA 2HRNA 5DJLA 1OAZA 5KOWA 1K0MA 3GFKA 3GN3A 2GSSA 4MJEA 1T8EB 18GSA 11GSA 3BD2A 1ON4A 2XPEA 2LNTA 1FOVA 3UJ1A 1EZKA 3TKPA 5F0GA 2AHEA 5AGYA 1VF2A 1EEMA 2LQQA 4MF6A 4X0XA 1BQ7A 2H30A 2CVKA 2DMMA 2IFQB 2A2SA 2QGVA 1K0CA 3DEXA 4QQ7A 2H73A 2HSYA 1YKCA 1K3OA 4K5RA 1NM3A 3H4KA 1GL8A 5E4WA 4IBPA 1UN2A 3F6DA 1V2AA 4MZBA 2AYTA 3UARA 4PQHA 4K7NA 1GSEA 1KBNA 3N5OA 1K0DA 2YV9A 3LSZA 1TP9A 3LQ7A 5IMDA 3MWHA 2GGTA 2GQKA 4GSNA 4FO5A 2GSRA 5J41A 2R37A 2GSTA 17GSA 3WT1A 3G7YA 4KCEA 3V1WA 4E8HA 2HNLA 2LJKA 2R0PA 4ML6A 5CRHA 5DQSA 3LEFA 2LSTA 5C00A 3IK9A 3ZFLA 4XS6A 3ZRDA 2H8LA 3I69A 4O7HA 2I9HA 3QOUA 1ERTA 4F82A 1AIUA 2G2QA 1S3DA 3LGCA 2VIMA 1GP1A 4JZQA 3I9V2 2H1AA 4Q5NA 3R3EA 1GUHA 3RAZA 3WYWA 5B6NA 2LJRA 1XBSA 4RQXA 5D8IA 3HVSA 2YWIA 2O85A 6GSWA 2H0GA 5JCWA 1T4YA 1O7UA 4Z2TA 2BJXA 10GSA 4K1FA 3CXGA 1ST9A 2DC5A 1NHOA 1EEJA 3D22A 2MMNA 3DXBA 3TKQA 3HCZA 4K8MA 1TRWA 4PTSA 1AUCA 1R5AA 4GQCA 2PVOC 2HRFA 4V2NA 3QFBC 4RUVA 1M2AA 4LL1B 4DSSA 4O5UA 1N8JA 2A2PA 5HQPA 3FZAA 5ECRB 3I6AA 1G6YA 4GSSA 5KOXA 1SKWB 1YF0A 2M72A 4I2TA 1U3IA 3WT2A 2NDOA 4BPYA 2F8AA 5CNWA 5AIXA 3AY8A 4KAEA 3GH9A 3IXRA 2MYGA 2L59A 4EKZA 2JZTA 1O73A 3KH7A 3UL3A 2PERA 4KF9A 4JR4A 4NPBA 3P7XA 5B7CA 1GUMA 1XWCA 4TR1A 4TW5A 3GUSA 1FB0A 2H6XA 1O8XA 4Q5RA 4ML1A 2NPBA 1X5CA 2PPTA 3IRAA 1XWBA 3FZ9A 3GTUB 4IKHA 3ISOA 4IQAA 1BG5A 1SD8A 4OD7A 2V6OA 1EWXA 1JZOA 2LTKA 2OE1A 1F2EA 2HSHA 2V2GA 2IJYA 2YNXA 3KMNA 4IHUA 1AAZA 2IN3A 1WE0A 3QMXA 4TR3A 3GA4A 1XZOA 1R26A 1I5GA 1WWJA 1TW9A 1GSFA 5DQYA 2TRXA 4KNDA 2OA7A 3VPQA 1M9AA 5ECLB 3VWUA 3FR3A 2VLTA 4K7IA 1B4QA 1EGOA 4EC0A 1GSSA 4I8BA 5ECQB 2FLSA 1K0BA 4OO4A 1FB6A 2C80A 4DSRA 3O3TA 3ERFA 2C0GA 5F8BA 4G2EA 1AXDA 4IQ1A 3C7MA 1THXA 4HQZA 5DALB 1PRXA 2K6VA 3KJYA 2VAFA 2VL9A 3UVTA 1ILOA 1V98A 3SBCA 3GHAA 1FOHA 3J7Yb 3C1SA 3IC4A 1BEDA 4JBBA 2ES7A 2K8VA 4WR4A 3VWVA 1UC7A 2P0GA 3M9JA 3IK7A 5CP1A 4DSSB 2YZUA 2QA1A 1JZWA 4KSOA 1SJ6A 4BL7A 4QL7A 4BVXB 4NMUA 3QAGA 3DIEA 5LD0A 4YQMA 4ECIA 1ZCPA 1PKWA 2BTOT 5ECIB 4YQUA 4HDEA 3IHGA 1TDIA 2H72A 2C3TA 3QD9A 3MYDA 3DWVA 2OJLA 4KE3A 3ED3A 4ISDA 3H79A 5J4UA 3U5RE 2MBTA 3TJFA 2DIYA 1YZXA 4IW9A 3DKSA 4ZXGA 5D9TA 3H93A 3IPZA 2K18A 4PQIA 2K8SA 5AIVA 4F0CA 1A0FA 3F3RA 2IMDA 5GSSA 2FY6A 3KEBA 2EIRA 2TRCP 2MMZA 5G30A 5FT3A 5KN1A 2V1MA 2NBSA 3M1GA 1PX6A 1K3YA 5D93A 1SJZA 2VL2C 2GVPA 1SKSB 1CQHA 1OKDA 3F63A 2LV3A 5ID2B 4WR5A 2NTOA 5D9WA 4HZ2A 1TOFA 1ERUA 2A2RA 4X43A 1U3AA 2XC2A 2O87A 2PN8A 1T4ZA 4N0ZA 4H86A 1W4VA 1SYXA 3L78A 1B48A 3HA9A 3GKNA 1C72A 4HU7A 2L5LA 1Z3EA 1NHYA 1S3CA 4L0UA 1TK8B 1ZYPA 2EIQA 3Q74A 4K9ZA 4J57E 1HQOA 3UMAA 3WGEA 3GRXA 3G7IA 6GSXA 2Z9SA 2DJJA 2GT6A 2WULA 4MJBA 3P8WA 4MNNA 5ECOB 1RW1A 1F37A 3LXTA 4GXZA 2GZYA 3GSTA 4OWYA 3GURA 2OKAA 3G9BA 5JCUA 1ZL9A 4KDYA 4WXTA 3LW9A 3M0FA 3FRCA 2YCDA 5FHIA 3ZZXA 3DYRA 4HU9A 1PL2A 4TXOB 3CSHA 4MCUA 4JU5A 4K6XA 4MJAA 2JACA 2C0FA 4XS1A 1CQGA 3LG6A 3MDKA 4USSA 4YH2A 1YQ1A 2YJ7A 1N2AA 1X5EA 2ON7A 3KP8A 1SJIA 3LYPA 1B4PA 2PGTA 3HZ4A 2WRTA 2VCTA 3E9JB 3VK9A 2REMA 3A3TA 2JADA 3ZIVA 3KIJA 2I4AA 5L71A 2H71A 3APOA 3EPTA 3GKMA 4I2UA 1K0OA 2I3YA 1G0TA 4AJ8A 2WGRA 2H74A 2VM1A 4K5SA 3IAS2 4ECBA 4ACSA 1OC8A 4FYUA 4IGJA 3KMOA 2LUSA 4CW9A 3TOUA 2B5EA 4TVEA 2CAIA 3CSJA 2VM2A 3EYTA 3CYNA 4I6XA 2HI7A 1QK8A 2XBIA 3ZITA 1A23A 1S3AA 3RBTA 3CRTA 2R2JA 3KZQA 4KH7A 3WGDA 2FUG2 1R7HA 4HS1A 2VCZA 2JZSA 2X99A 3KM6A 1TRUA 9GSSA 2RUEA 2X8CA 5B8BA 1AQXA 2X8HA 3KH9A 4NHZA 3L9UA 1NSWA 1TXXA 3DVXA 3PINA 3D5JA 5CO3A 3IR4A 8GSSA 4K2DA 2AJQB 1OYJA 3CMIA 4MJCA 1WMJA 3DVWA 1FG4A 1FW1A 3VI5A 3FR6A 2AAWA 1GLQA 3US3A 2VCQA 1H4OA 3EMXA 5DAKB 1XWAA 2GQMA 3GTUA 3KP9A 4KDXA 3ZTLA 2IMEA 1X9WB 1DE2A 4ILFA 1O85A 2KLXA 1SU9A 4K0GA 5D73A 1QFNA 2XPDA 3EINA 3QAVA 5C04A 4WBJA 1LBKA 5H5QA 1YJ6A 1WPIA 1M99A 3W8JA 5B6MA 1OE7A 4CY8A 5IPHA 2VUPA 4MH3A 4EO3A 1JLVA 5CRGA 4ZILA 2WCIA 4XS4B 1PX7A 3D4TA 2LEGA 5BMUA 4TRXA 5AISA 3FMWA 3U6VA 4K2XA 1AQWA 3FKFA 1UVZA 4OCFA 3TKSE 4BVYA 1JHBA 3IBHA 6GSVA 3O76A 4WKWA 2HRAA 2GT5A 3F4TA 2R4VA 3WGXA 2H66A 1KNGA 2IMIA 4FH8A 2R0GA 2YJHA 4EUYA 1R4WA 4PUFC 5IIZA 3A2VA 3IE3A 1EP8A 3HKRA 3ZVJD 1K0NA 5DALA 3GNJA 3CTGA 1X5DA 1XCCA 3QDNA 1F3BA 3SWLA 2D2ZA 5LCZA 1A24A 3MAKA 1KEBA 4HZ4A 4MK3A 1QUWA 2H1DA 4JRRA 2V6KA 4KUNA 4RQRA 1GTIA 5ECKB 3QFAC 4EXJA 1DE1A 1SK2A 4FYBA 3DRNA 4G0LA 2YZHA 5IQYA 2YV7A 1SL1B 2JZRA 5IMVA 2FCHA 2RM6A 2KHPA 3C71A 1GH2A 1K0AA 4KX4A 1M2DA 4BVXA 3IAM2 1Q4JA 2C0EA 4NWYA 3KD0A 1YKAA 5GAPD 2MZCA 5ECSA 4PX1A 2R5GA 2UZ8A 2ALBA 4G0KA 3BJ5A 3P90A 2DMLA 2VD0A 4TOPA 4CHSA 3P2AA 1M0UA 3C8EA 4HUAA 4FIWA 14GSA 6GSSA 1Y6EA 2LKUA 2OE3A 2R6KA 1AC1A 2KP2A 1V40A 4GSTA 5D96A 2HZFA 2WFCA 1GUKA 2AUVA 2QA2A 3GYKA 3GSSA 3OR5A 4L5LA 2A4HA 4ZB9A 5ABRA 1YF1A 3CRUA 2DSAA 1VGLA 1SL2B 3L4NA 3TRPA 4HOJA 2OE0A 1T3BA 4IP6A 5ECHB 3EVIA 2HZEB 3ZL5A 1E2YA 1YDKA 5G2ZA 3VURA 3KXOA 1UA5A 2VCXA 4ICYA 4O5RA 1WRYA 4KW6A 1SENA 5HFGA 3MSZA 4IVFA 3RHCA 4AGSA 3LJRA 5ID2A 2XBQA 3F9UA 4MZWA 5CRWA 3A5IA 3GL3A 5JWQB 4V2MA 4PXOA 4BVYB 2L5OA 1WP0A 3GMFA 2VOCA 2CT6A 4QL9A 5HFKA 2O89A 4IP1A 4O32A 3DD3A 4N11A 5EPFA 5G5FA 20GSA 3N9JA 5IOXA 1MD3A 1SD9A 4IELA 1MDIA 3TRQA 1SYRA 4GTUA 3KGKA 1AW9A 2N5FA 2P5RA 5G5EA 3KTLA 3D21A 4KSMA 4PNFA 1BJXA 2H6ZA 4EDYA 1EV9A 4O92A 5H5SA 3HVVA 4ID0A 2MMAA 1GSDA 1HNCA 5JCGA 1WJKA 2GS3A 4I5QA 3TKSA 2AV4A 4OMVA 5KN3A 3HDCA 3TJBA 2CA8A 3ERWA 2F3MA 4DVCA 4ZL9A 3CTFA 1TJDA 4POKA 5IO0A 3H1NA 19GSA 4TXOA 2VLUA 4OFMA 3W8SA 2C3QA 3PPUA 1USBA 1V58A 4GRFA 1Z7PA 1A2MA 2PWJA 5ELGA 1MEKA 7GSSA 4HQSA 2DJ2A 2G0FA 3FYGA 1QXHA 5HR0A 3GH6A 2TIRA 4MPFA 1ERVA 2XHFA 3R2QA 4N0VA 4KA0A 4ZB6A 4DSQA 2DKHA 1TKDB 2WZ9A 4CY6A 3Q19A 5IPGA 4WEYA 3IC8A 4ZB8A 3DMLA 2I1UA 1A8LA 2FWHA 1M9BA 1T00A 2X8GA 4YKGA 2HE3A 3Q6OA 5DCGA 4FQUA 5HR2A 13GSA 3BOAA 4NV5A 1XVWA 3TOTA 2L6CA 3L9SA 2F9SA 5J9BA 2YWMA 2R0CA 3GIXA 1K3LA 1BYEA 2V32A 3LYKA 1TI3A 3FZ5A 1IYHA 4ZBDA 2P5QA 3APQA 2H75A 2PBJA 2YP6A 5DDLA 5KEJA 3VPTA 5A4VA 2H0HA 2OADA 5EVOA 3TJGA 4WETA 2E2MA 2WJUA 2GSQA 1U6TA 1FO5A 1YY7A 5F07A 3ZLPA 2LRTA 4EDZA 5KN0A 3ZMLA 2KOKA 3GX0A 4PGTA 1XWKA 2HFDA 3F3QA 4O5QA 3EU4A 3HJPA 2J9HA 2F8FA 2GLRA 4E8EA 1GTUA 1QMVA 2DJKA 4MP4A 4IN0A 2C8UA 2V41A 4F0BA 1F6MC 3VWWA 5DVBA 1BX9A 1Y25A 2VLVA 3G7JA 4G9HA 3VWXA 2OBIA 1GNWA 2N5AA 2H1GA 2FWFA 1EGRA 3F4RA 5DAKA 1XW6A 1MTCA 2B5YA 3A5WA 4LA1A 4X1UA 1T7PB 1FAAA 4TXVA 3TGZA 3IHQA 3UBLA 1TK0B 1GTAA 1ZYNA 3UAPA 5A5KA 2DKIA 1ZYEA 4ECCA 5DCHA 3BCKA 4OO5A 2L57A 2DLXA 2NVLA 2M80A 1EV4A 2B7JA 2C0DA 4NXIA 6GSTA 2B7KA 4XS4A 4D73B 4V1Ap 5BRTA 3WD6A 4N10A 1G6WA 5IMAA 1JZDA 1V9WA 5G31A 5FWGA 3MNGA 4Z2RA 1YEXA 3FHKA 3LORA 3GX8A 1EP7A 2DIZA 2VD1A 4KCAA 3TUEA 2QSIA 2RUFA 4ZBBA 2H6YA 4L0WA 2YOIA 3TJJA 2F51A 3D4MA 1LJRA 4HJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2G A;  2IMF A;  2X64 A;  3QCP A;  1SL0 B;  4WBR D;  1DBY A;  1ACV A;  1J0F A;  4GF0 A;  4ZL7 A;  5CRD A;  2ZNM A;  3ZFB A;  1TK5 B;  3K8N A;  3TRX A;  2FWG A;  3D0Z A;  2M46 A;  1X0R A;  5CYY A;  3RHB A;  5J9C A;  3M3M A;  3RPN A;  2FHE A;  2CX4 A;  2H70 A;  2GTU A;  4POL A;  2YWN A;  1ERW A;  2VL3 A;  4EL1 A;  4EF0 A;  3JCM L;  3UEM A;  3O6T A;  12GS A;  5IO2 A;  3ME8 A;  4BWQ A;  4NHW A;  4GWR A;  1X9S B;  1GNE A;  2CVB A;  1O81 A;  4G19 A;  5ECP B;  4XRD A;  1H75 A;  2E7P A;  1OC9 A;  5KN2 A;  2CQ9 A;  2VCV A;  1PN9 A;  3NIV A;  4NAX A;  1FVK A;  5HR3 A;  2LJA A;  4K0N A;  2JL4 A;  1ZOF A;  3BCI A;  6GSY A;  4LMV A;  3ME7 A;  4RI6 A;  5F06 A;  5D9V A;  1GSU A;  5GST A;  3LXZ A;  2GQL A;  3IA1 A;  2HZE A;  1WIK A;  5COH A;  5G1K A;  4BA7 A;  3QPM A;  5A4U A;  2B1L A;  2B3S A;  4XRA A;  1TI1 A;  3UVH A;  1HNB A;  1QGV A;  2PVQ A;  2IWT A;  2I81 A;  3IDV A;  3RDW A;  4XTS A;  4PNG A;  1A2J A;  1XOA A;  5HFI A;  1MDK A;  3VLN A;  1HNA A;  3FW2 A;  22GS A;  2VCW A;  2EIO A;  4IJI A;  1EOH A;  1XOB A;  3FR9 A;  1GSY A;  2ZCT A;  3BBY A;  4TKY A;  3HD5 A;  1U88 A;  3IV4 A;  4HI7 A;  2J23 A;  3HHV A;  3GKK A;  5D9X A;  1PKZ A;  4MPG A;  1PA3 A;  2C1Y A;  1OKT A;  1VF1 A;  4TN8 A;  3UBK A;  6GSU A;  2A4V A;  1RQM A;  3NZN A;  5LNK e;  3I43 A;  3HJO A;  4KDU A;  4HJ2 A;  4JED A;  1VRS D;  5ECN B;  1ML6 A;  1OVN A;  1Z5Y E;  2FD3 A;  1VF4 A;  2HXK A;  1ZZY A;  2FGX A;  1WOU A;  1BAY A;  3F4S A;  5J3R A;  5ENU A;  3GV1 A;  2GDR A;  1ZYQ B;  2CX3 A;  2JSY A;  2QC7 A;  2LNS A;  1SK0 A;  4LMW A;  4KGI A;  4TR4 A;  1DSB A;  2RLI A;  1SK1 A;  3LFL A;  1QQ2 A;  4YQV A;  2HT9 A;  5DJM A;  3ZYW A;  5A4W A;  5DBQ A;  2K9F A;  1ZGN A;  1XXU A;  3W6G A;  4JE1 A;  1XW5 A;  1XFL A;  3DGQ A;  3L0H A;  5JWO B;  3EC3 A;  5IM9 A;  1HYU A;  1XWG A;  2CVD A;  2LRN A;  4I97 A;  1NW2 A;  4PUA A;  1J9B A;  1OC9 B;  2YAN A;  1THO A;  4J2F A;  1Q98 A;  2BMX A;  2DJ3 A;  1X9M B;  1Z9H A;  4POB A;  1G7E A;  5B8A A;  3TJK A;  3E3E A;  3KTB A;  2IMK A;  2H19 A;  1A0R P;  4OFT A;  4AF2 A;  4XCS A;  4J56 E;  3GKX A;  5CRE A;  2WB9 A;  3QAW A;  3IOS A;  3HXS A;  2KP1 A;  5G1L A;  5CAX A;  1XPV A;  3HY2 A;  1Z6M A;  3VFI A;  1URM A;  5E59 A;  2L4Q A;  1J08 A;  2WS2 A;  5H5R A;  3HVX A;  3RPP A;  1XW9 A;  3ZVJ A;  2P31 A;  2CZ2 A;  2ZUP A;  1MD4 A;  3C1R A;  2FA4 A;  1B8X A;  3NOF A;  1F9M A;  1FVJ A;  1ABA A;  4WF4 A;  4DEJ A;  2DBC A;  4N30 A;  3UIW A;  1EOG A;  3VI7 A;  2L6D A;  3QR6 A;  1M2B A;  3TB2 A;  3ZMK A;  4ZL8 A;  2CV4 A;  1YEP A;  2DJ1 A;  4WF5 A;  1TU8 A;  4MDC A;  2IIY A;  2H1B A;  1V57 A;  3PR8 A;  1ZMA A;  3Q18 A;  1KTE A;  3UOM A;  2HYX A;  4GLT A;  2LRC A;  4MH2 A;  4Z7X A;  2VL2 A;  2JSZ A;  4GCI A;  4EVM A;  5JWR B;  4ULX A;  2MBS A;  2MMO A;  4XIH A;  2B6M A;  2VO4 A;  1Z7R A;  4YAP A;  3F8U A;  3CSI A;  5IMF A;  5IOW A;  2IPA A;  4D73 A;  4HEA 2;  2OAC A;  1TU7 A;  1HD2 A;  4MZC A;  2YPM A;  2PMT A;  4PQ1 A;  1JLW A;  5ECM B;  4BWS A;  1SKR B;  1GWC A;  5GZZ B;  1B9Y C;  1TRV A;  4FYC A;  3ZRE A;  5F05 A;  2H76 A;  4V2L A;  2R3X A;  3FZ4 A;  1FHE A;  2H01 A;  4TR1 B;  3EU3 A;  4LL4 B;  2E0Q A;  1OC3 A;  1OE8 A;  4EE0 A;  4F03 A;  1PMT A;  4OCE A;  1A8Y A;  1E6B A;  3PGT A;  2FA8 A;  2PU9 C;  4IJ3 A;  5IMC A;  3A2X A;  4ZBA A;  4G10 A;  2QKE A;  2CZ3 A;  3LWA A;  2GZZ A;  1G7O A;  3TKS C;  1GLP A;  2B1K A;  5ELA A;  1PGT A;  4AJ7 A;  3CBU A;  2C4J A;  3FK8 A;  4MMM A;  2YN1 A;  2CAQ A;  2O7K A;  2L4C A;  4K7O A;  2H0I A;  1AQV A;  4TR0 A;  1R5P A;  3F0I A;  16GS A;  5AN1 A;  1JZR A;  2EC4 A;  4P3Y B;  1PD2 1;  4MF5 A;  3HJM A;  5EL8 A;  2JU5 A;  4YAV A;  5IMZ A;  2PUK C;  3KCM A;  3ERG A;  4AJ6 A;  1IYI A;  1O6J A;  1W89 A;  3J7Y k;  2IFQ A;  1F3A A;  4Q5Q A;  4F2I A;  3H8Q A;  3TCO A;  2WDU A;  1XVQ A;  4POM A;  4XHM A;  1U87 A;  2FNO A;  3F6F A;  3L9V A;  4JR6 A;  1GUL A;  1O8W A;  1RK4 A;  2YWO A;  4RI7 A;  2LQO A;  1I9D A;  1PL1 A;  4MLY A;  2RII A;  1LU4 A;  4LLR A;  3TDG A;  1T1V A;  2FWE A;  1A2L A;  4MAB A;  1GSQ A;  3HZ8 A;  4L5O A;  3E0U A;  4MF7 A;  4F9Z A;  1Z6N A;  2C3N A;  4NV2 A;  3FY7 A;  3HYP A;  1TRS A;  5INY A;  1VF3 A;  3APS A;  3S9F A;  4V1A g;  3PH9 A;  4ZIJ A;  1GTB A;  3EE2 A;  2RM5 A;  2HLS A;  4Q5F A;  4GQF A;  4PUR A;  3TKR A;  4CDO A;  2B5X A;  3FEU A;  5HR1 A;  3M9K A;  1DUG A;  2DJ0 A;  1PSQ A;  3GL5 A;  5J5N A;  5EY6 A;  1XIY A;  4KB3 A;  2AB6 A;  3C73 A;  1GRX A;  3EMP A;  3A2W A;  4ECJ A;  1JFU A;  4IS0 A;  4OFN A;  3M8N A;  1TTZ A;  3D6I A;  2O8V B;  2N5B A;  4MA9 A;  2IL3 A;  2OBK A;  3EWL A;  3EUR A;  2LS5 A;  5GAN D;  2KUC A;  1M7T A;  1MDJ A;  2ON5 A;  3ZIJ A;  4L8E A;  1PQN A;  1B9X C;  2GZP A;  2HRN A;  5DJL A;  1OAZ A;  1K0M A;  3GFK A;  3GN3 A;  2GSS A;  4MJE A;  1T8E B;  18GS A;  11GS A;  3BD2 A;  1ON4 A;  2XPE A;  2LNT A;  1FOV A;  3UJ1 A;  1EZK A;  3TKP A;  5F0G A;  2AHE A;  5AGY A;  1VF2 A;  1EEM A;  2LQQ A;  4MF6 A;  4X0X A;  1BQ7 A;  2H30 A;  2CVK A;  2DMM A;  2IFQ B;  2A2S A;  2QGV A;  1K0C A;  3DEX A;  4QQ7 A;  2H73 A;  2HSY A;  1YKC A;  1K3O A;  1NM3 A;  3H4K A;  1GL8 A;  5E4W A;  4IBP A;  1UN2 A;  3F6D A;  1V2A A;  4MZB A;  2AYT A;  3UAR A;  4PQH A;  4K7N A;  1GSE A;  1KBN A;  3N5O A;  1K0D A;  2YV9 A;  3LSZ A;  1TP9 A;  3LQ7 A;  5IMD A;  3MWH A;  2GGT A;  2GQK A;  4GSN A;  4FO5 A;  2GSR A;  5J41 A;  2R37 A;  2GST A;  17GS A;  3WT1 A;  3G7Y A;  4KCE A;  3V1W A;  4E8H A;  2HNL A;  2LJK A;  4ML6 A;  5CRH A;  5DQS A;  3LEF A;  2LST A;  5C00 A;  3IK9 A;  3ZFL A;  4XS6 A;  3ZRD A;  2H8L A;  3I69 A;  4O7H A;  2I9H A;  3QOU A;  1ERT A;  4F82 A;  1AIU A;  2G2Q A;  1S3D A;  3LGC A;  2VIM A;  1GP1 A;  4JZQ A;  3I9V 2;  2H1A A;  4Q5N A;  1GUH A;  3RAZ A;  3WYW A;  5B6N A;  2LJR A;  1XBS A;  4RQX A;  5D8I A;  3HVS A;  2YWI A;  2O85 A;  6GSW A;  2H0G A;  5JCW A;  1T4Y A;  1O7U A;  2BJX A;  10GS A;  4K1F A;  3CXG A;  1ST9 A;  2DC5 A;  1NHO A;  1EEJ A;  3D22 A;  2MMN A;  3DXB A;  3TKQ A;  3HCZ A;  4K8M A;  1TRW A;  1AUC A;  1R5A A;  4GQC A;  2PVO C;  2HRF A;  4V2N A;  3QFB C;  4RUV A;  1M2A A;  4LL1 B;  4DSS A;  1N8J A;  5HQP A;  3FZA A;  5ECR B;  3I6A A;  1G6Y A;  4GSS A;  1SKW B;  1YF0 A;  2M72 A;  4I2T A;  1U3I A;  3WT2 A;  2NDO A;  4BPY A;  2F8A A;  5CNW A;  5AIX A;  3AY8 A;  4KAE A;  3GH9 A;  3IXR A;  2MYG A;  2L59 A;  4EKZ A;  2JZT A;  1O73 A;  3KH7 A;  3UL3 A;  2PER A;  4JR4 A;  4NPB A;  3P7X A;  5B7C A;  1GUM A;  1XWC A;  4TR1 A;  4TW5 A;  3GUS A;  1FB0 A;  2H6X A;  1O8X A;  4Q5R A;  4ML1 A;  2NPB A;  1X5C A;  2PPT A;  3IRA A;  1XWB A;  3FZ9 A;  3GTU B;  4IKH A;  3ISO A;  4IQA A;  1BG5 A;  1SD8 A;  4OD7 A;  2V6O A;  1EWX A;  1JZO A;  2LTK A;  2OE1 A;  1F2E A;  2HSH A;  2V2G A;  2IJY A;  2YNX A;  3KMN A;  4IHU A;  1AAZ A;  2IN3 A;  1WE0 A;  3QMX A;  4TR3 A;  3GA4 A;  1XZO A;  1R26 A;  1I5G A;  1WWJ A;  1TW9 A;  1GSF A;  5DQY A;  2TRX A;  4KND A;  2OA7 A;  3VPQ A;  1M9A A;  5ECL B;  3VWU A;  3FR3 A;  2VLT A;  4K7I A;  1B4Q A;  1EGO A;  4EC0 A;  1GSS A;  4I8B A;  5ECQ B;  2FLS A;  1K0B A;  4OO4 A;  1FB6 A;  2C80 A;  4DSR A;  3O3T A;  3ERF A;  2C0G A;  5F8B A;  4G2E A;  1AXD A;  4IQ1 A;  3C7M A;  1THX A;  4HQZ A;  5DAL B;  1PRX A;  2K6V A;  3KJY A;  2VAF A;  2VL9 A;  3UVT A;  1ILO A;  1V98 A;  3SBC A;  3GHA A;  3J7Y b;  3C1S A;  3IC4 A;  1BED A;  4JBB A;  2ES7 A;  2K8V A;  4WR4 A;  3VWV A;  1UC7 A;  2P0G A;  3M9J A;  3IK7 A;  5CP1 A;  4DSS B;  2YZU A;  1JZW A;  4KSO A;  1SJ6 A;  4BL7 A;  4QL7 A;  4NMU A;  3QAG A;  3DIE A;  5LD0 A;  4YQM A;  4ECI A;  1ZCP A;  1PKW A;  2BTO T;  5ECI B;  4YQU A;  4HDE A;  1TDI A;  2H72 A;  2C3T A;  3QD9 A;  3DWV A;  2OJL A;  4KE3 A;  3ED3 A;  4ISD A;  3H79 A;  5J4U A;  3U5R E;  2MBT A;  3TJF A;  2DIY A;  1YZX A;  4IW9 A;  3DKS A;  4ZXG A;  5D9T A;  3H93 A;  3IPZ A;  2K18 A;  4PQI A;  2K8S A;  5AIV A;  4F0C A;  1A0F A;  3F3R A;  2IMD A;  5GSS A;  2FY6 A;  3KEB A;  2EIR A;  2TRC P;  2MMZ A;  5G30 A;  5FT3 A;  5KN1 A;  2V1M A;  2NBS A;  3M1G A;  1PX6 A;  1K3Y A;  5D93 A;  1SJZ A;  2VL2 C;  2GVP A;  1SKS B;  1CQH A;  1OKD A;  3F63 A;  2LV3 A;  5ID2 B;  4WR5 A;  2NTO A;  5D9W A;  4HZ2 A;  1TOF A;  1ERU A;  2A2R A;  4X43 A;  1U3A A;  2XC2 A;  2O87 A;  2PN8 A;  1T4Z A;  4N0Z A;  4H86 A;  1W4V A;  1SYX A;  3L78 A;  1B48 A;  3HA9 A;  3GKN A;  1C72 A;  4HU7 A;  2L5L A;  1Z3E A;  1NHY A;  1S3C A;  4L0U A;  1TK8 B;  2EIQ A;  3Q74 A;  4K9Z A;  4J57 E;  1HQO A;  3UMA A;  3WGE A;  3GRX A;  3G7I A;  6GSX A;  2Z9S A;  2DJJ A;  2GT6 A;  2WUL A;  4MJB A;  3P8W A;  5ECO B;  1RW1 A;  1F37 A;  3LXT A;  4GXZ A;  2GZY A;  3GST A;  4OWY A;  3GUR A;  2OKA A;  3G9B A;  5JCU A;  1ZL9 A;  4KDY A;  4WXT A;  3M0F A;  3FRC A;  2YCD A;  5FHI A;  3ZZX A;  3DYR A;  4HU9 A;  1PL2 A;  4TXO B;  3CSH A;  4MCU A;  4JU5 A;  4K6X A;  4MJA A;  2JAC A;  2C0F A;  4XS1 A;  1CQG A;  3LG6 A;  3MDK A;  4YH2 A;  1YQ1 A;  2YJ7 A;  1N2A A;  1X5E A;  2ON7 A;  3KP8 A;  1SJI A;  3LYP A;  1B4P A;  2PGT A;  3HZ4 A;  2WRT A;  2VCT A;  3E9J B;  3VK9 A;  2REM A;  3A3T A;  2JAD A;  3ZIV A;  3KIJ A;  2I4A A;  5L71 A;  2H71 A;  3APO A;  3GKM A;  4I2U A;  1K0O A;  2I3Y A;  1G0T A;  4AJ8 A;  2WGR A;  2H74 A;  2VM1 A;  3IAS 2;  4ECB A;  4ACS A;  1OC8 A;  4FYU A;  4IGJ A;  3KMO A;  2LUS A;  4CW9 A;  3TOU A;  2B5E A;  4TVE A;  2CAI A;  3CSJ A;  2VM2 A;  3EYT A;  3CYN A;  4I6X A;  2HI7 A;  1QK8 A;  2XBI A;  3ZIT A;  1A23 A;  1S3A A;  3RBT A;  3CRT A;  2R2J A;  3KZQ A;  4KH7 A;  3WGD A;  2FUG 2;  1R7H A;  4HS1 A;  2VCZ A;  2JZS A;  2X99 A;  3KM6 A;  1TRU A;  9GSS A;  2RUE A;  2X8C A;  5B8B A;  1AQX A;  2X8H A;  3KH9 A;  4NHZ A;  3L9U A;  1NSW A;  1TXX A;  3DVX A;  3PIN A;  3D5J A;  5CO3 A;  3IR4 A;  8GSS A;  4K2D A;  2AJQ B;  1OYJ A;  3CMI A;  4MJC A;  1WMJ A;  3DVW A;  1FG4 A;  1FW1 A;  3VI5 A;  3FR6 A;  2AAW A;  1GLQ A;  3US3 A;  2VCQ A;  1H4O A;  3EMX A;  5DAK B;  1XWA A;  2GQM A;  3GTU A;  3KP9 A;  4KDX A;  3ZTL A;  2IME A;  1X9W B;  1DE2 A;  4ILF A;  1O85 A;  2KLX A;  1SU9 A;  4K0G A;  5D73 A;  1QFN A;  2XPD A;  3EIN A;  3QAV A;  5C04 A;  4WBJ A;  1LBK A;  5H5Q A;  1YJ6 A;  1WPI A;  1M99 A;  3W8J A;  5B6M A;  1OE7 A;  5IPH A;  2VUP A;  4MH3 A;  4EO3 A;  1JLV A;  5CRG A;  4ZIL A;  2WCI A;  4XS4 B;  1PX7 A;  3D4T A;  2LEG A;  4TRX A;  5AIS A;  3U6V A;  1AQW A;  3FKF A;  1UVZ A;  4OCF A;  3TKS E;  4BVY A;  1JHB A;  3IBH A;  6GSV A;  3O76 A;  4WKW A;  2GT5 A;  3F4T A;  2R4V A;  3WGX A;  2H66 A;  1KNG A;  2IMI A;  4FH8 A;  2YJH A;  4EUY A;  1R4W A;  4PUF C;  5IIZ A;  3A2V A;  3IE3 A;  1EP8 A;  3HKR A;  3ZVJ D;  1K0N A;  5DAL A;  3GNJ A;  3CTG A;  1X5D A;  1XCC A;  3QDN A;  1F3B A;  3SWL A;  2D2Z A;  5LCZ A;  1A24 A;  3MAK A;  1KEB A;  4HZ4 A;  4MK3 A;  1QUW A;  2H1D A;  4JRR A;  2V6K A;  4KUN A;  4RQR A;  1GTI A;  5ECK B;  3QFA C;  4EXJ A;  1DE1 A;  1SK2 A;  4FYB A;  3DRN A;  2YZH A;  5IQY A;  2YV7 A;  1SL1 B;  2JZR A;  5IMV A;  2FCH A;  2RM6 A;  2KHP A;  3C71 A;  1GH2 A;  1K0A A;  4KX4 A;  1M2D A;  4BVX A;  3IAM 2;  1Q4J A;  2C0E A;  4NWY A;  3KD0 A;  1YKA A;  5GAP D;  2MZC A;  5ECS A;  4PX1 A;  2R5G A;  2ALB A;  3BJ5 A;  3P90 A;  2DML A;  2VD0 A;  4TOP A;  4CHS A;  3P2A A;  1M0U A;  3C8E A;  4HUA A;  4FIW A;  14GS A;  6GSS A;  1Y6E A;  2LKU A;  2OE3 A;  2R6K A;  1AC1 A;  2KP2 A;  1V40 A;  4GST A;  5D96 A;  2HZF A;  2WFC A;  1GUK A;  2AUV A;  3GYK A;  3GSS A;  3OR5 A;  4L5L A;  4ZB9 A;  5ABR A;  1YF1 A;  3CRU A;  2DSA A;  1VGL A;  1SL2 B;  3L4N A;  3TRP A;  4HOJ A;  2OE0 A;  1T3B A;  4IP6 A;  5ECH B;  3EVI A;  2HZE B;  3ZL5 A;  1E2Y A;  1YDK A;  5G2Z A;  3VUR A;  3KXO A;  1UA5 A;  2VCX A;  4O5R A;  1WRY A;  4KW6 A;  1SEN A;  5HFG A;  3MSZ A;  4IVF A;  3RHC A;  4AGS A;  3LJR A;  5ID2 A;  2XBQ A;  3F9U A;  4MZW A;  5CRW A;  3GL3 A;  5JWQ B;  4V2M A;  4PXO A;  2L5O A;  1WP0 A;  3GMF A;  2VOC A;  2CT6 A;  4QL9 A;  5HFK A;  2O89 A;  4IP1 A;  4O32 A;  3DD3 A;  4N11 A;  5EPF A;  5G5F A;  20GS A;  3N9J A;  5IOX A;  1MD3 A;  1SD9 A;  4IEL A;  1MDI A;  3TRQ A;  1SYR A;  4GTU A;  3KGK A;  1AW9 A;  2N5F A;  2P5R A;  5G5E A;  3KTL A;  3D21 A;  4KSM A;  4PNF A;  1BJX A;  2H6Z A;  4EDY A;  1EV9 A;  4O92 A;  5H5S A;  3HVV A;  4ID0 A;  2MMA A;  1GSD A;  1HNC A;  5JCG A;  1WJK A;  2GS3 A;  4I5Q A;  3TKS A;  2AV4 A;  4OMV A;  5KN3 A;  3HDC A;  3TJB A;  2CA8 A;  3ERW A;  2F3M A;  4DVC A;  4ZL9 A;  3CTF A;  1TJD A;  4POK A;  5IO0 A;  3H1N A;  19GS A;  4TXO A;  2VLU A;  4OFM A;  3W8S A;  2C3Q A;  1USB A;  1V58 A;  4GRF A;  1Z7P A;  1A2M A;  2PWJ A;  5ELG A;  1MEK A;  7GSS A;  4HQS A;  2DJ2 A;  2G0F A;  3FYG A;  1QXH A;  5HR0 A;  3GH6 A;  2TIR A;  4MPF A;  1ERV A;  2XHF A;  3R2Q A;  4N0V A;  4KA0 A;  4ZB6 A;  4DSQ A;  1TKD B;  2WZ9 A;  3Q19 A;  5IPG A;  4WEY A;  4ZB8 A;  3DML A;  2I1U A;  1A8L A;  2FWH A;  1M9B A;  1T00 A;  2X8G A;  2HE3 A;  3Q6O A;  5DCG A;  5HR2 A;  13GS A;  3BOA A;  4NV5 A;  1XVW A;  3TOT A;  2L6C A;  3L9S A;  2F9S A;  5J9B A;  2YWM A;  3GIX A;  1K3L A;  1BYE A;  2V32 A;  3LYK A;  1TI3 A;  3FZ5 A;  1IYH A;  4ZBD A;  2P5Q A;  3APQ A;  2H75 A;  2PBJ A;  2YP6 A;  5DDL A;  5KEJ A;  3VPT A;  5A4V A;  2H0H A;  2OAD A;  5EVO A;  3TJG A;  4WET A;  2E2M A;  2WJU A;  2GSQ A;  1U6T A;  1FO5 A;  1YY7 A;  5F07 A;  3ZLP A;  2LRT A;  4EDZ A;  5KN0 A;  3ZML A;  2KOK A;  3GX0 A;  4PGT A;  1XWK A;  2HFD A;  3F3Q A;  3EU4 A;  3HJP A;  2J9H A;  2F8F A;  2GLR A;  4E8E A;  1GTU A;  1QMV A;  2DJK A;  4MP4 A;  4IN0 A;  2C8U A;  2V41 A;  4F0B A;  1F6M C;  3VWW A;  5DVB A;  1BX9 A;  1Y25 A;  2VLV A;  3G7J A;  4G9H A;  3VWX A;  2OBI A;  1GNW A;  2N5A A;  2H1G A;  2FWF A;  1EGR A;  3F4R A;  5DAK A;  1XW6 A;  1MTC A;  2B5Y A;  3A5W A;  4LA1 A;  4X1U A;  1T7P B;  1FAA A;  4TXV A;  3TGZ A;  3IHQ A;  3UBL A;  1TK0 B;  1GTA A;  3UAP A;  5A5K A;  1ZYE A;  4ECC A;  5DCH A;  3BCK A;  4OO5 A;  2L57 A;  2DLX A;  2NVL A;  2M80 A;  1EV4 A;  2B7J A;  2C0D A;  4NXI A;  6GST A;  2B7K A;  4XS4 A;  4D73 B;  4V1A p;  3WD6 A;  4N10 A;  1G6W A;  5IMA A;  1JZD A;  1V9W A;  5G31 A;  5FWG A;  3MNG A;  1YEX A;  3FHK A;  3LOR A;  3GX8 A;  1EP7 A;  2DIZ A;  2VD1 A;  4KCA A;  3TUE A;  2QSI A;  2RUF A;  4ZBB A;  2H6Y A;  4L0W A;  2YOI A;  3TJJ A;  2F51 A;  3D4M A;  1LJR A;  4HJM A; 
#chains in the Genus database with same CATH topology
 2E2G A;  2IMF A;  2X64 A;  3QCP A;  1SL0 B;  4WBR D;  1DBY A;  1ACV A;  1J0F A;  4GF0 A;  4ZL7 A;  5CRD A;  2ZNM A;  3ZFB A;  1TK5 B;  3K8N A;  3TRX A;  2FWG A;  3D0Z A;  2M46 A;  1X0R A;  5CYY A;  3RHB A;  5J9C A;  3M3M A;  3RPN A;  2FHE A;  2CX4 A;  2H70 A;  2GTU A;  4POL A;  2YWN A;  1ERW A;  2VL3 A;  4EL1 A;  4EF0 A;  3JCM L;  3UEM A;  3O6T A;  12GS A;  5IO2 A;  3ME8 A;  4BWQ A;  4NHW A;  4GWR A;  4Z2U A;  1X9S B;  1GNE A;  2CVB A;  1O81 A;  4G19 A;  5ECP B;  4XRD A;  1H75 A;  2E7P A;  1OC9 A;  5KN2 A;  2CQ9 A;  2VCV A;  1PN9 A;  3NIV A;  2HSM A;  4NAX A;  1FVK A;  5HR3 A;  2LJA A;  4K0N A;  4A5P A;  2JL4 A;  1ZOF A;  3BCI A;  6GSY A;  4LMV A;  3ME7 A;  4RI6 A;  5F06 A;  5D9V A;  1GSU A;  5GST A;  3LXZ A;  2GQL A;  3IA1 A;  2HZE A;  1WIK A;  5COH A;  5G1K A;  4BA7 A;  3QPM A;  5A4U A;  2B1L A;  2B3S A;  3CQF A;  4XRA A;  1TI1 A;  3UVH A;  1HNB A;  1QGV A;  2PVQ A;  2IWT A;  2I81 A;  3IDV A;  3RDW A;  4XTS A;  4PNG A;  1A2J A;  1XOA A;  5HFI A;  1MDK A;  3VLN A;  1HNA A;  3FW2 A;  22GS A;  2VCW A;  2EIO A;  4IJI A;  1EOH A;  1XOB A;  3FR9 A;  1GSY A;  2ZCT A;  3BBY A;  4TKY A;  3HD5 A;  1U88 A;  3IV4 A;  4HI7 A;  2J23 A;  3HHV A;  3GKK A;  5D9X A;  1PKZ A;  4MPG A;  1PA3 A;  2C1Y A;  1OKT A;  1VF1 A;  4TN8 A;  3UBK A;  6GSU A;  2A4V A;  1RQM A;  3NZN A;  5LNK e;  3I43 A;  3HJO A;  4KDU A;  4HJ2 A;  4JED A;  1VRS D;  5ECN B;  1ML6 A;  1OVN A;  1Z5Y E;  2FD3 A;  1VF4 A;  2HXK A;  1ZZY A;  2FGX A;  1WOU A;  1BAY A;  3F4S A;  5J3R A;  5ENU A;  3GV1 A;  2GDR A;  1ZYQ B;  2CX3 A;  2JSY A;  2QC7 A;  2LNS A;  1SK0 A;  4LMW A;  4KGI A;  4TR4 A;  2X4A A;  1DSB A;  2RLI A;  1SK1 A;  3LFL A;  1QQ2 A;  4YQV A;  2HT9 A;  5DJM A;  3ZYW A;  5A4W A;  5DBQ A;  2K9F A;  1ZGN A;  1XXU A;  3W6G A;  4JE1 A;  1XW5 A;  1XFL A;  3DGQ A;  3L0H A;  5JWO B;  3EC3 A;  5IM9 A;  1HYU A;  1XWG A;  2CVD A;  2LRN A;  4I97 A;  1NW2 A;  4PUA A;  1J9B A;  1OC9 B;  2YAN A;  1THO A;  4J2F A;  1Q98 A;  2BMX A;  2DJ3 A;  1X9M B;  1Z9H A;  4POB A;  1G7E A;  4EIP A;  5B8A A;  3TJK A;  3E3E A;  3KTB A;  2IMK A;  2H19 A;  1A0R P;  4OFT A;  4AF2 A;  4XCS A;  4J56 E;  3GKX A;  5CRE A;  2WB9 A;  4X4J A;  3QAW A;  3IOS A;  3HXS A;  2KP1 A;  5G1L A;  5CAX A;  1XPV A;  3HY2 A;  1Z6M A;  3VFI A;  1URM A;  4G0I A;  5E59 A;  2L4Q A;  1J08 A;  2WS2 A;  5H5R A;  3HVX A;  3RPP A;  1XW9 A;  3ZVJ A;  2P31 A;  2CZ2 A;  2ZUP A;  1MD4 A;  3C1R A;  2FA4 A;  1B8X A;  3NOF A;  1F9M A;  1FVJ A;  1ABA A;  4WF4 A;  4DEJ A;  2DBC A;  4N30 A;  3UIW A;  1EOG A;  3VI7 A;  2L6D A;  3QR6 A;  1M2B A;  3TB2 A;  3ZMK A;  4ZL8 A;  2CV4 A;  1YEP A;  2DJ1 A;  4WF5 A;  1TU8 A;  4MDC A;  4YKF A;  2IIY A;  2H1B A;  1V57 A;  3PR8 A;  1ZMA A;  3Q18 A;  1KTE A;  3UOM A;  2HYX A;  4GLT A;  2LRC A;  4MH2 A;  4Z7X A;  2VL2 A;  2JSZ A;  4GCI A;  4EVM A;  5JWR B;  4ULX A;  2MBS A;  2MMO A;  4XIH A;  2B6M A;  2VO4 A;  1Z7R A;  4YAP A;  3F8U A;  3CSI A;  5IMF A;  5IOW A;  2IPA A;  4D73 A;  4HEA 2;  2OAC A;  1TU7 A;  1HD2 A;  4MZC A;  4EIQ A;  2YPM A;  2PMT A;  4PQ1 A;  1JLW A;  5ECM B;  2X49 A;  4BWS A;  1SKR B;  1GWC A;  5GZZ B;  1B9Y C;  1TRV A;  4FYC A;  3ZRE A;  5F05 A;  2H76 A;  4V2L A;  2R3X A;  3FZ4 A;  1FHE A;  2H01 A;  4TR1 B;  3EU3 A;  4LL4 B;  2E0Q A;  1OC3 A;  1OE8 A;  4EE0 A;  4F03 A;  1PMT A;  4OCE A;  1A8Y A;  1E6B A;  3PGT A;  2FA8 A;  2PU9 C;  4IJ3 A;  5IMC A;  3A2X A;  4ZBA A;  4G10 A;  2QKE A;  2CZ3 A;  3LWA A;  2HRK A;  2GZZ A;  1G7O A;  3TKS C;  1GLP A;  2B1K A;  5ELA A;  1PGT A;  4AJ7 A;  3CBU A;  2C4J A;  3FK8 A;  4MMM A;  2YN1 A;  2CAQ A;  2O7K A;  2L4C A;  4K7O A;  2H0I A;  1AQV A;  4TR0 A;  1R5P A;  3F0I A;  16GS A;  5AN1 A;  1JZR A;  2EC4 A;  4P3Y B;  1PD2 1;  4MF5 A;  3HJM A;  5EL8 A;  2JU5 A;  4YAV A;  5IMZ A;  2PUK C;  3KCM A;  3ERG A;  4AJ6 A;  1IYI A;  1O6J A;  1W89 A;  3J7Y k;  2IFQ A;  1F3A A;  4Q5Q A;  4F2I A;  3H8Q A;  3TCO A;  2WDU A;  1XVQ A;  4POM A;  4XHM A;  1U87 A;  2FNO A;  3F6F A;  3L9V A;  4JR6 A;  1GUL A;  1O8W A;  1RK4 A;  2YWO A;  4RI7 A;  2LQO A;  1I9D A;  1PL1 A;  4MLY A;  2RII A;  1LU4 A;  4LLR A;  3TDG A;  1T1V A;  2FWE A;  1A2L A;  4MAB A;  1GSQ A;  3HZ8 A;  4L5O A;  4BL7 B;  3E0U A;  4MF7 A;  4F9Z A;  1Z6N A;  2C3N A;  4NV2 A;  3FY7 A;  3MIX A;  3HYP A;  1TRS A;  5INY A;  1VF3 A;  3APS A;  3S9F A;  4V1A g;  3PH9 A;  4ZIJ A;  1GTB A;  3EE2 A;  2RM5 A;  2HLS A;  4Q5F A;  4GQF A;  4PUR A;  3TKR A;  4CDO A;  2B5X A;  3FEU A;  5HR1 A;  3M9K A;  1DUG A;  2DJ0 A;  1PSQ A;  3GL5 A;  5J5N A;  5EY6 A;  1XIY A;  4KB3 A;  2AB6 A;  3C73 A;  1GRX A;  3EMP A;  3A2W A;  4ECJ A;  1JFU A;  4IS0 A;  4OFN A;  3M8N A;  1TTZ A;  1PN0 A;  3D6I A;  2O8V B;  2N5B A;  4MA9 A;  2IL3 A;  2OBK A;  3EWL A;  3EUR A;  2LS5 A;  5GAN D;  2KUC A;  1M7T A;  1MDJ A;  2ON5 A;  3ZIJ A;  4L8E A;  1PQN A;  1B9X C;  2GZP A;  2HRN A;  5DJL A;  1OAZ A;  5KOW A;  1K0M A;  3GFK A;  3GN3 A;  2GSS A;  3HVN A;  4MJE A;  1T8E B;  18GS A;  11GS A;  3BD2 A;  1ON4 A;  2XPE A;  2LNT A;  1FOV A;  3UJ1 A;  1EZK A;  3TKP A;  5F0G A;  2AHE A;  5AGY A;  1VF2 A;  1EEM A;  2LQQ A;  4MF6 A;  4X0X A;  1BQ7 A;  2H30 A;  2CVK A;  2DMM A;  2IFQ B;  2A2S A;  2QGV A;  1K0C A;  3DEX A;  4QQ7 A;  2H73 A;  2HSY A;  1YKC A;  1K3O A;  4K5R A;  1NM3 A;  3H4K A;  1GL8 A;  5E4W A;  4IBP A;  1UN2 A;  3F6D A;  1V2A A;  4MZB A;  2AYT A;  3UAR A;  4PQH A;  4K7N A;  1GSE A;  1KBN A;  3N5O A;  1K0D A;  2YV9 A;  3LSZ A;  1TP9 A;  3LQ7 A;  5IMD A;  3MWH A;  2GGT A;  2GQK A;  4GSN A;  4FO5 A;  2GSR A;  5J41 A;  2R37 A;  2GST A;  17GS A;  3WT1 A;  3G7Y A;  4KCE A;  3V1W A;  4E8H A;  2HNL A;  2LJK A;  2R0P A;  4ML6 A;  5CRH A;  5DQS A;  3LEF A;  2LST A;  5C00 A;  3IK9 A;  3ZFL A;  4XS6 A;  3ZRD A;  1PFO A;  2H8L A;  3I69 A;  4O7H A;  2I9H A;  3QOU A;  1ERT A;  4F82 A;  1AIU A;  2G2Q A;  1S3D A;  3LGC A;  2VIM A;  1GP1 A;  4JZQ A;  3I9V 2;  2H1A A;  4Q5N A;  3R3E A;  1GUH A;  3RAZ A;  3WYW A;  5B6N A;  2LJR A;  1XBS A;  4RQX A;  5D8I A;  3HVS A;  2YWI A;  2O85 A;  6GSW A;  2H0G A;  5JCW A;  1T4Y A;  1O7U A;  4Z2T A;  2BJX A;  10GS A;  4K1F A;  3CXG A;  1ST9 A;  2DC5 A;  1NHO A;  1EEJ A;  3D22 A;  2MMN A;  3DXB A;  3TKQ A;  3HCZ A;  4K8M A;  1TRW A;  4PTS A;  1AUC A;  1R5A A;  4GQC A;  2PVO C;  2HRF A;  4V2N A;  3QFB C;  4RUV A;  1M2A A;  4LL1 B;  4DSS A;  4O5U A;  1N8J A;  2A2P A;  5HQP A;  3FZA A;  5ECR B;  3I6A A;  1G6Y A;  4GSS A;  5KOX A;  1SKW B;  1YF0 A;  2M72 A;  4I2T A;  1U3I A;  3WT2 A;  2NDO A;  4BPY A;  2F8A A;  5CNW A;  5AIX A;  3AY8 A;  4KAE A;  3GH9 A;  3IXR A;  2MYG A;  2L59 A;  4EKZ A;  2JZT A;  1O73 A;  3KH7 A;  3UL3 A;  2PER A;  4KF9 A;  4JR4 A;  4NPB A;  3P7X A;  5B7C A;  1GUM A;  1XWC A;  1XG8 A;  4TR1 A;  4TW5 A;  3GUS A;  1FB0 A;  2H6X A;  1O8X A;  4Q5R A;  4ML1 A;  2NPB A;  1X5C A;  2PPT A;  3IRA A;  1XWB A;  3FZ9 A;  3GTU B;  4IKH A;  3ISO A;  4IQA A;  1BG5 A;  1SD8 A;  4OD7 A;  2V6O A;  1EWX A;  1JZO A;  2LTK A;  2OE1 A;  1F2E A;  2HSH A;  2V2G A;  2IJY A;  2YNX A;  3KMN A;  4IHU A;  1AAZ A;  2IN3 A;  1WE0 A;  3QMX A;  4TR3 A;  3GA4 A;  1XZO A;  1R26 A;  1I5G A;  1WWJ A;  1TW9 A;  1GSF A;  5DQY A;  2TRX A;  4KND A;  2OA7 A;  3VPQ A;  1M9A A;  5ECL B;  3VWU A;  3FR3 A;  2VLT A;  4K7I A;  1B4Q A;  1EGO A;  4EC0 A;  1GSS A;  4I8B A;  5ECQ B;  2FLS A;  1K0B A;  4OO4 A;  1FB6 A;  2C80 A;  4DSR A;  3O3T A;  3ERF A;  2C0G A;  5F8B A;  4G2E A;  1AXD A;  4IQ1 A;  3C7M A;  1THX A;  4HQZ A;  5DAL B;  1PRX A;  2K6V A;  3KJY A;  2VAF A;  2VL9 A;  3UVT A;  1ILO A;  1V98 A;  3SBC A;  3GHA A;  1FOH A;  3J7Y b;  3C1S A;  3IC4 A;  1BED A;  4JBB A;  2ES7 A;  2K8V A;  4WR4 A;  3VWV A;  1UC7 A;  2P0G A;  3M9J A;  3IK7 A;  5CP1 A;  4DSS B;  2YZU A;  2QA1 A;  1JZW A;  4KSO A;  1SJ6 A;  4BL7 A;  4QL7 A;  4BVX B;  4NMU A;  3QAG A;  3DIE A;  5LD0 A;  4YQM A;  4ECI A;  1ZCP A;  1PKW A;  2BTO T;  5ECI B;  4YQU A;  4HDE A;  3IHG A;  1TDI A;  2H72 A;  2C3T A;  3QD9 A;  3MYD A;  3DWV A;  2OJL A;  4KE3 A;  3ED3 A;  4ISD A;  3H79 A;  5J4U A;  3U5R E;  2MBT A;  3TJF A;  2DIY A;  1YZX A;  4IW9 A;  3DKS A;  4ZXG A;  5D9T A;  3H93 A;  3IPZ A;  2K18 A;  4PQI A;  2K8S A;  5AIV A;  4F0C A;  1A0F A;  3F3R A;  2IMD A;  5GSS A;  2FY6 A;  3KEB A;  2EIR A;  2TRC P;  2MMZ A;  5G30 A;  5FT3 A;  5KN1 A;  2V1M A;  2NBS A;  3M1G A;  1PX6 A;  1K3Y A;  5D93 A;  4BIK A;  1SJZ A;  2VL2 C;  2GVP A;  1SKS B;  1CQH A;  1OKD A;  3F63 A;  2LV3 A;  5ID2 B;  4WR5 A;  2NTO A;  5D9W A;  4HZ2 A;  1TOF A;  1ERU A;  2A2R A;  4X43 A;  1U3A A;  2XC2 A;  2O87 A;  2PN8 A;  1T4Z A;  4N0Z A;  4H86 A;  4HSC X;  1W4V A;  1SYX A;  3L78 A;  1B48 A;  3HA9 A;  3GKN A;  1C72 A;  4HU7 A;  2L5L A;  1Z3E A;  1NHY A;  1S3C A;  4L0U A;  1TK8 B;  1ZYP A;  2EIQ A;  3Q74 A;  4K9Z A;  4J57 E;  1HQO A;  3UMA A;  3WGE A;  3GRX A;  3G7I A;  1M3I A;  6GSX A;  2Z9S A;  2DJJ A;  2GT6 A;  2WUL A;  4MJB A;  3P8W A;  4MNN A;  5ECO B;  1RW1 A;  1F37 A;  3LXT A;  4GXZ A;  2GZY A;  3GST A;  4OWY A;  3GUR A;  2OKA A;  3G9B A;  5JCU A;  1ZL9 A;  4KDY A;  4WXT A;  3LW9 A;  3M0F A;  3FRC A;  2YCD A;  5FHI A;  3ZZX A;  3DYR A;  4HU9 A;  1PL2 A;  4TXO B;  3CSH A;  4MCU A;  4JU5 A;  4K6X A;  4MJA A;  2JAC A;  2C0F A;  4XS1 A;  1CQG A;  3LG6 A;  3MDK A;  4USS A;  4YH2 A;  1YQ1 A;  2YJ7 A;  1N2A A;  1X5E A;  2ON7 A;  3KP8 A;  1SJI A;  3LYP A;  1B4P A;  2PGT A;  3HZ4 A;  2WRT A;  2VCT A;  3E9J B;  3VK9 A;  2REM A;  3A3T A;  2JAD A;  3ZIV A;  3KIJ A;  2I4A A;  5L71 A;  2H71 A;  3APO A;  3EPT A;  3GKM A;  4I2U A;  1K0O A;  2I3Y A;  1G0T A;  4AJ8 A;  2WGR A;  2H74 A;  2VM1 A;  4K5S A;  3IAS 2;  4ECB A;  4ACS A;  1OC8 A;  4FYU A;  4IGJ A;  3KMO A;  2LUS A;  4CW9 A;  3TOU A;  2B5E A;  4TVE A;  2CAI A;  3CSJ A;  2VM2 A;  3EYT A;  3CYN A;  4I6X A;  2HI7 A;  1QK8 A;  2XBI A;  3ZIT A;  1A23 A;  1S3A A;  3RBT A;  3CRT A;  2R2J A;  3KZQ A;  4KH7 A;  3WGD A;  2FUG 2;  1R7H A;  4HS1 A;  2VCZ A;  2JZS A;  2X99 A;  3KM6 A;  1TRU A;  9GSS A;  2RUE A;  2X8C A;  5B8B A;  1AQX A;  2X8H A;  3KH9 A;  4NHZ A;  3L9U A;  1NSW A;  1TXX A;  3DVX A;  3PIN A;  3D5J A;  5CO3 A;  3IR4 A;  8GSS A;  4K2D A;  2AJQ B;  1OYJ A;  3CMI A;  4MJC A;  1WMJ A;  3DVW A;  1FG4 A;  1FW1 A;  3VI5 A;  3FR6 A;  2AAW A;  1GLQ A;  3US3 A;  2VCQ A;  1H4O A;  3EMX A;  5DAK B;  1XWA A;  2GQM A;  3GTU A;  3KP9 A;  4KDX A;  3ZTL A;  2IME A;  1X9W B;  1DE2 A;  4ILF A;  1O85 A;  2KLX A;  1SU9 A;  4K0G A;  5D73 A;  1QFN A;  2XPD A;  3EIN A;  3QAV A;  5C04 A;  4WBJ A;  1LBK A;  5H5Q A;  1YJ6 A;  1WPI A;  1M99 A;  3W8J A;  5B6M A;  1OE7 A;  4CY8 A;  5IPH A;  2VUP A;  4MH3 A;  4EO3 A;  1JLV A;  5CRG A;  4ZIL A;  2WCI A;  4XS4 B;  1S3R A;  1PX7 A;  3D4T A;  2LEG A;  5BMU A;  4TRX A;  5AIS A;  3FMW A;  3U6V A;  4K2X A;  1AQW A;  3FKF A;  1UVZ A;  4OCF A;  3TKS E;  4BVY A;  1JHB A;  3IBH A;  6GSV A;  3O76 A;  4WKW A;  2HRA A;  2GT5 A;  3F4T A;  2R4V A;  3WGX A;  2H66 A;  1KNG A;  2IMI A;  4FH8 A;  2R0G A;  2YJH A;  1M3J A;  4EUY A;  1R4W A;  4PUF C;  5IIZ A;  3A2V A;  3IE3 A;  1EP8 A;  3HKR A;  3ZVJ D;  1K0N A;  5DAL A;  3GNJ A;  3CTG A;  1X5D A;  1XCC A;  3QDN A;  1F3B A;  3SWL A;  2D2Z A;  5LCZ A;  1A24 A;  3MAK A;  1KEB A;  4HZ4 A;  4MK3 A;  1QUW A;  2H1D A;  4JRR A;  2V6K A;  4KUN A;  4RQR A;  1GTI A;  5ECK B;  3QFA C;  4EXJ A;  1DE1 A;  1SK2 A;  4FYB A;  3DRN A;  4G0L A;  2YZH A;  5IQY A;  2YV7 A;  1SL1 B;  2JZR A;  5IMV A;  2FCH A;  2RM6 A;  2KHP A;  3C71 A;  1GH2 A;  1K0A A;  4KX4 A;  1M2D A;  4BVX A;  3IAM 2;  1Q4J A;  2C0E A;  4NWY A;  3KD0 A;  1YKA A;  5GAP D;  2MZC A;  5ECS A;  4PX1 A;  2R5G A;  2UZ8 A;  2ALB A;  4G0K A;  3BJ5 A;  3P90 A;  2DML A;  2VD0 A;  4TOP A;  4CHS A;  3P2A A;  1M0U A;  3C8E A;  4HUA A;  4FIW A;  14GS A;  6GSS A;  1Y6E A;  2LKU A;  2OE3 A;  2R6K A;  1AC1 A;  2KP2 A;  1V40 A;  4GST A;  5D96 A;  2HZF A;  2WFC A;  1GUK A;  2AUV A;  2QA2 A;  3GYK A;  3GSS A;  3OR5 A;  4L5L A;  2A4H A;  4ZB9 A;  5ABR A;  1YF1 A;  3CRU A;  2DSA A;  1VGL A;  1SL2 B;  3L4N A;  3TRP A;  4HOJ A;  2OE0 A;  1T3B A;  4IP6 A;  5ECH B;  3EVI A;  2HZE B;  3ZL5 A;  1E2Y A;  1YDK A;  5G2Z A;  3VUR A;  3KXO A;  1UA5 A;  2VCX A;  4ICY A;  4O5R A;  1WRY A;  4KW6 A;  1SEN A;  5HFG A;  3MSZ A;  4IVF A;  3RHC A;  4AGS A;  3LJR A;  5ID2 A;  2XBQ A;  3F9U A;  4MZW A;  5CRW A;  3A5I A;  3GL3 A;  5JWQ B;  4V2M A;  4PXO A;  4BVY B;  2L5O A;  1WP0 A;  3GMF A;  2VOC A;  2CT6 A;  4QL9 A;  5HFK A;  2O89 A;  4IP1 A;  4O32 A;  3DD3 A;  4N11 A;  5EPF A;  5G5F A;  20GS A;  3N9J A;  5IOX A;  1MD3 A;  1SD9 A;  4IEL A;  1MDI A;  3TRQ A;  1SYR A;  4GTU A;  3KGK A;  1AW9 A;  2N5F A;  2P5R A;  5G5E A;  3KTL A;  3D21 A;  4KSM A;  4PNF A;  1BJX A;  2H6Z A;  4EDY A;  1EV9 A;  4O92 A;  5H5S A;  3HVV A;  4ID0 A;  2MMA A;  1GSD A;  1HNC A;  5JCG A;  1WJK A;  2GS3 A;  4I5Q A;  3TKS A;  2AV4 A;  4OMV A;  5KN3 A;  3HDC A;  3TJB A;  2CA8 A;  3ERW A;  2F3M A;  4DVC A;  4ZL9 A;  3CTF A;  1TJD A;  4POK A;  5IO0 A;  3H1N A;  19GS A;  4TXO A;  2VLU A;  4OFM A;  3W8S A;  2C3Q A;  3PPU A;  1USB A;  1V58 A;  4GRF A;  1Z7P A;  1A2M A;  2PWJ A;  5ELG A;  1MEK A;  7GSS A;  4HQS A;  2DJ2 A;  2G0F A;  3FYG A;  1QXH A;  5HR0 A;  3GH6 A;  2TIR A;  4MPF A;  1ERV A;  2XHF A;  3R2Q A;  4N0V A;  4KA0 A;  4ZB6 A;  4DSQ A;  2DKH A;  1TKD B;  2WZ9 A;  4CY6 A;  3Q19 A;  5IPG A;  4WEY A;  3IC8 A;  4ZB8 A;  3DML A;  2I1U A;  1A8L A;  2FWH A;  1M9B A;  1T00 A;  2X8G A;  4YKG A;  2HE3 A;  3Q6O A;  5DCG A;  4FQU A;  5HR2 A;  13GS A;  3BOA A;  4NV5 A;  1XVW A;  3TOT A;  2L6C A;  3L9S A;  2F9S A;  5J9B A;  2YWM A;  2R0C A;  3GIX A;  1K3L A;  1BYE A;  2V32 A;  3LYK A;  1TI3 A;  3FZ5 A;  1IYH A;  4ZBD A;  2P5Q A;  3APQ A;  2H75 A;  2PBJ A;  2YP6 A;  5DDL A;  5KEJ A;  3VPT A;  5A4V A;  2H0H A;  2OAD A;  5EVO A;  3TJG A;  4WET A;  2E2M A;  2WJU A;  2GSQ A;  1U6T A;  1FO5 A;  1YY7 A;  5F07 A;  3ZLP A;  2LRT A;  4EDZ A;  5KN0 A;  3ZML A;  2KOK A;  3GX0 A;  4PGT A;  1XWK A;  2HFD A;  3F3Q A;  4O5Q A;  3EU4 A;  3HJP A;  2J9H A;  2F8F A;  2GLR A;  4E8E A;  1GTU A;  1QMV A;  2DJK A;  4MP4 A;  4IN0 A;  2C8U A;  2V41 A;  4F0B A;  1F6M C;  3VWW A;  5DVB A;  1BX9 A;  1Y25 A;  2VLV A;  3G7J A;  4G9H A;  3VWX A;  2OBI A;  1GNW A;  2N5A A;  2H1G A;  2FWF A;  1EGR A;  3F4R A;  5DAK A;  1XW6 A;  1MTC A;  2B5Y A;  3A5W A;  4LA1 A;  4X1U A;  1T7P B;  1FAA A;  4TXV A;  3TGZ A;  3IHQ A;  3UBL A;  1TK0 B;  1GTA A;  1ZYN A;  3UAP A;  5A5K A;  2DKI A;  1ZYE A;  4ECC A;  5DCH A;  3BCK A;  4OO5 A;  2L57 A;  2DLX A;  2NVL A;  2M80 A;  1EV4 A;  2B7J A;  2C0D A;  4NXI A;  6GST A;  2B7K A;  4XS4 A;  4D73 B;  4V1A p;  5BRT A;  3WD6 A;  4N10 A;  1G6W A;  5IMA A;  1JZD A;  1V9W A;  5G31 A;  5FWG A;  3MNG A;  4Z2R A;  1YEX A;  3FHK A;  3LOR A;  3GX8 A;  1EP7 A;  2DIZ A;  2VD1 A;  4KCA A;  3TUE A;  2QSI A;  2RUF A;  4ZBB A;  2H6Y A;  4L0W A;  2YOI A;  3TJJ A;  2F51 A;  3D4M A;  1LJR A;  4HJM A; 
#chains in the Genus database with same CATH homology
 2E2G A;  2IMF A;  2X64 A;  3QCP A;  1SL0 B;  4WBR D;  1DBY A;  1ACV A;  1J0F A;  4GF0 A;  4ZL7 A;  5CRD A;  2ZNM A;  3ZFB A;  1TK5 B;  3K8N A;  3TRX A;  2FWG A;  3D0Z A;  2M46 A;  1X0R A;  5CYY A;  3RHB A;  5J9C A;  3M3M A;  3RPN A;  2FHE A;  2CX4 A;  2H70 A;  2GTU A;  4POL A;  2YWN A;  1ERW A;  2VL3 A;  4EL1 A;  4EF0 A;  3JCM L;  3UEM A;  3O6T A;  12GS A;  5IO2 A;  3ME8 A;  4BWQ A;  4NHW A;  4GWR A;  4Z2U A;  1X9S B;  1GNE A;  2CVB A;  1O81 A;  4G19 A;  5ECP B;  4XRD A;  1H75 A;  2E7P A;  1OC9 A;  5KN2 A;  2CQ9 A;  2VCV A;  1PN9 A;  3NIV A;  2HSM A;  4NAX A;  1FVK A;  5HR3 A;  2LJA A;  4K0N A;  4A5P A;  2JL4 A;  1ZOF A;  3BCI A;  6GSY A;  4LMV A;  3ME7 A;  4RI6 A;  5F06 A;  5D9V A;  1GSU A;  5GST A;  3LXZ A;  2GQL A;  3IA1 A;  2HZE A;  1WIK A;  5COH A;  5G1K A;  4BA7 A;  3QPM A;  5A4U A;  2B1L A;  2B3S A;  4XRA A;  1TI1 A;  3UVH A;  1HNB A;  1QGV A;  2PVQ A;  2IWT A;  2I81 A;  3IDV A;  3RDW A;  4XTS A;  4PNG A;  1A2J A;  1XOA A;  5HFI A;  1MDK A;  3VLN A;  1HNA A;  3FW2 A;  22GS A;  2VCW A;  2EIO A;  4IJI A;  1EOH A;  1XOB A;  3FR9 A;  1GSY A;  2ZCT A;  3BBY A;  4TKY A;  3HD5 A;  1U88 A;  3IV4 A;  4HI7 A;  2J23 A;  3HHV A;  3GKK A;  5D9X A;  1PKZ A;  4MPG A;  1PA3 A;  2C1Y A;  1OKT A;  1VF1 A;  4TN8 A;  3UBK A;  6GSU A;  2A4V A;  1RQM A;  3NZN A;  5LNK e;  3I43 A;  3HJO A;  4KDU A;  4HJ2 A;  4JED A;  1VRS D;  5ECN B;  1ML6 A;  1OVN A;  1Z5Y E;  2FD3 A;  1VF4 A;  2HXK A;  1ZZY A;  2FGX A;  1WOU A;  1BAY A;  3F4S A;  5J3R A;  5ENU A;  3GV1 A;  2GDR A;  1ZYQ B;  2CX3 A;  2JSY A;  2QC7 A;  2LNS A;  1SK0 A;  4LMW A;  4KGI A;  4TR4 A;  2X4A A;  1DSB A;  2RLI A;  1SK1 A;  3LFL A;  1QQ2 A;  4YQV A;  2HT9 A;  5DJM A;  3ZYW A;  5A4W A;  5DBQ A;  2K9F A;  1ZGN A;  1XXU A;  3W6G A;  4JE1 A;  1XW5 A;  1XFL A;  3DGQ A;  3L0H A;  5JWO B;  3EC3 A;  5IM9 A;  1HYU A;  1XWG A;  2CVD A;  2LRN A;  4I97 A;  1NW2 A;  4PUA A;  1J9B A;  1OC9 B;  2YAN A;  1THO A;  4J2F A;  1Q98 A;  2BMX A;  2DJ3 A;  1X9M B;  1Z9H A;  4POB A;  1G7E A;  4EIP A;  5B8A A;  3TJK A;  3E3E A;  3KTB A;  2IMK A;  2H19 A;  1A0R P;  4OFT A;  4AF2 A;  4XCS A;  4J56 E;  3GKX A;  5CRE A;  2WB9 A;  4X4J A;  3QAW A;  3IOS A;  3HXS A;  2KP1 A;  5G1L A;  5CAX A;  1XPV A;  3HY2 A;  1Z6M A;  3VFI A;  1URM A;  4G0I A;  5E59 A;  2L4Q A;  1J08 A;  2WS2 A;  5H5R A;  3HVX A;  3RPP A;  1XW9 A;  3ZVJ A;  2P31 A;  2CZ2 A;  2ZUP A;  1MD4 A;  3C1R A;  2FA4 A;  1B8X A;  3NOF A;  1F9M A;  1FVJ A;  1ABA A;  4WF4 A;  4DEJ A;  2DBC A;  4N30 A;  3UIW A;  1EOG A;  3VI7 A;  2L6D A;  3QR6 A;  1M2B A;  3TB2 A;  3ZMK A;  4ZL8 A;  2CV4 A;  1YEP A;  2DJ1 A;  4WF5 A;  1TU8 A;  4MDC A;  4YKF A;  2IIY A;  2H1B A;  1V57 A;  3PR8 A;  1ZMA A;  3Q18 A;  1KTE A;  3UOM A;  2HYX A;  4GLT A;  2LRC A;  4MH2 A;  4Z7X A;  2VL2 A;  2JSZ A;  4GCI A;  4EVM A;  5JWR B;  4ULX A;  2MBS A;  2MMO A;  4XIH A;  2B6M A;  2VO4 A;  1Z7R A;  4YAP A;  3F8U A;  3CSI A;  5IMF A;  5IOW A;  2IPA A;  4D73 A;  4HEA 2;  2OAC A;  1TU7 A;  1HD2 A;  4MZC A;  4EIQ A;  2YPM A;  2PMT A;  4PQ1 A;  1JLW A;  5ECM B;  2X49 A;  4BWS A;  1SKR B;  1GWC A;  5GZZ B;  1B9Y C;  1TRV A;  4FYC A;  3ZRE A;  5F05 A;  2H76 A;  4V2L A;  2R3X A;  3FZ4 A;  1FHE A;  2H01 A;  4TR1 B;  3EU3 A;  4LL4 B;  2E0Q A;  1OC3 A;  1OE8 A;  4EE0 A;  4F03 A;  1PMT A;  4OCE A;  1A8Y A;  1E6B A;  3PGT A;  2FA8 A;  2PU9 C;  4IJ3 A;  5IMC A;  3A2X A;  4ZBA A;  4G10 A;  2QKE A;  2CZ3 A;  3LWA A;  2HRK A;  2GZZ A;  1G7O A;  3TKS C;  1GLP A;  2B1K A;  5ELA A;  1PGT A;  4AJ7 A;  3CBU A;  2C4J A;  3FK8 A;  4MMM A;  2YN1 A;  2CAQ A;  2O7K A;  2L4C A;  4K7O A;  2H0I A;  1AQV A;  4TR0 A;  1R5P A;  3F0I A;  16GS A;  5AN1 A;  1JZR A;  2EC4 A;  4P3Y B;  1PD2 1;  4MF5 A;  3HJM A;  5EL8 A;  2JU5 A;  4YAV A;  5IMZ A;  2PUK C;  3KCM A;  3ERG A;  4AJ6 A;  1IYI A;  1O6J A;  1W89 A;  3J7Y k;  2IFQ A;  1F3A A;  4Q5Q A;  4F2I A;  3H8Q A;  3TCO A;  2WDU A;  1XVQ A;  4POM A;  4XHM A;  1U87 A;  2FNO A;  3F6F A;  3L9V A;  4JR6 A;  1GUL A;  1O8W A;  1RK4 A;  2YWO A;  4RI7 A;  2LQO A;  1I9D A;  1PL1 A;  4MLY A;  2RII A;  1LU4 A;  4LLR A;  3TDG A;  1T1V A;  2FWE A;  1A2L A;  4MAB A;  1GSQ A;  3HZ8 A;  4L5O A;  4BL7 B;  3E0U A;  4MF7 A;  4F9Z A;  1Z6N A;  2C3N A;  4NV2 A;  3FY7 A;  3MIX A;  3HYP A;  1TRS A;  5INY A;  1VF3 A;  3APS A;  3S9F A;  4V1A g;  3PH9 A;  4ZIJ A;  1GTB A;  3EE2 A;  2RM5 A;  2HLS A;  4Q5F A;  4GQF A;  4PUR A;  3TKR A;  4CDO A;  2B5X A;  3FEU A;  5HR1 A;  3M9K A;  1DUG A;  2DJ0 A;  1PSQ A;  3GL5 A;  5J5N A;  5EY6 A;  1XIY A;  4KB3 A;  2AB6 A;  3C73 A;  1GRX A;  3EMP A;  3A2W A;  4ECJ A;  1JFU A;  4IS0 A;  4OFN A;  3M8N A;  1TTZ A;  1PN0 A;  3D6I A;  2O8V B;  2N5B A;  4MA9 A;  2IL3 A;  2OBK A;  3EWL A;  3EUR A;  2LS5 A;  5GAN D;  2KUC A;  1M7T A;  1MDJ A;  2ON5 A;  3ZIJ A;  4L8E A;  1PQN A;  1B9X C;  2GZP A;  2HRN A;  5DJL A;  1OAZ A;  5KOW A;  1K0M A;  3GFK A;  3GN3 A;  2GSS A;  4MJE A;  1T8E B;  18GS A;  11GS A;  3BD2 A;  1ON4 A;  2XPE A;  2LNT A;  1FOV A;  3UJ1 A;  1EZK A;  3TKP A;  5F0G A;  2AHE A;  5AGY A;  1VF2 A;  1EEM A;  2LQQ A;  4MF6 A;  4X0X A;  1BQ7 A;  2H30 A;  2CVK A;  2DMM A;  2IFQ B;  2A2S A;  2QGV A;  1K0C A;  3DEX A;  4QQ7 A;  2H73 A;  2HSY A;  1YKC A;  1K3O A;  4K5R A;  1NM3 A;  3H4K A;  1GL8 A;  5E4W A;  4IBP A;  1UN2 A;  3F6D A;  1V2A A;  4MZB A;  2AYT A;  3UAR A;  4PQH A;  4K7N A;  1GSE A;  1KBN A;  3N5O A;  1K0D A;  2YV9 A;  3LSZ A;  1TP9 A;  3LQ7 A;  5IMD A;  3MWH A;  2GGT A;  2GQK A;  4GSN A;  4FO5 A;  2GSR A;  5J41 A;  2R37 A;  2GST A;  17GS A;  3WT1 A;  3G7Y A;  4KCE A;  3V1W A;  4E8H A;  2HNL A;  2LJK A;  2R0P A;  4ML6 A;  5CRH A;  5DQS A;  3LEF A;  2LST A;  5C00 A;  3IK9 A;  3ZFL A;  4XS6 A;  3ZRD A;  2H8L A;  3I69 A;  4O7H A;  2I9H A;  3QOU A;  1ERT A;  4F82 A;  1AIU A;  2G2Q A;  1S3D A;  3LGC A;  2VIM A;  1GP1 A;  4JZQ A;  3I9V 2;  2H1A A;  4Q5N A;  3R3E A;  1GUH A;  3RAZ A;  3WYW A;  5B6N A;  2LJR A;  1XBS A;  4RQX A;  5D8I A;  3HVS A;  2YWI A;  2O85 A;  6GSW A;  2H0G A;  5JCW A;  1T4Y A;  1O7U A;  4Z2T A;  2BJX A;  10GS A;  4K1F A;  3CXG A;  1ST9 A;  2DC5 A;  1NHO A;  1EEJ A;  3D22 A;  2MMN A;  3DXB A;  3TKQ A;  3HCZ A;  4K8M A;  1TRW A;  4PTS A;  1AUC A;  1R5A A;  4GQC A;  2PVO C;  2HRF A;  4V2N A;  3QFB C;  4RUV A;  1M2A A;  4LL1 B;  4DSS A;  4O5U A;  1N8J A;  2A2P A;  5HQP A;  3FZA A;  5ECR B;  3I6A A;  1G6Y A;  4GSS A;  5KOX A;  1SKW B;  1YF0 A;  2M72 A;  4I2T A;  1U3I A;  3WT2 A;  2NDO A;  4BPY A;  2F8A A;  5CNW A;  5AIX A;  3AY8 A;  4KAE A;  3GH9 A;  3IXR A;  2MYG A;  2L59 A;  4EKZ A;  2JZT A;  1O73 A;  3KH7 A;  3UL3 A;  2PER A;  4KF9 A;  4JR4 A;  4NPB A;  3P7X A;  5B7C A;  1GUM A;  1XWC A;  4TR1 A;  4TW5 A;  3GUS A;  1FB0 A;  2H6X A;  1O8X A;  4Q5R A;  4ML1 A;  2NPB A;  1X5C A;  2PPT A;  3IRA A;  1XWB A;  3FZ9 A;  3GTU B;  4IKH A;  3ISO A;  4IQA A;  1BG5 A;  1SD8 A;  4OD7 A;  2V6O A;  1EWX A;  1JZO A;  2LTK A;  2OE1 A;  1F2E A;  2HSH A;  2V2G A;  2IJY A;  2YNX A;  3KMN A;  4IHU A;  1AAZ A;  2IN3 A;  1WE0 A;  3QMX A;  4TR3 A;  3GA4 A;  1XZO A;  1R26 A;  1I5G A;  1WWJ A;  1TW9 A;  1GSF A;  5DQY A;  2TRX A;  4KND A;  2OA7 A;  3VPQ A;  1M9A A;  5ECL B;  3VWU A;  3FR3 A;  2VLT A;  4K7I A;  1B4Q A;  1EGO A;  4EC0 A;  1GSS A;  4I8B A;  5ECQ B;  2FLS A;  1K0B A;  4OO4 A;  1FB6 A;  2C80 A;  4DSR A;  3O3T A;  3ERF A;  2C0G A;  5F8B A;  4G2E A;  1AXD A;  4IQ1 A;  3C7M A;  1THX A;  4HQZ A;  5DAL B;  1PRX A;  2K6V A;  3KJY A;  2VAF A;  2VL9 A;  3UVT A;  1ILO A;  1V98 A;  3SBC A;  3GHA A;  1FOH A;  3J7Y b;  3C1S A;  3IC4 A;  1BED A;  4JBB A;  2ES7 A;  2K8V A;  4WR4 A;  3VWV A;  1UC7 A;  2P0G A;  3M9J A;  3IK7 A;  5CP1 A;  4DSS B;  2YZU A;  2QA1 A;  1JZW A;  4KSO A;  1SJ6 A;  4BL7 A;  4QL7 A;  4BVX B;  4NMU A;  3QAG A;  3DIE A;  5LD0 A;  4YQM A;  4ECI A;  1ZCP A;  1PKW A;  2BTO T;  5ECI B;  4YQU A;  4HDE A;  3IHG A;  1TDI A;  2H72 A;  2C3T A;  3QD9 A;  3MYD A;  3DWV A;  2OJL A;  4KE3 A;  3ED3 A;  4ISD A;  3H79 A;  5J4U A;  3U5R E;  2MBT A;  3TJF A;  2DIY A;  1YZX A;  4IW9 A;  3DKS A;  4ZXG A;  5D9T A;  3H93 A;  3IPZ A;  2K18 A;  4PQI A;  2K8S A;  5AIV A;  4F0C A;  1A0F A;  3F3R A;  2IMD A;  5GSS A;  2FY6 A;  3KEB A;  2EIR A;  2TRC P;  2MMZ A;  5G30 A;  5FT3 A;  5KN1 A;  2V1M A;  2NBS A;  3M1G A;  1PX6 A;  1K3Y A;  5D93 A;  1SJZ A;  2VL2 C;  2GVP A;  1SKS B;  1CQH A;  1OKD A;  3F63 A;  2LV3 A;  5ID2 B;  4WR5 A;  2NTO A;  5D9W A;  4HZ2 A;  1TOF A;  1ERU A;  2A2R A;  4X43 A;  1U3A A;  2XC2 A;  2O87 A;  2PN8 A;  1T4Z A;  4N0Z A;  4H86 A;  1W4V A;  1SYX A;  3L78 A;  1B48 A;  3HA9 A;  3GKN A;  1C72 A;  4HU7 A;  2L5L A;  1Z3E A;  1NHY A;  1S3C A;  4L0U A;  1TK8 B;  1ZYP A;  2EIQ A;  3Q74 A;  4K9Z A;  4J57 E;  1HQO A;  3UMA A;  3WGE A;  3GRX A;  3G7I A;  6GSX A;  2Z9S A;  2DJJ A;  2GT6 A;  2WUL A;  4MJB A;  3P8W A;  4MNN A;  5ECO B;  1RW1 A;  1F37 A;  3LXT A;  4GXZ A;  2GZY A;  3GST A;  4OWY A;  3GUR A;  2OKA A;  3G9B A;  5JCU A;  1ZL9 A;  4KDY A;  4WXT A;  3LW9 A;  3M0F A;  3FRC A;  2YCD A;  5FHI A;  3ZZX A;  3DYR A;  4HU9 A;  1PL2 A;  4TXO B;  3CSH A;  4MCU A;  4JU5 A;  4K6X A;  4MJA A;  2JAC A;  2C0F A;  4XS1 A;  1CQG A;  3LG6 A;  3MDK A;  4USS A;  4YH2 A;  1YQ1 A;  2YJ7 A;  1N2A A;  1X5E A;  2ON7 A;  3KP8 A;  1SJI A;  3LYP A;  1B4P A;  2PGT A;  3HZ4 A;  2WRT A;  2VCT A;  3E9J B;  3VK9 A;  2REM A;  3A3T A;  2JAD A;  3ZIV A;  3KIJ A;  2I4A A;  5L71 A;  2H71 A;  3APO A;  3EPT A;  3GKM A;  4I2U A;  1K0O A;  2I3Y A;  1G0T A;  4AJ8 A;  2WGR A;  2H74 A;  2VM1 A;  4K5S A;  3IAS 2;  4ECB A;  4ACS A;  1OC8 A;  4FYU A;  4IGJ A;  3KMO A;  2LUS A;  4CW9 A;  3TOU A;  2B5E A;  4TVE A;  2CAI A;  3CSJ A;  2VM2 A;  3EYT A;  3CYN A;  4I6X A;  2HI7 A;  1QK8 A;  2XBI A;  3ZIT A;  1A23 A;  1S3A A;  3RBT A;  3CRT A;  2R2J A;  3KZQ A;  4KH7 A;  3WGD A;  2FUG 2;  1R7H A;  4HS1 A;  2VCZ A;  2JZS A;  2X99 A;  3KM6 A;  1TRU A;  9GSS A;  2RUE A;  2X8C A;  5B8B A;  1AQX A;  2X8H A;  3KH9 A;  4NHZ A;  3L9U A;  1NSW A;  1TXX A;  3DVX A;  3PIN A;  3D5J A;  5CO3 A;  3IR4 A;  8GSS A;  4K2D A;  2AJQ B;  1OYJ A;  3CMI A;  4MJC A;  1WMJ A;  3DVW A;  1FG4 A;  1FW1 A;  3VI5 A;  3FR6 A;  2AAW A;  1GLQ A;  3US3 A;  2VCQ A;  1H4O A;  3EMX A;  5DAK B;  1XWA A;  2GQM A;  3GTU A;  3KP9 A;  4KDX A;  3ZTL A;  2IME A;  1X9W B;  1DE2 A;  4ILF A;  1O85 A;  2KLX A;  1SU9 A;  4K0G A;  5D73 A;  1QFN A;  2XPD A;  3EIN A;  3QAV A;  5C04 A;  4WBJ A;  1LBK A;  5H5Q A;  1YJ6 A;  1WPI A;  1M99 A;  3W8J A;  5B6M A;  1OE7 A;  4CY8 A;  5IPH A;  2VUP A;  4MH3 A;  4EO3 A;  1JLV A;  5CRG A;  4ZIL A;  2WCI A;  4XS4 B;  1PX7 A;  3D4T A;  2LEG A;  5BMU A;  4TRX A;  5AIS A;  3FMW A;  3U6V A;  4K2X A;  1AQW A;  3FKF A;  1UVZ A;  4OCF A;  3TKS E;  4BVY A;  1JHB A;  3IBH A;  6GSV A;  3O76 A;  4WKW A;  2HRA A;  2GT5 A;  3F4T A;  2R4V A;  3WGX A;  2H66 A;  1KNG A;  2IMI A;  4FH8 A;  2R0G A;  2YJH A;  4EUY A;  1R4W A;  4PUF C;  5IIZ A;  3A2V A;  3IE3 A;  1EP8 A;  3HKR A;  3ZVJ D;  1K0N A;  5DAL A;  3GNJ A;  3CTG A;  1X5D A;  1XCC A;  3QDN A;  1F3B A;  3SWL A;  2D2Z A;  5LCZ A;  1A24 A;  3MAK A;  1KEB A;  4HZ4 A;  4MK3 A;  1QUW A;  2H1D A;  4JRR A;  2V6K A;  4KUN A;  4RQR A;  1GTI A;  5ECK B;  3QFA C;  4EXJ A;  1DE1 A;  1SK2 A;  4FYB A;  3DRN A;  4G0L A;  2YZH A;  5IQY A;  2YV7 A;  1SL1 B;  2JZR A;  5IMV A;  2FCH A;  2RM6 A;  2KHP A;  3C71 A;  1GH2 A;  1K0A A;  4KX4 A;  1M2D A;  4BVX A;  3IAM 2;  1Q4J A;  2C0E A;  4NWY A;  3KD0 A;  1YKA A;  5GAP D;  2MZC A;  5ECS A;  4PX1 A;  2R5G A;  2UZ8 A;  2ALB A;  4G0K A;  3BJ5 A;  3P90 A;  2DML A;  2VD0 A;  4TOP A;  4CHS A;  3P2A A;  1M0U A;  3C8E A;  4HUA A;  4FIW A;  14GS A;  6GSS A;  1Y6E A;  2LKU A;  2OE3 A;  2R6K A;  1AC1 A;  2KP2 A;  1V40 A;  4GST A;  5D96 A;  2HZF A;  2WFC A;  1GUK A;  2AUV A;  2QA2 A;  3GYK A;  3GSS A;  3OR5 A;  4L5L A;  2A4H A;  4ZB9 A;  5ABR A;  1YF1 A;  3CRU A;  2DSA A;  1VGL A;  1SL2 B;  3L4N A;  3TRP A;  4HOJ A;  2OE0 A;  1T3B A;  4IP6 A;  5ECH B;  3EVI A;  2HZE B;  3ZL5 A;  1E2Y A;  1YDK A;  5G2Z A;  3VUR A;  3KXO A;  1UA5 A;  2VCX A;  4ICY A;  4O5R A;  1WRY A;  4KW6 A;  1SEN A;  5HFG A;  3MSZ A;  4IVF A;  3RHC A;  4AGS A;  3LJR A;  5ID2 A;  2XBQ A;  3F9U A;  4MZW A;  5CRW A;  3A5I A;  3GL3 A;  5JWQ B;  4V2M A;  4PXO A;  4BVY B;  2L5O A;  1WP0 A;  3GMF A;  2VOC A;  2CT6 A;  4QL9 A;  5HFK A;  2O89 A;  4IP1 A;  4O32 A;  3DD3 A;  4N11 A;  5EPF A;  5G5F A;  20GS A;  3N9J A;  5IOX A;  1MD3 A;  1SD9 A;  4IEL A;  1MDI A;  3TRQ A;  1SYR A;  4GTU A;  3KGK A;  1AW9 A;  2N5F A;  2P5R A;  5G5E A;  3KTL A;  3D21 A;  4KSM A;  4PNF A;  1BJX A;  2H6Z A;  4EDY A;  1EV9 A;  4O92 A;  5H5S A;  3HVV A;  4ID0 A;  2MMA A;  1GSD A;  1HNC A;  5JCG A;  1WJK A;  2GS3 A;  4I5Q A;  3TKS A;  2AV4 A;  4OMV A;  5KN3 A;  3HDC A;  3TJB A;  2CA8 A;  3ERW A;  2F3M A;  4DVC A;  4ZL9 A;  3CTF A;  1TJD A;  4POK A;  5IO0 A;  3H1N A;  19GS A;  4TXO A;  2VLU A;  4OFM A;  3W8S A;  2C3Q A;  3PPU A;  1USB A;  1V58 A;  4GRF A;  1Z7P A;  1A2M A;  2PWJ A;  5ELG A;  1MEK A;  7GSS A;  4HQS A;  2DJ2 A;  2G0F A;  3FYG A;  1QXH A;  5HR0 A;  3GH6 A;  2TIR A;  4MPF A;  1ERV A;  2XHF A;  3R2Q A;  4N0V A;  4KA0 A;  4ZB6 A;  4DSQ A;  2DKH A;  1TKD B;  2WZ9 A;  4CY6 A;  3Q19 A;  5IPG A;  4WEY A;  3IC8 A;  4ZB8 A;  3DML A;  2I1U A;  1A8L A;  2FWH A;  1M9B A;  1T00 A;  2X8G A;  4YKG A;  2HE3 A;  3Q6O A;  5DCG A;  4FQU A;  5HR2 A;  13GS A;  3BOA A;  4NV5 A;  1XVW A;  3TOT A;  2L6C A;  3L9S A;  2F9S A;  5J9B A;  2YWM A;  2R0C A;  3GIX A;  1K3L A;  1BYE A;  2V32 A;  3LYK A;  1TI3 A;  3FZ5 A;  1IYH A;  4ZBD A;  2P5Q A;  3APQ A;  2H75 A;  2PBJ A;  2YP6 A;  5DDL A;  5KEJ A;  3VPT A;  5A4V A;  2H0H A;  2OAD A;  5EVO A;  3TJG A;  4WET A;  2E2M A;  2WJU A;  2GSQ A;  1U6T A;  1FO5 A;  1YY7 A;  5F07 A;  3ZLP A;  2LRT A;  4EDZ A;  5KN0 A;  3ZML A;  2KOK A;  3GX0 A;  4PGT A;  1XWK A;  2HFD A;  3F3Q A;  4O5Q A;  3EU4 A;  3HJP A;  2J9H A;  2F8F A;  2GLR A;  4E8E A;  1GTU A;  1QMV A;  2DJK A;  4MP4 A;  4IN0 A;  2C8U A;  2V41 A;  4F0B A;  1F6M C;  3VWW A;  5DVB A;  1BX9 A;  1Y25 A;  2VLV A;  3G7J A;  4G9H A;  3VWX A;  2OBI A;  1GNW A;  2N5A A;  2H1G A;  2FWF A;  1EGR A;  3F4R A;  5DAK A;  1XW6 A;  1MTC A;  2B5Y A;  3A5W A;  4LA1 A;  4X1U A;  1T7P B;  1FAA A;  4TXV A;  3TGZ A;  3IHQ A;  3UBL A;  1TK0 B;  1GTA A;  1ZYN A;  3UAP A;  5A5K A;  2DKI A;  1ZYE A;  4ECC A;  5DCH A;  3BCK A;  4OO5 A;  2L57 A;  2DLX A;  2NVL A;  2M80 A;  1EV4 A;  2B7J A;  2C0D A;  4NXI A;  6GST A;  2B7K A;  4XS4 A;  4D73 B;  4V1A p;  5BRT A;  3WD6 A;  4N10 A;  1G6W A;  5IMA A;  1JZD A;  1V9W A;  5G31 A;  5FWG A;  3MNG A;  4Z2R A;  1YEX A;  3FHK A;  3LOR A;  3GX8 A;  1EP7 A;  2DIZ A;  2VD1 A;  4KCA A;  3TUE A;  2QSI A;  2RUF A;  4ZBB A;  2H6Y A;  4L0W A;  2YOI A;  3TJJ A;  2F51 A;  3D4M A;  1LJR A;  4HJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...