1SKSB

Binary 3' complex of t7 dna polymerase with a dna primer/template containing a cis-syn thymine dimer on the template
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
105
structure length
105
Chain Sequence
KIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/electron transport/dna
molecule keywords 5'-D(*CP*GP*AP*AP*AP*AP*CP*GP*AP*C*GP*GP*CP*CP*AP*GP*TP*GP*C
publication title Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
total genus 27
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2004-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1sksB00
5FHIA 1YZXA 2GQMA 3FK8A 4PQIA 2C3NA 2HZFA 4POKA 3ZMLA 3TRPA 2LJRA 4GTUA 3CRUA 4MH2A 2VLTA 3D21A 1PKZA 5IPHA 1OC3A 1EEJA 4KCAA 3PINA 4WBJA 1GUHA 4MA9A 2HSHA 4XIHA 5IMCA 2WRTA 3ZVJD 4L5LA 2H75A 3GN3A 3A2XA 3LWAA 3LYKA 5ECNB 1GTAA 1ZZYA 5EY6A 3LSZA 2JSZA 2IIYA 5DAKB 1SL0B 3EVIA 3KM6A 1Y25A 5D8IA 5KN3A 2O8VB 3Q18A 2DIYA 2YJ7A 1HNBA 2OBKA 4F2IA 4IW9A 1N8JA 2JZTA 2H1GA 4N0ZA 1O7UA 2O7KA 1TRUA 3ZRDA 4EC0A 1TI1A 4BWQA 2GS3A 3QCPA 10GSA 1J08A 2N5AA 4TR0A 1WOUA 1MDIA 3BD2A 5ECLB 4OCFA 4EUYA 3HA9A 4EDZA 2L5LA 3TKPA 4D73B 2VCQA 3SBCA 4BA7A 3H93A 1EWXA 3L9UA 1G7EA 1B9YC 1WMJA 1QUWA 4DSSB 19GSA 1GSUA 3J7Yk 3W8SA 5DVBA 1DSBA 3ZIVA 3AY8A 4MPGA 3VPTA 5EL8A 4KW6A 2OE1A 3KJYA 1VF3A 1URMA 1OKTA 1EV4A 2TRCP 4K0NA 4I6XA 3J7Yb 2WULA 3EYTA 3ZFBA 4V2MA 4QQ7A 1K0OA 4ECIA 1YF0A 3DXBA 2NBSA 4KSMA 4AF2A 4P3YB 3F6FA 4V2LA 13GSA 4HJMA 4HEA2 3GRXA 4Q5FA 4CDOA 3FR9A 1SU9A 5CRWA 4JU5A 2PPTA 3RAZA 1PX7A 2JZRA 1QXHA 1UVZA 4BWSA 2EC4A 2RLIA 1GSQA 4O92A 5JCUA 3KP8A 1K0CA 1ZGNA 2O87A 3CSIA 1B48A 4IKHA 1XPVA 2IN3A 4KX4A 1K3YA 5C04A 3HVXA 2AUVA 5CRHA 4HJ2A 3S9FA 4EXJA 4GSSA 4HZ4A 1T4YA 2YANA 2DJ1A 2M80A 1TJDA 3TJJA 2CQ9A 3A2WA 2GT6A 2C3QA 2AB6A 5IMFA 5HFKA 1LBKA 22GSA 4HOJA 4OMVA 4PUAA 1XW5A 1X0RA 4E8EA 1EGOA 4QL9A 2H19A 4K7OA 1BQ7A 3GUSA 3MSZA 3H8QA 1NW2A 1NSWA 1SD8A 3WT1A 2C0DA 1WP0A 5DQYA 3US3A 4IJ3A 2K9FA 3GX0A 2QC7A 3RPNA 2WDUA 2GZZA 4XS4A 3TKQA 3UEMA 3HCZA 2X8CA 2IFQA 3F63A 4XRDA 2VL3A 4L8EA 2IJYA 3HVVA 3WGXA 3LFLA 3UBLA 3LJRA 2YN1A 2L6CA 4HU7A 5L71A 3F4TA 2F8AA 3C73A 5GSSA 4ZB8A 1PKWA 4ZB9A 2CZ3A 2B1LA 1EGRA 3TB2A 2C80A 5D9VA 3TUEA 3D5JA 1TW9A 1RW1A 3F8UA 1M7TA 1PN9A 1VF4A 5INYA 3ZITA 1LJRA 4OD7A 1HYUA 4ISDA 3IBHA 3DWVA 3KIJA 3IRAA 5G30A 1JLWA 2LRTA 4H86A 5ECMB 2FNOA 5AIVA 4HU9A 3HZ4A 2TIRA 5HR1A 3CXGA 2HRNA 5D9WA 2GZPA 4NMUA 2LNSA 3DYRA 5ECSA 5DQSA 5AISA 2F3MA 2H6ZA 1GNWA 4K7NA 3UBKA 5A4WA 2O89A 5ECHB 4NHWA 2H76A 3JCML 3FRCA 1R4WA 2H72A 3G7YA 3MNGA 1DE2A 2LQOA 1X9SB 5A4UA 4DEJA 3MDKA 1MEKA 2XPDA 3APQA 2O85A 1FHEA 2FA4A 5IO0A 5J5NA 2OACA 5DAKA 2FA8A 4IJIA 2CT6A 2GT5A 3VWUA 3GTUB 1SK2A 2HI7A 3EE2A 5G5FA 4KDXA 5G31A 3TCOA 4MF6A 4WF4A 4YAVA 6GSVA 1AQVA 2DMMA 3FW2A 3FZAA 1TOFA 3ZL5A 1T4ZA 2IMDA 1EV9A 2FY6A 2LSTA 3FHKA 2PERA 3LGCA 1AUCA 2YWMA 4KCEA 1YJ6A 1KEBA 1O81A 1DUGA 1OE7A 2KOKA 1T1VA 4K8MA 2R2JA 2L57A 4G10A 1TU8A 2H1AA 2AV4A 4D73A 4OO4A 1NHOA 4WF5A 3P90A 4ACSA 1TP9A 2VCXA 3TDGA 4HQSA 1OVNA 2RM5A 2X64A 4LMWA 5KEJA 2VM1A 4ULXA 3CTGA 5GZZB 2L4QA 2PMTA 1M2AA 1FOVA 2I81A 2C0FA 4TKYA 1U3AA 3EINA 2G2QA 1X9WB 2GTUA 2L4CA 1GH2A 4LA1A 4HZ2A 1Y6EA 2DSAA 3M9JA 2GLRA 4NWYA 1A8YA 1XWAA 4ZBAA 5C00A 5AIXA 6GSWA 3TKSC 3IR4A 1THXA 2A4VA 1GLQA 4CHSA 1A8LA 3KZQA 4Z7XA 2H1DA 1JZRA 3QFBC 4OO5A 2OBIA 2YZHA 1XW9A 3BCKA 5KN2A 1HD2A 4HDEA 2DJ3A 4PXOA 5ELAA 2BMXA 3ERWA 1SKRB 2JADA 4OWYA 4X43A 2IPAA 3TJGA 1U88A 2H71A 2B3SA 4XS6A 4JBBA 5G1KA 4L5OA 1BEDA 3CRTA 1XWCA 5ID2B 3HJOA 3RHCA 1V98A 1XOBA 1Z7RA 1TI3A 2OE0A 5B8BA 3ZMKA 3N5OA 2QGVA 4GQCA 3VWXA 3GH6A 3HDCA 1JZWA 1J0FA 3VFIA 3ZLPA 2WZ9A 4WR5A 4XHMA 1VF2A 1F2EA 2JZSA 3GH9A 2JL4A 2VOCA 2VAFA 1QMVA 2VUPA 4IGJA 3KD0A 5DDLA 1SK1A 4AJ8A 3ED3A 1GSDA 3G7JA 2HLSA 1VGLA 2I4AA 4O7HA 2V41A 4TR1A 1YKCA 4PQHA 2LV3A 2I9HA 5LD0A 2M46A 4J57E 4FIWA 1S3CA 1T7PB 1FW1A 2MMNA 1WWJA 3KXOA 6GSSA 5CO3A 2GDRA 4MPFA 2C3TA 5J9CA 3CBUA 5CNWA 4KH7A 4YQMA 3DD3A 3TJFA 3QMXA 1GWCA 6GSYA 2CVBA 5ECQB 3FR3A 1DE1A 4XTSA 1YF1A 2JU5A 1GL8A 1EP8A 4RQXA 1PA3A 5IPGA 1G6YA 5JWQB 3V1WA 1U3IA 4MH3A 1ZOFA 3G9BA 1FVJA 2WB9A 1JHBA 2AJQB 2QKEA 3UJ1A 3APSA 3QAWA 4TXVA 4PQ1A 2GSQA 2CA8A 2LUSA 4BPYA 4K0GA 3VWWA 5E4WA 5ECPB 3PGTA 1O6JA 4OFTA 4GSNA 2H66A 3F9UA 4GXZA 4F0CA 5HR3A 3DMLA 2LTKA 1YY7A 1XVQA 4V2NA 3IC4A 3TRQA 1THOA 2RIIA 2XC2A 4IHUA 4TXOB 4F0BA 1YKAA 5CRGA 1S3AA 1PD21 5F06A 4MZBA 1AXDA 4IP6A 1O8XA 2BTOT 2KP2A 3FY7A 1FVKA 1ZYQB 3GA4A 4K2DA 1E2YA 5CAXA 7GSSA 4O5RA 1JZDA 4KE3A 1ERUA 2H0IA 4NXIA 1HQOA 4GF0A 1GSEA 3VLNA 5F8BA 1GLPA 3EURA 4GLTA 3GYKA 1XWBA 3WGEA 1QGVA 2RUEA 2WJUA 4NPBA 4ZL8A 2DJ0A 4JRRA 4MLYA 1F9MA 1ERWA 2WFCA 1A23A 4KDUA 1PL1A 2DIZA 4MJBA 3L78A 3VK9A 1GP1A 2GSTA 2VLUA 5ECIB 2V6OA 3E0UA 3M9KA 4NAXA 2D2ZA 3IPZA 1I9DA 2IMFA 1A2LA 5KN1A 2YJHA 4I97A 3TOTA 1F6MC 5H5QA 5F07A 5HFIA 3KEBA 3TKSA 3BOAA 4KGIA 2HZEB 3RPPA 1B4QA 2VD0A 2VCTA 1GTIA 2AAWA 1YEXA 3C7MA 1AW9A 2QSIA 4K6XA 1XWKA 3UAPA 4NV2A 1U6TA 4WXTA 5B7CA 5D9TA 3D6IA 3KTBA 3NOFA 5CYYA 2G0FA 4TVEA 1XXUA 2X99A 2JSYA 2CVKA 1AC1A 2EIOA 1BG5A 4POBA 4MMMA 2LRNA 4I2TA 1VRSD 4KB3A 5ID2A 2ALBA 1PMTA 5DJMA 1IYIA 4LMVA 1FO5A 2A2SA 1X9MB 4OFNA 1V9WA 2GQKA 1GUMA 2VIMA 4NV5A 1A0RP 2WGRA 4KNDA 3IV4A 3IK9A 2MYGA 3BJ5A 3K8NA 1TK0B 2DJKA 3QFAC 4ZL9A 1E6BA 2PU9C 3KGKA 3O3TA 3WT2A 3QOUA 1K3OA 5F0GA 1RK4A 2HNLA 3UOMA 4TR3A 4K1FA 4POMA 2XBQA 2RUFA 2FWHA 3LEFA 3O6TA 2GGTA 3APOA 3IAS2 4X1UA 2XBIA 4J2FA 4GRFA 2R5GA 5LCZA 3WYWA 4F82A 3QDNA 2IMKA 2F8FA 3GKXA 1W4VA 5CRDA 2PVQA 1O73A 5IOXA 2MBTA 4KA0A 2FUG2 4ZIJA 2B1KA 1MD4A 1FB0A 1BYEA 2ON7A 4F03A 3C71A 2TRXA 2X8HA 3UMAA 3LXZA 3W8JA 1X5DA 1SL2B 2FCHA 4Q5RA 2X8GA 1ML6A 3L9VA 3ZFLA 3NZNA 4Q5NA 3HXSA 1H75A 14GSA 8GSSA 3EMXA 2HFDA 4IN0A 1UC7A 4EDYA 4V1Ap 2DJ2A 4WEYA 4PNGA 3MAKA 2H01A 1CQHA 4ID0A 1USBA 3ZYWA 4RI6A 2B7JA 4XRAA 3CTFA 1Z5YE 4RI7A 1C72A 3ERGA 1ZL9A 1XCCA 2J9HA 3ZZXA 1V40A 2I3YA 3LQ7A 2HRFA 5CREA 18GSA 4YH2A 1XFLA 1ILOA 1SYRA 3IXRA 1R5PA 1T00A 3EWLA 3BCIA 2MMOA 5EVOA 4EVMA 3FZ4A 5AN1A 2NVLA 4N10A 4MF7A 3W6GA 3VWVA 4DSSA 1A24A 4IVFA 4N0VA 1JFUA 2Z9SA 4AGSA 5A4VA 3KMNA 3A3TA 4ECCA 5D9XA 2M72A 5GAND 3Q19A 3IA1A 2ZCTA 3F3QA 1TKDB 3F4RA 5D93A 3LG6A 4KUNA 1SL1B 1K0AA 1GULA 4N30A 3I43A 5ECKB 4G19A 3M1GA 1GUKA 1Z6MA 3UVHA 5B6MA 5J41A 3QPMA 4RUVA 2HE3A 1EOHA 4PGTA 2HZEA 3Q6OA 3ME8A 3P7XA 2YWIA 2CVDA 4J56E 2MBSA 2N5BA 3LORA 3NIVA 5D96A 1TRVA 2E2MA 3CMIA 3QAGA 2KHPA 3H1NA 1G0TA 5HR0A 3RHBA 1M9BA 4YQVA 4ZBDA 4MABA 5ECOB 2REMA 4WETA 4K9ZA 1WJKA 2F51A 2VO4A 4FH8A 2A2RA 4JZQA 4DSRA 3CSJA 1AQWA 3IAM2 3GX8A 2H74A 1X5CA 2YPMA 5IM9A 1BJXA 3TKSE 2NTOA 2V32A 4POLA 5IO2A 5J3RA 5IIZA 3GHAA 4DVCA 3IK7A 2CAQA 2KUCA 3HHVA 4EKZA 1QFNA 1VF1A 20GSA 4IBPA 2OA7A 3HKRA 2DJJA 2OJLA 3H79A 2E7PA 2P5QA 1B9XC 1BX9A 2YNXA 5EPFA 2LJKA 3PH9A 2B7KA 4MJCA 2FD3A 3I9V2 1QK8A 5HFGA 2HYXA 4ZXGA 2H6XA 2VL2C 3F3RA 4L0WA 3F6DA 4JR6A 3KH9A 3FZ9A 3DVXA 17GSA 4EF0A 1AIUA 5IMAA 4RQRA 1W89A 1B4PA 3CYNA 4MF5A 3TGZA 2R37A 4YAPA 2ES7A 1IYHA 3FR6A 4KSOA 4PUFC 4BL7A 1OKDA 2P5RA 4MJAA 5AGYA 1HNAA 4ECBA 2N5FA 3R2QA 2ZNMA 1SKSB 3FEUA 1YQ1A 3L4NA 3C1RA 2MZCA 2EIRA 3F0IA 3E9JB 3GURA 1FG4A 3LXTA 2B6MA 3VI5A 4TN8A 4ML1A 1XIYA 3UVTA 2F9SA 1WE0A 3L9SA 3IOSA 1ON4A 5F05A 3SWLA 2AYTA 1OAZA 2RM6A 1FAAA 1SJIA 2VCWA 3HJPA 1R26A 3M3MA 2DBCA 4TRXA 2MMAA 3UL3A 1H4OA 2WS2A 2V2GA 2PVOC 5B8AA 5IMVA 1AQXA 4V1Ag 4GSTA 1YEPA 16GSA 4MJEA 3KP9A 2VLVA 3IE3A 1ZMAA 2GVPA 2KP1A 4FYCA 3GTUA 4JEDA 1MDKA 3L0HA 4KAEA 2PWJA 1TTZA 6GSXA 5DALB 1TRSA 1EOGA 1G7OA 3ZIJA 2R6KA 3UARA 4BVYA 4Q5QA 2YV9A 2K18A 5LNKe 5DCGA 5ENUA 3WGDA 2VD1A 1EZKA 1F37A 2CZ2A 2FWFA 2PBJA 1OC8A 3HZ8A 1MD3A 1RQMA 4EL1A 4LL4B 2LKUA 3ISOA 4TW5A 1ERVA 1OE8A 2CX4A 5IMZA 1O85A 2C0EA 5JWRB 2P31A 2L5OA 4G2EA 2H0HA 3GIXA 3N9JA 2IMEA 3RBTA 5B6NA 3U6VA 2K6VA 2YCDA 3I69A 4TOPA 1PSQA 1GRXA 1TXXA 3D0ZA 3M8NA 4X0XA 1GSYA 3HYPA 3GMFA 1OC9B 2DMLA 1NHYA 2YZUA 2C0GA 4EE0A 1BAYA 5DBQA 5G2ZA 2XPEA 1K0MA 2AHEA 1PGTA 4MDCA 2L6DA 3ERFA 2YWOA 1YDKA 4XCSA 3OR5A 3A2VA 3H4KA 5H5RA 2EIQA 3HVSA 2GZYA 3GSTA 3A5WA 2IMIA 3D22A 4AJ6A 2V6KA 3ZREA 2YOIA 3VPQA 4EO3A 5G1LA 1A2MA 1Q98A 1TDIA 1N2AA 4GWRA 2YV7A 1SKWB 3UIWA 1UA5A 4HQZA 4WBRD 3DGQA 2IL3A 1ZCPA 1QQ2A 1UN2A 5GSTA 1M9AA 2CX3A 1NM3A 1ST9A 2P0GA 2I1UA 4IQ1A 1Z9HA 2ZUPA 1WRYA 3FKFA 1ZYEA 4WKWA 3VI7A 2WCIA 4TR1B 3GL5A 3GKKA 2K8SA 3DKSA 3P2AA 3Q74A 3KMOA 3GNJA 1TU7A 5JCGA 4HI7A 2PGTA 3FYGA 2VCZA 1Z3EA 3DVWA 1SK0A 2NPBA 4K7IA 1F3BA 2PUKC 2YWNA 1EEMA 1CQGA 2VL2A 5IMDA 3U5RE 2GSSA 1ERTA 1J9BA 1A0FA 2LNTA 2JACA 4I8BA 2H0GA 3VURA 5D73A 1M2BA 2H8LA 3QR6A 5DJLA 1TRWA 1ABAA 1G6WA 1PL2A 3TOUA 4NHZA 3WD6A 4FYBA 4CW9A 4I5QA 2MMZA 2VM2A 4JE1A 3TJBA 4ECJA 3C1SA 2E0QA 1Z6NA 3QD9A 1GSFA 1T8EB 1WPIA 2FLSA 3PR8A 1K0DA 3GV1A 1A2JA 2ON5A 4HUAA 3BBYA 1XBSA 2K8VA 5ECRB 1XW6A 1PQNA 1XWGA 2LS5A 2CAIA 4ML6A 2YP6A 3CSHA 2R3XA 3G7IA 3HD5A 4F9ZA 3C8EA 1PRXA 4IS0A 5IQYA 1DBYA 1KBNA 1M99A 5DCHA 3HJMA 1I5GA 2OADA 1K0BA 5G5EA 4JR4A 2CV4A 4ILFA 2R4VA 2XHFA 2E2GA 1O8WA 1M2DA 4BVXA 4PURA 4OFMA 4TXOA 2DC5A 1XOAA 1MTCA 5HR2A 5IOWA 1JLVA 4ZBBA 11GSA 3O76A 4FYUA 3GL3A 2LJAA 2L59A 1SENA 3IHQA 5GAPD 5FWGA 4MCUA 2VCVA 1T3BA 2VL9A 1Q4JA 4FO5A 4HS1A 3EU3A 1U87A 5A5KA 5DALA 3GKNA 1K3LA 1GSSA 1SJZA 2J23A 1JZOA 2V1MA 5JCWA 3GFKA 3DIEA 4GQFA 4OCEA 5H5SA 1SYXA 4YQUA 2PN8A 2IWTA 2DLXA 3TKRA 4IQAA 2C1YA 4O32A 1SJ6A 4GCIA 1WIKA 2GQLA 4IP1A 5HQPA 4E8HA 1K0NA 1GTUA 1LU4A 4N11A 4IELA 3D4MA 3KTLA 3LYPA 1GNEA 3ME7A 1F3AA 2HT9A 4I2UA 12GSA 1B8XA 2C4JA 2OKAA 3IDVA 2NDOA 1R7HA 1OC9A 4WR4A 2HSYA 4ZL7A 4G9HA 1AAZA 1FB6A 2LRCA 5CP1A 3ZTLA 4LL1B 1XZOA 3DEXA 2OE3A 1KNGA 4TR4A 4XS1A 2H1BA 1HNCA 3HY2A 2LEGA 4AJ7A 1R5AA 1M0UA 2B5EA 1MDJA 4MZCA 2B5YA 1PX6A 4LLRA 6GSUA 3E3EA 3FZ5A 1KTEA 1OYJA 2H70A 2GSRA 3DRNA 3EMPA 2FWGA 3GSSA 1SD9A 6GSTA 5JWOB 3QAVA 3I6AA 3ZVJA 4QL7A 4L0UA 4XS4B 3RDWA 3KCMA 5ELGA 3EC3A 5FT3A 2IFQB 1Z7PA 2BJXA 4PNFA 2B5XA 3EU4A 3F4SA 1V58A 4MZWA 4ZB6A 4KDYA 1TK5B 3KH7A 2FHEA 3TRXA 2C8UA 1V57A 2H30A 3D4TA 1X5EA 3MWHA 1GTBA 5J4UA 5COHA 1TK8B 1ACVA 4DSQA 4MK3A 1V2AA 5E59A 1S3DA 4ZILA 5J9BA 3P8WA 5ABRA 2LQQA 3M0FA 4MP4A 3GKMA 2FGXA 3TJKA 2H6YA 1XVWA 1EP7A 5KN0A 9GSSA 2HXKA 2FWEA 2H73A 4PX1A 2KLXA
chains in the Genus database with same CATH superfamily
5FHIA 1YZXA 2GQMA 3FK8A 4PQIA 2C3NA 2HZFA 4POKA 3ZMLA 3TRPA 2LJRA 4GTUA 3CRUA 4MH2A 2VLTA 3D21A 1PKZA 5IPHA 1OC3A 1EEJA 4KCAA 3PINA 4WBJA 1GUHA 4MA9A 2HSHA 4XIHA 5IMCA 2WRTA 3ZVJD 4L5LA 2H75A 3GN3A 3A2XA 3LWAA 3LYKA 5ECNB 1GTAA 1ZZYA 5EY6A 3LSZA 2JSZA 2IIYA 5DAKB 1SL0B 3EVIA 3KM6A 2R0PA 1Y25A 5D8IA 5KN3A 2O8VB 3Q18A 2DIYA 2YJ7A 1HNBA 2OBKA 4F2IA 4IW9A 1N8JA 4Z2RA 2JZTA 2HRAA 2H1GA 4N0ZA 1M3IA 1O7UA 2O7KA 1TRUA 3ZRDA 4EC0A 1TI1A 4BWQA 2GS3A 3QCPA 10GSA 1J08A 2N5AA 4TR0A 1WOUA 1MDIA 3BD2A 5ECLB 4OCFA 4EUYA 3HA9A 4EDZA 2L5LA 3TKPA 4D73B 2VCQA 3SBCA 4BA7A 3H93A 1EWXA 3L9UA 1G7EA 1B9YC 1WMJA 1QUWA 4DSSB 19GSA 1GSUA 3J7Yk 3W8SA 5DVBA 1DSBA 3ZIVA 3AY8A 4MPGA 3VPTA 5EL8A 4KW6A 2OE1A 3KJYA 1VF3A 1URMA 1OKTA 1EV4A 2TRCP 4K0NA 4I6XA 3J7Yb 2WULA 4CY8A 3EYTA 3ZFBA 4V2MA 4QQ7A 1K0OA 4ECIA 1YF0A 5BMUA 3DXBA 4G0LA 2NBSA 4KSMA 4AF2A 4P3YB 3F6FA 4V2LA 13GSA 4HJMA 4HEA2 3GRXA 4Q5FA 4CDOA 3FR9A 1SU9A 5CRWA 4JU5A 2PPTA 3RAZA 1PX7A 2JZRA 1QXHA 1UVZA 4BWSA 2EC4A 2RLIA 1GSQA 4O92A 5JCUA 3KP8A 1K0CA 1ZGNA 2O87A 3CSIA 1B48A 4IKHA 1XPVA 2IN3A 4KX4A 1K3YA 5C04A 3HVXA 2AUVA 5CRHA 4HJ2A 3S9FA 4EXJA 4GSSA 4HZ4A 1T4YA 2YANA 2DJ1A 2M80A 1TJDA 3TJJA 2CQ9A 3A2WA 2GT6A 2C3QA 3MYDA 2AB6A 5IMFA 5HFKA 1LBKA 22GSA 4HOJA 4OMVA 4PUAA 1XW5A 1X0RA 4E8EA 1EGOA 4QL9A 2H19A 4K7OA 1BQ7A 3GUSA 3MSZA 3CQFA 3H8QA 1NW2A 1NSWA 1SD8A 3WT1A 2C0DA 1WP0A 5DQYA 3US3A 4IJ3A 2K9FA 3GX0A 2QC7A 3RPNA 2WDUA 2GZZA 4XS4A 3TKQA 3UEMA 3HCZA 2X8CA 2IFQA 3F63A 4XRDA 2VL3A 4L8EA 2IJYA 3HVVA 3WGXA 3LFLA 3UBLA 3LJRA 2YN1A 2L6CA 4HU7A 5L71A 3F4TA 1ZYNA 2F8AA 3C73A 5GSSA 4ZB8A 1PKWA 4ZB9A 2CZ3A 2B1LA 1EGRA 3TB2A 2C80A 5D9VA 3TUEA 3D5JA 1TW9A 1RW1A 3F8UA 1M7TA 1PN9A 1VF4A 5INYA 3ZITA 1LJRA 4OD7A 3PPUA 1HYUA 4ISDA 3IBHA 3DWVA 3KIJA 4K5RA 3IRAA 5G30A 1JLWA 2LRTA 4H86A 5ECMB 2FNOA 5AIVA 4HU9A 3HZ4A 2TIRA 5HR1A 3CXGA 2HRNA 5D9WA 2GZPA 4NMUA 2LNSA 3DYRA 5DQSA 5ECSA 5AISA 2F3MA 4Z2TA 2H6ZA 1GNWA 4K7NA 3UBKA 5A4WA 2O89A 5ECHB 2R0GA 4NHWA 2H76A 3JCML 3FRCA 1R4WA 2H72A 3G7YA 3MNGA 4YKGA 1DE2A 2LQOA 1X9SB 5A4UA 4DEJA 3MDKA 1MEKA 2XPDA 3APQA 2O85A 1FHEA 2FA4A 5IO0A 5J5NA 2OACA 5DAKA 2FA8A 4IJIA 2CT6A 2GT5A 3VWUA 3GTUB 1SK2A 2HI7A 3EE2A 5G5FA 4KDXA 5G31A 3TCOA 4MF6A 4WF4A 4YAVA 6GSVA 1AQVA 2DMMA 3FW2A 3FZAA 1TOFA 3ZL5A 1T4ZA 2IMDA 3IHGA 1EV9A 2FY6A 2LSTA 3FHKA 2PERA 3LGCA 1AUCA 2YWMA 4KCEA 1YJ6A 1KEBA 1O81A 1DUGA 1OE7A 2KOKA 1T1VA 4K8MA 2R2JA 2L57A 4G10A 2UZ8A 1TU8A 2H1AA 2AV4A 4D73A 4OO4A 1NHOA 4WF5A 3P90A 4ACSA 1TP9A 2VCXA 3TDGA 4HQSA 1OVNA 2RM5A 2X64A 4LMWA 5KEJA 2VM1A 4ULXA 3CTGA 5GZZB 2L4QA 2PMTA 1M2AA 1FOVA 2I81A 2C0FA 4TKYA 1U3AA 3EINA 2G2QA 1X9WB 2GTUA 2HSMA 2L4CA 1GH2A 4LA1A 4HZ2A 1Y6EA 2DSAA 3M9JA 4O5QA 2GLRA 4NWYA 1A8YA 1XWAA 4ZBAA 5C00A 5AIXA 6GSWA 3TKSC 3IR4A 1THXA 2A4VA 1GLQA 4CHSA 1A8LA 3KZQA 4Z7XA 2H1DA 1JZRA 2DKIA 3QFBC 4OO5A 2OBIA 2YZHA 1XW9A 3BCKA 5KN2A 1HD2A 4HDEA 2DJ3A 4PXOA 5ELAA 2BMXA 3ERWA 1SKRB 2JADA 4OWYA 4X43A 2IPAA 3TJGA 1U88A 2H71A 2B3SA 4XS6A 4JBBA 5G1KA 4L5OA 1BEDA 3CRTA 1XWCA 5ID2B 3HJOA 3RHCA 1V98A 1XOBA 1Z7RA 1TI3A 2OE0A 5B8BA 3ZMKA 3N5OA 2QGVA 4GQCA 3VWXA 3GH6A 3HDCA 1JZWA 1J0FA 3VFIA 3ZLPA 2WZ9A 4WR5A 4XHMA 1VF2A 1F2EA 2JZSA 3GH9A 2JL4A 2VOCA 2VAFA 1QMVA 2VUPA 4IGJA 3KD0A 5DDLA 1SK1A 4AJ8A 3ED3A 1GSDA 3G7JA 2HLSA 1VGLA 2I4AA 4O7HA 2V41A 4TR1A 1YKCA 4PQHA 2LV3A 2I9HA 5LD0A 2M46A 4J57E 4FIWA 1S3CA 1T7PB 1FW1A 2MMNA 1WWJA 3KXOA 2R0CA 6GSSA 5CO3A 2GDRA 4BIKA 4MPFA 2C3TA 5J9CA 3CBUA 5CNWA 4KH7A 4YQMA 3DD3A 3TJFA 3QMXA 1GWCA 6GSYA 2CVBA 5ECQB 3FR3A 1DE1A 4XTSA 1YF1A 2JU5A 1GL8A 1EP8A 4RQXA 1PA3A 5IPGA 1G6YA 5JWQB 3V1WA 1U3IA 4MH3A 1ZOFA 3G9BA 1FVJA 2WB9A 4FQUA 1JHBA 2AJQB 2QKEA 3UJ1A 3APSA 3QAWA 4TXVA 4PQ1A 2GSQA 2CA8A 3MIXA 2LUSA 4BPYA 4K0GA 3VWWA 5E4WA 5ECPB 3PGTA 1O6JA 4OFTA 4GSNA 2H66A 3F9UA 4GXZA 4F0CA 5HR3A 3DMLA 2LTKA 4BVXB 1YY7A 1XVQA 4V2NA 3IC4A 3TRQA 1THOA 2RIIA 2XC2A 4IHUA 4TXOB 4F0BA 1YKAA 5CRGA 1S3AA 1PD21 5F06A 4MZBA 1AXDA 4IP6A 1O8XA 2BTOT 4K5SA 2KP2A 3FY7A 1FVKA 1ZYQB 3GA4A 4K2DA 1E2YA 5CAXA 7GSSA 4O5RA 1JZDA 4KE3A 4G0IA 1ERUA 4HSCX 2A2PA 2H0IA 4NXIA 1HQOA 4GF0A 1GSEA 2A4HA 3VLNA 5F8BA 1GLPA 3EURA 4GLTA 3GYKA 1XWBA 3WGEA 1QGVA 2RUEA 2WJUA 4NPBA 4ZL8A 2DJ0A 4JRRA 4MLYA 1F9MA 1ERWA 2WFCA 1A23A 4KDUA 1PL1A 2DIZA 4MJBA 3L78A 3VK9A 1GP1A 2GSTA 2VLUA 5ECIB 5BRTA 2V6OA 3E0UA 3M9KA 4NAXA 2D2ZA 3IPZA 1I9DA 2IMFA 1A2LA 5KN1A 2YJHA 4I97A 3TOTA 1F6MC 5H5QA 5F07A 5HFIA 2X49A 3KEBA 3TKSA 3BOAA 4KGIA 2HZEB 3RPPA 1B4QA 2VD0A 2VCTA 1GTIA 2AAWA 1YEXA 3C7MA 1AW9A 2QSIA 4K6XA 1XWKA 3UAPA 4NV2A 1U6TA 4WXTA 5B7CA 5D9TA 3D6IA 3KTBA 3NOFA 5CYYA 4USSA 2G0FA 4TVEA 4EIQA 1XXUA 2X99A 2JSYA 2CVKA 1AC1A 2EIOA 1BG5A 4POBA 4MMMA 2LRNA 4I2TA 1VRSD 4KB3A 5ID2A 2ALBA 1PMTA 5DJMA 1FOHA 1IYIA 4LMVA 1FO5A 2A2SA 1X9MB 4OFNA 1V9WA 2GQKA 1GUMA 2VIMA 4NV5A 1A0RP 2WGRA 4KNDA 3IV4A 3IK9A 2MYGA 3BJ5A 3K8NA 1TK0B 2DJKA 3QFAC 4ZL9A 1E6BA 2PU9C 3KGKA 3O3TA 3WT2A 3QOUA 1K3OA 5F0GA 1RK4A 2HNLA 3UOMA 4TR3A 4K1FA 4POMA 2XBQA 2RUFA 2FWHA 3LEFA 3O6TA 2GGTA 3APOA 3IAS2 4X1UA 2XBIA 4J2FA 4GRFA 4BL7B 2R5GA 2QA1A 5LCZA 3WYWA 4F82A 3QDNA 2IMKA 2F8FA 3GKXA 1W4VA 5CRDA 2PVQA 1O73A 5IOXA 2MBTA 4KA0A 2FUG2 4ZIJA 2B1KA 1MD4A 1FB0A 1BYEA 2ON7A 4F03A 3C71A 2TRXA 2X8HA 3UMAA 3LXZA 3W8JA 1X5DA 1SL2B 2FCHA 4Q5RA 2X8GA 1ML6A 3L9VA 3ZFLA 3NZNA 4ICYA 4Q5NA 3HXSA 1H75A 1S3RA 8GSSA 3EMXA 2HFDA 4IN0A 1UC7A 14GSA 4EDYA 4V1Ap 2DJ2A 4WEYA 4PNGA 3MAKA 2H01A 1CQHA 4ID0A 1USBA 3ZYWA 4RI6A 2B7JA 4XRAA 3CTFA 1Z5YE 4RI7A 3FMWA 1C72A 3ERGA 1ZL9A 1XCCA 2J9HA 3ZZXA 1V40A 2I3YA 3LQ7A 2HRFA 5CREA 18GSA 4BVYB 4YH2A 1XFLA 1ILOA 1SYRA 3IXRA 1R5PA 1T00A 3EWLA 3BCIA 2MMOA 5EVOA 4EVMA 3FZ4A 5AN1A 2NVLA 4N10A 4MF7A 3W6GA 3VWVA 4DSSA 1A24A 4IVFA 4N0VA 1JFUA 2Z9SA 4AGSA 5A4VA 3KMNA 3A3TA 4ECCA 5D9XA 2M72A 5GAND 3Q19A 3IA1A 2ZCTA 3F3QA 1TKDB 3F4RA 4KF9A 5D93A 3LG6A 4KUNA 1SL1B 1K0AA 1GULA 4N30A 3I43A 5KOXA 5ECKB 4G19A 3M1GA 4YKFA 1GUKA 1Z6MA 3UVHA 5B6MA 2X4AA 5J41A 3EPTA 3QPMA 4RUVA 2HE3A 1EOHA 4PGTA 2HZEA 3Q6OA 3ME8A 3P7XA 2YWIA 2CVDA 4J56E 2MBSA 2N5BA 3LORA 3NIVA 5D96A 1TRVA 2E2MA 3CMIA 3QAGA 2KHPA 3H1NA 1G0TA 5HR0A 3RHBA 1M9BA 4YQVA 4ZBDA 4MABA 5ECOB 2REMA 4WETA 4K9ZA 1WJKA 2F51A 2VO4A 4FH8A 2A2RA 4JZQA 4DSRA 3CSJA 1AQWA 3IAM2 3GX8A 2H74A 1X5CA 2YPMA 5IM9A 1BJXA 3TKSE 2NTOA 2V32A 4POLA 5IO2A 5J3RA 5IIZA 3GHAA 4DVCA 3IK7A 2CAQA 2KUCA 3HHVA 4EKZA 1QFNA 1VF1A 20GSA 4IBPA 2OA7A 3HKRA 2DJJA 2OJLA 3H79A 2E7PA 2P5QA 1B9XC 1BX9A 2YNXA 5EPFA 2LJKA 3PH9A 2B7KA 4MJCA 2FD3A 3I9V2 1QK8A 5HFGA 2HYXA 4ZXGA 2H6XA 2VL2C 3F3RA 4L0WA 3F6DA 4JR6A 2DKHA 3KH9A 3FZ9A 3DVXA 17GSA 4EF0A 1AIUA 5IMAA 4RQRA 1W89A 1B4PA 3CYNA 4MF5A 1M3JA 3TGZA 2R37A 4YAPA 2ES7A 1IYHA 3FR6A 4KSOA 4PUFC 4BL7A 1OKDA 2P5RA 4MJAA 5AGYA 1HNAA 4ECBA 2N5FA 4MNNA 3R2QA 2ZNMA 1SKSB 3FEUA 1YQ1A 3L4NA 3C1RA 2MZCA 2EIRA 3F0IA 3E9JB 3GURA 1FG4A 3LXTA 2B6MA 3VI5A 4TN8A 4ML1A 1XIYA 3UVTA 2F9SA 1WE0A 3L9SA 3IOSA 1ON4A 5F05A 4K2XA 3SWLA 2AYTA 1OAZA 2RM6A 1FAAA 1SJIA 2VCWA 3HJPA 1R26A 3M3MA 2DBCA 4TRXA 2MMAA 3UL3A 1H4OA 2WS2A 2V2GA 2PVOC 5B8AA 5IMVA 1AQXA 4V1Ag 4GSTA 1YEPA 16GSA 4MJEA 3KP9A 2VLVA 3IE3A 1ZMAA 2GVPA 2KP1A 4FYCA 3GTUA 4JEDA 1MDKA 3L0HA 4KAEA 2PWJA 1TTZA 6GSXA 5DALB 1TRSA 1EOGA 1G7OA 3ZIJA 2R6KA 3UARA 4BVYA 4Q5QA 2YV9A 2K18A 4O5UA 5LNKe 5DCGA 5ENUA 3WGDA 2VD1A 1EZKA 1F37A 2CZ2A 2FWFA 2PBJA 1OC8A 3HZ8A 1MD3A 1RQMA 4EL1A 4LL4B 2LKUA 3ISOA 4TW5A 1ERVA 1OE8A 2CX4A 5IMZA 1O85A 2C0EA 5JWRB 2P31A 2L5OA 4G2EA 2H0HA 3GIXA 3N9JA 2IMEA 3RBTA 5B6NA 3U6VA 2K6VA 2YCDA 3I69A 4TOPA 1PSQA 1GRXA 1TXXA 3D0ZA 3M8NA 4X0XA 1GSYA 3HYPA 3GMFA 1OC9B 2DMLA 1NHYA 2YZUA 2C0GA 4EE0A 1BAYA 5DBQA 5G2ZA 2XPEA 1K0MA 2AHEA 1PGTA 4MDCA 2L6DA 3ERFA 2YWOA 1YDKA 4XCSA 3OR5A 3A2VA 3H4KA 5H5RA 2EIQA 3HVSA 2GZYA 3GSTA 3A5WA 2IMIA 3D22A 4AJ6A 4PTSA 2V6KA 3ZREA 2YOIA 3VPQA 4EO3A 5G1LA 1A2MA 1Q98A 1TDIA 1N2AA 3IC8A 4GWRA 2YV7A 1SKWB 3UIWA 1UA5A 4HQZA 4WBRD 4X4JA 3DGQA 2IL3A 3R3EA 1ZCPA 1QQ2A 1UN2A 5GSTA 1M9AA 2CX3A 1NM3A 1ST9A 2P0GA 2I1UA 4IQ1A 1Z9HA 2ZUPA 1WRYA 3FKFA 1ZYEA 4WKWA 3VI7A 2WCIA 4TR1B 3GL5A 3GKKA 2HRKA 2K8SA 3DKSA 3P2AA 3Q74A 3KMOA 3GNJA 1TU7A 5JCGA 5KOWA 4HI7A 2PGTA 3FYGA 2VCZA 1Z3EA 4G0KA 3DVWA 1SK0A 2NPBA 4K7IA 1F3BA 2PUKC 2YWNA 1EEMA 1CQGA 2VL2A 5IMDA 3U5RE 2GSSA 1ERTA 1J9BA 1A0FA 2LNTA 1PFOA 2JACA 4I8BA 2H0GA 3VURA 5D73A 1M2BA 2H8LA 3QR6A 5DJLA 1TRWA 1ABAA 1G6WA 1PL2A 3TOUA 4NHZA 3WD6A 4FYBA 4CW9A 4I5QA 2MMZA 2VM2A 4JE1A 3TJBA 4ECJA 3C1SA 2E0QA 1Z6NA 3QD9A 1GSFA 1T8EB 4A5PA 1WPIA 2FLSA 3PR8A 1K0DA 3GV1A 1A2JA 2ON5A 4HUAA 3BBYA 1XBSA 2K8VA 5ECRB 1XW6A 1PQNA 1XWGA 2LS5A 2CAIA 1PN0A 4ML6A 2YP6A 3CSHA 2R3XA 3G7IA 3HD5A 4F9ZA 3C8EA 1PRXA 4IS0A 5IQYA 1DBYA 1KBNA 1M99A 5DCHA 3HJMA 1I5GA 2OADA 1K0BA 5G5EA 4JR4A 2CV4A 4ILFA 2R4VA 2XHFA 2E2GA 1O8WA 1M2DA 4BVXA 4PURA 4OFMA 4TXOA 2DC5A 1XOAA 1MTCA 5HR2A 5IOWA 1JLVA 4ZBBA 11GSA 3O76A 4FYUA 3GL3A 2LJAA 2L59A 1SENA 3IHQA 5GAPD 5FWGA 4MCUA 2VCVA 1T3BA 2VL9A 1Q4JA 4FO5A 4HS1A 3EU3A 1U87A 5A5KA 5DALA 3GKNA 1K3LA 1GSSA 1SJZA 2J23A 1JZOA 2V1MA 5JCWA 3GFKA 3DIEA 4GQFA 4OCEA 5H5SA 1SYXA 4YQUA 2PN8A 2IWTA 2DLXA 3TKRA 4IQAA 2C1YA 4O32A 1SJ6A 4GCIA 1WIKA 2GQLA 4IP1A 5HQPA 4E8HA 1K0NA 1GTUA 1LU4A 4N11A 4IELA 3D4MA 3KTLA 3LYPA 1GNEA 3ME7A 1F3AA 2HT9A 4I2UA 12GSA 1B8XA 2C4JA 2OKAA 3IDVA 2NDOA 1R7HA 1OC9A 4WR4A 2HSYA 4ZL7A 4G9HA 1AAZA 1FB6A 2LRCA 5CP1A 3ZTLA 4LL1B 4CY6A 1XZOA 3DEXA 2OE3A 1KNGA 4TR4A 4XS1A 2H1BA 1HNCA 3HY2A 3A5IA 2LEGA 4EIPA 4AJ7A 1R5AA 1M0UA 2B5EA 1MDJA 4MZCA 2B5YA 1PX6A 4LLRA 6GSUA 3E3EA 3FZ5A 1KTEA 1OYJA 2H70A 2GSRA 3DRNA 3EMPA 2QA2A 2FWGA 3GSSA 1SD9A 6GSTA 5JWOB 3QAVA 3I6AA 3ZVJA 4QL7A 4L0UA 3LW9A 4XS4B 3RDWA 3KCMA 5ELGA 3EC3A 5FT3A 2IFQB 1ZYPA 1Z7PA 2BJXA 4PNFA 3HVNA 2B5XA 3EU4A 3F4SA 1V58A 4MZWA 4ZB6A 4KDYA 1TK5B 3KH7A 2FHEA 3TRXA 2C8UA 1V57A 2H30A 3D4TA 1X5EA 3MWHA 1GTBA 5J4UA 5COHA 1TK8B 1ACVA 4DSQA 4MK3A 1V2AA 5E59A 4Z2UA 1S3DA 4ZILA 5J9BA 3P8WA 5ABRA 1XG8A 2LQQA 3M0FA 4MP4A 3GKMA 2FGXA 3TJKA 2H6YA 1XVWA 1EP7A 5KN0A 9GSSA 2HXKA 2FWEA 2H73A 4PX1A 2KLXA
chains in the Genus database with same CATH topology
5FHIA 1YZXA 2GQMA 3FK8A 4PQIA 2C3NA 2HZFA 4POKA 3ZMLA 3TRPA 2LJRA 4GTUA 3CRUA 4MH2A 2VLTA 3D21A 1PKZA 5IPHA 1OC3A 1EEJA 4KCAA 3PINA 4WBJA 1GUHA 4MA9A 2HSHA 4XIHA 5IMCA 2WRTA 3ZVJD 4L5LA 2H75A 3GN3A 3A2XA 3LWAA 3LYKA 5ECNB 1GTAA 1ZZYA 5EY6A 3LSZA 2JSZA 2IIYA 5DAKB 1SL0B 3EVIA 3KM6A 2R0PA 1Y25A 5D8IA 5KN3A 2O8VB 3Q18A 2DIYA 2YJ7A 1HNBA 2OBKA 4F2IA 4IW9A 1N8JA 4Z2RA 2JZTA 2HRAA 2H1GA 4N0ZA 1O7UA 2O7KA 1TRUA 3ZRDA 4EC0A 1TI1A 4BWQA 2GS3A 3QCPA 10GSA 1J08A 2N5AA 4TR0A 1WOUA 1MDIA 3BD2A 5ECLB 4OCFA 4EUYA 3HA9A 4EDZA 2L5LA 3TKPA 4D73B 2VCQA 3SBCA 4BA7A 3H93A 1EWXA 3L9UA 1G7EA 1B9YC 1WMJA 1QUWA 4DSSB 19GSA 1GSUA 3J7Yk 3W8SA 5DVBA 1DSBA 3ZIVA 3AY8A 4MPGA 3VPTA 5EL8A 4KW6A 2OE1A 3KJYA 1VF3A 1URMA 1OKTA 1EV4A 2TRCP 4K0NA 4I6XA 3J7Yb 2WULA 4CY8A 3EYTA 3ZFBA 4V2MA 4QQ7A 1K0OA 4ECIA 1YF0A 5BMUA 3DXBA 4G0LA 2NBSA 4KSMA 4AF2A 4P3YB 3F6FA 4V2LA 13GSA 4HJMA 4HEA2 3GRXA 4Q5FA 4CDOA 3FR9A 1SU9A 5CRWA 4JU5A 2PPTA 3RAZA 1PX7A 2JZRA 1QXHA 1UVZA 4BWSA 2EC4A 2RLIA 1GSQA 4O92A 5JCUA 3KP8A 1K0CA 1ZGNA 2O87A 3CSIA 1B48A 4IKHA 1XPVA 2IN3A 4KX4A 1K3YA 5C04A 3HVXA 2AUVA 5CRHA 4HJ2A 3S9FA 4EXJA 4GSSA 4HZ4A 1T4YA 2YANA 2DJ1A 2M80A 1TJDA 3TJJA 2CQ9A 3A2WA 2GT6A 2C3QA 3MYDA 2AB6A 5IMFA 5HFKA 1LBKA 22GSA 4HOJA 4OMVA 4PUAA 1XW5A 1X0RA 4E8EA 1EGOA 4QL9A 2H19A 4K7OA 1BQ7A 3GUSA 3MSZA 3H8QA 1NW2A 1NSWA 1SD8A 3WT1A 2C0DA 1WP0A 5DQYA 3US3A 4IJ3A 2K9FA 3GX0A 2QC7A 3RPNA 2WDUA 2GZZA 4XS4A 3TKQA 3UEMA 3HCZA 2X8CA 2IFQA 3F63A 4XRDA 2VL3A 4L8EA 2IJYA 3HVVA 3WGXA 3LFLA 3UBLA 3LJRA 2YN1A 2L6CA 4HU7A 5L71A 3F4TA 1ZYNA 2F8AA 3C73A 5GSSA 4ZB8A 1PKWA 4ZB9A 2CZ3A 2B1LA 1EGRA 3TB2A 2C80A 5D9VA 3TUEA 3D5JA 1TW9A 1RW1A 3F8UA 1M7TA 1PN9A 1VF4A 5INYA 3ZITA 1LJRA 4OD7A 3PPUA 1HYUA 4ISDA 3IBHA 3DWVA 3KIJA 4K5RA 3IRAA 5G30A 1JLWA 2LRTA 4H86A 5ECMB 2FNOA 5AIVA 4HU9A 3HZ4A 2TIRA 5HR1A 3CXGA 2HRNA 5D9WA 2GZPA 4NMUA 2LNSA 3DYRA 5DQSA 5ECSA 5AISA 2F3MA 4Z2TA 2H6ZA 1GNWA 4K7NA 3UBKA 5A4WA 2O89A 5ECHB 2R0GA 4NHWA 2H76A 3JCML 3FRCA 1R4WA 2H72A 3G7YA 3MNGA 4YKGA 1DE2A 2LQOA 1X9SB 5A4UA 4DEJA 3MDKA 1MEKA 2XPDA 3APQA 2O85A 1FHEA 2FA4A 5IO0A 5J5NA 2OACA 5DAKA 2FA8A 4IJIA 2CT6A 2GT5A 3VWUA 3GTUB 1SK2A 2HI7A 3EE2A 5G5FA 4KDXA 5G31A 3TCOA 4MF6A 4WF4A 4YAVA 6GSVA 1AQVA 2DMMA 3FW2A 3FZAA 1TOFA 3ZL5A 1T4ZA 2IMDA 3IHGA 1EV9A 2FY6A 2LSTA 3FHKA 2PERA 3LGCA 1AUCA 2YWMA 4KCEA 1YJ6A 1KEBA 1O81A 1DUGA 1OE7A 2KOKA 1T1VA 4K8MA 2R2JA 2L57A 4G10A 2UZ8A 1TU8A 2H1AA 2AV4A 4D73A 4OO4A 1NHOA 4WF5A 3P90A 4ACSA 1TP9A 2VCXA 3TDGA 4HQSA 1OVNA 2RM5A 2X64A 4LMWA 5KEJA 2VM1A 4ULXA 3CTGA 5GZZB 2L4QA 2PMTA 1M2AA 1FOVA 2I81A 2C0FA 4TKYA 1U3AA 3EINA 2G2QA 1X9WB 2GTUA 2HSMA 2L4CA 1GH2A 4LA1A 4HZ2A 1Y6EA 2DSAA 3M9JA 4O5QA 2GLRA 4NWYA 1A8YA 1XWAA 4ZBAA 5C00A 5AIXA 6GSWA 3TKSC 3IR4A 1THXA 2A4VA 1GLQA 4CHSA 1A8LA 3KZQA 4Z7XA 2H1DA 1JZRA 2DKIA 3QFBC 4OO5A 2OBIA 2YZHA 1XW9A 3BCKA 5KN2A 1HD2A 4HDEA 2DJ3A 4PXOA 5ELAA 2BMXA 3ERWA 1SKRB 2JADA 4OWYA 4X43A 2IPAA 3TJGA 1U88A 2H71A 2B3SA 4XS6A 4JBBA 5G1KA 4L5OA 1BEDA 3CRTA 1XWCA 5ID2B 3HJOA 3RHCA 1V98A 1XOBA 1Z7RA 1TI3A 2OE0A 5B8BA 3ZMKA 3N5OA 2QGVA 4GQCA 3VWXA 3GH6A 3HDCA 1JZWA 1J0FA 3VFIA 3ZLPA 2WZ9A 4WR5A 4XHMA 1VF2A 1F2EA 2JZSA 3GH9A 2JL4A 2VOCA 2VAFA 1QMVA 2VUPA 4IGJA 3KD0A 5DDLA 1SK1A 4AJ8A 3ED3A 1GSDA 3G7JA 2HLSA 1VGLA 2I4AA 4O7HA 2V41A 4TR1A 1YKCA 4PQHA 2LV3A 2I9HA 5LD0A 2M46A 4J57E 4FIWA 1S3CA 1T7PB 1FW1A 2MMNA 1WWJA 3KXOA 2R0CA 6GSSA 5CO3A 2GDRA 4MPFA 2C3TA 5J9CA 3CBUA 5CNWA 4KH7A 4YQMA 3DD3A 3TJFA 3QMXA 1GWCA 6GSYA 2CVBA 5ECQB 3FR3A 1DE1A 4XTSA 1YF1A 2JU5A 1GL8A 1EP8A 4RQXA 1PA3A 5IPGA 1G6YA 5JWQB 3V1WA 1U3IA 4MH3A 1ZOFA 3G9BA 1FVJA 2WB9A 4FQUA 1JHBA 2AJQB 2QKEA 3UJ1A 3APSA 3QAWA 4TXVA 4PQ1A 2GSQA 2CA8A 3MIXA 2LUSA 4BPYA 4K0GA 3VWWA 5E4WA 5ECPB 3PGTA 1O6JA 4OFTA 4GSNA 2H66A 3F9UA 4GXZA 4F0CA 5HR3A 3DMLA 2LTKA 4BVXB 1YY7A 1XVQA 4V2NA 3IC4A 3TRQA 1THOA 2RIIA 2XC2A 4IHUA 4TXOB 4F0BA 1YKAA 5CRGA 1S3AA 1PD21 5F06A 4MZBA 1AXDA 4IP6A 1O8XA 2BTOT 4K5SA 2KP2A 3FY7A 1FVKA 1ZYQB 3GA4A 4K2DA 1E2YA 5CAXA 7GSSA 4O5RA 1JZDA 4KE3A 4G0IA 1ERUA 2A2PA 2H0IA 4NXIA 1HQOA 4GF0A 1GSEA 2A4HA 3VLNA 5F8BA 1GLPA 3EURA 4GLTA 3GYKA 1XWBA 3WGEA 1QGVA 2RUEA 2WJUA 4NPBA 4ZL8A 2DJ0A 4JRRA 4MLYA 1F9MA 1ERWA 2WFCA 1A23A 4KDUA 1PL1A 2DIZA 4MJBA 3L78A 3VK9A 1GP1A 2GSTA 2VLUA 5ECIB 5BRTA 2V6OA 3E0UA 3M9KA 4NAXA 2D2ZA 3IPZA 1I9DA 2IMFA 1A2LA 5KN1A 2YJHA 4I97A 3TOTA 1F6MC 5H5QA 5F07A 5HFIA 2X49A 3KEBA 3TKSA 3BOAA 4KGIA 2HZEB 3RPPA 1B4QA 2VD0A 2VCTA 1GTIA 2AAWA 1YEXA 3C7MA 1AW9A 2QSIA 4K6XA 1XWKA 3UAPA 4NV2A 1U6TA 4WXTA 5B7CA 5D9TA 3D6IA 3KTBA 3NOFA 5CYYA 4USSA 2G0FA 4TVEA 4EIQA 1XXUA 2X99A 2JSYA 2CVKA 1AC1A 2EIOA 1BG5A 4POBA 4MMMA 2LRNA 4I2TA 1VRSD 4KB3A 5ID2A 2ALBA 1PMTA 5DJMA 1FOHA 1IYIA 4LMVA 1FO5A 2A2SA 1X9MB 4OFNA 1V9WA 2GQKA 1GUMA 2VIMA 4NV5A 1A0RP 2WGRA 4KNDA 3IV4A 3IK9A 2MYGA 3BJ5A 3K8NA 1TK0B 2DJKA 3QFAC 4ZL9A 1E6BA 2PU9C 3KGKA 3O3TA 3WT2A 3QOUA 1K3OA 5F0GA 1RK4A 2HNLA 3UOMA 4TR3A 4K1FA 4POMA 2XBQA 2RUFA 2FWHA 3LEFA 3O6TA 2GGTA 3APOA 3IAS2 4X1UA 2XBIA 4J2FA 4GRFA 4BL7B 2R5GA 2QA1A 5LCZA 3WYWA 4F82A 3QDNA 2IMKA 2F8FA 3GKXA 1W4VA 5CRDA 2PVQA 1O73A 5IOXA 2MBTA 4KA0A 2FUG2 4ZIJA 2B1KA 1MD4A 1FB0A 1BYEA 2ON7A 4F03A 3C71A 2TRXA 2X8HA 3UMAA 3LXZA 3W8JA 1X5DA 1SL2B 2FCHA 4Q5RA 2X8GA 1ML6A 3L9VA 3ZFLA 3NZNA 4ICYA 4Q5NA 3HXSA 1H75A 14GSA 8GSSA 3EMXA 2HFDA 4IN0A 1UC7A 4EDYA 4V1Ap 2DJ2A 4WEYA 4PNGA 3MAKA 2H01A 1CQHA 4ID0A 1USBA 3ZYWA 4RI6A 2B7JA 4XRAA 3CTFA 1Z5YE 4RI7A 3FMWA 1C72A 3ERGA 1ZL9A 1XCCA 2J9HA 3ZZXA 1V40A 2I3YA 3LQ7A 2HRFA 5CREA 18GSA 4BVYB 4YH2A 1XFLA 1ILOA 1SYRA 3IXRA 1R5PA 1T00A 3EWLA 3BCIA 2MMOA 5EVOA 4EVMA 3FZ4A 5AN1A 2NVLA 4N10A 4MF7A 3W6GA 3VWVA 4DSSA 1A24A 4IVFA 4N0VA 1JFUA 2Z9SA 4AGSA 5A4VA 3KMNA 3A3TA 4ECCA 5D9XA 2M72A 5GAND 3Q19A 3IA1A 2ZCTA 3F3QA 1TKDB 3F4RA 4KF9A 5D93A 3LG6A 4KUNA 1SL1B 1K0AA 1GULA 4N30A 3I43A 5KOXA 5ECKB 4G19A 3M1GA 4YKFA 1GUKA 1Z6MA 3UVHA 5B6MA 2X4AA 5J41A 3EPTA 3QPMA 4RUVA 2HE3A 1EOHA 4PGTA 2HZEA 3Q6OA 3ME8A 3P7XA 2YWIA 2CVDA 4J56E 2MBSA 2N5BA 3LORA 3NIVA 5D96A 1TRVA 2E2MA 3CMIA 3QAGA 2KHPA 3H1NA 1G0TA 5HR0A 3RHBA 1M9BA 4YQVA 4ZBDA 4MABA 5ECOB 2REMA 4WETA 4K9ZA 1WJKA 2F51A 2VO4A 4FH8A 2A2RA 4JZQA 4DSRA 3CSJA 1AQWA 3IAM2 3GX8A 2H74A 1X5CA 2YPMA 5IM9A 1BJXA 3TKSE 2NTOA 2V32A 4POLA 5IO2A 5J3RA 5IIZA 3GHAA 4DVCA 3IK7A 2CAQA 2KUCA 3HHVA 4EKZA 1QFNA 1VF1A 20GSA 4IBPA 2OA7A 3HKRA 2DJJA 2OJLA 3H79A 2E7PA 2P5QA 1B9XC 1BX9A 2YNXA 5EPFA 2LJKA 3PH9A 2B7KA 4MJCA 2FD3A 3I9V2 1QK8A 5HFGA 2HYXA 4ZXGA 2H6XA 2VL2C 3F3RA 4L0WA 3F6DA 4JR6A 2DKHA 3KH9A 3FZ9A 3DVXA 17GSA 4EF0A 1AIUA 5IMAA 4RQRA 1W89A 1B4PA 3CYNA 4MF5A 3TGZA 2R37A 4YAPA 2ES7A 1IYHA 3FR6A 4KSOA 4PUFC 4BL7A 1OKDA 2P5RA 4MJAA 5AGYA 1HNAA 4ECBA 2N5FA 4MNNA 3R2QA 2ZNMA 1SKSB 3FEUA 1YQ1A 3L4NA 3C1RA 2MZCA 2EIRA 3F0IA 3E9JB 3GURA 1FG4A 3LXTA 2B6MA 3VI5A 4TN8A 4ML1A 1XIYA 3UVTA 2F9SA 1WE0A 3L9SA 3IOSA 1ON4A 5F05A 4K2XA 3SWLA 2AYTA 1OAZA 2RM6A 1FAAA 1SJIA 2VCWA 3HJPA 1R26A 3M3MA 2DBCA 4TRXA 2MMAA 3UL3A 1H4OA 2WS2A 2V2GA 2PVOC 5B8AA 5IMVA 1AQXA 4V1Ag 4GSTA 1YEPA 16GSA 4MJEA 3KP9A 2VLVA 3IE3A 1ZMAA 2GVPA 2KP1A 4FYCA 3GTUA 4JEDA 1MDKA 3L0HA 4KAEA 2PWJA 1TTZA 6GSXA 5DALB 1TRSA 1EOGA 1G7OA 3ZIJA 2R6KA 3UARA 4BVYA 4Q5QA 2YV9A 2K18A 4O5UA 5LNKe 5DCGA 5ENUA 3WGDA 2VD1A 1EZKA 1F37A 2CZ2A 2FWFA 2PBJA 1OC8A 3HZ8A 1MD3A 1RQMA 4EL1A 4LL4B 2LKUA 3ISOA 4TW5A 1ERVA 1OE8A 2CX4A 5IMZA 1O85A 2C0EA 5JWRB 2P31A 2L5OA 4G2EA 2H0HA 3GIXA 3N9JA 2IMEA 3RBTA 5B6NA 3U6VA 2K6VA 2YCDA 3I69A 4TOPA 1PSQA 1GRXA 1TXXA 3D0ZA 3M8NA 4X0XA 1GSYA 3HYPA 3GMFA 1OC9B 2DMLA 1NHYA 2YZUA 2C0GA 4EE0A 1BAYA 5DBQA 5G2ZA 2XPEA 1K0MA 2AHEA 1PGTA 4MDCA 2L6DA 3ERFA 2YWOA 1YDKA 4XCSA 3OR5A 3A2VA 3H4KA 5H5RA 2EIQA 3HVSA 2GZYA 3GSTA 3A5WA 2IMIA 3D22A 4AJ6A 4PTSA 2V6KA 3ZREA 2YOIA 3VPQA 4EO3A 5G1LA 1A2MA 1Q98A 1TDIA 1N2AA 3IC8A 4GWRA 2YV7A 1SKWB 3UIWA 1UA5A 4HQZA 4WBRD 4X4JA 3DGQA 2IL3A 3R3EA 1ZCPA 1QQ2A 1UN2A 5GSTA 1M9AA 2CX3A 1NM3A 1ST9A 2P0GA 2I1UA 4IQ1A 1Z9HA 2ZUPA 1WRYA 3FKFA 1ZYEA 4WKWA 3VI7A 2WCIA 4TR1B 3GL5A 3GKKA 2HRKA 2K8SA 3DKSA 3P2AA 3Q74A 3KMOA 3GNJA 1TU7A 5JCGA 5KOWA 4HI7A 2PGTA 3FYGA 2VCZA 1Z3EA 4G0KA 3DVWA 1SK0A 2NPBA 4K7IA 1F3BA 2PUKC 2YWNA 1EEMA 1CQGA 2VL2A 5IMDA 3U5RE 2GSSA 1ERTA 1J9BA 1A0FA 2LNTA 2JACA 4I8BA 2H0GA 3VURA 5D73A 1M2BA 2H8LA 3QR6A 5DJLA 1TRWA 1ABAA 1G6WA 1PL2A 3TOUA 4NHZA 3WD6A 4FYBA 4CW9A 4I5QA 2MMZA 2VM2A 4JE1A 3TJBA 4ECJA 3C1SA 2E0QA 1Z6NA 3QD9A 1GSFA 1T8EB 4A5PA 1WPIA 2FLSA 3PR8A 1K0DA 3GV1A 1A2JA 2ON5A 4HUAA 3BBYA 1XBSA 2K8VA 5ECRB 1XW6A 1PQNA 1XWGA 2LS5A 2CAIA 1PN0A 4ML6A 2YP6A 3CSHA 2R3XA 3G7IA 3HD5A 4F9ZA 3C8EA 1PRXA 4IS0A 5IQYA 1DBYA 1KBNA 1M99A 5DCHA 3HJMA 1I5GA 2OADA 1K0BA 5G5EA 4JR4A 2CV4A 4ILFA 2R4VA 2XHFA 2E2GA 1O8WA 1M2DA 4BVXA 4PURA 4OFMA 4TXOA 2DC5A 1XOAA 1MTCA 5HR2A 5IOWA 1JLVA 4ZBBA 11GSA 3O76A 4FYUA 3GL3A 2LJAA 2L59A 1SENA 3IHQA 5GAPD 5FWGA 4MCUA 2VCVA 1T3BA 2VL9A 1Q4JA 4FO5A 4HS1A 3EU3A 1U87A 5A5KA 5DALA 3GKNA 1K3LA 1GSSA 1SJZA 2J23A 1JZOA 2V1MA 5JCWA 3GFKA 3DIEA 4GQFA 4OCEA 5H5SA 1SYXA 4YQUA 2PN8A 2IWTA 2DLXA 3TKRA 4IQAA 2C1YA 4O32A 1SJ6A 4GCIA 1WIKA 2GQLA 4IP1A 5HQPA 4E8HA 1K0NA 1GTUA 1LU4A 4N11A 4IELA 3D4MA 3KTLA 3LYPA 1GNEA 3ME7A 1F3AA 2HT9A 4I2UA 12GSA 1B8XA 2C4JA 2OKAA 3IDVA 2NDOA 1R7HA 1OC9A 4WR4A 2HSYA 4ZL7A 4G9HA 1AAZA 1FB6A 2LRCA 5CP1A 3ZTLA 4LL1B 4CY6A 1XZOA 3DEXA 2OE3A 1KNGA 4TR4A 4XS1A 2H1BA 1HNCA 3HY2A 3A5IA 2LEGA 4EIPA 4AJ7A 1R5AA 1M0UA 2B5EA 1MDJA 4MZCA 2B5YA 1PX6A 4LLRA 6GSUA 3E3EA 3FZ5A 1KTEA 1OYJA 2H70A 2GSRA 3DRNA 3EMPA 2QA2A 2FWGA 3GSSA 1SD9A 6GSTA 5JWOB 3QAVA 3I6AA 3ZVJA 4QL7A 4L0UA 3LW9A 4XS4B 3RDWA 3KCMA 5ELGA 3EC3A 5FT3A 2IFQB 1ZYPA 1Z7PA 2BJXA 4PNFA 2B5XA 3EU4A 3F4SA 1V58A 4MZWA 4ZB6A 4KDYA 1TK5B 3KH7A 2FHEA 3TRXA 2C8UA 1V57A 2H30A 3D4TA 1X5EA 3MWHA 1GTBA 5J4UA 5COHA 1TK8B 1ACVA 4DSQA 4MK3A 1V2AA 5E59A 4Z2UA 1S3DA 4ZILA 5J9BA 3P8WA 5ABRA 2LQQA 3M0FA 4MP4A 3GKMA 2FGXA 3TJKA 2H6YA 1XVWA 1EP7A 5KN0A 9GSSA 2HXKA 2FWEA 2H73A 4PX1A 2KLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FHI A;  1YZX A;  2GQM A;  3FK8 A;  4PQI A;  2C3N A;  2HZF A;  4POK A;  3ZML A;  3TRP A;  2LJR A;  4GTU A;  3CRU A;  4MH2 A;  2VLT A;  3D21 A;  1PKZ A;  5IPH A;  1OC3 A;  1EEJ A;  4KCA A;  3PIN A;  4WBJ A;  1GUH A;  4MA9 A;  2HSH A;  4XIH A;  5IMC A;  2WRT A;  3ZVJ D;  4L5L A;  2H75 A;  3GN3 A;  3A2X A;  3LWA A;  3LYK A;  5ECN B;  1GTA A;  1ZZY A;  5EY6 A;  3LSZ A;  2JSZ A;  2IIY A;  5DAK B;  1SL0 B;  3EVI A;  3KM6 A;  1Y25 A;  5D8I A;  5KN3 A;  2O8V B;  3Q18 A;  2DIY A;  2YJ7 A;  1HNB A;  2OBK A;  4F2I A;  4IW9 A;  1N8J A;  2JZT A;  2H1G A;  4N0Z A;  1O7U A;  2O7K A;  1TRU A;  3ZRD A;  4EC0 A;  1TI1 A;  4BWQ A;  2GS3 A;  3QCP A;  10GS A;  1J08 A;  2N5A A;  4TR0 A;  1WOU A;  1MDI A;  3BD2 A;  5ECL B;  4OCF A;  4EUY A;  3HA9 A;  4EDZ A;  2L5L A;  3TKP A;  4D73 B;  2VCQ A;  3SBC A;  4BA7 A;  3H93 A;  1EWX A;  3L9U A;  1G7E A;  1B9Y C;  1WMJ A;  1QUW A;  4DSS B;  19GS A;  1GSU A;  3J7Y k;  3W8S A;  5DVB A;  1DSB A;  3ZIV A;  3AY8 A;  4MPG A;  3VPT A;  5EL8 A;  4KW6 A;  2OE1 A;  3KJY A;  1VF3 A;  1URM A;  1OKT A;  1EV4 A;  2TRC P;  4K0N A;  4I6X A;  3J7Y b;  2WUL A;  3EYT A;  3ZFB A;  4V2M A;  4QQ7 A;  1K0O A;  4ECI A;  1YF0 A;  3DXB A;  2NBS A;  4KSM A;  4AF2 A;  4P3Y B;  3F6F A;  4V2L A;  13GS A;  4HJM A;  4HEA 2;  3GRX A;  4Q5F A;  4CDO A;  3FR9 A;  1SU9 A;  5CRW A;  4JU5 A;  2PPT A;  3RAZ A;  1PX7 A;  2JZR A;  1QXH A;  1UVZ A;  4BWS A;  2EC4 A;  2RLI A;  1GSQ A;  4O92 A;  5JCU A;  3KP8 A;  1K0C A;  1ZGN A;  2O87 A;  3CSI A;  1B48 A;  4IKH A;  1XPV A;  2IN3 A;  4KX4 A;  1K3Y A;  5C04 A;  3HVX A;  2AUV A;  5CRH A;  4HJ2 A;  3S9F A;  4EXJ A;  4GSS A;  4HZ4 A;  1T4Y A;  2YAN A;  2DJ1 A;  2M80 A;  1TJD A;  3TJJ A;  2CQ9 A;  3A2W A;  2GT6 A;  2C3Q A;  2AB6 A;  5IMF A;  5HFK A;  1LBK A;  22GS A;  4HOJ A;  4OMV A;  4PUA A;  1XW5 A;  1X0R A;  4E8E A;  1EGO A;  4QL9 A;  2H19 A;  4K7O A;  1BQ7 A;  3GUS A;  3MSZ A;  3H8Q A;  1NW2 A;  1NSW A;  1SD8 A;  3WT1 A;  2C0D A;  1WP0 A;  5DQY A;  3US3 A;  4IJ3 A;  2K9F A;  3GX0 A;  2QC7 A;  3RPN A;  2WDU A;  2GZZ A;  4XS4 A;  3TKQ A;  3UEM A;  3HCZ A;  2X8C A;  2IFQ A;  3F63 A;  4XRD A;  2VL3 A;  4L8E A;  2IJY A;  3HVV A;  3WGX A;  3LFL A;  3UBL A;  3LJR A;  2YN1 A;  2L6C A;  4HU7 A;  5L71 A;  3F4T A;  2F8A A;  3C73 A;  5GSS A;  4ZB8 A;  1PKW A;  4ZB9 A;  2CZ3 A;  2B1L A;  1EGR A;  3TB2 A;  2C80 A;  5D9V A;  3TUE A;  3D5J A;  1TW9 A;  1RW1 A;  3F8U A;  1M7T A;  1PN9 A;  1VF4 A;  5INY A;  3ZIT A;  1LJR A;  4OD7 A;  1HYU A;  4ISD A;  3IBH A;  3DWV A;  3KIJ A;  3IRA A;  5G30 A;  1JLW A;  2LRT A;  4H86 A;  5ECM B;  2FNO A;  5AIV A;  4HU9 A;  3HZ4 A;  2TIR A;  5HR1 A;  3CXG A;  2HRN A;  5D9W A;  2GZP A;  4NMU A;  2LNS A;  3DYR A;  5ECS A;  5DQS A;  5AIS A;  2F3M A;  2H6Z A;  1GNW A;  4K7N A;  3UBK A;  5A4W A;  2O89 A;  5ECH B;  4NHW A;  2H76 A;  3JCM L;  3FRC A;  1R4W A;  2H72 A;  3G7Y A;  3MNG A;  1DE2 A;  2LQO A;  1X9S B;  5A4U A;  4DEJ A;  3MDK A;  1MEK A;  2XPD A;  3APQ A;  2O85 A;  1FHE A;  2FA4 A;  5IO0 A;  5J5N A;  2OAC A;  5DAK A;  2FA8 A;  4IJI A;  2CT6 A;  2GT5 A;  3VWU A;  3GTU B;  1SK2 A;  2HI7 A;  3EE2 A;  5G5F A;  4KDX A;  5G31 A;  3TCO A;  4MF6 A;  4WF4 A;  4YAV A;  6GSV A;  1AQV A;  2DMM A;  3FW2 A;  3FZA A;  1TOF A;  3ZL5 A;  1T4Z A;  2IMD A;  1EV9 A;  2FY6 A;  2LST A;  3FHK A;  2PER A;  3LGC A;  1AUC A;  2YWM A;  4KCE A;  1YJ6 A;  1KEB A;  1O81 A;  1DUG A;  1OE7 A;  2KOK A;  1T1V A;  4K8M A;  2R2J A;  2L57 A;  4G10 A;  1TU8 A;  2H1A A;  2AV4 A;  4D73 A;  4OO4 A;  1NHO A;  4WF5 A;  3P90 A;  4ACS A;  1TP9 A;  2VCX A;  3TDG A;  4HQS A;  1OVN A;  2RM5 A;  2X64 A;  4LMW A;  5KEJ A;  2VM1 A;  4ULX A;  3CTG A;  5GZZ B;  2L4Q A;  2PMT A;  1M2A A;  1FOV A;  2I81 A;  2C0F A;  4TKY A;  1U3A A;  3EIN A;  2G2Q A;  1X9W B;  2GTU A;  2L4C A;  1GH2 A;  4LA1 A;  4HZ2 A;  1Y6E A;  2DSA A;  3M9J A;  2GLR A;  4NWY A;  1A8Y A;  1XWA A;  4ZBA A;  5C00 A;  5AIX A;  6GSW A;  3TKS C;  3IR4 A;  1THX A;  2A4V A;  1GLQ A;  4CHS A;  1A8L A;  3KZQ A;  4Z7X A;  2H1D A;  1JZR A;  3QFB C;  4OO5 A;  2OBI A;  2YZH A;  1XW9 A;  3BCK A;  5KN2 A;  1HD2 A;  4HDE A;  2DJ3 A;  4PXO A;  5ELA A;  2BMX A;  3ERW A;  1SKR B;  2JAD A;  4OWY A;  4X43 A;  2IPA A;  3TJG A;  1U88 A;  2H71 A;  2B3S A;  4XS6 A;  4JBB A;  5G1K A;  4L5O A;  1BED A;  3CRT A;  1XWC A;  5ID2 B;  3HJO A;  3RHC A;  1V98 A;  1XOB A;  1Z7R A;  1TI3 A;  2OE0 A;  5B8B A;  3ZMK A;  3N5O A;  2QGV A;  4GQC A;  3VWX A;  3GH6 A;  3HDC A;  1JZW A;  1J0F A;  3VFI A;  3ZLP A;  2WZ9 A;  4WR5 A;  4XHM A;  1VF2 A;  1F2E A;  2JZS A;  3GH9 A;  2JL4 A;  2VOC A;  2VAF A;  1QMV A;  2VUP A;  4IGJ A;  3KD0 A;  5DDL A;  1SK1 A;  4AJ8 A;  3ED3 A;  1GSD A;  3G7J A;  2HLS A;  1VGL A;  2I4A A;  4O7H A;  2V41 A;  4TR1 A;  1YKC A;  4PQH A;  2LV3 A;  2I9H A;  5LD0 A;  2M46 A;  4J57 E;  4FIW A;  1S3C A;  1T7P B;  1FW1 A;  2MMN A;  1WWJ A;  3KXO A;  6GSS A;  5CO3 A;  2GDR A;  4MPF A;  2C3T A;  5J9C A;  3CBU A;  5CNW A;  4KH7 A;  4YQM A;  3DD3 A;  3TJF A;  3QMX A;  1GWC A;  6GSY A;  2CVB A;  5ECQ B;  3FR3 A;  1DE1 A;  4XTS A;  1YF1 A;  2JU5 A;  1GL8 A;  1EP8 A;  4RQX A;  1PA3 A;  5IPG A;  1G6Y A;  5JWQ B;  3V1W A;  1U3I A;  4MH3 A;  1ZOF A;  3G9B A;  1FVJ A;  2WB9 A;  1JHB A;  2AJQ B;  2QKE A;  3UJ1 A;  3APS A;  3QAW A;  4TXV A;  4PQ1 A;  2GSQ A;  2CA8 A;  2LUS A;  4BPY A;  4K0G A;  3VWW A;  5E4W A;  5ECP B;  3PGT A;  1O6J A;  4OFT A;  4GSN A;  2H66 A;  3F9U A;  4GXZ A;  4F0C A;  5HR3 A;  3DML A;  2LTK A;  1YY7 A;  1XVQ A;  4V2N A;  3IC4 A;  3TRQ A;  1THO A;  2RII A;  2XC2 A;  4IHU A;  4TXO B;  4F0B A;  1YKA A;  5CRG A;  1S3A A;  1PD2 1;  5F06 A;  4MZB A;  1AXD A;  4IP6 A;  1O8X A;  2BTO T;  2KP2 A;  3FY7 A;  1FVK A;  1ZYQ B;  3GA4 A;  4K2D A;  1E2Y A;  5CAX A;  7GSS A;  4O5R A;  1JZD A;  4KE3 A;  1ERU A;  2H0I A;  4NXI A;  1HQO A;  4GF0 A;  1GSE A;  3VLN A;  5F8B A;  1GLP A;  3EUR A;  4GLT A;  3GYK A;  1XWB A;  3WGE A;  1QGV A;  2RUE A;  2WJU A;  4NPB A;  4ZL8 A;  2DJ0 A;  4JRR A;  4MLY A;  1F9M A;  1ERW A;  2WFC A;  1A23 A;  4KDU A;  1PL1 A;  2DIZ A;  4MJB A;  3L78 A;  3VK9 A;  1GP1 A;  2GST A;  2VLU A;  5ECI B;  2V6O A;  3E0U A;  3M9K A;  4NAX A;  2D2Z A;  3IPZ A;  1I9D A;  2IMF A;  1A2L A;  5KN1 A;  2YJH A;  4I97 A;  3TOT A;  1F6M C;  5H5Q A;  5F07 A;  5HFI A;  3KEB A;  3TKS A;  3BOA A;  4KGI A;  2HZE B;  3RPP A;  1B4Q A;  2VD0 A;  2VCT A;  1GTI A;  2AAW A;  1YEX A;  3C7M A;  1AW9 A;  2QSI A;  4K6X A;  1XWK A;  3UAP A;  4NV2 A;  1U6T A;  4WXT A;  5B7C A;  5D9T A;  3D6I A;  3KTB A;  3NOF A;  5CYY A;  2G0F A;  4TVE A;  1XXU A;  2X99 A;  2JSY A;  2CVK A;  1AC1 A;  2EIO A;  1BG5 A;  4POB A;  4MMM A;  2LRN A;  4I2T A;  1VRS D;  4KB3 A;  5ID2 A;  2ALB A;  1PMT A;  5DJM A;  1IYI A;  4LMV A;  1FO5 A;  2A2S A;  1X9M B;  4OFN A;  1V9W A;  2GQK A;  1GUM A;  2VIM A;  4NV5 A;  1A0R P;  2WGR A;  4KND A;  3IV4 A;  3IK9 A;  2MYG A;  3BJ5 A;  3K8N A;  1TK0 B;  2DJK A;  3QFA C;  4ZL9 A;  1E6B A;  2PU9 C;  3KGK A;  3O3T A;  3WT2 A;  3QOU A;  1K3O A;  5F0G A;  1RK4 A;  2HNL A;  3UOM A;  4TR3 A;  4K1F A;  4POM A;  2XBQ A;  2RUF A;  2FWH A;  3LEF A;  3O6T A;  2GGT A;  3APO A;  3IAS 2;  4X1U A;  2XBI A;  4J2F A;  4GRF A;  2R5G A;  5LCZ A;  3WYW A;  4F82 A;  3QDN A;  2IMK A;  2F8F A;  3GKX A;  1W4V A;  5CRD A;  2PVQ A;  1O73 A;  5IOX A;  2MBT A;  4KA0 A;  2FUG 2;  4ZIJ A;  2B1K A;  1MD4 A;  1FB0 A;  1BYE A;  2ON7 A;  4F03 A;  3C71 A;  2TRX A;  2X8H A;  3UMA A;  3LXZ A;  3W8J A;  1X5D A;  1SL2 B;  2FCH A;  4Q5R A;  2X8G A;  1ML6 A;  3L9V A;  3ZFL A;  3NZN A;  4Q5N A;  3HXS A;  1H75 A;  14GS A;  8GSS A;  3EMX A;  2HFD A;  4IN0 A;  1UC7 A;  4EDY A;  4V1A p;  2DJ2 A;  4WEY A;  4PNG A;  3MAK A;  2H01 A;  1CQH A;  4ID0 A;  1USB A;  3ZYW A;  4RI6 A;  2B7J A;  4XRA A;  3CTF A;  1Z5Y E;  4RI7 A;  1C72 A;  3ERG A;  1ZL9 A;  1XCC A;  2J9H A;  3ZZX A;  1V40 A;  2I3Y A;  3LQ7 A;  2HRF A;  5CRE A;  18GS A;  4YH2 A;  1XFL A;  1ILO A;  1SYR A;  3IXR A;  1R5P A;  1T00 A;  3EWL A;  3BCI A;  2MMO A;  5EVO A;  4EVM A;  3FZ4 A;  5AN1 A;  2NVL A;  4N10 A;  4MF7 A;  3W6G A;  3VWV A;  4DSS A;  1A24 A;  4IVF A;  4N0V A;  1JFU A;  2Z9S A;  4AGS A;  5A4V A;  3KMN A;  3A3T A;  4ECC A;  5D9X A;  2M72 A;  5GAN D;  3Q19 A;  3IA1 A;  2ZCT A;  3F3Q A;  1TKD B;  3F4R A;  5D93 A;  3LG6 A;  4KUN A;  1SL1 B;  1K0A A;  1GUL A;  4N30 A;  3I43 A;  5ECK B;  4G19 A;  3M1G A;  1GUK A;  1Z6M A;  3UVH A;  5B6M A;  5J41 A;  3QPM A;  4RUV A;  2HE3 A;  1EOH A;  4PGT A;  2HZE A;  3Q6O A;  3ME8 A;  3P7X A;  2YWI A;  2CVD A;  4J56 E;  2MBS A;  2N5B A;  3LOR A;  3NIV A;  5D96 A;  1TRV A;  2E2M A;  3CMI A;  3QAG A;  2KHP A;  3H1N A;  1G0T A;  5HR0 A;  3RHB A;  1M9B A;  4YQV A;  4ZBD A;  4MAB A;  5ECO B;  2REM A;  4WET A;  4K9Z A;  1WJK A;  2F51 A;  2VO4 A;  4FH8 A;  2A2R A;  4JZQ A;  4DSR A;  3CSJ A;  1AQW A;  3IAM 2;  3GX8 A;  2H74 A;  1X5C A;  2YPM A;  5IM9 A;  1BJX A;  3TKS E;  2NTO A;  2V32 A;  4POL A;  5IO2 A;  5J3R A;  5IIZ A;  3GHA A;  4DVC A;  3IK7 A;  2CAQ A;  2KUC A;  3HHV A;  4EKZ A;  1QFN A;  1VF1 A;  20GS A;  4IBP A;  2OA7 A;  3HKR A;  2DJJ A;  2OJL A;  3H79 A;  2E7P A;  2P5Q A;  1B9X C;  1BX9 A;  2YNX A;  5EPF A;  2LJK A;  3PH9 A;  2B7K A;  4MJC A;  2FD3 A;  3I9V 2;  1QK8 A;  5HFG A;  2HYX A;  4ZXG A;  2H6X A;  2VL2 C;  3F3R A;  4L0W A;  3F6D A;  4JR6 A;  3KH9 A;  3FZ9 A;  3DVX A;  17GS A;  4EF0 A;  1AIU A;  5IMA A;  4RQR A;  1W89 A;  1B4P A;  3CYN A;  4MF5 A;  3TGZ A;  2R37 A;  4YAP A;  2ES7 A;  1IYH A;  3FR6 A;  4KSO A;  4PUF C;  4BL7 A;  1OKD A;  2P5R A;  4MJA A;  5AGY A;  1HNA A;  4ECB A;  2N5F A;  3R2Q A;  2ZNM A;  1SKS B;  3FEU A;  1YQ1 A;  3L4N A;  3C1R A;  2MZC A;  2EIR A;  3F0I A;  3E9J B;  3GUR A;  1FG4 A;  3LXT A;  2B6M A;  3VI5 A;  4TN8 A;  4ML1 A;  1XIY A;  3UVT A;  2F9S A;  1WE0 A;  3L9S A;  3IOS A;  1ON4 A;  5F05 A;  3SWL A;  2AYT A;  1OAZ A;  2RM6 A;  1FAA A;  1SJI A;  2VCW A;  3HJP A;  1R26 A;  3M3M A;  2DBC A;  4TRX A;  2MMA A;  3UL3 A;  1H4O A;  2WS2 A;  2V2G A;  2PVO C;  5B8A A;  5IMV A;  1AQX A;  4V1A g;  4GST A;  1YEP A;  16GS A;  4MJE A;  3KP9 A;  2VLV A;  3IE3 A;  1ZMA A;  2GVP A;  2KP1 A;  4FYC A;  3GTU A;  4JED A;  1MDK A;  3L0H A;  4KAE A;  2PWJ A;  1TTZ A;  6GSX A;  5DAL B;  1TRS A;  1EOG A;  1G7O A;  3ZIJ A;  2R6K A;  3UAR A;  4BVY A;  4Q5Q A;  2YV9 A;  2K18 A;  5LNK e;  5DCG A;  5ENU A;  3WGD A;  2VD1 A;  1EZK A;  1F37 A;  2CZ2 A;  2FWF A;  2PBJ A;  1OC8 A;  3HZ8 A;  1MD3 A;  1RQM A;  4EL1 A;  4LL4 B;  2LKU A;  3ISO A;  4TW5 A;  1ERV A;  1OE8 A;  2CX4 A;  5IMZ A;  1O85 A;  2C0E A;  5JWR B;  2P31 A;  2L5O A;  4G2E A;  2H0H A;  3GIX A;  3N9J A;  2IME A;  3RBT A;  5B6N A;  3U6V A;  2K6V A;  2YCD A;  3I69 A;  4TOP A;  1PSQ A;  1GRX A;  1TXX A;  3D0Z A;  3M8N A;  4X0X A;  1GSY A;  3HYP A;  3GMF A;  1OC9 B;  2DML A;  1NHY A;  2YZU A;  2C0G A;  4EE0 A;  1BAY A;  5DBQ A;  5G2Z A;  2XPE A;  1K0M A;  2AHE A;  1PGT A;  4MDC A;  2L6D A;  3ERF A;  2YWO A;  1YDK A;  4XCS A;  3OR5 A;  3A2V A;  3H4K A;  5H5R A;  2EIQ A;  3HVS A;  2GZY A;  3GST A;  3A5W A;  2IMI A;  3D22 A;  4AJ6 A;  2V6K A;  3ZRE A;  2YOI A;  3VPQ A;  4EO3 A;  5G1L A;  1A2M A;  1Q98 A;  1TDI A;  1N2A A;  4GWR A;  2YV7 A;  1SKW B;  3UIW A;  1UA5 A;  4HQZ A;  4WBR D;  3DGQ A;  2IL3 A;  1ZCP A;  1QQ2 A;  1UN2 A;  5GST A;  1M9A A;  2CX3 A;  1NM3 A;  1ST9 A;  2P0G A;  2I1U A;  4IQ1 A;  1Z9H A;  2ZUP A;  1WRY A;  3FKF A;  1ZYE A;  4WKW A;  3VI7 A;  2WCI A;  4TR1 B;  3GL5 A;  3GKK A;  2K8S A;  3DKS A;  3P2A A;  3Q74 A;  3KMO A;  3GNJ A;  1TU7 A;  5JCG A;  4HI7 A;  2PGT A;  3FYG A;  2VCZ A;  1Z3E A;  3DVW A;  1SK0 A;  2NPB A;  4K7I A;  1F3B A;  2PUK C;  2YWN A;  1EEM A;  1CQG A;  2VL2 A;  5IMD A;  3U5R E;  2GSS A;  1ERT A;  1J9B A;  1A0F A;  2LNT A;  2JAC A;  4I8B A;  2H0G A;  3VUR A;  5D73 A;  1M2B A;  2H8L A;  3QR6 A;  5DJL A;  1TRW A;  1ABA A;  1G6W A;  1PL2 A;  3TOU A;  4NHZ A;  3WD6 A;  4FYB A;  4CW9 A;  4I5Q A;  2MMZ A;  2VM2 A;  4JE1 A;  3TJB A;  4ECJ A;  3C1S A;  2E0Q A;  1Z6N A;  3QD9 A;  1GSF A;  1T8E B;  1WPI A;  2FLS A;  3PR8 A;  1K0D A;  3GV1 A;  1A2J A;  2ON5 A;  4HUA A;  3BBY A;  1XBS A;  2K8V A;  5ECR B;  1XW6 A;  1PQN A;  1XWG A;  2LS5 A;  2CAI A;  4ML6 A;  2YP6 A;  3CSH A;  2R3X A;  3G7I A;  3HD5 A;  4F9Z A;  3C8E A;  1PRX A;  4IS0 A;  5IQY A;  1DBY A;  1KBN A;  1M99 A;  5DCH A;  3HJM A;  1I5G A;  2OAD A;  1K0B A;  5G5E A;  4JR4 A;  2CV4 A;  4ILF A;  2R4V A;  2XHF A;  2E2G A;  1O8W A;  1M2D A;  4BVX A;  4PUR A;  4OFM A;  4TXO A;  2DC5 A;  1XOA A;  1MTC A;  5HR2 A;  5IOW A;  1JLV A;  4ZBB A;  11GS A;  3O76 A;  4FYU A;  3GL3 A;  2LJA A;  2L59 A;  1SEN A;  3IHQ A;  5GAP D;  5FWG A;  4MCU A;  2VCV A;  1T3B A;  2VL9 A;  1Q4J A;  4FO5 A;  4HS1 A;  3EU3 A;  1U87 A;  5A5K A;  5DAL A;  3GKN A;  1K3L A;  1GSS A;  1SJZ A;  2J23 A;  1JZO A;  2V1M A;  5JCW A;  3GFK A;  3DIE A;  4GQF A;  4OCE A;  5H5S A;  1SYX A;  4YQU A;  2PN8 A;  2IWT A;  2DLX A;  3TKR A;  4IQA A;  2C1Y A;  4O32 A;  1SJ6 A;  4GCI A;  1WIK A;  2GQL A;  4IP1 A;  5HQP A;  4E8H A;  1K0N A;  1GTU A;  1LU4 A;  4N11 A;  4IEL A;  3D4M A;  3KTL A;  3LYP A;  1GNE A;  3ME7 A;  1F3A A;  2HT9 A;  4I2U A;  12GS A;  1B8X A;  2C4J A;  2OKA A;  3IDV A;  2NDO A;  1R7H A;  1OC9 A;  4WR4 A;  2HSY A;  4ZL7 A;  4G9H A;  1AAZ A;  1FB6 A;  2LRC A;  5CP1 A;  3ZTL A;  4LL1 B;  1XZO A;  3DEX A;  2OE3 A;  1KNG A;  4TR4 A;  4XS1 A;  2H1B A;  1HNC A;  3HY2 A;  2LEG A;  4AJ7 A;  1R5A A;  1M0U A;  2B5E A;  1MDJ A;  4MZC A;  2B5Y A;  1PX6 A;  4LLR A;  6GSU A;  3E3E A;  3FZ5 A;  1KTE A;  1OYJ A;  2H70 A;  2GSR A;  3DRN A;  3EMP A;  2FWG A;  3GSS A;  1SD9 A;  6GST A;  5JWO B;  3QAV A;  3I6A A;  3ZVJ A;  4QL7 A;  4L0U A;  4XS4 B;  3RDW A;  3KCM A;  5ELG A;  3EC3 A;  5FT3 A;  2IFQ B;  1Z7P A;  2BJX A;  4PNF A;  2B5X A;  3EU4 A;  3F4S A;  1V58 A;  4MZW A;  4ZB6 A;  4KDY A;  1TK5 B;  3KH7 A;  2FHE A;  3TRX A;  2C8U A;  1V57 A;  2H30 A;  3D4T A;  1X5E A;  3MWH A;  1GTB A;  5J4U A;  5COH A;  1TK8 B;  1ACV A;  4DSQ A;  4MK3 A;  1V2A A;  5E59 A;  1S3D A;  4ZIL A;  5J9B A;  3P8W A;  5ABR A;  2LQQ A;  3M0F A;  4MP4 A;  3GKM A;  2FGX A;  3TJK A;  2H6Y A;  1XVW A;  1EP7 A;  5KN0 A;  9GSS A;  2HXK A;  2FWE A;  2H73 A;  4PX1 A;  2KLX A; 
#chains in the Genus database with same CATH topology
 5FHI A;  1YZX A;  2GQM A;  3FK8 A;  4PQI A;  2C3N A;  2HZF A;  4POK A;  3ZML A;  3TRP A;  2LJR A;  4GTU A;  3CRU A;  4MH2 A;  2VLT A;  3D21 A;  1PKZ A;  5IPH A;  1OC3 A;  1EEJ A;  4KCA A;  3PIN A;  4WBJ A;  1GUH A;  4MA9 A;  2HSH A;  4XIH A;  5IMC A;  2WRT A;  3ZVJ D;  4L5L A;  2H75 A;  3GN3 A;  3A2X A;  3LWA A;  3LYK A;  5ECN B;  1GTA A;  1ZZY A;  5EY6 A;  3LSZ A;  2JSZ A;  2IIY A;  5DAK B;  1SL0 B;  3EVI A;  3KM6 A;  2R0P A;  1Y25 A;  5D8I A;  5KN3 A;  2O8V B;  3Q18 A;  2DIY A;  2YJ7 A;  1HNB A;  2OBK A;  4F2I A;  4IW9 A;  1N8J A;  4Z2R A;  2JZT A;  2HRA A;  2H1G A;  4N0Z A;  1M3I A;  1O7U A;  2O7K A;  1TRU A;  3ZRD A;  4EC0 A;  1TI1 A;  4BWQ A;  2GS3 A;  3QCP A;  10GS A;  1J08 A;  2N5A A;  4TR0 A;  1WOU A;  1MDI A;  3BD2 A;  5ECL B;  4OCF A;  4EUY A;  3HA9 A;  4EDZ A;  2L5L A;  3TKP A;  4D73 B;  2VCQ A;  3SBC A;  4BA7 A;  3H93 A;  1EWX A;  3L9U A;  1G7E A;  1B9Y C;  1WMJ A;  1QUW A;  4DSS B;  19GS A;  1GSU A;  3J7Y k;  3W8S A;  5DVB A;  1DSB A;  3ZIV A;  3AY8 A;  4MPG A;  3VPT A;  5EL8 A;  4KW6 A;  2OE1 A;  3KJY A;  1VF3 A;  1URM A;  1OKT A;  1EV4 A;  2TRC P;  4K0N A;  4I6X A;  3J7Y b;  2WUL A;  4CY8 A;  3EYT A;  3ZFB A;  4V2M A;  4QQ7 A;  1K0O A;  4ECI A;  1YF0 A;  5BMU A;  3DXB A;  4G0L A;  2NBS A;  4KSM A;  4AF2 A;  4P3Y B;  3F6F A;  4V2L A;  13GS A;  4HJM A;  4HEA 2;  3GRX A;  4Q5F A;  4CDO A;  3FR9 A;  1SU9 A;  5CRW A;  4JU5 A;  2PPT A;  3RAZ A;  1PX7 A;  2JZR A;  1QXH A;  1UVZ A;  4BWS A;  2EC4 A;  2RLI A;  1GSQ A;  4O92 A;  5JCU A;  3KP8 A;  1K0C A;  1ZGN A;  2O87 A;  3CSI A;  1B48 A;  4IKH A;  1XPV A;  2IN3 A;  4KX4 A;  1K3Y A;  5C04 A;  3HVX A;  2AUV A;  5CRH A;  4HJ2 A;  3S9F A;  4EXJ A;  4GSS A;  4HZ4 A;  1T4Y A;  2YAN A;  2DJ1 A;  2M80 A;  1TJD A;  3TJJ A;  2CQ9 A;  3A2W A;  2GT6 A;  2C3Q A;  3MYD A;  2AB6 A;  5IMF A;  5HFK A;  1LBK A;  22GS A;  4HOJ A;  4OMV A;  4PUA A;  1XW5 A;  1X0R A;  4E8E A;  1EGO A;  4QL9 A;  2H19 A;  4K7O A;  1BQ7 A;  3GUS A;  3MSZ A;  3CQF A;  3H8Q A;  1NW2 A;  1NSW A;  1SD8 A;  3WT1 A;  2C0D A;  1WP0 A;  5DQY A;  3US3 A;  4IJ3 A;  2K9F A;  3GX0 A;  2QC7 A;  3RPN A;  2WDU A;  2GZZ A;  4XS4 A;  3TKQ A;  3UEM A;  3HCZ A;  2X8C A;  2IFQ A;  3F63 A;  4XRD A;  2VL3 A;  4L8E A;  2IJY A;  3HVV A;  3WGX A;  3LFL A;  3UBL A;  3LJR A;  2YN1 A;  2L6C A;  4HU7 A;  5L71 A;  3F4T A;  1ZYN A;  2F8A A;  3C73 A;  5GSS A;  4ZB8 A;  1PKW A;  4ZB9 A;  2CZ3 A;  2B1L A;  1EGR A;  3TB2 A;  2C80 A;  5D9V A;  3TUE A;  3D5J A;  1TW9 A;  1RW1 A;  3F8U A;  1M7T A;  1PN9 A;  1VF4 A;  5INY A;  3ZIT A;  1LJR A;  4OD7 A;  3PPU A;  1HYU A;  4ISD A;  3IBH A;  3DWV A;  3KIJ A;  4K5R A;  3IRA A;  5G30 A;  1JLW A;  2LRT A;  4H86 A;  5ECM B;  2FNO A;  5AIV A;  4HU9 A;  3HZ4 A;  2TIR A;  5HR1 A;  3CXG A;  2HRN A;  5D9W A;  2GZP A;  4NMU A;  2LNS A;  3DYR A;  5DQS A;  5ECS A;  5AIS A;  2F3M A;  4Z2T A;  2H6Z A;  1GNW A;  4K7N A;  3UBK A;  5A4W A;  2O89 A;  5ECH B;  2R0G A;  4NHW A;  2H76 A;  3JCM L;  3FRC A;  1R4W A;  2H72 A;  3G7Y A;  3MNG A;  4YKG A;  1DE2 A;  2LQO A;  1X9S B;  5A4U A;  4DEJ A;  3MDK A;  1MEK A;  2XPD A;  3APQ A;  2O85 A;  1FHE A;  2FA4 A;  5IO0 A;  5J5N A;  2OAC A;  5DAK A;  2FA8 A;  4IJI A;  2CT6 A;  2GT5 A;  3VWU A;  3GTU B;  1SK2 A;  2HI7 A;  3EE2 A;  5G5F A;  4KDX A;  5G31 A;  3TCO A;  4MF6 A;  4WF4 A;  4YAV A;  6GSV A;  1AQV A;  2DMM A;  3FW2 A;  3FZA A;  1TOF A;  3ZL5 A;  1T4Z A;  2IMD A;  3IHG A;  1EV9 A;  2FY6 A;  2LST A;  3FHK A;  2PER A;  3LGC A;  1AUC A;  2YWM A;  4KCE A;  1YJ6 A;  1KEB A;  1O81 A;  1DUG A;  1OE7 A;  2KOK A;  1T1V A;  4K8M A;  2R2J A;  2L57 A;  4G10 A;  2UZ8 A;  1TU8 A;  2H1A A;  2AV4 A;  4D73 A;  4OO4 A;  1NHO A;  4WF5 A;  3P90 A;  4ACS A;  1TP9 A;  2VCX A;  3TDG A;  4HQS A;  1OVN A;  2RM5 A;  2X64 A;  4LMW A;  5KEJ A;  2VM1 A;  4ULX A;  3CTG A;  5GZZ B;  2L4Q A;  2PMT A;  1M2A A;  1FOV A;  2I81 A;  2C0F A;  4TKY A;  1U3A A;  3EIN A;  2G2Q A;  1X9W B;  2GTU A;  2HSM A;  2L4C A;  1GH2 A;  4LA1 A;  4HZ2 A;  1Y6E A;  2DSA A;  3M9J A;  4O5Q A;  2GLR A;  4NWY A;  1A8Y A;  1XWA A;  4ZBA A;  5C00 A;  5AIX A;  6GSW A;  3TKS C;  3IR4 A;  1THX A;  2A4V A;  1GLQ A;  4CHS A;  1A8L A;  3KZQ A;  4Z7X A;  2H1D A;  1JZR A;  2DKI A;  3QFB C;  4OO5 A;  2OBI A;  2YZH A;  1XW9 A;  3BCK A;  5KN2 A;  1HD2 A;  4HDE A;  2DJ3 A;  4PXO A;  5ELA A;  2BMX A;  3ERW A;  1SKR B;  2JAD A;  4OWY A;  4X43 A;  2IPA A;  3TJG A;  1U88 A;  2H71 A;  2B3S A;  4XS6 A;  4JBB A;  5G1K A;  4L5O A;  1BED A;  3CRT A;  1XWC A;  5ID2 B;  3HJO A;  3RHC A;  1V98 A;  1XOB A;  1Z7R A;  1TI3 A;  2OE0 A;  5B8B A;  3ZMK A;  3N5O A;  2QGV A;  4GQC A;  3VWX A;  3GH6 A;  3HDC A;  1JZW A;  1J0F A;  3VFI A;  3ZLP A;  2WZ9 A;  4WR5 A;  4XHM A;  1VF2 A;  1F2E A;  2JZS A;  3GH9 A;  2JL4 A;  2VOC A;  2VAF A;  1QMV A;  2VUP A;  4IGJ A;  3KD0 A;  5DDL A;  1SK1 A;  4AJ8 A;  3ED3 A;  1GSD A;  3G7J A;  2HLS A;  1VGL A;  2I4A A;  4O7H A;  2V41 A;  4TR1 A;  1YKC A;  4PQH A;  2LV3 A;  2I9H A;  5LD0 A;  2M46 A;  4J57 E;  4FIW A;  1S3C A;  1T7P B;  1FW1 A;  2MMN A;  1WWJ A;  3KXO A;  2R0C A;  6GSS A;  5CO3 A;  2GDR A;  4BIK A;  4MPF A;  2C3T A;  5J9C A;  3CBU A;  5CNW A;  4KH7 A;  4YQM A;  3DD3 A;  3TJF A;  3QMX A;  1GWC A;  6GSY A;  2CVB A;  5ECQ B;  3FR3 A;  1DE1 A;  4XTS A;  1YF1 A;  2JU5 A;  1GL8 A;  1EP8 A;  4RQX A;  1PA3 A;  5IPG A;  1G6Y A;  5JWQ B;  3V1W A;  1U3I A;  4MH3 A;  1ZOF A;  3G9B A;  1FVJ A;  2WB9 A;  4FQU A;  1JHB A;  2AJQ B;  2QKE A;  3UJ1 A;  3APS A;  3QAW A;  4TXV A;  4PQ1 A;  2GSQ A;  2CA8 A;  3MIX A;  2LUS A;  4BPY A;  4K0G A;  3VWW A;  5E4W A;  5ECP B;  3PGT A;  1O6J A;  4OFT A;  4GSN A;  2H66 A;  3F9U A;  4GXZ A;  4F0C A;  5HR3 A;  3DML A;  2LTK A;  4BVX B;  1YY7 A;  1XVQ A;  4V2N A;  3IC4 A;  3TRQ A;  1THO A;  2RII A;  2XC2 A;  4IHU A;  4TXO B;  4F0B A;  1YKA A;  5CRG A;  1S3A A;  1PD2 1;  5F06 A;  4MZB A;  1AXD A;  4IP6 A;  1O8X A;  2BTO T;  4K5S A;  2KP2 A;  3FY7 A;  1FVK A;  1ZYQ B;  3GA4 A;  4K2D A;  1E2Y A;  5CAX A;  7GSS A;  4O5R A;  1JZD A;  4KE3 A;  4G0I A;  1ERU A;  4HSC X;  2A2P A;  2H0I A;  4NXI A;  1HQO A;  4GF0 A;  1GSE A;  2A4H A;  3VLN A;  5F8B A;  1GLP A;  3EUR A;  4GLT A;  3GYK A;  1XWB A;  3WGE A;  1QGV A;  2RUE A;  2WJU A;  4NPB A;  4ZL8 A;  2DJ0 A;  4JRR A;  4MLY A;  1F9M A;  1ERW A;  2WFC A;  1A23 A;  4KDU A;  1PL1 A;  2DIZ A;  4MJB A;  3L78 A;  3VK9 A;  1GP1 A;  2GST A;  2VLU A;  5ECI B;  5BRT A;  2V6O A;  3E0U A;  3M9K A;  4NAX A;  2D2Z A;  3IPZ A;  1I9D A;  2IMF A;  1A2L A;  5KN1 A;  2YJH A;  4I97 A;  3TOT A;  1F6M C;  5H5Q A;  5F07 A;  5HFI A;  2X49 A;  3KEB A;  3TKS A;  3BOA A;  4KGI A;  2HZE B;  3RPP A;  1B4Q A;  2VD0 A;  2VCT A;  1GTI A;  2AAW A;  1YEX A;  3C7M A;  1AW9 A;  2QSI A;  4K6X A;  1XWK A;  3UAP A;  4NV2 A;  1U6T A;  4WXT A;  5B7C A;  5D9T A;  3D6I A;  3KTB A;  3NOF A;  5CYY A;  4USS A;  2G0F A;  4TVE A;  4EIQ A;  1XXU A;  2X99 A;  2JSY A;  2CVK A;  1AC1 A;  2EIO A;  1BG5 A;  4POB A;  4MMM A;  2LRN A;  4I2T A;  1VRS D;  4KB3 A;  5ID2 A;  2ALB A;  1PMT A;  5DJM A;  1FOH A;  1IYI A;  4LMV A;  1FO5 A;  2A2S A;  1X9M B;  4OFN A;  1V9W A;  2GQK A;  1GUM A;  2VIM A;  4NV5 A;  1A0R P;  2WGR A;  4KND A;  3IV4 A;  3IK9 A;  2MYG A;  3BJ5 A;  3K8N A;  1TK0 B;  2DJK A;  3QFA C;  4ZL9 A;  1E6B A;  2PU9 C;  3KGK A;  3O3T A;  3WT2 A;  3QOU A;  1K3O A;  5F0G A;  1RK4 A;  2HNL A;  3UOM A;  4TR3 A;  4K1F A;  4POM A;  2XBQ A;  2RUF A;  2FWH A;  3LEF A;  3O6T A;  2GGT A;  3APO A;  3IAS 2;  4X1U A;  2XBI A;  4J2F A;  4GRF A;  4BL7 B;  2R5G A;  2QA1 A;  5LCZ A;  3WYW A;  4F82 A;  3QDN A;  2IMK A;  2F8F A;  3GKX A;  1W4V A;  5CRD A;  2PVQ A;  1O73 A;  5IOX A;  2MBT A;  4KA0 A;  2FUG 2;  4ZIJ A;  2B1K A;  1MD4 A;  1FB0 A;  1BYE A;  2ON7 A;  4F03 A;  3C71 A;  2TRX A;  2X8H A;  3UMA A;  3LXZ A;  3W8J A;  1X5D A;  1SL2 B;  2FCH A;  4Q5R A;  2X8G A;  1ML6 A;  3L9V A;  3ZFL A;  3NZN A;  4ICY A;  4Q5N A;  3HXS A;  1H75 A;  1S3R A;  8GSS A;  3EMX A;  2HFD A;  4IN0 A;  1UC7 A;  14GS A;  4EDY A;  4V1A p;  2DJ2 A;  4WEY A;  4PNG A;  3MAK A;  2H01 A;  1CQH A;  4ID0 A;  1USB A;  3ZYW A;  4RI6 A;  2B7J A;  4XRA A;  3CTF A;  1Z5Y E;  4RI7 A;  3FMW A;  1C72 A;  3ERG A;  1ZL9 A;  1XCC A;  2J9H A;  3ZZX A;  1V40 A;  2I3Y A;  3LQ7 A;  2HRF A;  5CRE A;  18GS A;  4BVY B;  4YH2 A;  1XFL A;  1ILO A;  1SYR A;  3IXR A;  1R5P A;  1T00 A;  3EWL A;  3BCI A;  2MMO A;  5EVO A;  4EVM A;  3FZ4 A;  5AN1 A;  2NVL A;  4N10 A;  4MF7 A;  3W6G A;  3VWV A;  4DSS A;  1A24 A;  4IVF A;  4N0V A;  1JFU A;  2Z9S A;  4AGS A;  5A4V A;  3KMN A;  3A3T A;  4ECC A;  5D9X A;  2M72 A;  5GAN D;  3Q19 A;  3IA1 A;  2ZCT A;  3F3Q A;  1TKD B;  3F4R A;  4KF9 A;  5D93 A;  3LG6 A;  4KUN A;  1SL1 B;  1K0A A;  1GUL A;  4N30 A;  3I43 A;  5KOX A;  5ECK B;  4G19 A;  3M1G A;  4YKF A;  1GUK A;  1Z6M A;  3UVH A;  5B6M A;  2X4A A;  5J41 A;  3EPT A;  3QPM A;  4RUV A;  2HE3 A;  1EOH A;  4PGT A;  2HZE A;  3Q6O A;  3ME8 A;  3P7X A;  2YWI A;  2CVD A;  4J56 E;  2MBS A;  2N5B A;  3LOR A;  3NIV A;  5D96 A;  1TRV A;  2E2M A;  3CMI A;  3QAG A;  2KHP A;  3H1N A;  1G0T A;  5HR0 A;  3RHB A;  1M9B A;  4YQV A;  4ZBD A;  4MAB A;  5ECO B;  2REM A;  4WET A;  4K9Z A;  1WJK A;  2F51 A;  2VO4 A;  4FH8 A;  2A2R A;  4JZQ A;  4DSR A;  3CSJ A;  1AQW A;  3IAM 2;  3GX8 A;  2H74 A;  1X5C A;  2YPM A;  5IM9 A;  1BJX A;  3TKS E;  2NTO A;  2V32 A;  4POL A;  5IO2 A;  5J3R A;  5IIZ A;  3GHA A;  4DVC A;  3IK7 A;  2CAQ A;  2KUC A;  3HHV A;  4EKZ A;  1QFN A;  1VF1 A;  20GS A;  4IBP A;  2OA7 A;  3HKR A;  2DJJ A;  2OJL A;  3H79 A;  2E7P A;  2P5Q A;  1B9X C;  1BX9 A;  2YNX A;  5EPF A;  2LJK A;  3PH9 A;  2B7K A;  4MJC A;  2FD3 A;  3I9V 2;  1QK8 A;  5HFG A;  2HYX A;  4ZXG A;  2H6X A;  2VL2 C;  3F3R A;  4L0W A;  3F6D A;  4JR6 A;  2DKH A;  3KH9 A;  3FZ9 A;  3DVX A;  17GS A;  4EF0 A;  1AIU A;  5IMA A;  4RQR A;  1W89 A;  1B4P A;  3CYN A;  4MF5 A;  1M3J A;  3TGZ A;  2R37 A;  4YAP A;  2ES7 A;  1IYH A;  3FR6 A;  4KSO A;  4PUF C;  4BL7 A;  1OKD A;  2P5R A;  4MJA A;  5AGY A;  1HNA A;  4ECB A;  2N5F A;  4MNN A;  3R2Q A;  2ZNM A;  1SKS B;  3FEU A;  1YQ1 A;  3L4N A;  3C1R A;  2MZC A;  2EIR A;  3F0I A;  3E9J B;  3GUR A;  1FG4 A;  3LXT A;  2B6M A;  3VI5 A;  4TN8 A;  4ML1 A;  1XIY A;  3UVT A;  2F9S A;  1WE0 A;  3L9S A;  3IOS A;  1ON4 A;  5F05 A;  4K2X A;  3SWL A;  2AYT A;  1OAZ A;  2RM6 A;  1FAA A;  1SJI A;  2VCW A;  3HJP A;  1R26 A;  3M3M A;  2DBC A;  4TRX A;  2MMA A;  3UL3 A;  1H4O A;  2WS2 A;  2V2G A;  2PVO C;  5B8A A;  5IMV A;  1AQX A;  4V1A g;  4GST A;  1YEP A;  16GS A;  4MJE A;  3KP9 A;  2VLV A;  3IE3 A;  1ZMA A;  2GVP A;  2KP1 A;  4FYC A;  3GTU A;  4JED A;  1MDK A;  3L0H A;  4KAE A;  2PWJ A;  1TTZ A;  6GSX A;  5DAL B;  1TRS A;  1EOG A;  1G7O A;  3ZIJ A;  2R6K A;  3UAR A;  4BVY A;  4Q5Q A;  2YV9 A;  2K18 A;  4O5U A;  5LNK e;  5DCG A;  5ENU A;  3WGD A;  2VD1 A;  1EZK A;  1F37 A;  2CZ2 A;  2FWF A;  2PBJ A;  1OC8 A;  3HZ8 A;  1MD3 A;  1RQM A;  4EL1 A;  4LL4 B;  2LKU A;  3ISO A;  4TW5 A;  1ERV A;  1OE8 A;  2CX4 A;  5IMZ A;  1O85 A;  2C0E A;  5JWR B;  2P31 A;  2L5O A;  4G2E A;  2H0H A;  3GIX A;  3N9J A;  2IME A;  3RBT A;  5B6N A;  3U6V A;  2K6V A;  2YCD A;  3I69 A;  4TOP A;  1PSQ A;  1GRX A;  1TXX A;  3D0Z A;  3M8N A;  4X0X A;  1GSY A;  3HYP A;  3GMF A;  1OC9 B;  2DML A;  1NHY A;  2YZU A;  2C0G A;  4EE0 A;  1BAY A;  5DBQ A;  5G2Z A;  2XPE A;  1K0M A;  2AHE A;  1PGT A;  4MDC A;  2L6D A;  3ERF A;  2YWO A;  1YDK A;  4XCS A;  3OR5 A;  3A2V A;  3H4K A;  5H5R A;  2EIQ A;  3HVS A;  2GZY A;  3GST A;  3A5W A;  2IMI A;  3D22 A;  4AJ6 A;  4PTS A;  2V6K A;  3ZRE A;  2YOI A;  3VPQ A;  4EO3 A;  5G1L A;  1A2M A;  1Q98 A;  1TDI A;  1N2A A;  3IC8 A;  4GWR A;  2YV7 A;  1SKW B;  3UIW A;  1UA5 A;  4HQZ A;  4WBR D;  4X4J A;  3DGQ A;  2IL3 A;  3R3E A;  1ZCP A;  1QQ2 A;  1UN2 A;  5GST A;  1M9A A;  2CX3 A;  1NM3 A;  1ST9 A;  2P0G A;  2I1U A;  4IQ1 A;  1Z9H A;  2ZUP A;  1WRY A;  3FKF A;  1ZYE A;  4WKW A;  3VI7 A;  2WCI A;  4TR1 B;  3GL5 A;  3GKK A;  2HRK A;  2K8S A;  3DKS A;  3P2A A;  3Q74 A;  3KMO A;  3GNJ A;  1TU7 A;  5JCG A;  5KOW A;  4HI7 A;  2PGT A;  3FYG A;  2VCZ A;  1Z3E A;  4G0K A;  3DVW A;  1SK0 A;  2NPB A;  4K7I A;  1F3B A;  2PUK C;  2YWN A;  1EEM A;  1CQG A;  2VL2 A;  5IMD A;  3U5R E;  2GSS A;  1ERT A;  1J9B A;  1A0F A;  2LNT A;  1PFO A;  2JAC A;  4I8B A;  2H0G A;  3VUR A;  5D73 A;  1M2B A;  2H8L A;  3QR6 A;  5DJL A;  1TRW A;  1ABA A;  1G6W A;  1PL2 A;  3TOU A;  4NHZ A;  3WD6 A;  4FYB A;  4CW9 A;  4I5Q A;  2MMZ A;  2VM2 A;  4JE1 A;  3TJB A;  4ECJ A;  3C1S A;  2E0Q A;  1Z6N A;  3QD9 A;  1GSF A;  1T8E B;  4A5P A;  1WPI A;  2FLS A;  3PR8 A;  1K0D A;  3GV1 A;  1A2J A;  2ON5 A;  4HUA A;  3BBY A;  1XBS A;  2K8V A;  5ECR B;  1XW6 A;  1PQN A;  1XWG A;  2LS5 A;  2CAI A;  1PN0 A;  4ML6 A;  2YP6 A;  3CSH A;  2R3X A;  3G7I A;  3HD5 A;  4F9Z A;  3C8E A;  1PRX A;  4IS0 A;  5IQY A;  1DBY A;  1KBN A;  1M99 A;  5DCH A;  3HJM A;  1I5G A;  2OAD A;  1K0B A;  5G5E A;  4JR4 A;  2CV4 A;  4ILF A;  2R4V A;  2XHF A;  2E2G A;  1O8W A;  1M2D A;  4BVX A;  4PUR A;  4OFM A;  4TXO A;  2DC5 A;  1XOA A;  1MTC A;  5HR2 A;  5IOW A;  1JLV A;  4ZBB A;  11GS A;  3O76 A;  4FYU A;  3GL3 A;  2LJA A;  2L59 A;  1SEN A;  3IHQ A;  5GAP D;  5FWG A;  4MCU A;  2VCV A;  1T3B A;  2VL9 A;  1Q4J A;  4FO5 A;  4HS1 A;  3EU3 A;  1U87 A;  5A5K A;  5DAL A;  3GKN A;  1K3L A;  1GSS A;  1SJZ A;  2J23 A;  1JZO A;  2V1M A;  5JCW A;  3GFK A;  3DIE A;  4GQF A;  4OCE A;  5H5S A;  1SYX A;  4YQU A;  2PN8 A;  2IWT A;  2DLX A;  3TKR A;  4IQA A;  2C1Y A;  4O32 A;  1SJ6 A;  4GCI A;  1WIK A;  2GQL A;  4IP1 A;  5HQP A;  4E8H A;  1K0N A;  1GTU A;  1LU4 A;  4N11 A;  4IEL A;  3D4M A;  3KTL A;  3LYP A;  1GNE A;  3ME7 A;  1F3A A;  2HT9 A;  4I2U A;  12GS A;  1B8X A;  2C4J A;  2OKA A;  3IDV A;  2NDO A;  1R7H A;  1OC9 A;  4WR4 A;  2HSY A;  4ZL7 A;  4G9H A;  1AAZ A;  1FB6 A;  2LRC A;  5CP1 A;  3ZTL A;  4LL1 B;  4CY6 A;  1XZO A;  3DEX A;  2OE3 A;  1KNG A;  4TR4 A;  4XS1 A;  2H1B A;  1HNC A;  3HY2 A;  3A5I A;  2LEG A;  4EIP A;  4AJ7 A;  1R5A A;  1M0U A;  2B5E A;  1MDJ A;  4MZC A;  2B5Y A;  1PX6 A;  4LLR A;  6GSU A;  3E3E A;  3FZ5 A;  1KTE A;  1OYJ A;  2H70 A;  2GSR A;  3DRN A;  3EMP A;  2QA2 A;  2FWG A;  3GSS A;  1SD9 A;  6GST A;  5JWO B;  3QAV A;  3I6A A;  3ZVJ A;  4QL7 A;  4L0U A;  3LW9 A;  4XS4 B;  3RDW A;  3KCM A;  5ELG A;  3EC3 A;  5FT3 A;  2IFQ B;  1ZYP A;  1Z7P A;  2BJX A;  4PNF A;  3HVN A;  2B5X A;  3EU4 A;  3F4S A;  1V58 A;  4MZW A;  4ZB6 A;  4KDY A;  1TK5 B;  3KH7 A;  2FHE A;  3TRX A;  2C8U A;  1V57 A;  2H30 A;  3D4T A;  1X5E A;  3MWH A;  1GTB A;  5J4U A;  5COH A;  1TK8 B;  1ACV A;  4DSQ A;  4MK3 A;  1V2A A;  5E59 A;  4Z2U A;  1S3D A;  4ZIL A;  5J9B A;  3P8W A;  5ABR A;  1XG8 A;  2LQQ A;  3M0F A;  4MP4 A;  3GKM A;  2FGX A;  3TJK A;  2H6Y A;  1XVW A;  1EP7 A;  5KN0 A;  9GSS A;  2HXK A;  2FWE A;  2H73 A;  4PX1 A;  2KLX A; 
#chains in the Genus database with same CATH homology
 5FHI A;  1YZX A;  2GQM A;  3FK8 A;  4PQI A;  2C3N A;  2HZF A;  4POK A;  3ZML A;  3TRP A;  2LJR A;  4GTU A;  3CRU A;  4MH2 A;  2VLT A;  3D21 A;  1PKZ A;  5IPH A;  1OC3 A;  1EEJ A;  4KCA A;  3PIN A;  4WBJ A;  1GUH A;  4MA9 A;  2HSH A;  4XIH A;  5IMC A;  2WRT A;  3ZVJ D;  4L5L A;  2H75 A;  3GN3 A;  3A2X A;  3LWA A;  3LYK A;  5ECN B;  1GTA A;  1ZZY A;  5EY6 A;  3LSZ A;  2JSZ A;  2IIY A;  5DAK B;  1SL0 B;  3EVI A;  3KM6 A;  2R0P A;  1Y25 A;  5D8I A;  5KN3 A;  2O8V B;  3Q18 A;  2DIY A;  2YJ7 A;  1HNB A;  2OBK A;  4F2I A;  4IW9 A;  1N8J A;  4Z2R A;  2JZT A;  2HRA A;  2H1G A;  4N0Z A;  1O7U A;  2O7K A;  1TRU A;  3ZRD A;  4EC0 A;  1TI1 A;  4BWQ A;  2GS3 A;  3QCP A;  10GS A;  1J08 A;  2N5A A;  4TR0 A;  1WOU A;  1MDI A;  3BD2 A;  5ECL B;  4OCF A;  4EUY A;  3HA9 A;  4EDZ A;  2L5L A;  3TKP A;  4D73 B;  2VCQ A;  3SBC A;  4BA7 A;  3H93 A;  1EWX A;  3L9U A;  1G7E A;  1B9Y C;  1WMJ A;  1QUW A;  4DSS B;  19GS A;  1GSU A;  3J7Y k;  3W8S A;  5DVB A;  1DSB A;  3ZIV A;  3AY8 A;  4MPG A;  3VPT A;  5EL8 A;  4KW6 A;  2OE1 A;  3KJY A;  1VF3 A;  1URM A;  1OKT A;  1EV4 A;  2TRC P;  4K0N A;  4I6X A;  3J7Y b;  2WUL A;  4CY8 A;  3EYT A;  3ZFB A;  4V2M A;  4QQ7 A;  1K0O A;  4ECI A;  1YF0 A;  5BMU A;  3DXB A;  4G0L A;  2NBS A;  4KSM A;  4AF2 A;  4P3Y B;  3F6F A;  4V2L A;  13GS A;  4HJM A;  4HEA 2;  3GRX A;  4Q5F A;  4CDO A;  3FR9 A;  1SU9 A;  5CRW A;  4JU5 A;  2PPT A;  3RAZ A;  1PX7 A;  2JZR A;  1QXH A;  1UVZ A;  4BWS A;  2EC4 A;  2RLI A;  1GSQ A;  4O92 A;  5JCU A;  3KP8 A;  1K0C A;  1ZGN A;  2O87 A;  3CSI A;  1B48 A;  4IKH A;  1XPV A;  2IN3 A;  4KX4 A;  1K3Y A;  5C04 A;  3HVX A;  2AUV A;  5CRH A;  4HJ2 A;  3S9F A;  4EXJ A;  4GSS A;  4HZ4 A;  1T4Y A;  2YAN A;  2DJ1 A;  2M80 A;  1TJD A;  3TJJ A;  2CQ9 A;  3A2W A;  2GT6 A;  2C3Q A;  3MYD A;  2AB6 A;  5IMF A;  5HFK A;  1LBK A;  22GS A;  4HOJ A;  4OMV A;  4PUA A;  1XW5 A;  1X0R A;  4E8E A;  1EGO A;  4QL9 A;  2H19 A;  4K7O A;  1BQ7 A;  3GUS A;  3MSZ A;  3H8Q A;  1NW2 A;  1NSW A;  1SD8 A;  3WT1 A;  2C0D A;  1WP0 A;  5DQY A;  3US3 A;  4IJ3 A;  2K9F A;  3GX0 A;  2QC7 A;  3RPN A;  2WDU A;  2GZZ A;  4XS4 A;  3TKQ A;  3UEM A;  3HCZ A;  2X8C A;  2IFQ A;  3F63 A;  4XRD A;  2VL3 A;  4L8E A;  2IJY A;  3HVV A;  3WGX A;  3LFL A;  3UBL A;  3LJR A;  2YN1 A;  2L6C A;  4HU7 A;  5L71 A;  3F4T A;  1ZYN A;  2F8A A;  3C73 A;  5GSS A;  4ZB8 A;  1PKW A;  4ZB9 A;  2CZ3 A;  2B1L A;  1EGR A;  3TB2 A;  2C80 A;  5D9V A;  3TUE A;  3D5J A;  1TW9 A;  1RW1 A;  3F8U A;  1M7T A;  1PN9 A;  1VF4 A;  5INY A;  3ZIT A;  1LJR A;  4OD7 A;  3PPU A;  1HYU A;  4ISD A;  3IBH A;  3DWV A;  3KIJ A;  4K5R A;  3IRA A;  5G30 A;  1JLW A;  2LRT A;  4H86 A;  5ECM B;  2FNO A;  5AIV A;  4HU9 A;  3HZ4 A;  2TIR A;  5HR1 A;  3CXG A;  2HRN A;  5D9W A;  2GZP A;  4NMU A;  2LNS A;  3DYR A;  5DQS A;  5ECS A;  5AIS A;  2F3M A;  4Z2T A;  2H6Z A;  1GNW A;  4K7N A;  3UBK A;  5A4W A;  2O89 A;  5ECH B;  2R0G A;  4NHW A;  2H76 A;  3JCM L;  3FRC A;  1R4W A;  2H72 A;  3G7Y A;  3MNG A;  4YKG A;  1DE2 A;  2LQO A;  1X9S B;  5A4U A;  4DEJ A;  3MDK A;  1MEK A;  2XPD A;  3APQ A;  2O85 A;  1FHE A;  2FA4 A;  5IO0 A;  5J5N A;  2OAC A;  5DAK A;  2FA8 A;  4IJI A;  2CT6 A;  2GT5 A;  3VWU A;  3GTU B;  1SK2 A;  2HI7 A;  3EE2 A;  5G5F A;  4KDX A;  5G31 A;  3TCO A;  4MF6 A;  4WF4 A;  4YAV A;  6GSV A;  1AQV A;  2DMM A;  3FW2 A;  3FZA A;  1TOF A;  3ZL5 A;  1T4Z A;  2IMD A;  3IHG A;  1EV9 A;  2FY6 A;  2LST A;  3FHK A;  2PER A;  3LGC A;  1AUC A;  2YWM A;  4KCE A;  1YJ6 A;  1KEB A;  1O81 A;  1DUG A;  1OE7 A;  2KOK A;  1T1V A;  4K8M A;  2R2J A;  2L57 A;  4G10 A;  2UZ8 A;  1TU8 A;  2H1A A;  2AV4 A;  4D73 A;  4OO4 A;  1NHO A;  4WF5 A;  3P90 A;  4ACS A;  1TP9 A;  2VCX A;  3TDG A;  4HQS A;  1OVN A;  2RM5 A;  2X64 A;  4LMW A;  5KEJ A;  2VM1 A;  4ULX A;  3CTG A;  5GZZ B;  2L4Q A;  2PMT A;  1M2A A;  1FOV A;  2I81 A;  2C0F A;  4TKY A;  1U3A A;  3EIN A;  2G2Q A;  1X9W B;  2GTU A;  2HSM A;  2L4C A;  1GH2 A;  4LA1 A;  4HZ2 A;  1Y6E A;  2DSA A;  3M9J A;  4O5Q A;  2GLR A;  4NWY A;  1A8Y A;  1XWA A;  4ZBA A;  5C00 A;  5AIX A;  6GSW A;  3TKS C;  3IR4 A;  1THX A;  2A4V A;  1GLQ A;  4CHS A;  1A8L A;  3KZQ A;  4Z7X A;  2H1D A;  1JZR A;  2DKI A;  3QFB C;  4OO5 A;  2OBI A;  2YZH A;  1XW9 A;  3BCK A;  5KN2 A;  1HD2 A;  4HDE A;  2DJ3 A;  4PXO A;  5ELA A;  2BMX A;  3ERW A;  1SKR B;  2JAD A;  4OWY A;  4X43 A;  2IPA A;  3TJG A;  1U88 A;  2H71 A;  2B3S A;  4XS6 A;  4JBB A;  5G1K A;  4L5O A;  1BED A;  3CRT A;  1XWC A;  5ID2 B;  3HJO A;  3RHC A;  1V98 A;  1XOB A;  1Z7R A;  1TI3 A;  2OE0 A;  5B8B A;  3ZMK A;  3N5O A;  2QGV A;  4GQC A;  3VWX A;  3GH6 A;  3HDC A;  1JZW A;  1J0F A;  3VFI A;  3ZLP A;  2WZ9 A;  4WR5 A;  4XHM A;  1VF2 A;  1F2E A;  2JZS A;  3GH9 A;  2JL4 A;  2VOC A;  2VAF A;  1QMV A;  2VUP A;  4IGJ A;  3KD0 A;  5DDL A;  1SK1 A;  4AJ8 A;  3ED3 A;  1GSD A;  3G7J A;  2HLS A;  1VGL A;  2I4A A;  4O7H A;  2V41 A;  4TR1 A;  1YKC A;  4PQH A;  2LV3 A;  2I9H A;  5LD0 A;  2M46 A;  4J57 E;  4FIW A;  1S3C A;  1T7P B;  1FW1 A;  2MMN A;  1WWJ A;  3KXO A;  2R0C A;  6GSS A;  5CO3 A;  2GDR A;  4MPF A;  2C3T A;  5J9C A;  3CBU A;  5CNW A;  4KH7 A;  4YQM A;  3DD3 A;  3TJF A;  3QMX A;  1GWC A;  6GSY A;  2CVB A;  5ECQ B;  3FR3 A;  1DE1 A;  4XTS A;  1YF1 A;  2JU5 A;  1GL8 A;  1EP8 A;  4RQX A;  1PA3 A;  5IPG A;  1G6Y A;  5JWQ B;  3V1W A;  1U3I A;  4MH3 A;  1ZOF A;  3G9B A;  1FVJ A;  2WB9 A;  4FQU A;  1JHB A;  2AJQ B;  2QKE A;  3UJ1 A;  3APS A;  3QAW A;  4TXV A;  4PQ1 A;  2GSQ A;  2CA8 A;  3MIX A;  2LUS A;  4BPY A;  4K0G A;  3VWW A;  5E4W A;  5ECP B;  3PGT A;  1O6J A;  4OFT A;  4GSN A;  2H66 A;  3F9U A;  4GXZ A;  4F0C A;  5HR3 A;  3DML A;  2LTK A;  4BVX B;  1YY7 A;  1XVQ A;  4V2N A;  3IC4 A;  3TRQ A;  1THO A;  2RII A;  2XC2 A;  4IHU A;  4TXO B;  4F0B A;  1YKA A;  5CRG A;  1S3A A;  1PD2 1;  5F06 A;  4MZB A;  1AXD A;  4IP6 A;  1O8X A;  2BTO T;  4K5S A;  2KP2 A;  3FY7 A;  1FVK A;  1ZYQ B;  3GA4 A;  4K2D A;  1E2Y A;  5CAX A;  7GSS A;  4O5R A;  1JZD A;  4KE3 A;  4G0I A;  1ERU A;  2A2P A;  2H0I A;  4NXI A;  1HQO A;  4GF0 A;  1GSE A;  2A4H A;  3VLN A;  5F8B A;  1GLP A;  3EUR A;  4GLT A;  3GYK A;  1XWB A;  3WGE A;  1QGV A;  2RUE A;  2WJU A;  4NPB A;  4ZL8 A;  2DJ0 A;  4JRR A;  4MLY A;  1F9M A;  1ERW A;  2WFC A;  1A23 A;  4KDU A;  1PL1 A;  2DIZ A;  4MJB A;  3L78 A;  3VK9 A;  1GP1 A;  2GST A;  2VLU A;  5ECI B;  5BRT A;  2V6O A;  3E0U A;  3M9K A;  4NAX A;  2D2Z A;  3IPZ A;  1I9D A;  2IMF A;  1A2L A;  5KN1 A;  2YJH A;  4I97 A;  3TOT A;  1F6M C;  5H5Q A;  5F07 A;  5HFI A;  2X49 A;  3KEB A;  3TKS A;  3BOA A;  4KGI A;  2HZE B;  3RPP A;  1B4Q A;  2VD0 A;  2VCT A;  1GTI A;  2AAW A;  1YEX A;  3C7M A;  1AW9 A;  2QSI A;  4K6X A;  1XWK A;  3UAP A;  4NV2 A;  1U6T A;  4WXT A;  5B7C A;  5D9T A;  3D6I A;  3KTB A;  3NOF A;  5CYY A;  4USS A;  2G0F A;  4TVE A;  4EIQ A;  1XXU A;  2X99 A;  2JSY A;  2CVK A;  1AC1 A;  2EIO A;  1BG5 A;  4POB A;  4MMM A;  2LRN A;  4I2T A;  1VRS D;  4KB3 A;  5ID2 A;  2ALB A;  1PMT A;  5DJM A;  1FOH A;  1IYI A;  4LMV A;  1FO5 A;  2A2S A;  1X9M B;  4OFN A;  1V9W A;  2GQK A;  1GUM A;  2VIM A;  4NV5 A;  1A0R P;  2WGR A;  4KND A;  3IV4 A;  3IK9 A;  2MYG A;  3BJ5 A;  3K8N A;  1TK0 B;  2DJK A;  3QFA C;  4ZL9 A;  1E6B A;  2PU9 C;  3KGK A;  3O3T A;  3WT2 A;  3QOU A;  1K3O A;  5F0G A;  1RK4 A;  2HNL A;  3UOM A;  4TR3 A;  4K1F A;  4POM A;  2XBQ A;  2RUF A;  2FWH A;  3LEF A;  3O6T A;  2GGT A;  3APO A;  3IAS 2;  4X1U A;  2XBI A;  4J2F A;  4GRF A;  4BL7 B;  2R5G A;  2QA1 A;  5LCZ A;  3WYW A;  4F82 A;  3QDN A;  2IMK A;  2F8F A;  3GKX A;  1W4V A;  5CRD A;  2PVQ A;  1O73 A;  5IOX A;  2MBT A;  4KA0 A;  2FUG 2;  4ZIJ A;  2B1K A;  1MD4 A;  1FB0 A;  1BYE A;  2ON7 A;  4F03 A;  3C71 A;  2TRX A;  2X8H A;  3UMA A;  3LXZ A;  3W8J A;  1X5D A;  1SL2 B;  2FCH A;  4Q5R A;  2X8G A;  1ML6 A;  3L9V A;  3ZFL A;  3NZN A;  4ICY A;  4Q5N A;  3HXS A;  1H75 A;  14GS A;  8GSS A;  3EMX A;  2HFD A;  4IN0 A;  1UC7 A;  4EDY A;  4V1A p;  2DJ2 A;  4WEY A;  4PNG A;  3MAK A;  2H01 A;  1CQH A;  4ID0 A;  1USB A;  3ZYW A;  4RI6 A;  2B7J A;  4XRA A;  3CTF A;  1Z5Y E;  4RI7 A;  3FMW A;  1C72 A;  3ERG A;  1ZL9 A;  1XCC A;  2J9H A;  3ZZX A;  1V40 A;  2I3Y A;  3LQ7 A;  2HRF A;  5CRE A;  18GS A;  4BVY B;  4YH2 A;  1XFL A;  1ILO A;  1SYR A;  3IXR A;  1R5P A;  1T00 A;  3EWL A;  3BCI A;  2MMO A;  5EVO A;  4EVM A;  3FZ4 A;  5AN1 A;  2NVL A;  4N10 A;  4MF7 A;  3W6G A;  3VWV A;  4DSS A;  1A24 A;  4IVF A;  4N0V A;  1JFU A;  2Z9S A;  4AGS A;  5A4V A;  3KMN A;  3A3T A;  4ECC A;  5D9X A;  2M72 A;  5GAN D;  3Q19 A;  3IA1 A;  2ZCT A;  3F3Q A;  1TKD B;  3F4R A;  4KF9 A;  5D93 A;  3LG6 A;  4KUN A;  1SL1 B;  1K0A A;  1GUL A;  4N30 A;  3I43 A;  5KOX A;  5ECK B;  4G19 A;  3M1G A;  4YKF A;  1GUK A;  1Z6M A;  3UVH A;  5B6M A;  2X4A A;  5J41 A;  3EPT A;  3QPM A;  4RUV A;  2HE3 A;  1EOH A;  4PGT A;  2HZE A;  3Q6O A;  3ME8 A;  3P7X A;  2YWI A;  2CVD A;  4J56 E;  2MBS A;  2N5B A;  3LOR A;  3NIV A;  5D96 A;  1TRV A;  2E2M A;  3CMI A;  3QAG A;  2KHP A;  3H1N A;  1G0T A;  5HR0 A;  3RHB A;  1M9B A;  4YQV A;  4ZBD A;  4MAB A;  5ECO B;  2REM A;  4WET A;  4K9Z A;  1WJK A;  2F51 A;  2VO4 A;  4FH8 A;  2A2R A;  4JZQ A;  4DSR A;  3CSJ A;  1AQW A;  3IAM 2;  3GX8 A;  2H74 A;  1X5C A;  2YPM A;  5IM9 A;  1BJX A;  3TKS E;  2NTO A;  2V32 A;  4POL A;  5IO2 A;  5J3R A;  5IIZ A;  3GHA A;  4DVC A;  3IK7 A;  2CAQ A;  2KUC A;  3HHV A;  4EKZ A;  1QFN A;  1VF1 A;  20GS A;  4IBP A;  2OA7 A;  3HKR A;  2DJJ A;  2OJL A;  3H79 A;  2E7P A;  2P5Q A;  1B9X C;  1BX9 A;  2YNX A;  5EPF A;  2LJK A;  3PH9 A;  2B7K A;  4MJC A;  2FD3 A;  3I9V 2;  1QK8 A;  5HFG A;  2HYX A;  4ZXG A;  2H6X A;  2VL2 C;  3F3R A;  4L0W A;  3F6D A;  4JR6 A;  2DKH A;  3KH9 A;  3FZ9 A;  3DVX A;  17GS A;  4EF0 A;  1AIU A;  5IMA A;  4RQR A;  1W89 A;  1B4P A;  3CYN A;  4MF5 A;  3TGZ A;  2R37 A;  4YAP A;  2ES7 A;  1IYH A;  3FR6 A;  4KSO A;  4PUF C;  4BL7 A;  1OKD A;  2P5R A;  4MJA A;  5AGY A;  1HNA A;  4ECB A;  2N5F A;  4MNN A;  3R2Q A;  2ZNM A;  1SKS B;  3FEU A;  1YQ1 A;  3L4N A;  3C1R A;  2MZC A;  2EIR A;  3F0I A;  3E9J B;  3GUR A;  1FG4 A;  3LXT A;  2B6M A;  3VI5 A;  4TN8 A;  4ML1 A;  1XIY A;  3UVT A;  2F9S A;  1WE0 A;  3L9S A;  3IOS A;  1ON4 A;  5F05 A;  4K2X A;  3SWL A;  2AYT A;  1OAZ A;  2RM6 A;  1FAA A;  1SJI A;  2VCW A;  3HJP A;  1R26 A;  3M3M A;  2DBC A;  4TRX A;  2MMA A;  3UL3 A;  1H4O A;  2WS2 A;  2V2G A;  2PVO C;  5B8A A;  5IMV A;  1AQX A;  4V1A g;  4GST A;  1YEP A;  16GS A;  4MJE A;  3KP9 A;  2VLV A;  3IE3 A;  1ZMA A;  2GVP A;  2KP1 A;  4FYC A;  3GTU A;  4JED A;  1MDK A;  3L0H A;  4KAE A;  2PWJ A;  1TTZ A;  6GSX A;  5DAL B;  1TRS A;  1EOG A;  1G7O A;  3ZIJ A;  2R6K A;  3UAR A;  4BVY A;  4Q5Q A;  2YV9 A;  2K18 A;  4O5U A;  5LNK e;  5DCG A;  5ENU A;  3WGD A;  2VD1 A;  1EZK A;  1F37 A;  2CZ2 A;  2FWF A;  2PBJ A;  1OC8 A;  3HZ8 A;  1MD3 A;  1RQM A;  4EL1 A;  4LL4 B;  2LKU A;  3ISO A;  4TW5 A;  1ERV A;  1OE8 A;  2CX4 A;  5IMZ A;  1O85 A;  2C0E A;  5JWR B;  2P31 A;  2L5O A;  4G2E A;  2H0H A;  3GIX A;  3N9J A;  2IME A;  3RBT A;  5B6N A;  3U6V A;  2K6V A;  2YCD A;  3I69 A;  4TOP A;  1PSQ A;  1GRX A;  1TXX A;  3D0Z A;  3M8N A;  4X0X A;  1GSY A;  3HYP A;  3GMF A;  1OC9 B;  2DML A;  1NHY A;  2YZU A;  2C0G A;  4EE0 A;  1BAY A;  5DBQ A;  5G2Z A;  2XPE A;  1K0M A;  2AHE A;  1PGT A;  4MDC A;  2L6D A;  3ERF A;  2YWO A;  1YDK A;  4XCS A;  3OR5 A;  3A2V A;  3H4K A;  5H5R A;  2EIQ A;  3HVS A;  2GZY A;  3GST A;  3A5W A;  2IMI A;  3D22 A;  4AJ6 A;  4PTS A;  2V6K A;  3ZRE A;  2YOI A;  3VPQ A;  4EO3 A;  5G1L A;  1A2M A;  1Q98 A;  1TDI A;  1N2A A;  3IC8 A;  4GWR A;  2YV7 A;  1SKW B;  3UIW A;  1UA5 A;  4HQZ A;  4WBR D;  4X4J A;  3DGQ A;  2IL3 A;  3R3E A;  1ZCP A;  1QQ2 A;  1UN2 A;  5GST A;  1M9A A;  2CX3 A;  1NM3 A;  1ST9 A;  2P0G A;  2I1U A;  4IQ1 A;  1Z9H A;  2ZUP A;  1WRY A;  3FKF A;  1ZYE A;  4WKW A;  3VI7 A;  2WCI A;  4TR1 B;  3GL5 A;  3GKK A;  2HRK A;  2K8S A;  3DKS A;  3P2A A;  3Q74 A;  3KMO A;  3GNJ A;  1TU7 A;  5JCG A;  5KOW A;  4HI7 A;  2PGT A;  3FYG A;  2VCZ A;  1Z3E A;  4G0K A;  3DVW A;  1SK0 A;  2NPB A;  4K7I A;  1F3B A;  2PUK C;  2YWN A;  1EEM A;  1CQG A;  2VL2 A;  5IMD A;  3U5R E;  2GSS A;  1ERT A;  1J9B A;  1A0F A;  2LNT A;  2JAC A;  4I8B A;  2H0G A;  3VUR A;  5D73 A;  1M2B A;  2H8L A;  3QR6 A;  5DJL A;  1TRW A;  1ABA A;  1G6W A;  1PL2 A;  3TOU A;  4NHZ A;  3WD6 A;  4FYB A;  4CW9 A;  4I5Q A;  2MMZ A;  2VM2 A;  4JE1 A;  3TJB A;  4ECJ A;  3C1S A;  2E0Q A;  1Z6N A;  3QD9 A;  1GSF A;  1T8E B;  4A5P A;  1WPI A;  2FLS A;  3PR8 A;  1K0D A;  3GV1 A;  1A2J A;  2ON5 A;  4HUA A;  3BBY A;  1XBS A;  2K8V A;  5ECR B;  1XW6 A;  1PQN A;  1XWG A;  2LS5 A;  2CAI A;  1PN0 A;  4ML6 A;  2YP6 A;  3CSH A;  2R3X A;  3G7I A;  3HD5 A;  4F9Z A;  3C8E A;  1PRX A;  4IS0 A;  5IQY A;  1DBY A;  1KBN A;  1M99 A;  5DCH A;  3HJM A;  1I5G A;  2OAD A;  1K0B A;  5G5E A;  4JR4 A;  2CV4 A;  4ILF A;  2R4V A;  2XHF A;  2E2G A;  1O8W A;  1M2D A;  4BVX A;  4PUR A;  4OFM A;  4TXO A;  2DC5 A;  1XOA A;  1MTC A;  5HR2 A;  5IOW A;  1JLV A;  4ZBB A;  11GS A;  3O76 A;  4FYU A;  3GL3 A;  2LJA A;  2L59 A;  1SEN A;  3IHQ A;  5GAP D;  5FWG A;  4MCU A;  2VCV A;  1T3B A;  2VL9 A;  1Q4J A;  4FO5 A;  4HS1 A;  3EU3 A;  1U87 A;  5A5K A;  5DAL A;  3GKN A;  1K3L A;  1GSS A;  1SJZ A;  2J23 A;  1JZO A;  2V1M A;  5JCW A;  3GFK A;  3DIE A;  4GQF A;  4OCE A;  5H5S A;  1SYX A;  4YQU A;  2PN8 A;  2IWT A;  2DLX A;  3TKR A;  4IQA A;  2C1Y A;  4O32 A;  1SJ6 A;  4GCI A;  1WIK A;  2GQL A;  4IP1 A;  5HQP A;  4E8H A;  1K0N A;  1GTU A;  1LU4 A;  4N11 A;  4IEL A;  3D4M A;  3KTL A;  3LYP A;  1GNE A;  3ME7 A;  1F3A A;  2HT9 A;  4I2U A;  12GS A;  1B8X A;  2C4J A;  2OKA A;  3IDV A;  2NDO A;  1R7H A;  1OC9 A;  4WR4 A;  2HSY A;  4ZL7 A;  4G9H A;  1AAZ A;  1FB6 A;  2LRC A;  5CP1 A;  3ZTL A;  4LL1 B;  4CY6 A;  1XZO A;  3DEX A;  2OE3 A;  1KNG A;  4TR4 A;  4XS1 A;  2H1B A;  1HNC A;  3HY2 A;  3A5I A;  2LEG A;  4EIP A;  4AJ7 A;  1R5A A;  1M0U A;  2B5E A;  1MDJ A;  4MZC A;  2B5Y A;  1PX6 A;  4LLR A;  6GSU A;  3E3E A;  3FZ5 A;  1KTE A;  1OYJ A;  2H70 A;  2GSR A;  3DRN A;  3EMP A;  2QA2 A;  2FWG A;  3GSS A;  1SD9 A;  6GST A;  5JWO B;  3QAV A;  3I6A A;  3ZVJ A;  4QL7 A;  4L0U A;  3LW9 A;  4XS4 B;  3RDW A;  3KCM A;  5ELG A;  3EC3 A;  5FT3 A;  2IFQ B;  1ZYP A;  1Z7P A;  2BJX A;  4PNF A;  2B5X A;  3EU4 A;  3F4S A;  1V58 A;  4MZW A;  4ZB6 A;  4KDY A;  1TK5 B;  3KH7 A;  2FHE A;  3TRX A;  2C8U A;  1V57 A;  2H30 A;  3D4T A;  1X5E A;  3MWH A;  1GTB A;  5J4U A;  5COH A;  1TK8 B;  1ACV A;  4DSQ A;  4MK3 A;  1V2A A;  5E59 A;  4Z2U A;  1S3D A;  4ZIL A;  5J9B A;  3P8W A;  5ABR A;  2LQQ A;  3M0F A;  4MP4 A;  3GKM A;  2FGX A;  3TJK A;  2H6Y A;  1XVW A;  1EP7 A;  5KN0 A;  9GSS A;  2HXK A;  2FWE A;  2H73 A;  4PX1 A;  2KLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...