3IAM2

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
179
structure length
179
Chain Sequence
b'GFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 44
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3iam201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3iam202
1Y6EA 5F07A 1FO5A 5IQYA 1X9SB 2WDUA 3L4NA 2C3NA 2X8HA 4AJ8A 2REMA 2VL2C 4OFMA 1PL2A 3G7JA 2PPTA 2R4VA 3L9SA 4PNGA 3DEXA 2CAQA 1T4YA 2VM1A 2IIYA 3TJJA 3RAZA 4F2IA 3QMXA 3ZMKA 3D4MA 4ML6A 2LEGA 4ZIJA 3HVVA 1DUGA 1TRSA 5LNKe 3P7XA 4ULXA 2B1KA 2I81A 3DXBA 4MCUA 4DSRA 1XVWA 3FZ4A 5DDLA 3UOMA 3C1RA 1DE1A 4NXIA 4GSNA 5B8AA 2MBTA 2FWGA 1X0RA 2B5YA 4IBPA 2RM6A 4MH2A 1T8EB 2GTUA 3DVXA 1PX7A 1EP8A 3A2VA 4XRAA 3C7MA 1TDIA 3HXSA 1FB0A 1JZRA 4LL1B 2ZCTA 5DVBA 4GSSA 3L0HA 4IW9A 4KAEA 4ILFA 5HR3A 2H66A 3IXRA 4D73B 5JCWA 1N2AA 1AXDA 3C71A 1KTEA 3KZQA 4Q5FA 1ON4A 3ZIVA 2AYTA 2FLSA 3P90A 2JSZA 3BOAA 4GLTA 2R6KA 3U5RE 1O7UA 5GSSA 1TU8A 2H30A 4WR4A 3HZ8A 2H6XA 4EC0A 22GSA 1G0TA 3HJPA 3EYTA 3GSSA 1J0FA 5CRHA 4BVYA 2RUFA 4WBRD 3UARA 1LBKA 1XOAA 2H1DA 4JR4A 4MZWA 3GURA 3GX8A 3IAS2 2QGVA 3KH9A 1HYUA 4KW6A 1ERUA 4O92A 4JE1A 3VWXA 1KBNA 5HFKA 1EEMA 5B6NA 2A2RA 1E6BA 2B5XA 3PINA 1T4ZA 3O3TA 3P8WA 3FR6A 4YAPA 1XIYA 3TKSA 3LFLA 4LA1A 3Q74A 1AQVA 4HJMA 1PGTA 3FK8A 4IJIA 2AAWA 3ZRDA 3ZZXA 2RLIA 2YWNA 2GGTA 4XTSA 4V2LA 4K2DA 3TKSC 1BJXA 1YJ6A 1EZKA 2L4CA 3Q6OA 2AV4A 3LXZA 3LSZA 1WOUA 3KP8A 2VM2A 1A0FA 2IFQB 1XVQA 4N0VA 3Q19A 4NHWA 3TJGA 4HU7A 2YV9A 2LJKA 1V40A 4MJCA 10GSA 1MD4A 3CTFA 2YWIA 4EUYA 5KN2A 1OC9A 4ZBDA 1BYEA 4TW5A 3HZ4A 1KNGA 1THOA 1F3AA 1SKWB 2YNXA 3R2QA 2GZZA 2HSHA 4PUFC 5IPGA 5CP1A 1DSBA 4L0UA 4DEJA 1S3DA 1DE2A 1PX6A 2CX4A 3TKQA 4BWSA 3EU4A 1GRXA 3FY7A 2O7KA 5JWRB 4EXJA 2TRCP 1XCCA 4GXZA 1K3YA 2G0FA 4G9HA 3VWUA 1TKDB 4NHZA 1USBA 2PN8A 4H86A 5J9CA 2PGTA 5CO3A 4GTUA 3GKMA 3M8NA 3C1SA 3F4RA 4F03A 4BA7A 5ECLB 1GUKA 3K8NA 2V6KA 5KEJA 1F37A 4MF7A 4X1UA 1R4WA 2H71A 1VGLA 2A2SA 4CHSA 3D0ZA 2P0GA 3ME8A 1BEDA 4G10A 4KNDA 5F05A 1NM3A 1TK5B 4KCEA 1SU9A 3GA4A 4WBJA 2L5LA 2LRTA 4GCIA 3EWLA 1M9BA 2YJ7A 4DSQA 1SK0A 4IJ3A 1F2EA 3EVIA 1FG4A 4I2UA 4EE0A 1TXXA 1XWBA 3G7YA 4AJ7A 2GSQA 3C73A 5EY6A 3DVWA 4ECBA 3QAVA 3ZYWA 3QR6A 3QOUA 3TGZA 5CREA 1K0BA 5J41A 2CA8A 3KH7A 1MDJA 2H0GA 4AF2A 2O85A 2C3TA 4OCFA 4JRRA 4D73A 1IYHA 1XBSA 3D5JA 3HDCA 3D22A 1BQ7A 1F3BA 3ED3A 2H6YA 5ECHB 3W6GA 5ECIB 4ZBBA 5ABRA 1PD21 1R26A 4XRDA 3ZVJA 2P31A 4EKZA 2KUCA 2YV7A 4ZBAA 5ECQB 2LRNA 1LJRA 1QMVA 1OVNA 5G5EA 2GDRA 2R2JA 4N30A 1G7OA 4JEDA 4NPBA 3E0UA 4JZQA 3IRAA 5J4UA 1AC1A 4HEA2 1XWGA 3L78A 2IMIA 4RI6A 2JSYA 6GSUA 3OR5A 4K7NA 1ZGNA 2J23A 4OCEA 4EDYA 1YF0A 1WE0A 1YEXA 1O85A 4V2MA 2Z9SA 1ZL9A 3FW2A 2QC7A 4F0CA 4TOPA 3EU3A 5EVOA 2L59A 5IOWA 3HJMA 3BJ5A 4LLRA 1C72A 4FYBA 1Q98A 2JADA 4ECCA 2BJXA 3HHVA 1V9WA 2FCHA 5H5QA 1EOHA 3VPTA 3GIXA 1RW1A 3LYKA 2YJHA 3CRUA 3GMFA 4K0NA 4WF5A 2KP1A 3VFIA 3HKRA 2VCWA 1U87A 1M9AA 4KSMA 1B9YC 13GSA 1BAYA 3ERGA 4O7HA 2IMKA 3V1WA 3WT2A 1OC3A 3H79A 2VCVA 5CRGA 3WGDA 2NDOA 6GSTA 3TOUA 3IA1A 1XZOA 3DGQA 2OADA 4MZBA 1V58A 2DLXA 2X64A 2H1GA 3HVXA 2IN3A 5DQYA 3GFKA 1OC9B 3UVTA 5LD0A 5EPFA 2IFQA 1Z5YE 2A4VA 4TRXA 4IP1A 3E9JB 2HYXA 2I4AA 1F9MA 4NWYA 3NIVA 2JU5A 4J57E 6GSXA 3CSHA 1T00A 2LKUA 2CX3A 5J9BA 2GVPA 1O8XA 5CRDA 5AN1A 4GWRA 1UVZA 4IGJA 1PQNA 1QQ2A 3KD0A 1PA3A 4O32A 2J9HA 4ID0A 1OC8A 3IE3A 2DSAA 4PX1A 3IPZA 2OKAA 2YANA 5DAKB 2B5EA 2MMZA 2ZUPA 4Q5QA 2R37A 2YZHA 4MDCA 3GSTA 5DJLA 4OO4A 3CSJA 2N5AA 1JZWA 1V2AA 4PQ1A 5CAXA 2OBIA 5ELGA 6GSSA 2E7PA 5J5NA 5CRWA 2VCTA 4ZILA 2E2GA 3A3TA 4PQHA 5F06A 2DMMA 3H93A 1TTZA 3SWLA 5HQPA 3F0IA 1Q4JA 2CV4A 2YOIA 3LJRA 4L5LA 2XPDA 1ZYQB 1GP1A 3KEBA 1IYIA 2H0HA 4IKHA 3UL3A 2HT9A 5LCZA 2H76A 1OE7A 4OFTA 3F6FA 4F9ZA 2C1YA 3TRQA 2HNLA 1A0RP 5GAND 4JU5A 5ID2B 4PURA 1XWKA 5JCUA 3IOSA 14GSA 1AIUA 2CQ9A 1U3AA 4EO3A 2H73A 3QFBC 3ZIJA 4ZL7A 1TU7A 2FA8A 2I1UA 4ZL9A 3EURA 2IPAA 1I9DA 1M0UA 1ERWA 3APSA 2BTOT 4DVCA 1WP0A 3VURA 2PUKC 2HRFA 1WJKA 3A2WA 5HFIA 1B4QA 2VLTA 9GSSA 1H4OA 5D9XA 1YF1A 2H6ZA 2DJKA 3FHKA 2NPBA 4BWQA 1QGVA 5DCGA 3WGXA 5FHIA 2HZEB 3UMAA 1A2LA 4MLYA 5G1KA 1ERTA 3GV1A 4N0ZA 3LYPA 2F51A 4HOJA 5JWQB 3BBYA 2VAFA 1GSFA 2B3SA 1SENA 1TK0B 4DSSA 3HVSA 3PGTA 1O8WA 1HNCA 3UEMA 1JZDA 3UBLA 1FB6A 5ECKB 1OYJA 2H19A 2L6CA 4BPYA 3FEUA 4MZCA 2IJYA 4IVFA 1S3AA 2P5RA 1NHYA 3HY2A 2WULA 4HU9A 4X43A 3HJOA 1FOVA 3E3EA 1BG5A 4Z7XA 2V41A 2H1BA 2V2GA 2YP6A 3UVHA 3S9FA 1Z9HA 4MPFA 3VI5A 3M9JA 5ECMB 5AIVA 5GSTA 5INYA 1TJDA 1XOBA 4QQ7A 3O76A 5G5FA 3AY8A 4JR6A 4KUNA 4FO5A 1W4VA 1B48A 2OA7A 1EP7A 4I6XA 3WYWA 2MYGA 2HZFA 2X8CA 1UN2A 1K3OA 2EC4A 3TKPA 2K18A 5JWOB 1VF2A 3DWVA 1EV4A 2MMOA 1QXHA 1PRXA 2K8VA 4PNFA 3QD9A 3RBTA 3TKSE 4IS0A 2QKEA 3F9UA 1GSDA 2VCZA 4KDUA 3N9JA 5IMFA 1A8YA 2XHFA 19GSA 3LXTA 3EC3A 2CZ2A 5HR0A 5IPHA 7GSSA 1J9BA 2B7KA 2LNTA 1OAZA 4L0WA 2HSYA 1N8JA 4GQFA 3G9BA 5HR1A 4QL7A 2H8LA 4KH7A 1M7TA 2C80A 4IN0A 3KJYA 3US3A 1Z6NA 2V32A 6GSYA 4J56E 3DIEA 5ECSA 3QAGA 4MABA 2WRTA 3VPQA 4WR5A 1K0NA 1FHEA 4BL7A 1F6MC 5DAKA 2LNSA 2M46A 3GKNA 2K8SA 4TVEA 3J7Yk 2WJUA 3GUSA 3RPNA 2NVLA 3GHAA 4K0GA 1TK8B 2JZRA 1PSQA 2K9FA 1WPIA 1GSYA 2OJLA 4IELA 4GSTA 1TW9A 1TI1A 2DJ1A 2C3QA 2VIMA 4PXOA 1SJZA 4JBBA 3G7IA 1AUCA 4MF5A 4I5QA 1JLWA 2TRXA 5GAPD 4LL4B 2BMXA 2JL4A 1H75A 2WZ9A 2GLRA 5D93A 3CMIA 3L9VA 4ZXGA 1S3CA 2R3XA 4MJEA 5ID2A 4KX4A 5D9VA 3KCMA 1G7EA 2IL3A 3IV4A 4ZB6A 1ILOA 1QFNA 1ACVA 4ECIA 4BVXA 2FGXA 2GSRA 2KHPA 1K0DA 3L9UA 2ON5A 1GSUA 3KXOA 4HUAA 4IHUA 1VRSD 2JACA 5DJMA 4HI7A 4POMA 4L5OA 5IMCA 3VWWA 1YZXA 2N5FA 4TXOA 4XIHA 2VOCA 1O73A 2DJ2A 4OO5A 3ZL5A 3I9V2 2NBSA 4POBA 3HYPA 11GSA 2DC5A 3ZREA 2AHEA 2FHEA 2VD0A 4GRFA 2M72A 2FA4A 4KB3A 2EIQA 2V1MA 3D21A 5D73A 3VK9A 4DSSB 3KMOA 1GNEA 1YKAA 5A5KA 4OD7A 2HZEA 1GTUA 4TR3A 1GL8A 4F82A 1ERVA 2IMFA 5FWGA 3QDNA 3F3RA 4FYCA 2L4QA 3APQA 3RHCA 4V2NA 2HRNA 1FVKA 3ZLPA 4EVMA 4ZB9A 5IOXA 3EMXA 2L6DA 4RQXA 2GS3A 2H75A 5AIXA 2LS5A 4WETA 2VL3A 5CNWA 1J08A 2LTKA 2KOKA 1AW9A 1JLVA 3CYNA 1PKZA 4IP6A 2LSTA 3CBUA 2WFCA 1MDKA 4I8BA 1GTIA 3EE2A 1U6TA 3H1NA 3QCPA 4O5RA 2D2ZA 1SYXA 5DALA 3VI7A 4XCSA 3PR8A 2H72A 4MP4A 3F4SA 3KTBA 3F4TA 3MNGA 2GT6A 4N11A 2F8FA 1B8XA 1XPVA 2OE1A 3W8JA 2OACA 3D6IA 5D9WA 3FR9A 3F3QA 1VF3A 2TIRA 4KDYA 1Y25A 2H70A 5ECOB 1R5PA 2IMDA 3KGKA 2YWMA 3IC4A 1ST9A 2XBIA 3DYRA 2F8AA 1WRYA 1SKSB 1UA5A 1MD3A 1GULA 2LJAA 5B8BA 3BCIA 1SD8A 3MAKA 1ZCPA 2YCDA 1GSEA 2K6VA 1YQ1A 3O6TA 4LMWA 3TRXA 2KP2A 4TN8A 2PBJA 3ZITA 2GSSA 5DBQA 1YEPA 2FY6A 1XWCA 3DRNA 4ISDA 3GN3A 2H0IA 5B6MA 4G2EA 4MH3A 3N5OA 4HQZA 4MJBA 3PH9A 2VCQA 3TCOA 4HZ4A 1A24A 4XHMA 2GZPA 2H1AA 3IDVA 3LWAA 3HA9A 3CXGA 2RUEA 2LUSA 3I69A 3WT1A 3RDWA 1ZZYA 2AUVA 3GX0A 3DMLA 2DMLA 3ERFA 2DIYA 2JZSA 4YAVA 3UIWA 1BX9A 4MMMA 1JZOA 4TR0A 2YZUA 2JZTA 2L5OA 3GRXA 4QL9A 5DQSA 1WMJA 1X5CA 5J3RA 4ACSA 5HFGA 2WGRA 1GH2A 3SBCA 3NOFA 4YQUA 4E8HA 1ML6A 4G19A 3KIJA 4N10A 1O6JA 5IMVA 4TR1A 3MSZA 5IMDA 1TRUA 1G6WA 2C0GA 5H5SA 1V57A 4AGSA 4ZB8A 1SKRB 2HLSA 2C0DA 2GT5A 4KA0A 1MTCA 3TDGA 2VLUA 2NTOA 1SK2A 4NV2A 1XW9A 1Z7PA 1A23A 1TRWA 1X5DA 5A4WA 3QPMA 2F3MA 1U88A 2OE0A 1B4PA 2OBKA 3FYGA 3GH6A 3MDKA 4TXOB 5IO2A 4ECJA 4K7OA 1I5GA 3APOA 2VCXA 4K1FA 4KGIA 2ZNMA 1X5EA 1Z6MA 4PUAA 5C00A 2HE3A 18GSA 1JFUA 2FNOA 3RPPA 1MEKA 5ECPB 3KP9A 3NZNA 5C04A 1R5AA 3GYKA 2VD1A 2CAIA 3TJFA 5JCGA 1PKWA 5G31A 2WCIA 1AQXA 2IMEA 3F6DA 3DKSA 4LMVA 5ELAA 4E8EA 3KMNA 2GZYA 3IK7A 1XFLA 1Z7RA 2DBCA 4ML1A 2I3YA 3A2XA 5KN0A 5KN3A 2YN1A 3I6AA 2I9HA 2CVBA 1HNBA 3KM6A 4I2TA 4TKYA 4HQSA 1KEBA 17GSA 5IMZA 2XC2A 1SK1A 2MMNA 2LJRA 3UJ1A 1GTBA 1VF4A 4XS4B 1WIKA 3ME7A 1EEJA 4OFNA 5DALB 2GSTA 5IMAA 2YPMA 1QK8A 2MMAA 5AISA 3WD6A 5F0GA 2LQOA 1THXA 4MPGA 3IAM2 1GNWA 3C8EA 2HFDA 5KN1A 1W89A 16GSA 2OE3A 3CTGA 4EF0A 1ZYEA 3CSIA 1K3LA 1K0CA 2PERA 3HD5A 1DBYA 1M2BA 4POLA 4TXVA 1EV9A 3BCKA 12GSA 4PGTA 1URMA 3TKRA 3GKKA 3LORA 4L8EA 2GQLA 2FWHA 1ABAA 2GQMA 1SYRA 5FT3A 1NW2A 2DJJA 3GTUB 4F0BA 1K0OA 2XPEA 2ALBA 2X99A 2VL9A 2HXKA 1SJIA 2LQQA 5A4VA 4X0XA 2CZ3A 4CDOA 5ECRB 4J2FA 2VUPA 1NHOA 3VLNA 5A4UA 2WB9A 2E2MA 2DJ3A 5CYYA 2IWTA 4NAXA 3IBHA 4I97A 3GH9A 1K0AA 4V1Ag 3RHBA 4CW9A 4YQVA 5G2ZA 2PMTA 1M2AA 1YY7A 5D96A 3W8SA 1HD2A 2VLVA 2C0FA 1O81A 3HCZA 4MF6A 4WKWA 2G2QA 1RQMA 5E59A 3TJBA 4P3YB 4WEYA 3UBKA 1TRVA 1GUHA 5D9TA 2ES7A 2P5QA 1E2YA 5H5RA 3I43A 1VF1A 4TR1B 2B7JA 2CVDA 1HQOA 4MA9A 1OKTA 3FR3A 4GQCA 1FW1A 1WWJA 3GKXA 2N5BA 4MJAA 4MK3A 1M2DA 2H01A 2PVQA 3CRTA 2FWFA 3ZMLA 1CQHA 3M1GA 2C0EA 3U6VA 3GL5A 1SL2B 3KTLA 1FVJA 1MDIA 3DD3A 2WS2A 2V6OA 3BD2A 1XW6A 1JHBA 1QUWA 5IIZA 3ZVJD 3GL3A 3LG6A 3TB2A 3QAWA 2QSIA 4FH8A 2E0QA 8GSSA 3F8UA 1A2JA 2EIOA 6GSWA 1YDKA 4KDXA 3FRCA 3IHQA 5EL8A 2C8UA 1EOGA 1T1VA 1M99A 3FZ5A 3H8QA 5F8BA 3JCML 4V1Ap 1G6YA 4GF0A 1B9XC 2FD3A 3F63A 4XS1A 2LRCA 2CT6A 4AJ6A 4RI7A 3TJKA 3LGCA 1EGOA 3MWHA 3FKFA 4RUVA 5IM9A 1ZMAA 1K0MA 2FUG2 4IQAA 4OMVA 2H74A 4TR4A 1OE8A 3TUEA 3TRPA 1ZOFA 2RIIA 1PN9A 3H4KA 1Z3EA 3J7Yb 2XBQA 4K6XA 1XW5A 1YKCA 5DCHA 2F9SA 1XXUA 2O89A 5IO0A 2ON7A 4POKA 1A2MA 1TP9A 3LEFA 1GTAA 1R7HA 2FWEA 2O8VB 4K9ZA 1GWCA 3D4TA 1SJ6A 4KSOA 4Q5NA 1AQWA 1EGRA 2R5GA 4RQRA 2B6MA 3WGEA 2X8GA 2PVOC 5L71A 2DJ0A 2L57A 4KCAA 2EIRA 2DIZA 3IR4A 4IQ1A 5G30A 4FYUA 5B7CA 3EINA 1TOFA 4K8MA 5G1LA 1GLPA 4XS4A 1SL0B 2GQKA 2LV3A 3ERWA 4KE3A 2HI7A 1NSWA 2PWJA 1U3IA 3ISOA 5HR2A 1X9WB 3QFAC 3ZFBA 3M0FA 1OKDA 5ECNB 2M80A 3Q18A 1GSSA 4ZL8A 4OWYA 5D8IA 4EDZA 1X9MB 4FIWA 2VO4A 1FAAA 3ZTLA 4WXTA 5COHA 1HNAA 3VWVA 2AJQB 3TOTA 3M9KA 1AAZA 5E4WA 1TI3A 20GSA 4K7IA 3A5WA 1GSQA 4YH2A 4HDEA 1SD9A 3FZAA 3LQ7A 4Q5RA 2B1LA 4PQIA 1UC7A 1GLQA 1LU4A 5GZZB 4EL1A 4NV5A 3EMPA 3GTUA 3UAPA 3FZ9A 5AGYA 3M3MA 2C4JA 6GSVA 1RK4A 2O87A 1V98A 1PMTA 3GNJA 1A8LA 2YWOA 4YQMA 3ZFLA 2AB6A 2VL2A 2MBSA 4HS1A 1T3BA 1EWXA 2RM5A 1XWAA 2CVKA 5ENUA 1PL1A 4WF4A 1CQGA 2KLXA 1SL1B 4NMUA 3IK9A 2MZCA 4XS6A 3P2AA 4HJ2A 4HZ2A 1T7PB 2PU9C 1GUMA
chains in the Genus database with same CATH superfamily
1Y6EA 2IPQX 4A0ZA 5F07A 1FO5A 5IQYA 3FMRA 4LOCA 2G9WA 1BN5A 5DM7F 1X9SB 1R1VA 2WDUA 3KYCB 3L4NA 2DK8A 2HWVA 2C3NA 4EM2A 2D45A 2X8HA 1EH8A 1FLIA 1GXPA 1T95A 2DA2A 2X1DA 3BG9A 3ULQB 1IF1A 2REMA 2ZBKA 1RUOA 2VL2C 4AJ8A 2PG4A 3EUAA 3HM5A 3KLNA 5CVRA 4OFMA 2NS0A 1FOWA 1PL2A 1W5CC 3G7JA 4G12A 2PPTA 2ZCWA 2R4VA 3L9SA 4PNGA 2IBDA 3ZOBA 4I7HA 2M7BA 5LRRA 1T4YA 2CAQA 2VM1A 3DEXA 1IN8A 1V54H 1M3JA 3KEYA 4EEFG 1JT6A 4UUSA 2IIYA 4QSHA 1M1EB 3TJJA 3RAZA 1ZH5A 2E36A 1FZPB 4F2IA 2LK2A 1WJDA 1Z3XA 1WCMJ 1HKTA 4HYEA 4A6DA 1IXRC 2JK3A 4XRFA 4G7HF 2IT0A 3QMXA 3CD6I 3ZMKA 3TW7A 4Q48A 3D4MA 4ML6A 2LEGA 4ZIJA 1TLHB 4A3FJ 3G4SI 2O8XA 2L2OA 5HDGA 3HVVA 3H0GJ 4XSZF 1DUGA 3F9KA 2B0LA 3BPXA 1TRSA 5KCMA 4EJOA 4A3IJ 1L3LA 5LNKe 3P7XA 3KP6A 3RYPA 4ULXA 4MFEA 1ETKA 3P9CA 1X1DA 2B1KA 3HOTA 4II3A 2I81A 3DXBA 3HC7A 4MCUA 1O3QA 1ETOA 4DSRA 2XSDC 1XVWA 4L5JA 3FZ4A 5DDLA 3UOMA 3C1RA 2N8GA 4XRSG 1DE1A 2K9SA 5M5XJ 3JRAA 2Q1ZB 2DQLA 2NS8A 1JUPA 3H35A 4NXIA 4CSWA 1I5ZA 5FLXZ 1NH3A 3B6CA 2H6BA 3ZPLA 3F22A 4ESJA 1SMTA 2OUMA 2IRFG 1YTYA 4GSNA 4PSWA 4LK0F 5DCMB 2YUSA 3K2AA 5IT3A 2O3FA 4ZDOA 4LLGF 5B8AA 2MBTA 2FWGA 1MBJA 3O8GA 1X0RA 3QPLA 2B5YA 1SANA 4IBPA 3FKJA 2HPMA 3WG9A 2RM6A 1D0ZA 2VE9A 4MH2A 1T8EB 3GMEA 2GTUA 1XGOA 2M3AA 3DVXA 1PX7A 1O7LA 1G3YA 1ZN2A 2QSFX 2WBMA 5L3CA 3ABLH 1EP8A 1Z91A 3A2VA 3FISA 4XRAA 4PTSA 2Z9OA 4CCNA 3C7MA 1HQCA 4IKFA 1TDIA 2CO5A 3HXSA 1JHHA 1FB0A 3BP8A 4E7SA 1XC5A 5IOZA 1JZRA 4P5OA 4KYWA 3AL0C 4BBRJ 2ZMEC 1SD4A 1FYLA 1BI2A 2ZB9A 3BR0A 3KZYA 4OINF 3ZMZA 3OYIA 2ZCTA 4GSSA 5DVBA 1YRNA 3TMOA 3L0HA 4IW9A 1V5GA 4KAEA 4ILFA 4UV9A 5HR3A 1K79A 2L0KA 2H66A 3IXRA 4D73B 4N9IA 3FXLA 1MBGA 4K5RA 1N2AA 5JCWA 3B6AA 1EF4A 1AXDA 2DKHA 4CZCA 1PUFA 3C71A 2DOFA 1LNWA 1W7PB 4JK1X 4G94A 3HRMA 2FXAA 4ENMA 1KTEA 2K9LA 2HVQA 2X6XA 3BZCA 2TDXA 1ON4A 3KZQA 2DFEA 2PMUA 1T98A 3L2UA 5D6EA 2AYTA 3ZIVA 2LY9A 3ZQIA 2FLSA 1BOAA 3AG3H 3P90A 4KUMA 5FJ8J 2IA2A 3EYYA 1KQ8A 2JSZA 4O5UA 1W1WE 5D6FA 3BOAA 3MFKA 4GLTA 2R6KA 4BVYA 2WV1A 3DKXA 2HDDA 5GTIC 1AOYA 2FQ4A 1O7UA 2MGQA 3U5RE 5GSSA 2HQNA 5JI6A 3K70D 1TU8A 2H30A 4WR4A 3HZ8A 2H6XA 2Y75A 3CQFA 4EC0A 1YO5C 22GSA 1T38A 3K4CA 3Q9VA 5D4SA 4F55A 1G0TA 3HJPA 3EYTA 4PGHA 5HS7A 5L3FA 2L5QA 1TC3C 3GSSA 1J0FA 1X3ZB 2KZVA 5CRHA 2V9VA 4RGRA 2RUFA 2CFOA 1P4AA 2PFBA 4JYKA 3M1EA 5J4VA 3S2DJ 2Z16A 4WBRD 2W25A 4KMFA 5E3NA 3BY6A 2DYRH 3CO7C 2GM4A 3UARA 2DMPA 1LBKA 1XOAA 2I5UA 1ZRCA 2H1DA 5E1WA 1OCRH 3R0AA 1IV8A 1Y0NA 4JR4A 2XAGA 4NBQA 4MZWA 2JPBA 3GURA 3S2WA 4I2UA 4ESFA 3FF5A 3TO7A 3GX8A 3IAS2 3GTPJ 4PJJA 2QGVA 3KH9A 1HYUA 2F2EA 1TWHJ 3E3VA 4KW6A 4O5QA 4ASNA 4HG2A 4WXCA 4WCGA 1KU7A 1IW7F 5IP6A 1JTYA 5ED4A 4UVBA 1ERUA 4EGZA 2FQ3A 4O92A 4JE1A 1AA7A 4RGSA 2LP0A 3HSFA 3A01A 4UXNA 2V1XA 1ZELA 4HDVA 2E34A 4MNNA 3VWXA 4EE0A 2QBYB 2BGCA 3DKWA 2ESNA 4ZZLA 1MNEA 2BHZA 3V8KA 1KBNA 5HFKA 1ZG3A 1EEMA 4OOIA 2A2RA 5B6NA 4KIGA 3JRHA 1RR8C 5DDGA 3MAJA 1E6BA 2B5XA 3T1BA 3PINA 4A3JJ 3KZZA 1T4ZA 4HX7A 3O3TA 4IHYA 3P8WA 3OIPA 3FR6A 4YAPA 1IO2A 1XIYA 2MA3A 4K5SA 3TKSA 3I59A 1FNNA 4I02A 3GZ5A 4MEXF 1WH7A 4MFDA 2LC2A 3LFLA 4LA1A 1ZKGA 5IYBJ 3Q74A 3S1RJ 4B3XA 4CY8A 2ID6A 2P5VA 1AQVA 4HJMA 5M3MJ 4AVZA 1I27A 2GXAA 4A5MA 1PGTA 3FK8A 2V6EA 3BR6A 1S9HA 1FBQA 5DD4A 3Q0VA 4RB1A 4BEHA 4IJIA 1Z7UA 5E8GA 3W6KB 3FXMA 2UUZA 3C3WA 2AAWA 3ZRDA 3ZZXA 2I8DA 2K40A 1FIPA 1WRJA 3KLOA 3BTIA 3HL2A 2IS6A 1IRXA 2RLIA 4XORA 2YWNA 2DT6A 5B5EC 2Y9ZA 1HDPA 1WJAA 4HAMA 4L0YB 5LD2C 2GGTA 4XL9A 3K1MA 5F6FA 1VQKI 2Y30A 4M9XA 4C9YA 4HQEA 4XTSA 4TV7A 4V2LA 3A2KA 1BI3A 3MQ0A 2K27A 2QQAA 4A3EJ 4K2DA 2XASA 4NQWB 4IQ4A 1QBJA 5E18F 2HXIA 5HS9A 2ZXHA 2ISZA 2X4AA 3TKSC 1BJXA 1YJ6A 1ENHA 3VYTB 2KMUA 4F3QA 2HDWA 5HLGA 3UKGA 1EZKA 2L4CA 4CCLA 3QYFA 3Q6OA 3SEZA 3L00A 1LKXA 3BCAA 4AVPA 2H8WA 4I2OA 2J5OA 2AV4A 3MN2A 3S3MA 3LXZA 2E19A 3FXQA 2QSGX 4MHGA 1BL0A 1WOUA 2E71A 2A69F 2W57A 3HJEA 4MTDA 3JRFA 2VM2A 3KP8A 5EZHA 3LSGA 1K78B 1A0FA 2R93J 4L0ZB 2IFQB 1I50J 1XGNA 4LMYA 1XVQA 4N0VA 3Q19A 4NHWA 4ZH4F 4HU7A 3TJGA 5BMUA 2YV9A 2K9MA 3MZYA 5AONA 2CJJA 3RKWA 3RTRA 2LJKA 4G0LA 3WE3A 1V40A 4MJCA 3BG5A 3QOEA 1QPMA 10GSA 5BRTA 3ZMTA 3MWMA 2CW8A 1OYIA 4F7ZA 2QSHX 1MD4A 2CV1A 2YWIA 1H88C 3CTFA 1B9MA 4EUYA 4B09A 5KN2A 1OC9A 4GFBA 5KVRA 1XG8A 4ZBDA 4XQFA 1VF9A 3FXKA 4HA8A 2JA8J 1BYEA 4TW5A 3HZ4A 3DPUA 4BUPA 1KNGA 2HU9A 3I4PA 2P7VB 1X1CA 2EZIA 1THOA 3SZTA 4RS8A 4FQUA 2LMDA 2O7OA 2HVSA 4UVCA 1JKRC 1IN6A 1F3AA 4Z2UA 1SKWB 2YNXA 2MD5A 1YQAA 1TQPA 3R2QA 2X48A 4O5VA 4PJNA 2A68F 2GZZA 2HSHA 3K1NA 4XSXF 4PUFC 5IPGA 1G6NA 4A3CJ 2X6YA 1R23A 5CP1A 1DSBA 4L0UA 2DOEA 2CQKA 1IGNA 5KOWA 4DEJA 1S3DA 2KRFA 2VN2A 4BE0A 1A35A 1DE2A 3ECHA 1MD0A 2HKOA 1J0RA 4RB3C 1ZR2A 1PX6A 3K4MA 4IEJA 3KYDB 2MBFA 2LD5A 2CX4A 3TKQA 4BWSA 1IN5A 3EU4A 2NVTJ 1B9NA 1GRXA 1IDYA 2O9LA 3I53A 4RAYA 1JT0A 3BTLA 1VQ9I 1RZ4A 3RQIA 1ETVA 2BYVE 3WHBA 4C2TA 3FY7A 3WE2A 2O7KA 2GIZA 1USTA 1VQLI 2OV7A 5IT9K 2W84A 5JWRB 1KA8A 3F0CA 4EXJA 1TQMA 2JPCA 4BDYA 2TRCP 1LQ1A 1MMDA 3ERED 4G6TB 1L0OC 2QCOA 4FQGA 1XCCA 1AHDP 3TO9A 2ECBA 1K3YA 2G0FA 4GXZA 4G9HA 3VWUA 2JQ7A 1TKDB 3N4MA 4NHZA 1BOBA 1USBA 3BCBA 2PN8A 4H86A 5J9CA 2HOSA 2PGTA 4PFOA 2M8GX 1BIAA 3G1LA 3HSRA 2EFWA 5CO3A 4GTUA 1VI0A 2DMTA 3ZXSA 5K7HA 2P7CB 3FM3A 3GKMA 3M8NA 3C1SA 3F4RA 4M9SA 2EH3A 1EH6A 1UG2A 4F03A 3BT9A 2NYXA 4BA7A 5ECLB 5EG0B 2EZKA 1KZHA 1LEBA 1GUKA 1YFHA 3CUQB 2G7HA 2ZNYA 4C30A 1WJ5A 1B59A 5GTHC 2V6KA 3K8NA 3H3UA 4QIWN 5KEJA 4YFNF 3ZQCA 5E3LA 4M74A 2R0CA 4IRHA 1TQIA 2QLZA 3TOAA 1F37A 4MF7A 4X1UA 4IF4A 4ENNA 2L7MP 3R4KA 1IRGA 1VZ0A 1R4WA 3WTYC 3SZPA 4YRVA 5E79C 4EM1A 1DUXC 2ZFUA 2H71A 1VGLA 4OO4A 3NRVA 1JKQC 2A2SA 2WA0A 3ELKA 3D0ZA 4CHSA 2R7XA 1JJ6C 2DA3A 3I58A 2P0GA 3ME8A 3VPRA 4XM3A 1BEDA 3BQZA 2EFOA 4JQFA 3ROUA 2MH2A 5JVGF 1UB9A 3GCMA 5L3BA 3CCUI 4BXXJ 4JBAA 4G10A 5F1RA 4KNDA 1NM3A 5F05A 2M34A 2ZJPF 1WJCA 3ZCOA 1HC8A 3DBRB 1TK5B 1S5LC 4C2MJ 4KCEA 1SU9A 1Z7LA 2X6OA 3GA4A 2L5LA 2LRTA 4GCIA 1LE8B 4WBJA 4O6JA 2R7RA 3EWLA 4EM0B 3O8HA 1M9BA 1UMQA 2HVRA 2YJ7A 4H4KC 4KJZA 3GEZA 3KP2A 4WXDA 2BY0A 4R79A 4M3EA 4DSQA 5GAGJ 2V1DA 5GAHJ 1SK0A 2BZTA 4IJ3A 5DCMA 2AQFA 1F2EA 4BHPA 3CMMA 3FZVA 4BS9A 4ITVA 3EVIA 2FX0A 3MVPA 5GPCA 3GVAA 2LYCA 3JRDA 3LOCA 3QU6A 5FGMA 1SFUA 3F23A 1YJ9I 1TXXA 1YIJI 1IG7A 1HOMA 1XWBA 3G7YA 3FMWA 4AJ7A 2M45A 3FXOA 2GSQA 3WU0A 3GLLA 1WGXA 4BXUA 4EVIA 2E2IJ 3C73A 3DVWA 3QAVA 5FKNA 2QQBA 3QR6A 3ZYWA 4ECBA 3GYHX 3RYRA 3QOUA 3TGZA 5CREA 5GAEJ 1K0BA 1FOYA 2VJ4A 5J41A 3RPUA 3HYIA 1I6XA 2CA8A 3KH7A 1MDJA 2OPTA 2H0GA 2HOTA 4AF2A 3BTCA 3OYKA 4EJWA 3EQLF 2ZSHB 2VKVA 5FKKA 2O85A 2C3TA 3K9TA 1R58A 3DEWA 1R9TJ 4OCFA 4LIVA 2VL8A 4JRRA 2AXTC 3D1NI 4C2UA 2O5RA 1IN7A 2DQRA 2F48A 2YPRA 3VB2A 1U0JA 2LRDA 4MQ9F 3OR2C 3A0HC 4CA0A 4D73A 1IYHA 1XBSA 1OKRA 2KPMA 4JOMA 3D5JA 2QKMB 2A4HA 3HDCA 1YITI 1W7PA 2V9KA 4F52A 3BJOA 1MNMC 3D22A 1BQ7A 1F3BA 1ZHFA 4KN4X 4J19A 3ED3A 2H6YA 5ECHB 3W6GA 4XKBA 5ECIB 4ZBBA 5ABRA 2R7OA 5J6XA 1FX7A 3IKTA 1OLTA 2ZSIB 5H20A 2K3FA 4GGGA 2ELKA 2Q2EB 4S04A 4MLOA 4RM3A 3B02A 2BBYA 3IUOA 1U9NA 1H9GA 3HPHA 1YW7A 4MNUA 1PD21 1R26A 1TP4A 4XRDA 1ZLJA 2CMPA 2EZHA 2KIFA 3DTKA 5J3LA 3HOZJ 1OCPA 4AUXA 3ZVJA 3AG4H 1BR1A 2QQ8A 1ZYRF 2P31A 4EKZA 3A02A 2JA2A 2OTJI 2LTPA 4ENJA 2KUCA 4NNJA 3FK6A 2YV7A 3M8FA 4XLCA 1SVMA 1MSEC 1W36D 1ETQA 5ECQB 4ZBAA 2LRNA 1QZEA 1TNTA 1WJEA 2F5FA 3TOBA 2R3SA 4Z6YA 1LJRA 4RDUA 1LDJA 4GO1A 2VASA 4NB5A 1W5SA 2UXXA 1YI2I 5KHDA 4XLAA 3OYMA 1LB2A 1OVNA 1QMVA 2P8TA 5G5EA 2GDRA 2R2JA 3RKYA 4N30A 2OU2A 3EUKL 1TWGJ 1G7OA 4Y13A 4JEDA 1NG7A 2HQAA 1REPC 4NPBA 3E0UA 1GV5A 4F92B 4JZQA 3J81Z 3QWLA 3IRAA 2HRAA 5J4UA 1AC1A 4KIBA 2XPVA 4HEA2 3RSNA 1XWGA 2VC1A 2KRCA 2OC6A 1T56A 1XSVA 2EZLA 3GF2A 4EJVA 2IMIA 3L78A 4RI6A 2DT7B 2JSYA 6GSUA 3E6MA 3OR5A 2FRHA 4L5EA 4K7NA 1ZGNA 2QF7A 3OS2A 2X1EA 4DW6A 2J23A 1ODDA 5JR3A 4OCEA 2IXSA 3BQYA 4EDYA 3I54A 2UV1A 2QBYA 1WE0A 1YEXA 2HZDA 4JP0A 2BY3A 4C3HJ 1P6RA 4U0WA 1JJ8C 1O85A 1ZL9A 2Z9SA 3FW2A 3FWEA 2X49A 3UNGC 2QC7A 4F0CA 5KK1A 4TOPA 3W2VA 3EU3A 5EVOA 1TTYA 2L59A 2W1OA 1P7JA 4BEHB 2WV0A 3LSZA 3HJMA 5IOWA 3BJ5A 4LLRA 3PNYA 3J7AY 1C72A 3HOYJ 4FYBA 4KITB 1JGGA 1Q98A 1Z05A 2JADA 4ECCA 2I10A 2DA1A 1ZYPA 3JTHA 4JX4A 2BJXA 3HHVA 1IUFA 3HBLA 1V9WA 2FCHA 1MZBA 3FXRA 5H5QA 4E7JA 2JVGA 1WKMA 2PX9A 2RNJA 1EOHA 3GUDA 3VPTA 2F4MB 4OAYA 1Y39A 3TEDA 3GIXA 1RW1A 3LYKA 5FRNA 3NQOA 3WHCA 3GZ6A 2YJHA 1IXSB 2LF7A 5DUKA 4XONA 3CRUA 2CH0A 4AM3A 3GMFA 2KP1A 4K0NA 4WF5A 1XS9A 3VFIA 3HOWJ 3HKRA 2VCWA 1U87A 1SVLA 2XB0X 2R7QA 2NNNA 4JX6A 5HLHA 1M9AA 4KSMA 4DYCA 2LDUA 1B9YC 3RDIA 1ZLKA 3VYSB 13GSA 1R6RA 1BAYA 3PSIA 1TZLA 3ERGA 4O7HA 1JXSA 2ELJA 2E60A 2IMKA 4R1HA 2OCCH 2L9NA 2K86A 2FNPA 2VQGA 2XV4S 2CQNA 3I5UA 3V1WA 3WT2A 1OC3A 2V6CA 3HGGA 3E1SA 4LLLA 3H79A 1XDSA 1RI7A 2VCVA 5CRGA 2F5EA 2Z33A 3HIFA 3WGDA 2NDOA 6GSTA 3RIRA 1PN0A 3IA1A 5F1JA 1XZOA 3DGQA 3TOUA 2OADA 4MZBA 1QZZA 3PIOF 1V58A 1YW9A 2GXGA 3SFZA 2QKLB 4FTHA 2IA0A 5EYRA 5DTDA 3E5XA 3WTSC 1AU7A 2DLXA 1BW5A 2X64A 2CS3A 2H1GA 3HVXA 2IN3A 3ZVJD 2HEOA 4CYCB 2COMA 5CYVA 5DQYA 1QVUA 2L7ZA 3GFKA 1SD5A 2VJJA 4G9YA 4XLNF 4QWQA 2R5YB 2V4JC 1OC9B 3UVTA 2PEXA 1JKPC 1UJ8A 4O3MA 2KQRA 1K78A 1O3RA 5FD5A 5FD6A 5LD0A 1UZCA 2ICWG 2X9DA 5EPFA 2IFQA 1Z5YE 4NUBA 4PCQA 2MABA 2A4VA 4TRXA 3U9GA 2E5NA 3K4NA 2HOEA 4IP1A 5DUIA 4Y4RA 2W7NA 3E9JB 1BW6A 2HYXA 2I4AA 1F9MA 4NWYA 3M3YJ 2JU5A 3NIVA 1X3WB 1QU3A 1YYVA 1GXQA 2ZFWA 3CQZJ 4J57E 5HLTA 4CGZA 2F5CA 4XRMA 3LAJA 2VIXA 1V5EA 3V42A 2BOLA 6GSXA 2HYFA 3EUHA 4BHCA 5FO5A 3CSHA 4HV5A 1T00A 1S7EA 2H27A 2LKUA 2CX3A 2DYSH 5J9BA 2E35A 3BROA 1ON1A 2GVPA 1JGSA 3D5RC 3GWZA 1Z9CA 2PLYA 1LDKB 4HLXA 1O8XA 5DS9A 3F21A 3I55I 5CRDA 1S72I 5AN1A 3K7AJ 2EV0A 4GWRA 3S1QJ 2A6TA 1UVZA 5F0HA 2UWMA 5CQEA 4QPQA 3VSKA 4IGJA 3T5XA 1PQNA 5HNFA 1QQ2A 2NOJB 3G1OA 5LLQA 3KD0A 1U9OA 3CCQI 1U2WA 2A05A 1P92A 1PA3A 2KZGA 4HF0A 5DM6F 2VKDA 4PZJA 4O32A 4EGYA 2J9HA 2CUFA 1FBUA 2LREA 4ID0A 1OC8A 1Z77A 3ZMVA 2DSAA 3IE3A 2NVQJ 4PX1A 3IPZA 2OKAA 4BL7B 3I0TA 2YANA 1ZRDA 3JRBA 5DAKB 2EFNA 3PM1A 3QU3A 4P1WA 2B5EA 3LSHA 2MMZA 1TBXA 2ZUPA 4IX7A 4C3JJ 4Q5QA 6PAXA 4L9VA 2EK5A 3EUHC 4HRIA 4A3MJ 2R37A 2YZHA 4UVAA 4MDCA 4EV0A 5A2QZ 4P9UA 2M87A 3GSTA 3ZMDA 1U5TB 2DA7A 2HI3A 4OAZA 3V8JA 2VPRA 3CSJA 1JHFA 4RAFA 2FMYA 9ANTA 1IXCA 2N5AA 1FT9A 3LQRA 4RAGA 5J47A 2NNYA 4N0BA 5K7FA 1JZWA 1V2AA 4PQ1A 5CAXA 3CLOA 2OBIA 2DODA 1SFKA 5ELGA 2X51A 2RVCA 4KMUX 2YR2A 6GSSA 1DGRM 2E7PA 5J5NA 1MJBA 2W85A 3PFYA 2P6SA 2VCTA 3JCUC 5CRWA 4ZILA 3PL8A 2E2GA 3A3TA 2DTRA 4PQHA 3DBHB 3GTMJ 2E5ZA 5F64A 1JE8A 2E1CA 2HGCA 1JKOC 5F06A 2DMMA 3O3KA 3BR3A 1ZGWA 3H93A 1TTZA 2FOWA 3SWLA 3JW4A 2AQEA 3GZNB 1Y56A 3E6BA 4E6KG 3PIPF 5HQPA 3H3ZA 2QVOA 3HHHA 1DGWY 1P9QC 5FFXA 2R7WA 5EG0A 1CF7B 1Q4JA 2EFQA 2CV4A 3F0IA 3NWTA 3CUQA 1U8BA 2YOIA 2P4WA 3ZN1A 3DBLB 1VQ7I 1OQYA 4LLNA 5C4XJ 4KT6A 5C4JJ 1UCRA 2XPDA 3LJRA 2GZWA 4L5LA 5EGOB 4NC8A 1ZYQB 2ZJ2A 3U1DA 1GP1A 3KEBA 2EIMH 1IYIA 2H0HA 4IKHA 3UL3A 4MEYF 5HNHA 2HT9A 5LCZA 3I71A 2H76A 3HTSB 3KIOA 4XLFA 1OE7A 4OFTA 4RB0A 4BQAA 2HQRA 2DA5A 3F6FA 4F9ZA 2DPUA 2C1YA 2JZYA 3TRQA 3W2WA 2JMWA 1QHHD 4QTRA 3FK7A 1APLC 3K69A 2HNLA 2QA2A 4UB6C 1A0RP 4DZPA 4JU5A 5GAND 2DFHA 4U7BA 1YW8A 1TW2A 5E1XA 5ID2B 5EZGA 1R5ID 3U1KA 2FJ1A 4PURA 5M5WJ 4KN7X 1XWKA 5JCUA 5ILSA 3IOSA 14GSA 4RA2A 1AIUA 2CQ9A 2FOKA 4BVXB 1BI1A 1U3AA 1LE8A 1J5YA 1QQIA 3FBNB 2K3PA 1FOHA 3GTKJ 2HQ5A 3CUQC 2NVXJ 4EO3A 2H73A 2KHMA 4HLYA 3RI4A 4Y7NJ 4FETA 2FBKA 1OISA 4BJTA 3IHGA 3MMYB 3QFBC 3ZIJA 3OYNA 4YKGA 3VODA 3WU2C 4ZL7A 1TU7A 1H9TA 3BR1A 3DF8A 3V7RA 1ONVA 3VFZA 1FMVA 3LSIA 2FA8A 2I1UA 4ZL9A 5LEKA 4NV5A 2H1LA 3EURA 2NVYJ 4A6EA 2ADUA 2B7EA 3ESWB 4V2FA 3L2WA 2UZKA 4J01A 1J75A 1I9DA 1ERWA 1M0UA 2IPAA 2CQ7A 2LG4A 3ZRGA 3CZ6A 1R00A 2JUCA 2YS9A 5FLXK 2HTJA 3APSA 1ITYA 1VQ5I 3U21A 1K6OA 2BTOT 3DV8A 2Y0SA 3V8LA 3S14J 4DVCA 3E5QA 1WP0A 3VURA 3S3NA 1HXDA 3P9IA 1G2HA 2PUKC 2HRFA 1WJKA 3A2WA 2E7XA 2EJRA 5HFIA 3KP4A 1B4QA 4BXFA 2VLTA 9GSSA 1I39A 1OCCH 1H4OA 2RC4A 5D9XA 4CXFA 5L3GA 1YF1A 3GX4X 4H0EA 2H6ZA 1K7AA 2DJKA 3FHKA 3ZR8X 2ISYA 2NPBA 4NC7A 3DEEA 4HBLA 4BWQA 1QGVA 2EWNA 1Z0XA 3S3OA 5DCGA 5K1YA 1KU3A 3A1YA 3WGXA 2HKXA 3DTEA 5IP9J 3AAFA 1U8RA 4K2XA 2HZEB 5FHIA 3UMAA 1A2LA 2DDAA 2A5WA 2GBYA 1T7PB 1WSUA 1R1TA 4MLYA 5G1KA 3LA7A 1ERTA 3GV1A 3NARA 2L4AA 4RB2C 4PSXA 4N0ZA 3LYPA 2F51A 4HOJA 4EIPA 3CCSI 2Q2EA 2VPLA 5JWQB 4E7LA 3BBYA 2L54A 2F4OB 2VAFA 3OMYA 3BZKA 1GSFA 2ZC2A 4B44A 1MBFA 2MH9A 4D5FA 1HW2A 3GTGJ 1SENA 2B3SA 1TK0B 4DSSA 1GUUA 1ZG5A 2MLKA 3IWFA 1W5TA 3HVSA 2KDZA 3PGTA 3VYUB 1O8WA 2VQCA 1TW3A 4GXOA 2EINH 1MMGA 3D0SA 4A0YA 1IRZA 1HNCA 3UEMA 1ZGAA 3OOPA 3ZMSA 2Q0OA 1JZDA 3UBLA 1PP7U 3OYBA 4A3DJ 1FB6A 5ECKB 3L2VA 2IS4A 1OYJA 2H19A 4BBSJ 2L6CA 4BPYA 3FEUA 1HF0A 2IJYA 4MZCA 1SMYF 4IVFA 1GHCA 1A36A 1S3AA 2P5RA 1NHYA 3HY2A 2Z2SB 2WULA 4G0KA 4EQQA 4HU9A 4X43A 3M07A 4XK4A 3OSFA 2VOPA 1F4KA 3HJOA 4Z2TA 3FM5A 4FE4A 4B43A 4AIKA 2XF5A 3I4NJ 3GTQJ 1FOVA 2XGEA 3E3EA 1DP3A 1BG5A 4Z7XA 2V41A 3CCRI 2H1BA 3KCCA 2V2GA 2BXYA 4XBFA 4BL0B 4AU7A 2D5VA 2E2HJ 5IYDJ 1X3UA 2YP6A 4X1EA 3UVHA 1A6IA 4KICA 3S9FA 1Z9HA 4MPFA 3CCMI 3UR3C 4M3BA 3VI5A 3M9JA 3PO3J 5ECMB 3WTTC 5AIVA 3ISPA 2EPFA 2H6CA 5GSTA 5INYA 1VNDA 1QA6A 2BVMA 1TJDA 1XOBA 2DA4A 4QQ7A 5C3EJ 3O76A 4A5NA 4QLCU 1FJLA 2MFZA 5IMVA 3H9JA 4AWXB 3FXJA 3SZGA 3AY8A 1PVEA 4ZJZA 4JR6A 5G5FA 4KUNA 3HRSA 3TO6A 4USSA 4FO5A 1W4VA 4PGGA 2M2EA 1B48A 4XNFA 4RMNA 1EP7A 1MMAA 2HR3A 4EJTA 2OA7A 4NDLA 2X0LA 4I6XA 1T2KA 3WYWA 3KFWX 2P5LC 1IV6A 2HZFA 2P81A 2VT3A 2MYGA 2X8CA 1B1BA 1XSXA 3NWSA 1UN2A 1K3OA 2EC4A 5F08A 4BAYA 3TKPA 2XAJA 1A04A 2K18A 5CKTA 1K4TA 5EY6A 4PJLA 3S17J 5JWOB 5EF6A 1VF2A 3DWVA 1EV4A 3PSFA 2D1VA 3BG7A 2MMOA 4Y17A 3SYTA 2GQQA 4YIFA 1QXHA 1J09A 1PRXA 4M72A 2K8VA 4PNFA 3QD9A 1B8IB 1QZYA 2FEZA 2CQQA 3BTJA 3RBTA 1WFXA 1H0MA 1HCRA 3IV5A 1DQUA 3TKSE 4IS0A 2QKEA 2GOMA 5LBQA 3F9UA 1GSDA 1VQ6I 3K4LA 3LFUA 3AG2H 2IEKA 2B9SA 1NK3P 2VCZA 4CYCA 1PP8F 5FLMJ 3N9JA 4HX4A 4KDUA 2KIQA 5IMFA 3G1MA 2CV0A 4K2EA 2R5YA 3S93A 4CO8A 2GLOA 1A8YA 2VBZA 19GSA 3N05A 2XHFA 3HGYA 3LXTA 3EC3A 2XDVA 1YX5A 3G6EI 3CCYA 3F8BA 5HDKA 2AS5F 5E17F 1ZQ3P 5BNGA 4X6AJ 4HF2A 2CZ2A 5HR0A 1WPKA 5IPHA 2A07F 3DFGA 2IP2A 7GSSA 2WWYA 4G7ZF 2WAQA 4AIDA 1BR2A 3OL4A 3TQNA 1LPQA 1J9BA 2K4BA 4F93B 2KT0A 2B7KA 1WI3A 2LNTA 3B73A 1OAZA 4BH9A 2QGUA 1MGTA 3DU6A 1KGSA 2EIKH 3LL7A 1YF0A 4L0WA 2HSYA 1N8JA 3E6CC 4GQFA 1YE9A 3G9BA 1ZG1A 1ETXA 1ZGJA 2L7FP 5HR1A 2XAUA 4ON0A 4QL7A 4BNCA 3LSKA 4M6VA 1KONA 2H8LA 1HDDC 1Z67A 4L18B 4KH7A 2M0MA 4IHSA 4BU2A 1M7TA 2C80A 4IN0A 4BHBA 3KJYA 4HSRA 5EEGA 3RCOA 3US3A 1MBHA 2XAHA 1Z6NA 2V32A 1SC7A 2TRTA 2XPUA 1EA3A 4IXAA 5DEQA 6GSYA 2W4SA 3H1CA 2XROA 3RKQA 1D5YA 2H8RA 3DIEA 4J56E 5ECSA 1N75A 1E2XA 3QAGA 4E4HA 2PBIA 3BZ6A 3KP5A 4MABA 2TCTA 2V1NA 2WRTA 4YKFA 1FSEA 4M3GA 3VPQA 2Y9YA 2RGVA 2COBA 4WR5A 2JT1A 3TDZC 3V4GA 4N4OB 4NHJA 3Q3SA 1FHEA 1K0NA 4BL7A 1F6MC 3HRUA 2LOOA 2XF7A 5DAKA 2LNSA 2M46A 2BVLA 3W3CA 4LL1B 3GKNA 4QPOA 3LAPA 2EIJH 2K8SA 4TVEA 3J7Yk 2WJUA 4DBQA 4ZTFA 3GUSA 1U5TA 3RPNA 2DTZA 1MDMB 1WVRA 3KX2A 2VOOA 2NVLA 3GHAA 3G2BA 2JZRA 1PSQA 1BJAA 4LGWA 2K9FA 3VDXA 1O4XA 1WPIA 5BMZA 1YJWI 1KYWA 1ON2A 1GSYA 2BW3B 2OJLA 4Q4ZF 3CO6C 4IELA 1BC7C 1ZREA 2PJRB 4IVNA 3H36A 4GSTA 5LFAA 1LUJB 2L01A 1TW9A 3KEOA 2XAQA 1BI0A 1TI1A 3P5JA 3R0JA 2XGXA 2DJ1A 1OYWA 2C3QA 2VIMA 4PXOA 1SJZA 5BS6A 4JBBA 3G7IA 5TRDA 5EEHA 4II2A 1IC8A 1ACIA 3S2HJ 2WTEA 4UUTA 1FP1D 1CF7A 1AUCA 2M9HA 1XDUA 1N77A 3CDIA 2L9SA 1SFOJ 3CDHA 5EJCA 1GT0C 4MF5A 3LQQA 4DIQA 4BY7J 4D1QA 4HX8A 3IP4B 5F0FA 5EGOA 4I5QA 4WWCA 1USSA 1JLWA 4D0PA 2LH9A 2TRXA 1U5TC 5GAPD 4LL4B 3HOXJ 2BMXA 3LSJA 2O6GE 3TKYA 1H75A 3ABTA 2JL4A 2WZ9A 3CCJI 2DCEA 1LFBA 1VQOI 2VQLA 2GLRA 1W7PD 1TT0A 1EKEA 2CW0F 2W48A 5D93A 3CMIA 1Q1VA 1XSDA 3L9VA 4ZXGA 1S3CA 2R3XA 5IPAA 2DXIA 4IL6C 3SJMA 1MJAA 4XMYA 4MJEA 1UHWA 3KETA 2STWA 2XB5A 4A3GJ 4KX4A 5ID2A 3PUFA 3DPLC 5D9VA 4UV8A 2AHQA 1FOKA 3KCMA 1G7EA 2IL3A 4M3DA 1RNLA 2FE3A 3IV4A 4ZB6A 1ILOA 2XC7A 1QFNA 4E70A 1D1CA 1TT5B 5H6RA 2MW8A 1ACVA 5J1UA 4ECIA 4BVXA 2FGXA 2GOXB 2GSRA 1OR7A 2KHPA 1K0DA 3L9UA 4HF1A 2ON5A 1GSUA 2P5KA 3HUGB 3IRRA 4GDFA 2XVCA 3KXOA 4HUAA 5DV5A 2PI0A 4D5CA 4IHUA 1VRSD 2JACA 5DJMA 4XLHA 4D7MA 5LEJA 3QAHA 2CG4A 4I99C 1J9IA 4HI7A 1WHUA 4POMA 4L5OA 5LGNA 5CLSA 1N25A 1Z6TA 4GCVA 5F04A 2HRKA 5IMCA 2MC4A 3ZP5A 3VWWA 2O03A 2DU9A 1Y1VJ 2JSCA 3MIXA 1ZK8A 3M8EA 1FSHA 3BDDA 4OIOF 1YZXA 1B72B 2N5FA 4TXOA 4XIHA 4Y3OA 4EMSA 1BJZA 3F8CA 4K0GA 4Y33A 3U2RA 4XKWA 2VOCA 3OYFA 4XRSA 2EA4A 1ULYA 4XKVA 3REOA 1O73A 2DJ2A 4OO5A 3LA2A 4D7NA 3ZL5A 1LVAA 3I9V2 3OYHA 2NBSA 4POBA 3HYPA 11GSA 1P4XA 4KT5C 2DC5A 4G6DA 2AHEA 2FHEA 2VD0A 4GRFA 2M72A 3ZREA 4RLFA 2FA4A 4KB3A 1QVTA 4FE7A 4Q5SF 2EIQA 2L9VA 2V1MA 2WY7Q 3LNQA 3D21A 4Z2RA 5D73A 3VK9A 4DSSB 4RGXA 2XKOA 3OYDA 3JRCA 2E7WA 4E7HA 1V5FA 3KMOA 4OIPF 3T8RA 1GNEA 4U88A 2QZ8A 1YKAA 5A5KA 3PUBA 4OD7A 2HZEA 4EATA 2GIVA 3F6VA 1GTUA 4TR3A 5TISC 4F82A 3COAC 1GL8A 3WTXC 4I6ZA 1G3SA 1ERVA 2IMFA 5FWGA 4ICYA 3QDNA 2CU7A 3F3RA 4FYCA 2L4QA 3APQA 3RHCA 2A61A 4V2NA 1E3HA 4J00A 2HRNA 3VWBA 1OCTC 1R4NB 4BIKA 4X0GA 1YIOA 5GP9A 3QYBA 4ANJA 2CUZA 4FISA 4U87A 2Y31A 3CC2I 1MMNA 2L3DA 1FVKA 2XKPA 3ZLPA 4EVMA 3BR5A 2RN7A 3IHUA 4ZB9A 3MYDA 5IOXA 1T0FA 1WJBA 3EMXA 3ZQHA 2L6DA 3F3XA 2OQGA 5F0CA 3O6BB 5GPAA 5BPIA 4RQXA 3Q9SA 2R0GA 2CRGA 4P96A 4M3FA 4ETSA 5LGTA 2GS3A 1MSFC 2H75A 5AIXA 2CV2A 2LS5A 4WETA 1TK8B 2PN6A 2VL3A 4XOPA 5CVUA 2XRNA 3GO5A 5DYMA 5CNWA 2F6CA 3K1PA 2Z1DA 1X4PA 1MW7A 3WGGA 1J08A 2LTKA 2KOKA 3MEXA 5BOXA 3E97A 4PFPA 2VONA 1AW9A 1VFCA 3ML6A 2H1KA 1JLVA 2QA1A 3CYNA 1PKZA 2IS1A 1R49A 4IP6A 4CYDA 4A12A 1ZYNA 2LSTA 1YLFA 3CCVI 4IHXA 3CBUA 1G8XA 1X1PA 3BLYA 2WFCA 1MDKA 4I8BA 3KP3A 1GTIA 3J81K 2A6HF 2DMUA 3QP6A 4S0HB 1LFUP 2R5ZA 3EE2A 3F8MA 2F5DA 1U6TA 2R7ZJ 3H1NA 3QCPA 3C18A 4RBOA 5LRSA 4O5RA 2D2ZA 1SYXA 5DALA 1MIJA 2CQXA 3KPHA 3IH3A 3IC7A 3ONQA 1N78A 4XCSA 3VI7A 5L3DA 4KISA 2H72A 3PR8A 4MP4A 3F4SA 2JVHA 1FWZA 2PQ8A 4BYYA 3F4TA 2Y0SN 2GT6A 3KTBA 3MNGA 4N11A 3M1CA 2FBIA 1POGA 2E1MB 2F8FA 2OBKA 1MKMA 3QRFF 2K02A 1RESA 3JAMZ 1B8XA 1D5VA 1XPVA 1D1BA 2OE1A 2KIMA 3W8JA 1SFEA 2OACA 3D6IA 4M73A 5J1YA 4N9HA 5D9WA 4MTEA 2DT5A 3K4BA 3FR9A 3F3QA 1ETYA 1VF3A 4FCYA 1UAAA 3IC8A 1WZ2A 2TIRA 3L2RA 4KDYA 3H5RA 1FBSA 2K9NA 1A5JA 1Y25A 1FEXA 2H70A 5ECOB 2RV8A 2Y69H 2QWWA 1E3PA 1R5PA 2IMDA 3KGKA 3K4JA 2YWMA 2VBWA 1PJRA 3HKZA 2LR8A 1ST9A 3IC4A 3OSGA 1R1UA 2F4IA 2WAFA 5L3EA 2QYOA 1J59A 1T33A 1FOXA 1V3FA 1B8IA 2XBIA 3DYRA 4UY8I 2ETHA 3A4CA 1H8AC 2F8AA 4N4NB 3HEFA 1F36A 1D1AA 1WRYA 1SKSB 1F1ZA 2HZTA 3Q0WA 1V4RA 2HTSA 3CP2A 1PDNC 4CICA 2GXBA 1JTXA 1MD3A 3PNVA 3GTLJ 4CZZA 3HOVJ 1GULA 3C2BA 1UA5A 2LJAA 1K6YA 2JRMA 1SD8A 3BCIA 5B8BA 5E8IA 3MAKA 1MH4A 4M6YA 1Z1DA 2RNGA 1ZCPA 2YCDA 3F8FA 1GSEA 4CUGA 3J80Z 3F6OA 3FIWA 2K6VA 1YQ1A 3O6TA 2NS7A 4LMWA 3TRXA 5K5QA 3MD2A 3GTOJ 2KP2A 3ZQGA 2VLAA 2VC0A 1FYKA 5D8LB 2FA5A 5J4YA 3MZHA 2XAFA 3DLAA 5JLXA 4MGRA 4TN8A 1DPRA 4A3LJ 2PBJA 3ZITA 3CMEI 3HB9A 3P9KA 3RZDJ 2GSSA 5DBQA 2BHYA 3AG1H 1YEPA 2FY6A 1XWCA 4L5IA 3DRNA 4ISDA 1T6SA 3GN3A 4ZTJA 2H09A 2JRTA 2KRHA 5HVQC 2H0IA 3IH2A 2PMZA 2ZXIA 5B6MA 4G2EA 3GLXA 2R92J 4MH3A 1Y1WJ 3N5OA 4HQZA 3HHGA 3QODA 4IJAA 3IL2A 2NAZA 4MJBA 5EDNA 1R22A 2VCQA 3PH9A 3TCOA 4HZ4A 1A24A 4XHMA 2GZPA 2H1AA 3IDVA 2MG4A 3HA9A 1SD6A 2NXNB 2EQRA 3CXGA 3LWAA 3CESA 1RKTA 2DJNA 2RUEA 4AYBA 2LUSA 3E7LA 4HNUA 3I69A 1RKWA 4I09A 3EETA 4BJ6C 3WT1A 3L2QA 3JR9A 1MH3A 1C0WA 2HFHA 1KQ0A 4HSTA 4B8XA 3RDWA 2VB6A 4DYRA 2DAOA 3EDPA 4M71A 3JSPA 1ZZYA 2AUVA 2VBYA 2ID3A 2O8KA 3RZOJ 2W24A 2OA4A 3GX0A 1U78A 3DMLA 2DMLA 3CCEI 1D0XA 3ERFA 2DIYA 2VQHA 3L1PA 4CY6A 2JZSA 4YAVA 1TL8A 2WADA 1O3SA 2XSJC 3A0BC 5FFZA 2NVUB 1XMAA 2ZJQF 3UIWA 5ILVA 1BX9A 1S7OA 1EH7A 4MMMA 3PNTA 4LB6B 2DK5A 2LKSA 4YG2F 1JZOA 4TR0A 4I98B 4YFKF 2YZUA 4ZDPA 1MDMA 4Y15A 3E6DA 2JZTA 4EIQA 1R7JA 2L5OA 3GRXA 4QL9A 2CUJA 5KAFC 2HYJA 5DQSA 2DDBA 1OFCX 3WTUC 4L9TA 2BW3A 2V1UA 4FHTA 2XHKA 1WMJA 1X5CA 5J3RA 3M9AA 4ACSA 4LD5A 5HFGA 2PJRA 1I3QJ 2WGRA 5HLIA 4XOTA 5A2QK 1GH2A 3SBCA 4XN3A 3N97A 3NOFA 1FY7A 5FKLA 2O0YA 3MZ8A 3QYEA 5CVJA 2FBHA 3WGHA 4YQUA 4E8HA 1ML6A 5IOYA 4G19A 3KIJA 4N10A 3AFHA 3VEPA 1O6JA 2P6TA 1T08B 2K85A 2ELHA 2KFDA 3QQAA 4ZYGA 2LBFA 2V7FA 2IA1A 4WK8F 3C1DA 4LG0B 4TR1A 3MSZA 1VQMI 5IMDA 1J7KA 1TRUA 5B3SH 5HOOA 3ABUA 3HG9A 3DP7A 3R61A 1G6WA 2C0GA 5H5SA 1U6GA 1V57A 2Z99A 2FD5A 1QPIA 1K4SA 4AGSA 4ZB8A 3RQ4A 5J8FA 5H6QA 3G3ZA 4C3IJ 1SKRB 5K5OA 1OYYA 2QENA 4AIHA 3IWZA 1SAXA 2C0DA 2HLSA 2GT5A 3ZQFA 4KA0A 2ZMEA 1RETA 4L9JA 3DPTA 3SDGA 1VQ8I 3IH4A 4ZZDA 1MTCA 2WAQN 3TDGA 2VLUA 3SDBA 2EILH 2NTOA 1SK2A 1MJ9A 4NV2A 1XW9A 1Z7PA 5B66C 1VQPI 1A23A 4YEJA 3EPZA 2DBBA 2HYGD 4U0YA 2LNBA 3FBIB 2JA7J 1ZR4A 1Y8QB 1TRWA 1KU9A 2PJPA 1X5DA 4HW0A 1SAUA 2XUBA 1XCBA 1BA5A 5A4WA 3QPMA 4PJMA 3LMMA 4DQ2A 3AKZA 2F3MA 4LB5A 3CUOA 1U88A 4PUSA 2OE0A 2KL4A 1B4PA 2UXNA 2QUFA 2Q8KA 1RPWA 3ABKH 3TGNA 1IZ1A 3VOEA 5LHHA 3ASOH 3WG7H 3FYGA 3GH6A 3MDKA 4TXOB 1HBXG 2NRAC 5IO2A 4ECJA 5ERIA 4K7OA 1I5GA 2OJED 3HUGA 3HOUJ 4BQOA 2EBIA 2D2WA 1R5GA 3JSOA 2LVSA 2KLOA 3MKLA 3JTGA 2KIUA 1TWAJ 3APOA 3DEUA 2Y2ZA 2VCXA 3S15J 5DJLA 1R4MB 4HPQA 4PK4A 1NTCA 1UG0A 5K5RA 3TBIA 1RRJA 2HDCA 4K1FA 1V55H 4FX4A 1LJ9A 2RAEA 2ZNZA 3BPVA 3KYLA 1Z3YA 3OS1A 2YU3A 1RR7A 2ZNMA 4KGIA 2R7UA 1B72A 5DCFA 1X5EA 2CUEA 2XF6A 2L02A 3W6JB 3C2GA 1Z6MA 3BJ6A 2FMLA 5CPRB 4LJZF 1FP2A 1PUEE 3V7CA 4PUAA 5C00A 3W2AA 3BJAA 2HE3A 18GSA 1JFUA 1YS6A 2W82A 3SFIA 2FNOA 3RPPA 1MEKA 4PDKA 2DLLA 3KP9A 5ECPB 4B48A 1KQ9A 4WF2A 3WU1B 3J7YJ 3NZNA 3JRGA 2VODA 5C04A 1SFXA 4ZC3A 2OZ6A 3FKIJ 3KP7A 3H5NA 5FKOA 1R5AA 5FRMA 3GYKA 2VD1A 4UHTA 4M6XA 4ZYDA 2CAIA 3TJFA 5JCGA 1PKWA 5G31A 2WCIA 1FC3A 1D0YA 1AQXA 3G71I 1UELB 1O3TA 2IMEA 3F6DA 3DKSA 3O2PE 3OY9A 2UZ8A 2GA2A 3S8PA 2KISA 3WODF 3BOQA 2Y48A 4LMVA 3MKWB 2YU9J 3A03A 5ELAA 4LK1F 2VXDA 4FT8A 3GW2A 3GFMA 2DOAA 4LITA 4E8EA 3OYAA 2A5YB 1A6QA 3KMNA 5IY5H 3ZGKA 2GWRA 2GZYA 2DA6A 2OZUA 1WQ2A 3SHFA 3IK7A 1G3TA 1X2MA 2KJBA 2YX4A 2X6WA 4DNCA 3JRIA 1XFLA 1HA8A 1BBYA 3SEQA 1Z7RA 2DBCA 2I3YA 1EV7A 3A2XA 4ML1A 5KN0A 5KN3A 2YN1A 4G6QA 2I9HA 2JJ7A 3G73A 3I6AA 2CVBA 1HNBA 1X2NA 3KM6A 4I2TA 4TKYA 1Q1HA 2ZKZA 5ICEA 1JI8A 3R60A 4HQSA 1KEBA 17GSA 2P0WA 2HOAA 3ABMH 1Y8RB 2V79A 5FROA 2R7SA 1P2FA 1SK1A 1XX5A 2XC2A 5TJJA 2MMNA 2LJRA 2RQPA 3UJ1A 1IJWC 2G0EA 3J7ZI 1GTBA 2WB1A 2MC3A 2L9RA 2R5ZB 1VF4A 4XS4B 2XPWA 3D5SC 4CHUA 1WIKA 3ME7A 1E0EA 1EEJA 3DQVC 4OFNA 5CJ9A 5DALB 3R3EA 4DBRA 4OIRF 3L9FA 3M8JA 3MKZA 2GSTA 5IMAA 4OMZA 2Y0MA 3LWFA 1D3YA 2K9QA 3S16J 2YPMA 4RM2A 1QK8A 2K7LA 2MMAA 5HS8A 1R71A 5AISA 4G8XA 3WD6A 1G3WA 5F0GA 2LQOA 1THXA 4MPGA 2HXOA 1I1GA 3KZIC 2IGNA 1YOVB 3IAM2 2VJIA 2HSMA 1GNWA 3Q5FA 3C8EA 5M5YJ 4MQVA 2KJCA 4XICA 2HFDA 1W89A 3I64A 2M30A 5KN1A 4A69C 4CH7A 16GSA 2R0PA 5GADJ 2QQ9A 4GRIA 4ABZA 4BGDA 3GXOA 2OE3A 2MLGA 3CTGA 1ZYEA 4EF0A 1DU0A 5ICFA 3CSIA 1K83J 1K3LA 3BG6A 1K0CA 5E3OA 3HRTA 2K4JA 5ILUA 2PERA 3HD5A 3K70C 2MD0A 3FDYA 4A3KJ 1DBYA 3OL3A 1RC9A 1M2BA 4POLA 1BR4A 4HZFA 3RKXA 1OMIA 4TXVA 3K10A 2EV6A 1EV9A 2GA1A 3BCKA 12GSA 3OIQA 3T0YA 2MSYA 1XGMA 2JWTA 4PGTA 4V2MA 3OYEA 1URMA 5HODA 3TKRA 1W0UA 3LA3A 1CGPA 3GKKA 1QO0D 3LORA 4UB8C 5M3FJ 4L8EA 3TP3A 2GQLA 1XMXA 4B4CA 3KE2A 3ZQLA 1TWCJ 2FWHA 2CGPA 1ZRFA 2E2JJ 2OTLI 1ABAA 5ICGA 1AKHB 2GQMA 3CTAA 1SYRA 4KFCA 4IHTA 3CLQA 1P4WA 3F8NA 3WGIA 1YG2A 3ASNH 4BKXA 3OS0A 4RLQA 5FT3A 3K0LA 1NW2A 5AIPA 1W0TA 3SXYA 3FHZA 2DJJA 2E1MC 1QGPA 4ZYEA 2BV6A 3GTUB 5IYCJ 1ZAOA 4LFUA 1K0OA 2XPEA 1JUMA 4F0BA 2ALBA 1FIAA 4L9NA 2X99A 2VL9A 5TGTA 1HKSA 3QP5A 1K61A 1Y0UA 3I4MJ 2HXKA 3BR2A 2DN0A 1SJIA 2LQQA 2LF8A 5A4VA 1VQNI 4HDUA 5DD8A 3DKYA 5BQTA 4X0XA 2WC2A 2VT2A 5IT9Z 3F72A 2CZ3A 4CDOA 5ECRB 2CW7A 3C7JA 5LHGA 4J2FA 3PO2J 2VUPA 1TWFJ 2IGMA 3H92A 1NHOA 4YELA 1SD7A 1A31A 3VLNA 3PQJA 2QEXI 3DWLE 3K6GA 2ESHA 2WB9A 5A4UA 2DJIA 2E2MA 1YJNI 4I0BA 4IRIA 2DJ3A 3H0DA 3CC4I 5CYYA 2V26A 2IWTA 4NAXA 2X4HA 2E1NA 4I76A 3IBHA 2DFFA 1GVDA 4HNVA 4AIJA 2XRLA 4I97A 1LEAA 4JX5A 2L7KA 3GH9A 3GFLA 1K0AA 4A93J 1GDTA 3HPGA 4IO9F 4V1Ag 3HSEA 3RHBA 1IDZA 4A2UA 2AXLA 2DMQA 3Q0UA 4CW9A 1W4MA 4YQVA 1P7IA 5G2ZA 5AIQA 5J8CA 2R7TA 2PMTA 4A0XA 3PJRA 1M2AA 5KOXA 3I3LA 1DU6A 1UFMA 4BDZA 4Q5FA 3QOPA 2MYSA 2IAIA 1KU2A 1YY7A 5D96A 1X19A 3W8SA 1HD2A 2VLVA 3RJPA 1DPUA 4E7ZA 1WH5A 4DGWB 2C0FA 2IS2A 1DDNA 3TP0A 1O81A 3HCZA 5BPDA 2DO7A 3A5IA 4IPAA 2B63J 1FG4A 2VUMJ 4MF6A 4WKWA 2G2QA 2HS5A 1RQMA 5E59A 3TJBA 3LSPA 5D4RA 4P3YB 1RUNA 3PFIA 4WEYA 4UUSB 3UBKA 2F5VA 2ECCA 4EJUA 1TRVA 1GUHA 2ZXWH 5D9TA 2ES7A 1E3OC 2P5QA 1BIBA 3K2ZA 3CCLI 1E2YA 1FTTA 5H5RA 1Z21A 2M5WA 3I43A 3BWGA 2LFBA 2HPIA 1GV2A 2LBFB 1S29A 4HV6A 5LHIA 1VF1A 4TR1B 4X4JA 2B7JA 1HW1A 2OCEA 2M7AA 1HSTA 1ORKA 2OBPA 3RPUD 4ZYHA 3HKZN 1HQOA 2CVDA 4MA9A 2CFXA 3LSMA 1BC8C 2VKHA 2ACJA 1OKTA 3HDDA 1YHQI 3FR3A 4GQCA 3DLLF 1FW1A 3MCZA 3OYGA 2A3SA 1WWJA 2GAUA 3GKXA 2N5BA 4AD9A 2OF7A 3AL0B 4MJAA 4MK3A 2ZMEB 1XN7A 3EYIA 1T8IA 1M2DA 1MNDA 2H01A 1HW5A 4OIQF 2PVQA 3CRTA 2FWFA 2JA6J 3JREA 1CQHA 3M1GA 3ZMLA 4LG0A 3OYLA 1XD7A 2A2PA 3TL4X 2C0EA 3H5AA 2FU4A 2ZJRF 4A3BJ 3U6VA 5CQGA 3DCFA 1AWCA 1I3AA 1DP7P 2O61A 3GL5A 3KTLA 4HSCX 5JHUA 1SL2B 1IUYA 2WAEA 1FVJA 1MBKA 2BE5F 1HLVA 1XGSA 2RREA 2DMNA 4R8HA 4B1RA 4W1UA 3H3VK 4WX9A 1MDIA 3DD3A 1E17A 2V6OA 2DW4A 2WS2A 5FLVA 2VE8A 3BD2A 3HVNA 1XB4A 4KDPA 1XW6A 2OD5A 1JHBA 1QUWA 5IIZA 5D5UB 5J1RA 2DI3A 2HNHA 2H94A 2LKPA 2WY8Q 1WI9A 3X2QH 3K4KA 2KKOA 4XKCA 5CVVA 1J2XA 1RIOH 3GL3A 3LG6A 3HOSA 4I0AA 3QAWA 3TB2A 2QSIA 4FH8A 4V19K 2E0QA 8GSSA 2OAZA 3F8UA 4IRGA 4GYGA 4UUVA 1A2JA 2PMZN 2IGOA 1I1SA 1ZARA 2EIOA 6GSWA 1YDKA 2LLKA 4KDXA 2Z3YA 3FRCA 4BE1A 4FX0A 4GYIA 2C6YA 1YRNB 4CDGA 4KNYA 2E1OA 5D8KB 3IHQA 3SQNA 1LFPA 2BY2A 4W97A 1IN4A 1FPQA 4RAZA 1IRFA 3DTIA 1HSJA 5EL8A 1WJFA 2C8UA 3L2CA 1EOGA 1T1VA 1M99A 1PUFB 3FXUA 2R0QC 2LSOA 3GFJA 3FZ5A 2LY1A 3M4OJ 3TW6A 2ZO4A 5LGUA 3H8QA 4AYBN 1S3RA 5F8BA 2M4GA 3JCML 2BEOA 3IRQA 1R5HA 3S1NJ 3T8TA 1BM9A 4AC0A 4V1Ap 3DXJF 3QPSA 1OCZH 1PFOA 3L09A 3DU5A 1G6YA 2G7UA 3CJNA 4GF0A 3H9QA 1B9XC 2FD3A 3F63A 1OR7C 3OV8A 4IZZA 4XS1A 2IW5A 5JVTA 2LRCA 2W00A 2CT6A 4AJ6A 4RI7A 1Y6IA 3E5UA 4Z2YA 3TJKA 3BG3A 1X1AA 4XLEA 5E1ZB 1T39A 3LGCA 1EGOA 4ZDLA 1FTZA 3FKFA 3MWHA 4RUVA 1STZA 2JTVA 2IVMA 5IM9A 1ZMAA 3J7AO 4IHWA 1S8NA 2DFIA 2JSPA 4S05A 2YSRA 1K0MA 4BACA 2CSOA 2FUG2 3NAUA 4IQAA 4OMVA 2H74A 1G59A 4TR4A 4BVYB 2EB7A 3LFKA 4E7IA 1R36A 1OE8A 3TUEA 2KDOA 3LSRA 2LKXA 2X1CA 3OIOA 5CVIA 4ESBA 1ZOFA 2RIIA 3TRPA 3CC7I 2JN6A 1F5TA 3ECOA 2FSWA 1PN9A 3H4KA 1Z3EA 2XGDA 2XBQA 3J7Yb 3L7WA 1D8KA 3OYCA 3FMQA 4HQMA 5K7ZA 4YIRX 3CMAI 4K6XA 1XW5A 1YKCA 5DCHA 5FB2A 2F9SA 4OWRB 1LVKA 4G0IA 1XXUA 1S7AA 1NK2P 4MO7A 4CCOA 3GFIA 2O89A 3V7SA 4U7DA 5IO0A 1QHGA 4B47A 1XCVA 2ON7A 5E20A 4POKA 1A2MA 1HKQA 1YS7A 2YX7A 1TP9A 3HZJA 2CWEA 3LEFA 1FYMA 1YX3A 3WTVC 3A01B 1GTAA 1R7HA 2FWEA 2O8VB 1F9NA 2VBXA 1GWCA 3D4TA 1SJ6A 4K9ZA 4KSOA 1FMWA 4Q5NA 2PMHA 1OJLA 5H2FC 1AQWA 3BC8A 1EGRA 2R5GA 3KEQA 4RQRA 3NEUA 2B6MA 3WGEA 2X8GA 1O57A 2PVOC 5L71A 4Q47A 4G7OF 2DJ0A 3ZN0A 1SVOA 2L57A 1MBEA 4KCAA 2XIGA 2EIRA 2R7DA 2DIZA 2FNAA 1XG1A 3IR4A 3I59B 4IQ1A 5G30A 4BY1J 2JUGA 1GLNA 2IGKA 4FYUA 1JUSA 4P55A 5B7CA 3EINA 5EEAA 3CF2A 1TOFA 1ETWA 3CJQB 1ZTRA 4K8MA 5G1LA 1GLPA 4XS4A 2D1HA 1SEUA 1T0FC 4HOBA 1S3JA 4E7KA 1SL0B 1H89C 1XMKA 2ME6A 3S1MJ 4OU0A 3W6VA 2KP6A 2GQKA 1OCOH 3RPQA 4KA4A 2LV3A 3ERWA 3D5LA 4KE3A 2HI7A 2VI6A 3C2HA 2RDPA 3CP8A 1NSWA 5FKMA 2PWJA 1U3IA 4YIIA 5J40A 2DPDA 3ISOA 3QPTA 2M1BA 5D5VB 1VQ4I 5HR2A 1X9WB 3I56I 2BY1A 1OPCA 3OYJA 4B3AA 3QFAC 4U0VA 3ZFBA 4BQNA 3S32A 3M7GA 1B4AA 3M0FA 4PJ0C 2EV5A 1NHAA 1OKDA 4DYQA 4HNTA 1NG6A 5ECNB 2OQRA 3H9GA 4A5PA 2R7FA 2M80A 3Q18A 2M0CA 3HXLA 3FHNA 1F43A 2Z5UA 1X58A 4M9ZA 2V9PA 3FMSA 4BE2A 2J5PA 4IHVA 4DZJA 1MMSA 2ZXJA 4CCKA 3CMYA 1GSSA 4OWYA 4FASD 3PQKA 5D8IA 4ZL8A 4EDZA 2QA4I 3CJTB 1X9MB 4BQQA 4FIWA 4NC6A 2VO4A 3HTUA 1FAAA 3ZTLA 2RQQA 3VYRB 1X1BA 3CJRB 4WXTA 5COHA 1HNAA 3VWVA 4XIDA 1Z6RA 2AJQB 3TOTA 1I6HJ 4UNOA 2EA2A 1W36C 4CCMA 1AAZA 3M9KA 5E4WA 3E0JB 4NQWA 3R6SA 1UHSA 4P9FA 1TI3A 20GSA 4K7IA 2EFPA 1KYZA 3CDLA 3A5WA 1GSQA 4YH2A 3ERMA 3JAMK 1WWXA 3MKYB 4HDEA 2RKHA 1SD9A 5E3MA 4ZYAA 3ZQQA 1XPXA 3FZAA 3LQ7A 3PPUA 4Q5RA 2QM3A 4CCJA 1X4OA 1O7FA 1IAWA 4OMYA 2VJ5A 1ERDA 3TDUC 5IP7J 2LY2A 3VSLA 5JHFA 2IJLA 4IOAF 2B1LA 2FF4A 5IMZA 2BXZA 3IKVA 4V2GA 1AKHA 2JA5J 1UC7A 1QNTA 1EJ9A 1S6LA 1GLQA 4PQIA 3OOUA 1LU4A 5D5WB 4RGUA 5GZZB 4EL1A 4IOCF 4BJ5C 3EPTA 5D5XB 2VKEA 2VXZA 5JLWA 2R4GA 2M4KA 2CYYA 3WTWC 1VTNC 3EMPA 3GTUA 4WXHA 3FZ9A 3UAPA 2NOGA 3OR1C 2DKIA 5AGYA 2R7VA 3M3MA 2C4JA 1B6AA 2K5CA 4XN0A 6GSVA 3LSTA 4DJAA 1RK4A 1XTAA 3FX3A 4KIFA 1V98A 2O87A 3P7NA 2L4MA 5C44J 3WTZA 1PMTA 3GNJA 5B1AH 1UHMA 4LG3A 1A8LA 2YWOA 4YQMA 3ZFLA 2AO9A 4YFXF 2AB6A 4DOZA 2X85A 2VL2A 2MBSA 1PYVA 4HS1A 2STTA 1T3BA 5JFRA 1U3EM 1CQTA 2ME0A 1EWXA 2WB1N 2RM5A 1XWAA 3ZQ7A 4XLPF 2CVKA 5ENUA 1PL1A 1M3IA 5B1BH 4WF4A 3J80K 4ENKA 5HDNA 1QRYA 1CQGA 4Y52J 3GTJJ 1G4DA 2KLXA 4I01A 1D8JA 3QPHA 4LIUA 5F27A 1SL1B 4NMUA 4XR6A 5KNLA 3IK9A 2MZCA 4XS6A 3GBGA 3ZMUA 4IQJA 2M8EA 2A6EF 3OWTA 3P2AA 5KAIC 4HJ2A 1LDDA 4D9JA 2XGCA 3LW9A 5ICCA 4HZ2A 1TNSA 4F91B 3CF5F 4KF9A 2PU9C 1GUMA 1GVJA 4MIMA
chains in the Genus database with same CATH topology
1Y6EA 5F07A 1FO5A 5IQYA 1X9SB 2WDUA 3L4NA 2C3NA 2X8HA 1T95A 2X1DA 2REMA 4AJ8A 2VL2C 3EUAA 4OFMA 1PL2A 3G7JA 2PPTA 2R4VA 3L9SA 4PNGA 3DEXA 2M7BA 2CAQA 1T4YA 2VM1A 3KEYA 2IIYA 3TJJA 3RAZA 4F2IA 1WJDA 1Z3XA 3QMXA 3ZMKA 3D4MA 4ML6A 2LEGA 4ZIJA 2L2OA 3HVVA 1DUGA 3F9KA 1TRSA 5KCMA 5LNKe 3P7XA 4ULXA 1X1DA 2B1KA 3HOTA 4II3A 2I81A 3DXBA 3HC7A 4MCUA 4DSRA 1XVWA 3FZ4A 5DDLA 3UOMA 3C1RA 1DE1A 2Q1ZB 3H35A 4NXIA 4CSWA 2OUMA 4GSNA 4PSWA 4ZDOA 5B8AA 2MBTA 2FWGA 1X0RA 2B5YA 4IBPA 3FKJA 2HPMA 2RM6A 1D0ZA 4MH2A 1T8EB 2GTUA 3DVXA 2M3AA 1PX7A 1EP8A 2WBMA 3A2VA 4XRAA 4PTSA 4CCNA 3C7MA 4IKFA 1TDIA 3HXSA 1FB0A 4E7SA 1JZRA 4P5OA 3AL0C 4LL1B 2ZCTA 5DVBA 3OYIA 4GSSA 3TMOA 3L0HA 4IW9A 1V5GA 4KAEA 4ILFA 5HR3A 2H66A 3IXRA 4D73B 5JCWA 4K5RA 1N2AA 2DKHA 1AXDA 4CZCA 3C71A 1KTEA 2K9LA 2X6XA 2HVQA 3KZQA 4Q5FA 1ON4A 3L2UA 3ZIVA 2AYTA 2FLSA 3P90A 4O5UA 2JSZA 3BOAA 4GLTA 2R6KA 3DKXA 3U5RE 1O7UA 5GSSA 3K70D 1TU8A 2H30A 4WR4A 3HZ8A 2H6XA 4EC0A 22GSA 3K4CA 4F55A 1G0TA 3HJPA 3EYTA 2L5QA 3GSSA 1J0FA 2KZVA 5CRHA 4BVYA 2RUFA 2CFOA 4WBRD 2Z16A 3UARA 1LBKA 1XOAA 2H1DA 4JR4A 4MZWA 3GURA 3GX8A 3IAS2 4PJJA 2QGVA 3KH9A 1HYUA 4O5QA 4KW6A 4HG2A 1ERUA 4O92A 4JE1A 1AA7A 1ZELA 4MNNA 3VWXA 1MNEA 1KBNA 5HFKA 1EEMA 5B6NA 2A2RA 1E6BA 2B5XA 3PINA 1T4ZA 3O3TA 3P8WA 3OIPA 3FR6A 4YAPA 1XIYA 4K5SA 3TKSA 2LC2A 3LFLA 4LA1A 3Q74A 4CY8A 4B3XA 1AQVA 4HJMA 4AVZA 1PGTA 3FK8A 2V6EA 1S9HA 4BEHA 4IJIA 2AAWA 2UUZA 3ZRDA 3ZZXA 2I8DA