3IAM2

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
179
structure length
179
Chain Sequence
GFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 44
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3iam201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3iam202
2D2ZA 2R6KA 4K7OA 2OKAA 2I4AA 1WIKA 3GL5A 3D21A 2C4JA 3C71A 3LSZA 2H0HA 1SK0A 3F9UA 4K7NA 2ALBA 1WWJA 3O6TA 1OKDA 1XOAA 4OFTA 4K9ZA 1X5CA 1GSDA 3GX0A 2EIRA 3TJKA 1YKCA 4I2TA 1SJ6A 3RHBA 3WYWA 4HQZA 3LORA 3ZFBA 2IMIA 3R2QA 1DSBA 4H86A 5B8BA 4GCIA 1B4QA 3G7YA 1ERTA 2CZ2A 3RPNA 4TVEA 1GUHA 2LJKA 2QSIA 3DVXA 1PRXA 1QFNA 1G6WA 1K3OA 5CRHA 3L78A 3HZ4A 3VWWA 4O5RA 3VPQA 1Q98A 3QAVA 4NV5A 1RQMA 5F06A 1PKWA 5ECQB 3TJJA 1Y25A 2GSQA 3IBHA 2V32A 1BAYA 2LS5A 1TU7A 1A0FA 3O76A 3TOTA 5EY6A 3FZ5A 1YEPA 2P5QA 4JR6A 2XPEA 3J7Yk 1YQ1A 3LJRA 1MD3A 2YV7A 4Q5QA 3UL3A 2PWJA 3CSJA 5ECHB 4AJ8A 5ECRB 1TW9A 4K7IA 4F9ZA 2H6YA 4K2DA 4MDCA 1U6TA 1O8WA 5LNKe 2HI7A 4ULXA 14GSA 1SD9A 3ZIVA 4ZBAA 3ERWA 2P31A 4XS1A 3KJYA 4V2LA 2H6ZA 4WR4A 1T00A 4L8EA 1A2LA 2VCQA 2BJXA 2HRFA 1JZRA 3BBYA 1KNGA 2PGTA 4BWQA 3KP8A 3UBLA 4XRDA 5DDLA 4IJ3A 4LA1A 4Z7XA 3GYKA 4J2FA 1SENA 3TRQA 3QMXA 5LD0A 1T8EB 2IPAA 5AN1A 2YPMA 1EOHA 2VAFA 5G1KA 3EE2A 2GGTA 4ZB9A 1AQWA 1SL1B 1MDIA 1T7PB 1OE7A 1TDIA 4GLTA 5JWQB 4PQHA 5A5KA 1Y6EA 1Z6MA 4JEDA 3IAS2 1M9BA 1GUKA 2VM2A 2QC7A 3AY8A 3GNJA 3W6GA 5HQPA 3GUSA 3BJ5A 2IN3A 3ZMLA 2O89A 1X5EA 3FR9A 4WXTA 1M2AA 4ZB6A 5JCUA 3QAGA 5FHIA 1A2MA 3CSHA 2X99A 3VWVA 3VK9A 5CRWA 3TB2A 2GDRA 3Q19A 1QGVA 4OFNA 4EC0A 4G19A 1XW9A 1QK8A 2RUFA 3ERFA 2WCIA 2H72A 1ST9A 1KEBA 4X1UA 3F6DA 1OC9B 3RBTA 2DIYA 1CQGA 1NW2A 1Z7PA 6GSYA 1THOA 5DBQA 1XVWA 2AV4A 2H1DA 1MDJA 1XOBA 1XXUA 4MF6A 4F2IA 2HT9A 2MBTA 4TW5A 1R7HA 3A2WA 2QGVA 1SJIA 3GA4A 2ES7A 2H0IA 3VLNA 2HZEB 2KOKA 2ZNMA 1K3LA 1K0CA 4TOPA 4GSNA 4YAVA 3KD0A 12GSA 4F0BA 1THXA 3Q6OA 1JZWA 4IN0A 2IIYA 3ZTLA 3WD6A 4OMVA 4PGTA 3QOUA 3LG6A 1PL1A 4FYUA 2VCWA 4F0CA 3US3A 3TJBA 1WE0A 2VM1A 1TOFA 1F37A 1SKRB 2F8FA 1N2AA 3H4KA 4WBRD 3ZITA 2GQKA 2GS3A 3F0IA 7GSSA 4JRRA 3DWVA 2C0GA 4IBPA 1TJDA 1B48A 3FZ9A 18GSA 3IK7A 4KGIA 4KH7A 1USBA 1VRSD 3IAM2 2K9FA 2EIQA 5JWOB 2FWFA 1TRUA 3RDWA 4GQCA 2FLSA 3LGCA 2JZTA 2KP1A 1QQ2A 2XBIA 2LRCA 1Z7RA 2MYGA 2FGXA 1V9WA 2VCXA 2GZPA 1ZYEA 2E2GA 4D73B 2H70A 2VLTA 4XS6A 2R3XA 1TXXA 4IQ1A 5IOWA 2L59A 3HD5A 5IIZA 1G7OA 2XPDA 3A2XA 1M99A 5CAXA 5KN2A 1TKDB 2F9SA 3KXOA 2M46A 4POLA 3I9V2 4MZBA 4MH3A 4K6XA 4EL1A 5ID2A 3Q74A 2B1KA 3FEUA 1TU8A 3HCZA 3N5OA 1K0OA 3TCOA 3IHQA 3GKKA 1TP9A 3VPTA 3UJ1A 1TRWA 2DLXA 4EDZA 1AUCA 2AUVA 2X8HA 2MMNA 2JZSA 22GSA 3TRPA 2GQMA 4CDOA 1FG4A 3GRXA 3IA1A 1J9BA 3KH7A 5ECNB 3EMPA 4XS4B 2CX4A 3IV4A 3WT1A 4Q5FA 3QAWA 4HZ4A 2JZRA 3LYKA 4KCAA 1EV4A 2BMXA 3H1NA 2H01A 2H1AA 2LQQA 2H8LA 4IVFA 1GH2A 2CVDA 5ENUA 2LSTA 2LRNA 1R26A 2YWNA 2LNSA 1XWGA 4CHSA 2L5LA 1A0RP 1A8YA 2DJKA 4I6XA 2HE3A 1HNAA 1TRVA 4L5OA 2WRTA 3FZ4A 3ZVJA 5J5NA 2I81A 1FOVA 3LYPA 1LBKA 3G7JA 5D96A 3V1WA 3UAPA 4HEA2 1M7TA 5HFIA 2PUKC 3VWXA 1ZZYA 2HXKA 1FB0A 2LJAA 5DALB 2L4QA 2OBKA 5C00A 4AF2A 16GSA 3VI7A 3ZMKA 3VWUA 3KP9A 1XPVA 1PX6A 1LJRA 1GSUA 2B7JA 1MEKA 4ZXGA 1PN9A 3P8WA 5AIVA 1GTIA 5B7CA 2WULA 3L4NA 3HYPA 5DQYA 2GLRA 1H4OA 3GTUA 3M9JA 4WF4A 3P7XA 4IKHA 3VURA 3HKRA 19GSA 1GSQA 5H5RA 1M0UA 1V2AA 3APSA 4YAPA 3ERGA 4JU5A 5B8AA 1ZCPA 20GSA 1DE1A 4IELA 3TJGA 1JZDA 4MZWA 3TRXA 4RQRA 1DE2A 2LTKA 8GSSA 3BOAA 2G0FA 1BJXA 5A4VA 2DJJA 4BL7A 1ILOA 2FY6A 3DVWA 5AGYA 2YV9A 2NTOA 1E6BA 3D22A 1IYIA 2GZZA 1S3CA 3G7IA 4IP1A 1B4PA 3GMFA 2V6OA 5CREA 1EGOA 1A23A 3LEFA 3K8NA 2YWOA 10GSA 3ME8A 3F3QA 2PVQA 4ECCA 1WPIA 2GT6A 1EOGA 4NHWA 2H71A 4TR1A 1AXDA 2F3MA 1ZGNA 3KZQA 1XCCA 4NHZA 3FR3A 1GTBA 4AJ7A 4HJMA 1OKTA 3EC3A 1AQXA 2IFQA 2L6CA 4GQFA 4PQ1A 1WRYA 1B9XC 5AISA 2H76A 5H5SA 4TR3A 1EP8A 1IYHA 3FY7A 3IR4A 4HQSA 2YJHA 2WB9A 3E9JB 4WKWA 1JLVA 1V57A 1OVNA 1FVKA 4KDXA 1NHOA 2MBSA 4MLYA 4NMUA 1PKZA 2O85A 4OCEA 4XHMA 1AC1A 1HNBA 2H19A 4KNDA 1TK5B 1FO5A 2OJLA 3UOMA 2H0GA 1GWCA 2RUEA 4Q5RA 4PQIA 5IMAA 4MK3A 2PBJA 4YQVA 4OD7A 2I9HA 4KAEA 4WR5A 3OR5A 1WMJA 2AJQB 3FKFA 2H75A 1F3AA 2OE0A 3CTFA 1Q4JA 2AB6A 1O73A 1O8XA 1WJKA 2XHFA 2C1YA 3APQA 4EXJA 2K8SA 2M72A 2IMKA 4GXZA 2TRCP 4G2EA 2OBIA 3O3TA 2P5RA 2K18A 1MDKA 4QQ7A 3C73A 4DEJA 1FAAA 2C0DA 5CYYA 3HXSA 3MNGA 3FK8A 1VF3A 1A8LA 4HU7A 1GP1A 4POBA 1M9AA 4KE3A 1TK8B 2GTUA 4N11A 5HFKA 3M1GA 1U88A 1HQOA 2YNXA 2G2QA 3HJPA 4TR4A 4EKZA 2JU5A 1U3IA 3A3TA 5IO2A 5B6NA 2B1LA 3H93A 2PERA 2VL9A 4FIWA 3HA9A 4WF5A 4ZL7A 2L5OA 3HHVA 3UVTA 4ML6A 1BQ7A 5ELGA 3KGKA 3KIJA 3N9JA 1LU4A 5DAKA 4RI6A 2V6KA 5EVOA 5L71A 2C8UA 2CZ3A 3LXTA 1EZKA 4V2MA 1JFUA 3D0ZA 5D8IA 1HNCA 3FRCA 3HVXA 2YP6A 2OADA 1FHEA 4HS1A 4WETA 5IMVA 2DJ1A 2DSAA 1OE8A 4FH8A 1ABAA 1F9MA 2HSYA 1NSWA 4O92A 4MABA 1SKWB 3IK9A 4PUFC 2N5FA 3I43A 3TKSE 5KEJA 3CTGA 5GSSA 1K0AA 2KUCA 2YANA 1S3AA 4MPFA 4YH2A 1ACVA 2L4CA 4MF7A 4GWRA 3GL3A 5D93A 3GSSA 3IE3A 4TXVA 1YEXA 2R37A 1PMTA 3J7Yb 2QKEA 5HR1A 2PMTA 1XFLA 4BVYA 1BYEA 4FO5A 2RIIA 1G6YA 2WFCA 2V2GA 2E2MA 3E3EA 3WGXA 3MWHA 1EGRA 1O81A 2EIOA 1KBNA 3EVIA 2AYTA 6GSSA 1ZOFA 1RW1A 4ML1A 5D9VA 3HZ8A 3DIEA 4HI7A 1ML6A 4ZIJA 3F6FA 4EF0A 4XTSA 1TI1A 1FW1A 2WZ9A 4OO5A 1SL2B 3H79A 1TRSA 3ZZXA 5KN1A 3C1RA 2HLSA 5HR2A 3F4TA 1R5PA 4F03A 2DIZA 4KSOA 3FR6A 1K0MA 3A2VA 3ISOA 5G30A 1EV9A 3GFKA 1EWXA 4TXOA 1UA5A 5HR0A 4I5QA 2OE3A 1PSQA 2FNOA 1T4ZA 4OFMA 3DXBA 4QL9A 2O87A 4ZILA 4HU9A 3KCMA 1YZXA 5KN3A 3D6IA 6GSWA 1MD4A 2R2JA 3TKQA 1XW5A 2WJUA 5ECMB 2CA8A 4HJ2A 1UVZA 4G10A 3ZYWA 2GSRA 1SU9A 2YOIA 2L6DA 1AAZA 1I5GA 2B3SA 3CRTA 2L57A 5IQYA 1R5AA 4IJIA 1YDKA 3QR6A 1T4YA 3D4TA 3F4RA 5CP1A 4GSTA 2VIMA 4K8MA 2LJRA 4JR4A 2HYXA 4BPYA 2J9HA 1DUGA 3QPMA 4TN8A 1YJ6A 2YJ7A 2XBQA 1F2EA 3KTBA 1V98A 2NBSA 2H66A 3H8QA 2B6MA 1QMVA 2ON5A 3L9UA 3EYTA 3CSIA 3GKMA 4KSMA 5F05A 3U5RE 3KMNA 4BVXA 4BWSA 3WGEA 1GUMA 5J9BA 5JCWA 3L9VA 3EURA 1JZOA 4L0UA 2F8AA 3SWLA 2YZUA 1VF2A 2CVKA 4WBJA 2FCHA 4K0NA 1GSEA 3QFAC 2FHEA 2VD0A 1F3BA 2NPBA 5A4WA 3IRAA 3M0FA 2LNTA 2IWTA 3BD2A 4TKYA 1SYRA 3CYNA 4NV2A 4POKA 4O32A 4EVMA 1J08A 3UIWA 1VGLA 1AIUA 1SK1A 2CAQA 5DVBA 2FA4A 1XZOA 1MTCA 3TJFA 2CX3A 1VF4A 4O7HA 5IPGA 2WS2A 2OA7A 3KMOA 1B8XA 1C72A 2MMAA 3RPPA 4MJBA 5F0GA 3L9SA 4MJEA 1NM3A 5IMCA 11GSA 2VUPA 1JLWA 4JBBA 3ZVJD 1QXHA 2PN8A 5DQSA 1TI3A 4IW9A 6GSTA 1SL0B 2KHPA 2IMEA 3LQ7A 3MAKA 4LMWA 2PPTA 3NZNA 4L0WA 1GL8A 4PNGA 2LRTA 4XIHA 2X8GA 4N30A 3KEBA 1V40A 3QCPA 2KLXA 2IMDA 4MA9A 5DCGA 2DMLA 4PX1A 2H1GA 1HD2A 5LCZA 1GNWA 2WGRA 3F4SA 2LQOA 5IPHA 3APOA 2ON7A 4YQUA 4GSSA 4FYBA 3IXRA 2R4VA 1PL2A 1DBYA 2VD1A 4N10A 2I1UA 4ILFA 1M2DA 3NOFA 1RK4A 2CVBA 1GRXA 3M9KA 4TR0A 2MZCA 2K6VA 2C80A 4DSSB 4J56E 3GURA 4X0XA 3QFBC 2JSZA 1SJZA 1X9WB 1Z3EA 2H74A 1ERVA 3GN3A 2IL3A 4RQXA 5J41A 2IJYA 4MMMA 4MF5A 4EUYA 3Q18A 4NWYA 3C8EA 2E7PA 4ZL8A 2VOCA 5GZZB 1ERWA 2DBCA 2JL4A 2CV4A 5IO0A 3FW2A 5J3RA 4N0VA 2VLUA 2LKUA 4MH2A 3QDNA 4XCSA 4V1Ag 5B6MA 3MSZA 2LUSA 4I8BA 4ZBBA 3VFIA 4HDEA 5ID2B 3CXGA 1V58A 4EDYA 4PUAA 1O6JA 3W8JA 2O8VB 5D9WA 5DJMA 2O7KA 5C04A 5D9TA 4MJAA 2B7KA 4K0GA 2C3QA 1BEDA 17GSA 1OC9A 3U6VA 4DVCA 2DC5A 1FB6A 5F8BA 5G2ZA 1FVJA 3TDGA 5DCHA 2LEGA 2FA8A 3P2AA 3ZIJA 4Q5NA 4KX4A 2HZEA 1H75A 2YZHA 3BCKA 3ZFLA 2DJ2A 1X5DA 2Z9SA 3GV1A 5HFGA 1SKSB 1W4VA 1E2YA 1ON4A 1B9YC 1GSSA 5CRDA 1CQHA 3UEMA 3ME7A 4ISDA 4NXIA 2N5AA 3UMAA 3PH9A 2A2RA 3TUEA 2YWMA 2BTOT 3FZAA 3CMIA 4LL1B 4DSRA 4HZ2A 3DMLA 4X43A 3PGTA 1ZL9A 3S9FA 4PNFA 3LXZA 1XWCA 1URMA 1XBSA 5G31A 3WT2A 2AHEA 2HRNA 3CBUA 3I6AA 1AW9A 2GVPA 3GHAA 4BA7A 1YF1A 4CW9A 4ZBDA 3SBCA 1ERUA 1BG5A 4J57E 1XIYA 13GSA 4IQAA 3D5JA 2FWHA 4V1Ap 5ECLB 5INYA 4I2UA 3GTUB 6GSXA 2VLVA 2LV3A 2R5GA 1O85A 4ECBA 3TOUA 4MZCA 1EP7A 2FD3A 2B5EA 4EO3A 2RM5A 2J23A 2HNLA 1OAZA 3C7MA 4D73A 1N8JA 3L0HA 1ZMAA 2X64A 2CQ9A 1PD21 2YCDA 3HJMA 5CRGA 3CRUA 2H1BA 5IMFA 2GT5A 4POMA 4ZB8A 2H73A 3UBKA 5J9CA 2XC2A 4KCEA 5GAND 2GZYA 1UC7A 3BCIA 4ECJA 5FWGA 4GRFA 5COHA 9GSSA 5E4WA 3IPZA 3DKSA 2VCZA 4HUAA 4AGSA 1AQVA 2JSYA 2V41A 4NAXA 4OWYA 3NIVA 5G5EA 1TK0B 1J0FA 2C3TA 1F6MC 1SYXA 1GTUA 2DMMA 3P90A 1TTZA 2HZFA 1PX7A 3LFLA 1SD8A 1YF0A 4TR1B 1PGTA 4V2NA 4KUNA 3IOSA 3HY2A 1WOUA 4P3YB 1U87A 2IFQB 4XS4A 2GSTA 3I69A 2YN1A 2B5XA 2E0QA 3M3MA 5IMDA 4DSQA 4E8EA 3JCML 4AJ6A 1GSFA 1T3BA 3LWAA 2OE1A 5G5FA 3UVHA 3ZRDA 3A5WA 2VL3A 2RM6A 3PINA 4YQMA 2M80A 5GSTA 3G9BA 5JCGA 4ZL9A 4NPBA 4K1FA 2FWEA 2TRXA 2I3YA 4IP6A 4ACSA 4MP4A 3VI5A 1JHBA 2NDOA 3ED3A 2F51A 5ELAA 2GSSA 3DGQA 5EL8A 4HOJA 2VO4A 5DALA 1EEMA 1K3YA 3EINA 1KTEA 3DYRA 2DJ0A 3TGZA 4FYCA 1GTAA 1BX9A 2A4VA 1SK2A 2PU9C 1VF1A 4WEYA 1A24A 2H6XA 5E59A 1NHYA 1A2JA 1U3AA 2CT6A 4ECIA 5ECPB 2K8VA 2TIRA 4N0ZA 5G1LA 3QD9A 2GQLA 1I9DA 4L5LA 1M2BA 3W8SA 2C0EA 1GNEA 1XVQA 4KW6A 3E0UA 3GSTA 3GX8A 4PXOA 5ECIB 5ECSA 4IHUA 4TRXA 2FWGA 1PQNA 2CAIA 2YWIA 1GLPA 2JADA 5D73A 4MJCA 3UARA 1O7UA 2EC4A 3HVSA 4DSSA 3GH6A 5A4UA 1EEJA 3EU3A 2HFDA 1ZYQB 1XWAA 5CNWA 4F82A 1G7EA 3F63A 3GH9A 4RUVA 6GSVA 2X8CA 3EU4A 3GKXA 2VCVA 4IS0A 4G9HA 1OC3A 1WP0A 3ZLPA 3TKRA 2VL2C 3ZL5A 4GTUA 5DAKB 5ECOB 1X9MB 4I97A 1QUWA 4E8HA 5H5QA 3ZREA 5GAPD 1R4WA 4OO4A 3C1SA 3TKSC 4MCUA 5ABRA 4PURA 2RLIA 3M8NA 2AAWA 4KB3A 3RHCA 2PVOC 2MMOA 1GSYA 3D4MA 5F07A 4ID0A 2C0FA 3DRNA 5IOXA 3FYGA 3FHKA 1XW6A 2REMA 3MDKA 1X9SB 3GKNA 2N5BA 2MMZA 5DJLA 4LLRA 3EWLA 4GF0A 4JZQA 2C3NA 5CO3A 3TKPA 2JACA 3PR8A 2KP2A 4KDYA 1OC8A 1GLQA 1X0RA 3F8UA 1W89A 4KA0A 1PA3A 1GULA 1XWKA 4KDUA 1Z9HA 4EE0A 1G0TA 1UN2A 2P0GA 4IGJA 1YKAA 2ZCTA 2IMFA 2WDUA 3EMXA 2H30A 4RI7A 3RAZA 3DEXA 3WGDA 2HSHA 3IDVA 2A2SA 1OYJA 4MPGA 3KH9A 4JE1A 1Z6NA 5D9XA 5J4UA 3HJOA 3DD3A 2NVLA 5JWRB 3GIXA 6GSUA 5FT3A 4OCFA 4LMVA 2V1MA 5IMZA 2ZUPA 5AIXA 1S3DA 5HR3A 1K0BA 5ECKB 2FUG2 2DJ3A 1Z5YE 2VL2A 3KM6A 2VCTA 4TXOB 1K0NA 5IM9A 1T1VA 1HYUA 2OACA 4QL7A 3IC4A 1XWBA 4XRAA 3KTLA 3HDCA 1K0DA 3TKSA 2B5YA 3HVVA 1YY7A 4LL4B 5KN0A 5EPFA 3F3RA
chains in the Genus database with same CATH superfamily
4WF2A 1IDYA 2P0WA 5KNLA 2D2ZA 3GLXA 2DODA 2R6KA 5HDKA 1UHSA 4MLOA 4K7OA 2R92J 4PGGA 4MQ9F 2OKAA 2I4AA 1KU9A 1HC8A 1WIKA 1JJ8C 3OSFA 3AL0C 2PMHA 4UHTA 1SD5A 3PM1A 5D4RA 2WWYA 1R1UA 1K78A 2O61A 4C3JJ 2YU9J 3D21A 5HS7A 1FYKA 2C4JA 4FCYA 3C71A 3LSZA 4H4KC 2H0HA 3CCJI 2HXIA 3GCMA 4R79A 1SK0A 3G3ZA 3K4KA 3F9UA 2L9NA 2B7EA 1I1SA 4K7NA 1JI8A 4O5UA 3WTXC 2ALBA 1U8RA 2FNPA 1WWJA 3O6TA 1OKDA 1EH6A 1WI9A 4UUTA 2YS9A 3CC7I 1J59A 5FO5A 1XOAA 3RTRA 4OFTA 3KZIC 1X5CA 3BG5A 4K9ZA 4ZZDA 4XLPF 2IP2A 2QA1A 3T0YA 1GSDA 3I54A 4MTEA 1FBQA 1GHCA 2TCTA 3CUQA 1FP1D 2EK5A 4QPQA 1QGPA 1E17A 3GX0A 2EIRA 3QQAA 1WH7A 1IAWA 3TJKA 1W4MA 1F1ZA 5IYCJ 1YITI 1YKCA 4I2TA 3MAJA 2BYVE 2HVRA 1SJ6A 5ILUA 3RHBA 3WYWA 2CUFA 4BVXB 1J09A 3VWBA 3H5RA 2BEOA 1VF9A 5AIQA 2DA2A 2DQRA 2V79A 4HQZA 1LE8B 1VQLI 2L4AA 3LORA 3ZFBA 1XN7A 1YJNI 3KP4A 4HYEA 1KQ9A 2IMIA 3R2QA 2JK3A 2YU3A 3BCBA 2LNBA 4CCOA 1DSBA 3GL5A 1FSEA 4H86A 4GCIA 5B8BA 2K4BA 1XMAA 2DA6A 5ILSA 1B4QA 2VBYA 3G7YA 1ERTA 1OYIA 2CZ2A 2NS8A 3TBIA 4EM0B 1GXPA 3RPNA 1MZBA 4TVEA 4E6KG 1GUHA 3JRBA 4A69C 2LJKA 1QA6A 4PGHA 2JN6A 1YO5C 1OISA 2QSIA 2Z1DA 4KICA 3DVXA 3DPTA 2P8TA 1FX7A 1PRXA 3R0JA 3HYIA 1LFBA 1QFNA 1Z05A 2M5WA 4G6DA 2VKHA 5DCMB 3CJNA 1G6WA 4CZCA 1K3OA 5CRHA 5HODA 3FISA 2R7ZJ 3L78A 3GZ5A 4M9ZA 2R7XA 4I0BA 4CXFA 1ZKGA 1BI2A 3HZ4A 1IRGA 3VWWA 2H09A 5EEGA 2VKDA 1KU7A 1IUFA 2F4MB 2JWTA 4O5RA 2Y0SA 1ZARA 1O3SA 3ISPA 3KFWX 3VPQA 1Q98A 4ESFA 2JA6J 3QAVA 4NV5A 3O8GA 1RQMA 3IH3A 5F06A 1PKWA 3D0SA 4RGUA 3LSMA 3V8JA 2JRMA 3BPVA 1ZG5A 4LLNA 1XB4A 5ECQB 3TJJA 3M9AA 2QUFA 1Y25A 2GSQA 3IBHA 3BWGA 1UJ8A 2V32A 3TP3A 1B9MA 1O57A 1BAYA 2Y69H 1TU7A 3HHGA 5DM6F 4JK1X 2LS5A 4Z6YA 3D1NI 1X1AA 2DXIA 1J75A 4GXZA 1W7PA 1MBJA 4XN0A 3AG2H 2WB1N 4F3QA 1G3WA 1A0FA 4C30A 3O76A 3TOTA 5EY6A 4GO1A 2RREA 3FZ5A 1V55H 3CZ6A 1YEPA 1HLVA 1JKQC 2L01A 2P5QA 1U78A 4JR6A 2H1LA 1F5TA 2XPEA 1PYVA 1QZZA 4LD5A 5GTHC 3J7Yk 1YQ1A 2XGXA 4XKVA 2A05A 3F8CA 2W24A 3LJRA 1MD3A 1YIOA 2FD5A 5H6RA 2YV7A 3O8HA 4Q5QA 3WU1B 2PWJA 1U5TB 3CSJA 5JHFA 3DF8A 5ECHB 5KHDA 3UL3A 2P7CB 4AC0A 4A12A 4AJ8A 5ECRB 1T0FA 1GXQA 2PMZN 1JKPC 4Y13A 1TW9A 1RKWA 3ERMA 3KCCA 2BW3B 3VOEA 3W2WA 3LSRA 4K7IA 4F9ZA 3RSNA 2H6YA 2ESNA 1W0UA 4K2DA 2TRTA 1YFHA 4MDCA 4MGRA 1U6TA 2KHMA 1KA8A 3M1EA 1QU3A 1O8WA 4Z2UA 1A31A 5LNKe 2JJ7A 5B66C 3F22A 3ZMDA 2HI7A 4ZJZA 4BBSJ 2VJIA 4ULXA 5L3CA 14GSA 1B9NA 1MDMA 3HEFA 1SD9A 2FMLA 4P55A 4ZBAA 3ZIVA 5BNGA 3KPHA 3ERWA 2P31A 2E7XA 5CQGA 1ZAOA 2L9VA 4BGDA 2ID6A 4XS1A 2GOXB 2X6WA 1YQAA 3KJYA 2VBZA 4V2LA 3NRVA 4DGWB 2MD5A 2X1DA 4L9JA 3T1BA 2HOTA 1PN0A 1T00A 1ZYNA 2H6ZA 4WR4A 1I3QJ 2JRTA 2DFIA 4B47A 2PMUA 4L8EA 3HSFA 3JRIA 5CYVA 1A2LA 2QF7A 2VCQA 3DKXA 4KN4X 4HF0A 4ENNA 1XD7A 4PJMA 4AIHA 3RZOJ 5IT9Z 2BJXA 1JZRA 1JGGA 2HRFA 3BBYA 1KNGA 5E79C 4C2TA 4BIKA 4DYQA 2PGTA 4BWQA 4BUPA 1L0OC 1T56A 3KP8A 2P7VB 3DU5A 4PFPA 4NBQA 4B3XA 4J19A 3ZP5A 4XRDA 5DDLA 6PAXA 4E7HA 3UBLA 4IJ3A 3LAJA 4LA1A 4Z7XA 3GYKA 4J2FA 1SENA 3TRQA 2BOLA 1YJ9I 3QMXA 5LD0A 1T8EB 2UXXA 2YX4A 1WGXA 3GMEA 2IPAA 5AN1A 2YPMA 1W5CC 4A0XA 3MZHA 1FZPB 3CBUA 1EOHA 1ZGAA 2IXSA 4I01A 2W85A 2CYYA 2VAFA 1Z7LA 3S32A 3AAFA 3IKVA 1W0TA 3EE2A 3CLOA 2G7HA 5G1KA 1REPC 5LEKA 2GAUA 2GGTA 1ZN2A 2HZTA 1AQWA 2LSOA 4ZB9A 1SL1B 5JI6A 2XDVA 3KZZA 4ZYDA 1MDIA 1VQ9I 1X2NA 1T7PB 2MLKA 4NUBA 3PSIA 1OE7A 1TDIA 3OYMA 1QPMA 4GLTA 1SFKA 1SD4A 3JRGA 2OC6A 2R7OA 4RLFA 4HLYA 2KIQA 2OBPA 5JWQB 2IA1A 4PQHA 1BC7C 5FKKA 5A5KA 1Y6EA 1Z6MA 4JEDA 4E7ZA 3IAS2 4MTDA 4AVPA 1M9BA 4A93J 2ZMEB 1BW5A 4I76A 1GUKA 1X19A 4JQFA 2VM2A 2QC7A 4AM3A 3OYKA 2JA7J 3AY8A 2RGVA 3GNJA 4EIQA 3W6GA 3HC7A 2V1DA 5DYMA 5HNHA 4YFXF 5HQPA 2KLOA 2FSWA 3GUSA 4PSXA 4XLEA 3BZ6A 5JFRA 1VQKI 1XSXA 3PQKA 2LDUA 3W3CA 5KVRA 3JAMZ 3BJ5A 2RNJA 4M73A 1UCRA 5GAEJ 2IN3A 4A3KJ 3OYFA 3MN2A 3ZMLA 1T98A 1ETWA 1PJRA 4DQ2A 2DMUA 4F91B 2O89A 1X5EA 3R0AA 1O3RA 3FR9A 1J7KA 4WXTA 3WTTC 1M2AA 4K5RA 4ZB6A 3HRUA 3QAGA 3E6DA 5JCUA 2CGPA 5FHIA 1A2MA 1WJAA 1IXRC 3VYUB 2ZFUA 3BJAA 3C1DA 1J9IA 3CSHA 2Z9OA 1WJCA 2X99A 3VWVA 3VK9A 4E70A 5CRWA 3TB2A 4S0HB 2GDRA 4JX4A 2OTJI 4ZDLA 3P5JA 3Q19A 2HYJA 1QGVA 1WJEA 4OFNA 1LFPA 1USTA 5TISC 1VQ8I 2NS7A 1M3IA 3MYDA 2Y0SN 4EC0A 3K4BA 4G19A 2VONA 2VKVA 2HYFA 2ID3A 1O4XA 5F64A 1XW9A 5FKNA 2KIFA 5J8FA 1LJ9A 2KIUA 2RV8A 2F4OB 1QK8A 2RUFA 2CV2A 1VQ5I 3IWZA 2XPUA 1FT9A 3ERFA 1FJLA 4WXHA 2X48A 4PDKA 4RAGA 4Y4RA 5AONA 5FFXA 2WCIA 3OS2A 4A5NA 5ICFA 2H72A 2FBKA 5L3DA 3OYNA 1ST9A 2Q2EB 2K7LA 4Q5SF 1KEBA 4M3EA 4X1UA 3F6DA 4BJ6C 3HGYA 1LVKA 1OC9B 2V9KA 4BAYA 3RBTA 3N05A 1C0WA 2DIYA 2O6GE 1CQGA 1JTYA 3A5IA 3F9KA 3VFZA 3HXLA 2J5PA 2W82A 1NW2A 3K10A 1Z7PA 6GSYA 5CJ9A 2AS5F 2LBFB 4MNUA 1THOA 5DBQA 1XVWA 3CJRB 2AV4A 2H1DA 2OZ6A 5K5QA 1MDJA 1XOBA 3W6KB 1XXUA 4MF6A 1XSDA 2DTRA 2JSPA 2HT9A 3GF2A 4F2IA 2MBTA 4TW5A 4PZJA 2VKEA 1ZRCA 1R7HA 3A2WA 3OY9A 2QGVA 5F1RA 4XK4A 1XG1A 5D6EA 1SJIA 3GA4A 4G7ZF 1YJWI 2ES7A 2H0IA 1FY7A 3VLNA 1WWXA 2HZEB 2KOKA 4HSRA 2ZNMA 3GVAA 2HPMA 1K3LA 1ETXA 3QPTA 4WK8F 1K0CA 4WXDA 1YX5A 4GSNA 4TOPA 1Y6IA 4KIGA 4LGWA 4YAVA 2NS0A 1TQMA 3R6SA 3S2HJ 3KD0A 3U1DA 12GSA 4F0BA 4RB2C 1TC3C 1THXA 5FJ8J 2VC0A 5BRTA 2K9MA 4RB3C 3RPUA 3RPUD 3G73A 2FMYA 3G71I 1G3YA 3MNGA 3Q6OA 5ICEA 3M7GA 4U0YA 2HU9A 4BDYA 5EDNA 3JW4A 1OCCH 4C9YA 1M1EB 1JZWA 4IN0A 2IIYA 1UELB 5D5VB 3ZTLA 3I56I 2FRHA 1ZG3A 2DYSH 3L2VA 3WD6A 1FMWA 1IN8A 4OMVA 1D1BA 5F0HA 1FIAA 4EJOA 4PGTA 4M72A 3QOUA 3LG6A 3TOAA 4F7ZA 1S7AA 2DAOA 1PL1A 4FYUA 4NDLA 2M45A 1FPQA 3DTKA 2VCWA 2A6EF 3US3A 4F0CA 3TJBA 5HNFA 1WE0A 4M3FA 1EA3A 1LDJA 3A02A 1F37A 1TOFA 2VM1A 1SKRB 3BDDA 4DBQA 2X1CA 1S7OA 2V1UA 1N2AA 3BOQA 4G7OF 2F8FA 3H4KA 3MVPA 5KK1A 4BACA 3HGGA 3U1KA 1KU2A 4WBRD 4B3AA 3ZITA 4UUSA 1G8XA 2GQKA 2GS3A 3F0IA 3P9KA 7GSSA 2VOPA 4JRRA 1YS7A 2NVUB 3G1OA 1ZRDA 3ZCOA 2IPQX 4KNYA 2WC2A 3DWVA 2DN0A 3BTCA 4N4OB 5TGTA 1JXSA 2C0GA 2OQGA 1Z9CA 4B1RA 2IS6A 2IGMA 1TJDA 4IBPA 1B48A 3FZ9A 18GSA 2ZKZA 5GTIC 3IK7A 4KGIA 5GSSA 2ZXIA 2V26A 4Y17A 1FOXA 2BVLA 2CUZA 1HW5A 4KH7A 1USBA 4G6TB 1VRSD 3QOPA 3IAM2 2K9FA 2C6YA 2EIQA 5JWOB 2FWFA 1TRUA 3RDWA 1X1CA 4RGRA 4GQCA 1DPUA 2HRKA 3IV5A 3UKGA 2HQ5A 2JVGA 3DWLE 4IL6C 3BG6A 5HDGA 2EFWA 1FOHA 2FLSA 3SZGA 1BJAA 4PJLA 3I5UA 4DW6A 3LGCA 2JZTA 5CVRA 2F5EA 2KP1A 3LSJA 1QQ2A 2XBIA 2OAZA 2HEOA 4DNCA 1R22A 2LRCA 2IW5A 3F8MA 5F0FA 1F43A 4HA8A 4D7NA 1Z7RA 1BI1A 2MYGA 4BEHB 1YYVA 3I59B 4XRSA 4KISA 2FGXA 1FLIA 2V9VA 2HOAA 1V9WA 2HQRA 2VCXA 2LY1A 2H94A 5F08A 1K4TA 2GZPA 4UUVA 1SFEA 3HL2A 4IHYA 1ZYEA 2E2GA 4GYIA 4D73B 3PSFA 3SEZA 2H70A 2VLTA 1MW7A 5KAFC 4XS6A 2R3XA 1TXXA 2XRNA 4XQFA 2NRAC 5ILVA 2Y75A 1MSFC 4IQ1A 1TZLA 4K5SA 3OS1A 4KN7X 2ACJA 5IOWA 2E7WA 4CUGA 3GZNB 1WJ5A 2L59A 3HD5A 1Y8QB 1U9NA 3DU6A 3GWZA 3WTWC 5IIZA 3RKWA 1G7OA 1XX5A 3ZN0A 3WTUC 2XPDA 3A2XA 4CYCA 1M99A 5CAXA 5KN2A 1FOYA 2R3SA 3FWEA 2YUSA 3OYGA 1TKDB 3LFKA 3BZCA 3OYJA 2F9SA 3KXOA 3A2KA 1T95A 2JZYA 2XROA 2M46A 4POLA 3I9V2 4B8XA 4MZBA 2BE5F 2Z3YA 2GA2A 1ZGJA 3UNGC 4ZYEA 4MH3A 4OU0A 1I39A 2HYGD 4LLLA 1KZHA 1DUXC 4GGGA 1K6OA 4K6XA 4EL1A 5ID2A 3Q74A 2B1KA 3FEUA 1TU8A 1BOBA 3HCZA 4MHGA 4GYGA 3TCOA 3N5OA 1K0OA 2K9SA 2VQGA 4FQGA 1KU3A 2NVYJ 2BHYA 2XF6A 3QU6A 4QWQA 3HDDA 4IQJA 1TP9A 5E3OA 2B9SA 3GKKA 3VPTA 2CS3A 4AIJA 5BQTA 5FRNA 3UJ1A 1TRWA 2K9QA 1DP3A 2DLXA 4EDZA 4U87A 3K69A 1G2HA 1YLFA 2MD0A 2NYXA 2V9PA 2CG4A 1AUCA 2AUVA 4WX9A 2CUEA 1FP2A 2ZO4A 3F8BA 3GTLJ 3J7AO 5E3MA 2X8HA 1J5YA 2MMNA 3LQRA 2JZSA 3U9GA 22GSA 3IH2A 1A04A 4J00A 4S04A 4XRFA 2GQMA 3TRPA 4CDOA 4G0LA 1A6QA 5B1BH 2HI3A 4CA0A 3VEPA 1FG4A 3E5UA 3L2UA 3GRXA 2HVQA 4WXCA 3TEDA 1USSA 3IA1A 3CLQA 1X3WB 2ZJQF 3GBGA 3S2WA 3E3VA 1J9BA 5LHIA 3KH7A 5ECNB 2HZDA 2EJRA 3DEWA 3ABLH 3EMPA 2OA4A 4RAZA 3V4GA 1OMIA 2K3FA 2LYCA 2HPIA 3Q9VA 4XS4B 2DMPA 1XCVA 4OMYA 1EF4A 2CX4A 3IV4A 5GPAA 3WT1A 4Q5FA 2JUGA 1X3UA 3CMYA 3RKXA 2ZSHB 2ZJ2A 3FXUA 5A2QK 4B48A 3QAWA 3HSEA 4ETSA 5EEAA 1MMGA 1OLTA 2R5ZB 2JZRA 5M3MJ 3LYKA 4HZ4A 1YRNA 4NC8A 4QSHA 1EV4A 4O3MA 2BMXA 4BE1A 3H1NA 4UY8I 3G1LA 2H01A 2CV1A 2H1AA 5DUKA 2DMQA 2H8LA 2LQQA 1WRJA 1GH2A 4IVFA 2CVDA 3X2QH 5ENUA 1J0RA 4G6QA 1T33A 2LSTA 1JT6A 2LRNA 3D4MA 3EQLF 1R26A 2YWNA 2LNSA 1XWGA 4CHSA 1LEAA 2L5LA 1IXCA 1HSJA 2GA1A 3DPUA 4KMUX 1A0RP 1A8YA 2DJKA 3KEQA 4II3A 2COBA 4F93B 2VE9A 1T8IA 4I6XA 4FETA 1Z1DA 3GW2A 1GV2A 1HNAA 1TRVA 2HE3A 4L5OA 2LVSA 4E7JA 2WRTA 3FZ4A 3ZVJA 1Y0NA 3BR6A 1K79A 2I81A 5J5NA 2ZJRF 3CCSI 5FB2A 3EUHA 1ITYA 2R4GA 1FOVA 2M2EA 3LYPA 2DA3A 5E1XA 4D0PA 1NK2P 1LBKA 3G7JA 5D96A 3V1WA 3OR2C 3UAPA 4HEA2 2ZCWA 3OYAA 1HA8A 1OQYA 2WV0A 1M7TA 1B72A 4HRIA 4LK1F 2M7AA 2PUKC 5HFIA 3O6BB 3VWXA 1MGTA 1ZZYA 3KP7A 2HXKA 3CCMI 1FB0A 2LJAA 1Z6TA 4IRIA 1BN5A 4WBJA 5DALB 2FA5A 2L4QA 2RAEA 5CKTA 4YIIA 2OBKA 5C00A 4AF2A 16GSA 4I98B 2E1MB 4RS8A 3VI7A 3ZMKA 3VWUA 2KL4A 2PMZA 3L2QA 1RNLA 3K4MA 3ZMSA 2B63J 1PUFB 1XPVA 3KP9A 2K86A 1PX6A 1LJRA 5GP9A 2K5CA 1B8IA 5IOZA 1Y56A 2PU9C 1X1DA 4KUMA 2J5OA 2CMPA 2JPBA 1ENHA 3FIWA 4B4CA 1SFUA 1GSUA 2E71A 2MYSA 5DS9A 1MEKA 2JT1A 2F5CA 4ZXGA 3TL4X 2LRDA 5KOXA 4AIKA 1YTYA 1OPCA 1MJAA 3CESA 3RI4A 1PN9A 3P8WA 1LNWA 4MEYF 5K7HA 1XS9A 5AIVA 1GTIA 4XSXF 3WTVC 5B7CA 2WULA 3L4NA 2GWRA 3HYPA 5J4VA 3OYHA 5DQYA 4IF4A 4XN3A 2L0KA 1H4OA 2GLRA 1W36C 3D5LA 2LLKA 3GTUA 3M9JA 4WF4A 2DJIA 3P7XA 1NTCA 3IC8A 2WBMA 3ZMUA 4IKHA 3CCYA 3VURA 3HKRA 1GVJA 19GSA 4I02A 2KMUA 1N78A 2K40A 1GSQA 5H5RA 2CW0F 4CYDA 1M0UA 1B4AA 1V2AA 4LIUA 2E1NA 3BR3A 1JKOC 1MMSA 2P5VA 4P96A 3APSA 2PBIA 2MA3A 3LSTA 5FKLA 3RKYA 3QYBA 3ERGA 4JU5A 4YAPA 1SC7A 1ZCPA 5B8AA 2DLLA 3GYHX 3OWTA 2KZVA 4Z2YA 1TW2A 20GSA 3AKZA 3HIFA 1DE1A 2UZ8A 2XSJC 1S6LA 2E5NA 4LIVA 4IELA 3TJGA 1JZDA 4MZWA 3TRXA 2HSMA 1AHDP 4RQRA 1DE2A 4DYCA 1V5GA 3CF5F 5A2QZ 3K9TA 2LTKA 8GSSA 3V7RA 3MKWB 2G0FA 3BOAA 3LSGA 5A4VA 1BJXA 2ZXWH 2M0MA 4IRHA 2ME6A 4XKCA 2IS1A 2JQ7A 2X4HA 5C4JJ 2DJJA 4XSZF 4PTSA 4BL7A 1V5FA 2F4IA 2PFBA 1ILOA 2FY6A 1R00A 1UFMA 3I53A 3DVWA 3UR3C 5AGYA 1S9HA 3VPRA 3OOUA 2XGDA 4ZDOA 2YV9A 2DJNA 3K1NA 3CCVI 1D0YA 2M3AA 1FTZA 4YRVA 2DMTA 2NTOA 3TP0A 2OPTA 5HVQC 5C3EJ 1E6BA 4PJ0C 3BJ6A 3HRTA 3PFYA 1IYIA 3QP5A 3WE3A 2NVXJ 1S3CA 2GZZA 2R0PA 3G7IA 3HBLA 4IP1A 1Z91A 1U9OA 1B4PA 3GMFA 2V6OA 1ETKA 5CREA 3OYLA 1EGOA 1A23A 2FU4A 1NK3P 1D1CA 1YIJI 1U0JA 3L2CA 2ADUA 3LEFA 2EFOA 2Y2ZA 3K8NA 5FD6A 5LEJA 2YWOA 3BG3A 2BZTA 10GSA 4IXAA 3DLAA 3ME8A 3F3QA 2PVQA 4ECCA 5KAIC 3IH4A 5EF6A 3ZPLA 4WWCA 1XC5A 3GX4X 1WPIA 2W84A 2GT6A 4NC6A 2MABA 1EOGA 2AO9A 4NHWA 2H71A 3LOCA 4TR1A 4IHTA 3BCAA 1G3SA 1AXDA 2F3MA 4P9UA 3MKZA 1ZGNA 2VE8A 4NQWA 3KZQA 4XBFA 4AYBN 1XCCA 4RM2A 4NHZA 5GAHJ 3FR3A 1GTBA 3HB9A 4HJMA 4AJ7A 4A5MA 3HZJA 5E8IA 1OKTA 4G94A 1YW7A 4M3BA 3EC3A 1AQXA 2X4AA 2IFQA 2HDDA 2L6CA 1WH5A 2PEXA 3TKYA 4GQFA 4PQ1A 1WRYA 5D8LB 3DXJF 3KYCB 5EGOB 1B9XC 2H76A 5AISA 5H5SA 4TR3A 1EP8A 1IYHA 4BQQA 3FY7A 4EEFG 3IR4A 1R49A 2L5QA 4HQSA 3RDIA 2YJHA 2WB9A 3E9JB 2Q2EA 1D5YA 4G0IA 1I6XA 4XKWA 4XL9A 1ZK8A 4WKWA 1JLVA 5F04A 4L0ZB 2W4SA 1ZELA 4A3LJ 4Y52J 1V57A 4IO9F 1OVNA 1FVKA 4KDXA 1R1VA 3ZQHA 4KMFA 2LREA 2XRLA 2H8RA 1NHOA 2E5ZA 2MBSA 2XAFA 2ZXHA 4MLYA 4NMUA 1PKZA 2LBFA 1OCTC 2O85A 4OCEA 4XHMA 5FLMJ 2LTPA 2DK5A 1O7FA 5CVIA 2IVMA 3M07A 2OD5A 3G4SI 1QHHD 1AC1A 1HNBA 1FOWA 2H19A 4KNDA 3M1CA 4A3MJ 1W7PD 2F5FA 1TK5B 3PQJA 2P5LC 2HKOA 1QVTA 2NVQJ 2LP0A 2JPCA 3MKLA 1FO5A 2OJLA 3UOMA 2H0GA 2XHKA 4PCQA 1GWCA 2RUEA 4HDVA 1A5JA 2QWWA 4YEJA 1W5TA 4PUSA 4PQIA 4Q5RA 3G2BA 3WGHA 5IMAA 4MK3A 2PBJA 4YQVA 3V7SA 3QPLA 4PFOA 3RYRA 3JSPA 5L3BA 4OD7A 4I0AA 3WG7H 4QLCU 1TL8A 2I9HA 3PIOF 4BU2A 4KAEA 4WR5A 2IJLA 3OR5A 4DOZA 1WMJA 2VQHA 3JSOA 4BHBA 1G6NA 2AJQB 3FKFA 1WHUA 2H75A 1F3AA 3CCEI 2XPWA 2RQQA 3F8NA 2OE0A 3CTFA 4XORA 1Q4JA 4G0KA 3GFLA 2VC1A 4QTRA 2DA5A 1JJ6C 2AB6A 1F9NA 2YPRA 1CF7A 1O73A 1HXDA 1VTNC 2FNAA 1O8XA 2Y31A 5DV5A 1HDPA 3HOTA 1IUYA 4RGSA 1WJKA 2XHFA 4HBLA 1YE9A 2O8KA 4V19K 2C1YA 2K4JA 3ASOH 1JHFA 4CCLA 4U7DA 5M3FJ 3APQA 1XGOA 2L2OA 4KCAA 4EXJA 3MEXA 4XLFA 4XR6A 4JP0A 3CCRI 2K8SA 4OIPF 1Z3XA 5JVGF 1VQNI 5L3FA 2M72A 4MO7A 1SD6A 2LKPA 1QRYA 3Q0UA 4HOBA 2H27A 4ZDPA 1OYWA 2Y9YA 1O7LA 3BTIA 1D8JA 4L9TA 2BHZA 5CVUA 2IMKA 4EM2A 1HSTA 5FROA 4HV5A 1DDNA 2TRCP 4G2EA 2VJJA 4IKFA 2OBIA 3GFJA 5E20A 3O3TA 2P5RA 1I3AA 4HSTA 2K18A 1B6AA 2BY0A 1MDKA 4HQMA 4QQ7A 1P7JA 5BPDA 5KCMA 3C73A 3OYDA 3CCQI 4PSWA 2DOFA 2R7FA 3K0LA 4NNJA 1IO2A 1FAAA 2C0DA 1TTYA 5J40A 5B5EC 1BR4A 3FK8A 3DKYA 2W48A 1A8LA 1VF3A 4HU7A 2KFDA 3EUKL 4EGZA 1GP1A 4JX5A 4POBA 2DOEA 5HS9A 4IOCF 1QPIA 1QBJA 1AOYA 4ANJA 3L2RA 1M9AA 4M9XA 4KE3A 3H36A 3ZQQA 2GTUA 1TK8B 4RDUA 4N11A 3F0CA 5HFKA 3ZMZA 2KISA 3M1GA 1HW1A 2IBDA 2BY3A 1HQOA 1U88A 2G2QA 2YNXA 1LDKB 3HJPA 3PPUA 5ICCA 4TR4A 1T08B 4EKZA 3K6GA 1VFCA 3M4OJ 2YX7A 2D5VA 2JU5A 1U3IA 3NWSA 1HCRA 1IRXA 1X1PA 1UHWA 1WFXA 1MBKA 2O5RA 3A0BC 4FT8A 1OR7C 3PFIA 4JBAA 1LVAA 4QPOA 1DP7P 4BY1J 3A3TA 1RC9A 5IO2A 5B6NA 2B1LA 3TW7A 3EUAA 2PERA 4AD9A 3H93A 4IOAF 1D0XA 2VL9A 3JRFA 2KIMA 4FIWA 4YIRX 3HA9A 4WF5A 1B59A 4ZL7A 2B0LA 5BOXA 2ISZA 5EG0A 2GXAA 2L5OA 3HHVA 3UVTA 4KITB 2PJRA 3SHFA 4ML6A 1BQ7A 4RLQA 5ELGA 2F5VA 3CUOA 3DBRB 1R9TJ 4UNOA 3KGKA 1MMDA 3E5QA 3KIJA 4F55A 3N9JA 1LU4A 3D5SC 3LWFA 3CDHA 5DAKA 5DD8A 4RI6A 1YS6A 2ZBKA 4Q48A 4LG0B 2V6KA 2BY1A 5EVOA 5L71A 2C8UA 2VXZA 2CZ3A 3LXTA 3C18A 2LY2A 1SAUA 4OIQF 2G7UA 1XCBA 4A0YA 4D7MA 1KQ0A 2OCCH 3OL3A 1E3OC 2R7UA 4C3HJ 1EZKA 4V2MA 3BROA 5GPCA 5J47A 1JFUA 3D0ZA 2E36A 5D8IA 5B1AH 1HNCA 5ICGA 3H3VK 4RMNA 1K78B 3HJEA 1CQTA 4XLHA 1T6SA 2NXNB 3FRCA 1MMAA 3HVNA 2YP6A 2JSCA 2OADA 2GBYA 1FHEA 3HVXA 5CYYA 3S3OA 4HS1A 1P92A 1TW3A 1VNDA 1R36A 4I7HA 4ITVA 3HOWJ 1E2XA 3MIXA 3S14J 4WETA 5IMVA 2DJ1A 2DSAA 1KGSA 1OE8A 4AWXB 4FH8A 1ABAA 5CVJA 1F9MA 1ZTRA 3HHHA 1NSWA 2HSYA 4O92A 2DPDA 5FGMA 4MABA 1SKWB 1RR7A 3S16J 1QZEA 3FMQA 2BBYA 4S05A 3CUQB 3LAPA 3PO3J 1U8BA 2VOOA 3IK9A 4PUFC 2CW7A 2XAHA 4GFBA 2N5FA 3MCZA 3CMAI 3WHBA 4Y3OA 3I43A 2UV1A 2V4JC 3TKSE 5M5YJ 2LFBA 3FX3A 1TP4A 5KEJA 1XDSA 2HKXA 2FEZA 5F0CA 1AKHA 2B7JA 1X58A 4LB5A 1E3HA 3CTGA 4FQUA 4V2GA 1K0AA 2XIGA 2LD5A 2KUCA 2YANA 1EV7A 2KRCA 1S3AA 4MPFA 3ZQ7A 2R7SA 3OIQA 4YH2A 3ZQCA 4HQEA 2ZSIB 2HGCA 1ACVA 2LOOA 5L3EA 2E19A 2L4CA 4HNVA 4MF7A 5LHHA 5TJJA 4GWRA 3CC2I 2H1KA 2CUJA 3GL3A 5D93A 3GSSA 3IE3A 3GUDA 4TXVA 5JLXA 2M30A 2IA2A 2GXBA 1YEXA 2GXGA 1TWHJ 1PMTA 1DQUA 2D45A 2R37A 4DEJA 3K1MA 2V6CA 3J7Yb 2Q1ZB 2QKEA 1O3TA 5HR1A 2PMTA 1XFLA 4BVYA 4BL0B 1APLC 2FBHA 1BYEA 4FO5A 1Z21A 1ETQA 1GVDA 5HS8A 2O0YA 5J1YA 3J7YJ 1G6YA 1A6IA 1FBUA 2RIIA 2VIXA 2WFCA 2KT0A 1XSVA 2V2GA 3E6BA 2E2MA 3ZGKA 3MD2A 3O3KA 3E3EA 3BR0A 4BE0A 4ICYA 3F6OA 1IF1A 3WGXA 4LOCA 1D3YA 3IP4B 4HNTA 3MWHA 3IHQA 1EGRA 1O81A 2EIOA 3BT9A 4BQOA 2L02A 2DW4A 2VLAA 3DBLB 3OYBA 4A5PA 2XGCA 1KBNA 2AYTA 1TNTA 3EVIA 6GSSA 1TQPA 1P6RA 2OU2A 1FWZA 1P2FA 2WV1A 1RW1A 1ZOFA 3E5XA 3OIOA 5H6QA 3KP6A 4HF1A 4ML1A 3RYPA 5D9VA 2LC2A 3HZ8A 2ELKA 3SDGA 3DIEA 2CRGA 3JRHA 4IVNA 5EEHA 4HI7A 1ML6A 4ZIJA 2K3PA 3K4JA 2M4KA 3F6FA 1FNNA 4XTSA 1W7PB 4EMSA 4EF0A 5FFZA 2XSDC 1TI1A 1FW1A 2WZ9A 1SVLA 1STZA 4RGXA 4OO5A 4E7LA 3QPHA 1HKQA 3L7WA 1SL2B 3H79A 1TRSA 1OCOH 2EIKH 3ZZXA 5KN1A 4KDPA 2PI0A 4UVCA 3C1RA 3FXLA 2HLSA 1R1TA 5HR2A 3DEEA 2Y0MA 3WE2A 3F4TA 1R5PA 4F03A 2WAEA 2DIZA 4KSOA 3SFIA 2LF7A 3FR6A 5ERIA 1K0MA 3A2VA 1WJBA 3GTKJ 5D4SA 2CQXA 3BJOA 3H1CA 3W2AA 3ISOA 4CCKA 2DA4A 1A36A 5G30A 3QODA 2QQ8A 5GAND 4L18B 1MD0A 4ABZA 5H20A 2DPUA 1QZYA 1EV9A 1EWXA 3GFKA 4MEXF 1I27A 3PNVA 2L4MA 4TXOA 1EH7A 3MWMA 1UA5A 5J1RA 1SEUA 4HLXA 4LMYA 1RIOH 5HR0A 3S3MA 1D1AA 4I5QA 3QU3A 3MKYB 2DO7A 2OE3A 1PSQA 1WSUA 3OR1C 2FNOA 5IPAA 1T4ZA 1SVMA 4OFMA 2OUMA 2IGOA 4BBRJ 4LJZF 4Q47A 2Y48A 4D5CA 2O87A 4MFDA 1U6GA 4HX4A 3RQ4A 3DXBA 4BXFA 1MDMB 4ZILA 4HU9A 3KCMA 4XMYA 1YZXA 5D5WB 5KN3A 3DP7A 3LSHA 4AVZA 3D6IA 2R7QA 2QQAA 1CGPA 1SFXA 5B3SH 4HF2A 5J6XA 6GSWA 4UXNA 2HNHA 3ECOA 1MD4A 3KIOA 2R2JA 3TKQA 1XW5A 2WJUA 1U5TC 3RCOA 5DD4A 2EZKA 5ECMB 2M34A 2HXOA 4L9VA 4UVBA 4X1EA 1MJBA 2CA8A 4HJ2A 1UVZA 3VSLA 4G10A 3WTYC 2DCEA 2EZLA 4HPQA 2MC4A 3ZYWA 3KEYA 2GSRA 5CPRB 4IJIA 1HKSA 2HDCA 2HOEA 4P9FA 1SU9A 2YOIA 2L6DA 2EFNA 3AG3H 3CCUI 1AAZA 1FIPA 1I5GA 2B3SA 3VYRB 2L57A 3CRTA 4IHSA 4M6VA 1BOAA 1FBSA 1MMNA 2DT5A 3LQQA 4RM3A 4AU7A 3H0GJ 3DCFA 1R5AA 1T4YA 1YDKA 2HRAA 4XOPA 3D4TA 3QR6A 3BG9A 4FE7A 1AU7A 1ZREA 5D8KB 2ZJPF 2NOJB 4XKBA 3TDZC 1BBYA 3N97A 4OIOF 2A4VA 3F4RA 4GSTA 5CP1A 2VIMA 4K8MA 2LJRA 1T2KA 3MZ8A 2EINH 4JR4A 1V3FA 2HYXA 2DDBA 3KETA 2ZNZA 2OQRA 1PDNC 5BMUA 1LB2A 3VB2A 4BPYA 3FM5A 3GTOJ 4ZYHA 2HFHA 2J9HA 1DUGA 3QPMA 2W1OA 2WAQN 1YJ6A 4TN8A 4YG2F 3T8TA 2XBQA 1F2EA 4GXOA 2IAIA 2YJ7A 3L2WA 1LDDA 3HPHA 3MQ0A 3KTBA 4DZJA 1LFUP 5CLSA 5FLXK 1V98A 4M71A 2NBSA 1IV8A 4D9JA 2H66A 1B1BA 1YHQI 3H8QA 3JCUC 2K9LA 4EJVA 2B6MA 4MFEA 1QMVA 4EQQA 1QO0D 3R60A 2ON5A 4IRGA 3L9UA 3EYTA 2HR3A 2MG4A 1S72I 3QAHA 2ECCA 3CSIA 3GKMA 3S1NJ 2HTJA 4KSMA 3HSRA 5F05A 2EWNA 1YW9A 1R5ID 2GIVA 3U5RE 4PJNA 3KMNA 1SANA 4BVXA 2XKOA 3WGIA 1NG6A 2WY8Q 1D8KA 4EVIA 4BWSA 1LE8A 3WGEA 4RAYA 5DEQA 1IXSB 2X6XA 2X49A 1GUMA 2CQ7A 3AG4H 3WG9A 4II2A 5J9BA 3A4CA 5C4XJ 5JCWA 3QYFA 5K7ZA 3L9VA 3EURA 1JZOA 5EZHA 1F4KA 2MSYA 3BTLA 4XRMA 4EJTA 2F8AA 4L0UA 2Z99A 4A3CJ 2MH2A 1U3EM 3ASNH 2R5YB 2CWEA 4BS9A 3HKZA 4KA4A 2A69F 2D2WA 1FYLA 3SWLA 2YZUA 1VF2A 1O3QA 2CVKA 4K2XA 3PUFA 1YOVB 3P9IA 4TV7A 4NB5A 4XOTA 2CQNA 4XRSG 2XUBA 1ZG1A 4X6AJ 2FCHA 2R0CA 3HOVJ 2ZMEC 3CJTB 2XF5A 4K0NA 1GSEA 3WHCA 3HRMA 3QFAC 2G9WA 2GOMA 3C3WA 4AYBA 4XICA 1JT0A 2VODA 5DCMA 2NNYA 4HNUA 4RB1A 2FHEA 4K2EA 3V7CA 1F3BA 2VD0A 2NPBA 1H0MA 4A3FJ 5A4WA 3IRAA 4PK4A 5LRRA 4AUXA 2LNTA 2IWTA 3BD2A 3M0FA 5FRMA 4TKYA 1MSEC 3KP5A 4FHTA 2W00A 1SYRA 3CYNA 3PNYA 4NV2A 5BS6A 4POKA 4O32A 1WJDA 4EVMA 1J08A 1EJ9A 3E0JB 4MIMA 3UIWA 2DK8A 1VGLA 1D0ZA 1AIUA 1FMVA 2O7OA 3OYEA 1SK1A 3NQOA 3SXYA 1KYZA 1FYMA 3TGNA 3IHUA 2CAQA 2A5YB 5DVBA 2FA4A 3H3UA 3K4LA 4BA7A 1GLNA 1MTCA 2XB0X 2XKPA 3S1MJ 4D1QA 1VF4A 1XZOA 1JUMA 3FMRA 2CX3A 4O7HA 2WS2A 2OA7A 5IPGA 3I4NJ 3VDXA 3KMOA 4G7HF 1WKMA 5K5RA 1B8XA 1TWAJ 5HLGA 4MQVA 1C72A 2RC4A 1R7JA 3VYSB 2MMAA 4MJBA 4LK0F 3L9SA 4MJEA 2KRHA 5F0GA 3RPPA 2BGCA 3S15J 3DV8A 1X2MA 1RR8C 4QL9A 1NM3A 5IMCA 5E3LA 2QM3A 4LITA 1M3JA 11GSA 2VUPA 2CFOA 1JLWA 2OV7A 9ANTA 3FZVA 4JBBA 3ZVJD 1IZ1A 3S3NA 2MGQA 5LRSA 3KP2A 4EIPA 1GT0C 1QXHA 1LEBA 3JR9A 3CO6C 5IYDJ 2PN8A 2RDPA 3K2ZA 5DQSA 1TI3A 1HW2A 3S1RJ 4BE2A 3FXOA 1XPXA 1RUOA 4IW9A 1QVUA 4X4JA 2VT3A 4GCVA 1U5TA 6GSTA 1SL0B 4ON0A 2QZ8A 2IMEA 2KHPA 4B09A 5DDGA 3GFIA 2CJJA 3BR1A 3LQ7A 3MAKA 4LMWA 2PPTA 5FLXZ 3NZNA 2KJBA 4L0WA 2BW3A 2Z5UA 1GL8A 1OYYA 1X4PA 5K5OA 3NWTA 3P7NA 4PNGA 1R58A 3H9JA 1Q1VA 2LRTA 5TRDA 5HDNA 5FKOA 1IDZA 4CO8A 4XIHA 2X8GA 4N30A 3KEBA 3MZYA 1UG0A 3B02A 2UZKA 1V40A 4X0GA 4IJAA 2ICWG 3QCPA 2KQRA 2W57A 1OKRA 2IMDA 2KLXA 4MA9A 3EETA 2A6HF 3S93A 5DCGA 1TLHB 1LKXA 1W5SA 2DMLA 4PX1A 4M6YA 3JRCA 2H1GA 2NNNA 1TNSA 3L00A 3A01B 3GZ6A 1HD2A 4C2MJ 5LCZA 4W97A 3M8JA 1GNWA 2WY7Q 2WGRA 3F4SA 3JRAA 2Z16A 2LQOA 3HTUA 4Q4ZF 2R7VA 1ZHFA 2JA2A 1V5EA 4OWRB 4XIDA 1S3RA 5IPHA 1HDDC 3EDPA 3ZQGA 3ZR8X 3APOA 2GM4A 2VPLA 2ON7A 2FF4A 2VQLA 3K7AJ 3FXRA 3A03A 4YQUA 2VJ5A 4GSSA 2CFXA 4UV8A 3TW6A 4FYBA 3IXRA 2R4VA 2IT0A 2NOGA 4UUSB 1PL2A 1DBYA 4U0WA 4D5FA 2VD1A 1IJWC 1XGNA 4HZFA 2XV4S 3CD6I 4N10A 4G9YA 2I1UA 2DKHA 4ILFA 2OCEA 1M2DA 3NOFA 3CMMA 2K9NA 3CCLI 1RK4A 3BLYA 3J80K 2CVBA 1GRXA 5E17F 1JE8A 3M9KA 4TR0A 1ZH5A 1ZYPA 2MZCA 2K6VA 2C80A 4ZTFA 4DSSB 3H92A 4J56E 5DCFA 3GURA 4EJWA 4X0XA 1MBFA 3B6AA 3QFBC 2JSZA 3WODF 1LQ1A 4JOMA 1IRFA 1SJZA 2F5DA 1X9WB 1R23A 3DTIA 4XLNF 2EV6A 5IT3A 1Z3EA 2F2EA 2EV0A 2H74A 3ZMVA 1ERVA 3H35A 2RN7A 2IL3A 3GN3A 3IRQA 2AQFA 3NAUA 4N4NB 1Z0XA 2L7ZA 3FF5A 4RQXA 1NG7A 2GIZA 2LH9A 1FOKA 2STTA 5J41A 2IJYA 3M3YJ 4MMMA 3GTGJ 1BIAA 2K02A 5IP7J 4MF5A 4LFUA 4HW0A 4AIDA 4YELA 5D6FA 1FEXA 3Q18A 3O2PE 4EUYA 2HS5A 4CZZA 2P5KA 4GDFA 2ZMEA 4L5IA 3LFUA 5CVVA 4OIRF 2QA2A 4NWYA 3JTHA 2DU9A 3C8EA 2IA0A 3D22A 3QWLA 2E7PA 4ZL8A 2P4WA 3PJRA 2EA2A 1ULYA 5H2FC 2XAUA 2VOCA 2R0GA 5GZZB 1ERWA 2DBCA 1IRZA 3TOBA 4GRIA 3F3XA 2E1CA 2JL4A 5CQEA 2G0EA 2CV4A 2CQKA 2HWVA 2Q8KA 3FW2A 5IO0A 5J3RA 4A3JJ 1P9QC 1BM9A 1ZR4A 2K27A 4N0VA 2A4HA 1R5HA 3QP6A 1MH4A 3HKZN 3V8KA 2VLUA 1QHGA 4CYCB 2LKUA 3PIPF 4O5VA 4Z2TA 2AHQA 2A5WA 4J01A 3H5AA 3ONQA 1K4SA 2CU7A 4MH2A 3QDNA 5EZGA 3T8RA 4BYYA 2I5UA 4HSCX 4XCSA 2WA0A 5E3NA 4V1Ag 5JLWA 5B6MA 2XASA 3FK6A 2L9RA 3MSZA 2LUSA 1HF0A 2XPVA 3K4NA 2MW8A 1I5ZA 3U21A 2YR2A 4I8BA 4ZBBA 4KFCA 1S5LC 4HDEA 3CXGA 3VFIA 5ID2B 2IS2A 2QYOA 1SD7A 1JUSA 3ZQIA 2O3FA 5J8CA 5LLQA 1V58A 5IQYA 4EDYA 2R7DA 4C2UA 4PUAA 2V1XA 1ZQ3P 2WADA 4EGYA 3VODA 1O6JA 3W8JA 2H8WA 3H3ZA 2IRFG 3VSKA 2O8VB 1BW6A 5D9WA 3GXOA 3B6CA 5DJMA 2FBIA 3B73A 2HQAA 2O7KA 5DUIA 2VB6A 3M8EA 5C04A 1MNDA 4B43A 4BY7J 5D9TA 2DA7A 4MJAA 3EYYA 2B7KA 4XM3A 5GADJ 2ELHA 2VBXA 4K0GA 4U0VA 2DI3A 5IT9K 2C3QA 1XGSA 3TDUC 5IP6A 1BEDA 17GSA 1OC9A 3LSKA 3ZQFA 5LGTA 1L3LA 4M3GA 2CO5A 1VQ7I 3U6VA 4DVCA 2DC5A 1FB6A 2STWA 5F8BA 3J80Z 2DYRH 5G2ZA 3LA7A 2GLOA 4BHCA 1FVJA 3FDYA 3TDGA 4UVAA 1VQOI 5DCHA 2LEGA 1VZ0A 3TMOA 1LUJB 2FA8A 5LGUA 3P2AA 3C7JA 2VQCA 2QBYB 1ERDA 2EIJH 4N9IA 3ZIJA 3L09A 4CCJA 4Q5NA 4KX4A 5E1ZB 2ZC2A 2HZEA 1H75A 4BHPA 2DOAA 2YZHA 2ETHA 5K7FA 2V6EA 1YRNB 3BCKA 2ME0A 3ZFLA 2DJ2A 4ZC3A 3PUBA 1X5DA 2Z9SA 3GV1A 5HFGA 3U2RA 3I64A 1SKSB 3ZRGA 1W36D 1W4VA 1P7IA 3F6VA 3KE2A 1E2YA 3T5XA 2MLGA 4G8XA 3IWFA 2BVMA 2P6TA 2DBBA 3ZOBA 3CQZJ 1MNMC 4BXXJ 3TJFA 5BMZA 2AQEA 1MKMA 1ON4A 1PFOA 2VN2A 3SFZA 1KONA 1R4NB 5LGNA 1B9YC 3FKJA 4I6ZA 1GSSA 3KLOA 1CQHA 4A3EJ 3HTSB 3L1PA 5CRDA 4I99C 3UEMA 1W1WE 1ETOA 1ETVA 3ME7A 2N5AA 4ISDA 3REOA 4NXIA 3UMAA 3PH9A 4C3IJ 1FSHA 2E60A 3I4PA 4HV6A 1Y0UA 1RKTA 2FOWA 1JUPA 2L7MP 2L7KA 2A2RA 2LF8A 3TUEA 1DU0A 2YWMA 3JAMK 2BTOT 2FQ3A 2OZUA 3FZAA 3CMIA 2XVCA 5EYRA 1B72B 4LL1B 2M87A 2QSHX 1A35A 4DSRA 4HZ2A 2QA4I 3DMLA 2VT2A 2KRFA 3BY6A 3OS0A 3PGTA 4X43A 2Y9ZA 2LR8A 2R7RA 1ZL9A 4P1WA 3DFGA 1HQCA 3S9FA 2FX0A 2X6YA 4PNFA 2EQRA 2HDWA 4O6JA 2ZB9A 1RUNA 3GFMA 3E6CC 3LXZA 1R5GA 4XLAA 4BJ5C 1UHMA 1XWCA 3CC4I 1URMA 4N0BA 5K1YA 1XBSA 5D5UB 1RI7A 5G31A 2E2IJ 3DBHB 3IL2A 3WT2A 4ENMA 2AHEA 1B8IB 4XNFA 1TBXA 2FXAA 2M1BA 1FC3A 1ZR2A 3S2DJ 1AW9A 2UUZA 1YF1A 2GVPA 3GHAA 1MBEA 1XMXA 2DQLA 4ZBDA 3SBCA 4CW9A 1EH8A 1I50J 2BV6A 3MMYB 5LFAA 1BG5A 1ERUA 3HUGB 4J57E 1H8AC 3SJMA 3QOEA 1XIYA 2M4GA 13GSA 1S8NA 1R4MB 4IQAA 2ESHA 4EATA 3D5JA 5J4YA 3CP8A 4BKXA 2FWHA 3C2BA 2X51A 4DJAA 3R61A 3J7ZI 4V1Ap 5ECLB 3H9GA 5INYA 1V54H 1OJLA 3BZKA 1ON1A 3GTUB 4I2UA 1WQ2A 4M6XA 6GSXA 1YX3A 2LG4A 2VLVA 2LV3A 3ERED 5GAGJ 4BJTA 4CICA 2R5GA 1O85A 2E1MC 2W25A 3BQYA 1U2WA 2IEKA 1BI3A 1X4OA 3GTPJ 4ECBA 5KOWA 1BR2A 4BEHA 3TOUA 1OCPA 3WGGA 4MZCA 3I59A 1EP7A 2FD3A 2B5EA 1GUUA 1K83J 4EO3A 2KDZA 3K70C 3HOSA 2FOKA 2DT7B 2E2HJ 3K4CA 2RM5A 2V1NA 3FXQA 3W6JB 2W7NA 2HNLA 1OAZA 2J23A 4R1HA 3C7MA 4D73A 3OSGA 2NAZA 1N8JA 3L0HA 1WJFA 2N8GA 4OOIA 1ZMAA 2DT6A 2X64A 2CQ9A 3FMWA 1PD21 2YCDA 3HJMA 3FMSA 5CRGA 3CRUA 2H1BA 5IMFA 3WTZA 2QLZA 4A6EA 3OYIA 3PNTA 4E7IA 2GT5A 1UB9A 2EPFA 4FX0A 1Y8RB 4BL7B 4POMA 1UG2A 4FE4A 4ZB8A 3ABTA 2H73A 4KT5C 2QGUA 3UBKA 5J9CA 2QKMB 3OL4A 3WU2C 2QENA 2XC2A 4KCEA 3AFHA 4HG2A 1UC7A 3AG1H 2QSFX 2GZYA 3BCIA 4ECJA 3R3EA 1YW8A 5HOOA 3S17J 5FWGA 2D1VA 3M8FA 4E4HA 2WAFA 2WAQA 2XGEA 3CDIA 4GRFA 2MBFA 1TWFJ 3ESWB 3FHNA 2OTLI 5COHA 2JTVA 2VASA 4MNNA 9GSSA 5J1UA 5E4WA 4O5QA 1YI2I 4YFKF 3IPZA 3DKWA 1BIBA 2A61A 4HX7A 3DKSA 1PP8F 2VCZA 2PN6A 4HUAA 4AGSA 5IYBJ 1AQVA 2JSYA 2V41A 4BNCA 4NAXA 4OWYA 2FJ1A 4KIFA 1K61A 5F6FA 2EV5A 3NIVA 5G5EA 4H0EA 2CW8A 5EJCA 3CTAA 2E1OA 1TK0B 4UB8C 1J0FA 2C3TA 4ESBA 5DM7F 1F6MC 1SYXA 1KYWA 1GTUA 3ABMH 3SZPA 3HXSA 4IHXA 2DMMA 1TT0A 2P6SA 5FD5A 3KLNA 2JA5J 2R5YA 1WVRA 4KT6A 1GSYA 1TTZA 2HZFA 3P90A 1PX7A 3LFLA 1SD8A 1YF0A 4TR1B 2I10A 2CH0A 3F21A 2LMDA 1ON2A 4NQWB 1PGTA 4V2NA 1S7EA 4CY8A 2EB7A 3GTQJ 2ISYA 4KUNA 4KIBA 2M9HA 2EIMH 3J81K 3V8LA 2Q0OA 3BTJA 1SMYF 3FHZA 3IOSA 3CDLA 3HY2A 2DKIA 4BQNA 3GTJJ 1WOUA 4RAFA 3LSPA 1Z3YA 1U87A 4P3YB 3HOXJ 4M74A 5HLHA 2IFQB 4XS4A 2M7BA 3E1SA 2IGKA 2GSTA 3CQFA 3I69A 1ZLKA 2YN1A 2B5XA 2E0QA 3M3MA 2X0LA 5IMDA 4DSQA 1E3PA 2VJ4A 2VUMJ 3JCML 4E8EA 2HTSA 4CGZA 4AJ6A 3F23A 4ENKA 3IHGA 3GLLA 2R5ZA 2LK2A 1ORKA 2VPRA 1GSFA 1T3BA 1S3JA 3LWAA 2OE1A 4R8HA 1VQMI 1K7AA 4ESJA 1R71A 4YFNF 5G5FA 4YKGA 3UVHA 3ZRDA 2L7FP 4ZTJA 3A5WA 1XMKA 2MC3A 3ZN1A 3Q0WA 2VL3A 2RM6A 3PINA 4YQMA 3W2VA 2M80A 1E0EA 1ONVA 3G9BA 4QIWN 1ZLJA 2R0QC 2HOSA 4A0ZA 5GSTA 2X9DA 5JCGA 3Q3SA 2FE3A 4NPBA 3EYIA 4ZL9A 4K1FA 2VXDA 4E7KA 2FWEA 2TRXA 2I3YA 2BXYA 4L5JA 3E6MA 3K2AA 4BDZA 4IP6A 5D5XB 1G4DA 4IQ4A 1ETYA 4CCMA 5JHUA 3HOUJ 1JGSA 4ACSA 4MP4A 1XTAA 3VI5A 2DTZA 4FISA 3N4MA 1JHBA 2OJED 3SYTA 2NDOA 3FXKA 3ED3A 4CCNA 2XAJA 3V42A 2F51A 4A6DA 4U88A 5ELAA 2DFEA 2EBIA 1I6HJ 2UWMA 3OOPA 3TO7A 1IV6A 3GO5A 2E35A 2GSSA 3DGQA 5EL8A 2QKLB 3ELKA 1OR7A 4HOJA 4FTHA 2DA1A 2CV0A 2VO4A 5DALA 1EEMA 4I09A 2R93J 2QVOA 1K3YA 1AWCA 3EINA 2RKHA 2PQ8A 1KTEA 1POGA 1Z7UA 2WTEA 2DJ0A 1ZGWA 3DYRA 3TGZA 1BR1A 3S8PA 1PUFA 4FYCA 5E18F 1BX9A 1CF7B 1GTAA 2HRNA 1VQPI 4UB6C 4Y15A 4A2UA 1PP7U 3LMMA 1H9TA 3H0DA 1SK2A 5E1WA 1VF1A 2M8EA 3K70D 3NEUA 4WEYA 2Y30A 1GV5A 1A24A 3A01A 3JREA 2NVTJ 1ACIA 2EILH 2A2PA 2H6XA 1RESA 5E59A 1H9GA 2X6OA 1H88C 2O8XA 1IGNA 1A2JA 1NHYA 4L5EA 1U3AA 1K6YA 3ML6A 2X85A 2CT6A 5ECPB 2K8VA 4ECIA 2TIRA 4N0ZA 5G1LA 3KZYA 4F92B 3QD9A 2GQLA 1MNEA 5C44J 1I9DA 5ED4A 4L5LA 1M2BA 3W8SA 4Z2RA 2EFPA 1P4AA 1YG2A 5J3LA 1IN7A 3AL0B 1GNEA 1XVQA 2C0EA 4DZPA 3ZXSA 1DU6A 1BI0A 4KW6A 2R7WA 1XGMA 3C2GA 3FXJA 3BR5A 5M5WJ 3E0UA 3ABKH 1TT5B 1MBHA 3A1YA 2A6TA 4ZZLA 3GSTA 3GX8A 4PXOA 5ECIB 1TWGJ 5LHGA 3J81Z 2HVSA 5ECSA 2AXLA 2O9LA 4IHUA 4TRXA 2Z2SB 3BC8A 3CP2A 3FK7A 3HPGA 3ULQB 1PQNA 2CAIA 2FWGA 2YWIA 1N75A 2LKSA 1GLPA 2GZWA 2IGNA 3EUHC 2F48A 4RA2A 2JADA 5D73A 2KDOA 4EJUA 3MFKA 3LA3A 3GTMJ 4MJCA 2EZIA 2KP6A 1IW7F 3UARA 1O7UA 2EC4A 3HVSA 4DSSA 3GH6A 5A4UA 5L3GA 1IC8A 5FLVA 3I4MJ 2DDAA 3FKIJ 2E2JJ 4CY6A 2QEXI 1EEJA 3EU3A 2HFDA 2R7TA 1WCMJ 2PG4A 4IHWA 1ZYQB 2KKOA 1XWAA 3KP3A 5CNWA 4F82A 2FQ4A 1SAXA 1G7EA 1IN6A 2V7FA 3F63A 4HAMA 3F72A 5E8GA 5DTDA 3GH9A 4RUVA 6GSVA 3EPTA 3DQVC 3KX2A 1T39A 2X8CA 3EU4A 2VCVA 3GKXA 4HX8A 5HLIA 2OF7A 2RQPA 3I0TA 3RKQA 1BA5A 2EFQA 4IS0A 4G9HA 1OC3A 1WP0A 5EG0B 2QSGX 3TKRA 3FXMA 3ZLPA 2PJRB 4FX4A 3DTEA 4A3BJ 2VL2C 3FM3A 5LBQA 3C2HA 3ZL5A 1T38A 2DFFA 2KZGA 2RVCA 5M5XJ 2PX9A 3BP8A 1UZCA 4GTUA 5DAKB 3QRFF 5ECOB 2F6CA 1NHAA 2XB5A 4ZYGA 4BH9A 1BC8C 2EH3A 1PUEE 3RJPA 3I55I 1X9MB 1N77A 4I97A 4L9NA 4A3DJ 4A3GJ 1QUWA 1VI0A 3P9CA 4E8HA 2KPMA 3D5RC 1JTXA 2QCOA 3CF2A 3A0HC 4JYKA 2LKXA 5H5QA 3ZREA 2H6CA 5HLTA 1I1GA 4P5OA 3OMYA 1R4WA 1IN4A 4OO4A 5GAPD 4ASNA 3C1SA 2QQ9A 4CHUA 3TKSC 3TO6A 4M9SA 5LD2C 4G12A 3FBNB 4ENJA 4MCUA 1MBGA 5ABRA 3QYEA 4PURA 2RLIA 3M8NA 2AAWA 2BY2A 3G1MA 3VYTB 4UV9A 1RETA 2PLYA 4KB3A 4XONA 3I71A 3RHCA 2PVOC 3KYDB 3Q5FA 2MMOA 3SEQA 1Z67A 4HDUA 1FTTA 1QQIA 2ZXJA 4F52A 4M3DA 1KQ8A 1J2XA 1F36A 4RB0A 2JVHA 4YIFA 3LNQA 2MFZA 1UMQA 4ZYAA 4IZZA 2C0FA 4ID0A 5F07A 3DRNA 2QQBA 4PJJA 5IOXA 1PVEA 1VQ4I 4W1UA 3TO9A 3FHKA 1XW6A 3FYGA 3OV8A 2REMA 3I6AA 3CO7C 3GEZA 3LL7A 3Q9SA 5JR3A 5EGOA 3MDKA 2LY9A 3K1PA 4OMZA 3SZTA 3CMEI 3GKNA 1X9SB 2X1EA 1N25A 2VL8A 1AA7A 2MMZA 2N5BA 5AIPA 5DJLA 2L9SA 4LLRA 1SVOA 2JMWA 4ZH4F 1OCZH 1Y1WJ 3EWLA 2MH9A 4GF0A 4JZQA 4LLGF 1Z6RA 1RPWA 1AKHB 2C3NA 5CO3A 3TKPA 3ROUA 4EV0A 2JACA 3PR8A 2KP2A 4KDYA 1OC8A 1JHHA 1G3TA 1GLQA 1X0RA 1DGWY 1DGRM 1ODDA 3F8UA 1W89A 1RZ4A 4KA0A 1IN5A 4RBOA 1PA3A 2O03A 1GULA 3E7LA 1GDTA 2L54A 3IC7A 1XWKA 3EPZA 4KDUA 3WTSC 3IUOA 4IEJA 5F27A 3CUQC 1Z9HA 4IPAA 5F1JA 2UXNA 2DFHA 4IX7A 4OAZA 4NHJA 1G0TA 4EE0A 1UN2A 2BXZA 2P0GA 4N9HA 2QBYA 1YKAA 4IGJA 3HG9A 2ZCTA 3SQNA 3RPQA 4BVYB 3COAC 2KJCA 2IMFA 2WDUA 3EMXA 2PJPA 4OAYA 2H30A 4RI7A 2EZHA 2M8GX 4V2FA 2EA4A 1G59A 4LB6B 4L0YB 3RAZA 4XLCA 3E97A 3OYCA 3JTGA 3DEXA 1S29A 3WGDA 2P81A 4LG3A 2HSHA 4A3IJ 3HOYJ 3WU0A 2GQQA 4KF9A 3IDVA 3ECHA 2DMNA 2RNGA 2TDXA 3L9FA 4Y33A 3RIRA 2A2SA 4DYRA 2CQQA 1OYJA 3HM5A 4DIQA 3BG7A 1MIJA 1H89C 3CJQB 2H6BA 1OFCX 3RZDJ 3S1QJ 1P4WA 3KEOA 3ZQLA 4CH7A 1BL0A 3LW9A 3JRDA 5FKMA 4MPGA 2XAGA 3I3LA 3RQIA 1WZ2A 3IKTA 3ZMTA 4WCGA 3LA2A 3KH9A 3DLLF 1MJ9A 4JE1A 1Z6NA 5D9XA 5J4UA 4Y7NJ 1QNTA 1BJZA 2A07F 1LPQA 1D5VA 2WB1A 3HJOA 3DD3A 2Z33A 4EM1A 1VQ6I 2NVLA 4BXUA 1XG8A 5JWRB 3BPXA 1Y1VJ 3GIXA 5FT3A 6GSUA 1ZYRF 4YKFA 2K85A 2D1HA 3H9QA 4FASD 2XC7A 4KYWA 5JVTA 4OCFA 1R6RA 3G6EI 2YSRA 1HKTA 2V1MA 3QPSA 4LMVA 3DPLC 1Z77A 2L3DA 4USSA 2ZUPA 3I58A 4B44A 5AIXA 5IMZA 1SFOJ 5IP9J 1S3DA 3TQNA 5HR3A 3PO2J 1V4RA 2A68F 4KJZA 4BQAA 2ZFWA 2JUCA 4U7BA 2COMA 1IG7A 1K0BA 3SDBA 1JKRC 5ECKB 1X1BA 2FUG2 2DJ3A 3OIPA 1EKEA 1Z5YE 2VL2A 2JA8J 3KM6A 1MH3A 1TQIA 1HBXG 2VCTA 4TXOB 4IHVA 1K0NA 5IM9A 5IY5H 3J7AY 1Y39A 1TWCJ 1T1VA 2IS4A 3W6VA 3FBIB 3HUGA 3ABUA 1HYUA 2OACA 3HRSA 2M0CA 2AXTC 2ZNYA 4DBRA 4QL7A 3IC4A 2VI6A 1XWBA 2HQNA 2VBWA 2I8DA 4I2OA 3KTLA 4XRAA 3HDCA 3BR2A 1ZRFA 3LSIA 4CDGA 1K0DA 3TKSA 3R4KA 3Q0VA 1Q1HA 2B5YA 1SMTA 1X3ZB 3F8FA 1WPKA 2CSOA 3DEUA 3HVVA 4OINF 1T0FC 3BQZA 5IOYA 1XDUA 1WI3A 1YY7A 3H5NA 4CSWA 1HOMA 4LL4B 5KN0A 1RRJA 1NH3A 3NARA 3PL8A 3HOZJ 5EPFA 1P4XA 4E7SA 1DPRA 2A3SA 2XAQA 5BPIA 2XF7A 4LG0A 1UAAA 1OCRH 3F3RA 4NC7A 2E34A 2ECBA 2ELJA 3IRRA 3KYLA 4JX6A
chains in the Genus database with same CATH topology
2P0WA 5KNLA 2D2ZA 2R6KA 4MLOA 4K7OA 2OKAA 2I4AA 1WIKA 3AL0C 3GL5A 3D21A 2C4JA 3C71A 3LSZA 4H4KC 2H0HA 4R79A 1SK0A 4O5UA 3K4KA 3F9UA 2L9NA 4K7NA 1JI8A 2ALBA 1WWJA 3O6TA 1OKDA 1XOAA 3RTRA 4OFTA 4K9ZA 1X5CA 2QA1A 1GSDA 4QPQA 3GX0A 2EIRA 3TJKA 1YKCA 4I2TA 2HVRA 1SJ6A 3RHBA 3WYWA 4BVXB 1J09A 3VWBA 3H5RA 4HQZA 3LORA 3ZFBA 2IMIA 3R2QA 3BCBA 4CCOA 1DSBA 4H86A 5B8BA 4GCIA 1B4QA 3G7YA 1ERTA 2CZ2A 3TBIA 3RPNA 4TVEA 4E6KG 1GUHA 2LJKA 2QSIA 2Z1DA 3DVXA 3DPTA 1PRXA 1QFNA 2VKHA 1G6WA 4CZCA 1K3OA 5CRHA 3L78A 2R7XA 3HZ4A 3VWWA 2VKDA 4O5RA 2Y0SA 3VPQA 1Q98A 3QAVA 4NV5A 1RQMA 5F06A 1PKWA 3LSMA 5ECQB 3TJJA 1Y25A 2GSQA 3IBHA 2V32A 1BAYA 2LS5A 1TU7A 2DXIA 1X1AA 4XN0A 4F3QA 1A0FA 4C30A 3O76A 3TOTA 5EY6A 2RREA 3FZ5A 3CZ6A 1YEPA 2P5QA 4JR6A 2XPEA 1PYVA 3J7Yk 1YQ1A 4XKVA 3LJRA 1MD3A 2YV7A 4Q5QA 3UL3A 2PWJA 3CSJA 5JHFA 5ECHB 5KHDA 4AJ8A 5ECRB 1TW9A 2BW3B 3W2WA 4K7IA 4F9ZA 3RSNA 2H6YA 4K2DA 4MDCA 1U6TA 2KHMA 1O8WA 1QU3A 4Z2UA 5LNKe 2HI7A 4ZJZA 2VJIA 4ULXA 14GSA 1SD9A 3ZIVA 4ZBAA 3ERWA 2P31A 5CQGA 4BGDA 4XS1A 2GOXB 2X6WA 3KJYA 4V2LA 4DGWB 1ZYNA 2X1DA 2H6ZA 4WR4A 1PN0A 1T00A 4B47A 4L8EA 1A2LA 2VCQA 3DKXA 4PJMA 2BJXA 2HRFA 1JZRA 3BBYA 1KNGA 4C2TA 2PGTA 4BWQA 4BUPA 3KP8A 3DU5A 4PFPA 4B3XA 3UBLA 4XRDA 5DDLA 4E7HA 4IJ3A 4LA1A 4Z7XA 3GYKA 4J2FA 1SENA 3TRQA 2BOLA 3QMXA 5LD0A 1T8EB 2IPAA 5AN1A 2YPMA 1EOHA 2VAFA 2IXSA 5G1KA 1Z7LA 3S32A 3EE2A 2GGTA 4ZB9A 1AQWA 1SL1B 2XDVA 1MDIA 1T7PB 4NUBA 3PSIA