3IAM2

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
179
structure length
179
Chain Sequence
GFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
total genus 44
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3iam201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3iam202
1VGLA 1OE8A 1WPIA 5B8BA 2B1KA 3IC4A 2CA8A 4MDCA 1PSQA 14GSA 2YOIA 1TOFA 1OC8A 1I9DA 3QMXA 2WS2A 2N5AA 3G7JA 3L0HA 3O76A 4KX4A 1EOGA 2F9SA 4OMVA 4PURA 1GNEA 3MNGA 2NDOA 1N2AA 2VAFA 1XWCA 2GDRA 4OO5A 2C4JA 2I1UA 3WGEA 1F6MC 2IMFA 2GGTA 1QMVA 4YQMA 3CTFA 2WJUA 4IGJA 2VL2C 4XTSA 4K0GA 2EIRA 5HR1A 2VLTA 2A4VA 4LMWA 2ZNMA 5A4WA 2XPDA 3W8JA 1T4ZA 5CYYA 2YCDA 2C0DA 2HT9A 3I9V2 3LJRA 2H76A 1GH2A 5GSTA 2IPAA 2CVDA 3VWVA 5FT3A 3L9VA 3ZRDA 1B4QA 3CSJA 2C3NA 1YEPA 5ECMB 5ID2A 2HNLA 1FG4A 2IL3A 1J08A 3IR4A 3KJYA 1WP0A 1UN2A 4LL1B 3H93A 3GTUA 3EMPA 2MBTA 2WRTA 2YV9A 2JZTA 1T00A 2KP1A 1FB6A 1U3IA 1AQWA 6GSWA 3I6AA 1YKAA 1B48A 4POLA 2HFDA 3TDGA 2A2RA 2J9HA 1U87A 2IFQB 4IHUA 2X99A 3UEMA 2DIZA 3ERGA 3C1RA 3E9JB 1TXXA 1FHEA 4MK3A 4KAEA 2ZUPA 2OADA 5J5NA 4G9HA 3DWVA 3TKQA 2AUVA 2I3YA 2G2QA 4MPFA 2H71A 4YH2A 8GSSA 1ZCPA 4TR1B 5D9XA 2H19A 4GCIA 2VL3A 1K0BA 3L78A 3H79A 3EYTA 10GSA 4XS6A 1SENA 2F8AA 4FIWA 1V2AA 1GLQA 2GSQA 2GS3A 2E2MA 1TDIA 3IDVA 3HD5A 5AIXA 4HQSA 2JACA 2VO4A 1X5DA 3HKRA 1PX6A 3VWXA 2WGRA 4IKHA 22GSA 4IELA 2VL9A 1AW9A 1SJ6A 1MD3A 2H1AA 2P5RA 3IRAA 2YWNA 5DAKB 2FWFA 5ENUA 3KP9A 4BVXA 2XBQA 4X0XA 1GTAA 4ECIA 3GKKA 3BOAA 3QD9A 4GF0A 2C3TA 2PGTA 1TRVA 3GN3A 4NHWA 5IO0A 2NPBA 5AN1A 2GVPA 1QFNA 2VCVA 4YAVA 3F6DA 4ZL9A 3ME8A 2O89A 1EEMA 4FH8A 4TR1A 1TU8A 3F4SA 4PXOA 4GSSA 3GL3A 2VOCA 4K2DA 4KSMA 2L59A 2OE3A 1GTIA 3UBKA 2V2GA 3BCKA 1EZKA 1FOVA 3TRQA 1JZDA 5CREA 3FEUA 4JRRA 19GSA 1E6BA 2IN3A 2OE1A 3FYGA 3H1NA 1BQ7A 3OR5A 2J23A 2BJXA 1OAZA 4GWRA 2YPMA 2NVLA 3CXGA 5J9BA 4WEYA 3GX0A 2VIMA 3CYNA 2LV3A 2L6CA 1O8WA 5B8AA 2L57A 3BCIA 1TK8B 3ZLPA 6GSVA 5ECSA 3GRXA 1DE2A 3I69A 1B9XC 4XRAA 1DBYA 2TRXA 3FHKA 1SYXA 5JCUA 2DMMA 3H4KA 4TW5A 2OBKA 1MTCA 3A5WA 3FR3A 2YN1A 1MD4A 3ZVJA 1X5EA 4NAXA 2WFCA 1G6YA 1AIUA 4MJEA 3J7Yb 1VF4A 3KTBA 4I97A 1ERWA 1OE7A 3Q74A 1KNGA 2JADA 3FW2A 2OACA 4YAPA 1EEJA 2KP2A 3U5RE 1ERUA 2CQ9A 3PINA 3D21A 1XIYA 4TR0A 5KN1A 4JZQA 3RDWA 3WGXA 4Q5RA 4BWQA 2QKEA 2V6OA 3M9KA 4HDEA 4O92A 1F37A 2CAIA 4IBPA 3EWLA 2L4CA 5H5QA 1ILOA 3K8NA 3P7XA 4PUFC 3QAWA 2LQQA 1SYRA 2JSZA 2O8VB 2GQKA 3GUSA 4PX1A 3GKMA 3DMLA 2KHPA 5HR0A 3IOSA 5JCWA 3F3RA 4IJ3A 7GSSA 2CX3A 2JL4A 1A2JA 1K0NA 4F9ZA 2H0GA 1SD8A 2WDUA 4OCEA 1N8JA 2X8GA 6GSSA 3C71A 2F8FA 2XPEA 2H1BA 3KGKA 4NV5A 5J4UA 3VI7A 3LXZA 4WXTA 1TRWA 1KTEA 4DSSB 1PN9A 4LL4B 1X0RA 3IPZA 4QL7A 3TJGA 3C8EA 2GZYA 4PNGA 5L71A 5EPFA 2C8UA 2GQLA 4F03A 4X1UA 4CDOA 2PMTA 5ECIB 3VI5A 3C7MA 4N11A 1WJKA 3V1WA 3EVIA 3IK7A 3VPTA 3MWHA 1CQGA 4RI6A 13GSA 2NTOA 5ECNB 2YJ7A 4MJCA 3KZQA 3GMFA 2D2ZA 2QSIA 1MEKA 3DEXA 3LYPA 1TU7A 1SD9A 2R4VA 5KN3A 1A8LA 1S3DA 2HYXA 3A3TA 2KOKA 5F0GA 5IMVA 1TI3A 3A2VA 3TKSA 4DEJA 5KN0A 2B7KA 2K8SA 1R7HA 1FAAA 2P5QA 2YANA 1J0FA 2X8HA 1ERVA 2BMXA 2HI7A 5J3RA 3RBTA 3UAPA 3FZ5A 4MZCA 2LRNA 1PRXA 3ERWA 4RQXA 2B1LA 4L5LA 4EDZA 1VF2A 4N0ZA 2E7PA 2PERA 4Z7XA 1KBNA 2REMA 4EXJA 4DSSA 4G10A 1SKWB 4V2LA 1NHOA 1T3BA 4LMVA 1FO5A 1THOA 5D93A 3RHCA 3ZMKA 4FO5A 2AV4A 1ST9A 1GSFA 3HZ4A 4MF6A 1S3AA 4K8MA 2GTUA 1A2MA 2LSTA 1JFUA 1XVWA 3SWLA 2V41A 4MCUA 4PNFA 1XOAA 1X9SB 3VLNA 1XVQA 1XOBA 3IHQA 5G2ZA 1A0FA 4PQHA 4BA7A 3DYRA 1PA3A 2CAQA 2GT5A 3VK9A 2GSRA 5AISA 4GXZA 1XBSA 2PVOC 5ID2B 3I43A 5AIVA 4MJAA 1X5CA 1JZWA 3ZVJD 4LA1A 6GSUA 3GTUB 1GP1A 3UMAA 1TTZA 1I5GA 2AB6A 2FCHA 2DJ2A 1Y25A 5LNKe 2FLSA 4CHSA 1V9WA 1YQ1A 3APSA 5HQPA 3KXOA 1YY7A 2DSAA 3GV1A 2JU5A 2YWMA 4MA9A 1QQ2A 1Z6NA 3EMXA 2ON5A 1YZXA 1URMA 1GSYA 2GLRA 1ON4A 4O32A 5KEJA 2H01A 1TK0B 3TJFA 1SL0B 2ALBA 4EVMA 4H86A 3D6IA 3D4MA 1AUCA 1O81A 3WD6A 3G9BA 3ZYWA 4ZILA 4FYCA 2FWHA 3KM6A 2LNSA 1EP7A 2H70A 4K9ZA 5D9VA 5IOWA 1F3AA 1Q98A 5D73A 4I5QA 2L4QA 4ECJA 2HZFA 2JZRA 2H30A 1TRSA 1BEDA 1A24A 2XC2A 1SKSB 18GSA 4DSRA 2V32A 5ABRA 3UOMA 5J41A 1JHBA 1OC9A 5IIZA 2TRCP 1EV9A 4WBJA 5B6NA 4K7OA 3LYKA 4YQUA 2L6DA 1GSQA 5DDLA 2HLSA 3FR6A 4MF7A 3DVXA 3PGTA 2V1MA 5B7CA 2IMEA 2YJHA 5IMDA 2DJKA 1ML6A 4EC0A 4IN0A 2YWIA 1XFLA 4GQCA 5E59A 3UBLA 4ILFA 4V2NA 1Z9HA 2L5OA 5IM9A 3TKSC 1GUKA 1K3LA 4OWYA 3P8WA 1W4VA 1XZOA 3Q6OA 3ZTLA 4J56E 3E0UA 3N5OA 4BL7A 5JWRB 2IJYA 2LRCA 4IP1A 2B3SA 3KP8A 4V1Ap 1ACVA 2VCXA 2K18A 1OYJA 5CRWA 5IPGA 2C0EA 4QQ7A 1G7OA 5IPHA 3TJBA 1EP8A 3TKSE 5G1KA 4O7HA 2P0GA 1PL2A 3LGCA 4L0WA 1GL8A 1GSEA 2MBSA 2LKUA 4HQZA 3KMNA 1THXA 4HUAA 2H74A 3GL5A 3EC3A 2MMNA 2B5YA 5D9TA 2GZPA 4IS0A 4XCSA 2PBJA 4N10A 3QFAC 3UIWA 3CSIA 2B5XA 5F8BA 1V40A 4AF2A 1K3OA 3KH7A 1GUMA 4OFTA 5ECKB 1TW9A 4JBBA 4ZL8A 2LJRA 4ZB8A 3R2QA 1DSBA 2LJKA 2LS5A 3ZREA 3LQ7A 1U3AA 1TRUA 4PQIA 4N0VA 3NIVA 4XHMA 4V1Ag 1U88A 3GSTA 4MF5A 3CBUA 4KNDA 4DVCA 4F2IA 4HJ2A 5LD0A 4KB3A 1Z3EA 4KCAA 5ECHB 4TOPA 1YEXA 5DBQA 4POBA 3GURA 3GH6A 4MMMA 2DJJA 3TUEA 2IMIA 3DIEA 20GSA 4TR4A 1WMJA 2CX4A 2QGVA 3NZNA 3F6FA 5JWOB 2PU9C 1BAYA 1H4OA 2IMDA 3AY8A 1OC3A 1BX9A 5CRGA 2DLXA 4FYUA 2WULA 3KCMA 1IYHA 1U6TA 2FWGA 4JE1A 2ON7A 4Q5FA 1G0TA 2IIYA 2K9FA 6GSYA 2H6ZA 4HJMA 4EDYA 4X43A 5D96A 2E0QA 1XW9A 1DE1A 2HRFA 5FHIA 3D0ZA 5GZZB 2ES7A 4EL1A 1PQNA 1PKWA 1K0AA 4IQ1A 5ECPB 2C0GA 2E2GA 4OD7A 2F3MA 4ZIJA 1TK5B 4KSOA 4K1FA 3ZL5A 4MLYA 5DJMA 4D73A 3ZMLA 2VCQA 1BG5A 3KD0A 4POKA 3MAKA 3CSHA 3G7YA 3D5JA 2MYGA 2FA8A 4TRXA 4GSNA 2F51A 2GZZA 1JLVA 1LU4A 2H6YA 3TRXA 4K7NA 4ISDA 3F63A 1A2LA 3RAZA 4WF5A 5ELGA 2WB9A 5DCGA 3QOUA 3M3MA 1Z6MA 1V98A 2DBCA 2PN8A 1XW5A 3DGQA 4HS1A 4KA0A 5C04A 2FD3A 2PVQA 4KW6A 4IQAA 2VCWA 4EUYA 3L9UA 3GIXA 4WBRD 2EC4A 4O5RA 2R5GA 1O6JA 4GSTA 5CO3A 2FY6A 2OKAA 2HE3A 3LXTA 3WYWA 5HR3A 3RHBA 9GSSA 2C80A 1Z7RA 1Y6EA 4WKWA 3FZ4A 3HVVA 16GSA 3LWAA 2PWJA 3IE3A 1F9MA 1PL1A 3GFKA 5DALA 2HRNA 3LFLA 3F3QA 4K7IA 5G1LA 4BWSA 4NWYA 5ECQB 5AGYA 3LEFA 4KDUA 3PH9A 4MABA 1AAZA 1R5AA 1XWAA 3P2AA 3O6TA 3M8NA 2GSTA 2AJQB 1V57A 1T4YA 5C00A 3CTGA 5CRDA 5DQYA 2VLVA 3VFIA 5DVBA 4JR6A 5IMFA 3UL3A 1W89A 4ECBA 4MJBA 3TJJA 1ERTA 3EU3A 2BTOT 4ZBAA 2I4AA 3QR6A 2LUSA 3FK8A 5J9CA 1B8XA 4K0NA 5DQSA 2CT6A 3UVTA 3A2XA 3C1SA 2N5FA 1WWJA 3LORA 2IMKA 1GULA 1J9BA 1FW1A 1O85A 2HXKA 3VWUA 4I8BA 1EWXA 4MP4A 3FR9A 5HFIA 3EURA 3GNJA 3Q19A 3QAGA 2EIQA 1T7PB 1XW6A 1EGRA 3UJ1A 2FWEA 3HDCA 4GRFA 2H0HA 3IXRA 4L5OA 2Z9SA 1GSDA 3U6VA 1VF1A 4TXOB 1PX7A 3NOFA 5HFKA 5EL8A 3IAM2 3HY2A 3US3A 1YDKA 2HSHA 3KIJA 3WGDA 1LJRA 2VCZA 3GX8A 2RUFA 2O87A 1R5PA 5ECRB 3D4TA 5D9WA 2O7KA 2WCIA 3QAVA 4ZBDA 4TKYA 3TJKA 3KMOA 3MDKA 3G7IA 2HZEB 1C72A 1VRSD 4I2UA 4K6XA 1RW1A 4I2TA 2AHEA 3ZFBA 4RI7A 5H5SA 1AQVA 1QUWA 5G5EA 2FGXA 4L8EA 4HZ4A 3RPNA 3UARA 4AGSA 2A2SA 4WR4A 4OFMA 4IW9A 1PD21 1XCCA 2FNOA 17GSA 4MH2A 5ECOB 4J57E 1SJZA 1SK1A 2P31A 1OC9B 5H5RA 2MMOA 2TIRA 3IV4A 5CAXA 3CMIA 3GA4A 2I81A 1O7UA 3JCML 1TKDB 1F2EA 2K8VA 2OJLA 4FYBA 4JEDA 5ECLB 5B6MA 2B5EA 3MSZA 3DVWA 3F0IA 5COHA 1PMTA 4TXOA 1YJ6A 2MZCA 1M9BA 3GHAA 3HXSA 1DUGA 3M9JA 4OFNA 2LRTA 1MDKA 2H1GA 3HYPA 4ID0A 4QL9A 1M2BA 1Z7PA 2GSSA 1G6WA 2FHEA 4NXIA 1KEBA 1H75A 4XS4A 2HZEA 4BPYA 1M2DA 3A2WA 4TVEA 3APOA 1GTBA 3FRCA 3KTLA 1MDJA 2NBSA 1O8XA 1R26A 3HJMA 4WETA 2YP6A 1WE0A 4KE3A 4ZBBA 1NHYA 4MZWA 4EF0A 2B7JA 4PQ1A 5CNWA 1XPVA 1XXUA 1USBA 1M99A 3HVXA 5GSSA 4CW9A 1QXHA 4G2EA 4IJIA 2B6MA 3L4NA 2LNTA 1B9YC 4ZXGA 1GWCA 4ECCA 1ZZYA 2H75A 2C3QA 3GKNA 2CZ2A 4L0UA 4F0BA 3VURA 3TKRA 2YNXA 4GLTA 3ZFLA 4EKZA 1HNAA 1G7EA 5IMAA 2OA7A 1NSWA 2CVBA 2I9HA 2H73A 3VPQA 1GSUA 4WF4A 5A5KA 1FB0A 2YZHA 4RUVA 2R37A 2N5BA 4ZL7A 4TR3A 5E4WA 2RLIA 2M46A 1XWBA 2R2JA 3H8QA 5HFGA 4XRDA 5GAPD 4V2MA 4EO3A 5GAND 3TKPA 3FZAA 4TXVA 5IMCA 3M1GA 1F3BA 2PPTA 3QDNA 3ZZXA 3W6GA 1OVNA 4EE0A 5ELAA 1PGTA 3DD3A 1ZYQB 2JSYA 1XWGA 2H8LA 2CZ3A 1SK2A 3CRTA 1GNWA 4E8EA 5F05A 2VM2A 4TN8A 3IAS2 1GTUA 5JCGA 3HA9A 3UVHA 2IFQA 2G0FA 3WT2A 1SJIA 5KN2A 4J2FA 4RQRA 1ZYEA 3ZITA 1ZMAA 1UA5A 3ME7A 2H0IA 3GKXA 1CQHA 2YV7A 3APQA 1V58A 2H6XA 1WOUA 3P90A 1ABAA 3ZIJA 3HVSA 3SBCA 2VLUA 1GLPA 1M9AA 4D73B 12GSA 1VF3A 1X9MB 1UC7A 2XBIA 4MZBA 3IA1A 1GUHA 2KLXA 4IVFA 3L9SA 3F8UA 2RIIA 3LG6A 2RUEA 5CRHA 2O85A 6GSXA 2GT6A 1A8YA 3F9UA 11GSA 2X64A 3PR8A 5IO2A 4G19A 1PKZA 4POMA 5JWQB 4N30A 1YF0A 3HJOA 1K0MA 1YKCA 3TRPA 4KCEA 2R6KA 1X9WB 5EVOA 4ZB9A 2C0FA 4Q5QA 2V6KA 1HYUA 3W8SA 2LQOA 1T8EB 2H66A 2DJ3A 5DAKA 1NW2A 3D22A 3IK9A 1EGOA 1QK8A 4AJ7A 3TGZA 3ERFA 2VM1A 3TB2A 3TCOA 2IWTA 1GRXA 3FZ9A 4MPGA 2FUG2 5DALB 1RQMA 2YZUA 4KDXA 1AXDA 2XHFA 2LTKA 3J7Yk 4LLRA 2AYTA 4PGTA 4NPBA 4AJ8A 2OE0A 3QFBC 1TI1A 1TJDA 2RM5A 4E8HA 3N9JA 3WT1A 2OBIA 4I6XA 4KGIA 3QCPA 3VWWA 2VCTA 2C1YA 2HSYA 5HR2A 3IBHA 3HZ8A 5A4VA 3BJ5A 4ML1A 4HEA2 3RPPA 5IOXA 3HJPA 3QPMA 5INYA 2PUKC 4ML6A 4MH3A 3DXBA 4JU5A 1FVJA 1ZOFA 4AJ6A 1QGVA 1E2YA 4ACSA 2K6VA 2MMAA 1B4PA 2QC7A 2WZ9A 2MMZA 1NM3A 3EE2A 1ZL9A 1A23A 1OKDA 2RM6A 3HCZA 4HU9A 1SKRB 5DJLA 2L5LA 3C73A 3S9FA 1M0UA 2DJ0A 1A0RP 3TOTA 2DC5A 1SU9A 2VL2A 4KDYA 4WR5A 5IQYA 3FY7A 1OKTA 1WIKA 5G30A 1YF1A 2VD0A 1S3CA 5G31A 3BBYA 2CVKA 1K0CA 1UVZA 1HNCA 1HNBA 5CP1A 2AAWA 4NHZA 1GSSA 2R3XA 3FKFA 4P3YB 6GSTA 1LBKA 1FVKA 1XWKA 4Q5NA 3DKSA 1Z5YE 1WRYA 2LEGA 3TOUA 4GTUA 3ED3A 5F06A 4IP6A 3GSSA 1JZOA 4F0CA 1M7TA 3EU4A 5FWGA 3GH9A 1RK4A 3BD2A 4OCFA 3DRNA 4DSQA 1K0DA 2GQMA 2ZCTA 5EY6A 3M0FA 4KUNA 4F82A 3CRUA 4NMUA 3E3EA 5G5FA 4HU7A 1HD2A 4XS1A 5LCZA 4XIHA 2H72A 1EV4A 1TP9A 2X8CA 3ISOA 4GQFA 5D8IA 1K0OA 2H1DA 3LSZA 4PUAA 1T1VA 5A4UA 2DIYA 4NV2A 3KEBA 4HI7A 1SL1B 1MDIA 1M2AA 5IMZA 3ZIVA 4JR4A 4BVYA 2YWOA 3HHVA 2KUCA 1R4WA 1AC1A 2DMLA 4ULXA 1BYEA 4HZ2A 1JZRA 4XS4B 2VUPA 4KH7A 2EIOA 1K3YA 4ZB6A 1ZGNA 1Q4JA 1O73A 1BJXA 2DJ1A 2M72A 1IYIA 2LJAA 1HQOA 1EOHA 2M80A 1JLWA 3Q18A 5F07A 1SL2B 3F4TA 2JZSA 4OO4A 2VD1A 4HOJA 1SK0A 2FA4A 3O3TA 5DCHA 3GYKA 3F4RA 2CV4A 1AQXA 4YQVA 3EINA 3KH9A
chains in the Genus database with same CATH superfamily
5K7HA 2PJRB 5ED4A 1VGLA 1OE8A 3DKYA 1Y1VJ 5B3SH 2D45A 2QQ9A 1WPIA 1S7AA 4IQ4A 1HW5A 4IXAA 4BEHA 2DOEA 4CSWA 4NC8A 5B8BA 5CVIA 2B1KA 2YU9J 3O3KA 3IC4A 2CA8A 4MDCA 4OOIA 3LSGA 1PSQA 14GSA 2VIXA 3BCBA 3BOQA 2EFPA 4CZZA 1U9OA 3IV5A 1OC8A 1TOFA 2ICWG 4GRIA 5FLXK 4ESBA 3R6SA 1I9DA 2N5AA 2HPIA 2BXYA 1NG6A 2A6EF 2WS2A 3G7JA 4GWRA 5ILSA 2UZKA 3L0HA 1Z67A 4OIRF 3O76A 3JAMZ 4KX4A 2M45A 2DFHA 1EOGA 3OYAA 2F9SA 4OMVA 4PURA 4PFPA 1GNEA 3MNGA 4M6VA 1N2AA 2NDOA 2VAFA 4G0KA 1XWCA 1H0MA 2GDRA 1IDZA 4ZZDA 2C4JA 4OO5A 1MGTA 4IPAA 2CS3A 1UB9A 2I1UA 3S15J 1PDNC 4BBSJ 2EQRA 3WGEA 1RZ4A 1XCVA 4UUSA 3K10A 4U7DA 1F6MC 2IMFA 3AAFA 2GGTA 3VDXA 3JAMK 3OMYA 2QUFA 1G3YA 4I0AA 5CVVA 3HOSA 1T8IA 1ETQA 1FBSA 2WC2A 1C0WA 4OMYA 1BW5A 3FX3A 1HDDC 1QMVA 4YQMA 3FBIB 2A5YB 3CTFA 1SMTA 1FOHA 2JSPA 1QPMA 2WJUA 4IGJA 2HKOA 2VL2C 2XSJC 4FHTA 4XTSA 1M3IA 4K0GA 2GOXB 2FD5A 1ZK8A 2M5WA 2PMHA 3KYCB 3GTPJ 1U2WA 2L7ZA 4LIUA 4RAZA 1FLIA 1IN6A 2EIRA 5HR1A 1NK3P 2VLTA 5HDNA 3I54A 1JUPA 2A4VA 3FZVA 4HDUA 2V9PA 1I3AA 2QA2A 3IRRA 5J47A 3HBLA 3KEOA 4LMWA 2ZNMA 1I5ZA 4IL6C 4I09A 4G6DA 4AD9A 1TWGJ 4BJTA 2VL8A 2IXSA 5C3EJ 5A4WA 2XPDA 1SC7A 3W8JA 4B47A 4XBFA 2KFDA 1PUFB 1T4ZA 5CYYA 2K3PA 2K7LA 1YFHA 1KA8A 3WTVC 2YCDA 4CCLA 2C0DA 3I9V2 4F7ZA 3AKZA 2HT9A 3LJRA 1ERDA 4RM3A 3ZMZA 2VI6A 2H76A 1GH2A 1X3UA 2HYJA 5GSTA 2IPAA 2CVDA 3QOEA 3R0JA 2DU9A 2E1NA 3JR9A 3VWVA 1VQ5I 5HLIA 4XQFA 4IHTA 5FT3A 4Y4RA 3L9VA 3ZRDA 1B4QA 1T6SA 2HVRA 2C3NA 1YEPA 3CSJA 3GXOA 4HV5A 1D1CA 2CSOA 1FJLA 3OIOA 3MIXA 4B3AA 2XB5A 5DJLA 2M9HA 2O61A 5ECMB 3ONQA 5ID2A 2HNLA 4KN4X 2K02A 1FG4A 2IL3A 1J08A 3I5UA 1HCRA 3IR4A 4F91B 3KJYA 1WP0A 1UN2A 4LL1B 3QP5A 3GTUA 3EMPA 3H93A 2MBTA 1TWHJ 2WRTA 3L2QA 2YV9A 5FRNA 2JZTA 1T00A 2R7FA 1ENHA 4FT8A 4L5EA 2KP1A 3RIRA 1FB6A 4BE1A 4B1RA 1U3IA 1AQWA 2LRDA 3T8RA 6GSWA 4RM2A 3I6AA 2FNAA 1B48A 1YKAA 3E97A 4HX4A 4POLA 3GYHX 2DYSH 1N25A 2HFDA 2LDUA 3TDGA 3G1OA 5LRRA 1VQ8I 3PJRA 2A2RA 1S5LC 2D5VA 2J9HA 1U87A 2IFQB 4IHUA 4E7LA 1SL1B 4DGWB 3GMEA 1FZPB 2X99A 4Y15A 2DIZA 3UEMA 3ERGA 4BVXB 1ZG5A 4IHVA 2IA1A 4WWCA 4AVZA 2E71A 1GT0C 1DDNA 2GQQA 3C1RA 3E9JB 3CUQA 1XB4A 1TXXA 1FHEA 2CV2A 2JUGA 4MK3A 3TKYA 1S29A 2L4AA 4KAEA 2ZUPA 2M87A 5E1ZB 2OADA 5J5NA 3BTIA 1IGNA 2OTJI 3DV8A 4FTHA 4G9HA 1D0ZA 3DWVA 2L9RA 2AUVA 2MW8A 5EEAA 3CCEI 3TKQA 2NS0A 1R22A 5EEGA 2A05A 2CMPA 3ML6A 4H4KC 1PJRA 2FF4A 1ORKA 2WTEA 3K1NA 2I3YA 4EIPA 1MNMC 4QSHA 2Y0MA 3WGHA 3GTJJ 2G2QA 2A69F 2XUBA 4HF0A 3ABTA 4MPFA 3LW9A 3F8MA 2KRFA 1X58A 3Q9SA 2H71A 4YH2A 8GSSA 1Z0XA 4DW6A 4HX7A 4QPOA 2JZYA 4MLOA 3HRTA 1ZCPA 1JKPC 4TR1B 5ILVA 5D9XA 3TL4X 2H09A 1OCZH 4GYIA 2H19A 4GCIA 1EH6A 3NRVA 2CUFA 2RQQA 3KP2A 4M73A 2VL3A 4A3EJ 4UY8I 1K0BA 3L78A 2EINH 3H79A 4LG0A 4MNNA 1IN5A 2F6CA 1TNSA 3PQKA 3EYTA 4XS6A 3S1RJ 1SENA 10GSA 2H6BA 3GX4X 2F8AA 3MWMA 2FQ4A 1GLQA 1V2AA 4ZJZA 3DEEA 4II3A 1X4PA 2GSQA 5HLTA 1F1ZA 2GS3A 4Q47A 2E2MA 3H9JA 2EBIA 1K79A 2DDAA 1TDIA 3IDVA 3ULQB 3HD5A 5ILUA 5AIXA 1G59A 2BY0A 2YR2A 4ENMA 2F48A 4HQSA 3MKLA 2DJ1A 2A68F 1DQUA 3NWSA 1FIAA 1FMVA 2FE3A 2QLZA 2HOSA 2JACA 3W3CA 2VO4A 3B6CA 4C3JJ 5EEHA 4XIDA 2CFOA 4BGDA 1YW9A 1X5DA 3V7CA 3HKRA 4L5IA 4DZJA 3WTZA 1PX6A 3CTAA 2HDDA 3VWXA 1RUOA 2WGRA 4IKHA 5L3CA 22GSA 4IELA 2VL9A 1AW9A 1PVEA 4CYDA 2BV6A 1VQ9I 2JTVA 4R79A 2PBIA 2E36A 3OWTA 5HLGA 5CQGA 4MO7A 2P7VB 4HX8A 3DEWA 4U0VA 1ACIA 2ZNZA 3S2WA 3SYTA 1SJ6A 4A5MA 4Y13A 3R60A 1YG2A 2NS7A 3PQJA 1MD3A 2XGEA 5J6XA 3MFKA 4I01A 4FCYA 3U1DA 2H1AA 2P5RA 3IRAA 4XKVA 2YWNA 1ZGWA 4QLCU 1EV7A 2DN0A 4FE4A 3F22A 2FWFA 3K0LA 5DAKB 5E3MA 5ENUA 3BY6A 2AHQA 1IUFA 2XIGA 2Q1ZB 3HPGA 5LBQA 3KP9A 4BVXA 2FOWA 5AIPA 2XBQA 4X0XA 3H5NA 5CJ9A 2CGPA 5BMZA 3TDZC 1GTAA 3MZHA 1J2XA 1D8KA 1KYWA 4Q48A 4ECIA 1YIOA 3BR3A 3NARA 2UXXA 1LPQA 4HF1A 3BOAA 3GKKA 3QD9A 5E8IA 4EJUA 4GF0A 2C3TA 3S93A 2PGTA 3PNYA 1TRVA 3GN3A 4NHWA 2EFNA 2G7HA 1LDJA 5IO0A 4M6YA 1GUUA 4YG2F 2NPBA 5AN1A 3B6AA 2GVPA 1S8NA 3G1LA 1QFNA 4HOBA 2VCVA 3TW6A 2IS2A 3F6DA 3PO3J 2EB7A 4YAVA 4ZL9A 2CQKA 3ME8A 2O89A 1TQPA 2CQQA 4GXOA 5JHUA 1Z3YA 3TOAA 3COAC 1EEMA 1RIOH 4M3DA 4PFOA 2HPMA 4CYCB 1ITYA 1YRNB 4XLNF 4TR1A 4YELA 3GTOJ 1P4XA 1SAUA 3BDDA 3W6KB 2GWRA 5F0HA 1TU8A 3F4SA 6PAXA 4HNUA 4PXOA 4OAZA 2HXIA 4C30A 2M8EA 4EATA 3E3VA 4GSSA 3GL3A 3FXLA 1YTYA 3SXYA 2BOLA 5E3OA 2LREA 2VOCA 4K2DA 4R8HA 4A93J 3M8JA 4HRIA 2DCEA 3ERMA 4KSMA 3CP8A 3WU1B 2L59A 5HS9A 2OE3A 3C2BA 1GTIA 3UBKA 2VE8A 3RJPA 2V2GA 4IHWA 5FKKA 3BT9A 4A3IJ 1ZREA 2ETHA 4KT5C 3BCKA 1DP7P 2VPLA 1EZKA 3LAPA 2WB1N 1FOVA 2XDVA 3TRQA 1XSVA 3K7AJ 3GEZA 1JZDA 4A5PA 1ZQ3P 3IWZA 2DDBA 3PL8A 3CMEI 3FEUA 5CREA 3Q0UA 2V79A 1Y39A 2OCCH 3SZGA 3C2HA 4ESJA 2XPWA 1VQKI 4JRRA 1G3SA 5L3GA 1BJZA 2Y2ZA 19GSA 1E6BA 2IN3A 2OE1A 3FYGA 3H1NA 1BQ7A 2XAHA 4S0HB 4ZDPA 2ID3A 3OR5A 1ETKA 2J23A 4XLPF 2BJXA 1FSHA 1OAZA 3DTIA 3FXUA 1TNTA 2VN2A 2WAQA 3GFMA 3KETA 2R7OA 3K2ZA 4G7OF 3AG2H 2YPMA 1XD7A 5HODA 2NVLA 3CCSI 3CXGA 5J9BA 3HSEA 4WEYA 2HSMA 3GX0A 3HUGB 2E5ZA 3CCQI 2VIMA 2VC1A 3KP4A 2H1KA 4KJZA 3CYNA 2W4SA 5EG0B 2ZJ2A 2X51A 5EJCA 2L6CA 1O8WA 2LV3A 4B4CA 5B8AA 2L57A 3BCIA 1QNTA 1TK8B 3ZLPA 6GSVA 2VT3A 2DMTA 2DMUA 5ECSA 3O8GA 3WHBA 3QPHA 3GRXA 1DE2A 4A3KJ 4BHPA 3I69A 1JHFA 3F9KA 2OAZA 3OYHA 1B9XC 3OYJA 3L2CA 4I0BA 4XRAA 1DP3A 1DBYA 1QQIA 2BVLA 1KU2A 2TRXA 3FHKA 1SYXA 4PZJA 5JCUA 2DMMA 2ZXWH 2PI0A 1R5GA 5TGTA 2VE9A 3EPZA 4KA4A 1DGRM 3H4KA 4TW5A 3HKZA 4RLQA 2NXNB 2HFHA 2OBKA 3H0DA 4CYCA 3C18A 1MTCA 4RB3C 2MGQA 3A5WA 3FR3A 2BBYA 2YN1A 1MD4A 3OR1C 4KYWA 4OIQF 3ZVJA 2WB1A 2A3SA 1S72I 2BY2A 1ETOA 4HQEA 2E1CA 1X5EA 1RRJA 4NAXA 2WFCA 1G6YA 1P7JA 3IKVA 5K5OA 1AIUA 2F5EA 4MJEA 3J7Yb 1SVOA 1VF4A 3KTBA 4I97A 1QZZA 1J09A 1X1AA 3CUQC 1ERWA 2DJNA 4HLYA 3H5RA 3NAUA 4HSTA 1OE7A 3Q74A 5J1YA 1KNGA 2JADA 2HTSA 2L9VA 3EPTA 2OACA 2WAFA 3FW2A 4YAPA 5DTDA 2QSHX 1FYLA 4EM2A 3CZ6A 4NUBA 4P1WA 4PGGA 1EEJA 5LRSA 2LG4A 2M2EA 3JTGA 4E4HA 3FM5A 1WFXA 2KP2A 3LSTA 3U5RE 3WTTC 3E6CC 1SAXA 4CHUA 1ERUA 2CQ9A 2CUZA 2EA4A 3HGYA 3PINA 4Z2TA 3D21A 2LY9A 1GLNA 1XIYA 2QA1A 4TR0A 5KN1A 4XORA 2HQNA 3BQZA 3FXJA 1IDYA 2J5OA 1HKQA 4JZQA 3RDWA 3WGXA 2HOTA 4Q5RA 4BWQA 2LSOA 5FJ8J 2QKEA 2V6OA 5KAIC 4EJTA 1J7KA 3M9KA 1XG1A 4LOCA 2YU3A 3J80Z 1J59A 2QQ8A 5F0CA 2G9WA 4HDEA 4O92A 4MTEA 5JLXA 1F37A 1GDTA 2CAIA 5CPRB 1VQLI 5KOWA 1OCTC 3EWLA 4IBPA 2V1DA 2L4CA 1QZEA 4UB8C 4EEFG 1WJDA 5DCMB 5J4VA 5C4JJ 5H5QA 2JPCA 1ILOA 2K5CA 4XKBA 3IH2A 3G73A 1I3QJ 4LMYA 3K8NA 2XGCA 3P7XA 3QAWA 4I99C 2LQQA 4YKGA 3DBRB 3ZMUA 5GAHJ 3HUGA 1SYRA 2JSZA 3DEUA 2O8VB 3J80K 3ROUA 1F5TA 2GQKA 3GUSA 4PX1A 1W5TA 3GCMA 2CG4A 3GKMA 1BW6A 3BP8A 4WXDA 5EG0A 1S9HA 3DPLC 1MSEC 3DMLA 3LOCA 5E3NA 3MKZA 5H20A 5D5WB 2KHPA 2JRTA 2DK8A 5F64A 1HA8A 5HR0A 3IOSA 3PO2J 5JCWA 3HHHA 3F3RA 3ZR8X 3HHGA 4IJ3A 1S7OA 7GSSA 2CX3A 1QHGA 2W1OA 2QSGX 2JL4A 1A2JA 2LF8A 4CO8A 3OYFA 1F4KA 1K0NA 3K4JA 3GBGA 4A3LJ 1R1UA 4F9ZA 3A5IA 4KIGA 3ZCOA 2H0GA 3CLOA 4B09A 5HS8A 3DFGA 2PQ8A 1SD8A 2UWMA 2WDUA 1SFKA 4OCEA 1N8JA 1NH3A 5D4SA 1XS9A 1AKHB 1I1GA 2X8GA 6GSSA 2NVYJ 2MC4A 1ZG3A 3C71A 3F6VA 4NHJA 1ZN2A 4P5OA 3OYGA 1U5TB 3LSJA 2DBBA 3A1YA 3GTKJ 4PJNA 2F8FA 2XPEA 1ULYA 2H1BA 2CW8A 3KGKA 2CQ7A 5B1BH 4NV5A 5J4UA 3VI7A 3F8FA 4BVYB 2EWNA 3QU3A 3LXZA 4WXTA 1FMWA 1TP4A 5D8KB 1RESA 1AHDP 1D5YA 4KMFA 4A3DJ 1KTEA 1PN9A 2ADUA 1SVMA 1TRWA 1X0RA 3IPZA 4LL4B 4QL7A 3TJGA 1JGSA 3FM3A 1FBQA 5H2FC 1KQ0A 2M7BA 5DUKA 2EZLA 3C8EA 2CYYA 2B9SA 2BXZA 2GZYA 2QCOA 4PNGA 5L71A 2PMZN 2CQNA 5CVJA 5EPFA 1USTA 3TMOA 2C8UA 2GQLA 5IOYA 4F03A 2OPTA 2KISA 4Q4ZF 4X1UA 5FKMA 4CDOA 3PUFA 4PGHA 2PMTA 5ECIB 4D7MA 1R71A 2HKXA 4PUSA 3VI5A 3HXLA 5ERIA 2HNHA 5C4XJ 1WJKA 1I6XA 1ZGAA 2W00A 4JOMA 3C7MA 2H27A 2W24A 1J75A 4DYCA 3V1WA 2CW0F 3K1MA 3EVIA 5DYMA 3IK7A 2W7NA 3SFIA 3VPTA 2EZHA 3E5QA 1ON1A 4OAYA 4XLFA 1OLTA 3MWHA 1CQGA 2LH9A 4RI6A 1B8IB 3QWLA 2A07F 13GSA 4I7HA 3GZNB 2NTOA 1RR7A 3EUHA 5ECNB 3ELKA 2YJ7A 5F8BA 1ON2A 3P9KA 4HAMA 1LFUP 3KZQA 4MJCA 4O5UA 3GMFA 1Y6IA 2EV6A 1E0EA 4GYGA 2D2ZA 2QSIA 4CH7A 1MEKA 3DEXA 2XF6A 4DBRA 2E60A 4WCGA 4I02A 5IYDJ 4BYYA 3DTKA 1MMAA 2VUMJ 3LYPA 2IGNA 2YX4A 1D1BA 1TU7A 4DZPA 3BPVA 1W4MA 5HS7A 4J19A 1IC8A 2HEOA 3PFIA 1SD9A 2LVSA 2R4VA 1A8LA 1MBHA 5KN3A 2CUJA 2MSYA 4UXNA 1LVAA 1S3DA 1TTYA 2HYXA 4Z6YA 1WJBA 3K4CA 3A3TA 1JHHA 3S1NJ 1B59A 2KOKA 5F0GA 3FWEA 5IMVA 4MNUA 1TI3A 1B6AA 1ZKGA 3V8KA 4IEJA 3VEPA 2X9DA 3A2VA 3TKSA 2VKHA 4DEJA 2F4OB 2JSCA 2XVCA 3BG6A 3ISPA 3LMMA 1PUEE 3HDDA 2DA5A 4RA2A 5KN0A 1MJBA 3HOWJ 2B7KA 2K8SA 1R7HA 1FAAA 4HLXA 2P5QA 2XC7A 3TO9A 2YANA 1IXRC 1J0FA 1IJWC 2X8HA 1ERVA 2BMXA 2HI7A 5J3RA 2M4GA 2FMLA 4DYRA 4L0ZB 2PMZA 3RBTA 2F5DA 3FZ5A 2P5VA 2W25A 1BC8C 2X49A 4MZCA 3UAPA 5L3EA 3P9IA 4A5NA 4YRVA 4U7BA 1I6HJ 2LRNA 4XRFA 3BJOA 1PRXA 5C44J 3ERWA 4RQXA 2B1LA 4M72A 2XROA 1U5TA 2ZJRF 4L5LA 4EDZA 3I71A 1V54H 1VF2A 4N0ZA 2E7PA 1SFEA 1NTCA 2MC3A 4G94A 2PERA 4Z7XA 1KBNA 2REMA 4TRXA 1UHMA 1N77A 4EXJA 3VSKA 3CCMI 4UUSB 3JREA 4DSSA 3LQRA 1XGMA 4G10A 1SKWB 4HDVA 2NVQJ 2Y48A 3CDIA 4V2LA 1NHOA 1T3BA 4N9IA 4LMVA 1FO5A 4ZZLA 1THOA 5D93A 3RHCA 3ZMKA 2R7RA 4RAFA 4FO5A 1XTAA 4FQGA 2AV4A 1JE8A 3HSRA 3KLOA 3LL7A 1MBGA 3BROA 1YIJI 1ST9A 1GSFA 3HZ4A 3F8BA 4MF6A 2BEOA 4RMNA 1S3AA 4K8MA 2EV5A 1HKSA 3R61A 2GTUA 4XM3A 1A2MA 1BBYA 1ETVA 2LSTA 1R6RA 1USSA 2GA1A 3WGIA 3HOZJ 1JFUA 1ZR4A 1OYWA 1XVWA 4B43A 1FOXA 4Y7NJ 2UXNA 3SWLA 3K4LA 3IL2A 3LSIA 2V41A 4BBRJ 1KYZA 3I56I 1RKTA 2VQHA 2LR8A 1QVTA 3D0SA 2M1BA 5J4YA 1B8IA 3IP4B 3F0CA 4Z2RA 2JVHA 4XKWA 1HSJA 4MCUA 4PNFA 1R1VA 1XOAA 3IRQA 2OCEA 3QU6A 3LAJA 1R00A 2QYOA 1X9SB 2K9SA 1XMAA 3VLNA 2X6WA 3HB9A 1XVQA 1XOBA 2ZJPF 3IHQA 1OCPA 3M1EA 4GCVA 4IRIA 2GXBA 5G2ZA 2DFEA 3BZ6A 1A0FA 4PQHA 4BA7A 2XRLA 5M3MJ 1PFOA 1PA3A 3DYRA 5KOXA 1S7EA 3BCAA 3CLQA 5J40A 2CAQA 2GT5A 4OINF 2GSRA 3VK9A 1WJCA 4ASNA 5EGOB 2FRHA 5AISA 4GXZA 1XBSA 2FBHA 2DQRA 1CF7B 2PVOC 4EVIA 5ID2B 3K9TA 3I43A 4ABZA 5DDGA 5AIVA 4MJAA 1SANA 1MMDA 3QYFA 1X5CA 4QPQA 1JZWA 3L9FA 1VQMI 1KU9A 1WWXA 2RDPA 5K7FA 4LA1A 3ZVJD 6GSUA 1R9TJ 3GTUB 3HSFA 3HGGA 1GP1A 3UMAA 1TTZA 2LTPA 3LA7A 1I5GA 5F1RA 2AB6A 4RGXA 4MFDA 2FCHA 2V1UA 2DJ2A 3N4MA 2ZXJA 3PNTA 1Y25A 5LNKe 2X85A 1XPXA 2W57A 3RCOA 5K1YA 1E2XA 2L7KA 1KZHA 3ZQHA 4XRSG 3ZOBA 2FLSA 3RYPA 4CCJA 1O7FA 4CHSA 1V9WA 1YQ1A 3APSA 4BE0A 5LGUA 9ANTA 2ME0A 5HQPA 3KXOA 1YY7A 5TISC 5HNHA 1QRYA 1A36A 2F5CA 3OIQA 3TW7A 2HDCA 2DSAA 3GV1A 2JU5A 2YWMA 3LNQA 4MA9A 1QQ2A 1Z6NA 2KZGA 4NNJA 3ASNH 4IOCF 1VQOI 3HZJA 3EMXA 2ON5A 3CO6C 1URMA 1YZXA 2CFXA 3KIOA 3CUQB 1GSYA 2GLRA 1HDPA 1ON4A 2MLKA 3QP6A 1P7IA 4O32A 4ZH4F 5KEJA 4AIJA 5JR3A 2H01A 1TK0B 3HOYJ 4J01A 4EJVA 3FXQA 3OS2A 3TJFA 1SL0B 5M5YJ 4OIOF 2PG4A 2ALBA 1SEUA 4EVMA 3IWFA 2M7AA 4BXFA 1TC3C 1FYMA 1IN7A 2VBZA 4EGYA 4BJ5C 3OY9A 2BY3A 3CDHA 4HW0A 2DJIA 3ZMVA 2O9LA 1TLHB 4H86A 1APLC 3D6IA 2KRCA 3HTUA 3D4MA 1AUCA 2MYSA 1O81A 3WD6A 3G9BA 2JN6A 4GO1A 5E79C 4NDLA 3ZYWA 1X2MA 4FYCA 3V8LA 1AA7A 4X4JA 4ZILA 2DA7A 5F1JA 1KGSA 2IA2A 2NNNA 5KHDA 4EM0B 4BNCA 4M74A 4YIRX 2FWHA 3DKXA 3K1PA 4LG0B 4K2XA 3ABMH 2DAOA 3KM6A 3I55I 3HOTA 4BUPA 4NQWA 4D0PA 2LNSA 1VF9A 1ZARA 1EP7A 2H70A 2H1LA 4K9ZA 5D9VA 3TGNA 5F6FA 1UFMA 1F3AA 4K5RA 1Q98A 5D73A 5IOWA 3L1PA 2CRGA 3HC7A 2L4QA 4I5QA 4ECJA 5EZGA 3DPTA 2HZFA 2JZRA 1Z05A 1P6RA 5EGOA 2H30A 1TRSA 3R3EA 2KIUA 1BEDA 1A24A 1R58A 5F08A 2XC2A 1CF7A 3T1BA 2J5PA 2L01A 2RVCA 1SKSB 4E70A 1T33A 2BHYA 5DD4A 18GSA 1R1TA 1HXDA 1P9QC 2OV7A 4DSRA 1HLVA 3H3VK 2V32A 2KZVA 5ABRA 3UOMA 3KLNA 5J41A 1JHBA 4CGZA 1OC9A 4C3HJ 2R3SA 1FP2A 2A6HF 4N4NB 3M7GA 5IIZA 1HQCA 4E7HA 2DI3A 2TRCP 3BWGA 3ZN0A 1EV9A 2HVQA 2E5NA 3PFYA 4XICA 2JA2A 4JX4A 4WBJA 5B6NA 3WG7H 4YKFA 3BZKA 3K4NA 2K86A 2ZCWA 1YI2I 1TWAJ 4PTSA 2ELJA 3LYKA 4K7OA 4K5SA 4YQUA 2Z99A 1YS6A 3AG3H 3EUHC 2L6DA 1GSQA 4HQMA 3S1QJ 5DDLA 3L09A 2HLSA 3EQLF 2ESNA 1DPUA 3FR6A 1BI2A 3DVXA 4MF7A 2HOEA 1EF4A 3PGTA 3RKYA 4LK0F 2V1MA 5B7CA 2E1OA 4MFEA 1O7LA 2IMEA 1Y8RB 2YJHA 2R92J 3S1MJ 2XAUA 5IMDA 2DJKA 2L02A 2NNYA 4CZCA 5F0FA 1ML6A 4EC0A 4MEYF 1VQ7I 4V19K 1SMYF 4L9VA 4IN0A 2YWIA 2Z1DA 2OC6A 3EETA 1U8RA 1XFLA 5DCFA 3OL3A 4GQCA 1O4XA 5E59A 3UBLA 5DM6F 3K4BA 4ILFA 4V2NA 2AS5F 1Y56A 2K9MA 4G6QA 2ISZA 1Z9HA 2L5OA 1B9NA 5IM9A 3TKSC 1GUKA 1K3LA 5LFAA 4OWYA 5H6RA 2VJJA 3P8WA 3GW2A 1W4VA 5KVRA 3CMAI 1XZOA 5DEQA 5D4RA 3Q6OA 3DP7A 4UB6C 4J56E 3ZTLA 3E0UA 2KMUA 3TDUC 3N97A 5J8FA 1MNDA 3N5OA 2L7FP 1XMKA 3S32A 4BL7A 4MEXF 5JWRB 2IJYA 4L5JA 2M0CA 2DODA 3RQIA 4ETSA 2LRCA 3K69A 4IP1A 2B3SA 2ZNYA 4IRGA 3JW4A 3KP8A 2HWVA 2IT0A 4C2MJ 1A6QA 1ACVA 4V1Ap 1POGA 2VCXA 1U5TC 2HI3A 3O8HA 4IKFA 2K18A 5JHFA 1OYJA 5CRWA 5IPGA 2K9NA 4IHYA 4XSXF 3RPUA 2C0EA 4QQ7A 3U1KA 2DYRH 1G7OA 3FXMA 3TP0A 5E17F 3GZ5A 4ZYAA 5IPHA 3DLLF 3RI4A 3BG9A 1LE8A 2MBFA 2DTZA 2IPQX 2Y31A 3TJBA 3RQ4A 2X6XA 1EP8A 1FBUA 2VJ5A 3E6MA 2VLAA 2QBYA 4O7HA 5G1KA 2P0GA 3TKSE 3F23A 1ZLJA 1PL2A 3ZXSA 3LGCA 3N05A 4A0XA 5IOZA 4PSXA 3H3ZA 4L0WA 1GL8A 1GSEA 3KP3A 5FRMA 4B3XA 2MBSA 3AFHA 3L2VA 1ETWA 1HW2A 1V55H 2LKUA 5FLMJ 4HQZA 1MJ9A 4DJAA 3HOVJ 2P0WA 1H9GA 1JUSA 4PJ0C 4EGZA 1THXA 3KMNA 2H8RA 4HUAA 1SD5A 2OZ6A 3F8NA 1R36A 4ON0A 3JTHA 2H74A 3GL5A 1WJ5A 3QQAA 4N4OB 4G6TB 3EC3A 3NQOA 1LDDA 4BACA 2B5YA 4YIIA 2MMNA 1DGWY 1X2NA 1ZELA 5H6QA 4B48A 2LC2A 2VBWA 5FD6A 2GZPA 2PBJA 4IS0A 4N10A 2G0EA 3QFAC 4XCSA 5EZHA 3CJTB 4KF9A 3JRHA 1A5JA 3UIWA 1T08B 3CSIA 4HG2A 2B5XA 3CCJI 4E7IA 3AL0C 4IHSA 1O3TA 4HSRA 1V40A 5D5VB 2M4KA 1K3OA 4AF2A 1N75A 3KH7A 1P2FA 1GUMA 4OFTA 2PN6A 5ECKB 1TW9A 4JBBA 2BVMA 4RAYA 4ZL8A 2L9SA 2LJRA 3FISA 1MD0A 2E2JJ 3R2QA 4ZB8A 1SD6A 1DSBA 2LJKA 2LS5A 3ZREA 3JRDA 3LQ7A 2ZXIA 1U3AA 2MG4A 1JTXA 1K83J 2WWYA 2KJBA 1TRUA 4N0VA 2JK3A 3NIVA 2WAQN 3TO7A 4ZDLA 4XHMA 1QU3A 3QPTA 1XG8A 4V1Ag 2JMWA 1O3RA 1U88A 1MBEA 3SZTA 1XSDA 1T38A 3GSTA 2KL4A 3CBUA 3O2PE 4KNDA 4MF5A 4DVCA 4F2IA 1X1PA 2Y75A 3GFLA 1RR8C 4HJ2A 5LD0A 4KB3A 4KIBA 3OYLA 1Z3EA 4KCAA 3ZQIA 2IW5A 5ECHB 3V7RA 4TOPA 4YFXF 4WXHA 1YEXA 3RKXA 2GA2A 2Z5UA 1JJ6C 3LSPA 1L0OC 5DBQA 4POBA 3GURA 1Y8QB 1G3WA 1DU0A 4FQUA 5FLVA 5BRTA 1KQ9A 2R7VA 3GH6A 4MMMA 2TRTA 3QPSA 2DJJA 4XIHA 2XRNA 3UNGC 1LEBA 3TUEA 2ID6A 2IMIA 3DIEA 2PX9A 4PJJA 20GSA 3GWZA 3ZRGA 1ZRDA 4TR4A 1WMJA 1HBXG 2OBPA 4EJOA 2CX4A 2QGVA 1B4AA 3NZNA 3F6FA 1X1DA 1XGOA 3F3XA 3H9GA 3HKZN 2E2IJ 1NG7A 2K4BA 1ZAOA 5JWOB 2PU9C 2BE5F 2NYXA 1BAYA 3LWFA 1H4OA 2IMDA 1EH7A 2VB6A 2K4JA 1OKRA 2DT5A 4DBQA 2VONA 1BX9A 1OC3A 3AY8A 5CRGA 2DLXA 3CJQB 1RNLA 3L2WA 3M8FA 1M1EB 1WZ2A 2R7XA 4FYUA 1E17A 4BIKA 2OJED 1QVUA 4U0WA 3E6DA 1IRGA 1Y0NA 4KISA 2WULA 4XRSA 1WQ2A 3C1DA 3KCMA 2OU2A 3MYDA 5BNGA 4A6DA 4FX0A 2YUSA 1J9IA 3EYYA 2FEZA 1D0YA 1MW7A 3GZ6A 4XLAA 3ERED 1IYHA 3S17J 4XRMA 3FHZA 1U6TA 4ZC3A 2FWGA 1KU7A 1AOYA 4JE1A 5E3LA 4BS9A 4BQOA 2A4HA 2ON7A 1TW3A 4E7SA 4Q5FA 1R5HA 1NHAA 1IXCA 1IRFA 1H88C 1FYKA 2V6EA 4KFCA 1BR4A 1G0TA 2DA3A 3OOPA 2R5ZA 3KEQA 4M71A 2IEKA 2R7SA 5KK1A 3I3LA 2IIYA 2K9FA 6GSYA 2H6ZA 4M6XA 3DU5A 4BHCA 3OS0A 2GM4A 3M3YJ 4HJMA 4EDYA 2XAJA 4X43A 3VODA 2LK2A 2DPUA 1P4WA 5D8LB 2AQFA 5D96A 2E0QA 2F4MB 1BOBA 1XW9A 1DE1A 3BR5A 1VTNC 2HRFA 1XGNA 3IC7A 4IJAA 3D0ZA 3ZMTA 5FHIA 5GZZB 2ME6A 2JJ7A 2HZTA 2ES7A 3OS1A 1PQNA 4EL1A 1RUNA 1K7AA 2KIFA 1YX3A 5GPCA 4UVAA 2K3FA 1A35A 1HKTA 1PKWA 1K0AA 4DQ2A 1LQ1A 2AXTC 2VQCA 4IQ1A 2HDWA 2C0GA 3FK7A 3J7AO 5ECPB 2E2GA 4OD7A 3AG4H 1LDKB 2R4GA 3U21A 2UUZA 2F3MA 4ZIJA 3R4KA 2H8WA 1TK5B 1SD4A 11GSA 3CO7C 4KSOA 1BOAA 1K61A 4PK4A 1X3ZB 3L2UA 3ERFA 2QVOA 2O8XA 4K1FA 2YSRA 1MMGA 3GLLA 2L7MP 3NEUA 3CCLI 3B73A 3ZL5A 3FXRA 3GUDA 3JRIA 3MKYB 4E7KA 4MLYA 5DJMA 2K9QA 4M9XA 3D5RC 1GV2A 3SEQA 2RKHA 4D73A 3M9AA 1MH3A 3ZMLA 2RREA 2VCQA 1BG5A 3S8PA 3KD0A 4POKA 3MAKA 3CSHA 4A3GJ 4QTRA 3D5JA 2KP6A 4FASD 2FA8A 3CJNA 2X6YA 2F51A 2GZZA 2MYGA 4GSNA 2V9VA 4EV0A 3TEDA 1JI8A 1JLVA 2QM3A 1LU4A 2H6YA 3KYDB 3TRXA 2QSFX 2XB0X 1X4OA 4K7NA 3PSFA 4ISDA 1LVKA 4CA0A 3F63A 1MIJA 3BR0A 3MD2A 1A2LA 4D1QA 3RAZA 3ABLH 5GAGJ 4WF5A 1IV6A 5ELGA 2WB9A 5FKOA 5DCGA 3GTGJ 5IP7J 1WSUA 1R49A 3QOUA 3M3MA 4PSWA 4F52A 1H89C 1Z6MA 4DNCA 1V98A 2DBCA 4OMZA 2FJ1A 3HJEA 1XW5A 2PN8A 1BR2A 3DGQA 4C3IJ 4XL9A 2R5YB 4HS1A 4KA0A 5C04A 5LD2C 1FPQA 5ICGA 1WKMA 4EQQA 2VKDA 2IS4A 2FD3A 1K6YA 3I4PA 2JA6J 3WG9A 2PVQA 5B66C 4BJ6C 4KW6A 1FNNA 1FTTA 2H94A 4HBLA 4RB0A 2LKSA 1IZ1A 4YFKF 1GV5A 4UUTA 4IQAA 2VCWA 2GLOA 1D1AA 4EUYA 3K70C 1JJ8C 3BG7A 1OMIA 3L9UA 3GIXA 5IT9Z 4WBRD 2EC4A 4O5RA 1FT9A 1LKXA 2QA4I 2R5GA 2FSWA 3C7JA 2O3FA 3GFJA 3IKTA 1O6JA 2FY6A 4GSTA 5CO3A 1TQIA 2P6SA 1YJ9I 2OKAA 1FC3A 2HE3A 3LXTA 3WYWA 2E7XA 3HM5A 2EJRA 4CCMA 3I58A 3DF8A 5HR3A 3RHBA 3QPLA 4NC6A 4HYEA 9GSSA 3CDLA 2C80A 1Z7RA 1Y6EA 3RPUD 1UZCA 3DPUA 2CO5A 3LQQA 1P92A 1DU6A 3FZ4A 4WKWA 5IT9K 2CUEA 3J81Z 3K70D 2Y9YA 4UVCA 4DSSB 3HVVA 1FWZA 1Z91A 16GSA 2R7QA 1ZRFA 2K27A 4FISA 2EPFA 1Z6TA 4JX5A 2MH9A 2VKEA 2KRHA 2VQGA 3MKWB 3LWAA 3FHNA 2PWJA 3J7AY 1BI1A 4A0ZA 1F9MA 3IE3A 2ZKZA 1O3SA 3TO6A 2ZXHA 5E20A 2WV0A 4IZZA 1PL1A 3DQVC 2M72A 2X0LA 1PN0A 1UCRA 1DUXC 3GFKA 3MVPA 4ANJA 5DALA 1Q1HA 3JRCA 1J0RA 2HRNA 3J81K 4EIQA 2Q8KA 4E7JA 5LEJA 3F3QA 3LFLA 4K7IA 5G1LA 2JA7J 4BWSA 4HA8A 3GF2A 3RZDJ 4NWYA 5ECQB 5JVTA 5BS6A 3PSIA 1RC9A 5L3FA 2HOAA 4D9JA 1YHQI 5AGYA 3LFKA 3LEFA 3OYNA 4KDUA 3PH9A 4MABA 2DK5A 1HW1A 1QO0D 3SFZA 5GAEJ 5EF6A 1AAZA 1R5AA 1XWAA 3Q9VA 1YW8A 3VOEA 3P2AA 3L00A 2DPDA 3O6TA 4ZYGA 2QQBA 3FKIJ 3M8NA 4I76A 2KDZA 3KEYA 2VASA 3E7LA 2GSTA 2AJQB 1VZ0A 1V57A 2ZC2A 1QBJA 1T4YA 4G8XA 3CQFA 3HG9A 1S6LA 5B5EC 5C00A 5M5XJ 2STWA 1FEXA 1ETYA 3CTGA 3CUOA 3BTJA 2M3AA 4AIHA 5CRDA 3T5XA 1OCCH 2NOJB 5DQYA 5CVUA 2I5UA 2VLVA 2CH0A 3VFIA 2OQRA 2X1EA 5DVBA 5KCMA 4JR6A 1TQMA 2R5YA 5IMFA 3UL3A 2L54A 4PCQA 2E7WA 4RB1A 1VNDA 2OZUA 1VQ4I 1IF1A 1LB2A 2XAQA 4PJLA 2Y69H 3BJ6A 1W89A 4ECBA 2ZFWA 4MJBA 2QQAA 3TJJA 3FXKA 1A6IA 2KPMA 1ERTA 3J7ZI 3L2RA 3DBHB 1LUJB 3EU3A 2HGCA 3AL0B 2BTOT 3I4NJ 1KU3A 2WA0A 3D5SC 2I4AA 3QR6A 4V2GA 4ZBAA 4BDZA 1WPKA 2A2PA 3D1NI 2UV1A 2R7WA 4JQFA 2GXGA 2LUSA 4ESFA 3FK8A 5J9CA 1G7EA 5GPAA 1B8XA 4K0NA 5DQSA 2CT6A 3UVTA 2XF7A 2RGVA 5K5QA 3A2XA 3C1SA 1BR1A 2N5FA 1WWJA 3LORA 2BHZA 3OOUA 2IMKA 1X3WB 2COMA 2XV4S 4B8XA 1GULA 4XN0A 1J9BA 2HQ5A 1FW1A 3OYBA 2XGDA 3BZCA 1CGPA 1O85A 3W2VA 3WE2A 2HXKA 3VWUA 4BQAA 2Q2EA 1UJ8A 4I8BA 1EWXA 4MP4A 4KUMA 3FR9A 1ZYPA 3CF2A 1GHCA 5HFIA 1OCRH 4RB2C 3EURA 3GNJA 3Q19A 3QAGA 5D9TA 2EIQA 4XR6A 1QZYA 2V6CA 2W48A 5J1RA 1T7PB 4A0YA 1JUMA 2QZ8A 4XLHA 1G6NA 1IO2A 3WTYC 5TJJA 3VYSB 4D5FA 3KP7A 2EFQA 3PM1A 4LIVA 2JWTA 2Y30A 3ECHA 4D5CA 1XW6A 1OJLA 3PIPF 5DD8A 2XAGA 3FXOA 5B1AH 1YJWI 4Y52J 3UJ1A 1EGRA 3JRFA 2FWEA 3HDCA 4GRFA 3RTRA 2H0HA 3IXRA 4K2EA 4L5OA 3KP6A 2JA8J 1W7PA 2AQEA 2E19A 1TL8A 1D3YA 2DFIA 2K9LA 1GSDA 3ZQGA 2Z9SA 4CY8A 1U78A 3U6VA 1VF1A 4TXOB 5CKTA 4IRHA 1PX7A 3NOFA 5HFKA 5EL8A 3IAM2 3HY2A 5L3DA 3BR2A 3US3A 1YDKA 4KDPA 2HSHA 5ICEA 2NVTJ 2VBYA 2BW3B 3SEZA 1Z21A 1SVLA 3KIJA 1HSTA 4O6JA 1K78B 3WGDA 5LGTA 4LK1F 3MMYB 4IVNA 3I59A 4U88A 1LJRA 2VCZA 1SFOJ 1Z6RA 3GX8A 2RUFA 2O87A 2MFZA 3P5JA 4LG3A 3RYRA 2IBDA 4AC0A 2LYCA 3VFZA 3VYUB 4A3BJ 1R5PA 3D4TA 5ECRB 5D9WA 3EUAA 2O7KA 1D0XA 1YYVA 2WCIA 1G4DA 3QAVA 2L9NA 2MLGA 4M3BA 4TKYA 4XNFA 4ZBDA 1TBXA 1U0JA 2V1NA 1MMSA 3IHGA 2XAFA 3K6GA 4UHTA 1JKQC 3TJKA 2P4WA 2Z16A 3KMOA 2O0YA 2BZTA 1K4SA 3MDKA 1T56A 3G7IA 3GLXA 2HZEB 1TW2A 1C72A 3PIOF 2MH2A 1VRSD 4I2UA 1QPIA 4NQWB 4CCOA 1ONVA 4K6XA 1RW1A 4I2TA 2AHEA 3ZFBA 4UVBA 2XHKA 1KQ8A 4RI7A 5H5SA 2V1XA 4UV9A 1AQVA 1QUWA 2FGXA 4L8EA 2R7ZJ 2VOOA 5G5EA 3CC7I 3BG3A 4HZ4A 3RPNA 4PDKA 2HR3A 4RGUA 2KDOA 3UARA 4AGSA 2A2SA 4WR4A 2AXLA 4OFMA 4IW9A 5D5XB 3BR1A 5J8CA 2D1HA 1PD21 1R5ID 2YX7A 5E18F 1XCCA 2FNOA 5DUIA 2EZKA 1UMQA 3HYIA 17GSA 4MIMA 4MH2A 5ECOB 1X1CA 4DOZA 4A3FJ 4J57E 1SJZA 1ETXA 3I4MJ 1SK1A 3I0TA 4BQNA 5HNFA 2P31A 1OC9B 5H5RA 2MMOA 2ZBKA 2QWWA 4Y33A 4RDUA 2TIRA 1W5SA 3IV4A 5CAXA 1MJAA 4L18B 3CMIA 3ECOA 4XLCA 4ZYHA 3GA4A 5LHGA 2I81A 1O7UA 3JCML 3IH3A 1TKDB 2XPUA 1XC5A 1F2EA 3SDGA 5IPAA 2K8VA 3JRGA 2OJLA 3TOBA 4U87A 4FYBA 4JEDA 3W6VA 5ECLB 2DA2A 4CCNA 4Z2UA 5B6MA 1L3LA 3ZQ7A 3W2AA 3DTEA 2B5EA 3MSZA 3E5UA 2R93J 3BTLA 4L9JA 3DVWA 3ZP5A 1E3PA 3DKWA 3A02A 4DYQA 4A3JJ 1A04A 1LEAA 2CQXA 3F0IA 5COHA 4RS8A 1PMTA 2R7TA 2CV1A 1YJ6A 4TXOA 2VQLA 2MZCA 4BHBA 1E3OC 1XGSA 3IH4A 4IOAF 1M9BA 4MHGA 3BQYA 3GHAA 3HXSA 2BW3A 2KHMA 2TCTA 1K78A 2BY1A 2X6OA 3FMSA 1DUGA 1Y0UA 3DCFA 5JI6A 3M9JA 3TP3A 4LFUA 4DIQA 4MTDA 4OFNA 2P6TA 4XLEA 3J7YJ 3KP5A 2DLLA 1EA3A 4F3QA 2LRTA 2HRKA 3IUOA 4KICA 1MDKA 2ELKA 2RQPA 4IO9F 2H1GA 1GXQA 1JT6A 3HYPA 1F36A 3CC4I 5FROA 4ID0A 4BL7B 1UG2A 2E34A 1Z7UA 3TBIA 3WTWC 2ACJA 2NVXJ 4QL9A 1M2BA 3ZMDA 4KMUX 2V9KA 1Z7PA 4JP0A 2VODA 3VPRA 2FU4A 2GSSA 4XONA 1G6WA 3MEXA 1FP1D 4B44A 2FHEA 1WCMJ 4NXIA 1KEBA 2HRAA 1H75A 4C9YA 4A69C 4XS4A 4AIDA 1XDUA 2DW4A 2ZSHB 3G6EI 3GTLJ 2HZEA 1PP7U 3HRUA 1UAAA 4XN3A 4E6KG 1H9TA 4A6EA 1SFUA 4M9ZA 3F6OA 5F27A 4BPYA 2ECBA 2KT0A 1LE8B 4PUFC 2A61A 3DWLE 1M2DA 2EFOA 3A2WA 4I6ZA 1G8XA 3LSHA 3M1CA 3RDIA 3V8JA 2QBYB 3CQZJ 3G3ZA 2OQGA 1U9NA 1V5EA 3S14J 1MMNA 2V4JC 3QRFF 4BE2A 4JX6A 4S05A 3ASOH 2RAEA 4AM3A 3APOA 3SDBA 2DA4A 1GTBA 2CU7A 3FRCA 3VB2A 4TVEA 3HIFA 1YX5A 3KTLA 4QIWN 1OYIA 5CVRA 3A01A 1G3TA 1T98A 1MDJA 2NBSA 4XOPA 1WJAA 1O8XA 1R26A 5M5WJ 3CD6I 3HJMA 4WETA 4M3FA 5F04A 1FX7A 1G2HA 4IF4A 2QEXI 2NRAC 3HTSB 2YP6A 3EYIA 2PFBA 3OSGA 1WHUA 4TV7A 1WE0A 2PJRA 4NC7A 5EYRA 2P8TA 1FOKA 4KE3A 4ZBBA 2YPRA 2ZB9A 1NHYA 4MZWA 4EF0A 1YOVB 1ZGJA 2GOMA 5J1UA 1W0TA 1ZLKA 1ZYNA 1TWCJ 2RC4A 2B7JA 1QGPA 1YS7A 3DXJF 5DV5A 4PQ1A 5CNWA 2R7DA 3MAJA 2FMYA 1XPVA 2O7OA 4YEJA 2R0PA 4II2A 3ZN1A 2HTJA 1USBA 1XXUA 5L3BA 3CJRB 1M99A 5DM7F 4BY7J 1EKEA 3HVXA 2VBXA 3V42A 1KONA 1OFCX 4WF2A 5E1XA 3C3WA 3ZMSA 4AYBN 2LKPA 4ENJA 5KAFC 1A31A 4FIWA 2DMQA 4CW9A 1X1BA 3CP2A 4FX4A 1QXHA 3T8TA 4G2EA 5HDGA 2STTA 4IJIA 4CCKA 2B6MA 3L4NA 4KITB 2LMDA 3CCVI 1J5YA 3FIWA 1EJ9A 2LNTA 4F92B 2OTLI 1B9YC 2MD0A 1W36C 2LKXA 3A0HC 1IRZA 1UG0A 4O5VA 4ZXGA 3CCYA 5FO5A 1BL0A 1GWCA 4ECCA 1ZZYA 1BI3A 4LD5A 4E7ZA 1V5FA 2H75A 1MH4A 2ZMEC 1ZHFA 2C3QA 2WADA 3GKNA 2CZ2A 5GADJ 4L0UA 2EH3A 2FBKA 3ABUA 3W6JB 4JBAA 2R0GA 4HSCX 3VURA 4F0BA 3TKRA 2X48A 2YNXA 1O57A 4GLTA 1ZYRF 1LFPA 2XPVA 5J3LA 5LGNA 1T0FA 3ZFLA 4EKZA 1HNAA 1IRXA 4BY1J 3G71I 3FMWA 4FE7A 1LNWA 2B0LA 4ZDOA 5IMAA 2OA7A 2ECCA 2LNBA 4LITA 4AVPA 3OV8A 2DMNA 2R0QC 3ZQQA 1W36D 2B7EA 2VT2A 4EM1A 3G1MA 1MBJA 3KZYA 1NSWA 5CLSA 2CVBA 2FOKA 4L0YB 2EZIA 4BAYA 3IHUA 2EFWA 2I9HA 3G4SI 4RLFA 4LGWA 3H35A 4J00A 1E3HA 2H73A 3VPQA 3OSFA 1GSUA 2EIKH 1ZRCA 1PUFA 3OYEA 4WF4A 3F21A 3BLYA 3LA2A 5A5KA 4WK8F 1VQPI 2E1MB 4JYKA 1FB0A 2YZHA 3G7YA 2R37A 4RUVA 1HOMA 2CWEA 3G2BA 3VWBA 2N5BA 3QMXA 5D5UB 1W7PD 4BH9A 4G7HF 4ENKA 4AYBA 4ZL7A 3WE3A 5D6FA 3E5XA 3M8EA 4TR3A 2RLIA 2M46A 1XX5A 5E4WA 1WH5A 2I10A 3BJAA 1XWBA 2R2JA 3H8QA 4BL0B 2L3DA 5HFGA 5KNLA 4XRDA 5GAPD 3OYKA 4MQVA 4V2MA 4EO3A 5GAND 3TKPA 2M30A 3FZAA 2R5ZB 2EIJH 2JA5J 4I2OA 2HQAA 4TXVA 5IMCA 3FK6A 4O3MA 4M3EA 3M1GA 1F3BA 2L4MA 2PPTA 2IVMA 3Q3SA 2PJPA 3QDNA 3ZZXA 3HRSA 2EILH 3W6GA 4F55A 1X19A 1OVNA 4EE0A 5ELAA 3JCUC 1PGTA 3DD3A 4HF2A 1ZYQB 1BA5A 4LLGF 1XWGA 2JSYA 5IYCJ 2WBMA 3ABKH 5K5RA 2HVSA 2CZ3A 1SK2A 2H8LA 3JSOA 2F4IA 1GNWA 3CRTA 2Q0OA 4E8EA 2IAIA 4GGGA 5F05A 2VM2A 2X1CA 4TN8A 3IAS2 3NWTA 5HVQC 1RI7A 2L2OA 4WX9A 1GTUA 5JCGA 1FSEA 4FETA 3HA9A 3UVHA 1JKRC 2IFQA 4USSA 1B72B 2G0FA 3WT2A 5HDKA 1O3QA 1SJIA 5KN2A 4A3CJ 5CQEA 4X0GA 3VSLA 4J2FA 4YIFA 2YOIA 4RQRA 1ZYEA 3LSMA 4EMSA 3ZITA 2JQ7A 1ZMAA 1UA5A 2DO7A 4EJWA 2HZDA 3ME7A 2H0IA 2JPBA 2GBYA 3GKXA 1ZR2A 1CQHA 2YV7A 2QF7A 3APQA 1JGGA 1V58A 2KJCA 2H6XA 1F43A 2DQLA 4AWXB 3MCZA 3S3NA 1H8AC 1WOUA 1ABAA 3P90A 2IGKA 4A2UA 2LLKA 1IG7A 2KIQA 3HOXJ 3ZIJA 5M3FJ 4A3MJ 3A2KA 2OF7A 4L9NA 4D7NA 1R23A 3HVSA 3GTQJ 3SBCA 2VLUA 1GLPA 1M9AA 4D73B 2IGOA 3HPHA 1HF0A 12GSA 1VF3A 1BM9A 1WI9A 4N11A 1X9MB 1Z77A 2C6YA 1UC7A 3SHFA 2OD5A 3K2AA 2WY7Q 3GO5A 4P96A 4LB5A 2XBIA 3KFWX 4G0LA 1XDSA 1IN4A 1WGXA 1FOWA 1TT0A 4MZBA 1PP8F 3IA1A 1GUHA 2KLXA 3CMMA 2F2EA 4IVFA 4RAGA 3L9SA 4HZFA 3F8UA 2LF7A 2RIIA 3CF5F 4LB6B 4X6AJ 3LG6A 1WI3A 1Z9CA 1OCOH 2IGMA 2RUEA 5CRHA 3Q0WA 3OYMA 1R4NB 2O85A 5K7ZA 3CC2I 2B63J 3SZPA 1P4AA 4BDYA 4FH8A 6GSXA 1S3RA 3ESWB 4N0BA 1D5VA 1Z1DA 1W5CC 2GT6A 1YLFA 2VJIA 2XASA 4F93B 2GAUA 3I64A 3KZZA 5A2QZ 1A8YA 1IXSB 1OR7A 2X64A 3F9UA 3PR8A 2QENA 3KYLA 4PJMA 1WVRA 5IO2A 4G19A 1OPCA 1PKZA 4POMA 5JWQB 3FF5A 3F8CA 5FB2A 1XMXA 3RZOJ 4G7ZF 4N30A 1PYVA 1T95A 4KNYA 1YF0A 3M4OJ 2JVGA 2K40A 2CJJA 3HJOA 1K0MA 1YKCA 3BPXA 3MZYA 4KCEA 3TRPA 2R6KA 1X9WB 3HEFA 4M3GA 5EVOA 3H9QA 2ZFUA 3QAHA 4ZB9A 2Z3YA 2C0FA 1R7JA 1MBKA 5A2QK 4Q5QA 2FX0A 1BIAA 5LHHA 2KQRA 2V6KA 2GZWA 3WHCA 1HYUA 3W8SA 4P9UA 2LQOA 4NB5A 1NK2P 3CCRI 1T8EB 2MD5A 3JRAA 1IUYA 2D2WA 2H66A 2IS1A 3HVNA 2GXAA 2IRFG 2M8GX 4HV6A 2DJ3A 4V2FA 3B02A 2HXOA 5DAKA 1B72A 4ITVA 1NW2A 1AWCA 3D22A 3IK9A 4BXXJ 2VXZA 2L0KA 2ZO4A 3EUKL 1T39A 1EGOA 2BYVE 2ZJQF 1QK8A 3K4MA 5GTHC 5HOOA 3MN2A 1MDMB 2F5FA 4AJ7A 3TGZA 5E8GA 4GFBA 4CUGA 2JUCA 3HL2A 1MNEA 2COBA 1VI0A 3H5AA 3RKWA 5CYVA 3SJMA 5BPIA 2VM1A 3O6BB 2LD5A 3TB2A 3AG1H 3TCOA 3RSNA 2IWTA 2FBIA 3F72A 3DU6A 1GRXA 3FZ9A 3LA3A 1S3JA 5GP9A 3LSRA 1XCBA 1R4MB 3HOUJ 3A03A 4MPGA 2FUG2 5DALB 1RQMA 2YZUA 2LOOA 4KDXA 1AXDA 2WY8Q 3OYCA 3FMQA 2LTKA 2XHFA 3J7Yk 4LLRA 3DBLB 1YITI 2UZ8A 2AYTA 4M9SA 4PGTA 2KKOA 2L5QA 4NPBA 1WH7A 4RGRA 4AJ8A 2LBFB 1OYYA 1I50J 1JTYA 5BOXA 1VFCA 1EH8A 2OE0A 4YFNF 3X2QH 1YRNA 3QFBC 3CMYA 2DXIA 2BGCA 4KT6A 1YJNI 1TI1A 1TJDA 4O5QA 3OR2C 2RM5A 4E8HA 2KIMA 3N9JA 4MGRA 2OBIA 4I6XA 3WT1A 4AIKA 4KGIA 3QCPA 1IN8A 1VQNI 3QOPA 1MZBA 5LEKA 3LSKA 3VWWA 2DMPA 2V26A 5ICCA 2C1YA 2HSYA 2VCTA 5HR2A 3IBHA 3C2GA 1W1WE 4Q5SF 3HZ8A 2QKMB 1DPRA 5A4VA 2DT7B 3TQNA 2HYFA 3I53A 4Y3OA 3BJ5A 2G7UA 2QGUA 1FTZA 2RV8A 3QYBA 4ML1A 4HEA2 2JT1A 3V7SA 3RPPA 1D8JA 1QA6A 3WU2C 2LY1A 1T0FC 2RNJA 1IW7F 2W84A 4NBQA 2NVUB 3RPQA 3JSPA 3HJPA 3QPMA 3QODA 5ICFA 5INYA 2PUKC 4ZTFA 4ML6A 2Z9OA 3PUBA 3A0BC 3E6BA 5IP6A 2ESHA 2O5RA 3DXBA 4JU5A 1FVJA 4MH3A 3H92A 5IOXA 2E2HJ 3KE2A 2VJ4A 1Y1WJ 2NOGA 1ZOFA 4AJ6A 1QGVA 4CY6A 4GDFA 1E2YA 4ACSA 1Z7LA 2FQ3A 2VXDA 2K6VA 4RBOA 5BPDA 2EIMH 2DA6A 2PEXA 4P55A 1B4PA 2NS8A 2X1DA 2MMAA 2QC7A 2WZ9A 4MQ9F 2MMZA 3FMRA 4ZYEA 1Q1VA 1NM3A 3S2HJ 1GXPA 4UV8A 1V5GA 4HNVA 3HRMA 3KCCA 3S3MA 3EE2A 2VC0A 1ZL9A 2P81A 5FKLA 1A23A 1BN5A 3FDYA 3ZQLA 1WJFA 4G12A 1OKDA 4IX7A 2RM6A 3FBNB 2I8DA 4Z2YA 2EV0A 3HCZA 2Q2EB 3GTMJ 1MBFA 4HU9A 1SKRB 2DKIA 2DTRA 1N78A 2FA5A 4ENNA 2HS5A 3ZQFA 4IHXA 1K6OA 1MDMA 2ZMEB 3BG5A 2XF5A 2HYGD 4CDGA 1SFXA 2L5LA 1SD7A 3C73A 3S9FA 1M0UA 2GIZA 2DJ0A 3DLAA 5D6EA 1A0RP 3TOTA 1K4TA 4N9HA 2DC5A 3OIPA 3KX2A 1LFBA 4KIFA 4S04A 1B1BA 1SU9A 2VL2A 4KDYA 3PNVA 5JVGF 1ZH5A 4A12A 4WR5A 1ODDA 5IQYA 3WTUC 3FY7A 1W7PB 2Y0SN 1YE9A 1OKTA 1WIKA 2AO9A 5G30A 3WGGA 4P9FA 3H0GJ 3S16J 1YF1A 2VD0A 2LBFA 4G0IA 2VOPA 1S3CA 5FGMA 5G31A 3REOA 3LFUA 4AUXA 3QYEA 1ZTRA 1JT0A 3S2DJ 1XN7A 2O8KA 3V4GA 3I59B 2CVKA 3BBYA 1K0CA 1UVZA 2YS9A 1STZA 3KPHA 1W0UA 1HNCA 1IAWA 4XMYA 1HNBA 2RNGA 5CP1A 4LLLA 1HC8A 4XK4A 2AAWA 2F5VA 1FY7A 4NHZA 5FFZA 2P5KA 3MQ0A 1GSSA 2EA2A 3UR3C 1Z3XA 4W97A 2R3XA 1BIBA 3BR6A 3FKFA 4P3YB 6GSTA 1LBKA 2P5LC 1YQAA 1FVKA 1TWFJ 3VYRB 2JRMA 2A5WA 1XWKA 2CW7A 2IA0A 4Q5NA 3DKSA 1Z5YE 3P7NA 1VQ6I 3H1CA 4UNOA 4OU0A 2TDXA 1WRYA 4QWQA 2LEGA 2HQRA 4GTUA 3ED3A 3TOUA 5F06A 1OQYA 4IP6A 3GSSA 2DT6A 3BTCA 1BC7C 2D1VA 2R7UA 5LLQA 1JZOA 2N8GA 1M7TA 4ICYA 4F0CA 3EU4A 4W1UA 1B9MA 5IYBJ 3UKGA 5HLHA 3VYTB 2QKLB 2XKPA 2IJLA 2ZSIB 5IT3A 5FWGA 4XSZF 4RGSA 3GVAA 3GH9A 2O03A 1FOYA 1U8BA 1RK4A 1BI0A 1M3JA 2DFFA 3BD2A 3CESA 4OCFA 2WAEA 2VKVA 3R0AA 5FFXA 3DRNA 1MSFC 4ZYDA 1UHSA 2X4AA 3D5LA 4DSQA 5DCMA 2Z2SB 1F9NA 2E1MC 2LY2A 1K0DA 2GQMA 2ZCTA 2DOAA 2IP2A 2XGXA 5IY5H 2OA4A 5E1WA 2Y0SA 5EY6A 3U2RA 3M0FA 4KUNA 2HU9A 2WV1A 2FNPA 4U0YA 1UHWA 2RN7A 3WU0A 4F82A 2MA3A 3E1SA 2CV0A 3CRUA 2ZMEA 4NMUA 5GTIC 1OR7C 1I27A 3E3EA 4AU7A 2XKOA 1AU7A 4BEHB 4HU7A 5G5FA 1JKOC 1TZLA 2OUMA 3GFIA 1HD2A 1V3FA 2DKHA 4CICA 3PPUA 4XS1A 5LCZA 2P7CB 1U3EM 1I1SA 2V7FA 1UELB 1GVDA 3MZ8A 3T0YA 1EV4A 1GVJA 1LJ9A 1RETA 1TP9A 2H72A 2X8CA 3ISOA 4GQFA 5D8IA 3Q0VA 2H6CA 1K0OA 2H1DA 3LSZA 4PUAA 3OYIA 1OISA 4JK1X 4UUVA 1T1VA 3ZPLA 4LLNA 4CXFA 5A4UA 2DIYA 4I98B 4BU2A 4NV2A 1FIPA 2LP0A 3OYDA 1YO5C 1AKHA 4IQJA 2IS6A 1MDIA 3KEBA 1RKWA 3JRBA 4ZTJA 4HI7A 1M2AA 2O6GE 2DA1A 3P9CA 2KLOA 1U6GA 5IMZA 1MKMA 2W82A 3ZGKA 3ZIVA 4C2UA 1TT5B 4JR4A 4BVYA 3U9GA 2YWOA 3HHVA 2KUCA 5FD5A 4BQQA 3E0JB 4C2TA 1R4WA 4PQIA 2LFBA 3M07A 1AC1A 5BMUA 1YW7A 5EDNA 3IC8A 3SQNA 5IP9J 1WRJA 2DMLA 4ULXA 1BYEA 1BJAA 4HZ2A 5LHIA 4XOTA 2NAZA 1JZRA 2PLYA 3W2WA 4HPQA 3WTXC 3ZQCA 1I39A 2Y9ZA 4XS4B 2VUPA 3WODF 2XSDC 4KH7A 2EIOA 1K3YA 1JXSA 4ZB6A 1CQTA 4L9TA 4WXCA 3CCUI 2W85A 2Z33A 1QHHD 1Q4JA 1ZGNA 1O73A 5JFRA 5DS9A 4Y17A 2X4HA 1BJXA 4XKCA 5JLWA 1WJEA 2M34A 3L7WA 3S3OA 2VPRA 1IYIA 2E35A 5FKNA 2LJAA 1HQOA 1EOHA 3KZIC 2M80A 1JLWA 3H3UA 2DOFA 3Q18A 5F07A 1SL2B 3BC8A 4R1HA 2MABA 3Q5FA 2PMUA 1V4RA 3WTSC 3F4TA 2JZSA 4OO4A 1T2KA 2VD1A 2M0MA 3K4KA 1XSXA 2EK5A 1IV8A 4OWRB 2K85A 5AONA 5BQTA 3EDPA 3RKQA 4HOJA 2ELHA 4BXUA 3FKJA 2A6TA 3A4CA 3OL4A 4LJZF 4H0EA 1ZG1A 1SK0A 2FA4A 3O3TA 3A01B 4G9YA 5AIQA 2R0CA 4KN7X 1RPWA 4X1EA 4OIPF 5TRDA 3GYKA 5DCHA 1REPC 3F4RA 2CV4A 3H36A 2FXAA 4HNTA 5FLXZ 1AQXA 2GIVA 4YQVA 3EINA 3KH9A 5GSSA 4BKXA 2ISYA
chains in the Genus database with same CATH topology
2PJRB 1VGLA 1OE8A 3DKYA 1WPIA 4IQ4A 4BEHA 4CSWA 4NC8A 5B8BA 2B1KA 3IC4A 2CA8A 4MDCA 3LSGA 1PSQA 14GSA 2VIXA 3BCBA 2YOIA 1TOFA 1OC8A 4GRIA 1I9DA 3QMXA 2WS2A 2N5AA 2HPIA 1NG6A 3G7JA 3L0HA 3O76A 4KX4A 1EOGA 3OYAA 2F9SA 4OMVA 4PURA 4PFPA 1GNEA 3MNGA 2NDOA 1N2AA 2VAFA 4G0KA 1XWCA 2GDRA 4OO5A 2C4JA 2CS3A 2I1UA 3WGEA 3K10A 1F6MC 2IMFA 2GGTA 3VDXA 3OMYA 3HOSA 1QMVA 4YQMA 3FBIB 3CTFA 1FOHA 2JSPA 2WJUA 4IGJA 2VL2C 2XSJC 4XTSA 4K0GA 2GOXB 2EIRA 4LIUA 5HR1A 2VLTA 2A4VA 2QA2A 4LMWA 2ZNMA 4BJTA 2VL8A 2IXSA 5A4WA 2XPDA 3W8JA 4B47A 1T4ZA 5CYYA 2K3PA 2YCDA 4CCLA 2C0DA 3I9V2 3AKZA 2HT9A 3LJRA 1ERDA 4RM3A 2H76A 1GH2A 5GSTA 2IPAA 2CVDA 3QOEA 3VWVA 4XQFA 5FT3A 4Y4RA 3L9VA 3ZRDA 1B4QA 2HVRA 3CSJA 2C3NA 1YEPA 1D1CA 3MIXA 5ECMB 3ONQA 5ID2A 2HNLA 1FG4A 2IL3A 1J08A 3IR4A 4F91B 3KJYA 1WP0A 1UN2A 4LL1B 3H93A 3GTUA 3EMPA 2MBTA 2WRTA 3L2QA 2YV9A 5FRNA 2JZTA 1T00A 2KP1A 1FB6A 4BE1A 1U3IA 1AQWA 2LRDA 6GSWA 4RM2A 3I6AA 1YKAA 1B48A 4POLA 2HFDA 3TDGA 3PJRA 2A2RA 2J9HA 1U87A 2IFQB 4IHUA 4E7LA 4DGWB 2X99A 3UEMA 2DIZA 3ERGA 4BVXB 4AVZA 3C1RA 3E9JB 1TXXA 1FHEA 2CV2A 2JUGA 4MK3A 4KAEA 2ZUPA 2OADA 5J5NA 4G9HA 1D0ZA 3DWVA 3TKQA 2AUVA 2CMPA 4H4KC 1PJRA 4EIPA 2I3YA 2G2QA 4MPFA 3LW9A 2H71A 4YH2A 8GSSA 4QPOA 4MLOA 1ZCPA 4TR1B 5D9XA 3TL4X 2H19A 4GCIA 2RQQA 2VL3A 1K0BA 3L78A 3H79A 4MNNA 2F6CA 3EYTA 10GSA 4XS6A 1SENA 2F8AA 4FIWA 1V2AA 1GLQA 4ZJZA 3DEEA 4II3A 1X4PA 2GSQA 5HLTA 2GS3A 2E2MA 3H9JA 1TDIA 3IDVA