3IAM2

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
179
structure length
179
Chain Sequence
GFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase subunit 1
total genus 44
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3iam201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3iam202
4IW9A 3QFBC 1TRUA 2H1GA 1FB0A 4TR1B 4V2MA 3HCZA 4MJAA 2GT6A 4KSMA 2OE1A 3WGXA 1TU7A 2CQ9A 2HFDA 1K3LA 5G2ZA 2FUG2 2J23A 4ECCA 3DMLA 4IQ1A 4E8EA 2B5XA 1JZRA 3FY7A 2H75A 2I4AA 22GSA 2E7PA 4K8MA 2L5LA 4NHZA 5ECQB 1X5CA 5HR3A 2V6KA 2ON5A 1JLVA 4FYUA 1T1VA 3QMXA 2OJLA 5LD0A 4N10A 5JCWA 1YKAA 3CYNA 5ECNB 1A0FA 3ED3A 2V32A 1TDIA 5AIVA 3DKSA 4AF2A 1MD4A 2CZ3A 2JL4A 2AB6A 3ERWA 2WGRA 5DQYA 2ZUPA 3FYGA 3PGTA 2HZFA 5CAXA 5DVBA 4HEA2 2KUCA 4KDXA 1XIYA 3FEUA 2CAIA 4NV5A 1O81A 2JACA 3ZITA 3ERGA 1V57A 1GH2A 1WOUA 3P90A 2L5OA 3VWVA 3L9UA 4TKYA 2VOCA 3CBUA 1M99A 4IP1A 4NMUA 4NXIA 3F9UA 1M2BA 3HJOA 1GTUA 4GQFA 6GSVA 4XS1A 5G5EA 4X1UA 3QDNA 4WKWA 5A4VA 4K7OA 4PXOA 5DDLA 4PGTA 4IHUA 1PMTA 2BMXA 3CRUA 1YEPA 3ERFA 2AJQB 2H1BA 5IMCA 1U6TA 3CTFA 2H66A 1SK0A 2HLSA 2VLUA 1GTBA 1SK2A 2HI7A 2GSRA 2F3MA 5IOXA 2AYTA 3W8SA 4WXTA 2EC4A 4PNFA 3LJRA 2WZ9A 4FIWA 4TR0A 2VL3A 1TI1A 2KHPA 1Q4JA 5D9VA 4O92A 5DAKB 8GSSA 1WMJA 2PWJA 5ID2B 3P2AA 1GLQA 3TB2A 2VCVA 3CRTA 1XZOA 2VLTA 5LCZA 3IDVA 1BJXA 1ILOA 1UC7A 1R5AA 5L71A 3P7XA 1AIUA 1HNAA 5ECPB 2FD3A 2IWTA 1GTAA 3HVVA 4KGIA 4MP4A 2DJ0A 4XRDA 2H1DA 2IMDA 2DMLA 4ILFA 4CDOA 3SWLA 3KEBA 1GSSA 2LJKA 1J0FA 4G2EA 5AISA 3LG6A 4KH7A 1F6MC 3US3A 2VO4A 1GNWA 4K0NA 1GRXA 4WR5A 2C80A 5KN3A 1G0TA 3IV4A 5J9CA 1LBKA 4KB3A 1QGVA 4JZQA 2OACA 2YV9A 1ZGNA 5C04A 1KBNA 3LSZA 5C00A 1VF4A 5JWQB 2TRCP 2PGTA 4DSSA 1T4ZA 2LRTA 14GSA 2B1LA 3FW2A 2GLRA 4FYCA 1BQ7A 3Q18A 3TUEA 13GSA 2YPMA 2O85A 4L0UA 3CMIA 1O8WA 1OVNA 4AJ6A 1GL8A 5GZZB 1GNEA 3DGQA 1FAAA 1NM3A 2YANA 2HZEA 4NHWA 2AHEA 1ERWA 1V98A 2G0FA 4IS0A 4ECIA 2HRFA 4K0GA 3W6GA 2H74A 2H01A 3A3TA 4MPGA 1JFUA 2YP6A 1TRSA 3ZVJD 1SU9A 1U3IA 4TN8A 4TRXA 4H86A 1E6BA 4EUYA 4GSTA 6GSUA 2GT5A 4I97A 3O76A 4OFMA 3KM6A 2RM6A 1MTCA 4DSRA 4MF7A 1SL1B 1AAZA 1B4PA 2DIZA 3KH7A 1SK1A 2YWOA 4NAXA 2DMMA 1MDIA 3GMFA 1V9WA 2XC2A 2WJUA 3TKPA 2LEGA 1EGRA 4HI7A 3UAPA 5E59A 5H5RA 5AGYA 3GSSA 1B48A 2C0FA 3QFAC 5JCGA 2I9HA 5HFGA 1OC9A 2R3XA 3APQA 2OADA 1X0RA 2DIYA 4F0CA 3F4TA 3MDKA 5DCGA 3HZ4A 1BAYA 2TIRA 1SL2B 4CW9A 4WF5A 3U6VA 2FWEA 4POBA 1XWCA 2O8VB 4I5QA 1Y25A 1GSYA 3HYPA 1TK5B 5HQPA 4AJ7A 1FVKA 1QQ2A 1DSBA 1A8LA 1FOVA 3C8EA 2LJAA 3EMPA 4XS4B 2DJ1A 2VM2A 4YAPA 3D4MA 1X5DA 3IOSA 5F07A 3UBKA 1IYIA 2L57A 2MMAA 4IKHA 4MJBA 2R5GA 1NW2A 3FR3A 2CV4A 2FWHA 3EINA 1AXDA 4MABA 3ZVJA 1EV4A 3MWHA 3EMXA 1ZCPA 1G6WA 4F03A 3TKQA 2K8SA 4XCSA 2J9HA 2M80A 1YZXA 5D9TA 4V2LA 5FWGA 4X0XA 3SBCA 2GSTA 2H6XA 4GCIA 2M72A 3KTLA 3ZMKA 4HU7A 1K3OA 1PQNA 3F4RA 2IL3A 3APOA 1WIKA 1SJIA 2OBIA 1S3DA 3GKKA 1F2EA 3NIVA 4MDCA 1M7TA 3HKRA 3RPNA 1YF1A 4IN0A 1TU8A 2PERA 2R4VA 5GSSA 2LUSA 2OE0A 3F3RA 1K0AA 2TRXA 3PH9A 2DSAA 4RQRA 3UIWA 1EZKA 2HZEB 4E8HA 2KP1A 1W89A 3KP8A 3FR9A 4KA0A 1M0UA 1V40A 1Z6NA 1J08A 4EDYA 4LL4B 2MZCA 3VI7A 1PRXA 2L4QA 2X64A 5ECIB 4OO5A 3IBHA 4ZL9A 5A4UA 2REMA 2PUKC 4F82A 12GSA 2C1YA 3ME8A 3KMNA 3BOAA 1H75A 2C0GA 5B6MA 3ZMLA 2V41A 2HSYA 3EWLA 3WD6A 2FCHA 1XOBA 2FGXA 4ZB9A 4ACSA 5CREA 1Z5YE 3EURA 1R7HA 5ECKB 2IIYA 1ZZYA 2XBIA 3GHAA 1ZL9A 3QD9A 1ERTA 1WRYA 2WULA 1XWGA 2JSYA 1WPIA 4KSOA 3JCML 4KCEA 4XIHA 2B3SA 1J9BA 4ZIJA 1T4YA 4PURA 3KMOA 2QGVA 3ZRDA 1EOGA 10GSA 1E2YA 1NSWA 1A23A 4AGSA 1PL1A 3ZREA 2H0HA 1UVZA 3TJBA 4I2UA 4TR3A 3C73A 4XRAA 3NZNA 3DYRA 3TRPA 3HJMA 2KP2A 2V6OA 2H0GA 2JSZA 4K7IA 1XPVA 4LMVA 1PGTA 2AAWA 1T00A 3CXGA 5J41A 2M46A 1SKWB 4IJ3A 1OE8A 3HVSA 5ABRA 4DVCA 1BX9A 2VL9A 3PINA 4PNGA 5IMZA 4ZBAA 1LU4A 1Z3EA 4ZILA 5JWOB 3RHBA 18GSA 4ML6A 1K0OA 5EY6A 3CSJA 5COHA 3H1NA 1BG5A 4MCUA 3KP9A 3HY2A 4G10A 3GTUB 1TK8B 3A2WA 1AQVA 1QXHA 4MA9A 4HOJA 4ZB8A 3RAZA 3TJJA 4NWYA 1YEXA 5B7CA 2JU5A 1HNCA 3IRAA 5LNKe 2VCZA 4PUAA 1ON4A 4MH3A 4ML1A 2EIQA 5H5QA 2NBSA 5F06A 2H1AA 3QR6A 5D96A 3IAM2 2CZ2A 2H6ZA 3KZQA 1FO5A 2IPAA 4V1Ap 4MF5A 3N5OA 3EU4A 1FHEA 3IHQA 4JU5A 3WYWA 2L4CA 5IO2A 2C8UA 3LFLA 3D6IA 4XHMA 2LRCA 4XTSA 4YQMA 9GSSA 4DEJA 2LQOA 4K9ZA 4TXVA 3LGCA 1GWCA 3TKSE 2C0EA 3KH9A 2FLSA 4BVYA 3HHVA 1URMA 4WETA 3CTGA 1VRSD 4GSNA 5HFKA 2H76A 4LMWA 2LS5A 5ECMB 4L0WA 3F63A 2MMNA 4K6XA 5DALB 3GX0A 2VCTA 5IMDA 1THXA 1A24A 16GSA 4HDEA 1HQOA 4KAEA 1YJ6A 3LXZA 2MYGA 2X8GA 3IK9A 1A8YA 4I8BA 3M0FA 4N11A 5ELGA 1EV9A 5GAND 4MZBA 1Q98A 4GF0A 1RW1A 5D8IA 2PBJA 2HT9A 3IXRA 1SYRA 4NPBA 4YH2A 3ZLPA 4WF4A 1OC9B 3GNJA 1TOFA 3FZ4A 3A2XA 1PL2A 3BCIA 3EYTA 2JZRA 3H4KA 3GN3A 1MDKA 2EIRA 2ZCTA 2YV7A 2VD0A 1TXXA 2YN1A 3TGZA 1VF3A 2CX3A 4PQ1A 4KDYA 3DVWA 5ENUA 3E9JB 1LJRA 2HNLA 5DBQA 5IO0A 2HSHA 4KUNA 3Q74A 2VCWA 4POLA 3GUSA 4Q5RA 4TR1A 3QPMA 5G5FA 3D22A 2V2GA 3AY8A 3GKXA 3E0UA 2V1MA 2CVDA 3I9V2 4IELA 2GZYA 2L6DA 2GQKA 1AQXA 3M3MA 1BYEA 2F8AA 2VL2C 2L59A 1Z7PA 3GTUA 5D93A 2LNSA 2RIIA 3N9JA 3WGDA 1TJDA 1GULA 1OC8A 1VF2A 1ABAA 3DXBA 4EKZA 2R2JA 2B6MA 4O32A 3C7MA 3I6AA 3D21A 4IP6A 3IPZA 3M9KA 3UL3A 1B9YC 1XXUA 2RUEA 4HJMA 5HFIA 2I81A 2XPEA 4RI6A 1R5PA 5CYYA 1N8JA 4L5LA 5EL8A 4P3YB 4EC0A 2R6KA 5IOWA 2GTUA 3KD0A 2C4JA 3UEMA 3O6TA 3OR5A 1EEMA 3KCMA 1K0CA 3WT2A 1QK8A 3L9SA 1ML6A 2NVLA 4PUFC 1K0MA 3UMAA 4TW5A 1PKWA 4MH2A 2GS3A 17GSA 3GH9A 1DBYA 4N0VA 4DSSB 5D73A 4XS4A 1EWXA 2E2GA 3TJGA 1FB6A 1IYHA 3HD5A 2GDRA 2HXKA 4OWYA 1SKSB 3GA4A 4TVEA 6GSSA 2I3YA 4I6XA 1VF1A 3UOMA 1F3AA 4RUVA 4N30A 1UN2A 1SKRB 1HNBA 1XVQA 3LWAA 2KOKA 1NHOA 5J4UA 3DD3A 3ISOA 1G6YA 2A2SA 3BCKA 3FRCA 1JZWA 1XVWA 1T7PB 3TRQA 1B4QA 3HDCA 1U3AA 2YNXA 2YOIA 3GURA 4MJEA 4OCEA 1X9SB 2ALBA 2G2QA 4EO3A 1XWKA 2YWNA 3UVTA 1GUKA 4K2DA 2P5RA 2N5AA 4ZL8A 2IMKA 1F9MA 2CVKA 1O73A 2VD1A 2VM1A 3VWXA 4DSQA 2B7JA 2YJHA 2LJRA 4QL7A 1U87A 1RK4A 2LKUA 3D0ZA 3IE3A 3RPPA 1OC3A 2NTOA 3UJ1A 2YZUA 4LLRA 2D2ZA 1Y6EA 1M2DA 3TDGA 4TR4A 5DJLA 2YZHA 1XW5A 3TKRA 1HD2A 3QCPA 5E4WA 3ZL5A 4EE0A 2LRNA 3LEFA 2IJYA 5CRDA 4FYBA 2N5FA 4PX1A 4XS6A 5CP1A 2H72A 2C3NA 3VLNA 4HZ2A 2O89A 3FHKA 3F8UA 3HXSA 3NOFA 3LQ7A 2AV4A 3W8JA 4O5RA 2MBSA 4HQSA 4V2NA 20GSA 2B5YA 2XHFA 3H8QA 3DWVA 4IVFA 4MZCA 5G31A 3RDWA 4HU9A 4IGJA 4WR4A 3E3EA 3VK9A 5J9BA 4D73B 2EIOA 3GFKA 3VFIA 1N2AA 4MF6A 1TK0B 1ERUA 5A4WA 3ME7A 4KDUA 3FZ9A 4GTUA 4GWRA 4QQ7A 4X43A 4HS1A 1G7OA 2VUPA 4NV2A 2H30A 2WS2A 5H5SA 1ZOFA 4YAVA 1V58A 4EDZA 4YQUA 1OKDA 4L5OA 3U5RE 1T3BA 1K0BA 2GZPA 2L6CA 5ECRB 1BEDA 4MK3A 4ZBDA 1PA3A 1OE7A 2K18A 3TCOA 1VGLA 1AUCA 4ULXA 2CA8A 2DJ2A 2FA8A 4JR6A 2X99A 1F3BA 3C1SA 1QMVA 1KTEA 4JR4A 3VWUA 1WWJA 4HQZA 4JE1A 5KEJA 2JZSA 3MNGA 4MMMA 2FWFA 3VURA 1PX6A 3ZZXA 2K8VA 3J7Yb 2ES7A 5HR0A 1ZYEA 2MMZA 3G7IA 1XCCA 2YWIA 4OCFA 4BL7A 1OAZA 1X9WB 5DQSA 4HZ4A 4Q5QA 3IC4A 3GRXA 3P8WA 3KIJA 2YWMA 2GQMA 1R4WA 4Q5FA 1U88A 3GSTA 4F0BA 2VLVA 5FHIA 2NPBA 1EOHA 1GSFA 2A2RA 3L9VA 2DJKA 1DUGA 3J7Yk 3EVIA 4ZL7A 2GVPA 2GQLA 2HRNA 4WEYA 4RQXA 5F05A 4EVMA 2OA7A 4FH8A 2B7KA 2OBKA 5D9XA 1PKZA 4BWSA 1XWAA 2Z9SA 3QOUA 5G30A 5B8BA 2WDUA 1K0DA 1SD8A 1TP9A 3EU3A 1KNGA 3GV1A 3I69A 2PPTA 1YY7A 2B5EA 3LYKA 4KX4A 2H70A 2QKEA 3MAKA 3H93A 19GSA 1B9XC 2VCQA 3DRNA 2DJ3A 4ZBBA 2E0QA 1HYUA 5CRWA 3C71A 2FHEA 3HJPA 1QUWA 4ZXGA 4PQIA 3UVHA 5F8BA 2OE3A 2QSIA 1GSDA 3GKNA 1Z7RA 1M2AA 3F0IA 4KE3A 3F3QA 1XWBA 2HYXA 1RQMA 1TRWA 3ZYWA 3VPQA 3L4NA 3GH6A 5JCUA 1CQGA 6GSWA 2P0GA 4JEDA 4IBPA 1G7EA 2IFQB 5IM9A 2H19A 4EF0A 1TRVA 3CSIA 3IK7A 2RLIA 2VIMA 1A2MA 4CHSA 3ZFBA 3K8NA 5GSTA 11GSA 1A2JA 2OKAA 4HJ2A 4HUAA 3GKMA 1Z6MA 1PX7A 4G19A 2PU9C 4MJCA 5D9WA 5CNWA 3IAS2 3Q6OA 1THOA 2JZTA 1X9MB 1AW9A 5B8AA 2C0DA 2IN3A 2H73A 5F0GA 4MZWA 4IQAA 3FZAA 1ZYQB 3BJ5A 5GAPD 1X5EA 4EXJA 2VAFA 4JRRA 2K9FA 5ECSA 4YQVA 4ECJA 1O7UA 1SD9A 2AUVA 4OFTA 1C72A 2IMIA 2WRTA 1TI3A 1GUMA 2XBQA 3I43A 4BA7A 5ID2A 5ECHB 2HE3A 3IA1A 1EP7A 1UA5A 4TOPA 4BWQA 3HA9A 3CSHA 3LYPA 2PVQA 1S3AA 1SYXA 2IMEA 4JBBA 1ACVA 5IPHA 1R26A 3G7YA 2C3QA 2PMTA 1W4VA 2CX4A 2PVOC 2GSSA 1MDJA 4D73A 1TW9A 2GSQA 3WT1A 4KNDA 2GZZA 3QAVA 1K0NA 4POMA 3UBLA 1GLPA 4ID0A 5G1KA 1XFLA 1V2AA 1OYJA 4V1Ag 1GUHA 4RI7A 2FNOA 2DJJA 1FW1A 3GX8A 3TJFA 2RM5A 1O8XA 4Z7XA 1T8EB 2ON7A 4N0ZA 2LSTA 3M8NA 1JLWA 3F4SA 2P31A 1AQWA 1M9AA 4MLYA 5G1LA 4LA1A 1GSEA 3UARA 1B8XA 2WCIA 4OO4A 1GTIA 5DAKA 3LORA 3M9JA 3L78A 2LNTA 2CAQA 4G9HA 4GQCA 1FG4A 3G9BA 1O6JA 5JWRB 3V1WA 5J3RA 1YDKA 2YCDA 4LL1B 1WP0A 5IQYA 1SJZA 3ZTLA 3D5JA 1SJ6A 5INYA 1USBA 1F37A 3PR8A 3HVXA 2DBCA 3L0HA 3S9FA 2FA4A 1O85A 5DJMA 5IMAA 2X8CA 4KW6A 1WE0A 3TJKA 2H0IA 2RUFA 1XOAA 4MPFA 1XW9A 1DE1A 3R2QA 5IIZA 2B1KA 5KN0A 2CT6A 2C3TA 4OD7A 4ZB6A 4BVXA 1JZDA 3TKSC 3LXTA 5ECOB 4GSSA 1EP8A 6GSTA 5J5NA 5IMVA 2NDOA 3ZFLA 2ZNMA 4GLTA 1XW6A 2A4VA 1ZMAA 3BBYA 2CVBA 3FZ5A 1Z9HA 5KN2A 6GSXA 4ISDA 3BD2A 3GIXA 3A5WA 3QAWA 4AJ8A 3M1GA 3ZIVA 2LQQA 4FO5A 2DC5A 3QAGA 3VWWA 3KJYA 1S3CA 2VCXA 5IPGA 5DCHA 3RBTA 7GSSA 3O3TA 3APSA 2WFCA 2XPDA 1ERVA 5CO3A 1WJKA 4EL1A 1KEBA 3H79A 3KGKA 3MSZA 2YJ7A 4PQHA 1PD21 2O87A 3RHCA 4GXZA 4TXOB 3EC3A 4OFNA 1YQ1A 1TTZA 2JADA 1JHBA 2P5QA 2H8LA 2WB9A 1K3YA 2H6YA 2F51A 2X8HA 5HR2A 2H71A 1XBSA 2IFQA 3KXOA 2FY6A 1JZOA 4QL9A 3GL3A 5AN1A 1EEJA 1PN9A 3WGEA 1ST9A 2O7KA 4GRFA 2IMFA 2MBTA 1MEKA 3HZ8A 4J57E 1GSUA 1QFNA 1GP1A 3TOTA 1SL0B 1A2LA 6GSYA 2BTOT 4I2TA 3DEXA 3EE2A 5ECLB 5KN1A 1EGOA 1NHYA 4J2FA 5DALA 4KCAA 3VI5A 2DLXA 2I1UA 2K6VA 3DIEA 1AC1A 2PN8A 3GL5A 2LTKA 4L8EA 5EPFA 4TXOA 3D4TA 3DVXA 3G7JA 4K1FA 4F2IA 3A2VA 3TOUA 1I9DA 1SENA 3FK8A 1YF0A 1DE2A 3C1RA 5FT3A 1GSQA 3F6DA 3VPTA 4POKA 2N5BA 4OMVA 1H4OA 2E2MA 4F9ZA 4O7HA 3FR6A 1M9BA 1I5GA 2KLXA 2F9SA 5A5KA 3IR4A 1TKDB 1MD3A 3ZIJA 3KTBA 4WBRD 2F8FA 4J56E 4WBJA 5EVOA 4BPYA 1PSQA 4Q5NA 3TKSA 2R37A 5CRGA 5B6NA 2LV3A 2FWGA 3FKFA 2MMOA 1A0RP 3Q19A 3GYKA 5AIXA 5HR1A 2BJXA 2GGTA 3F6FA 1YKCA 2VL2A 4ECBA 1OKTA 4K7NA 4IJIA 5IMFA 1FVJA 5ELAA 1CQHA 5CRHA 2QC7A 3TRXA
chains in the Genus database with same CATH superfamily
4IW9A 3QFBC 2DFFA 4G0KA 1TRUA 2WV1A 2H1GA 2N8GA 3A01B 2YS9A 3ZCOA 1FB0A 4TR1B 4AD9A 3MKYB 4V2MA 2KZVA 3HCZA 4MJAA 5EEAA 2GT6A 4KSMA 2OE1A 5FRNA 3L9FA 1MBKA 3SZTA 3WGXA 2Z2SB 3PO3J 1TU7A 2ZXHA 3I3LA 3F8CA 2CQ9A 4YRVA 1R4MB 2L4MA 1MNDA 4L9NA 1K3LA 3BZ6A 3C3WA 2FUG2 3QYBA 4B8XA 2HFDA 5G2ZA 3OIPA 2J23A 4ECCA 1YOVB 2R5ZB 1A35A 3DMLA 4CH7A 4XICA 4IQ1A 4E8EA 2B5XA 2P0WA 4B3XA 1JZRA 3FY7A 2H75A 5EEGA 2I4AA 4MNNA 2QQ9A 3OS1A 4ZDPA 4OIPF 1R00A 5D5XB 4U88A 2BXZA 3KX2A 4MQVA 3TKYA 22GSA 2DO7A 2E7PA 4K8MA 1SVMA 5HNHA 4XN3A 5F27A 3A2KA 1JI8A 2L5LA 1D1AA 2MGQA 4NHZA 3JW4A 5ECQB 2XF6A 1X5CA 2V6KA 5HR3A 1A04A 3L7WA 2ON5A 1JLVA 2RV8A 2EA4A 1LPQA 4FYUA 1LE8A 1T1VA 2A05A 3QMXA 2OJLA 3L2WA 5LD0A 2EWNA 3I71A 2CRGA 5IP7J 4N10A 5JCWA 3SDGA 2L01A 1YKAA 1QRYA 3GZNB 3P5JA 3CYNA 5ECNB 1A0FA 3ED3A 3LAJA 2V32A 3CC2I 1TDIA 5AIVA 4DNCA 2IS4A 3DKSA 1S72I 4IO9F 4AF2A 4CCMA 3ROUA 1MD4A 5L3DA 3LSPA 2CZ3A 2ZFUA 4IXAA 4L5JA 2BYVE 2JL4A 4L18B 2AB6A 3ERWA 5DEQA 5EZHA 2WGRA 5CQEA 5DQYA 4RS8A 2F5FA 4J00A 5M3MJ 2KRCA 3DV8A 3PFIA 4LG3A 4BBRJ 2ZUPA 4DBRA 2MW8A 3FYGA 4Z2TA 2R0QC 4NHJA 3BTLA 3PGTA 2KDOA 2HZFA 1Z77A 1YI2I 3HOUJ 4A0XA 3OYKA 5CAXA 4BEHA 5ICEA 4HEA2 5M5YJ 3GTJJ 2HOAA 5DVBA 2KUCA 4RAYA 4KDXA 4LK0F 4IOAF 3NRVA 3EDPA 3I54A 1NG6A 4C3IJ 1CF7A 1M3JA 3PSIA 1XIYA 3FEUA 2CV2A 2CAIA 2ZCWA 1SAXA 4NV5A 4G94A 3DPTA 1O81A 1TT5B 4IQ4A 2JACA 1EH7A 3K4KA 3Q5FA 4D9JA 2CFXA 3CUQB 2GWRA 3G73A 1PUFB 3ZITA 3ERGA 5K5RA 1V57A 4RLQA 3FM5A 1GH2A 1WOUA 4LIUA 4QPOA 3P90A 2L5OA 3VWVA 3L9UA 1B9MA 2W25A 2XROA 4TKYA 1WH7A 4YFKF 3JTHA 2VOCA 4F55A 3W2WA 3CBUA 3T0YA 2TDXA 3E5QA 1E17A 1M99A 5KAFC 4IP1A 4NMUA 4NXIA 3F9UA 1USSA 1M2BA 1R23A 2BOLA 5H2FC 3HJOA 1RESA 1GTUA 4CY8A 2MBFA 4FISA 4HQMA 4GQFA 5HDKA 6GSVA 1Z3YA 4XS1A 1S3RA 4GXOA 5G5EA 2MC3A 1SD5A 1UG0A 5E3OA 1SAUA 2XAGA 3LSKA 4XLPF 3QDNA 4WKWA 4X1UA 3HRMA 5A4VA 3ASNH 3WGIA 4K7OA 4NUBA 4NDLA 3KLNA 4PXOA 5DDLA 4PGTA 1XDUA 4IHUA 4EMSA 1IXSB 2KRFA 1PMTA 2BMXA 3CRUA 3AG4H 2P4WA 1TWHJ 1YEPA 3ERFA 3HHGA 1BBYA 2AJQB 2M3AA 1XMXA 2H1BA 3H36A 3LSHA 3O6BB 3IRRA 5IMCA 1U6TA 2K4JA 3CTFA 2E7XA 3HRUA 2H66A 1WQ2A 5TRDA 1SK0A 4F0CA 2DI3A 1H0MA 2HLSA 2VLUA 2V1XA 3CCLI 1GTBA 4C30A 4ETSA 1SK2A 1KQ0A 2GSRA 2F3MA 2HI7A 5IOXA 2DOEA 2QEXI 1YW9A 2ISZA 2VKHA 2KL4A 2AYTA 4Y3OA 3W8SA 1KYZA 4W1UA 3HVNA 3OYEA 3ZGKA 2O5RA 5FFZA 1ZN2A 2EC4A 4PNFA 4WXTA 4AIKA 5FLXZ 1QQIA 3LJRA 3FXRA 2WZ9A 3VPRA 3IV5A 3GF2A 3D5RC 4FIWA 2GA1A 1KZHA 3CMEI 2FD5A 4BDZA 1YO5C 1TI1A 1ETQA 3DTEA 1GXPA 2KHPA 2VL3A 4K5SA 4C2TA 3CESA 2GXBA 1Q4JA 2UZ8A 5FLMJ 5LD2C 4Y7NJ 3T8TA 5D9VA 4O92A 4ZDLA 5DAKB 4WF2A 4HSRA 1BR2A 2JSPA 3SDBA 8GSSA 5A2QZ 1WMJA 3Q3SA 1BW5A 3F22A 2PWJA 1VQ6I 4PGGA 1C0WA 2HVRA 3TJJA 5ID2B 4XKCA 3P2AA 1GLQA 3TB2A 2VCVA 2HQ5A 4KN7X 3CRTA 1KQ9A 1VQNI 1XZOA 4OIRF 3BG6A 3M3YJ 4XLEA 2VLTA 2PLYA 3GFJA 3EUHA 2FRHA 5LCZA 3RTRA 3IDVA 3H5AA 3UR3C 1BJXA 4I99C 2ZMEB 1UC7A 1ILOA 2EPFA 2FOKA 5ICGA 4HF1A 4BQNA 1R5AA 5L71A 4BY7J 3V7SA 3LSGA 1KONA 2GBYA 3BTJA 5J47A 3P7XA 3CP8A 1AIUA 1HNAA 4CYCB 2PFBA 3QPHA 5ECPB 1R49A 2FD3A 2RN7A 3CUOA 3MFKA 2IWTA 1GTAA 1D8KA 5DTDA 3HVVA 1W0TA 2DJIA 4KGIA 4ANJA 1I6XA 4AUXA 4MP4A 2QBYA 4NC7A 2DJ0A 4XRDA 2LF8A 2H1DA 1ERDA 2IMDA 1IGNA 2DMLA 4ILFA 4UB8C 4CDOA 3SWLA 3KEBA 2AHQA 1GSSA 2LJKA 1D0XA 4EJWA 5FKNA 2X4HA 1AKHB 2A2PA 2X49A 4Q5SF 1J0FA 1UG2A 2F48A 5HODA 1WI9A 1IJWC 4FT8A 4G2EA 2O03A 4OWRB 5AISA 4G6TB 3LG6A 3ZXSA 4LGWA 1IRFA 1ON2A 4KH7A 1FC3A 1F6MC 2M4GA 3US3A 5IOZA 2VO4A 2KDZA 1TZLA 1ZELA 3QODA 4J19A 1GNWA 1FBUA 1WCMJ 1T2KA 3BR3A 4K0NA 1GRXA 1GLNA 1N78A 4WR5A 3GEZA 2ZSIB 3H35A 4KA4A 2C80A 5KN3A 3OL3A 1M1EB 2FA5A 1G0TA 5B1BH 5GTIC 2Z9OA 3IV4A 2Q2EB 3KCCA 5IOYA 5J9CA 3HKZA 4HRIA 3LFKA 3FIWA 1OCPA 1LBKA 4KB3A 2MC4A 4PZJA 5EEHA 1Y1VJ 3HRTA 5DM7F 1RIOH 1QGVA 4JZQA 2OACA 2YV9A 2A6EF 1ZGNA 2OQGA 5C04A 1S7OA 1KBNA 3LSZA 3S3MA 5C00A 3CTAA 4OINF 1MBFA 5DDGA 1VF4A 1ZK8A 3EYYA 3FMRA 3O3KA 2WB1N 2QA2A 5JWQB 4BHBA 2TRCP 2PGTA 4DSSA 1Z1DA 2LY1A 2DN0A 2PJRA 3M8FA 3HOWJ 1FOWA 4ABZA 4C2MJ 3R6SA 3TP3A 5D8KB 1V54H 2IA1A 4L9JA 1OISA 2HOEA 4JK1X 5F1JA 1W36D 5KOXA 2VPLA 1T4ZA 3LQQA 5M3FJ 3R60A 4ENJA 1HF0A 4XKWA 1HOMA 2LRTA 1NK3P 1GUUA 3ZMUA 5F0CA 1EA3A 4FASD 5DUIA 4YEJA 5C44J 14GSA 2B1LA 2XGXA 4P5OA 2QSFX 4D0PA 3VYUB 2GLRA 2KQRA 3PIPF 3FW2A 4FYCA 1BQ7A 1M3IA 3Q18A 3TUEA 13GSA 2YPMA 2BW3A 4IPAA 4RAFA 2ZSHB 2O85A 3CMIA 4L0UA 1B8IB 3SHFA 5F0HA 1O8WA 1OVNA 2V9VA 4GYIA 4AC0A 2H8WA 2JA2A 4AJ6A 1GL8A 5GZZB 1YRNA 1X1PA 1GNEA 3BOQA 4HV5A 5JHFA 3JAMZ 1FAAA 1NM3A 3DGQA 2YANA 4HF0A 3NEUA 3E3VA 2HZEA 4PSXA 5BS6A 4NHWA 2QQ8A 1QHGA 2AHEA 3DF8A 2V1DA 1ERWA 1V98A 2G0FA 3G2BA 2HRFA 2ZKZA 4IS0A 3V42A 3JRIA 4K0GA 1A6IA 1QO0D 3BCAA 3JSOA 2H74A 3W6GA 2H01A 3CLQA 4OAZA 2A5YB 3CQZJ 3A3TA 4MPGA 4WETA 1GVJA 3P9KA 1JFUA 3A02A 3GLXA 1LVAA 2YP6A 3HSRA 1MSFC 1F4KA 4UNOA 4OOIA 1TRSA 3ZVJD 1SU9A 1U3IA 4TN8A 2VBXA 5J1UA 4TRXA 1MW7A 3F8NA 3A0BC 4H86A 4U0VA 5FKOA 1I5ZA 2QUFA 2ELKA 1E6BA 4EUYA 2IGKA 3BROA 5E20A 4XRSG 4EJOA 4GSTA 2LLKA 3L2QA 6GSUA 2BHYA 2DPUA 3KEYA 1DPUA 2GT5A 3O76A 4I97A 4OFMA 3FBNB 4A6EA 1DGWY 3I4MJ 2RM6A 1Q1VA 3KM6A 2DFHA 3G1OA 4U7DA 4FE7A 4IRHA 1MTCA 1VFCA 4DSRA 5JLWA 1P4XA 4MF7A 1AAZA 1B4PA 3GTMJ 1SL1B 5CPRB 1DP3A 2DIZA 1N75A 3KH7A 2B63J 1UAAA 1SK1A 3KP4A 1GVDA 4Z2UA 2YWOA 4XQFA 4YIIA 1ZKGA 2WBMA 3M4OJ 3I56I 2GLOA 4NAXA 1PN0A 4HLXA 4CGZA 2LYCA 2DMMA 1MDIA 3GMFA 2JQ7A 3KEOA 3C18A 3EUKL 2IEKA 3HBLA 1V9WA 4EIPA 1LE8B 2XC2A 1SFXA 2WJUA 3TKPA 2DFIA 2QGUA 5HS8A 2LEGA 1EGRA 4HI7A 2A61A 1SFOJ 3UAPA 1U8BA 5E59A 2YX7A 2Y69H 3OYBA 2E1OA 3A5IA 3GSSA 5AGYA 1B48A 2C0FA 3QFAC 3L09A 4Z2YA 3GTLJ 2LQOA 4BUPA 2I9HA 3E6DA 5JCGA 4G7ZF 4CZCA 5HFGA 1R5ID 3M8EA 3GLLA 4V2GA 1OC9A 2R3XA 2OV7A 5E1XA 2OADA 1X0RA 3APQA 2DIYA 5G30A 3KFWX 5CQGA 1QZEA 5DYMA 3WG7H 2QBYB 2P5KA 3F4TA 3NWSA 3HZ4A 3MDKA 5DCGA 4Z2RA 1R36A 3K1PA 1W4MA 4M73A 3WTXC 1BAYA 2X6OA 2TIRA 1ZHFA 1SL2B 1T0FA 1B9NA 1UHSA 3BT9A 1Z0XA 4CW9A 1LJ9A 2L3DA 2XF7A 2P81A 1FOYA 4WF5A 3U6VA 3KP5A 3TOBA 2R5ZA 2LTPA 4QWQA 2FWEA 4A2UA 3S8PA 4A3EJ 3F21A 2ZNYA 4POBA 4ENKA 4D1QA 1XWCA 2O8VB 1Y25A 1GSYA 3HYPA 4I5QA 1TK5B 2RGVA 3FHZA 2Y0MA 5HQPA 4A93J 4JYKA 1FVKA 1QQ2A 4AJ7A 1DSBA 3CO7C 1HQCA 3R0AA 5GPCA 3ESWB 3M8JA 1D3YA 2K27A 3FK7A 4PUSA 4MEYF 1A8LA 1FOVA 4EQQA 2A4HA 4CDGA 3C8EA 2MABA 4XRMA 2LJAA 1K79A 3EMPA 2ECCA 5EG0A 5F04A 3S2HJ 1W7PB 3WTVC 1BIBA 5GPAA 4XS4B 2DOAA 1XGSA 2F4OB 4KIBA 4CZZA 3COAC 2DJ1A 1T8IA 4DW6A 1TLHB 2VM2A 4YAPA 1ZGWA 1ZG1A 3FBIB 1X5DA 3D4MA 1Z91A 3JCUC 1RNLA 3JREA 3IOSA 3E0JB 2XPVA 2X1CA 3MCZA 4LB5A 5F07A 3UBKA 1IYIA 3TL4X 2HRAA 2L57A 2VXDA 2L0KA 2MMAA 4IKHA 2OC6A 4XLCA 1YTYA 4MJBA 2RC4A 3IC7A 5LGUA 4RM2A 4Z6YA 3F6VA 3OSGA 2R5GA 2EIKH 3OS0A 4FETA 1SEUA 2IGNA 1HC8A 2L9RA 1NW2A 3FR3A 1BJZA 2CV4A 1J0RA 2XGEA 2FWHA 3EINA 4A3KJ 4L9TA 1AXDA 4MABA 3ZVJA 1EV4A 5JHUA 3MWHA 3EMXA 2W24A 1ZCPA 1G6WA 4F03A 3TKQA 4RB2C 2K8SA 4XCSA 4KF9A 4NNJA 5KHDA 1JHFA 5HNFA 2J9HA 1RZ4A 1YS7A 4PJ0C 2YU9J 2M80A 3CDHA 5L3GA 2HDWA 1YZXA 4V2LA 5D9TA 2XPWA 2HVSA 3GTOJ 3P7NA 2RDPA 2IA0A 1J5YA 2LMDA 1A36A 3QRFF 2EZIA 1FTTA 4M72A 1Z3XA 4IF4A 5FWGA 2HS5A 2VC1A 2EV5A 3BJAA 3KEQA 1B72B 4X0XA 2P8TA 1MMSA 2EV6A 3L00A 3SBCA 3RZOJ 4UVCA 3DEEA 4G7HF 3HZJA 2GSTA 1OYYA 2ID3A 1ZTRA 4M9ZA 2DYSH 4E4HA 1FBSA 2H94A 5HOOA 2H6XA 4GCIA 2M72A 4MQ9F 3KTLA 2XPUA 2YPRA 1DP7P 3ZMKA 4LG0B 2K9NA 1NG7A 4AIHA 4HU7A 1A6QA 2TCTA 1K3OA 1H9TA 3MIXA 1PQNA 3F4RA 2LY2A 3VDXA 3WTWC 2CFOA 2IL3A 3APOA 3K70D 3OV8A 2JWTA 4QLCU 3KETA 4NC6A 1WIKA 2VASA 2KJBA 1SJIA 2DA7A 3KLOA 2PBIA 5ED4A 1H89C 2OBIA 5IP9J 4RGRA 1OCOH 1S8NA 3ASOH 4A69C 1S3DA 3GKKA 2R92J 1G59A 3FHNA 1F2EA 3NIVA 1VF9A 3RSNA 2EFQA 3T8RA 3RPUD 4HG2A 4BXUA 2FU4A 4MDCA 4DYQA 1M7TA 3HKRA 1WRJA 4AIDA 3BG7A 3RPNA 3U9GA 1NHAA 1YF1A 4IN0A 4BIKA 1TU8A 2PERA 4W97A 2M1BA 4JOMA 1WJAA 4QIWN 2R4VA 1SVOA 2LUSA 2XF5A 4E7KA 4A3MJ 3PL8A 2OE0A 3F3RA 5GSSA 1K0AA 2TRXA 3PH9A 2LOOA 3AFHA 3J7AY 3OWTA 2DSAA 2FNAA 1LB2A 3BC8A 3GWZA 4RQRA 1EZKA 3UIWA 5D4SA 5DCMA 5LFAA 2HZEB 4E8HA 2X6XA 4G0IA 1FIPA 1X3ZB 2KP1A 1W89A 2R7DA 1L3LA 2KT0A 3KP8A 4Y13A 4EV0A 2ZNZA 1FNNA 3FR9A 1M0UA 4KA0A 1APLC 2R5YA 1V40A 1Z6NA 3A0HC 3RZDJ 1TNTA 2E34A 1J08A 1X3WB 3ZQGA 1UJ8A 1P92A 3CC7I 4EDYA 2GXGA 4KFCA 4CXFA 4LL4B 2MZCA 2HYFA 2AXTC 5F08A 3ZMVA 3VI7A 3PUBA 1PRXA 4KMUX 3PNVA 4XLAA 3E6CC 2L4QA 2X64A 5ECIB 4MNUA 4OO5A 1X2MA 2JZYA 3W2VA 3IBHA 2CW0F 1FOXA 4ZL9A 5A4UA 5FLVA 2XDVA 2ZJPF 4RBOA 5LHGA 4CICA 5B3SH 2ISYA 5B1AH 2E2IJ 3RPQA 3OYGA 2REMA 1BR4A 2W85A 2PUKC 4F82A 3SFIA 4IJAA 3OYFA 2ADUA 3SFZA 5L3EA 12GSA 2C1YA 3GFLA 2ETHA 4UVBA 1PP8F 1G3WA 3GTPJ 3ME8A 3AL0B 3KMNA 3BOAA 2M30A 1H75A 2EINH 2C0GA 5EGOA 2A6TA 3CJRB 1OCRH 2P6TA 1LFUP 2Q0OA 3CDLA 2NVQJ 4Q47A 3ZMLA 4M3GA 5BRTA 3FM3A 2RQPA 2V41A 2ELJA 2HSYA 3EWLA 3QP5A 1FLIA 3WD6A 3B6CA 2CG4A 5H6RA 3J7AO 2FCHA 4MJCA 2M8GX 3L2VA 2HOSA 1XOBA 1S7AA 4QTRA 1LUJB 2FGXA 3E97A 1VQMI 4ZB9A 5AIQA 3V7CA 1Y0UA 3WHBA 5J8FA 2HOTA 2DXIA 3IKVA 1YQAA 1WWXA 1YLFA 4ACSA 3H9GA 5CREA 2FQ3A 2GQQA 4BJTA 1ZG5A 3S1NJ 1Z5YE 1S5LC 5AIPA 4A5NA 4RGSA 3EURA 4UXNA 3DBRB 1R7HA 5ECKB 3K70C 2IIYA 1ZZYA 2XHKA 2HPMA 2CV0A 2WTEA 2XBIA 3GHAA 2WAQA 4HOBA 1ZL9A 3I64A 4EM0B 3QD9A 1ERTA 1WRYA 3DEWA 2KIQA 1XWGA 2JSYA 2WULA 2E5ZA 2YU3A 5EZGA 3NQOA 2X6WA 2X51A 1ETWA 5KAIC 5JR3A 1WPIA 4KSOA 3JCML 3R3EA 4KCEA 2DOFA 3PUFA 5F6FA 2D1HA 4XIHA 3TEDA 2B3SA 1NK2P 4GRIA 4ZTFA 1J9BA 2R7XA 4ZIJA 1W5CC 2KHMA 1T4YA 3I5UA 4KDPA 3VFZA 2FMLA 3A01A 2Z3YA 4P9FA 4RLFA 3RJPA 4A3FJ 3G6EI 4DYCA 4PURA 3KMOA 3KP6A 4G6DA 2QGVA 3ZRDA 3QP6A 2M7AA 2HFHA 2HTSA 1EOGA 1LVKA 3CC4I 10GSA 1VQPI 3D1NI 3SEZA 2JA8J 4IEJA 2W00A 1E2YA 3ML6A 4EM2A 3E1SA 3W6JB 3NWTA 2LD5A 3V8LA 1P6RA 2HR3A 1A23A 4HV6A 4BQAA 1NSWA 1RR7A 3Q0UA 3LWFA 3U2RA 4EIQA 4IX7A 4AGSA 1AU7A 1XGNA 2X1EA 2LC2A 3ABKH 4CA0A 1TW3A 1FYKA 2VPRA 1PL1A 1YJWI 3ZREA 5K7HA 2H0HA 1WJCA 5FLXK 1UVZA 3TJBA 2DMQA 4I2UA 4TR3A 3C73A 4XRAA 5K1YA 1Z67A 4ZYHA 3NZNA 4XLHA 2LDUA 3DYRA 1JKOC 3TRPA 3HJMA 2XRLA 2KP2A 2V6OA 4B09A 3PO2J 3RQ4A 2QCOA 4HSCX 2VB6A 3IWZA 2H0GA 2JSZA 4K7IA 1XPVA 4LMVA 2XASA 1FT9A 2YX4A 2Z16A 1PGTA 3CJQB 4I02A 1BL0A 1ZREA 2VBWA 2E5NA 2FF4A 3KP2A 1T38A 2AAWA 2OBPA 1DUXC 3T5XA 1VQLI 1T00A 2DT5A 1ON1A 1VNDA 3ZQFA 3CXGA 2LY9A 5ILUA 2HDCA 4WX9A 1QA6A 4GDFA 5J41A 1O3QA 3EPZA 2M46A 1SKWB 3CMYA 4IJ3A 1MMAA 2F5EA 3KZYA 1S29A 2ZBKA 1JJ6C 1OE8A 3HVSA 2L2OA 4ENMA 4DVCA 3FXLA 5FO5A 5ABRA 1BX9A 1Y8RB 2VL9A 3PINA 4PNGA 5IMZA 4ZBAA 3DKWA 3SJMA 1LU4A 1R22A 1T33A 2FNPA 3HSFA 1Z3EA 4ZILA 5JWOB 3WG9A 3L2RA 4IKFA 4PJNA 3HJEA 2CO5A 2Z99A 5FROA 18GSA 3WU0A 3RHBA 2R7SA 2WWYA 4ML6A 1K0OA 5B66C 5HLTA 5EY6A 1I6HJ 4RAGA 3CSJA 2VQLA 5CNWA 4CCOA 1QBJA 1WPKA 3KZIC 1OR7C 2K4BA 1WJEA 2B9SA 4IZZA 2JUGA 3PFYA 4LIVA 1OCCH 4XIDA 4USSA 4F91B 3S15J 4UV9A 1GV2A 3LAPA 5COHA 1LEAA 3WU2C 2NYXA 3DQVC 3H1NA 1Z6TA 1OCZH 4HA8A 1BG5A 2M4KA 1SD6A 1O7FA 2IVMA 3KP9A 4MCUA 3HY2A 4G10A 3C2HA 3H0GJ 3GTUB 4X0GA 1TK8B 3A2WA 1JUSA 2E1MC 1AQVA 2HQRA 1VZ0A 1X1AA 3L1PA 4KNYA 1QXHA 4UY8I 4MA9A 2O7OA 1ZRFA 4HOJA 1FP2A 2FXAA 1E2XA 3RYPA 4ZB8A 3RAZA 1HSJA 2VBZA 4GCVA 3VSLA 3L2UA 1GDTA 2KLOA 5D6EA 4NWYA 2RNJA 3S16J 1YEXA 5B7CA 2JU5A 4F7ZA 3HL2A 1PUEE 2OQRA 1ITYA 4WXCA 4CSWA 3IH3A 1LQ1A 1HNCA 2EQRA 1RR8C 3IRAA 5LNKe 3I59A 1LDKB 2VJIA 1HCRA 3OYDA 2VCZA 4PUAA 1ON4A 4MH3A 3IP4B 2EIQA 4ZYGA 5BOXA 3I4NJ 4ML1A 2NBSA 5H5QA 2DODA 3VYSB 4L0YB 5F06A 3ZR8X 3J81K 1IN8A 1OYIA 5M5XJ 2EFWA 2H1AA 3QR6A 2M87A 3IAM2 1EV7A 2CZ2A 3MAJA 2H6ZA 1WI3A 2HXIA 2OPTA 2UXNA 5F1RA 1AWCA 2IPAA 2G7HA 1FO5A 1YE9A 4V1Ap 3CUQA 4MF5A 3N5OA 1LFPA 1FMVA 3EU4A 4AVZA 2DKHA 2A68F 4ZTJA 2DA1A 4B43A 1FHEA 3IHQA 2WAFA 4JU5A 2WA0A 3WYWA 3HC7A 2X0LA 2CH0A 3J7ZI 2ESHA 2FSWA 2L4CA 2BY2A 2JN6A 4LMYA 5IO2A 2C8UA 3R4KA 3LFLA 1KU3A 1FY7A 3D6IA 1TWGJ 4XHMA 2LRCA 3ZOBA 2O61A 2VXZA 4XTSA 3U1KA 4YQMA 2PG4A 9GSSA 4BU2A 4DEJA 2NOJB 2V7FA 5IOWA 1KA8A 2QKLB 1STZA 2VI6A 2HWVA 2LH9A 4RA2A 1ETKA 3BP8A 3NARA 4QPQA 4BHPA 3QU3A 1VQOI 2DLLA 3RKXA 4K9ZA 4TXVA 3LGCA 2MFZA 1GWCA 4E7HA 5EG0B 4AYBA 2W7NA 3TKSE 2Q1ZB 2C0EA 3KH9A 2X4AA 1X1DA 3GW2A 1G2HA 2FLSA 1D5VA 4BVYA 2LP0A 2MA3A 3CLOA 3HDDA 3HHVA 1URMA 1HDDC 2L7ZA 2WV0A 4DQ2A 3CTGA 1OCTC 2E2JJ 3BJOA 1VRSD 2H76A 4GSNA 2XIGA 2LS5A 4LMWA 2UWMA 5ECMB 4L0WA 3F63A 2MMNA 1Z21A 4K6XA 5FGMA 1LKXA 1W5SA 2DA6A 2VQGA 3M1EA 5DALB 3GX0A 2VCTA 3UNGC 3KYLA 5IMDA 4V19K 3RQIA 1ETYA 4KICA 4IQJA 1THXA 1A24A 1FPQA 16GSA 1B8IA 4HDEA 3ZMDA 1YFHA 3CF5F 1HQOA 3ZMTA 1U6GA 3HGGA 2E1CA 1TXXA 5CVIA 1LDJA 3O8GA 4JBAA 4LITA 3LXZA 3U21A 2MYGA 3GUDA 2X8GA 3IK9A 1XGMA 1Y39A 1E3PA 1A8YA 1KU7A 2LSOA 2XAUA 4I8BA 3M0FA 3K69A 4N11A 4NBQA 5ELGA 1EV9A 2VL8A 1HDPA 1MSEC 5GAND 1EH6A 2WB1A 1O7LA 3BJ6A 3H92A 4MZBA 5BMZA 5E3LA 1Q98A 1V5FA 5L3BA 3HM5A 4IRIA 5E8IA 2QA4I 1RW1A 4GF0A 2PBJA 5D8IA 2HT9A 3IXRA 2X9DA 1K78B 1IXCA 2WY7Q 1A31A 1SYRA 2ELHA 3B73A 5D5UB 1X1BA 4NPBA 1YW8A 4YH2A 3ZLPA 4WF4A 1YYVA 3LA3A 1WVRA 1OC9B 3GNJA 2NXNB 4XRFA 3S17J 2VQHA 4M3FA 1ZARA 1TOFA 4I09A 4A3JJ 3RKYA 3G4SI 3FZ4A 4BY1J 4Q48A 3HEFA 3A2XA 1IUYA 2JVHA 2IA2A 4XRSA 4G9YA 5IPAA 1PL2A 3BCIA 3EYTA 2XKOA 3K9TA 2JZRA 3H4KA 1L0OC 2AXLA 2HDDA 3CUQC 2EH3A 3GN3A 2H1LA 1MDKA 2EIRA 2ZCTA 1ORKA 1V5EA 1IO2A 2YV7A 4M3DA 1RKTA 1TWCJ 3DP7A 3E7LA 2VD0A 3IWFA 2CGPA 3FXKA 4C9YA 3CCQI 2Q2EA 1V4RA 1W7PD 4I7HA 2A5WA 3WGHA 2V4JC 4J01A 2YN1A 1QZYA 4IVNA 3TGZA 1VF3A 3TMOA 2IGOA 2CX3A 4PQ1A 1D0ZA 3VEPA 4KDYA 3DVWA 5ENUA 2HGCA 3E9JB 1BI1A 4UUSB 4U0WA 1LJRA 3LSJA 4R79A 5EJCA 2HNLA 2L7MP 3H5RA 2FX0A 4I98B 5DBQA 4B4CA 4D5FA 5EGOB 1F9NA 2ZFWA 4WWCA 3QPSA 5IO0A 3E5UA 3GZ5A 2HSHA 2LKXA 4KUNA 2F4IA 4KIGA 3WE3A 2K3PA 3Q74A 1A5JA 2K85A 3BPVA 3H1CA 2HZDA 2JA5J 2VCWA 1AOYA 3QOEA 4LB6B 4IHVA 3RCOA 4POLA 3GUSA 3MVPA 4PFPA 2KMUA 4Q5RA 4K2XA 1UMQA 2XSJC 3CJTB 2Y31A 3QPMA 4TR1A 4UUTA 4EGYA 1R9TJ 3HOZJ 5G5FA 3D22A 2V2GA 3AY8A 3GKXA 2HVQA 4MTEA 4A0YA 1X4OA 4CCLA 2L7KA 3J80K 3E0UA 2F5VA 2V1MA 2CVDA 5BNGA 2BE5F 1F5TA 3I9V2 4IELA 5F0FA 2D2WA 1KU2A 1HBXG 1OQYA 2GZYA 2C6YA 3JRGA 2L6DA 3I53A 1HKTA 1W1WE 2LFBA 1G3YA 3MKWB 2GQKA 1AQXA 3WTUC 3WTTC 3ECOA 3M3MA 2DA4A 4ASNA 1U9OA 2MD5A 3JRFA 1P4AA 2DT6A 1SD7A 4ENNA 4ON0A 1LEBA 1QPIA 1BYEA 3TQNA 2D45A 2JVGA 2GXAA 2F8AA 3V4GA 1PDNC 2VL2C 4K5RA 3LQRA 2L59A 2DAOA 1Z7PA 4A3GJ 1JT6A 3GTUA 1MH3A 2K9LA 3DWLE 5B8BA 2PJRB 5D93A 2LNSA 3FX3A 3W6VA 1MD0A 4BJ6C 1OPCA 5L3CA 2STWA 2RIIA 3N9JA 5CLSA 2K9QA 6PAXA 4C3JJ 1XB4A 3DXJF 3F0CA 2XAQA 2DTRA 3WGDA 2BY0A 3MKLA 1RKWA 1TJDA 1GULA 4F52A 1OC8A 5J8CA 1VF2A 1ABAA 4BACA 3DXBA 1KU9A 4EKZA 4BE0A 5DD4A 1MH4A 2R2JA 2B6MA 2BHZA 4BS9A 2EFOA 2A07F 1FTZA 3C7MA 3D21A 3I6AA 4O32A 1ZLJA 3DPLC 3OIQA 5FD6A 2ZMEC 4IP6A 4FQUA 5CYVA 2Y2ZA 3IPZA 3M9KA 3HOVJ 3UL3A 3HUGB 1U0JA 4XOPA 4PCQA 1B9YC 1XXUA 3F23A 3M1CA 3PIOF 4BXFA 2RUEA 4HJMA 1WZ2A 3G1LA 4II2A 2OUMA 3HTUA 4YKFA 5HFIA 4LJZF 5GP9A 5J40A 3JR9A 2I81A 2XPEA 2BXYA 3BTIA 1B72A 1ZGJA 4RI6A 2WAQN 3BCBA 1BC8C 1R5PA 5CYYA 5GAHJ 2M7BA 1IG7A 1TNSA 1N8JA 2IGMA 4L5LA 4ICYA 4P3YB 5EL8A 1ZRCA 3E6MA 4EC0A 3KE2A 4NC8A 4IHXA 2NS7A 2XV4S 2HEOA 5DD8A 1YX3A 2VE8A 3WHCA 2MYSA 2GTUA 4H4KC 2R6KA 3KD0A 2C4JA 3HRSA 3TOAA 2Y0SN 3UEMA 3ZQQA 1O3TA 3O6TA 2DMTA 2QWWA 5HVQC 3CCUI 4O3MA 2EA2A 2VE9A 4BHCA 2K9SA 3OR5A 4MIMA 1EEMA 3KCMA 1K0CA 3BR5A 5D9WA 3BZKA 5EYRA 3ZPLA 2XRNA 3AG1H 4MGRA 4KITB 3WT2A 1YJ6A 2Z33A 1QK8A 2F5DA 2YUSA 1ML6A 3L9SA 2NVLA 5IY5H 2O6GE 3BG9A 3C2GA 3MMYB 4PUFC 2X1DA 2R7QA 4L5IA 2HKOA 1K0MA 3UMAA 1P7JA 1U3EM 4EM1A 1PKWA 3TO7A 4MH2A 4TW5A 2GS3A 3O2PE 5TJJA 5E3NA 3OYMA 5J1RA 17GSA 1P9QC 3SQNA 3GH9A 3S32A 2HKXA 3J7YJ 1K83J 2IBDA 5D96A 2IT0A 1DBYA 3GZ6A 4N0VA 2UZKA 4EVIA 4DSSB 5D73A 4IL6C 2KIFA 1MBJA 4XS4A 1EKEA 2LBFA 5FFXA 4X6AJ 1EWXA 2E2GA 3TJGA 1DDNA 3K1MA 2NNNA 1XDSA 2JSCA 5HLHA 1FZPB 2HYGD 1IYHA 1FB6A 1QGPA 1EH8A 3ISPA 5M5WJ 2GDRA 3HD5A 2JK3A 4BAYA 4B3AA 2HXKA 4OWYA 1SKSB 3GA4A 1RUOA 5EDNA 2DDAA 4CYDA 4TVEA 2HU9A 3ABTA 3P9CA 6GSSA 3MEXA 1TQMA 2I3YA 4I6XA 3OYLA 5F64A 1MBHA 1XD7A 2CUFA 1VI0A 4IHSA 2MD0A 4X4JA 2JRMA 1K4TA 5H6QA 1XPXA 1VF1A 3JRAA 1Z7LA 5L3FA 4F93B 3GBGA 4H0EA 2ECBA 3CP2A 3MQ0A 1REPC 2O8XA 1YIJI 3UOMA 1TQPA 2MH9A 1T56A 2CW7A 4EATA 5J1YA 2CW8A 1R4NB 1F3AA 4RUVA 4N30A 4ESBA 5D5VB 4B1RA 1UN2A 1SKRB 2W1OA 2CS3A 1HNBA 1XVQA 3LWAA 3F3XA 5LEKA 2KOKA 4KAEA 5FKKA 1ZH5A 4I6ZA 1FYLA 4DIQA 1NHOA 5J4UA 1FOKA 3DD3A 3ISOA 1UHWA 3FKIJ 1G6YA 2A2SA 3ZN1A 5IYBJ 1AHDP 3BCKA 3FRCA 3KIOA 1MNEA 1JZWA 1XVWA 1T7PB 2QA1A 3TRQA 3F72A 3C2BA 2KFDA 1B4QA 3HDCA 3E6BA 2XAJA 1U3AA 2YNXA 4BQQA 2YOIA 4RGXA 4Y33A 3GURA 5LRSA 1TC3C 5HDNA 4MJEA 2E1NA 4CO8A 5J3LA 4OCEA 1X9SB 2NVYJ 3Q9VA 4PJMA 2CUZA 1YX5A 5DUKA 4UUSA 2ALBA 4BQOA 4A6DA 4CCNA 4P96A 3BR2A 2G2QA 3B6AA 2HI3A 1F1ZA 2RNGA 3SYTA 4EO3A 1JT0A 5HS9A 1XWKA 1U5TA 2E35A 2YWNA 1UHMA 3CJNA 4RDUA 3UVTA 1GUKA 4K2DA 2ESNA 2P5RA 2N5AA 2F5CA 3H3ZA 4ZL8A 2IMKA 4HNVA 1F9MA 4JX5A 2CVKA 5K5QA 1IW7F 1O73A 2VD1A 2VM1A 3ZQIA 3DLLF 2PI0A 3OSFA 1X1CA 3VWXA 3FXOA 5IT9Z 3PQKA 3PSFA 2L02A 4DZJA 2JPCA 4I0AA 1S9HA 1TW2A 2WADA 3K4MA 4D7MA 2H27A 2JA7J 4DSQA 2E36A 2B7JA 4N0BA 2YJHA 2LJRA 1NH3A 4QL7A 5C4XJ 1U87A 1RK4A 3CCSI 2LKUA 3D0ZA 2LRDA 3IE3A 3H3UA 1ZGAA 3RPPA 1OC3A 2JPBA 1RI7A 2NTOA 3UJ1A 3K4JA 3OYCA 5J4YA 4YKGA 3ZMZA 2YZUA 4LLRA 3BQYA 5DCFA 4A5MA 2K40A 3ZN0A 4I01A 1BN5A 2D2ZA 2QYOA 1IC8A 1Y6EA 1M2DA 2BVMA 3TDGA 4O5QA 4U0YA 3N97A 5CJ9A 5GAEJ 4TR4A 2VIXA 5DJLA 2YZHA 1XW5A 3TKRA 1ONVA 1HD2A 1DQUA 3W2AA 3QCPA 2M0CA 4MO7A 5E4WA 3ZL5A 2KP6A 1Y56A 1CGPA 4EE0A 1G3TA 2IAIA 2LRNA 2LKSA 1IRZA 1I27A 3LEFA 1QVTA 2DMUA 2RVCA 4GYGA 3DFGA 5H20A 4UUVA 1DPRA 2IJYA 1O3RA 4I2OA 4Y4RA 5CRDA 3M7GA 2XGCA 4HSTA 4AWXB 4FYBA 2N5FA 3GFMA 1QHHD 4PX1A 4XS6A 5CP1A 4CCJA 4G8XA 2H72A 2C3NA 3VLNA 4A3BJ 1ZG3A 4HZ2A 2O89A 2DK8A 2HSMA 4YELA 3RDIA 3FHKA 1U5TB 3F8UA 3HXSA 3NOFA 3LQ7A 2AV4A 3EUAA 3W8JA 3A03A 3FISA 3TDZC 4O5RA 5LEJA 4HQSA 2MBSA 4V2NA 3CDIA 1ENHA 20GSA 2W57A 4Y15A 2B5YA 2FBHA 2FJ1A 2XHFA 3DWVA 3H8QA 4IVFA 4MZCA 5G31A 1I3QJ 3BLYA 3RDWA 2EK5A 1TL8A 3DEUA 3C1DA 4HU9A 3VYTB 3PJRA 2DW4A 4E7ZA 3K4NA 1XC5A 3TGNA 4IGJA 3E3EA 4WR4A 2O8KA 4AM3A 2R7VA 3VK9A 3BR0A 1Z6RA 5DV5A 3PNTA 2LBFB 2DDBA 1FSEA 1WSUA 4ESFA 1X19A 3S2WA 2K86A 4P1WA 4DGWB 5J9BA 2NVUB 4OMYA 4D73B 2EIOA 3HGYA 1R1TA 1HKQA 3GFKA 3VFIA 2I5UA 4OIOF 4G6QA 1N2AA 1RPWA 4MF6A 1T0FC 4M74A 1TK0B 1ERUA 5A4WA 4QSHA 2XGDA 4MFDA 4G12A 4U7BA 1JTXA 3ME7A 2E7WA 3IKTA 4KDUA 4KT5C 3FZ9A 3FMQA 2XAFA 4GTUA 4GWRA 4QQ7A 2W48A 2R7OA 3QU6A 4HS1A 4X43A 1G7OA 2VUPA 4BEHB 3QWLA 3HKZN 4NV2A 1YW7A 4BGDA 1QPMA 5K5OA 1VTNC 2H30A 1D1CA 2WS2A 1LNWA 5H5SA 1JJ8C 1ZOFA 2MH2A 4YAVA 3JRCA 2CQ7A 2GA2A 3QYFA 4KT6A 4PK4A 4S05A 1V58A 2XB5A 3CCEI 1U2WA 3FMSA 2IXSA 3ZMSA 2V9KA 4EDZA 4YQUA 2RQQA 4FX0A 3BTCA 1SC7A 1OKDA 4L5OA 1SFUA 4BL7B 1FEXA 3U5RE 2ZJRF 1T3BA 1K0BA 1JGGA 3EYIA 2BVLA 3GMEA 3R61A 5C4JJ 1BM9A 2JTVA 4KMFA 2FBKA 2GZPA 2L6CA 2CSOA 5ECRB 1BEDA 4FQGA 1JGSA 4MK3A 4MLOA 2XC7A 2NRAC 4DZPA 3LSIA 1PA3A 1OE7A 4ZBDA 2KIMA 4ZJZA 1OMIA 3ULQB 2K18A 4Y52J 3H5NA 1XSVA 2MLGA 2NNYA 3TCOA 3DPUA 1TP4A 1G8XA 2GAUA 1VGLA 4HYEA 1AUCA 1PJRA 1IRXA 4ULXA 3K0LA 2CA8A 3K2ZA 3ABLH 3F8BA 2DJ2A 5IT3A 2FA8A 4JR6A 3FF5A 5FRMA 3GXOA 2VN2A 1F3BA 4M71A 2X99A 1MMNA 2FMYA 2X48A 1T6SA 3K6GA 2R93J 3C1SA 2QSHX 1USTA 1MJ9A 2A69F 4K2EA 2A6HF 2O9LA 1QMVA 2LR8A 2L9NA 2XKPA 3A4CA 1KTEA 4JR4A 5D5WB 3VWUA 1TT0A 2OTLI 3BR1A 1WWJA 4HQZA 4JE1A 5B5EC 4LOCA 3S1MJ 1W36C 2JZSA 5KEJA 1FSHA 1ZYPA 5ICFA 5ICCA 1GT0C 3MNGA 1HW2A 1EF4A 4G7OF 1J2XA 3PM1A 5E1ZB 2FWFA 4MMMA 3CMMA 1WJ5A 1UELB 2COBA 4HNUA 2OZ6A 3VURA 1PX6A 2JUCA 2QM3A 2IS1A 3ZZXA 3EPTA 4JX4A 1I39A 1WH5A 2YR2A 2K8VA 5CVVA 3LA2A 3J7Yb 1ZR4A 1W5TA 1HW5A 4DOZA 1P7IA 2ES7A 5HR0A 1ZYEA 4KJZA 4ZZDA 2MMZA 3VOEA 3G7IA 2GIZA 1XCCA 1ETXA 2YWIA 4OCFA 4BL7A 1HLVA 1OAZA 1X9WB 5DQSA 2VONA 1IAWA 1DU0A 5TISC 3EUHC 5KVRA 4HZ4A 4Q5QA 3N4MA 1T98A 3IC4A 4OIQF 1CQTA 3GRXA 3P8WA 3KIJA 1MMGA 2YWMA 2E2HJ 2OA4A 2GQMA 2IP2A 1R4WA 4HW0A 4Q5FA 3BDDA 3QPTA 2LKPA 4XR6A 1ETOA 1U88A 3GSTA 1IRGA 2HRKA 4ZYAA 2ME0A 4F0BA 3D5SC 5C3EJ 2HZTA 2M2EA 4N9IA 4L0ZB 2G9WA 4XOTA 1FOHA 2VLVA 2EV0A 1T39A 4FHTA 4ZZLA 2QF7A 3FMWA 5ILSA 4BE2A 1J59A 1B1BA 2TRTA 1YITI 5FHIA 3ZQCA 1J09A 2NPBA 5E8GA 1EOHA 3NAUA 3G1MA 4ZH4F 1GSFA 3DU5A 1LFBA 1K78A 1MBEA 2A2RA 2P5VA 1Z9CA 2M34A 1YRNB 5TGTA 2LVSA 2WC2A 1JTYA 2BEOA 3RKQA 1DU6A 3L9VA 4UHTA 2CQXA 4XL9A 2NS8A 1DUGA 2DJKA 2V79A 4X1EA 3BZCA 3EVIA 4ZL7A 2ICWG 3J7Yk 4R8HA 2GVPA 3BQZA 2DTZA 2GQLA 2CMPA 4A0ZA 2HRNA 4WEYA 1FX7A 2M9HA 1QNTA 3CCMI 1TQIA 4RQXA 5F05A 1I50J 2KPMA 5HLGA 4EVMA 5KCMA 2OA7A 2DPDA 3GVAA 4FH8A 2B7KA 1IN7A 2OBKA 4MHGA 3HIFA 2QENA 1PKZA 5D9XA 4BWSA 4LLNA 2VC0A 3S1QJ 1XWAA 2Z9SA 3QOUA 4V2FA 3SEQA 2QVOA 4WXHA 4XSZF 4CCKA 4CY6A 1IN4A 2WDUA 3HOTA 1K0DA 1I1GA 1SD8A 1TP9A 2R0GA 3EU3A 1P2FA 4XKBA 1KNGA 3GV1A 4O5UA 3I69A 2G0EA 1XSXA 4JP0A 2PPTA 2O3FA 1MJAA 4OAYA 3IUOA 1YY7A 2B5EA 1PFOA 3IHGA 3LYKA 4KX4A 3FXQA 2H70A 2QKEA 4HNTA 2DMNA 3TP0A 3MAKA 1FYMA 3H93A 2E71A 2BY3A 5FKLA 3JAMK 1V5GA 5CVRA 3RIRA 19GSA 1B9XC 1BW6A 2Y75A 2VCQA 1SMTA 3DRNA 3F6OA 2DJ3A 4ZBBA 2EZHA 2E0QA 1HYUA 5BMUA 1PP7U 1MDMB 5CRWA 3QAHA 3TO9A 3C71A 2COMA 4NQWA 3DCFA 2FHEA 3HJPA 1RETA 1QUWA 4ZXGA 1MNMC 2L7FP 4FX4A 4A3DJ 4PQIA 3GX4X 1UCRA 3UVHA 1XSDA 1D1BA 5K7ZA 5F8BA 2OE3A 2QSIA 3FZVA 1IDYA 1K6YA 3TBIA 3VSKA 4R1HA 5E18F 1X3UA 2BY1A 4IHTA 4YIRX 1GSDA 4IHYA 3GKNA 4GFBA 2K9MA 1Z7RA 2BZTA 1M2AA 2AO9A 2JRTA 3F0IA 3F3QA 1XWBA 4KE3A 3VODA 2HYXA 4N4NB 1RQMA 1TRWA 2VT3A 1CF7B 2VKEA 2A3SA 3ZYWA 3DLAA 1S6LA 1MKMA 3BG5A 2DK5A 3MN2A 3VPQA 3JTGA 4B47A 1X4PA 2L5QA 2V1NA 4GO1A 4C2UA 2LG4A 3L4NA 5IP6A 3GH6A 5IYDJ 5JCUA 5AONA 1H9GA 3OOPA 2RAEA 1CQGA 6GSWA 5HS7A 2KZGA 1HKSA 2P0GA 1OLTA 2DU9A 1BA5A 4JEDA 3ECHA 4IBPA 2CYYA 1B4AA 1G7EA 5FJ8J 2IFQB 5IT9K 2F2EA 2NVXJ 3R0JA 4BKXA 1SD4A 3RKWA 5IM9A 3BWGA 2H19A 2R7RA 4HX7A 5KK1A 4N9HA 3ZQLA 1ZLKA 4EF0A 1TRVA 3LMMA 2CU7A 3CSIA 1V3FA 4JQFA 3DKXA 2VQCA 3OR2C 3FK6A 3IK7A 2HYJA 2RLIA 2VIMA 2MLKA 1A2MA 3GFIA 3ZFBA 4CHSA 2Y48A 4M3BA 1U78A 3K8NA 5GSTA 11GSA 4XNFA 3BR6A 3DBLB 2DFEA 1MZBA 3QOPA 1A2JA 3EETA 3ERED 5JVGF 2OKAA 4HJ2A 2R7ZJ 2L9SA 3BPXA 2H6BA 1VQ7I 1ULYA 3H3VK 4HUAA 3GKMA 3A1YA 1Z6MA 4YFNF 1PX7A 4G19A 1AA7A 4NQWB 4F3QA 5GAGJ 1BI0A 3IAS2 1BOBA 3L2CA 2PU9C 3Q6OA 3ERMA 4HX4A 1THOA 2JZTA 1JKRC 1X9MB 4YIFA 1AW9A 5B8AA 2C0DA 1MDMA 2IN3A 3GO5A 2H73A 1GXQA 2HNHA 4DJAA 3P9IA 2V1UA 4ECIA 5F0GA 4MZWA 1G6NA 3FXUA 4IQAA 3MZYA 2M8EA 2EILH 1B6AA 3FZAA 3B02A 1UB9A 1SFKA 2O0YA 2XVCA 2VODA 1ZYQB 3BJ5A 5GAPD 1X5EA 3JRHA 1YJNI 2VAFA 4EXJA 2EFPA 2UV1A 4LLGF 4JRRA 3I0TA 2F6CA 2K5CA 3I58A 3KPHA 1JE8A 2H8RA 2K9FA 4LFUA 4FE4A 3S14J 2MSYA 5ECSA 3ZRGA 4YQVA 4XSXF 1IN5A 4ECJA 4M6XA 4A3CJ 3OS2A 4BL0B 1O7UA 1SD9A 1K6OA 2AUVA 4OFTA 3CCRI 2VJ5A 1C72A 2IMIA 2WRTA 1TI3A 1OKRA 2X85A 2I10A 1GUMA 2K7LA 3K7AJ 3LOCA 2XBQA 1ZR2A 3M07A 2W82A 1XMKA 3I43A 4BA7A 1YS6A 2ZXIA 2R4GA 3AG2H 5D6FA 3CMAI 5ID2A 4LK1F 2V6CA 2L9VA 4B48A 5ECHB 2HE3A 5J6XA 1Y8QB 3PNYA 2H1KA 5DS9A 1EP7A 3IA1A 1UA5A 2ZMEA 1T95A 4S04A 1N77A 4TOPA 4BWQA 1MIJA 1XS9A 3HA9A 3WU1B 2EB7A 2W84A 3CSHA 3LYPA 2PVQA 4ITVA 2DA5A 1KGSA 1XCBA 3AAFA 1JXSA 1S3AA 1SYXA 4EEFG 2IMEA 2BBYA 3FKJA 1MBGA 2H09A 1XX5A 4HX8A 4JBBA 1ACVA 5IPHA 3V8JA 4MEXF 1R26A 2PMZN 1KYWA 4MTDA 3G7YA 2C3QA 2VJ4A 2PMTA 2FQ4A 1W4VA 1KQ8A 2CX4A 2CUEA 5HLIA 3LSRA 2PVOC 4E70A 2GSSA 1U9NA 3HXLA 1MDJA 4D73A 2EZKA 1TW9A 3LNQA 2DQLA 4I0BA 2GSQA 2E60A 3WT1A 4RGUA 4DBQA 4DYRA 4HDUA 2DYRH 2UXXA 4KNDA 3I4PA 2QQAA 2GZZA 3QAVA 4TR0A 1K0NA 4POMA 3UBLA 1RRJA 3RYRA 5LRRA 1GLPA 4ID0A 5G1KA 3HYIA 2DT7B 1RUNA 1XFLA 1V2AA 1OYJA 3KP3A 4V1Ag 1GUHA 4RI7A 1K7AA 2R7TA 3H9JA 1ZAOA 3WGGA 2XSDC 1MMDA 1TWAJ 2FNOA 2WY8Q 2DJJA 2BV6A 4KYWA 1FW1A 3GX8A 1BR1A 3TJFA 2RM5A 2M5WA 1O8XA 1TTYA 4Z7XA 1T8EB 5LHHA 2CV1A 2ON7A 4N0ZA 3ABMH 1IN6A 2OCEA 4A3LJ 2LSTA 1BI3A 2Z1DA 1SFEA 1JLWA 2P31A 3F4SA 3DTIA 3M8NA 4EJTA 1AQWA 1XN7A 4UV8A 2VBYA 1FBQA 2HTJA 1E3HA 1M9AA 1WJBA 5LBQA 2P5LC 4MLYA 2Z5UA 5G1LA 3KZZA 4RB0A 4LA1A 1GSEA 3UARA 1F43A 2NOGA 1B8XA 2WCIA 1SVLA 2QKMB 2VUMJ 2EBIA 1O4XA 3HB9A 1T08B 1QZZA 4OO4A 4A12A 4XM3A 1GTIA 3LA7A 3SZPA 5ILVA 4M9SA 2L4AA 2R0CA 4PTSA 1GHCA 4M3EA 3LORA 3M9JA 5DAKA 3N05A 3L78A 1R5HA 1TBXA 3F8MA 5LHIA 2D1VA 1HXDA 4KISA 2LNTA 4NB5A 3CQFA 4WXDA 1XMAA 1H88C 2CAQA 1K4SA 4G9HA 1PYVA 4GQCA 4KIFA 2HXOA 4XMYA 4XLNF 1FG4A 3G9BA 1O6JA 5JWRB 3QPLA 3KYCB 1IF1A 3V1WA 2PQ8A 2ZC2A 4TV7A 2R0PA 4JX6A 2DQRA 5K7FA 4ZDOA 2FE3A 1VQ9I 3Q9SA 1FP1D 2L54A 1WFXA 1E0EA 5J3RA 3IC8A 1BC7C 2R7FA 4HPQA 3S1RJ 1YDKA 5JI6A 3OL4A 3DBHB 4D5CA 3LSTA 4HDVA 2R7UA 2YCDA 3I59B 4LL1B 1WP0A 5IQYA 2XB0X 4PFOA 1OR7A 2OCCH 1VQKI 3S3OA 1ACIA 3ABUA 2AS5F 1JHHA 5A2QK 3DKYA 1D0YA 3MYDA 1SJZA 2ID6A 3ZTLA 3K10A 3D5JA 1SJ6A 2OTJI 5INYA 3ZP5A 4UVAA 1VQ8I 3IRQA 1B59A 1H8AC 1USBA 2IS6A 1F37A 3LFUA 1FMWA 1E3OC 3PR8A 4L9VA 1O57A 4HAMA 5CVJA 1HSTA 3K1NA 3REOA 3HVXA 2DBCA 3L0HA 2DKIA 3S9FA 2FA4A 1O85A 4M6YA 3KP7A 5DJMA 4II3A 4EJVA 1ZRDA 5LGNA 5IMAA 2J5PA 3CCYA 2PMHA 3TW7A 1J9IA 3W3CA 1YIOA 2X8CA 3LW9A 2ZB9A 4KW6A 2WAEA 1WE0A 3TJKA 2UUZA 5CKTA 4GGGA 2IPQX 3FWEA 2H0IA 4ESJA 4CUGA 2RUFA 4UB6C 1XOAA 4XKVA 4XN0A 1PUFA 4MPFA 1S3JA 1XW9A 1DE1A 2LNBA 2NVTJ 3R2QA 2MG4A 3QYEA 1WJFA 1FWZA 2ZXJA 1EJ9A 5IIZA 2EZLA 4P55A 2K3FA 2B1KA 4BVYB 1N25A 4KN4X 3O8HA 2Q8KA 2CT6A 5KN0A 3OYAA 2ACJA 4IOCF 2C3TA 4RMNA 3KZQA 4OD7A 1MGTA 3CF2A 4ZB6A 4BVXA 1JZDA 3TKSC 3GCMA 3V7RA 3WTZA 3LXTA 1FJLA 5ECOB 2NAZA 4BDYA 1FIAA 2IRFG 2FOWA 4GSSA 3WTYC 2OD5A 3FXJA 1EP8A 3K4CA 3IL2A 1OJLA 6GSTA 5BPIA 5J5NA 4F92B 1PVEA 2NS0A 5IMVA 1YJ9I 2NDOA 3ZFLA 2F4MB 3FXMA 3OMYA 2FBIA 2V9PA 3ONQA 2ZJQF 2E19A 2IW5A 2PMUA 2ZNMA 2LK2A 3LSMA 1XW6A 3JRDA 3CZ6A 1ZMAA 2A4VA 3BBYA 4GLTA 4WCGA 2CVBA 4PJJA 3FZ5A 1Z9HA 2Y9YA 6GSXA 3GYHX 1G4DA 4ISDA 3BD2A 5KN2A 5CVUA 3TO6A 2QSGX 1JUMA 3GIXA 3DU6A 1OYWA 4YFXF 1F36A 3HPGA 2R3SA 3F8FA 3A5WA 5D4RA 1R5GA 2DCEA 2DJNA 3H9QA 4Q4ZF 3ELKA 3QAWA 4AJ8A 1JKPC 3IH2A 5FKMA 3M1GA 2CUJA 4S0HB 3ZIVA 4XLFA 3CD6I 1X2NA 3HOXJ 2HQNA 2LQQA 1XCVA 4FO5A 3VB2A 1D8JA 1O3SA 2DC5A 3S2DJ 3QAGA 3QQAA 1I1SA 3VWWA 1Z7UA 3KJYA 1J7KA 2VOPA 2DBBA 3PQJA 1S3CA 4I76A 1V55H 2P6SA 2VCXA 1MJBA 3CCVI 5IPGA 3VWBA 3SXYA 2CQKA 4XBFA 1QVUA 5DCHA 3CCJI 2JA6J 2EFNA 2M0MA 3RBTA 1W7PA 3J81Z 2QC7A 2BGCA 1ZYRF 2P7VB 4RB1A 2YSRA 4ZYDA 3MD2A 1Z05A 2CJJA 3KYDB 1XG8A 3DTKA 3APSA 3O3TA 7GSSA 2WFCA 4HBLA 1NTCA 2XPDA 1ERVA 1WJKA 3Q0VA 5ERIA 5CO3A 3WE2A 2X6YA 3WTSC 1TWFJ 5E79C 5JLXA 4EL1A 4XORA 1IUFA 1Y6IA 1KEBA 1Y0NA 3UKGA 1IDZA 2DA3A 3TW6A 3H79A 3KGKA 3OYIA 1WKMA 3AG3H 1JKQC 2ZJ2A 3MSZA 2BW3B 3MWMA 5EF6A 5IYCJ 2YJ7A 3K4LA 2VOOA 2D5VA 3HHHA 4KUMA 3HPHA 2LF7A 3IH4A 4PQHA 2VJJA 1PD21 3I55I 4CYCA 1BIAA 4IRGA 5E3MA 2O87A 3RHCA 2JMWA 3G71I 4GXZA 2OJED 4RB3C 4TXOB 3MZ8A 3EC3A 4RM3A 1VQ5I 4OFNA 1YQ1A 2FEZA 1TTZA 2JADA 1JHBA 1OFCX 1POGA 3CO6C 2ME6A 1ZYNA 2AQEA 2W4SA 2P5QA 4A5PA 2H8LA 2KJCA 3RPUA 3T1BA 2WB9A 2Y30A 1K3YA 2H6YA 3X2QH 2F51A 2X8HA 5HR2A 1UZCA 2H71A 1XBSA 1R7JA 2IFQA 3KXOA 4HF2A 2FY6A 2VT2A 1U8RA 2KIUA 1JZOA 2P7CB 4QL9A 1ZQ3P 2B7EA 2R7WA 2HPIA 2GM4A 1Y1WJ 3GTQJ 3OIOA 3ZQHA 3GL3A 5GADJ 4C3HJ 1QU3A 5AN1A 1EEJA 1R1UA 2K02A 4PDKA 1AKHA 1PN9A 3WODF 2KISA 1ST9A 3WGEA 2O7KA 2ZXWH 3V8KA 2R5YB 4GRFA 2IMFA 2MBTA 4OU0A 4BXXJ 5KOWA 2GOMA 1MEKA 3HZ8A 2I8DA 3EQLF 4J57E 1R6RA 1GSUA 1QFNA 4PJLA 1GP1A 3TOTA 1SL0B 1SANA 4YG2F 1R58A 4U87A 4M9XA 3ZQ7A 1A2LA 4D7NA 4HLYA 3RI4A 4BE1A 6GSYA 2BTOT 1VQ4I 4ZYEA 3BG3A 4I2TA 4B44A 3DEXA 3EE2A 5ECLB 5KN1A 1EGOA 4BYYA 3K2AA 1G3SA 1NHYA 5HFKA 3D5LA 4BH9A 4J2FA 4HZFA 3HTSB 5DALA 4PGHA 2LREA 2H6CA 2AQFA 4XONA 4EGZA 1YG2A 4A3IJ 1R71A 4KCAA 2DLXA 3VI5A 2VKVA 3FDYA 1UFMA 2Y0SA 3OYHA 2I1UA 2JT1A 1GV5A 2K6VA 3DIEA 4RAZA 5LLQA 4N4OB 3S3NA 4EJUA 2ZO4A 1DGRM 2GIVA 3C7JA 5KNLA 1AC1A 4AVPA 4WK8F 2CQQA 2CQNA 4LD5A 2PN8A 3GL5A 2LTKA 1J75A 9ANTA 2E1MB 4AYBN 3HUGA 5D8LB 1U5TC 4L8EA 5EPFA 5JFRA 4FTHA 4TXOA 3D4TA 2KRHA 3DVXA 3G7JA 3OYJA 4BNCA 5BQTA 4K1FA 1WGXA 4PSWA 4F2IA 5DCMB 3G3ZA 3VYRB 1LDDA 1HW1A 3A2VA 2DMPA 1I9DA 3S93A 1D5YA 1SENA 3TOUA 2DA2A 1JUPA 3K4BA 4Y17A 3FK8A 1YF0A 1WHUA 1WJDA 5DM6F 2PN6A 4FCYA 2EJRA 1DE2A 3JRBA 4AIJA 1XGOA 3C1RA 5FT3A 3HOYJ 3W6KB 1ETVA 3HSEA 1GSQA 1RC9A 3F6DA 2V26A 1SMYF 3VPTA 2OF7A 4POKA 1XTAA 2N5BA 2OAZA 3OR1C 1S7EA 4OMVA 1H4OA 1ODDA 3F9KA 1Q1HA 3H0DA 2E2MA 4F9ZA 4E7SA 2QZ8A 1IZ1A 4M6VA 1K61A 4E7IA 5FB2A 4O7HA 2OU2A 3TDUC 3PPUA 5JVTA 4O5VA 4L5EA 2VKDA 4P9UA 4LLLA 3AKZA 3FR6A 3D0SA 1IV6A 2KKOA 1I5GA 1M9BA 3HOSA 2KLXA 1P4WA 4E7JA 2F9SA 3HG9A 5A5KA 4MFEA 1BI2A 3IR4A 1TKDB 2HQAA 2RKHA 3Q0WA 1MD3A 3ZIJA 3MKZA 4E7LA 4ZC3A 2STTA 2PJPA 3KTBA 4BJ5C 5J4VA 4WBRD 2OZUA 2F8FA 4E6KG 4OMZA 3GTKJ 4J56E 3OY9A 4WBJA 5EVOA 4BPYA 2M45A 1PSQA 4Q5NA 3M9AA 3TKSA 5H5RA 2RREA 4BVXB 4G0LA 3LL7A 2PMZA 3MZHA 2R37A 2JJ7A 4XK4A 2VLAA 2CWEA 3E5XA 3OOUA 3J80Z 3SZGA 4IHWA 5CRGA 1XG1A 5B6NA 4LG0A 2LV3A 4AU7A 2J5OA 2FWGA 5GTHC 3FKFA 2MMOA 1A0RP 3Q19A 2EIMH 3GYKA 2B0LA 5AIXA 2BJXA 2XUBA 5HR1A 1BOAA 1W0UA 2GGTA 3F6FA 1YKCA 2VL2A 5HDGA 5E17F 5B6MA 1HA8A 2EIJH 2XAHA 4ECBA 2QLZA 3AL0C 2PEXA 4HQEA 2IJLA 5FD5A 1I3AA 1R1VA 5E1WA 2Y9ZA 1IXRC 3OYNA 2G7UA 2GZWA 1OKTA 1IV8A 2QQBA 4K7NA 5LGTA 4BBSJ 2PX9A 4O6JA 3JSPA 4IJIA 1YHQI 5IMFA 5BPDA 3GTGJ 2IS2A 3U1DA 4CHUA 3BY6A 1X58A 3IHUA 2GOXB 1FVJA 5ELAA 1CQHA 5CRHA 1BJAA 2V6EA 3TRXA
chains in the Genus database with same CATH topology
4IW9A 3QFBC 4G0KA 1TRUA 2H1GA 3ZCOA 1FB0A 4TR1B 3MKYB 4V2MA 2KZVA 3HCZA 4MJAA 2GT6A 4KSMA 2OE1A 5FRNA 3WGXA 2Z2SB 1TU7A 2ZXHA 3I3LA 2CQ9A 4YRVA 1MNDA 1K3LA 2HFDA 5G2ZA 2FUG2 3QYBA 3OIPA 2J23A 4ECCA 3DMLA 4CH7A 4IQ1A 4E8EA 2B5XA 2P0WA 4B3XA 1JZRA 3FY7A 2H75A 2I4AA 4MNNA 3OS1A 4ZDPA 3KX2A 22GSA 2E7PA 4K8MA 5HNHA 4XN3A 1JI8A 3A2KA 2L5LA 1D1AA 4NHZA 5ECQB 2XF6A 1X5CA 2V6KA 5HR3A 2ON5A 1JLVA 4FYUA 1T1VA 3QMXA 2OJLA 3L2WA 5LD0A 4N10A 5JCWA 1YKAA 3CYNA 5ECNB 1A0FA 3ED3A 2V32A 1TDIA 5AIVA 2IS4A 3DKSA 4AF2A 4CCMA 1MD4A 2CZ3A 2ZFUA 2JL4A 2AB6A 3ERWA 2WGRA 5CQEA 5DQYA 4J00A 2KRCA 4LG3A 2ZUPA 3FYGA 4Z2TA 4DBRA 3PGTA 2KDOA 2HZFA 3OYKA 5CAXA 4BEHA 5DVBA 4HEA2 2KUCA 4KDXA 1NG6A 1XIYA 3FEUA 3PSIA 2CV2A 2CAIA 4NV5A 3DPTA 1O81A 4IQ4A 2JACA 3K4KA 3ZITA 4D9JA 3ERGA 1V57A 4RLQA 1GH2A 1WOUA 4LIUA 4QPOA 3P90A 2L5OA 3VWVA 3L9UA 4TKYA 2VOCA 4F55A 3W2WA 3CBUA 1M99A 4IP1A 4NMUA 4NXIA 3F9UA 1M2BA 2BOLA 3HJOA 1GTUA 4CY8A 4GQFA 6GSVA 1Z3YA 4XS1A 5G5EA 1UG0A 3QDNA 1SAUA 4X1UA 3LSKA 4WKWA 5A4VA 4K7OA 4NUBA 4PXOA 5DDLA 4PGTA 4IHUA 1PMTA 2BMXA 3CRUA 1YEPA 3ERFA 2AJQB 2M3AA 2H1BA 3LSHA 5IMCA 1U6TA 3CTFA 2H66A 1SK0A 2HLSA 2VLUA 1GTBA 4C30A 1SK2A 2HI7A 2GSRA 2F3MA 5IOXA 2VKHA 2KL4A 2AYTA 4Y3OA 3W8SA 3OYEA 3ZGKA 2O5RA 2EC4A 4PNFA 4WXTA 3LJRA 2WZ9A 3D5RC 4FIWA 4BDZA 4TR0A 2VL3A 1TI1A 3DTEA 2KHPA 4K5SA 4C2TA 3CESA 1Q4JA 2UZ8A 5LD2C 5D9VA 4O92A 4ZDLA 5DAKB 4HSRA 1BR2A 2JSPA 3SDBA 8GSSA 1WMJA 2PWJA