3IAM2

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
179
structure length
179
Chain Sequence
GFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NADH-quinone oxidoreductase subunit 1
total genus 44
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3iam201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3iam202
5ID2B 1T4YA 2V41A 4ILFA 2E7PA 3IRAA 1GSEA 2BJXA 3HXSA 3QFBC 1ZOFA 1Z9HA 4OD7A 1F9MA 4BWQA 4OCEA 3KM6A 5KN2A 1EEJA 2P5RA 2IN3A 1J08A 4FH8A 4RQXA 1SK0A 3BJ5A 3Q18A 3QOUA 3M9KA 3IOSA 5HR3A 2LJKA 3FYGA 1TRUA 5ECIB 2RM6A 3EMXA 1GLQA 3HVXA 4OFMA 1TK0B 2TRXA 1PL2A 2FWHA 2JSZA 3CMIA 2L57A 4MZWA 4G9HA 1WRYA 1J9BA 3QAVA 1PSQA 2O8VB 5D9VA 2VLVA 2FUG2 3HDCA 5CRWA 2G0FA 4HS1A 3VWUA 1N8JA 4GXZA 1XW9A 3MSZA 4K2DA 3APOA 2V1MA 2AHEA 5ID2A 4J2FA 4GWRA 1U3AA 2FA8A 1GTBA 1TI3A 3C8EA 1GTIA 2R6KA 1ZCPA 1JFUA 1SL0B 3CSIA 4FYCA 1A0RP 2R5GA 1XOBA 1R4WA 2IMFA 4L5OA 4GQCA 4IKHA 4TRXA 5HR0A 3KP8A 5ELAA 1JLVA 4RQRA 2C1YA 3EU4A 2GQMA 2RIIA 3ZL5A 2JZRA 4POMA 4V2MA 3QD9A 4L0UA 4Z7XA 4ML1A 2IMDA 1IYIA 3D22A 3WGDA 5DCGA 3VURA 1O85A 2H6XA 3P7XA 8GSSA 2AB6A 5D9XA 5ECKB 1H4OA 1I9DA 1WPIA 5CREA 3GMFA 4MABA 3FY7A 4WBRD 5ECRB 2XPDA 4L8EA 4TR1A 2DJ0A 1MDIA 2JZTA 1VF2A 4JBBA 1SJIA 4GSNA 4E8EA 3QPMA 4MH3A 4TXOB 5IM9A 1X9WB 3GH9A 2B5YA 1K0DA 4LLRA 2HSHA 1T1VA 2IMKA 3S9FA 5F06A 2YN1A 1X0RA 2O87A 2J23A 3GX0A 4MH2A 2OADA 1MEKA 3IA1A 4ZBBA 3A3TA 2FCHA 2YJHA 1QGVA 3D0ZA 4CHSA 2VCTA 3V1WA 2CVDA 5H5QA 4OFNA 4IBPA 3RPNA 2OBIA 2KLXA 2KOKA 2C3TA 4QL9A 1XVQA 4ECJA 4K8MA 3TJBA 2P0GA 1ZYQB 1Y6EA 1PKZA 1YDKA 1SJZA 1YQ1A 4HJ2A 3BCKA 1VRSD 3TJFA 2CA8A 3W8JA 4GF0A 3J7Yk 1EEMA 5F05A 4GCIA 5EL8A 4OO5A 2HT9A 2L4QA 4KH7A 1ON4A 4V2NA 2YV7A 2N5FA 2R3XA 4K0NA 3TDGA 3EINA 1YEXA 3DIEA 6GSYA 3W8SA 3KCMA 3U5RE 1DE1A 2H74A 1R5AA 2DJ2A 2FNOA 3LXTA 1PRXA 2PMTA 1PMTA 3O6TA 1ERTA 3KTLA 4ACSA 1DSBA 2LQQA 2AJQB 2DLXA 4LL1B 2MMAA 5D9TA 5H5SA 1SK1A 1MD3A 3TKSC 4ZB8A 4F0BA 2GSTA 1TW9A 1YKAA 4QQ7A 4NHWA 2AV4A 2DJ1A 3GUSA 3KH7A 2Z9SA 5AISA 4DSRA 4DEJA 1A8YA 3F3RA 4IN0A 1ABAA 1S3DA 2N5BA 1F3BA 4YQVA 1B9XC 1M99A 1HYUA 1U87A 2B5XA 5IO0A 3M8NA 1RW1A 3C71A 2CVBA 2WRTA 5B6NA 3ME7A 3UVHA 2LUSA 3TJKA 5GAPD 4TR1B 3TJJA 2QKEA 2WJUA 4QL7A 1EV4A 3I6AA 4EKZA 1VF3A 4G19A 2CV4A 3KH9A 2C0FA 1DUGA 2IMEA 4PQ1A 1ZMAA 4ML6A 2HFDA 2C3QA 2VLUA 3K8NA 2WS2A 1URMA 2CAIA 2VAFA 1VF1A 4WBJA 4JR6A 4FO5A 4DSQA 1A2LA 1K0BA 3L9VA 2X8GA 5FWGA 3QCPA 3KXOA 1WWJA 2NDOA 4TKYA 4KSMA 1UVZA 2KHPA 2H70A 4MZCA 4TXOA 1XVWA 1E6BA 3IR4A 4IS0A 1AAZA 2C80A 2YP6A 2VL9A 2EIOA 3DMLA 3LFLA 3CTGA 4PQHA 2GTUA 4ZL9A 5DJMA 1YF1A 2HZEA 5ECMB 3ZFLA 3U6VA 3JCML 2RUFA 2F3MA 3LYKA 4AF2A 2WCIA 2DMMA 10GSA 5ECPB 2KP1A 4GSTA 3DYRA 4KCEA 1EZKA 3FZAA 1GULA 3Q6OA 1XOAA 5D9WA 5COHA 3R2QA 3F4TA 4HQSA 4LA1A 3LGCA 1K3OA 4EO3A 1XCCA 4ECBA 2C0DA 2HE3A 2F8AA 5F0GA 1BEDA 3A2WA 5J9CA 1XZOA 4EL1A 1FG4A 3DGQA 5DQYA 3DKSA 3LJRA 2LQOA 4NPBA 1GSUA 1V9WA 1ZGNA 3E0UA 5JWOB 1QFNA 4RI7A 1M0UA 3EYTA 1ILOA 4HEA2 1ERWA 5INYA 2B7KA 1JLWA 2R37A 4NHZA 1GWCA 3I9V2 4N0VA 4IQ1A 5IPGA 5G5FA 2WFCA 3UJ1A 1O73A 3RPPA 2KUCA 4LMWA 2RUEA 2HZEB 1USBA 2HRFA 4ZIJA 1X9SB 4YQMA 3EC3A 3HD5A 1LJRA 4MDCA 3PGTA 5JCUA 1TU8A 4H86A 2L6DA 2RM5A 1AC1A 1WIKA 1K3LA 2ALBA 1HNCA 4ID0A 3FKFA 3GKMA 4HDEA 3TKSE 3UBLA 2E2MA 4KDYA 5C00A 2LKUA 4ISDA 2YOIA 4HJMA 5FT3A 2GVPA 2HNLA 2LJAA 3TGZA 4XIHA 2BTOT 1PQNA 4ZBDA 4ZL8A 1FAAA 4IP1A 4G2EA 5D8IA 4KA0A 2E2GA 3F6FA 1SENA 3TKSA 1X5EA 1YF0A 5ECLB 3Q19A 1X5CA 2ZUPA 1PX6A 2GLRA 5IMFA 4GSSA 3GV1A 1OKTA 1B48A 4EDZA 1MDJA 2TIRA 2VM2A 2I9HA 1SKRB 2GQKA 4PX1A 1YY7A 4K9ZA 5J4UA 1PN9A 19GSA 1XW5A 1NHOA 3D4TA 3EURA 2C8UA 2N5AA 2DBCA 1F2EA 3I43A 6GSWA 4KE3A 3TOTA 3IAS2 1TU7A 3WYWA 4I97A 4PUFC 2MMNA 3C73A 2H1BA 1UC7A 2H6ZA 1JZRA 4G10A 1T00A 2CQ9A 3GFKA 1SL1B 3QR6A 5DBQA 3TCOA 4OO4A 1THXA 2EIRA 2DJKA 1T3BA 2GSSA 4BVXA 1XWKA 3NIVA 1U6TA 1MD4A 1T7PB 1O8WA 4K7OA 3G7IA 4LMVA 2LS5A 4PNFA 1VF4A 3FZ4A 16GSA 2QSIA 4ULXA 4Q5QA 2F51A 1KTEA 5IMDA 3FZ5A 5CO3A 2LTKA 5ENUA 2X8CA 1M2DA 1RK4A 4KAEA 3KMOA 4K6XA 1XIYA 2NBSA 4KX4A 3DVWA 3KD0A 2JADA 1THOA 2DJ3A 3TKQA 4MZBA 2PERA 1JHBA 3ZIVA 4DVCA 4XRAA 2YV9A 2EC4A 2EIQA 5J41A 1ACVA 2H76A 1FB6A 4WR5A 2XBQA 3VPQA 3VLNA 3PH9A 1ST9A 3FR6A 1A2JA 2FHEA 1GSYA 2YJ7A 2YANA 4NAXA 4WF5A 5IOXA 4HOJA 1B9YC 3IAM2 1XXUA 2LRCA 4KNDA 4RUVA 3HJPA 1EGRA 2MYGA 5E59A 4X0XA 4GQFA 4I6XA 3GSSA 3RAZA 2RLIA 5HFIA 1LBKA 1GSSA 3BOAA 4J57E 4O92A 2H72A 3H93A 2WZ9A 4PXOA 3ED3A 2HYXA 3NZNA 2YZHA 2NVLA 1F3AA 2OJLA 5F8BA 4MJAA 3EVIA 5H5RA 4BWSA 1V58A 1G7OA 2PU9C 5DAKA 1FOVA 1TRWA 1MDKA 5L71A 1XFLA 4X1UA 3TKPA 4ZL7A 1JZWA 4KDXA 1JZDA 4F0CA 4EC0A 3VWXA 1OE8A 3O76A 1J0FA 2B3SA 2H1AA 1HQOA 4J56E 3LWAA 2GQLA 2HI7A 5ABRA 1GSQA 3QDNA 3GHAA 3F4RA 4HUAA 1X9MB 2PVQA 4MLYA 2V2GA 1R7HA 1GL8A 1T8EB 1XPVA 3J7Yb 2ZCTA 1W4VA 5HFKA 1AQXA 2DIZA 3GN3A 3FEUA 4ECCA 2VLTA 22GSA 5CYYA 4MP4A 1KEBA 2VO4A 1AW9A 1AXDA 5CNWA 1SD8A 2H0IA 4DSSA 2PN8A 1F6MC 2R2JA 4XTSA 2B1LA 2I4AA 1R5PA 3GTUA 4WEYA 5A4WA 5IIZA 6GSUA 2VCQA 3LQ7A 3HKRA 3L9UA 2O89A 2JSYA 1OE7A 4FIWA 2LRTA 4L5LA 5J5NA 3QFAC 1FW1A 1EGOA 3HZ8A 2IMIA 5JCGA 4F9ZA 3LEFA 1GH2A 4JEDA 2PWJA 3MWHA 1V98A 5ELGA 1OC8A 1QK8A 1M2AA 2PGTA 5AN1A 4D73B 4HZ4A 3C7MA 4MJBA 1FO5A 3P8WA 4F2IA 2WB9A 3DD3A 3UIWA 20GSA 1S3CA 4EVMA 5LNKe 1Z6MA 2GGTA 1N2AA 1XWBA 5JWQB 1PGTA 2VL3A 3BD2A 4MPFA 3TRXA 1BX9A 3P90A 2XPEA 4K0GA 1TP9A 4JU5A 4TN8A 4MPGA 4JE1A 1K0CA 4K7IA 4POLA 2X64A 1CQHA 3A5WA 1V2AA 4XS1A 3ZMLA 3CRUA 1NM3A 3WT2A 2DJJA 4XS4A 3RDWA 3E3EA 5A4VA 3LXZA 1OC9B 5CP1A 5IO2A 3GKNA 2OA7A 4BPYA 1OC9A 1R26A 1EWXA 4MJCA 1GSFA 4Q5NA 4YH2A 2H0HA 2K18A 4K7NA 1FB0A 3BBYA 4BL7A 1BG5A 2ZNMA 1SKWB 3HY2A 1GTAA 5GSTA 2HRNA 4IQAA 3GIXA 4X43A 1SD9A 2YWIA 2TRCP 3ERFA 2DSAA 3HJOA 2K6VA 1YEPA 2FY6A 4O5RA 4WETA 3W6GA 5J9BA 5KN0A 5EPFA 1WP0A 3D5JA 3FHKA 3OR5A 2O7KA 5GSSA 1Q98A 1H75A 2GZPA 3TRQA 5A5KA 5CRDA 2GSQA 4I8BA 5HR1A 1Z7PA 4TR0A 2JZSA 2GZYA 4I2TA 1Z3EA 3EWLA 3GX8A 1TRVA 4MF7A 3CRTA 5DALA 2ES7A 1MTCA 4EF0A 4KB3A 2H19A 2IIYA 4KW6A 4TVEA 4AGSA 2KP2A 5IQYA 2FWGA 1O6JA 5JWRB 3UVTA 1TKDB 2LSTA 7GSSA 3HYPA 2K8SA 2VCXA 4KSOA 2OE0A 1EP8A 2VOCA 1FVKA 5CAXA 4MF5A 1CQGA 1UN2A 4ZBAA 3LYPA 2H01A 2CX4A 2A2RA 3TUEA 5IMCA 3H79A 4GLTA 2VCWA 3DRNA 3ZRDA 3WT1A 4POKA 3VPTA 1AUCA 3TJGA 3GURA 1Z6NA 1GRXA 4WXTA 3TOUA 1RQMA 4BVYA 4DSSB 1G7EA 1NHYA 3ZVJD 5AGYA 3A2XA 2O85A 2XBIA 5G1LA 3F0IA 1TJDA 3DEXA 2CZ2A 1B8XA 1TRSA 1NSWA 1IYHA 2B5EA 5AIXA 5EY6A 3IBHA 1SU9A 4YAPA 2WDUA 4HQZA 3UBKA 3GTUB 4AJ6A 3F63A 2IFQB 1HNBA 3ZVJA 4MK3A 1OC3A 5G1KA 4PQIA 4IJIA 3C1RA 2OE3A 2BMXA 2YWMA 5DCHA 12GSA 5DAKB 5FHIA 4EUYA 5G5EA 4E8HA 4ZB6A 2MZCA 3ISOA 1C72A 4IVFA 3M3MA 1DE2A 5LCZA 4IGJA 1HNAA 3GNJA 4XHMA 1GUKA 1EOGA 5HFGA 2GZZA 1OVNA 4ZB9A 3MNGA 1QXHA 5ECOB 3UAPA 3GH6A 4XS6A 3KMNA 2NPBA 2X99A 2FGXA 1B4PA 3US3A 4KGIA 3GKXA 3HVVA 2LNSA 2IFQA 2LRNA 3F4SA 1Y25A 5ECQB 2MBTA 2DC5A 1GLPA 1BYEA 1ZYEA 4KDUA 5GZZB 2VUPA 2J9HA 1PD21 3LORA 2CAQA 3IK7A 3N9JA 3HZ4A 3ZITA 5D93A 5B8BA 1FHEA 1A0FA 1QMVA 3ZLPA 2C3NA 3HHVA 5F07A 2ON5A 3WGEA 2VD1A 2F9SA 1WJKA 1A24A 4IJ3A 2XHFA 2MBSA 1F37A 2HZFA 4MA9A 5DJLA 3CYNA 2M72A 2P31A 5GAND 2H71A 1OAZA 1XW6A 4NXIA 1VGLA 4V2LA 1K0AA 2CT6A 4HU9A 4BA7A 2HSYA 2ON7A 4YQUA 3EE2A 2E0QA 3RHBA 3WGXA 3ERWA 5CRGA 3HVSA 6GSTA 1G6WA 1T4ZA 2DMLA 3GRXA 4AJ8A 2L4CA 4IELA 1GNEA 1HD2A 4V1Ap 2FA4A 3FZ9A 2C0GA 1SK2A 2V6OA 4OFTA 2VL2A 4CDOA 3UEMA 1V40A 4O32A 3FW2A 1SYXA 2MMOA 2VM1A 3FRCA 2AAWA 3D6IA 2FD3A 3L4NA 1AQWA 3M9JA 3ME8A 2C4JA 3VWVA 1TOFA 4JRRA 4NWYA 3QAGA 2LJRA 3SBCA 1WOUA 4POBA 3VI5A 4N0ZA 5IOWA 3ZIJA 3ZFBA 1A2MA 3DWVA 3N5OA 1JZOA 2YWOA 4WF4A 2IJYA 3EU3A 1V57A 3MDKA 4PGTA 4JR4A 1SJ6A 2H75A 3CBUA 4PURA 4TW5A 18GSA 4N30A 1S3AA 4I2UA 3F8UA 1SKSB 2A2SA 1EP7A 3AY8A 1K3YA 2I1UA 3PR8A 3APQA 3KEBA 2X8HA 4OCFA 2H8LA 3I69A 2VL2C 3CTFA 4EDYA 2AYTA 2GSRA 4TXVA 4ECIA 4OWYA 5J3RA 3KP9A 3ERGA 4YAVA 4XS4B 1AQVA 4WKWA 3UOMA 1EV9A 4F03A 4FYUA 3L9SA 1BQ7A 2H66A 3GL5A 5DDLA 2VIMA 1ML6A 2H1GA 3WD6A 3CSHA 2XC2A 3IDVA 3ZYWA 5D73A 1GNWA 5A4UA 3TB2A 1YJ6A 3IV4A 2H30A 5IPHA 3IC4A 2OBKA 5ECNB 1WE0A 4NV2A 1KNGA 2FWEA 1X5DA 3FR3A 2JU5A 4TR3A 1BAYA 4Q5RA 1ZL9A 2WGRA 1G6YA 3HCZA 5B8AA 1M9BA 5HR2A 5EVOA 1Z7RA 1TXXA 5DQSA 1I5GA 1ZZYA 2B6MA 1UA5A 3G9BA 3KIJA 3GKKA 2QGVA 2V6KA 1G0TA 2MMZA 3IK9A 2HXKA 1PA3A 1U3IA 2A4VA 4JZQA 3L0HA 3VWWA 3F3QA 3RBTA 2H73A 2P5QA 3SWLA 1FVJA 5G30A 5DVBA 1W89A 3GA4A 4HU7A 2JACA 4N10A 3VK9A 4IP6A 2VCZA 2H1DA 3ZTLA 9GSSA 1YKCA 5B6MA 1AIUA 4D73A 2REMA 1KBNA 1E2YA 1B4QA 3CSJA 2VD0A 6GSVA 2OE1A 3QMXA 2M80A 3KGKA 3KZQA 5G31A 3MAKA 2L59A 2F8FA 3F9UA 1NW2A 1LU4A 1M9AA 2M46A 1WMJA 2YCDA 2CZ3A 3IE3A 5AIVA 2GDRA 3A2VA 3HA9A 2YPMA 4WR4A 3D4MA 11GSA 5JCWA 2DIYA 3GSTA 1Z5YE 2GT5A 1O81A 2GS3A 4EE0A 1YZXA 4AJ7A 1XBSA 2B7JA 3UMAA 3UARA 2K9FA 2PUKC 1U88A 5HQPA 4F82A 2IPAA 4XCSA 5IMZA 1SL2B 2YZUA 1TK5B 2VCVA 1ERVA 2IL3A 2K8VA 4CW9A 3LSZA 4KCAA 2QC7A 3O3TA 3M1GA 5E4WA 4IHUA 3VFIA 4TR4A 3E9JB 4HI7A 4GRFA 4K1FA 1QUWA 3PINA 3IPZA 1PX7A 5B7CA 2CVKA 5G2ZA 3BCIA 3TKRA 3QAWA 2L5LA 1A8LA 2FLSA 3FK8A 4PNGA 1GTUA 13GSA 4O7HA 2LNTA 4HZ2A 5KN3A 3DVXA 6GSXA 1QQ2A 2D2ZA 2LV3A 3CXGA 2C0EA 1SYRA 5ECHB 1XWAA 4Q5FA 3TRPA 3G7YA 3ZMKA 2PPTA 2IWTA 1GP1A 1TDIA 3NOFA 4RI6A 5D96A 1TI1A 4GTUA 1EOHA 4N11A 4MMMA 5IMVA 3HJMA 4MF6A 3ZZXA 5KEJA 1K0OA 3D21A 1O7UA 3UL3A 3G7JA 2NTOA 3RHCA 3IHQA 2GT6A 2CX3A 2HLSA 1GUMA 3KTBA 3IXRA 3DXBA 2L5OA 2G2QA 5CRHA 4NMUA 4IW9A 2I3YA 2LEGA 3H8QA 3H4KA 3KJYA 4EXJA 1OYJA 4ZILA 3Q74A 3LG6A 3VI7A 3GYKA 1OKDA 2B1KA 6GSSA 2PBJA 4OMVA 14GSA 4MJEA 2FWFA 3C1SA 4FYBA 1TTZA 17GSA 1XWGA 2H6YA 1M2BA 3ZREA 1K0NA 4MCUA 5C04A 1M7TA 3FR9A 5IMAA 1A23A 2L6CA 2YNXA 2I81A 5KN1A 1ERUA 3F6DA 2R4VA 4I5QA 2OKAA 4ZXGA 1PKWA 1Q4JA 1O8XA 2JL4A 1PL1A 3H1NA 4TOPA 4KUNA 2YWNA 1BJXA 4XRDA 3GL3A 1GSDA 2AUVA 1XWCA 1DBYA 4PUAA 3APSA 3L78A 1TK8B 5LD0A 1K0MA 3P2AA 5DALB 3M0FA 3EMPA 5ECSA 1GUHA 4L0WA 4V1Ag 2OACA 4NV5A 2WULA 2H0GA 2V32A 4P3YB 4LL4B 2PVOC
chains in the Genus database with same CATH superfamily
2LF8A 2BW3B 1T4YA 5ID2B 3H9QA 2V41A 2EPFA 4ILFA 5FRMA 4BY1J 1D8JA 3K6GA 4PTSA 1WQ2A 2E7PA 2ZJQF 2A6EF 1GSEA 4A3BJ 2BJXA 1W0TA 3HXSA 3IRAA 1RKWA 4BNCA 1Z9HA 2XKPA 1QVTA 2DMUA 3FK7A 1ZOFA 3ZQQA 1F9MA 1R58A 4OD7A 1MNDA 4BWQA 4OCEA 3LA7A 1KZHA 2EZHA 3KM6A 2YPRA 5KN2A 2CGPA 1M1EB 1EEJA 2LLKA 2CO5A 1WH7A 5CVJA 5J3LA 2DFEA 2X6YA 2P5RA 2IW5A 2JK3A 2DW4A 1P4XA 1R22A 1J08A 2IN3A 1TBXA 3LQQA 2EJRA 4FH8A 5DD4A 2DA6A 1OFCX 2YX7A 3SZGA 5JHUA 1SK0A 4RQXA 3BJ5A 1J75A 3Q18A 1BN5A 4HLXA 2VT3A 3RQIA 4EJUA 5M3MJ 2O6GE 3M9KA 3QOUA 1WHUA 3J7YJ 3CD6I 2EIKH 2MC4A 3IOSA 3IC7A 3RSNA 4F3QA 5HR3A 4BH9A 1FOWA 3A4CA 4V2GA 3HOTA 2R7XA 2VUMJ 2LJKA 3FYGA 1MMAA 3P7NA 5LGUA 1TRUA 2RM6A 5ECIB 3EMXA 1FIAA 5GTHC 1GLQA 3HVXA 4ZZDA 3E6MA 2JZYA 4OFMA 1TK0B 2TRXA 5J8CA 2KRCA 1HA8A 2MYSA 1B9NA 2D45A 2R7VA 1E17A 4A3CJ 3Q5FA 1PL2A 2FWHA 2UZ8A 3AL0B 4S05A 2JSZA 1WJAA 4M6VA 3ELKA 3MZ8A 2DQRA 1HW2A 3CMIA 4P96A 2L57A 1UB9A 2P81A 4G9HA 4MZWA 3E3VA 1DU6A 1WJDA 2GA2A 1WRYA 1J9BA 3QAVA 1PSQA 2O8VB 5HDGA 5D9VA 4EIPA 4PUSA 2VLVA 4MTEA 2BY2A 2FUG2 2WADA 3V8KA 1GT0C 1K4SA 1H8AC 3DEEA 3HDCA 5CRWA 2PQ8A 1HLVA 2XAQA 2G0FA 3S1RJ 1O4XA 4HS1A 3VWUA 1N8JA 4GXZA 1XW9A 3HSRA 3Q9VA 3MSZA 1ODDA 4IKFA 1J7KA 3CUQB 4K2DA 2DAOA 3MN2A 3APOA 2V1MA 1Z21A 2AHEA 1JGSA 2BW3A 1RKTA 4I76A 4RAFA 5ID2A 2QQAA 1I5ZA 1MMDA 1GUUA 3BT9A 4J2FA 4XRFA 4UUSB 2XAGA 4GWRA 1U3AA 1OKRA 3TQNA 2A6HF 2FA8A 3Q0UA 3CJQB 1JT6A 3DV8A 4PFOA 5KCMA 4IOAF 1GTBA 1TI3A 3C8EA 4A5MA 3ZMVA 1GTIA 4MNNA 1MGTA 4V2MA 2R6KA 2WB1A 1F36A 2K85A 3K4MA 3LMMA 1FMVA 4CGZA 5CVUA 5DDGA 1ZCPA 1JFUA 1ETYA 1QQIA 1SL0B 4KJZA 5KK1A 3CSIA 3CUQC 4FYCA 1T38A 3HXLA 4M72A 2CW0F 3GX4X 1A0RP 1TNTA 5CKTA 1QZZA 1XOBA 2R5GA 1R4WA 2IMFA 4OIQF 4L5OA 4GQCA 1ZREA 3JSOA 1KU2A 2DMTA 4IKHA 4TRXA 4BXFA 2IS2A 3PM1A 1LFUP 4TV7A 4LB5A 1SD7A 5HR0A 1WVRA 4CZCA 3KP8A 3CMEI 3RQ4A 4XKVA 2DMQA 1PVEA 2DTRA 3FMQA 2VE8A 5ELAA 1TW3A 5K1YA 3F3XA 1R49A 3HDDA 3KP5A 1JLVA 4H86A 3BZ6A 1KU9A 1I6HJ 4RQRA 2C1YA 3EU4A 3DBLB 2GQMA 2RIIA 3ZL5A 3NEUA 2JZRA 4POMA 2XF7A 2WB1N 2ZXJA 3WU1B 3ZQIA 3QD9A 4L0UA 4G6TB 2R7QA 4Z7XA 4HQEA 5ED4A 5DV5A 1JKOC 2GXGA 4ML1A 4FHTA 4L5JA 2IMDA 1IYIA 3D22A 3WGDA 5DCGA 2LYCA 3P5JA 3QYEA 2E1CA 3VURA 3ZRGA 1O85A 2H6XA 1Z6TA 2Q1ZB 4HQMA 4XLCA 2AB6A 3P7XA 8GSSA 4RLQA 5F6FA 2XKOA 5D9XA 5ECKB 2Z16A 2ZJ2A 1H4OA 2FBKA 1I9DA 1B8IA 1XGNA 3L00A 1WPIA 5CREA 1FY7A 4OMZA 1I3QJ 3I4PA 3GMFA 4BQOA 2ZMEB 5B3SH 2VOPA 4MABA 4CO8A 3B73A 4X6AJ 3FY7A 2XGDA 2NXNB 4WBRD 4IRHA 5ECRB 2XPDA 5F27A 1TWHJ 2VPLA 4I7HA 4L8EA 2KJCA 3OS0A 2B0LA 2JA6J 2RNGA 3RPQA 4K5RA 1UZCA 4TR1A 2M9HA 4A3GJ 1K78A 1NTCA 2KKOA 3PFIA 3MD2A 2DJ0A 4DOZA 1X3WB 3C2GA 1ZR4A 1MDIA 3K1NA 2JZTA 5AIPA 3GEZA 5GTIC 1VF2A 4JBBA 3H3ZA 2V1NA 4Q5SF 2JWTA 4KDPA 1SJIA 2DDBA 4GSNA 2F2EA 3WE3A 2RKHA 3BZCA 2HNHA 4E8EA 1SL2B 3QPMA 4MH3A 5KAFC 4TXOB 5IM9A 1X9WB 3RDIA 1EKEA 1S9HA 2DA5A 3FXOA 3BJOA 3HJEA 3GFJA 3GH9A 1IRFA 2EH3A 4KA4A 5BOXA 4KFCA 2B5YA 2WY7Q 2CUJA 3MMYB 3NRVA 4A5NA 1K0DA 5J6XA 4XORA 4LLRA 4ENMA 2HSHA 1T1VA 4EATA 2IMKA 3S9FA 5F06A 1VNDA 2YN1A 1X0RA 3OYFA 2O87A 3ISPA 2J23A 2FF4A 1V3FA 4BJTA 4RGRA 4B3AA 1P2FA 2QBYA 5J4YA 2OU2A 2PEXA 3FXQA 2HFHA 3GX0A 3V8JA 4MH2A 3AKZA 4JYKA 1B4AA 2Z1DA 3AG4H 2OADA 4JK1X 4D1QA 2DU9A 1MEKA 2L3DA 3IA1A 4ZBBA 3FF5A 3A3TA 2FCHA 2YJHA 1QGVA 3D0ZA 2BXZA 2VCTA 4CHSA 3V1WA 2CVDA 1VQMI 2D2WA 4OFNA 4A93J 3RTRA 4IBPA 4EJTA 3P9CA 2ZSIB 4WXDA 1XG1A 3RPNA 4D5CA 2OBIA 3S2WA 3JSPA 3GYHX 1I1SA 4O5QA 1YW9A 4G7HF 2CQ7A 3P9IA 4N4OB 2KLXA 2KOKA 1LUJB 1E2XA 2HQRA 2C3TA 4CCKA 2X49A 1WGXA 5E18F 2V9PA 3G1MA 2EV5A 5LGNA 5HDKA 4QL9A 4ON0A 4C2TA 1XVQA 4ECJA 3PSIA 1WJFA 4D7MA 4K8MA 1UELB 2A07F 3RIRA 3F6VA 2OAZA 3ULQB 3TJBA 1ENHA 2P0GA 4HZFA 1Y6EA 1ZYQB 2HDWA 3TDUC 1ACIA 4HYEA 1PKZA 2LTPA 1YDKA 4K2XA 2MH2A 1SJZA 1YQ1A 4M3FA 5FD6A 4HJ2A 2JSCA 3HBLA 1VRSD 3BCKA 1BI3A 1X2MA 1WPKA 1X58A 1VQ8I 3TJFA 4GDFA 2CA8A 3W8JA 4GF0A 3J7Yk 2M3AA 1EEMA 1E3PA 2PMHA 5LLQA 4GCIA 5F05A 5EL8A 3W2WA 4OO5A 2CJJA 2HT9A 2B7EA 5BNGA 2L4QA 3PNYA 4KH7A 2STWA 1ON4A 4V2NA 3RPUA 2CRGA 5GPAA 2YV7A 2N5FA 5ICCA 2R3XA 3IRQA 3ABMH 2TCTA 1PJRA 4A3IJ 4K0NA 3TDGA 2NS7A 1FZPB 3EINA 1UFMA 2IAIA 4II3A 4CCOA 3BCAA 1EF4A 2QQBA 1YEXA 3DIEA 4L9TA 4ANJA 1CF7A 6GSYA 3W8SA 1G8XA 1YW8A 1FSHA 3KCMA 3U5RE 1G3YA 1W7PD 3BR2A 3A01B 4DVCA 3KP2A 1DE1A 3UR3C 4LIUA 1Z9CA 2H74A 3S93A 2DK5A 1R5AA 3NQOA 1ETKA 2HVSA 2DJ2A 2DMNA 1JKPC 3BQZA 2FNOA 3LXTA 1PRXA 3MQ0A 4BYYA 3D5RC 2PMTA 3T8RA 4EGYA 1PMTA 2IGNA 2JA2A 5LRSA 3O6TA 1ERTA 3KTLA 4HW0A 3BDDA 3JRAA 3ONQA 2QKMB 3QPHA 4QSHA 1U8BA 1DSBA 5F1JA 3QPTA 2QENA 3IKVA 2HSMA 2LQQA 2H27A 2V7FA 5M5XJ 4CCLA 3VOEA 1GDTA 2DLXA 4M9SA 2K40A 2MMAA 4LL1B 5D9TA 2AJQB 4UHTA 4KNYA 5H5SA 1FT9A 3ZMSA 1SK1A 1S3JA 1QBJA 2QZ8A 1MD3A 2ESNA 4BAYA 2DDAA 5D8LB 4ZB8A 3TKSC 4F0BA 5D5WB 1NH3A 5C3EJ 2GSTA 1TW9A 1YKAA 4QQ7A 1YQAA 4NHWA 2AQFA 4IXAA 3TW6A 1MDMB 4PJJA 2AV4A 1G3SA 2DJ1A 4AYBN 1Z05A 4IPAA 3G1LA 4LLNA 5E1XA 3E6DA 3GUSA 3KH7A 2Z9SA 2DBBA 2ZBKA 3WGGA 3TO7A 5H6QA 5AISA 3DXJF 3TO9A 4J01A 4DSRA 3F8MA 4BGDA 5HLHA 2DPDA 4DEJA 1UCRA 3OS1A 1A8YA 1D8KA 3W6KB 1QVUA 2GAUA 3A01A 2K9NA 3F3RA 1YO5C 3J7AO 4IN0A 1ABAA 3SXYA 2O7OA 1S3DA 1WKMA 5D5XB 4CDGA 2N5BA 4PSXA 1EJ9A 4KMFA 1F3BA 3EPTA 2M5WA 1B9XC 4YQVA 3VYUB 1HSJA 5E1WA 1M99A 4OAYA 2BE5F 1HYUA 4HX7A 2CWEA 1XGOA 4MHGA 3V42A 3JRIA 2LD5A 5J1UA 1U87A 2OCCH 3WU0A 2B5XA 3BG5A 4G9YA 3TDZC 3J80K 1L0OC 4B1RA 1O3TA 3VYTB 1I3AA 1UG2A 4IW9A 3M8NA 5IO0A 2VXDA 1RW1A 3C71A 2DI3A 2CVBA 4N9HA 2KISA 2WRTA 3CTAA 5B6NA 4OIRF 3LA2A 3ME7A 3LOCA 1IRXA 1XCVA 2Q2EB 3I71A 2LUSA 2WBMA 3UVHA 4DBQA 3BPXA 3TJKA 5GAPD 3PIPF 1T0FC 4TR1B 3ZMUA 1S5LC 2QKEA 2WJUA 4QL7A 3TJJA 1EV4A 3I6AA 4EKZA 2WA0A 1JHFA 1VF3A 4G19A 2CV4A 2PJPA 3KH9A 4UVCA 5LEJA 1Z7UA 2F6CA 4L9JA 2BY1A 1DUGA 1HKQA 3CDIA 2C0FA 1ON2A 1N25A 2QEXI 2A4HA 5GAEJ 2M4GA 2IMEA 4LITA 3L2RA 1B8IB 3BZKA 3DLLF 4PQ1A 1ZMAA 4ML6A 2OQGA 2HFDA 2CUFA 2C3QA 2VLUA 3JCUC 1E3OC 3K8NA 4RB0A 4JX5A 3E6BA 2EFPA 2FE3A 1W4MA 2P7CB 2WS2A 3GLLA 2GBYA 3KEOA 4QWQA 5LHGA 2O8KA 5D8KB 3MZHA 1LFPA 1JXSA 1URMA 3IUOA 1EA3A 4UV8A 2X85A 1HXDA 2RDPA 3GZNB 3KZIC 4NHJA 2CAIA 1VF1A 2VAFA 4WBJA 1RESA 1T95A 3CF5F 3GTPJ 4FO5A 4JR6A 2XASA 4DSQA 1A2LA 1WJCA 5BMUA 2R7TA 3F22A 2OA4A 3ERMA 1K0BA 3L9VA 2X8GA 5FWGA 3QCPA 3KXOA 1WWJA 2NDOA 5EZHA 4TKYA 1X2NA 4KMUX 4KSMA 4BY7J 1UVZA 2KHPA 2H70A 3BR1A 1S7AA 3CQZJ 4MZCA 5DEQA 3GXOA 3QPLA 3T8TA 5E3MA 2P8TA 3FKJA 2XPVA 2CU7A 1VQPI 2YS9A 5BQTA 1XVWA 4TXOA 4LIVA 2JTVA 4MNUA 4XSZF 3CP8A 4I6ZA 1E6BA 3IR4A 4IS0A 1AAZA 2C80A 4DQ2A 2X6OA 5EGOB 4BDYA 1ETOA 2YP6A 3GLXA 2DJNA 3A02A 4CZZA 1XS9A 2VL9A 3MKZA 2FU4A 4PJ0C 5FLMJ 2EIOA 3DMLA 3LFLA 3CTGA 3CCYA 4PQHA 2GTUA 1K78B 4ZL9A 4BIKA 2RVCA 5DJMA 1YF1A 4XLEA 2DJIA 2H94A 2HZEA 5ECMB 4JQFA 2IT0A 3ZFLA 3U6VA 3P9KA 3JCML 3HC7A 2RUFA 2F3MA 3LYKA 4AF2A 2GIVA 4E7LA 5DD8A 1O3QA 2A6TA 1AA7A 2WCIA 2YUSA 2DMMA 4ZDPA 2XV4S 4HNVA 10GSA 1VQ6I 3DTKA 4MIMA 4XKWA 1U5TB 2LBFA 3L1PA 2KP1A 4GSTA 3REOA 5D5VB 3SEZA 1EH8A 1IRGA 1OISA 1OR7A 1ZYNA 3DYRA 2DA3A 4KCEA 2XF5A 2H09A 1EZKA 3FZAA 1ZARA 3KZZA 3LSHA 1GULA 3Q6OA 1XOAA 5D9WA 3K2AA 1BC7C 1FBUA 2FQ4A 3CP2A 1QA6A 1TT0A 4Q48A 3GTJJ 1VQ7I 3F4TA 3R2QA 4HQSA 5COHA 3A0BC 3ZQCA 4A3LJ 4LA1A 4A6DA 5FLXZ 3LGCA 1MBKA 2ZMEC 3ZQGA 2KIQA 1K3OA 4EM0B 3HRSA 2MC3A 2J5OA 3HTUA 5BPIA 4EO3A 3I64A 2EK5A 3HUGB 4FT8A 4E7ZA 1XCCA 2C0DA 2HE3A 4ECBA 2ESHA 3OOUA 2QM3A 2F8AA 5F0GA 2KFDA 3KYDB 4XM3A 1BEDA 1SD6A 4EEFG 3LSGA 4U0WA 3A2WA 1B1BA 1G3WA 3O8GA 5J9CA 5EEHA 4G94A 4IZZA 2CV2A 1E0EA 1XZOA 1X4OA 1A31A 2KRHA 4EL1A 1FG4A 3DGQA 5DQYA 3S3OA 3SQNA 3DKSA 3LJRA 2LQOA 2QSHX 4NPBA 1DQUA 3BC8A 2VKHA 1GSUA 1V9WA 3TO6A 3HM5A 3GZ6A 3VODA 3CC2I 1ZGNA 2OQRA 2NVXJ 4HSCX 2GLOA 1FP2A 4E7JA 1V55H 2DA7A 2R7SA 1QFNA 3E0UA 5JWOB 1YIOA 1VQ5I 4RI7A 3QYFA 5JHFA 1OYIA 1M0UA 1SVMA 3EYTA 4BL7B 5CVIA 1ILOA 2VPRA 4HEA2 3H92A 1ERWA 5INYA 4JX4A 4R1HA 3K70D 3G73A 2B7KA 2ZB9A 2HEOA 4RAGA 5ERIA 1JLWA 2HTJA 2R37A 4NHZA 3BTCA 3FBNB 1GWCA 1PN0A 3I9V2 4N0VA 4IQ1A 2KRFA 5EG0B 5AIQA 5G5FA 5IPGA 2E1OA 2WFCA 3KP4A 1R4NB 1MNMC 1USSA 3F8BA 4E7KA 3UJ1A 1HW5A 2HGCA 1O73A 3RPPA 2KUCA 4LMWA 2RUEA 2HZEB 1USBA 4Z2RA 2D1HA 3HVNA 1BOAA 5LHIA 4D5FA 2HRFA 4ZIJA 1X9SB 3ZMDA 3HOYJ 5F04A 2QA1A 4YQMA 3EC3A 3HD5A 1RR8C 1AKHA 3L2WA 1LJRA 5JR3A 4MDCA 1JT0A 4NQWA 4P9UA 3PGTA 2UXNA 5JCUA 2DT5A 4HLYA 1JUPA 1BR1A 1QNTA 4LOCA 1QZYA 5KAIC 4CCMA 4YIRX 2XAUA 3Q3SA 4Y17A 3F8FA 2L6DA 4HV5A 2VXZA 1GVJA 3CC7I 1FOXA 2RM5A 1AC1A 1Y1VJ 1WIKA 3QODA 1K3LA 3KP7A 1ZQ3P 2OZUA 2ALBA 3EUKL 1HNCA 3KIOA 5FO5A 4BDZA 2ECCA 3DU5A 4WCGA 4ID0A 3AFHA 2HVQA 3FKFA 3GKMA 3IHUA 1X1BA 4HDEA 3TKSE 3RKYA 3SDGA 2E2MA 4KDYA 5EG0A 5C00A 3UBLA 2LKUA 4DYQA 4ISDA 3WTSC 5HLIA 4IVNA 2I10A 1W7PA 3OYDA 2YOIA 4HJMA 3O8HA 5FT3A 2MA3A 3DEUA 1JJ8C 2GVPA 3JREA 2HNLA 2LJAA 2QLZA 3CCMI 1LEAA 2F5EA 3TGZA 1KONA 5D6EA 1LKXA 4BS9A 1ZN2A 2E1MC 1M3JA 5CYVA 3QQAA 2WAQN 4XIHA 2VBWA 4RB3C 2BTOT 1GXQA 1PQNA 4ZBDA 2STTA 4ZL8A 1FAAA 4IP1A 4HX4A 4G2EA 1W1WE 5D8IA 4KA0A 4F55A 2E2GA 3F6FA 2XF6A 3QOEA 1BM9A 3B02A 1SENA 1X5EA 3TKSA 1YF0A 5IP7J 1L3LA 1X5CA 2ZUPA 3Q19A 5ECLB 3K10A 3S1QJ 3IL2A 3UKGA 1PX6A 2GLRA 5IMFA 1B72B 4PZJA 1J9IA 1FJLA 4GSSA 1BR2A 2UUZA 5F0CA 2QGUA 2R7WA 3GV1A 5EEAA 1S7OA 2VQLA 4ZYHA 2ISYA 4YKGA 1OKTA 1B48A 1X1CA 4EDZA 2ELJA 3BTLA 1MDJA 2TIRA 4FETA 2XPUA 5H20A 2VM2A 1Y0UA 2I9HA 1SKRB 3HUGA 2DO7A 4FTHA 2OZ6A 1RETA 2E34A 4II2A 5DUKA 4BEHB 2CUZA 2GQKA 4PX1A 2K9QA 1YY7A 3BPVA 3CLOA 3K0LA 4CYCB 1Z6RA 4K9ZA 5J4UA 3IP4B 4RLFA 1PN9A 19GSA 1D3YA 1TZLA 2D1VA 1XW5A 2FX0A 2I5UA 3GVAA 3ZGKA 5IT3A 1NHOA 1MIJA 2QF7A 3D4TA 3EURA 2C8UA 3L7WA 3PUBA 2EQRA 3AAFA 2HDCA 3W3CA 5E3NA 3S1NJ 2KP6A 2N5AA 2DBCA 1F2EA 3I43A 3SZTA 4AU7A 6GSWA 3IV5A 4KE3A 1Y8QB 2F5FA 1KYZA 3TOTA 4L9VA 4DZJA 3CF2A 2LY2A 3IAS2 1TU7A 4O6JA 4I97A 3FMSA 3WYWA 2NS0A 4PUFC 1PFOA 2DOEA 4OWRB 3I55I 4B44A 3FISA 2MMNA 1FP1D 3C73A 4AIKA 2DFHA 2H1BA 1JHHA 1UC7A 2FMLA 4Y3OA 3ABKH 2Z2SB 2H6ZA 1JZRA 4G10A 2JVGA 1T00A 2ZXHA 5H6RA 2CQ9A 5HLTA 2L7KA 1T39A 4ZTFA 4G0KA 3GFKA 1BC8C 1SL1B 3QR6A 4OMYA 5DBQA 3TCOA 2E1NA 4OO4A 1THXA 2EIRA 4LGWA 1UHSA 3NARA 3G71I 5JI6A 3G4SI 1M3IA 4CY6A 3S16J 1SVLA 2HI3A 2R7RA 4GGGA 2HOAA 4OINF 1Z91A 3LAJA 1T3BA 1Y1WJ 3I4NJ 1SD5A 1IXSB 1R6RA 1PDNC 5FLVA 2DJKA 2GSSA 1SFOJ 2WAQA 2Y0SA 3PFYA 4MQVA 1RRJA 2HPIA 1S3RA 3ZR8X 1IZ1A 4XQFA 1FTTA 4BVXA 1KA8A 1XWKA 2Q2EA 3QU3A 3NIVA 1NG7A 1U6TA 1NK3P 1MD4A 3ABTA 2ZSHB 1T7PB 1O8WA 1ZG5A 4K7OA 3OYBA 3G7IA 4LMVA 2ZO4A 4F93B 2LS5A 4PNFA 1VF4A 4NDLA 3BR6A 3FZ4A 16GSA 2QSIA 2L01A 1YE9A 4ULXA 3UNGC 5C4JJ 2F51A 4Q5QA 3S3NA 1KTEA 3HRTA 1TWGJ 1FX7A 1IG7A 4ZYEA 4LD5A 3F72A 5E3OA 3V7CA 2DKHA 1MJBA 3PO3J 2W82A 5IMDA 1ZGAA 4F2IA 4J00A 1J09A 3LSRA 4PFPA 5L3FA 1MSEC 3FZ5A 2LTKA 5CO3A 1TNSA 5ENUA 3D5SC 1W36D 1M2DA 1G3TA 1RK4A 2X8CA 5C44J 4KAEA 2PJRA 3IC8A 3KMOA 4K6XA 1YYVA 3OV8A 3J7AY 4KUMA 3QP6A 4XMYA 1XIYA 2JADA 2NBSA 3DVWA 3KD0A 4KX4A 1TWAJ 1RPWA 1ZK8A 1LE8A 1HDDC 1VFCA 1THOA 2DT7B 2DJ3A 3TKQA 4CCJA 2H6CA 4RDUA 3S2HJ 4PJNA 4MZBA 2R92J 2PERA 1ULYA 1JHBA 3BROA 4NC7A 1DPUA 4RAYA 3ZIVA 2P6SA 3HZJA 3AG2H 3MVPA 4NNJA 4M3DA 2O9LA 4XRAA 2YV9A 2EC4A 2EIQA 5J41A 1ACVA 2H76A 1UHMA 1O7LA 2R5YB 2CSOA 1WH5A 3FBIB 2F5DA 3G1OA 3K4BA 3K4CA 3LQRA 4YG2F 1FB6A 2A69F 4WR5A 2XBQA 2VBYA 4IHVA 3VPQA 3GUDA 3VLNA 3PH9A 1ST9A 2LG4A 1LFBA 1V4RA 2FD5A 3LAPA 2EIJH 4HF2A 2HYFA 3FR6A 1A2JA 1Z3XA 3WHCA 2L9RA 2LNBA 1XTAA 2CW8A 2Y48A 4AIDA 4BACA 1GSYA 2FHEA 2YANA 2YJ7A 4NAXA 1OLTA 2NNYA 4WF5A 2BVMA 3MFKA 4ENKA 2ID6A 4B09A 4L5IA 5IOXA 2HVRA 4HOJA 3CZ6A 1B9YC 2LKSA 4IHYA 3QFBC 3IAM2 1XXUA 2LRCA 4KNDA 3IH4A 3HJPA 4RUVA 1EGRA 2MYGA 5E59A 4X0XA 4GQFA 3BLYA 2Z33A 1YJWI 3GSSA 4I6XA 3RAZA 3U2RA 1LJ9A 2BY3A 3WGHA 2RLIA 1HBXG 3G2BA 4UVBA 4A3JJ 2V9KA 3GW2A 2CQQA 5HFIA 2JA8J 1LBKA 1GSSA 1YRNA 3BOAA 2ETHA 2O8XA 4ESJA 3RKQA 2PFBA 2X1DA 3BG7A 3ROUA 1FYMA 2GOXB 4J57E 4G7OF 3DPUA 2EILH 4O92A 5KVRA 2H72A 2K7LA 4BXUA 5E8IA 5B5EC 1AWCA 2WZ9A 2EIMH 3H93A 2JUCA 3S3MA 2ZFWA 4BE0A 3QPSA 2P5VA 5LD2C 2CW7A 2EA4A 4PXOA 3DTIA 2FOKA 3K4KA 3TBIA 3ED3A 5E8GA 3BWGA 1O57A 3A03A 3OSGA 2DT6A 3EUHC 2MD0A 3VYRB 2DPUA 2HYXA 3NZNA 3ZQHA 2YZHA 4G0LA 5TISC 1POGA 1RIOH 3D0SA 4LK1F 4E4HA 3VDXA 1HC8A 2NVLA 1D1BA 1F3AA 4FASD 2OJLA 2JT1A 5F8BA 4GXOA 4JX6A 3T5XA 4MJAA 3EVIA 1IF1A 2JUGA 2L2OA 2LMDA 2K3FA 2V9VA 4HX8A 4S04A 3L2UA 1OCPA 1YJ9I 4YRVA 1V58A 3ZN0A 4BWSA 1JKQC 1G7OA 2NS8A 2PU9C 5DAKA 1FOVA 1TRWA 1SFXA 3HPGA 1MDKA 4CCNA 5L71A 2IPQX 1XFLA 2X4AA 1RC9A 2F4MB 4X1UA 2TDXA 3TKPA 1P4WA 4ZL7A 3E97A 3VSLA 2Y9ZA 2YU9J 2B9SA 1JZWA 4KDXA 1JZDA 4F0CA 4EC0A 3VWXA 1OE8A 4HA8A 1ZELA 2VJ4A 1W5CC 3CCEI 4IHSA 1T56A 2V6CA 3O76A 3BTJA 1J0FA 4NBQA 3FZVA 3QAHA 4KN4X 3ZQFA 2B3SA 2H1AA 2BXYA 1HQOA 4Y13A 4B4CA 1MZBA 2PMZA 1Q1HA 2DOAA 1A5JA 1IRZA 2GQLA 5LRRA 2XRLA 4M74A 1GSQA 2HI7A 3LWAA 5J40A 3HOSA 4XK4A 3KCCA 3GHAA 3QDNA 3F4RA 4HUAA 1N75A 2FNPA 1X9MB 2PVQA 5ECPB 2QVOA 4MLYA 2V2GA 4CYDA 1R7HA 1GL8A 2QGVA 1DGRM 2A05A 2COBA 2EZKA 1T8EB 1XPVA 2G0EA 4I01A 2IS4A 3J7Yb 2ZCTA 1W4VA 3H5AA 4RM2A 1J2XA 1B72A 4CICA 5HFKA 1XSDA 1D0YA 2DN0A 1I27A 1ZAOA 3H3UA 1JGGA 2IGKA 1WZ2A 2M45A 4EJVA 4DW6A 2ZKZA 2L7ZA 3KP3A 1AQXA 2X6XA 2DIZA 3GN3A 5K7FA 3FEUA 4ECCA 2VLTA 5KOXA 4WWCA 2K9MA 2VJIA 4MFDA 2OPTA 4OOIA 3CCJI 22GSA 2PBIA 5CYYA 4BE1A 2XIGA 4I0AA 5M3FJ 2DMPA 2Y9YA 2D5VA 4D7NA 4J56E 4MP4A 1KEBA 2VO4A 2M4KA 1U8RA 1QZEA 3PSFA 2EFWA 5FB2A 1AW9A 1AXDA 2E71A 3MZYA 2JJ7A 4UB8C 3W6VA 5F0FA 3T1BA 3K2ZA 4EJOA 5CNWA 1SD8A 3RI4A 1I39A 2H0IA 4DSSA 2LSOA 2FA5A 2PN8A 1X4PA 1F6MC 1V5GA 4BQAA 4E6KG 2DOFA 3IWFA 3OIPA 2ADUA 4XKBA 2R2JA 4QPQA 2VI6A 1F5TA 2VASA 4XTSA 1P7JA 2KQRA 2B1LA 2I4AA 1R5PA 2L54A 4RA2A 3GTUA 2W1OA 1TQPA 1YITI 4WEYA 2VOOA 5A4WA 2ZXWH 3OR2C 1FOHA 1T33A 2CFXA 5IIZA 6GSUA 4LMYA 4GFBA 2EB7A 3DFGA 4E7SA 2VCQA 3LQ7A 4PDKA 2RQPA 3HKRA 3L9UA 2O89A 2JSYA 1OE7A 3H35A 4FIWA 4NUBA 4RB1A 2LRTA 2RN7A 4L5LA 3W6JB 5JVGF 5J5NA 3QFAC 2CMPA 1GHCA 1Y0NA 4CYCA 3E6CC 1FW1A 1EGOA 2CQKA 3HZ8A 2IMIA 1JTXA 1G4DA 5JCGA 3CCVI 3CDHA 2CV1A 2P4WA 3FXRA 2E2IJ 2L7FP 2RAEA 5CQGA 3LEFA 4F9ZA 1LDDA 1GH2A 2DODA 1XG8A 4JEDA 3ZOBA 2PWJA 3FXUA 3MWHA 1V98A 1XSXA 3FMWA 5FRNA 5ELGA 2VQCA 3M1EA 1OC8A 4AYBA 5EVOA 3OYNA 1QK8A 1M2AA 4CSWA 1V5EA 1DP3A 1K79A 2X48A 2PGTA 1X1AA 2BOLA 5ILUA 5L3DA 3JRBA 1A6IA 2IBDA 5AN1A 4D73B 1LPQA 1Z77A 2I8DA 3FMRA 5D6FA 4E70A 4HZ4A 3GFIA 4RS8A 3K7AJ 3C7MA 2OC6A 3C1DA 2FMYA 4MJBA 4LK0F 3TEDA 3C3WA 1BA5A 1IW7F 1XMXA 2A61A 1FO5A 3WODF 1XD7A 2ACJA 4F52A 2R7FA 3EYYA 2HXIA 1Z67A 1DP7P 1QPMA 3I59B 3P8WA 2CS3A 1DPRA 2V1DA 2XB5A 20GSA 2WB9A 3DD3A 1S3CA 3UIWA 2A5WA 4EVMA 1Z6MA 5LNKe 4FE4A 2K9SA 2GGTA 1N2AA 2EV0A 2R93J 3OSFA 1PP7U 3DKWA 1QHHD 3A1YA 4ZYAA 1YHQI 4EIQA 1XWBA 5JWQB 1PGTA 2VL3A 4PGHA 4BXXJ 2GQQA 2HU9A 4LG3A 5EJCA 1BI2A 2FQ3A 3HYIA 2W48A 3BD2A 2Y30A 4MPFA 3TRXA 1BX9A 1TU8A 1SKSB 1D5YA 3P90A 2XPEA 2L9VA 4B8XA 1KGSA 4K0GA 3SEQA 4BJ5C 1TP9A 5E1ZB 3U9GA 3WTYC 5FJ8J 1LEBA 1T08B 5ILVA 4JU5A 4E7HA 2E2JJ 3HOWJ 4TN8A 4MPGA 2XPWA 4GCVA 2Z9OA 3E5QA 4JE1A 3FM3A 3A0HC 5IOYA 1K0CA 4K7IA 4POLA 2X64A 1CQHA 2QA2A 2E7WA 3A5WA 3LSMA 5FKKA 5E20A 2EFOA 5ILSA 1V2AA 2EBIA 4XS1A 3CRUA 3ZMLA 4CXFA 1JKRC 2HS5A 3WTWC 2M0CA 1H0MA 1NM3A 3JRHA 3WT2A 3MEXA 2OTJI 2DJJA 4XS4A 3RDWA 3E3EA 2A2PA 1WI9A 2P7VB 4EM2A 5A4VA 1ETVA 2DCEA 5HS9A 3LXZA 1ZGWA 2M8EA 3DBHB 1OC9B 3GF2A 3GKNA 5CP1A 5HODA 4L18B 5IO2A 1W7PB 3FXKA 2QSGX 3L09A 1RZ4A 2OA7A 1IDYA 4BPYA 3GZ5A 3OWTA 4I99C 1OC9A 1R26A 3HL2A 1PUFB 1EWXA 4MJCA 1IJWC 2Q0OA 1GSFA 4O5UA 3DCFA 1YX3A 4Q5NA 3RZOJ 2Z5UA 4YH2A 3U21A 2K4JA 2H0HA 3EYIA 3ASNH 3FK6A 2KDOA 3GCMA 4A2UA 1USTA 2K18A 4K7NA 2X9DA 1FB0A 3BBYA 4BL7A 1BG5A 2ZNMA 1SKWB 1X3UA 3HY2A 1GTAA 4UVAA 4F7ZA 1TQMA 1O3RA 1Z7LA 5GSTA 3MWMA 4Y33A 4I0BA 4HBLA 1Y8RB 2M8GX 3ABLH 4YFNF 2HRNA 4IQAA 1XSVA 3DP7A 2ZCWA 4PCQA 2C6YA 3GIXA 3K4JA 4X43A 2DA4A 4DBRA 2HZDA 3LFKA 1SD9A 2YWIA 3I59A 2ZC2A 3S15J 3BR3A 2TRCP 3ERFA 4G0IA 1NG6A 2DSAA 5HNFA 3HJOA 2K6VA 1YEPA 2FY6A 4UUTA 4O5RA 4WETA 3W6GA 5J9BA 1VQ4I 5KN0A 5EPFA 2Y2ZA 4Y4RA 2X4HA 1WP0A 3D5JA 1CQTA 1H89C 3JAMZ 3FHKA 2HKOA 4IX7A 1SD4A 3OR5A 1D0ZA 2LBFB 3JRDA 2Q8KA 2O7KA 5GSSA 1Q98A 2H1KA 2XVCA 1U3EM 1ERDA 2LREA 1H75A 4MEYF 2W25A 2GZPA 3TRQA 5A5KA 5L3GA 2GSQA 4I8BA 5CRDA 3OYIA 3F9KA 5DUIA 1JTYA 1Z7PA 1ORKA 4TR0A 5HR1A 4D0PA 3CJTB 2LP0A 3LSTA 1X19A 5BS6A 2JZSA 5KOWA 1X3ZB 3OYMA 1STZA 2GZYA 1OJLA 2JRMA 5K5QA 1ZRFA 4AM3A 1HQCA 1G2HA 1W5TA 2MGQA 1B6AA 2WY8Q 4I2TA 1Z3EA 2XAFA 3EWLA 3GX8A 2BVLA 1TRVA 4MF7A 4MGRA 1IN7A 4WXHA 4R79A 1OQYA 3CRTA 5DALA 4LG0A 4I02A 2IA2A 3U1KA 5ICGA 2ES7A 1MTCA 4FCYA 1Y6IA 3EUAA 4EF0A 1ETQA 2JN6A 4KB3A 5EZGA 2H19A 4OAZA 4U88A 2NNNA 1YOVB 1U9NA 3QOPA 2WWYA 2IIYA 1BW6A 3HOVJ 4KW6A 3L9FA 4HF1A 4S0HB 2PX9A 4CA0A 4TVEA 5H5QA 3ASOH 2KP2A 4AGSA 5IQYA 3WU2C 4MTDA 3J80Z 1SMYF 3OL4A 3A5IA 2HQNA 2FWGA 1D0XA 1O6JA 5JWRB 3UVTA 1FSEA 3BG9A 4XL9A 1TKDB 1MH4A 2LSTA 3ESWB 3KFWX 2WV1A 3J81Z 7GSSA 3HYPA 2Z99A 4ETSA 1IUFA 2K8SA 3ZXSA 3BG3A 4IL6C 3SJMA 5EGOA 1YJNI 1PP8F 2IS1A 5FGMA 2HQ5A 4ZJZA 5KNLA 2VCXA 4KSOA 2OE0A 1EP8A 3Q0WA 2VOCA 3OY9A 3BJAA 1FVKA 5CAXA 4AC0A 4U87A 1IN4A 4MF5A 1CQGA 3K1MA 1UN2A 4ZBAA 4BL0B 2BHYA 1BL0A 1RUOA 3TP3A 3LYPA 2IGMA 2H01A 2CX4A 2LC2A 3FHZA 4C2MJ 2A2RA 3TUEA 3FWEA 3H79A 5IMCA 4GLTA 2VCWA 1IN6A 3DRNA 3ZRDA 2Z3YA 1U5TA 4POKA 3VPTA 3WT1A 1AUCA 3TJGA 2VL8A 2QKLB 3GURA 1Z6NA 4P5OA 1GRXA 3GTKJ 2EWNA 4WXTA 3TOUA 2KIMA 4YEJA 3E5XA 1F1ZA 5LGTA 5IYBJ 3CCSI 2CFOA 2JPCA 2HOSA 1RQMA 4BVYA 4DSSB 1G7EA 2VB6A 3L2CA 2DKIA 1R23A 2XHKA 4GRIA 1NHYA 3ZVJD 3ML6A 5AGYA 2YU3A 3RCOA 1K61A 5HOOA 2J5PA 4GYIA 4PJLA 4W97A 4OIPF 2E60A 2Y0SN 2LY9A 4WF2A 3DKYA 1BJZA 3K4NA 1F4KA 3A2XA 2IVMA 2O85A 2XBIA 5G1LA 4UV9A 3HB9A 3OIOA 3F0IA 4V2FA 3DWLE 4AD9A 4C3IJ 1IDZA 3OYAA 1TJDA 1HKSA 4IHXA 3TKYA 3DEXA 4A3KJ 1MMNA 3FDYA 2CZ2A 1B8XA 4H0EA 1LDJA 1TRSA 1NSWA 1I6XA 3TOBA 5LEKA 2IGOA 2PI0A 1IYHA 5EEGA 1U78A 2OCEA 2B5EA 1OYYA 5AIXA 2KPMA 3LFUA 5IPAA 3IBHA 5EY6A 1SAXA 1SU9A 2EFQA 5H5RA 4YAPA 2MLKA 1FBQA 2WDUA 2GWRA 4HQZA 1KU7A 3R61A 3LWFA 3PQJA 5FD5A 5M5YJ 2HRAA 3GTUB 3UBKA 2K3PA 1I50J 1BI0A 1XN7A 4AJ6A 3CCRI 1QGPA 1GVDA 4ITVA 1TWCJ 3FIWA 2HYGD 3F63A 1MBJA 1HW1A 2IFQB 2VQHA 1HNBA 3MYDA 3ZVJA 2FEZA 4MK3A 2VQGA 1OC3A 2A68F 5G1KA 4PQIA 1XGSA 2G7HA 2O5RA 3HRMA 2AS5F 4L0YB 4IJIA 2XSJC 3C1RA 2M1BA 2ME0A 3ZMTA 1KYWA 1IUYA 2BMXA 2OE3A 2YWMA 2OV7A 2M7AA 5DCHA 1F9NA 1BIAA 1J5YA 2KIUA 1KU3A 2WAFA 4YIIA 12GSA 1WSUA 2VJ5A 5DAKB 5FHIA 4EUYA 2XUBA 3GFMA 2UWMA 2XROA 1TT5B 1BIBA 3SYTA 5G5EA 4E8HA 4ZB6A 2R5YA 2F5CA 3N97A 2IS6A 2VKEA 1OCTC 1C72A 4XRMA 2MZCA 3ISOA 4IVFA 4RM3A 2QWWA 3M3MA 2QA4I 3PNVA 2BBYA 1DE2A 5J47A 5LCZA 1YRNB 4IGJA 1HNAA 3GNJA 4XHMA 1U9OA 2NRAC 1K7AA 3VYSB 3CJNA 5LHHA 2L7MP 4ACSA 5F08A 5L3BA 3KLNA 1YW7A 3H1CA 3I54A 3MKLA 1GUKA 3Q9SA 1VQLI 1EOGA 2KL4A 5HFGA 2GZZA 1OVNA 3U1DA 4ZB9A 3MNGA 4UUVA 1QXHA 4CUGA 5HR2A 4Y7NJ 2ZXIA 1CF7B 5ECOB 1JE8A 2X1EA 5FKLA 4YIFA 3LA3A 3UAPA 3GH6A 3HRUA 5HNHA 1R5GA 4XS6A 3WGIA 3KMNA 2NPBA 4QPOA 3WE2A 2L9SA 2M34A 1FLIA 5C4XJ 3RYPA 2FGXA 2X99A 1FMWA 1B4PA 3US3A 5IP9J 4C3HJ 5F64A 1UMQA 2O3FA 3TMOA 3GKXA 1DU0A 1ETXA 4WX9A 4KGIA 3G3ZA 3LSPA 3HVVA 5HLGA 4P55A 1ZLKA 2LNSA 1PYVA 2R7DA 3M8FA 2IFQA 1H88C 2G7UA 5D96A 4BKXA 2QSFX 4BUPA 2K02A 4MO7A 2FBIA 3WTVC 3H0DA 2P0WA 3PIOF 2LRNA 1E3HA 1SANA 4B43A 2OTLI 3F4SA 4M6YA 5ICFA 1Y25A 4UB6C 5ECQB 2OF7A 1H9GA 3TW7A 4EVIA 2MW8A 2MBTA 2M7BA 2DC5A 4XRSA 1GLPA 1KQ0A 3A2KA 1HSTA 2GM4A 2E35A 2TRTA 3ZPLA 1BBYA 3I3LA 2DA1A 4FQGA 3BJ6A 1MDMA 2M2EA 2MD5A 1ZYEA 2R5ZB 4KDUA 5GZZB 4JP0A 1HOMA 4M71A 4DNCA 5IYCJ 3JRGA 2J9HA 2VUPA 1PD21 3LORA 1ZG1A 1TL8A 2CAQA 5CLSA 4G6DA 4D9JA 2HTSA 4KIFA 3OYCA 3DBRB 3IK7A 3N9JA 1FPQA 2XGXA 3CUOA 4ABZA 3HZ4A 4IF4A 4L5EA 5L3EA 3PO2J 3ZITA 4X4JA 4I09A 4A3DJ 4XN0A 5D93A 3N4MA 5B8BA 6PAXA 1A0FA 3SHFA 1FHEA 1QMVA 2E7XA 2KT0A 2OD5A 4PSWA 2E36A 3F21A 3ZLPA 2MABA 3WG7H 3QWLA 5TJJA 3MKYB 5E79C 3PUFA 1HDPA 4UXNA 4JBAA 2R0QC 3S2DJ 3H5RA 1EH6A 3M9AA 4HAMA 2PJRB 2C3NA 5IYDJ 5J8FA 4U0YA 1WI3A 3HHVA 5F07A 4M3GA 4GYGA 3TGNA 2ON5A 3WGEA 2P6TA 2M0MA 1YG2A 2VD1A 2F9SA 2ZJRF 1WJKA 1A24A 3BQYA 2MLGA 3J7ZI 4IJ3A 2R3SA 2XHFA 2MBSA 1YI2I 1F37A 2HZFA 2FJ1A 2FRHA 3D5LA 3AG1H 3GBGA 1OCRH 1LVKA 4MA9A 3CYNA 5DJLA 2M72A 2DTZA 4KYWA 2P31A 5GAND 2H71A 1OAZA 1XW6A 4NXIA 2LH9A 4U7DA 1IV8A 1BI1A 1VGLA 1K0AA 4V2LA 2RC4A 2CT6A 2QBYB 3OYEA 3LNQA 3CO6C 4HU9A 4C3JJ 4BA7A 3I5UA 2HSYA 2ON7A 1Y39A 4YQUA 3EE2A 2E0QA 4FX0A 1DGWY 4L0ZB 3OYLA 4J19A 4F91B 3RHBA 3WGXA 2VT2A 2QUFA 3ERWA 1W0UA 2E1MB 5CRGA 2HR3A 2H1LA 3GMEA 5D4RA 3HVSA 1ZGJA 3DTEA 4HF0A 3COAC 6GSTA 5K7HA 1G6WA 2CQXA 1T4ZA 1ON1A 2DMLA 3GRXA 4AJ8A 5BPDA 2LVSA 1D1AA 4U0VA 2P5LC 4G7ZF 3HEFA 2YX4A 2L4CA 4IELA 4IEJA 2VBXA 1EV7A 2VC1A 1FC3A 2NVQJ 1GNEA 2XAJA 1HD2A 4V1Ap 4P9FA 4DYCA 5J4VA 3CC4I 2FA4A 2C0GA 3FZ9A 3S1MJ 4UNOA 1SK2A 3HGYA 4CY8A 2V6OA 4OFTA 4XOPA 2VL2A 3IWZA 4KT6A 2VONA 4CDOA 1LNWA 3UEMA 1V40A 2Y0MA 3HOXJ 4PK4A 4XSXF 3CESA 3M8JA 2ELKA 3IKTA 4O32A 1TC3C 4X0GA 1TQIA 4KF9A 1B59A 4HDUA 3FW2A 4ZYDA 1SYXA 2MMOA 1Y56A 4XKCA 1Z1DA 3BTIA 3HHHA 4HV6A 4IRGA 3RKXA 2VM1A 1I1GA 1XDUA 3FRCA 1OCZH 4BVXB 4YELA 4RMNA 2AAWA 3D6IA 2FD3A 3L4NA 3C18A 1AQWA 3W2AA 3M9JA 3MAJA 3ME8A 2C4JA 2RREA 5LFAA 2YR2A 3F23A 3VWVA 3G6EI 3KYLA 3KE2A 1O3SA 1TOFA 4CHUA 4JRRA 4NWYA 2DFFA 3QAGA 1HF0A 3F8NA 4C30A 2FNAA 2LJRA 1TP4A 4WXCA 5CQEA 3SBCA 2FOWA 2PLYA 1ZTRA 3NAUA 5CJ9A 1WOUA 1P4AA 2W24A 1GV5A 3AG3H 4POBA 3VI5A 1FIPA 2R7ZJ 1KQ8A 2FXAA 4N0ZA 1P9QC 5IOWA 5D5UB 3ZIJA 1AKHB 4FQUA 4E7IA 1UG0A 2W84A 2XDVA 1R5HA 3EPZA 2O61A 3ZFBA 1A2MA 4JOMA 3DWVA 3N5OA 5FKMA 2GIZA 3C2HA 1OCCH 3V8LA 1JZOA 1OPCA 3MIXA 1S8NA 2YWOA 3RYRA 4MQ9F 3R4KA 4WF4A 2IJYA 5DS9A 2L02A 1VQ9I 3L2VA 2IA1A 3HG9A 2RQQA 3EU3A 1V57A 2VJJA 4MEXF 1VQNI 4HSTA 3MDKA 1DUXC 3CUQA 3TL4X 2L5QA 1ZRCA 4PGTA 2BY0A 1YLFA 3RPUD 1TW2A 3DQVC 1FBSA 1R00A 2CH0A 4JR4A 1SJ6A 2H75A 3CBUA 4PURA 4H4KC 2EZIA 4AVZA 4A3EJ 4K5SA 2QCOA 4TW5A 18GSA 3DU6A 4N30A 1S3AA 2R4GA 3WHBA 4M73A 1K4TA 2HRKA 3F8UA 4I2UA 2F4OB 3BOQA 3LL7A 3JW4A 2EFNA 2PMZN 4ZYGA 3F8CA 4KITB 3JTGA 2LKXA 1EP7A 2A2SA 3AY8A 1K3YA 2I1UA 4UUSA 1P6RA 3RZDJ 3PR8A 4NB5A 2W85A 3OL3A 3APQA 2GXAA 4BEHA 3KEBA 3GO5A 3WTTC 2X8HA 3CMMA 3KZYA 1A35A 2YSRA 1YX5A 3ZN1A 4OCFA 1R1UA 3SDBA 2BZTA 2H8LA 2KZVA 2GOMA 3I69A 4O3MA 1GXPA 1SEUA 2HXOA 2VL2C 3CTFA 4EDYA 2AYTA 3SFZA 1TLHB 4DGWB 1IN8A 3M1CA 5DCMB 2XRNA 1V5FA 1Q1VA 2GSRA 2R7UA 4TXVA 4ECIA 1T8IA 4OWYA 2F48A 5J3RA 4KN7X 3KP9A 1ZKGA 4AIJA 5JLXA 3ERGA 4HNTA 3OOPA 4YAVA 1ZLJA 3S14J 4XS4B 1AQVA 4WKWA 3UOMA 1ZHFA 1ZR2A 1BOBA 1EV9A 4F03A 1R4MB 2NYXA 4FYUA 3L9SA 4DJAA 4EV0A 3VFZA 1BQ7A 1D5VA 3E5UA 2Y75A 2H66A 2CUEA 3GL5A 3KEYA 5DDLA 3HTSB 4BBRJ 2VIMA 4EGZA 1R7JA 2L4MA 3NWTA 4ESBA 2KJBA 1ML6A 3LSIA 3R6SA 1RNLA 2H1GA 3WD6A 4AVPA 2V26A 3CSHA 1MH3A 2XC2A 1IGNA 3IDVA 3ZYWA 5D73A 3N05A 5GADJ 1GNWA 2EA2A 3OIQA 3WTZA 2ELHA 5A4UA 4XLPF 3OR1C 4AUXA 1YJ6A 4ZDLA 2XAHA 3IV4A 1BJAA 3TB2A 4RGUA 2H30A 2K86A 5CPRB 3H0GJ 5JFRA 2G9WA 5IPHA 2VC0A 3IC4A 4I98B 4FX4A 2OBKA 3BCBA 3D1NI 1MJ9A 5ECNB 2IA0A 3O3KA 1WE0A 4NV2A 1K6OA 5BMZA 1DDNA 1KNGA 2FWEA 1X5DA 4Q4ZF 4ZDOA 1S72I 1MBEA 3KLOA 4IRIA 3FR3A 2JU5A 4TR3A 2H8WA 2K5CA 1BAYA 1YS6A 1F43A 2AXLA 4Q5RA 2X1CA 1IXRC 2LY1A 1MKMA 2R7OA 5DCMA 2BV6A 5TGTA 1ITYA 3V7SA 3H3VK 1ZL9A 1MJAA 3O2PE 2WGRA 2F4IA 4XBFA 1G6YA 3HCZA 2MBFA 3C2BA 5B8AA 5CVRA 1M9BA 4G12A 2VN2A 3FXJA 3HHGA 2CYYA 4A0ZA 1VF9A 2KDZA 1MW7A 5K5RA 2ZJPF 4G8XA 1GV2A 2X51A 5A2QZ 1S7EA 1Z7RA 4A5PA 1TXXA 2MFZA 5DQSA 1I5GA 3DF8A 2K9LA 3M07A 4Y15A 1SAUA 2BGCA 4XLNF 2NOJB 2WV0A 1VQKI 4ENNA 1QU3A 1VTNC 2VBZA 4IOCF 1REPC 1ZZYA 2B6MA 1UA5A 3G9BA 4M3EA 5DTDA 4AWXB 2LOOA 2PG4A 3KIJA 3JRFA 3E7LA 5FFZA 3GKKA 4HPQA 1XX5A 3TP0A 5EDNA 2FBHA 2A3SA 3T0YA 2LF7A 2UXXA 4Y52J 1G0TA 2MMZA 4XNFA 2V6KA 2HXKA 3IK9A 1PA3A 3W2VA 1U3IA 2A4VA 1LDKB 4JZQA 3SZPA 1WFXA 2HKXA 2LR8A 3L0HA 2VKVA 3KX2A 2NAZA 4UY8I 1FOYA 1XMAA 3RJPA 3VWWA 3F3QA 4KISA 3RBTA 4PJMA 3GTLJ 1XMKA 2E19A 5B66C 4IO9F 4BHPA 1N77A 2H73A 2P5QA 1UJ8A 1HKTA 3SWLA 3K69A 2XGEA 3VEPA 1FVJA 2KIFA 1IC8A 5G30A 1G59A 5DVBA 4A69C 2DK8A 1W89A 3JRCA 4YFKF 2HYJA 3GA4A 4HU7A 5E3LA 2ME6A 3NWSA 2O03A 3QYBA 3S8PA 2E2HJ 2JACA 2V1XA 4EMSA 4RB2C 4N10A 2RGVA 2H6BA 2E5ZA 3LSKA 2ID3A 3OMYA 4XLHA 4O5VA 2CQNA 3VK9A 2JVHA 1MD0A 2W57A 2EV6A 5FFXA 1QRYA 4IP6A 2VCZA 2NVYJ 3FXLA 5KHDA 3FKIJ 5F1RA 2H1DA 1MNEA 3JAMK 3ZTLA 5GAHJ 1YKCA 9GSSA 3DLAA 4Z6YA 4U7BA 5IOZA 3CJRB 5HDNA 5B6MA 3PQKA 1AIUA 2RNJA 4D73A 1FTZA 3BG6A 4IJAA 2REMA 3S17J 2NVUB 4HDVA 1KBNA 2PMUA 4QTRA 4QLCU 2VKDA 1E2YA 5IT9K 4DZPA 3I0TA 1B4QA 3CO7C 1WJ5A 1U6GA 1WJEA 3KEQA 4XONA 4ZTJA 2ZFUA 1JJ6C 3HOUJ 2AO9A 2VD0A 4M9ZA 1WJBA 3CSJA 4BBSJ 2LKPA 4A12A 5DYMA 5GPCA 6GSVA 1S29A 2OE1A 1OYWA 3DPTA 4Z2YA 4OIOF 4A3FJ 3QMXA 2M80A 3KGKA 3KZQA 5G31A 4K2EA 2QYOA 4KIGA 3MAKA 2L59A 2OUMA 4WK8F 2EINH 3WG9A 2F8FA 3F6OA 2JA7J 3F9UA 2R5ZA 2M87A 3I53A 1NW2A 4V19K 4N4NB 1SMTA 4I2OA 1LU4A 1M9AA 2M46A 1WMJA 2YCDA 2CZ3A 2IXSA 2HOTA 3IE3A 5AIVA 4M6XA 3H36A 4YKFA 3JR9A 4BQQA 1QPIA 1P7IA 3R3EA 4DIQA 2JSPA 3HKZA 2GDRA 2KMUA 3H9JA 5LBQA 2HOEA 3A2VA 4A6EA 2ZNZA 3E1SA 3HA9A 4KT5C 2YPMA 5EYRA 1B9MA 4WR4A 3D4MA 5CVVA 11GSA 3ERED 3R0AA 2V6EA 1S6LA 5JCWA 3GTGJ 5TRDA 2DIYA 3GSTA 1Z5YE 2GT5A 3VWBA 1O81A 2GS3A 5FROA 5FLXK 3PJRA 4EE0A 4ICYA 1YZXA 4AJ7A 3ZCOA 3B6AA 1XBSA 2B7JA 3UMAA 3UARA 3IH2A 2Y69H 2K9FA 2PUKC 3V7RA 1U88A 5HQPA 3BR0A 4F82A 3KETA 2L4AA 2L9NA 3Q0VA 2IPAA 3M3YJ 4XCSA 3WTUC 5IMZA 2W4SA 5K5OA 5DM7F 2MG4A 1NHAA 2P5KA 3ZQ7A 2YZUA 1IN5A 4YFXF 3CCUI 2VCVA 1RR7A 1TK5B 1ERVA 2IL3A 1SVOA 3LSJA 2K8VA 4ZH4F 2EZLA 1UAAA 3QU6A 1QO0D 4CW9A 1XB4A 4AIHA 4B48A 3K4LA 3HGGA 1ETWA 1PUEE 1LE8B 3DKXA 1CGPA 2V1UA 3CQFA 3LSZA 2WTEA 4KCAA 2ZNYA 1LQ1A 1T98A 2QC7A 3H9GA 1FWZA 2DA2A 4B47A 2UZKA 2XGCA 3OYGA 1QHGA 1R9TJ 1SFEA 1TTYA 5F0HA 3O3TA 3M1GA 1ZG3A 2GZWA 2L0KA 2LK2A 1U5TC 5E4WA 4QIWN 4IHUA 3GWZA 4FISA 3VFIA 2IRFG 4Z2TA 3EDPA 2HDDA 3BY6A 4TR4A 4XLFA 2DFIA 2PN6A 3FXMA 1XC5A 3E9JB 1AU7A 4HI7A 4GRFA 2W00A 5JLWA 3AL0C 3IH3A 1JUSA 4K1FA 1IO2A 1G6NA 2K27A 3I58A 3GTOJ 1QUWA 2GA1A 3PINA 1RI7A 2X0LA 5J1YA 3CCQI 5E17F 4FE7A 2BHZA 1BW5A 3IPZA 5HS7A 2JPBA 1PX7A 1APLC 4XICA 1MSFC 1XDSA 5B7CA 1XGMA 4DYRA 3ZP5A 2CVKA 1D1CA 2COMA 3BCIA 5G2ZA 3TKRA 4RAZA 1N78A 3QAWA 2L5LA 1A04A 1P92A 5K7ZA 4Z2UA 1R1VA 1A8LA 4G6QA 2FLSA 1H9TA 3FK8A 2MSYA 1R36A 5JVTA 1GTUA 13GSA 4O7HA 4PNGA 4RBOA 2LNTA 4HZ2A 1SFUA 2X6WA 5KN3A 4IQJA 4GO1A 1JI8A 1J0RA 3DVXA 6GSXA 3VSKA 1VZ0A 2K4BA 3I4MJ 2ICWG 3M7GA 1YS7A 2NOGA 1ZRDA 1QQ2A 4ESFA 3K70C 2VE9A 4A0YA 1MMSA 2JRTA 2AHQA 2WAEA 2C0EA 2VODA 1SYRA 2D2ZA 4ASNA 3R0JA 2LV3A 3CXGA 4C9YA 5ECHB 2FSWA 5FKOA 3MCZA 1A6QA 1XWAA 3DEWA 4Q5FA 3TRPA 3G7YA 1ZH5A 2PPTA 3LW9A 3ZMKA 1OR7C 2IWTA 3CDLA 1GP1A 1T0FA 1TDIA 3NOFA 4RI6A 4NC6A 3HSEA 1T2KA 1U2WA 2AXTC 3EETA 1C0WA 1R5ID 1TI1A 1MBGA 3EQLF 1FYLA 2R0PA 4GTUA 5IY5H 1VI0A 5IP6A 2V4JC 1NK2P 1EOHA 2BEOA 3CLQA 2VIXA 4HNUA 4N11A 2HZTA 4MMMA 2IP2A 1OCOH 2VLAA 2F5VA 3HJMA 5IMVA 2QQ8A 1W36C 4MF6A 3GTMJ 2OJED 3ZZXA 3IHGA 5KEJA 1K0OA 1YIJI 3D21A 2AQEA 2ZMEA 1O7UA 4XR6A 3UL3A 3G7JA 3R60A 3HSFA 4NC8A 2NTOA 3RHCA 4RGXA 1YFHA 5L3CA 4BJ6C 3IHQA 2GT6A 2CX3A 2HLSA 1ONVA 3FM5A 1GUMA 3E0JB 3KTBA 1MBFA 5ICEA 4LB6B 3IXRA 2O0YA 1WWXA 1X1PA 4HSRA 3M4OJ 2LFBA 3DXBA 2L5OA 2G2QA 4B3XA 3OS2A 2DLLA 3IRRA 5CRHA 4NMUA 3CMYA 2DXIA 1J59A 2IEKA 5D4SA 2JA5J 3RKWA 3B6CA 1JUMA 3DPLC 3ECOA 3CMAI 4BE2A 1XPXA 1AHDP 4EM1A 1MMGA 1X1DA 4BU2A 4F92B 9ANTA 1FOKA 2I3YA 1IXCA 2LDUA 1IAWA 2CG4A 3GFLA 4LLGF 3V4GA 2LEGA 3H8QA 3H4KA 1FNNA 2DYSH 1OYJA 3KJYA 4EXJA 1OMIA 2CV0A 1FEXA 2DQLA 3Q74A 4ZILA 1LB2A 4OU0A 5J1RA 2XSDC 3LG6A 5BRTA 4L9NA 2ECBA 2OBPA 4M9XA 4RGSA 3SFIA 3X2QH 1GLNA 3ZQLA 3VI7A 4EQQA 4BVYB 4IQ4A 3GTQJ 2BYVE 1XCBA 3GYKA 3KPHA 3ZMZA 2N8GA 4BQNA 2W7NA 3L2QA 1Z3YA 4XOTA 3OYKA 1U0JA 1MBHA 3ECHA 4LFUA 1IV6A 1OKDA 2B1KA 2KHMA 3K9TA 1AOYA 4XLAA 5M5WJ 6GSSA 3OYHA 4W1UA 1HCRA 5DCFA 1EH7A 5DM6F 2PBJA 4OMVA 4ENJA 14GSA 5HVQC 4MJEA 1V54H 5B1BH 3TOAA 4HG2A 1ZYRF 2FWFA 1WCMJ 2R0GA 2XB0X 3C1SA 1SFKA 1TTZA 4FYBA 17GSA 1XWGA 3QRFF 2H6YA 4ZZLA 3I56I 2A5YB 3ABUA 1K0NA 1M2BA 3ZREA 3M8EA 1WRJA 5ABRA 5GAGJ 1RUNA 1KQ9A 4KICA 4MCUA 3F0CA 3HOZJ 5C04A 3HIFA 1M7TA 3FR9A 5IMAA 1A23A 2L6CA 1K83J 1Z0XA 1R71A 2E5NA 3PL8A 1LVAA 2KLOA 2I81A 2YNXA 5KN1A 1ERUA 3F6DA 2WC2A 3O6BB 2R4VA 4C2UA 4HRIA 4I5QA 4M3BA 4R8HA 4N0BA 3WTXC 1R1TA 4XIDA 2OKAA 4ZXGA 3QP5A 1PKWA 1VQOI 1A36A 3FX3A 1Q4JA 3FHNA 2HPMA 1O8XA 3S32A 2H8RA 2QQ9A 1SC7A 4XRSG 2JL4A 1PL1A 3H1NA 4TOPA 4KUNA 3C7JA 2R0CA 2UV1A 4P1WA 3BP8A 3CCLI 2YWNA 5HS8A 1YTYA 2V79A 4IHTA 1BJXA 3VPRA 4CH7A 2RV8A 2GXBA 4LJZF 4BHCA 5B1AH 3GL3A 4XRDA 1GSDA 5FKNA 4N9IA 2MH9A 2AUVA 3HPHA 5AONA 1TWFJ 4MFEA 2LRDA 1XWCA 1DBYA 2M30A 4PUAA 4BHBA 2Y31A 4ZC3A 3APSA 1PUFA 2JQ7A 3L78A 5LD0A 1TK8B 4X1EA 1FYKA 4KIBA 4EJWA 5GP9A 3PNTA 1K0MA 4LLLA 4IHWA 4USSA 2JMWA 3BR5A 2HQAA 3KP6A 1T6SA 3P2AA 4LG0B 1K6YA 2ISZA 5DALB 4A0XA 3K1PA 3M0FA 1BR4A 2B63J 1BYEA 3EMPA 5ECSA 5H2FC 3EUHA 4A3MJ 1GUHA 5EF6A 5IT9Z 4L0WA 3VB2A 4XN3A 3PPUA 4V1Ag 2OACA 4HOBA 4MLOA 1O7FA 1W5SA 4NV5A 2XC7A 2HWVA 1UHWA 4PGGA 3OYJA 2WULA 2IJLA 2NVTJ 1ZYPA 2H0GA 3KYCB 2V32A 4P3YB 2DYRH 2KZGA 3H5NA 4LL4B 3JTHA 3MKWB 3HKZN 4Q47A 3J81K 2PVOC 5A2QK 4NQWB
chains in the Genus database with same CATH topology
2BW3B 1T4YA 5ID2B 3H9QA 2V41A 4ILFA 5FRMA 3K6GA 4PTSA 2E7PA 3IRAA 1GSEA 2BJXA 3HXSA 3QFBC 1ZOFA 1Z9HA 4OD7A 3ZQQA 1F9MA 4BWQA 1MNDA 4OCEA 3KM6A 5KN2A 1EEJA 2X6YA 2P5RA 2IN3A 1J08A 4FH8A 3SZGA 4RQXA 1SK0A 3BJ5A 3Q18A 4K5RA 3QOUA 3M9KA 3IOSA 2MC4A 5HR3A 3RSNA 4F3QA 3A4CA 3HOTA 2R7XA 2LJKA 3FYGA 1MMAA 1TRUA 5ECIB 2RM6A 3EMXA 1GLQA 3HVXA 4OFMA 1TK0B 2TRXA 1HA8A 2KRCA 2MYSA 2R7VA 1PL2A 2FWHA 2UZ8A 3AL0B 2JSZA 1WJAA 3CMIA 2L57A 4MZWA 4G9HA 1WJDA 1WRYA 1J9BA 3QAVA 1PSQA 2O8VB 5D9VA 4EIPA 4PUSA 2VLVA 2FUG2 2WADA 3DEEA 3HDCA 5CRWA 2G0FA 4HS1A 3VWUA 1N8JA 4GXZA 1XW9A 3MSZA 4IKFA 4K2DA 3APOA 2V1MA 1Z21A 2AHEA 2BW3A 5ID2A 1MMDA 4J2FA 4GWRA 1U3AA 2FA8A 3CJQB 4PFOA 5KCMA 1GTBA 1TI3A 3C8EA 1GTIA 4MNNA 2R6KA 2WB1A 3K4MA 3LMMA 1FMVA 1ZCPA 1JFUA 1SL0B 4KJZA 3CSIA 4FYCA 3HXLA 1A0RP 2R5GA 5CKTA 1XOBA 1R4WA 2IMFA 4L5OA 4GQCA 4IKHA 4TRXA 4BXFA 2IS2A 5HR0A 4CZCA 3KP8A 3RQ4A 4XKVA 5ELAA 1JLVA 4RQRA 2C1YA 3EU4A 2GQMA 2RIIA 3ZL5A 2JZRA 4POMA 2XF7A 4V2MA 3QD9A 4L0UA 4G6TB 2R7QA 4Z7XA 4ML1A 2IMDA 1IYIA 3D22A 3WGDA 5DCGA 2LYCA 3QYEA 3VURA 3ZRGA 1O85A 2H6XA 3P7XA 2Q1ZB 4XLCA 8GSSA 2AB6A 4RLQA 5D9XA 5ECKB 2Z16A 1H4OA 1I9DA 1WPIA 5CREA 3GMFA 4BQOA 4MABA 3FY7A 4WBRD 5ECRB 2XPDA 2VPLA 4L8EA 3OS0A 2RNGA 4TR1A 3MD2A 2DJ0A 4DOZA 3C2GA 1MDIA 2JZTA 1VF2A 4JBBA 2V1NA 1SJIA 4GSNA 4E8EA 2HNHA 3QPMA 4MH3A 4TXOB 5IM9A 1X9WB 1S9HA 3GH9A 2B5YA 2WY7Q 2CUJA 3MMYB 1K0DA 4XORA 4LLRA 2HSHA 1T1VA 4EATA 2IMKA