3IAM2

Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, reduced, 2 mol/asu, with bound nadh
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
179
structure length
179
Chain Sequence
GFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHLQVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAGKRLEEIELPGKCGHHVHEVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADH-quinone oxidoreductase subunit 1
publication title Structural basis for the mechanism of respiratory complex I
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 44
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature ec 1.6.99.5: Transferred entry: 1.6.5.11.
pdb deposition date 2009-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF01257 2Fe-2S_thioredx Thioredoxin-like [2Fe-2S] ferredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1590 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3iam201
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3iam202
1TJDA 2YN1A 4PURA 3FZ4A 1YEXA 4MMMA 3UEMA 4JE1A 4NWYA 3QR6A 3BCIA 3IDVA 1KBNA 5ECNB 2OA7A 1ST9A 4O92A 1FOVA 2P31A 4KX4A 4V1Ap 2DJKA 1K0BA 1SKRB 1U87A 1SK0A 2E2MA 4NMUA 5ECKB 3EU4A 3EVIA 4I8BA 4XS6A 2GGTA 5DAKB 5H5RA 2AV4A 3CSIA 4ML6A 1M2BA 3ISOA 3RBTA 4TN8A 2EC4A 2VM2A 1V58A 3BCKA 3LYKA 2LRCA 5KN0A 5ELGA 1XW6A 2QSIA 1JFUA 2CV4A 1NHOA 1FHEA 5COHA 1WIKA 4KSMA 3ME8A 1HNAA 3Q6OA 3O3TA 1EEJA 1GL8A 5ABRA 1ML6A 4MPGA 4AJ7A 3NZNA 5B8AA 3F3RA 1YJ6A 3GKNA 2YZUA 3FKFA 1AC1A 4FH8A 5HR3A 2IMIA 1HNBA 5CNWA 3QAVA 1F6MC 4RQRA 2WZ9A 1OC8A 3P8WA 3PINA 1AQVA 3GX8A 2R6KA 3RDWA 2H0GA 4PXOA 2L4CA 2VCTA 3UMAA 3FZ9A 5J9CA 1R4WA 4JU5A 3FK8A 3GKMA 4Z7XA 1GRXA 1SKSB 3GNJA 3HZ8A 4QL7A 4BPYA 1VF2A 2LTKA 3UIWA 1TW9A 1HNCA 4Q5QA 5ECSA 4N0VA 5A4UA 2FWHA 2I81A 1WRYA 5AGYA 3QPMA 2IIYA 3ME7A 1QUWA 3G7YA 2O87A 2CQ9A 2RM5A 4YQVA 1RK4A 2DJ0A 2DJ2A 1TK0B 1XWGA 4Q5NA 1THOA 2GZYA 3UOMA 4ZIJA 2OADA 1EZKA 2CX4A 1O85A 1HYUA 3C8EA 3LXTA 1QQ2A 1U3IA 5FT3A 1ABAA 4N0ZA 1B8XA 4BA7A 4O32A 3P90A 4OFNA 3TKSA 4EC0A 3F8UA 3ERGA 2D2ZA 2DJ1A 3HCZA 4ML1A 3ZFBA 1B9XC 3IC4A 1GTBA 4OFTA 2C8UA 1AAZA 5A4VA 3WT1A 2WRTA 4WKWA 4TXOB 1A2MA 4RQXA 2B7KA 2A2RA 3NIVA 2FWFA 5D93A 3KXOA 1XW5A 5ECLB 3E9JB 1XW9A 1ERUA 4DSRA 4FYBA 1UA5A 2YJHA 1MDKA 1SKWB 6GSUA 3QD9A 1TKDB 4HJ2A 4E8HA 1QXHA 4IN0A 4MZCA 3DEXA 3E0UA 3L9SA 2I4AA 1TI3A 1VGLA 3J7Yb 3J7Yk 4CHSA 5G1LA 1UVZA 2REMA 3KM6A 2GS3A 4WEYA 1V2AA 4OD7A 1G7EA 4HI7A 3D22A 1ZGNA 4H86A 3TRPA 5ECOB 3ZLPA 4KSOA 3GFKA 3BBYA 2PVOC 4XS1A 1MEKA 5IPHA 5HR1A 2K8SA 4XCSA 4TR4A 2M46A 2WULA 3BOAA 6GSTA 1MD4A 3FYGA 1SYRA 3FW2A 5H5SA 1G0TA 2VL2C 2VO4A 4HQZA 4KW6A 3ZTLA 1YEPA 5KN2A 3IE3A 1HD2A 5H5QA 3OR5A 1Y25A 4NHWA 2R2JA 4GTUA 4HDEA 1U88A 3U6VA 5G5FA 8GSSA 3TRQA 3ED3A 2VCWA 2R4VA 1PN9A 3KP8A 1AQXA 3EURA 1GLQA 1GH2A 5GZZB 2V6OA 2FWGA 2GQKA 4OCFA 2LEGA 5ECMB 1BQ7A 2KP2A 2VUPA 4EO3A 2YANA 3HJPA 4YQMA 3ZVJD 3IA1A 1ACVA 2MZCA 3QOUA 4IELA 4KDXA 3TJJA 19GSA 4EL1A 2K8VA 4IP6A 5F0GA 4KAEA 1O81A 4G19A 1R5AA 2GTUA 3LGCA 3RHBA 3KMOA 4LL1B 2X64A 4TR0A 3UVHA 3ZL5A 3GRXA 4PGTA 2L6DA 1M9AA 4IJIA 4K7NA 2M80A 3EINA 2OBIA 4TXVA 4KNDA 3M3MA 4L0WA 4EXJA 2N5AA 1TRSA 4HUAA 16GSA 5B6NA 1W89A 1BJXA 3MWHA 3RHCA 1O6JA 5J4UA 2CT6A 1B9YC 3EYTA 3G9BA 3SBCA 2H1AA 5FWGA 2NVLA 4K6XA 4PUFC 5B8BA 3APOA 4D73B 3BD2A 3IR4A 4KA0A 3ZIVA 2IFQB 1XBSA 1R5PA 2JL4A 3LG6A 1QFNA 1OYJA 4G2EA 1R7HA 3TDGA 2QKEA 3ZZXA 1VF4A 1JZRA 3ZIJA 9GSSA 3TKRA 3IOSA 4JZQA 3IAS2 3HJOA 4EE0A 1A23A 1EP7A 2C3NA 4L5LA 2N5FA 4V1Ag 4LLRA 2IMDA 4WF4A 3W8JA 3IV4A 2FUG2 2YPMA 1XFLA 4ZB8A 2B5XA 2WJUA 2TRCP 1PD21 3GURA 4K7IA 1WMJA 3LORA 1VF1A 6GSXA 5L71A 4F9ZA 2PERA 4IBPA 1W4VA 1GTUA 5HQPA 1QGVA 1SD9A 2LRNA 4GCIA 3FHKA 1T8EB 5HFKA 1BAYA 5HFGA 5F06A 1TI1A 2KHPA 3F4TA 1GTIA 1EOHA 1PSQA 5DCHA 4POBA 5INYA 2CVDA 3HVVA 5HR0A 3M0FA 3TJGA 2V1MA 2R37A 2L4QA 3TB2A 2CZ2A 4ZBAA 2XBQA 3H79A 3WGXA 2H75A 3HD5A 1ZOFA 1J08A 1E2YA 3GKKA 4KE3A 2RUEA 1I9DA 3HHVA 3TRXA 3ERWA 4EVMA 2XC2A 4E8EA 2LJKA 3L78A 4I2TA 2IJYA 4CW9A 1F9MA 1EEMA 5HR2A 2OBKA 4HZ2A 4OO4A 3HDCA 4MLYA 5HFIA 1DE1A 2RIIA 4MA9A 3Q19A 4ZBDA 18GSA 2DMMA 3PH9A 2PBJA 5DJMA 1XOAA 4MF7A 2C0GA 1FW1A 2X8HA 1GUHA 4BWSA 5IMCA 3LSZA 1SJIA 3CBUA 4MZWA 2O8VB 6GSWA 4OFMA 2LNTA 2B3SA 5CP1A 4TVEA 2IPAA 1PQNA 3QFBC 4WR5A 1PRXA 5J3RA 3UARA 5JCGA 1JZWA 2PU9C 2A4VA 5AIVA 3TOUA 2VIMA 2GZPA 3P7XA 3C71A 2C3TA 2ON5A 1FO5A 1YZXA 3FY7A 3ZFLA 2DJJA 2HLSA 4IP1A 12GSA 2YWOA 4YQUA 4POLA 4GSSA 5GAPD 4TRXA 1GNEA 1EWXA 3GL5A 4KDYA 3CRTA 1T00A 4GQCA 10GSA 5E59A 1UN2A 5CRGA 3LWAA 2HT9A 3V1WA 2GDRA 2VLVA 3EMXA 2I3YA 2V2GA 2GT6A 2O7KA 3DXBA 2CVBA 1HQOA 2V32A 3Q74A 3QAGA 3KJYA 1LU4A 1FVKA 2CAIA 3KTBA 2XPEA 4ZILA 1T7PB 1X9SB 4O5RA 2K18A 2VL3A 1PKWA 5EPFA 5DBQA 1SL2B 3UVTA 5LCZA 5IPGA 2O85A 1SK1A 5B6MA 4EKZA 3HJMA 3M1GA 5CREA 3CXGA 2VLTA 5JCWA 4D73A 2F8FA 1ZYEA 3ZITA 5IMDA 4G10A 4OMVA 1DSBA 4EUYA 1TP9A 5AN1A 4WXTA 1QK8A 4AGSA 4ZBBA 1S3AA 3F4SA 2I9HA 3LJRA 5KN3A 2JZTA 3GH9A 4K2DA 1AIUA 3I6AA 1JZDA 1SL1B 5FHIA 2YOIA 3DRNA 5JWRB 2WDUA 1WWJA 3CRUA 2LSTA 3VI5A 3RAZA 5IIZA 5ENUA 3KMNA 2PUKC 2L59A 2HFDA 3DKSA 3TUEA 1A0FA 3W8SA 2G0FA 1KNGA 3NOFA 1WPIA 2NBSA 1M2AA 2O89A 3I9V2 2JZSA 2M72A 5LNKe 2HI7A 4V2LA 2PGTA 4KH7A 3IXRA 13GSA 4MH3A 3GX0A 4XS4B 3D6IA 1ON4A 5C00A 4IW9A 1TDIA 3LXZA 4IS0A 3VPTA 1V40A 4ISDA 2IMFA 2E2GA 1R26A 1OE8A 1OC9B 1OKTA 4K0GA 4PX1A 5J9BA 3GHAA 1Z6NA 3M9JA 3ZMKA 4GQFA 4J2FA 3TOTA 2LKUA 4BVYA 3KH7A 2PPTA 3H1NA 4ACSA 5JCUA 1SYXA 2LJAA 2H6YA 3HVXA 4IGJA 2GSTA 3QFAC 2VD0A 1GUMA 2H6ZA 3KIJA 5DALA 3CTGA 5G5EA 4J57E 1V9WA 4G9HA 4I2UA 1N2AA 3Q18A 3EE2A 3QAWA 2YWMA 4X0XA 2OKAA 1E6BA 11GSA 4ZL7A 1I5GA 1RW1A 2MMZA 1SK2A 4ID0A 3GTUB 1SU9A 1TRUA 3N9JA 2G2QA 1XWBA 2WCIA 1GSQA 3HA9A 5ECIB 4I6XA 4F0CA 2C3QA 4BWQA 4V2MA 1TXXA 2MMNA 3KZQA 2ON7A 2YJ7A 1IYHA 1ZCPA 3WYWA 3VWVA 2JACA 3EC3A 5DCGA 1K0DA 2KUCA 4BVXA 2B1KA 3EWLA 5DVBA 4L0UA 3I43A 3PGTA 1XWKA 1AW9A 2LQQA 1GWCA 4MJEA 5D9WA 2GQLA 1BX9A 1NSWA 4ZL9A 1T3BA 2J9HA 2KLXA 4L8EA 4ZL8A 1Z3EA 1X0RA 5CRWA 1TU7A 3G7IA 5DAKA 3C1SA 2R5GA 3GKXA 1ZMAA 5IO0A 1GNWA 1BG5A 3K8NA 4MK3A 4GSTA 2GT5A 2EIRA 1A24A 1M0UA 1EOGA 1FAAA 1OC3A 2X8GA 4KCEA 2PVQA 3IHQA 3D4TA 4WR4A 2JSYA 4HU7A 4JR6A 3KH9A 3D0ZA 4F82A 4N30A 3LYPA 4LA1A 4MP4A 4POKA 3ZYWA 17GSA 2CX3A 5CRHA 2CA8A 4ULXA 3GUSA 3EMPA 1GSYA 5ECRB 3F3QA 5B7CA 4GRFA 4ECIA 1FVJA 3HKRA 4TOPA 2H74A 2F3MA 1PL2A 1XWCA 5IMAA 1ERWA 5G1KA 2WB9A 5CYYA 1AQWA 2H70A 2OE0A 4IKHA 4XHMA 2JSZA 3TKPA 3KEBA 1XPVA 2IMEA 2B5EA 1AXDA 1MDIA 3U5RE 4XRDA 4NHZA 3KCMA 2YCDA 2L57A 1KEBA 4TR3A 3TKSC 4OCEA 4MF5A 3N5OA 1TK5B 3FR6A 4IJ3A 1Z7PA 4JEDA 1SJZA 1EV9A 3WGDA 5E4WA 1USBA 4FIWA 1K0MA 2NTOA 3P2AA 2JZRA 5CO3A 2C80A 2N5BA 4XS4A 1QMVA 1WOUA 2MMOA 3VURA 3ERFA 3F9UA 1DUGA 2ALBA 2DBCA 4K8MA 3WD6A 4FO5A 1OC9A 1PKZA 1XIYA 2H01A 3VK9A 1XVWA 3A2WA 1PX6A 5DJLA 4TKYA 1JZOA 1YKAA 1Y6EA 1GLPA 4HZ4A 3CMIA 2JU5A 1YDKA 2C0DA 4AJ6A 4TXOA 2MYGA 3W6GA 1K3LA 1WJKA 4WBJA 3FRCA 1K0NA 3WGEA 1PMTA 4QL9A 2WS2A 4GSNA 2YV7A 1S3DA 3IK7A 3R2QA 4Q5RA 1Q98A 1M99A 5ECHB 3A5WA 2YZHA 2EIOA 1GUKA 2AAWA 5DDLA 5ECPB 3GH6A 3KGKA 3HY2A 2HRFA 2ES7A 5IM9A 2PMTA 3H4KA 5DQSA 1O7UA 2FY6A 1U6TA 2K6VA 3O6TA 1O8WA 1O73A 4DSQA 2GVPA 1TRWA 2A2SA 2WFCA 2J23A 2LNSA 1EV4A 4IQAA 4J56E 2MBSA 3A3TA 5IOWA 4JBBA 2DMLA 3D21A 1T4ZA 4FYCA 3O76A 2GLRA 1G6YA 2NDOA 2RLIA 2MBTA 2P0GA 2YP6A 1X5DA 4PUAA 2OE3A 3GL3A 5AISA 4DEJA 2C4JA 4KGIA 5EVOA 1MTCA 2OJLA 4RUVA 3LQ7A 5GSTA 2EIQA 3FR3A 4JR4A 4XIHA 6GSSA 1YF1A 4TR1B 2OE1A 4YH2A 3FEUA 2AHEA 1DE2A 2VOCA 2H72A 4K7OA 3IBHA 2VD1A 2ZCTA 2LUSA 2QGVA 3JCML 3ZVJA 1X5CA 1JLWA 2RUFA 3F6DA 4KUNA 4GF0A 1M2DA 1GSUA 2YNXA 1TTZA 2IMKA 4WETA 1YY7A 2HSHA 5G30A 3VPQA 1A0RP 3US3A 6GSVA 2H73A 2JADA 1VF3A 1WP0A 2VL2A 2B1LA 4K9ZA 4GWRA 4ILFA 4JRRA 4PQIA 1ILOA 1EGRA 3GV1A 1ZL9A 4EDZA 1K0AA 4FYUA 5AIXA 3G7JA 1F37A 3CYNA 3TJKA 3UL3A 2E0QA 2LRTA 4HU9A 3F63A 4MZBA 2AJQB 3VWUA 1XOBA 4X1UA 2H66A 1F3BA 4MPFA 3C1RA 2Z9SA 3C7MA 5D8IA 2F9SA 2FA8A 3HZ4A 2H71A 2PWJA 4OO5A 4K0NA 1F2EA 1EP8A 5G2ZA 3UJ1A 1GSSA 1NHYA 1B48A 1K0CA 4LMWA 2IL3A 1OKDA 3DIEA 2IFQA 3D4MA 2B6MA 2DLXA 1O8XA 4N10A 2ZUPA 3GN3A 2XBIA 4K1FA 1T4YA 4DVCA 1K0OA 2IN3A 1CQHA 1J9BA 1THXA 2HE3A 2CAQA 3ZRDA 5JWQB 3TKSE 3KP9A 2GSQA 4MABA 3F4RA 3IK9A 2IWTA 1F3AA 4HJMA 2TRXA 2DIZA 3C73A 2VL9A 2E7PA 5J41A 1TRVA 2H76A 3TJFA 5CRDA 3A2XA 4KB3A 4LMVA 2MMAA 3CSJA 5JWOB 2LV3A 2P5RA 4YAVA 1SL0B 1PX7A 2YWNA 2VCZA 3GMFA 3ZMLA 4HEA2 2HSYA 1Z9HA 2AB6A 4DSSB 1MDJA 3L9VA 1KTEA 5ELAA 4ECJA 1SJ6A 2DSAA 4MCUA 2H19A 1B4PA 5DQYA 3DMLA 2ZNMA 1XWAA 4L5OA 3VLNA 1G7OA 2HZEB 1A2LA 2H8LA 4F0BA 3UBKA 4ZXGA 3APSA 4HS1A 1YKCA 5EY6A 4MF6A 1GTAA 5ID2B 2HYXA 3VI7A 2VCQA 5GAND 2VLUA 3IAM2 3UAPA 3IRAA 4F03A 2P5QA 3VFIA 1YQ1A 1PA3A 3UBLA 2L5OA 2RM6A 4MJBA 4MDCA 5IMFA 1V98A 2NPBA 5IMVA 1DBYA 2TIRA 1RQMA 4IVFA 1JHBA 4XRAA 3I69A 3RPNA 4NV2A 2H1GA 2XPDA 3L4NA 3CSHA 1T1VA 2BJXA 3MDKA 4NAXA 1M9BA 2H6XA 3AY8A 3FZ5A 3IPZA 1PL1A 2KOKA 3MNGA 1CQGA 4MJAA 6GSYA 3D5JA 1LJRA 4IQ1A 3S9FA 1BEDA 2C0FA 3BJ5A 5J5NA 1XCCA 2BMXA 4O7HA 3LFLA 1LBKA 4I97A 2LQOA 1GULA 3M9KA 4TR1A 5KEJA 4KDUA 1IYIA 4EF0A 5D96A 1S3CA 3TCOA 2FA4A 4PNFA 4OWYA 5D9XA 1X9MB 3QDNA 4P3YB 4KCAA 1U3AA 2FGXA 3TKQA 2DJ3A 2C1YA 2FLSA 1UC7A 1H75A 5GSSA 1H4OA 3GA4A 3DWVA 3RPPA 2LJRA 1A8LA 3VWXA 5LD0A 3SWLA 4LL4B 1MD3A 2DIYA 2XHFA 5F05A 1A8YA 1VRSD 3GSSA 1FG4A 3APQA 7GSSA 3ZREA 2VCVA 2AYTA 1PGTA 1J0FA 1V57A 3GIXA 1GP1A 5IO2A 2FNOA 4NPBA 3DD3A 1X9WB 1Q4JA 2B5YA 3GYKA 5C04A 2VM1A 4CDOA 5KN1A 2L6CA 3A2VA 1GSEA 2L5LA 3FZAA 2F51A 1A2JA 1Z7RA 4HOJA 4ECBA 1FB6A 2H30A 3DGQA 2GQMA 4RI7A 5A4WA 3VWWA 1C72A 4HQSA 4PQHA 3KTLA 2QC7A 2FCHA 2K9FA 2H0IA 4V2NA 5IOXA 5F8BA 5A5KA 1SENA 4AJ8A 1OVNA 3L0HA 2HNLA 2HZFA 3H93A 2GZZA 2C0EA 3HYPA 2H0HA 1TOFA 2GSSA 1URMA 4EDYA 2PN8A 3H8QA 3QCPA 5D73A 1XZOA 3MAKA 4PQ1A 2F8AA 4NXIA 4ZB9A 3TJBA 1NM3A 4IHUA 4PNGA 2H1DA 2YWIA 2X99A 5G31A 4NV5A 4QQ7A 3DYRA 2FWEA 2FHEA 4TW5A 2WGRA 2HRNA 1BYEA 1WE0A 3LEFA 2X8CA 4MJCA 1GSFA 3DVWA 3CTFA 5D9TA 1TU8A 1TK8B 3EU3A 1OE7A 2V41A 4DSSA 3DVXA 2FD3A 2V6KA 3HVSA 2CZ3A 3QMXA 1AUCA 2DC5A 2YV9A 3F0IA 2KP1A 3MSZA 3WT2A 5IMZA 3FR9A 1EGOA 2HZEA 3F6FA 5EL8A 5F07A 1JLVA 4POMA 2B7JA 3HXSA 1ZYQB 1XVQA 4BL7A 4N11A 3GSTA 4GXZA 14GSA 5ID2A 2VAFA 1K3OA 1ERVA 2CVKA 4YAPA 2LS5A 4ECCA 1ZZYA 1B4QA 1M7TA 2HXKA 1G6WA 4WBRD 1Z5YE 4GLTA 4X43A 2BTOT 3TGZA 4WF5A 1K3YA 1X5EA 2GSRA 5DALB 3GTUA 2VCXA 1XXUA 1YF0A 3E3EA 5D9VA 5ECQB 4F2IA 4XTSA 3M8NA 1OAZA 1SD8A 2AUVA 2I1UA 3KD0A 4Q5FA 2OACA 20GSA 4AF2A 5IQYA 5CAXA 1Z6MA 22GSA 2R3XA 1FB0A 1GSDA 4RI6A 1N8JA 4I5QA 4MH2A 2H1BA 4ZB6A 1NW2A 3PR8A 3L9UA 1ERTA
chains in the Genus database with same CATH superfamily
1TJDA 2YN1A 1K78B 2IP2A 4PURA 3FZ4A 1YEXA 1JUMA 4MMMA 3UEMA 3A0BC 4JE1A 4NWYA 2WB1N 2XF7A 2HRAA 2L7ZA 1Z77A 3NEUA 3QR6A 3BG7A 2M7BA 2BVMA 1W0UA 1UG0A 2XAJA 2XROA 3BCIA 3IDVA 5CVRA 4HYEA 3VEPA 2FRHA 1KBNA 5ECNB 5D6FA 2OA7A 1ST9A 4O92A 1FOVA 2P31A 1SD5A 4KX4A 4V1Ap 4LK0F 2OU2A 4XORA 4B44A 5H2FC 3WTXC 1SVMA 2DJKA 3TEDA 3W2WA 1ZAOA 1K0BA 2FNAA 1SKRB 1U6GA 2PJPA 2A68F 1IN5A 1U87A 4FASD 4M9SA 1SK0A 2E2MA 4NMUA 4ZJZA 3VSKA 3WTWC 2V9VA 4HA8A 3RQ4A 3EU4A 5ECKB 5J47A 2BOLA 3DU5A 3RCOA 1F36A 3K4LA 3WGGA 3AAFA 3EVIA 2L9RA 4A6DA 1AA7A 3K9TA 4AVPA 2KL4A 2LKXA 4I8BA 4B3AA 4XS6A 2GGTA 5DAKB 5H5RA 2AV4A 3CSIA 5DM6F 1ODDA 4ML6A 1M2BA 3HPHA 1BI2A 1HW1A 1XG1A 3TP0A 4RMNA 3SDGA 2DTRA 3IRAA 3ZQFA 3ISOA 3RBTA 1YG2A 3RJPA 4CH7A 4TN8A 2EC4A 2EB7A 3HIFA 2VM2A 3T5XA 1V58A 3BCKA 3LYKA 4A0XA 2LRCA 2R7OA 3H5RA 5KN0A 1A31A 1X19A 2UZ8A 5ELGA 4UVAA 2DO7A 3C2GA 1J0RA 4AU7A 1XW6A 2M8EA 2CW7A 4ETSA 2QSIA 2HS5A 1MD0A 4JX4A 2IS2A 1JFUA 2X4HA 3CP2A 3OYLA 2OZUA 2XF5A 2LC2A 3C2HA 2CV4A 3MMYB 1JJ6C 5EEGA 1IC8A 1ZYPA 1NHOA 2QM3A 2PJRB 1FHEA 5COHA 1BW6A 1WIKA 1EKEA 4KSMA 2EV0A 2CQKA 3HKZA 3K1NA 4I6ZA 2FE3A 3ME8A 2K3PA 5F27A 1HNAA 3Q6OA 3O3TA 1EEJA 2COBA 2BW3B 5E1XA 3JRCA 1BM9A 1LKXA 2EZKA 1GL8A 2MFZA 5ABRA 1ML6A 4MPGA 4NB5A 1K79A 1C0WA 1S72I 4AJ7A 4QTRA 2VT2A 2OQGA 3NZNA 5B8AA 2K85A 3F3RA 2PN6A 2V1DA 2E1MC 1YJ6A 3GKNA 1ZYNA 2YZUA 2M8GX 4G12A 1ZK8A 2H94A 3FKFA 1AC1A 3PL8A 3G3ZA 3J80Z 2LOOA 4A12A 1U8RA 3CP8A 1QGPA 4FH8A 3K10A 5HR3A 2IMIA 4WXDA 1HNBA 4AM3A 2CUEA 5CNWA 1E17A 3CDIA 4J00A 3QAVA 1BJZA 5D8LB 3E1SA 3S3MA 2WBMA 1ETOA 2KIQA 2HVRA 3S2HJ 1F6MC 1H9TA 1YIOA 4RQRA 3FZVA 2WZ9A 2Y9YA 2DPDA 1OC8A 1HLVA 3H3UA 3CCRI 3P8WA 5F0HA 3PINA 2DFFA 3GTGJ 1AQVA 3GX8A 2DYRH 1BI3A 2R7DA 2XGDA 3O8GA 2DA3A 2QWWA 2R6KA 4J19A 3RDWA 2G9WA 3BROA 2XPWA 4XM3A 2H0GA 4I01A 3CCYA 3FXLA 4EJTA 4PXOA 2L4CA 2VCTA 1LB2A 3UMAA 2STTA 1EJ9A 4XKBA 3GX4X 4OWRB 1ZHFA 3FZ9A 4P5OA 1WI3A 4E7ZA 5J9CA 1R4WA 1FY7A 2XGEA 3LSJA 3OYBA 3FK8A 1EH6A 2L0KA 3RKYA 3ZQHA 3GKMA 2B63J 4Y15A 4EVIA 3S17J 4Z7XA 1GRXA 3TOAA 4YFNF 1SKSB 3GNJA 4IHVA 3OS2A 3ZN1A 3HZ8A 2CQNA 3IH3A 4ZTFA 4ENKA 4QL7A 4BPYA 1VF2A 2LTKA 3UIWA 2ZBKA 1TW9A 3RKQA 1PYVA 4IX7A 3COAC 1JXSA 2DA7A 3VDXA 3MKZA 1HNCA 2JN6A 2EZIA 2FOKA 4Q5QA 5ECSA 1FYKA 3C7JA 5ERIA 4N0VA 4ON0A 5A4UA 4M3EA 3BR2A 1DPRA 1G4DA 2FWHA 2I81A 5C44J 1WRYA 4I99C 2W7NA 2XRNA 2ZSIB 5AGYA 3QPMA 2L5QA 3FISA 2IIYA 3ME7A 1QUWA 3G7YA 4KMFA 2CQ9A 2O87A 3G6EI 1DGRM 2M2EA 5J8CA 3ZMUA 5JR3A 4C3IJ 2RM5A 1IXRC 3MFKA 4YQVA 2Y30A 3CJRB 1JTXA 1RK4A 1ZKGA 3MWMA 2DJ0A 4BYYA 4PGHA 1MBEA 2K27A 2DJ2A 3FM3A 1TK0B 1XWGA 4ASNA 4B43A 3BG3A 1XSXA 2E1OA 5GAHJ 1F4KA 3IH4A 4Q5NA 3LAPA 1THOA 2GZYA 3UOMA 2FBKA 3Q0UA 4I76A 4ZIJA 4F92B 2FMLA 5L3GA 2Z9OA 2OZ6A 4A3BJ 2OADA 5HDNA 1BN5A 4U88A 1ITYA 1EZKA 1S3RA 2CX4A 1O85A 1HYUA 1QRYA 3C8EA 5F08A 2CFXA 2Q2EA 4DYCA 3LXTA 1QQ2A 3QP6A 1U3IA 1E3HA 1MMGA 1ORKA 2RREA 4Y3OA 1ERDA 5FT3A 5CJ9A 5HLIA 5JVGF 1IUYA 1ABAA 3LSKA 1D0ZA 4N0ZA 2L54A 1HDDC 1D1BA 3L2CA 1B8XA 2EIKH 4U0YA 3M1CA 1IDZA 2R0CA 1D1AA 3KP6A 4FHTA 4K2EA 2DQLA 2V9PA 3HHGA 4AD9A 4F52A 4K2XA 4IHSA 3P90A 4O32A 4OFNA 4BA7A 3TKSA 2VONA 3AL0C 2M4GA 5JHUA 1FIAA 2JTVA 4EC0A 3F8UA 3ERGA 3MZYA 5DV5A 3S1QJ 2O6GE 5KAFC 2D2ZA 2DJ1A 3IP4B 4BAYA 2M0MA 1DU0A 3AKZA 3GYHX 4IJAA 5C3EJ 3HCZA 1Y1VJ 4ML1A 3ZFBA 1B9XC 1R5GA 4YEJA 4CZZA 4EIPA 1WJBA 2P81A 4JK1X 2XKOA 5M3MJ 4XKCA 1TWAJ 2IVMA 2ZJQF 4MNUA 2R5ZA 3IC4A 5F1JA 5J1YA 1ETQA 5J3LA 1GTBA 2FBIA 4OFTA 3QRFF 4XR6A 2C8UA 5EEHA 5JLXA 5CQGA 1RR7A 4XLPF 1AAZA 2H8RA 3H3VK 5A4VA 3WT1A 3CUQB 2JA8J 5DCFA 4BEHB 3J7YJ 4CGZA 1G2HA 2WRTA 3MN2A 4A3LJ 1TZLA 3R4KA 2H27A 1VQ7I 4WKWA 2WAEA 4CDGA 4TXOB 2IBDA 1A2MA 4RQXA 2KJCA 4G7OF 5BPDA 2VPLA 2B7KA 3ZMTA 5E3NA 4M3FA 2A2RA 3NIVA 2FWFA 5D93A 3KXOA 2HKXA 3H35A 4XICA 3GCMA 5CKTA 1XW5A 1OR7C 1J2XA 2FNPA 2DU9A 5ECLB 3KZYA 2COMA 4NC7A 1DP3A 2XSJC 3E9JB 1YRNB 2VE9A 3ABKH 1ERUA 1XW9A 1IAWA 4DSRA 1S29A 2K86A 1UA5A 4FYBA 3S15J 3BR1A 3DPLC 2HZDA 1MDKA 2YJHA 4XOPA 1TQMA 1WQ2A 2K4JA 2QA2A 1SKWB 6GSUA 3I71A 3QD9A 1TKDB 4HJ2A 1GXQA 3JRHA 2ISYA 2OCCH 1EF4A 1OCOH 1QXHA 4E8HA 4UV9A 4IN0A 2W4SA 4MZCA 3DEXA 2ZSHB 3E0UA 1MH4A 2R7FA 3L9SA 2I4AA 1ZQ3P 1TI3A 1VGLA 1T38A 4OMZA 1WH7A 5BNGA 1U8BA 3J7Yb 4UY8I 2DFIA 4CHSA 2RDPA 3J7Yk 1XPXA 2R7WA 3BCBA 2MH9A 1HKTA 1TW2A 2X4AA 5G1LA 4FE7A 1UVZA 14GSA 1T95A 4K7IA 1T0FA 1POGA 3BT9A 2REMA 2TRTA 3KM6A 3KEQA 2VASA 4HZFA 3F72A 2GS3A 2EZLA 2WC2A 4WEYA 1V2AA 2R7QA 4FQUA 3LOCA 3MAJA 4OD7A 1G7EA 4ENJA 4HI7A 2HRKA 1VTNC 3EPZA 3KP2A 4N4OB 3D22A 1ZGNA 4H86A 2HGCA 4A6EA 1CQTA 3TRPA 1K0AA 2JVGA 2O3FA 3CMMA 4RLFA 1X4PA 2E7XA 3VYUB 5LEKA 4WCGA 3JR9A 2NYXA 3OSGA 1ZLKA 2HEOA 3GFKA 4KSOA 4IVNA 2NVTJ 2K9LA 3BBYA 2KDOA 1Y0NA 2E60A 2FEZA 2PVOC 4XS1A 4KFCA 2CUZA 3BG5A 2AO9A 5DUKA 1MEKA 4WXHA 1XS9A 5IPHA 5HR1A 2K8SA 4XCSA 4TR4A 2M46A 2WULA 3BOAA 6GSTA 1Z7LA 3IC8A 3SXYA 1MD4A 3FYGA 1SYRA 3FW2A 3WODF 2VJIA 2ZFWA 2CMPA 1G0TA 5H5SA 1LDKB 3LNQA 1LE8B 3HL2A 2VL2C 1Y56A 1JT0A 2F5CA 3M9AA 4N4NB 1Z6RA 3ZCOA 4AIHA 2F6CA 1H89C 2HYGD 4OMYA 2VO4A 2LP0A 4HQZA 4KW6A 2VBZA 2F5FA 2GIZA 3LL7A 4UUTA 3ZTLA 3MZ8A 2DN0A 3TO7A 1YEPA 5KN2A 3IE3A 2K40A 1H88C 4MEXF 1HD2A 1XTAA 3ZMZA 5F1RA 3JRAA 5H5QA 3OR5A 1Y25A 4D7MA 4NHWA 5GTHC 2R2JA 4GTUA 1U88A 2HDWA 4HDEA 3V7CA 5G5FA 3TRQA 3U6VA 8GSSA 2CJJA 1YJNI 3MKLA 3ED3A 4G8XA 3BTCA 2P8TA 3LA2A 2EPFA 2VCWA 2R4VA 4EQQA 1PN9A 3KP8A 3LFKA 2KIUA 1UZCA 2Y75A 1AQXA 2QSGX 2Z2SB 4U0VA 3DBHB 3TGNA 3EURA 1GLQA 1GH2A 4HSRA 5GZZB 1FP2A 2V6OA 2FWGA 4XBFA 1JUPA 2GQKA 4OCFA 4MO7A 3WGIA 2LEGA 1M1EB 1MNMC 2AS5F 4BNCA 2WB1A 1BQ7A 2KP2A 2VUPA 5ECMB 2Z3YA 5H6QA 2MBFA 2O03A 4ZDOA 4EO3A 1IO2A 2IGKA 2KZGA 3JCUC 4EGYA 2GM4A 2YANA 3HJPA 4YQMA 2QEXI 3ZVJD 5F04A 5EDNA 1D8KA 3IA1A 5EGOB 2DT7B 1ACVA 2MZCA 1BIAA 2LH9A 4C2TA 3QOUA 1HXDA 4IELA 4KDXA 2XB0X 19GSA 3TJJA 4JP0A 2K8VA 4IP6A 1GVDA 5F0GA 4EL1A 3ZQQA 2PMUA 3I59B 5E79C 5BRTA 2C6YA 4KAEA 2Y31A 3DLAA 1O81A 4RAFA 5HLHA 2RAEA 4G19A 5DYMA 1ZR4A 2PJRA 3L2WA 1R5AA 1EV7A 1J9IA 1B59A 1LDJA 2GTUA 1P4WA 3LGCA 5E8GA 4A2UA 2R0PA 3RHBA 3KMOA 3FHNA 2CO5A 2X9DA 3RZOJ 4LL1B 2X64A 3R61A 4EJOA 2BW3A 2X85A 3U9GA 1O7FA 3WTTC 5E17F 2VKEA 3CC7I 4TR0A 3UVHA 3ZL5A 2XIGA 2BHYA 3OYIA 1B8IB 5IOZA 1PP8F 1UJ8A 1K7AA 1UHWA 4MFDA 4KICA 3GRXA 3GVAA 2IEKA 2EZHA 4PGTA 4IF4A 3CCEI 3S1RJ 4OOIA 2ECCA 1M9AA 2L6DA 4IJIA 4K7NA 2W24A 2M80A 2D5VA 1MBHA 3EINA 3V42A 2OBIA 3ZQIA 4TXVA 4BJ5C 2VBWA 3M3MA 1XMKA 2QKMB 4KNDA 4L0WA 3CF2A 3C2BA 4EXJA 3OS0A 2GLOA 1PUFB 2N5AA 1TRSA 2ELKA 4HUAA 1IW7F 4DYRA 1RKTA 16GSA 5HS7A 4PUSA 2VQLA 2R0QC 3BTIA 2LBFB 2O8KA 2IS1A 3EQLF 2JQ7A 5B6NA 2R93J 1SVLA 2VPRA 1W89A 1BJXA 3GFMA 3D5LA 5GAGJ 3MWHA 3RHCA 4DQ2A 2VOOA 1O6JA 5J4UA 2CT6A 2BHZA 1B9YC 2LY9A 3EYTA 2KT0A 3G9BA 2H1AA 3SBCA 5FWGA 2NVLA 4K6XA 3IH2A 4PUFC 4Z6YA 5B8BA 1T56A 2OC6A 3RKWA 2MC4A 2VOPA 3APOA 5ECOB 4D73B 3BR0A 1R4NB 1T98A 5M5YJ 3BD2A 3IR4A 3Q0WA 5DS9A 4KA0A 1SFKA 2KJBA 3FX3A 3FKJA 3VB2A 1SEUA 3ZIVA 2L3DA 2LSOA 2ZJ2A 3DPUA 4HX4A 4CYCB 2IFQB 3BZ6A 4RAZA 3VODA 3PSFA 1XBSA 3ZOBA 2BY1A 3CC4I 1R5PA 2X1EA 4UUSB 2E7WA 2JL4A 1X58A 3LG6A 1QFNA 1OYJA 4BS9A 4G2EA 3FXOA 1ZLJA 1R7HA 1KQ0A 3TDGA 2QKEA 2P6SA 4XQFA 3ZZXA 1VF4A 1Z91A 4HF0A 1XDUA 4HSTA 4TV7A 3L2UA 4MTDA 1JZRA 3OIPA 3ZXSA 5A2QK 3ZIJA 5CLSA 9GSSA 1YO5C 3TKRA 2YX4A 2MC3A 3WU2C 3IOSA 4JZQA 2XV4S 3ZR8X 3IAS2 2GZWA 3EPTA 5K5RA 3HJOA 4EE0A 1I27A 3K4KA 2AHQA 4DGWB 5H20A 5GTIC 2ZJPF 5FROA 1PDNC 2X6YA 4YELA 1A23A 1EP7A 2JSPA 2C3NA 4L5LA 2N5FA 5BMUA 3EDPA 1FP1D 4XSZF 5A2QZ 2IMDA 4LLRA 4V1Ag 4WF4A 1V5EA 3W8JA 2HQ5A 2WY8Q 3IV4A 1ZR2A 2DXIA 3VFZA 3HOSA 1LVAA 1FMVA 4YIIA 1D0XA 1RC9A 3KZIC 3S3NA 2PBIA 4Q5SF 3IWZA 2FUG2 2YPMA 3ZGKA 3CCLI 4IHYA 3GZ6A 2LVSA 1XFLA 4ZB8A 2B5XA 5K1YA 5D4SA 2FJ1A 3MKYB 4E7IA 2XGCA 2WADA 5FJ8J 2JA7J 2TRCP 2WJUA 2D1HA 3S8PA 1PD21 2CGPA 3E5QA 5F0CA 2H6CA 5IY5H 4HW0A 4BE0A 3GURA 1VQ4I 1WMJA 1VF1A 3A5IA 4IEJA 3LORA 6GSXA 1I6XA 5L71A 4CSWA 2QSHX 3PUBA 1BJAA 2CG4A 2R3SA 1FX7A 3LQQA 2H09A 1G6NA 2RV8A 3VYSB 3T8RA 5K7FA 4F9ZA 2B0LA 2PERA 2P5VA 3K70D 3KCCA 2JPCA 4IBPA 1W4VA 1GTUA 1OISA 1K61A 1X1DA 5HQPA 2V6CA 5E20A 2EFWA 1QGVA 1SD9A 1E2XA 2JSCA 2LRNA 3FHKA 4GCIA 1T8EB 1ETKA 1SD6A 1UMQA 1R7JA 1BAYA 3HVNA 5HFKA 1WWXA 2R92J 1R22A 2BYVE 5HFGA 2QQAA 5K5OA 3U2RA 3ERED 3HOYJ 5FFZA 2M3AA 2CW8A 1B72B 4CCKA 3CUQA 3H3ZA 1DU6A 4BEHA 1MMSA 3OL3A 2ZNYA 5F06A 3FXRA 1TI1A 2KHPA 1QNTA 2QLZA 5E3OA 1R5ID 2LKPA 5CVUA 2H8WA 4M9XA 2P7CB 3EYIA 3HOZJ 1GTIA 3F4TA 4BVYB 2OF7A 4PJJA 1EOHA 2OCEA 3FF5A 1JT6A 2QENA 1PSQA 4XL9A 4D9JA 4XLCA 3F8MA 2DK5A 1QVUA 2PEXA 4LMYA 1A36A 5DCHA 4POBA 1NTCA 2QCOA 1O3SA 5CVJA 2CVDA 3NQOA 3HVVA 5HR0A 3M0FA 3TJGA 5INYA 2V1MA 3EUHC 3KZZA 1RIOH 1YRNA 2R37A 1F1ZA 1B9MA 4M9ZA 4E7KA 3S2DJ 2CZ2A 2L4QA 3TB2A 4PFOA 2K9NA 4ZBAA 3TP3A 4HNVA 2XBQA 4JU5A 4KDPA 3H79A 4NC8A 2H75A 3BG6A 5LBQA 3WGXA 3HD5A 4NUBA 1J08A 1E2YA 1ZOFA 3GKKA 5EG0B 2GAUA 2GA2A 2VBXA 3H9GA 2MD0A 4HNTA 4IQJA 2FXAA 3BCAA 4KE3A 4IZZA 2RUEA 1YW8A 1IZ1A 1I9DA 3OWTA 4HF1A 2Q1ZB 3HHVA 2QSFX 2Y0SN 3TRXA 4RDUA 4OU0A 2Y9ZA 3ERWA 3LMMA 4KIGA 3M8JA 1IRGA 4EVMA 2QQBA 2XC2A 3O6BB 4XONA 2ZKZA 1LEBA 4E8EA 3L00A 3Q0VA 4P9FA 2LJKA 1VFCA 3FM5A 3ZMSA 3L78A 4I2TA 1FBSA 2MW8A 2IJYA 2M34A 4CW9A 1F9MA 1LFBA 3DQVC 1EEMA 4B09A 5HR2A 2OBKA 4HZ2A 4OO4A 3HDCA 3GWZA 1WPKA 4V2FA 4B4CA 1L0OC 5IT9Z 3OR2C 2XUBA 4C30A 1FTZA 3PPUA 2L9VA 2VL8A 4MLYA 5HFIA 2E71A 1DE1A 2ECBA 2RIIA 1YYVA 4AYBN 4MA9A 3Q19A 1WJAA 2DMNA 2UZKA 2PMZN 18GSA 2E34A 4ZBDA 3HSFA 3RIRA 2DMMA 3DTKA 1DGWY 1OCRH 3PH9A 2PBJA 5DJMA 1XOAA 4MF7A 2ISZA 2P0WA 2C0GA 1FW1A 2O0YA 3F23A 3ZP5A 2X8HA 3KP3A 1GUHA 3KP4A 1EH8A 2MABA 4DOZA 3I4NJ 3DXJF 1KYWA 5HLGA 1NH3A 4LIVA 5IMCA 4BWSA 2BVLA 4KISA 2R0GA 4BVXB 1BR1A 3LSZA 1SJIA 1OYIA 1LE8A 4UNOA 3CBUA 4MZWA 2O8VB 2K9MA 3FKIJ 4HDUA 6GSWA 4F03A 4OFMA 4W1UA 2LNTA 1QHGA 5FKNA 2ETHA 1D8JA 2B3SA 3I4PA 5CP1A 3D1NI 1HOMA 4U87A 4TVEA 3DFGA 1SAUA 3BQYA 2IPAA 1PQNA 3QFBC 4WR5A 1PRXA 3QODA 2JZYA 5FRMA 1Z0XA 3FBIB 3H5NA 4E70A 5J3RA 2F5VA 3UARA 2ZCWA 3ZQ7A 1JZWA 2PU9C 4RBOA 5HNFA 5JCGA 1A6QA 4L9TA 3W2VA 1P7JA 2XAQA 1JGGA 2A4VA 5AIVA 1PVEA 3TOUA 2VIMA 2GZPA 2DMPA 1UAAA 3P7XA 2ID3A 4G0IA 4NQWB 2EK5A 3C71A 3OOUA 2EINH 2ZB9A 5B1AH 3SEQA 2C3TA 2DA4A 1FPQA 1WH5A 4ZDPA 3HOTA 4LOCA 1RUNA 3JRIA 2CYYA 3VWBA 2ON5A 1FO5A 1YZXA 3B6CA 3V8JA 4UXNA 2XF6A 1VQNI 1G3YA 4G7HF 1NG7A 2DTZA 3FY7A 3ZFLA 2DJJA 1ZRDA 2HLSA 1WHUA 4IP1A 12GSA 2YWOA 1RRJA 4YQUA 4I02A 4POLA 4ZZLA 4DZJA 1RUOA 2TCTA 2ZMEB 1G3WA 4GSSA 1IDYA 1UELB 1XX5A 4CCJA 3AG4H 4TRXA 5GAPD 4P96A 3RPUD 5EGOA 3HOUJ 1GNEA 2W25A 1USTA 4MGRA 1EWXA 2ME0A 4O3MA 2F48A 3FMSA 3GL5A 4KDYA 2EV5A 3L2RA 1YJWI 9ANTA 1T00A 3CRTA 4HLYA 4GQCA 3GZNB 5E59A 10GSA 1KU7A 1UN2A 4BACA 3LWAA 5CRGA 3BZKA 2HT9A 2KRCA 3V1WA 2GDRA 2EFQA 1Z3YA 2E2JJ 2KRFA 1BW5A 2VLVA 4M6XA 2PFBA 5GAEJ 3FXKA 3JTHA 3EMXA 2XKPA 1LFPA 3J80K 3FWEA 1FTTA 3IKVA 4CUGA 2I3YA 1O57A 4G9YA 1KA8A 2V2GA 2GT6A 2O7KA 2VKHA 1Y39A 3DXBA 2BZTA 1WJFA 3E97A 2CVBA 2IGOA 2V1NA 3VYRB 1VQOI 1HQOA 2V32A 3TKYA 4P1WA 1NHAA 1D5VA 2JT1A 3ZN0A 2V1XA 1B8IA 3Q74A 2MLGA 3QAGA 2X1CA 4EJVA 1TLHB 1FIPA 3KJYA 1IGNA 5DD8A 2VQGA 1LU4A 3HSEA 3I58A 1FVKA 2CAIA 1FSHA 1P4XA 3E7LA 4ZTJA 3KTBA 2L7MP 2XPEA 5HNHA 1QBJA 4ZILA 1MMDA 1I39A 1T7PB 1X9SB 4O5RA 1AWCA 4BU2A 4CCNA 1KU3A 3ERMA 2K18A 1PUFA 4UVCA 2VL3A 5TISC 1NK2P 1YIJI 1PKWA 2GOXB 5EPFA 4N9HA 2GOMA 5DBQA 2VKVA 3R6SA 1JE8A 3KETA 3UVTA 5LCZA 4XK4A 2O85A 3GTLJ 5IPGA 4N9IA 2LBFA 2NXNB 2HTSA 2HZTA 3CTAA 4KT5C 4XRSA 3WE2A 1SK1A 5B6MA 4ENMA 3A2KA 3BJ6A 3HJMA 3HXLA 4EKZA 5IYDJ 4X6AJ 3M1GA 3JW4A 3PNYA 2OUMA 5IYBJ 5CREA 1QHHD 3CXGA 1F5TA 3ISPA 2VLTA 5JCWA 4D73A 1MBKA 1T2KA 2F8FA 3RI4A 5LGTA 1ZYEA 5DTDA 1MMAA 4IQ4A 4BY7J 1ETYA 4F93B 1OMIA 5IMDA 3ZITA 2M4KA 4G10A 4XLAA 4OMVA 3G1OA 1DSBA 4XLHA 4EUYA 4BY1J 4CYCA 5F64A 3JREA 3KE2A 2HR3A 4PJNA 1FLIA 1DPUA 4EM0B 1TP9A 4UUSA 4KNYA 2MSYA 2VN2A 4WXTA 5AN1A 2RC4A 1QK8A 2F4OB 5GP9A 4AGSA 2A5YB 4ZBBA 5B3SH 1OFCX 2IA0A 1S3AA 4RM2A 3F4SA 4L9VA 2I9HA 1WSUA 3LJRA 5KN3A 3OR1C 4WWCA 1K6YA 2DAOA 4A5MA 2JZTA 2AXTC 4XSXF 2DKIA 3GH9A 1SD4A 4K2DA 2W57A 2W85A 1TBXA 3BP8A 3K4JA 5D6EA 1WZ2A 4QPQA 1MKMA 4XRFA 1AIUA 1JZDA 4PCQA 3I6AA 2E1MB 1SL1B 5FHIA 1YJ9I 3S2WA 2X6OA 2YOIA 3DRNA 5D8KB 3PFIA 4Y17A 4L5EA 3K2AA 2D45A 5JWRB 2GWRA 2A6HF 1MNDA 5F0FA 2WDUA 1WWJA 3CRUA 2LSTA 3VI5A 3RAZA 5IIZA 5ENUA 1B6AA 2IRFG 3K7AJ 2XC7A 3RTRA 3SYTA 2PUKC 3KMNA 2BV6A 2L59A 4KN7X 2NVQJ 4P9UA 3R60A 2HFDA 3DKSA 4NBQA 4A3GJ 3TUEA 5E3MA 1A0FA 3W8SA 1BA5A 5HS9A 1NK3P 4XIDA 3OYAA 1KNGA 2G0FA 2HQAA 2Q0OA 5E1WA 3NOFA 1WPIA 4EMSA 3H92A 2NBSA 4B3XA 3K4CA 1M2AA 3I9V2 2X0LA 2JZSA 2O89A 2LTPA 2M72A 5LNKe 2HI7A 3WTVC 4V2LA 2QGUA 2V4JC 1JKPC 2PGTA 4KH7A 1I1SA 2IGNA 3IXRA 13GSA 5D5VB 4MH3A 1XSDA 1V54H 3GX0A 4XS4B 3D6IA 1ON4A 5C00A 3Q9SA 4E7SA 4Y4RA 3SZPA 4IRHA 2QA1A 4JBAA 4IW9A 2HYJA 3M8FA 2ZO4A 1TDIA 3DPTA 3IRRA 2IAIA 3QYFA 4BQOA 2QUFA 3KX2A 3HDDA 1K4TA 3DKYA 3QYBA 3LXZA 4IS0A 5LLQA 3S1MJ 4A3JJ 3VPTA 2R4GA 1V40A 4ISDA 4E7JA 2CQQA 1V3FA 2IMFA 1WGXA 4CY6A 2O8XA 2OD5A 3DWLE 2LR8A 1M3JA 3LSRA 2E2GA 2P4WA 3CUOA 4DBQA 4BJTA 3KYDB 1R26A 4KF9A 2WAQN 5KHDA 3OYMA 2A3SA 1FNNA 4XNFA 2CUJA 3DU6A 5D5UB 3EUKL 1OC9B 1OKTA 4K0GA 1AKHA 4PX1A 1IN4A 2EIMH 3CJTB 5AIQA 1W4MA 3OS1A 5J9BA 3GHAA 5CVIA 1Z6NA 1G8XA 3M3YJ 2EWNA 3GEZA 3M9JA 3ZMKA 2BY3A 2BY0A 3GTOJ 4Q47A 2O9LA 4GQFA 1U5TC 4J2FA 1ZYRF 2F5DA 2MGQA 4PGGA 3K2ZA 1XB4A 4P55A 4UB8C 3TMOA 1B72A 3TOTA 2LKUA 2MG4A 1XGSA 4GO1A 2BY2A 2N8GA 1T39A 4PJ0C 4U7BA 1P6RA 4BVYA 3KH7A 5LFAA 2PPTA 3H1NA 1FOYA 4ACSA 2VT3A 5EJCA 5JCUA 4C2MJ 1SFXA 2R5YB 1MMNA 2HI3A 1J75A 3F21A 2LD5A 4K5SA 1SYXA 4BL7B 2LJAA 4OAZA 2H6YA 3E6BA 3IRQA 2L7FP 3GFLA 5BS6A 3HVXA 4IGJA 2GSTA 2CQ7A 1JKOC 2JRMA 2VD0A 3QFAC 3TO9A 3OY9A 1GUMA 1MDMB 2E5ZA 2CW0F 2LYCA 2H6ZA 3B6AA 5HLTA 4IOCF 3KIJA 5DALA 4FCYA 3CTGA 5G5EA 3LQRA 3B02A 3JAMZ 1R00A 4J57E 1V9WA 2L9SA 3F8BA 5ICFA 4G9HA 4I2UA 2NS0A 1O3QA 1N2AA 3Q18A 3DKWA 2XB5A 1OYWA 3AL0B 3HM5A 3EE2A 1H0MA 1W5TA 2HOEA 3EYYA 4RGRA 3FK6A 5GPAA 3QAWA 2YWMA 3ZMVA 1XMXA 2RQQA 1X1BA 4X0XA 2OKAA 2MH2A 1E6BA 1QO0D 2ADUA 2KIMA 3BJAA 11GSA 1R1TA 3HRSA 3S1NJ 4ZL7A 5HODA 1I5GA 3D5SC 5FD6A 4ESJA 1ZRFA 1TP4A 1RW1A 1SK2A 2PX9A 2MMZA 4ID0A 4M3GA 3GTUB 1SU9A 1TRUA 2VBYA 3N9JA 2G2QA 4W97A 2ZNZA 2E1NA 2O7OA 1GSQA 1XWBA 1J09A 2WCIA 3HA9A 1T33A 4BDZA 3I4MJ 1ZN2A 1XDSA 5ECIB 3QPLA 5FLXZ 4H4KC 3MVPA 1R6RA 2XAUA 4I6XA 2HVSA 2M5WA 3EUAA 2C3QA 4N11A 3ZMDA 4BWQA 4F0CA 2WTEA 5DCMB 4BHCA 1TXXA 4V2MA 4AIKA 2MMNA 5HDKA 1HDPA 3KZQA 1K78A 3HGYA 1ZREA 2ON7A 1RESA 4QIWN 4D1QA 3DLLF 4BE2A 1MJAA 1IYHA 2AQEA 2X51A 1ZCPA 2YJ7A 3VWVA 3WYWA 4BGDA 3QU6A 2JA5J 2HDCA 2JACA 2DJIA 4KIBA 4HDVA 3EC3A 5DCGA 2KFDA 1K0DA 2KUCA 4IXAA 4BVXA 2KHMA 4GCVA 2B1KA 3EWLA 1D1CA 4CCOA 4L0UA 5DVBA 1P9QC 3I43A 1B1BA 1USSA 3PM1A 2R7TA 2DW4A 1AW9A 1XWKA 3PGTA 1ZTRA 2DOEA 3QPSA 2LF8A 2LQQA 5AONA 1GWCA 3GBGA 2NVUB 3BG9A 4KUMA 4MJEA 5D9WA 3GLLA 3T0YA 2GQLA 1RI7A 5FRNA 1BX9A 2VUMJ 4IRIA 2F4MB 3F6OA 3W2AA 4RGXA 3BPXA 2J5OA 3F8FA 1NSWA 4ZL9A 1GHCA 1T3BA 2J9HA 3GTJJ 2OJED 3MKWB 2F5EA 2KLXA 4L8EA 4ZL8A 1Z3EA 1GT0C 2B7EA 1X0RA 1IRZA 5CRWA 1TU7A 2HWVA 4O5QA 2E5NA 5J1UA 3UNGC 3C1SA 3G7IA 3IHGA 5DAKA 4FETA 2R5GA 4WXCA 4AYBA 5K7ZA 4YIRX 1R9TJ 4NQWA 3GKXA 5KOWA 2PMZA 3GTQJ 1BI1A 1CGPA 2FU4A 2NAZA 2RN7A 1VI0A 2CV0A 2F4IA 3IKTA 3MIXA 1ZMAA 3QWLA 2J5PA 5IO0A 1GNWA 4CCMA 2KMUA 1ZGJA 4CZCA 1U3EM 3RPUA 5KCMA 2HYFA 1BG5A 1DDNA 5ED4A 1RR8C 3R3EA 3DF8A 2LG4A 2OV7A 2ESHA 3FXQA 3GZ5A 3ZQCA 2OTJI 5E8IA 3K8NA 3RPQA 1STZA 3WTUC 1I50J 4MK3A 1XC5A 2ZMEA 4E7LA 4GSTA 3TQNA 2GT5A 3TDUC 4MNNA 2ACJA 2EIRA 3G1MA 1JUSA 2GIVA 3CQFA 1TWHJ 1A24A 3OMYA 1M0UA 1VNDA 1EOGA 5J8FA 4EIQA 2CRGA 5M5WJ 3J81Z 4PDKA 3A1YA 3IUOA 4HSCX 2EH3A 4Z2TA 1FAAA 3QOPA 1OC3A 2X8GA 4A0YA 4KCEA 1WKMA 2JA6J 2PVQA 4G6TB 3IHQA 4YIFA 3W3CA 4Z2RA 3D4TA 5JVTA 4WK8F 1IRFA 2JSYA 4WR4A 4HU7A 5E3LA 1YLFA 1T08B 1YE9A 4B47A 4JR6A 3KH9A 4M6VA 2DA2A 1QQIA 3D0ZA 4F82A 1N75A 4NNJA 4N30A 5ILVA 3LYPA 4LA1A 2O5RA 2EFPA 5CQEA 3FMQA 4A69C 4MP4A 4E6KG 4POKA 3ZYWA 2VJJA 17GSA 2CX3A 5CRHA 3OSFA 2CA8A 3DEUA 2HXOA 4UUVA 4NDLA 4XMYA 3SHFA 3GUSA 2YX7A 3CF5F 4ULXA 3NRVA 3EMPA 1GSYA 3ASNH 3SFZA 3PNTA 1R58A 2ESNA 2KQRA 4GRIA 5TJJA 5ECRB 3J7AO 3F3QA 5B7CA 4GRFA 3PO2J 2QBYB 4BBRJ 1I5ZA 4ECIA 1FVJA 4DYQA 4HRIA 3RKXA 4ENNA 3HKRA 3BY6A 3GTKJ 4RLQA 3CMYA 4TOPA 2H74A 2RVCA 2F3MA 1SC7A 4ZC3A 1PL2A 4LLGF 4JX6A 1XWCA 5FLVA 1IV6A 1W5SA 5IMAA 1ERWA 5G1KA 1P2FA 2WB9A 5L3BA 3A01B 5FKOA 5LHHA 4FQGA 4I7HA 1JHFA 3CMEI 5CYYA 2HQNA 1XSVA 3CJNA 3EETA 4G6QA 1LJ9A 1AQWA 2H70A 5D5XB 1SVOA 4FX0A 2OE0A 4IKHA 3K4NA 4XHMA 2JSZA 1S7AA 1O4XA 3TKPA 2PI0A 1KU2A 4Q48A 2HFHA 2VB6A 2EFNA 3V7SA 4ZH4F 5B66C 1XPVA 3KEBA 2IMEA 4ZDLA 2QQ8A 2B5EA 1JHHA 4BXXJ 1AXDA 1MDIA 1RNLA 3KPHA 5C4JJ 3U5RE 4XRDA 2UWMA 2DK8A 1AHDP 2A2PA 2UV1A 3OYEA 2A69F 4NHZA 4A3DJ 3ZQGA 3TW7A 3KCMA 2GQQA 1X3ZB 1B4AA 2YCDA 1ZARA 3LAJA 2L57A 3G71I 5FKLA 2DMTA 4B1RA 5IT3A 3HOWJ 1KEBA 3CDLA 4KYWA 3S9FA 1D5YA 2CQXA 4TR3A 1VQ6I 4RGUA 4PK4A 2CV1A 2VE8A 4Q4ZF 3TKSC 2EQRA 2FF4A 3ZLPA 3M8EA 4OCEA 4FISA 3ELKA 4MF5A 1FBQA 4L0ZB 4JYKA 2DMUA 1MSFC 3A0HC 4AVZA 3N5OA 1B9NA 2QQ9A 3FR6A 1TK5B 1TQIA 2MA3A 2L4MA 4IJ3A 3NWTA 1Z7PA 2JMWA 4JEDA 1SJZA 1BBYA 2QKLB 3L9FA 3AFHA 3J7AY 1EV9A 3WGDA 4JX5A 1YX3A 1JGSA 2ME6A 4CYDA 5E4WA 2VODA 1HC8A 4MTEA 1BR4A 2Z16A 3VSLA 4E7HA 1KONA 1USBA 1YW7A 2K5CA 4FIWA 1K0MA 4IHTA 2DT6A 1FZPB 4N0BA 4Y33A 3CZ6A 2NTOA 2M0CA 3F8CA 1TW3A 5KAIC 2XPUA 1H9GA 4A3KJ 3CLOA 1V55H 2STWA 2C80A 2JZRA 3P2AA 5CO3A 2N5BA 3VYTB 2X49A 4EM1A 4XS4A 3VPRA 2BXZA 3C3WA 4O6JA 4HV5A 3KIOA 2RNJA 4F55A 1QMVA 1WOUA 2MMOA 3VURA 2UXNA 2HOTA 2CWEA 1IG7A 2VQHA 5KVRA 5IOYA 3ERFA 3F9UA 5GADJ 1DUGA 2ALBA 2DBCA 1W36C 4K8MA 3WD6A 3CESA 1RPWA 1WVRA 3SQNA 1OCTC 2HOSA 4FO5A 3CDHA 4Y13A 2EA2A 1OC9A 2DDBA 2IS6A 1PKZA 3WU0A 5ICEA 3E0JB 3FXMA 1XIYA 2H01A 3VK9A 4GGGA 3ABLH 1XVWA 3A2WA 1MZBA 2AQFA 4AIJA 1PX6A 3WE3A 3V4GA 1FYLA 2MLKA 4TKYA 5DJLA 3OYJA 3FMWA 4H0EA 1N77A 1JZOA 1YKAA 1Y6EA 1GLPA 1T0FC 3WTZA 2UUZA 2EA4A 4IO9F 2L2OA 4HZ4A 3CMIA 1SFOJ 4BHPA 2JU5A 3JRDA 3ABMH 2A61A 1YFHA 3PO3J 2Y2ZA 1YDKA 2C0DA 2K9SA 4DZPA 4TXOA 2MYGA 3H0GJ 3W6GA 4AJ6A 2V6EA 2R7SA 1K3LA 4DBRA 1WJKA 4WBJA 3M07A 3FRCA 4G0LA 1K0NA 2X1DA 3F22A 2DLLA 2ZFUA 4X0GA 3WGEA 2GXAA 3BTJA 5IPAA 3DTIA 2VQCA 1PMTA 1MJBA 4QL9A 2WS2A 4GSNA 4HPQA 2OA4A 2YV7A 1S3DA 3CJQB 1TTYA 3IK7A 5BMZA 4O5UA 3HG9A 3R2QA 1MIJA 4PSWA 4Q5RA 1IV8A 1XMAA 5H6RA 1Q98A 2L4AA 1SMYF 1M99A 4CO8A 4S0HB 4LG0B 2M7AA 1MDMA 3A5WA 5ECHB 1HKSA 2BE5F 4CXFA 4FX4A 5D5WB 1PP7U 3LSGA 2HDDA 1DQUA 2YZHA 3W6KB 2EIOA 1SMTA 4D5CA 5IP7J 1GUKA 2AAWA 5M3FJ 1PN0A 5DDLA 5IT9K 5ECPB 1W7PB 3GH6A 3KGKA 2NNYA 3ABTA 3HY2A 2CSOA 3PQKA 1FOXA 4FE4A 2HRFA 2ES7A 1J7KA 5IM9A 2PMTA 3H4KA 5DQSA 2PG4A 4EATA 5K5QA 2LKSA 4DNCA 1QA6A 2Z99A 3B73A 5HS8A 5D4RA 4UVBA 1UB9A 1MNEA 1W7PD 3K1MA 2KDZA 1O7UA 2FY6A 1U6TA 2K6VA 1Q1HA 2WFCA 4B8XA 2V79A 3O6TA 1O8WA 2BBYA 5FD5A 2Y48A 1FEXA 2DBBA 1O73A 4DSQA 3U1KA 1W36D 3KP5A 1ETVA 2GVPA 1TRWA 2A2SA 3SFIA 2JWTA 1HW5A 3K69A 4A3FJ 5FKKA 4KA4A 1ZG3A 3GUDA 4PJMA 1QZEA 5DCMA 5DDGA 5DM7F 4ABZA 1EV4A 2J23A 2LNSA 4IQAA 4J56E 2MBSA 3A3TA 4BDYA 3LSHA 5IOWA 2XHKA 3HHHA 3NWSA 3SZGA 4JBBA 2DMLA 1KQ8A 3OIQA 3D21A 3FDYA 4BXUA 1T4ZA 4FYCA 2E1CA 3O76A 2HPIA 2GLRA 1Z7UA 1OR7A 1K83J 4IL6C 1MSEC 1G6YA 3N05A 2MBTA 2NDOA 2P0GA 1M3IA 2RLIA 3LA3A 4ESFA 2YP6A 1X5DA 3OYFA 1KQ9A 4PUAA 2OE3A 1X3WB 3GL3A 3FXUA 5AISA 4DEJA 2C4JA 3V8LA 2KRHA 3Q9VA 2IGMA 4KGIA 5EVOA 1W5CC 1MTCA 2NVYJ 4KN4X 2OJLA 4RUVA 4Z2UA 1RZ4A 5EZGA 1JKRC 3LQ7A 5GSTA 3C1DA 1F43A 2EIQA 3FR3A 2A4HA 5ILUA 5KNLA 4JR4A 1WJEA 2V7FA 3I5UA 4GXOA 4CICA 4XIHA 2NVXJ 4F3QA 4L18B 3HUGB 3CCVI 6GSSA 4M6YA 1YF1A 4TR1B 2OE1A 4YH2A 3JSPA 3WGHA 3A4CA 3ECOA 4EGZA 1WFXA 2DODA 3FEUA 3IC7A 3W6JB 3A02A 4XN3A 2Q8KA 5L3CA 2AHEA 2VOCA 1DE2A 2H72A 4K7OA 4CA0A 2XASA 3IBHA 2VD1A 1ON1A 4V2GA 2ZCTA 2LUSA 2QGVA 1QZYA 1H8AC 3WTYC 3JCML 3LSIA 3ZVJA 1Z1DA 2PQ8A 3PFYA 3SEZA 5FFXA 2HNHA 1JKQC 3JSOA 1JLWA 1X5CA 2RUFA 1WCMJ 1FMWA 3F6DA 1ENHA 2KP6A 6PAXA 4GF0A 4KUNA 1M2DA 3MZHA 1HSJA 2LF7A 3DV8A 1GSUA 2A05A 4KITB 1OPCA 3OYCA 2DI3A 3LA7A 3I55I 2YNXA 2DDAA 3HTUA 1TTZA 1WRJA 4EM2A 2IMKA 4WETA 1I3QJ 3E6CC 1PFOA 1YY7A 2HSHA 5G30A 3VPQA 1A0RP 4A3MJ 3US3A 3I59A 2H73A 6GSVA 1S8NA 1HW2A 4PTSA 2D1VA 1IRXA 2L9NA 4L5JA 2V26A 3CLQA 4PZJA 4XN0A 2JADA 2XSDC 4XKWA 2ZC2A 2KZVA 4M74A 1TWGJ 3WG7H 3HBLA 1VF3A 1WP0A 2VL2A 1U9NA 2B1LA 4YKGA 4K9ZA 4GWRA 4C3JJ 2DPUA 4ILFA 4JRRA 1QU3A 4PQIA 1S9HA 1ILOA 1EGRA 1ONVA 3HOXJ 2YPRA 3GV1A 3H9JA 1IN7A 2DA5A 2GBYA 5LGUA 1TT5B 2FMYA 1ZL9A 3LFUA 4EDZA 4EJUA 1X2NA 2LDUA 3HRMA 2BEOA 3GTMJ 2X6XA 2ZXHA 4XKVA 5FB2A 3PIPF 4FYUA 5AIXA 4KT6A 1BIBA 1AOYA 3G7JA 4V19K 3H1CA 4R1HA 3HSRA 1F37A 1MBFA 1EA3A 4I2OA 3L09A 3OV8A 2OAZA 3CYNA 3TJKA 3KLOA 3UL3A 2K7LA 2E0QA 2LRTA 4HU9A 3IL2A 1F9NA 3M4OJ 1KGSA 3F63A 4LFUA 2VC1A 1GV5A 1J5YA 3RDIA 4BL0B 2QBYA 2DOAA 4MZBA 2AJQB 3VWUA 4BUPA 1S5LC 4AWXB 3FHZA 1XOBA 3ZQLA 4X1UA 1ETXA 2H66A 1YHQI 2K9QA 2VXDA 1F3BA 1TL8A 4MPFA 4HBLA 3C1RA 2CS3A 4B48A 4YFKF 2Z9SA 2QF7A 4ITVA 3DBRB 4F91B 3C7MA 5D8IA 3P5JA 4M73A 1TWFJ 4ESBA 5B1BH 3A01A 2F9SA 5KOXA 2FA8A 2OQRA 3VOEA 2DKHA 2RKHA 5CPRB 3SDBA 3U21A 2CUFA 2H71A 3HZ4A 2ZJRF 2XGXA 2W00A 2PWJA 1N78A 4ZZDA 4K0NA 1WJCA 4OO5A 1F2EA 1EP8A 3OOPA 3PJRA 3LSMA 4ZYEA 1R71A 2HOAA 3MD2A 4BQAA 2IS4A 5G2ZA 1HBXG 3UJ1A 1GSSA 1NHYA 1Z21A 3WHCA 1B48A 1K0CA 4LMWA 5E18F 4LB6B 2IL3A 1IXCA 3V7RA 1OKDA 2IFQA 3DIEA 4S04A 3D4MA 2WV1A 3I56I 2B6MA 4G0KA 1HKQA 2H1LA 3F6VA 2DLXA 1O8XA 4N10A 4USSA 1S3JA 3ULQB 2DYSH 4AC0A 2ZUPA 2X6WA 2YS9A 3HGGA 3GN3A 2M87A 3GLXA 2XBIA 4K1FA 1XGMA 2VI6A 5C4XJ 1T4YA 2H1KA 1NG6A 2EV6A 3ONQA 2D2WA 3CCMI 1MW7A 4DVCA 1K0OA 2IN3A 1GLNA 4CHUA 4DW6A 5K7HA 1CQHA 2DCEA 2ZXIA 2NNNA 3F9KA 4HG2A 4XOTA 1P92A 1VQLI 2IT0A 5BOXA 1FSEA 4ZYGA 1QVTA 4ANJA 3OYNA 1J9BA 1THXA 3RYRA 2HE3A 3BQZA 4XLFA 2CAQA 3ZRDA 2P5LC 5JWQB 2I5UA 3E5UA 3E6DA 3TKSE 1U9OA 4Z2YA 2M9HA 3KP9A 1L3LA 4XRMA 3LW9A 1FYMA 2QZ8A 2GSQA 4MABA 1U2WA 3QU3A 3F4RA 2P5KA 3IK9A 2FX0A 2YU9J 2IWTA 1F3AA 4HJMA 3CUQC 1UHMA 1ON2A 3OYHA 4C9YA 2TRXA 2DIZA 3PSIA 3C73A 2VL9A 4JOMA 2E7PA 1GVJA 4GYIA 3TO6A 5J41A 1TRVA 3W6VA 4OIPF 2H76A 3TJFA 1IXSB 1I3AA 3QOEA 5CRDA 1E3OC 4OAYA 3A2XA 4L9JA 2LMDA 4KB3A 1SD7A 2LY2A 4M3DA 3GW2A 1HF0A 2MMAA 3DCFA 3CSJA 4LMVA 3JRBA 5JWOB 2LV3A 2P5RA 3PUFA 4YAVA 1SL0B 1PX7A 1E3PA 2VCZA 4IPAA 2YWNA 2W48A 3GMFA 1MBGA 3OYGA 3ZMLA 3GFIA 3BC8A 4HEA2 5M5XJ 2HSYA 1T6SA 3FBNB 2FSWA 5EYRA 1YW9A 1YI2I 1Z9HA 2AB6A 4A3IJ 1VQ8I 2Z1DA 3NARA 3G2BA 1I6HJ 4DSSB 4RA2A 1MDJA 2VKDA 1HQCA 1HA8A 2UXXA 3ZRGA 3L9VA 1A35A 1P7IA 1X1CA 2W82A 3QAHA 4BJ6C 3CO7C 1KTEA 1G7OA 1Z67A 4I09A 2VXZA 4LB5A 3WG9A 3AG3H 3D5RC 1O7LA 5DEQA 5ELAA 3KFWX 4ECJA 3HEFA 1DP7P 1SJ6A 3N97A 2DSAA 4MCUA 4BE1A 4D5FA 2H19A 1B4PA 2ICWG 3HB9A 5DQYA 3DMLA 1HSTA 2ZNMA 1XWAA 4L5OA 1QPMA 4YKFA 3VLNA 3K4BA 3P9CA 2HSMA 3TOBA 4BH9A 1A2LA 3BR3A 5ICGA 2H8LA 1A5JA 2HZEB 3H9QA 1TT0A 2GXBA 4RAGA 1VQ5I 2EIJH 2KLOA 3UBKA 1IN6A 4F0BA 3JAMK 3OL4A 2A07F 3E3VA 2R7VA 3SJMA 3APSA 4HS1A 4ZXGA 1YKCA 2E2IJ 5EY6A 4RGSA 3CMAI 4M72A 2CFOA 4II2A 3RZDJ 3QQAA 2R7RA 3HYIA 1G3TA 4MF6A 1GTAA 3Q5FA 5ID2B 2HYXA 3VI7A 2RGVA 2VCQA 2A6EF 4O5VA 2IW5A 1APLC 1XCVA 2VLUA 3IAM2 5GAND 2V9KA 2HXIA 3I3LA 2DJNA 3UAPA 3HRUA 4LG0A 4LK1F 4DIQA 2OTLI 2W84A 3GMEA 4MEYF 5JHFA 5JFRA 5EG0A 4A0ZA 2P5QA 1BOAA 4AUXA 2DOFA 3VFIA 1FT9A 2FD5A 1TWCJ 4HNUA 3A03A 4RM3A 4DJAA 1W7PA 2IJLA 1YQ1A 3FIWA 1PA3A 3UBLA 1X1PA 3HTSB 1KU9A 3K1PA 3WHBA 2L5OA 5FLXK 2RM6A 4MJBA 3PNVA 3REOA 4MDCA 2GXGA 1TC3C 4G6DA 5IMFA 4CY8A 2YU3A 1V98A 4HX7A 2XPVA 2NPBA 5IMVA 1DBYA 3C18A 4OIQF 3K0LA 5LRRA 1RQMA 2TIRA 4MLOA 2R7XA 4IVFA 1JHBA 4XRAA 4LITA 5HDGA 3H0DA 3BJOA 1MH3A 2FQ3A 5B5EC 4FTHA 1CF7B 3I69A 3RPNA 2WAFA 3BDDA 3BLYA 1LVKA 4NV2A 1REPC 2XVCA 1BI0A 1FOHA 4RAYA 2H1GA 1U5TB 4GFBA 4EJWA 2XPDA 3L4NA 2P6TA 2IPQX 1D0YA 2Y0MA 3OIOA 4XLEA 3CQZJ 3L2QA 3CSHA 2O61A 1GV2A 1T1VA 4BIKA 4UHTA 5E1ZB 5L3EA 2BJXA 3MDKA 4NAXA 1LDDA 3SZTA 1S6LA 1M9BA 4EV0A 4L9NA 2H6XA 4RB0A 1Z6TA 3AY8A 3FZ5A 5TGTA 1PJRA 3BWGA 4J01A 2HTJA 1E0EA 3IPZA 1PL1A 5LD2C 4HQMA 1BR2A 3M1EA 4NC6A 4KMUX 4X4JA 2VC0A 1LPQA 3DP7A 3KEYA 2KOKA 4M3BA 1LEAA 3CCUI 3MNGA 1UFMA 1CQGA 2Y0SA 4MJAA 5FO5A 6GSYA 2G7HA 3EUHA 3G1LA 3I53A 1ZGAA 3AG1H 4BQQA 4G7ZF 3D5JA 1LJRA 4IQ1A 2NRAC 4G94A 3PIOF 1BEDA 2C0FA 3BJ5A 1EH7A 2QVOA 2PLYA 2JA2A 3O3KA 1SAXA 5J5NA 1XCCA 3S14J 2XAHA 2BMXA 3LFLA 4O7HA 1LBKA 1VQMI 4I97A 2LQOA 1GULA 4A5NA 1X1AA 2GA1A 2ZXWH 3IWFA 1K6OA 4C2UA 3M9KA 1XGOA 3UR3C 2VIXA 3HUGA 2DFHA 4TR1A 1X2MA 2LRDA 5KEJA 4KDUA 5JLWA 1IYIA 4EF0A 1TQPA 1O3RA 2MD5A 4QPOA 1LFUP 4BKXA 5D96A 1S3CA 3ROUA 1ZRCA 3X2QH 3TCOA 3V8KA 3I64A 1OE8A 4YG2F 3TBIA 2QA4I 2FA4A 5LRSA 4PNFA 3LSPA 4I0BA 1FOWA 5BPIA 2E36A 3BZCA 3J81K 3P9IA 2HQRA 5CYVA 5BQTA 4IHXA 1VZ0A 2EILH 2Y69H 4I98B 4OWYA 5D9XA 1U78A 4IOAF 2TDXA 3HKZN 3O8HA 2B9SA 1X9MB 3ML6A 3QDNA 4P3YB 4KCAA 3CCQI 3ZPLA 2L01A 3U1DA 2L02A 4BBSJ 2AXLA 1Z05A 4A3EJ 4LJZF 1U3AA 2EBIA 3ASOH 5DUIA 4PSXA 5J40A 2FGXA 3TKQA 5IP9J 1R5HA 1FBUA 1ULYA 2DJ3A 3FK7A 3Q3SA 3HC7A 3KYCB 2C1YA 2FLSA 2OPTA 1UC7A 4Y52J 4AIDA 1H75A 5GSSA 1H4OA 3GA4A 1Z9CA 2JUGA 5HOOA 3FXJA 4MQVA 3OYDA 3DWVA 3ESWB 2LJRA 3RPPA 3JTGA 2ID6A 3CCJI 1IUFA 1D3YA 1A8LA 1LQ1A 3VWXA 4L0YB 5LD0A 2K4BA 2LNBA 4LL4B 3SWLA 2DFEA 3IV5A 4HAMA 4RB3C 5GPCA 1BC7C 1V5FA 5LHGA 1MD3A 5FLMJ 2OBPA 5J6XA 1BL0A 2DIYA 2R7ZJ 1A8YA 1VRSD 2XHFA 5F05A 4A5PA 3GSSA 1FG4A 3APQA 2CH0A 3ZREA 7GSSA 2ELJA 2WWYA 4D7NA 2DQRA 2NOGA 1GUUA 3DEEA 2AYTA 1PGTA 2VCVA 2CU7A 1UHSA 1GXPA 1ZG1A 2RNGA 2YSRA 2W1OA 4HF2A 2FQ4A 1V57A 1J0FA 3CC2I 2R7UA 2IA2A 4LD5A 3CCSI 3TL4X 3GIXA 3GO5A 1W0TA 4LLLA 3ABUA 1GP1A 4U7DA 2XDVA 2FNOA 3DD3A 4NPBA 5IO2A 1X9WB 1G59A 1Q4JA 2B5YA 3GYKA 5C04A 3G4SI 1R1VA 4ZYAA 2VM1A 5KN1A 4CDOA 2L6CA 3A2VA 1SANA 1MJ9A 1GSEA 2L5LA 1SFEA 3FZAA 2F51A 1MBJA 2I10A 1A2JA 1Z7RA 3HZJA 1DUXC 4HOJA 1BOBA 1VQPI 5KK1A 3RSNA 2M45A 4ECBA 2RQPA 1R36A 1YTYA 4GDFA 1FB6A 2H30A 3DGQA 1A04A 2GQMA 2DMQA 3M7GA 4RI7A 1RETA 1YS6A 5A4WA 3QP5A 3VWWA 1IN8A 1Y0UA 3CD6I 1C72A 2VJ5A 3LWFA 4HQSA 4UV8A 4FT8A 4C3HJ 4PQHA 1OLTA 3KTLA 2IXSA 2QC7A 1LNWA 3GF2A 3E5XA 2A6TA 4HQEA 1N25A 1XN7A 2FCHA 1U0JA 2G7UA 2M1BA 4M71A 1PUEE 2K9FA 1V5GA 3MEXA 3UKGA 1SL2B 3KYLA 4IKFA 2H0IA 3BTLA 4V2NA 1WJDA 5IOXA 1OCZH 2LFBA 5F8BA 3TDZC 5A5KA 1SENA 4LG3A 1JTYA 3TW6A 1OVNA 1J59A 4OIRF 3L0HA 4AJ8A 4LIUA 3WU1B 3E6MA 1GDTA 1VQKI 5L3FA 2HNLA 2LK2A 3P9KA 2CV2A 1OJLA 2FA5A 1YOVB 2HKOA 2NS8A 2X48A 3K4MA 4EEFG 2HZFA 5JI6A 5EZHA 3K70C 3H93A 1Y8RB 5EF6A 3G73A 4OINF 2GZZA 2C0EA 1VF9A 3HYPA 4K5RA 2H0HA 1TOFA 4MQ9F 3F3XA 4QWQA 5J4YA 1R1UA 1XCBA 1URMA 2GSSA 4EDYA 1R23A 2IA1A 4UB6C 2PN8A 1OYYA 3H8QA 3QCPA 2MYSA 1XZOA 3MAKA 4PQ1A 5D73A 5AIPA 1I1GA 2F8AA 1JI8A 3DKXA 3ECHA 3HOVJ 4NXIA 4A3CJ 1Q1VA 4ZB9A 1WJ5A 3TJBA 1NM3A 4IHUA 4E4HA 2A5WA 1VQ9I 2I8DA 4BQNA 3I0TA 4PNGA 3KLNA 3I54A 4ZYDA 2H1DA 2KIFA 3MQ0A 5LHIA 1FC3A 4MFEA 4R79A 5L3DA 2YWIA 5F6FA 2E19A 2KPMA 2X99A 5G31A 4NV5A 2DA1A 4ICYA 4QQ7A 3K6GA 2L7KA 2YR2A 3KEOA 3JRGA 3WTSC 2FWEA 3DYRA 3L2VA 2FHEA 5DD4A 5J1RA 2F2EA 1UCRA 4TW5A 4RB1A 3BR5A 2WGRA 1YQAA 2HRNA 4II3A 1BYEA 2EFOA 2WV0A 2XAFA 2K3FA 3O2PE 4I0AA 2LREA 1WE0A 1OKRA 3LEFA 3AG2H 2X8CA 4KIFA 4OIOF 4MJCA 1YX5A 2LLKA 2QYOA 3R0AA 4HOBA 1Y1WJ 1GSFA 4R8HA 3DBLB 5LGNA 3DVWA 1Z3XA 3CTFA 3T8TA 4WF2A 3R0JA 1KZHA 1AU7A 2BGCA 1TU8A 5D9TA 1QPIA 3BR6A 1TK8B 2Q2EB 1KYZA 2E35A 4D0PA 4CCLA 1SFUA 3EU3A 3JRFA 1ZH5A 1OE7A 2V41A 4DSSA 1O3TA 4S05A 2JUCA 3BPVA 1G3SA 3RQIA 3DVXA 2ZXJA 2BXYA 3S16J 2FD3A 1ETWA 3DEWA 4NHJA 2V6KA 2VJ4A 2E2HJ 3HVSA 2CZ3A 4U0WA 3QMXA 1AUCA 1A6IA 3LSTA 4HV6A 2DC5A 1Y8QB 2YV9A 2NOJB 1W1WE 3FMRA 2ELHA 1V4RA 3IHUA 1OCCH 1BC8C 4QSHA 1IJWC 1WI9A 3KP7A 4HLXA 3P7NA 3F0IA 3QPHA 3L7WA 4ZYHA 4LLNA 2KKOA 2KP1A 3MSZA 5LEJA 5IMZA 2G0EA 3WT2A 1S7OA 3FR9A 4XLNF 2HZEA 1EGOA 1IF1A 1K4SA 2H6BA 3F8NA 4L5IA 4MIMA 3T1BA 3F6FA 1AKHB 5EL8A 1LUJB 5EEAA 4IRGA 3H36A 2R5YA 2R5ZB 5F07A 3J7ZI 1JLVA 2YUSA 4POMA 1UG2A 2B7JA 3HXSA 5HVQC 1ZYQB 3D0SA 5IYCJ 1RKWA 1XVQA 4BL7A 3QPTA 3S93A 2XRLA 4BHBA 1XD7A 3GSTA 3QYEA 4GXZA 1XG8A 2K02A 1FWZA 1JJ8C 3NAUA 4F7ZA 2VAFA 5ID2A 2V1UA 1K3OA 4YRVA 5FGMA 2EJRA 5IP6A 4HX8A 3RYPA 1R4MB 1TNTA 1ERVA 4RB2C 2WAQA 2CVKA 2P7VB 3PQJA 1FJLA 5ICCA 1X4OA 1HCRA 4YAPA 3HJEA 4PJLA 2XAGA 1YITI 5CVVA 2LS5A 4ECCA 2Z33A 3L1PA 1T8IA 1ZZYA 2HU9A 1QZZA 1B4QA 1M7TA 2HXKA 1R49A 1G6WA 4WBRD 1Z5YE 4WX9A 4GLTA 4X43A 2NS7A 2JK3A 4RS8A 2JPBA 2M30A 2WA0A 3F0CA 4PFPA 4QLCU 4MHGA 2BTOT 4YFXF 3TGZA 1X3UA 5J4VA 4BXFA 4WF5A 1K3YA 2HVQA 4JQFA 4A93J 1X5EA 1OQYA 2JJ7A 3GXOA 2DA6A 3CO6C 4LGWA 2GSRA 3HPGA 5DALB 2JRTA 4IHWA 1CF7A 2VCXA 3GTUA 4XRSG 1XXUA 1YF0A 3E3EA 1YS7A 5D9VA 5ECQB 5TRDA 4F2IA 2KISA 2FBHA 4XTSA 3OYKA 3M8NA 1S7EA 1OAZA 3BOQA 4X1EA 1SD8A 1U5TA 2AUVA 1MGTA 2I1UA 3KD0A 2VLAA 1ZGWA 3MYDA 1OCPA 3S3OA 4Q5FA 2OACA 4GYGA 2DT5A 20GSA 4AF2A 5IQYA 2Z5UA 1TNSA 1ZELA 5CAXA 1ZG5A 1Z6MA 22GSA 1P4AA 2R3XA 2FOWA 1FB0A 3N4MA 1GSDA 4RI6A 5ILSA 2PMHA 1FOKA 1ACIA 2LY1A 1N8JA 4Y7NJ 1Y6IA 1XGNA 3MCZA 3HRTA 4I5QA 3GTPJ 3H5AA 3GFJA 4MH2A 2H1BA 4ZB6A 1NW2A 2HPMA 2WY7Q 2JVHA 2ZMEC 3DTEA 4KJZA 3S32A 3L9UA 3PR8A 1ERTA 5FKMA
chains in the Genus database with same CATH topology
1TJDA 2YN1A 4PURA 3FZ4A 1YEXA 4MMMA 3UEMA 4JE1A 4NWYA 2XF7A 2HRAA 3QR6A 3BG7A 2M7BA 2BVMA 1UG0A 3BCIA 3IDVA 1KBNA 5ECNB 2OA7A 1ST9A 4O92A 1FOVA 2P31A 4KX4A 4V1Ap 4XORA 4B44A 2DJKA 3W2WA 1K0BA 1SKRB 1U87A 4FASD 1SK0A 2E2MA 4NMUA 4ZJZA 3VSKA 5ECKB 3EU4A 3RQ4A 2BOLA 3DU5A 3RCOA 3K4LA 3EVIA 1AA7A 2KL4A 4I8BA 4XS6A 2GGTA 5DAKB 5H5RA 2AV4A 3CSIA 4ML6A 1M2BA 3HPHA 4RMNA 3ISOA 3RBTA 4CH7A 4TN8A 2EC4A 2VM2A 1V58A 3BCKA 3LYKA 2LRCA 2R7OA 3H5RA 5KN0A 1X19A 2UZ8A 5ELGA 3C2GA 4AU7A 1XW6A 2QSIA 2CW7A 2IS2A 1JFUA 3CP2A 3OYLA 2XF5A 2LC2A 3C2HA 2CV4A 3MMYB 1ZYPA 1NHOA 2PJRB 1FHEA 5COHA 1WIKA 4KSMA 3ME8A 3HKZA 2K3PA 1HNAA 3Q6OA 3O3TA 1EEJA 2BW3B 1LKXA 1GL8A 2MFZA 5ABRA 1ML6A 4MPGA 4AJ7A 3NZNA 5B8AA 3F3RA 2E1MC 1YJ6A 3GKNA 1ZYNA 2YZUA 3FKFA 1AC1A 3PL8A 2LOOA 3CP8A 4FH8A 5HR3A 3K10A 2IMIA 1HNBA 5CNWA 4J00A 3QAVA 3S3MA 3E1SA 2WBMA 2HVRA 1F6MC 4RQRA 2WZ9A 1OC8A 3P8WA 3PINA 1AQVA 3GX8A 2R6KA 3RDWA 4XM3A 2H0GA 4PXOA 2L4CA 2VCTA 3UMAA 4XKBA 4OWRB 3FZ9A 4P5OA 4E7ZA 5J9CA 1R4WA 4JU5A 3OYBA 3FK8A 3GKMA 4Z7XA 1GRXA 1SKSB 3GNJA 3OS2A 3HZ8A 4ZTFA 4QL7A 4BPYA 1VF2A 2LTKA 3UIWA 1TW9A 1PYVA 4IX7A 3VDXA 3MKZA 1HNCA 4Q5QA 5ECSA 4N0VA 5A4UA 2FWHA 2I81A 1WRYA 2W7NA 5AGYA 2ZSIB 3QPMA 2L5QA 2IIYA 3ME7A 1QUWA 3G7YA 2O87A 2CQ9A 1DGRM 2RM5A 4YQVA 3CJRB 1RK4A 2DJ0A 2DJ2A 1TK0B 1XWGA 4B43A 4Q5NA 1THOA 2GZYA 3UOMA 4ZIJA 4F92B 2OADA 1EZKA 2CX4A 1O85A 1HYUA 3C8EA 3LXTA 1QQ2A 1U3IA 1MMGA 1ERDA 2RREA 4Y3OA