3VWUA

Crystal structure of peroxiredoxin 4 from m. musculus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
172
Chain Sequence
LSKAKISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKGVLRQITLNDLPVGRSVDETLRLVQAFQYTVCPAGWKPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin-4
publication title Synergistic cooperation of PDI family members in peroxiredoxin 4-driven oxidative protein folding
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 49
structure length 172
sequence length 177
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vwuA00
5G31A 5ECQB 5HR0A 1Q98A 1GSDA 1TRUA 3C7MA 3W8SA 4YH2A 1AAZA 4V2NA 3FR9A 2HT9A 1EZKA 1OE7A 4EC0A 2GDRA 3LXTA 2G0FA 1XPVA 4BL7A 5COHA 2YJHA 5D93A 12GSA 2H1BA 1S3CA 3HJPA 1ZYEA 3GSTA 2N5AA 3RHBA 1ERVA 3GNJA 1AQVA 1XWBA 3I69A 5F07A 2VL2A 2RUEA 1ERWA 2IMEA 2YN1A 4LMWA 1YJ6A 4F82A 2LKUA 4AF2A 4F03A 5KN0A 5G30A 3VLNA 1SK0A 1SJIA 1PX7A 1A2MA 4LLRA 4G10A 1TRSA 4N0ZA 3WT1A 1GSSA 1XWAA 4WKWA 2VL9A 4N10A 2VCWA 3N5OA 4ZXGA 4CHSA 2WJUA 1TRVA 2MMAA 2OBKA 4AJ7A 5FT3A 4MJEA 1LBKA 2IL3A 5G2ZA 5HR1A 2GSQA 4OD7A 5IOWA 5A4VA 2XPEA 3S9FA 1PX6A 3FZAA 5ELAA 4QL7A 4XRAA 1KNGA 1GULA 1G7EA 3OR5A 4MZBA 3GN3A 4TR0A 4DSSA 1JLVA 3I9V2 5B8AA 3ZMLA 4GSTA 3VWXA 1WE0A 17GSA 1SKWB 1H75A 2H66A 4PQ1A 2FA8A 3M3MA 3UBKA 3H1NA 5B6MA 4H86A 3F6DA 1NW2A 2XHFA 4WF4A 5CAXA 2IN3A 3LYPA 3GKXA 1EP7A 2WFCA 3GH6A 2HE3A 1ACVA 1ZGNA 4KCEA 1ST9A 1MEKA 3CRUA 3ERWA 4IVFA 1FB0A 1GTAA 2CZ3A 3IR4A 1A2JA 4WR4A 3IA1A 2DSAA 1XWKA 1JLWA 1PMTA 2EIQA 4KA0A 3RPNA 2REMA 1Q4JA 4HQSA 1VF2A 1AQWA 1U87A 3ZVJD 5DAKA 4YAVA 1TP9A 1QK8A 2WRTA 2LRTA 2GSSA 1AW9A 3LXZA 2AJQB 2OKAA 1Z5YE 2I3YA 2KOKA 1PD21 3UVTA 2GS3A 1U6TA 1K0DA 1O85A 3APOA 2IWTA 2K8VA 14GSA 2AHEA 3TDGA 1EOGA 3G7JA 4RUVA 2GSTA 5IPHA 1EOHA 1YEXA 4EO3A 3GTUB 3IXRA 1X5DA 1HNAA 1MD3A 4EDZA 2H1GA 5G1KA 1YQ1A 3TJKA 3ZVJA 1GRXA 2VIMA 4NHWA 3TKSE 1SU9A 6GSXA 1ERTA 2V41A 4PUAA 3GHAA 1FVKA 4Q5QA 4MP4A 2WGRA 3TOUA 1TI3A 19GSA 4TR1A 3QFBC 1M9BA 1YKAA 4HU9A 1Z6MA 1Y6EA 1O8WA 3HZ4A 4ZBDA 1JHBA 3F6FA 2JL4A 3CMIA 3LFLA 4CW9A 3ZZXA 2X8GA 1HD2A 1XBSA 3HVSA 1QMVA 2K6VA 4HQZA 1BX9A 2R5GA 4KH7A 3H8QA 5FHIA 1DUGA 3ZIVA 2V2GA 1FG4A 2LUSA 5HFKA 1TDIA 4MH3A 5ECPB 2LRCA 1VF1A 3FKFA 4JEDA 2CVDA 5CRDA 4POBA 1ML6A 2JACA 2MMNA 5ECKB 1JZDA 3DRNA 4KDYA 3R2QA 5ECMB 2YANA 3A2WA 5ECRB 3EU4A 3KXOA 2O87A 2LTKA 3KD0A 3UIWA 3D4TA 3L9UA 2FNOA 3RAZA 4ECIA 5CP1A 2GT5A 1S3AA 5HFGA 2LNSA 2F3MA 5ID2B 2YPMA 4XS1A 2WZ9A 2H76A 2M80A 3DMLA 1EP8A 5HFIA 2ON7A 5DQSA 5EY6A 3M8NA 1WIKA 3QDNA 4OFNA 1GUKA 3WGDA 4TVEA 1U3IA 4OCEA 4FH8A 2IMFA 3CRTA 1T8EB 1XCCA 1M2BA 4FYBA 4V1Ag 1V2AA 2FY6A 1TI1A 3DD3A 3CSHA 2K9FA 4RI6A 2L5LA 4WBRD 3A3TA 2I4AA 2R3XA 5JCWA 1DE1A 5GAPD 4F0BA 4HZ4A 1JZOA 3CTGA 2H6YA 4N0VA 1ZMAA 3GKKA 3KH9A 5F8BA 4ID0A 1FO5A 3TRQA 1N8JA 5CRHA 3KMNA 2MYGA 5D9XA 3JCML 2VCXA 3MNGA 3D4MA 1FVJA 4XHMA 1AC1A 1M2AA 1GP1A 5F0GA 2X99A 1B4QA 1K0MA 2H71A 2O89A 2H1AA 2OADA 5D73A 1O8XA 3CTFA 2F9SA 2PBJA 3NIVA 18GSA 1M0UA 1SK1A 2V1MA 2CA8A 2N5BA 2L59A 3LQ7A 5IOXA 16GSA 1GH2A 2CT6A 5FWGA 1TKDB 4NPBA 1VRSD 2M72A 4I5QA 2KLXA 2HLSA 3GRXA 1F3BA 2LEGA 2HRNA 2DBCA 5GAND 5F05A 4IKHA 2CV4A 1PKWA 2B5XA 3UL3A 2D2ZA 5JWQB 1I5GA 4Q5NA 3PINA 3DXBA 4V2MA 5GSSA 3A2XA 4X1UA 4NHZA 2H8LA 2L4QA 2HZEA 4O7HA 2MMZA 2P5QA 3GURA 3VK9A 3IAS2 4XTSA 3HHVA 5IMAA 1YEPA 2LJAA 2RUFA 4GSNA 3EE2A 2VUPA 5J4UA 2GSRA 5J5NA 4KDXA 1IYIA 2IMDA 3M9KA 4I6XA 3F0IA 1EV4A 2EIOA 1W89A 4RI7A 3WGEA 1TU7A 5ECHB 1F3AA 2H75A 4TRXA 4J2FA 3J7Yk 2L6DA 4KUNA 3IE3A 6GSUA 2LJKA 4KGIA 4AJ8A 5KN3A 1R5PA 2OBIA 1G7OA 3TJJA 4RQXA 3PGTA 1C72A 1GLQA 2FWHA 1ZYQB 3O3TA 3QAVA 2DLXA 2VM1A 2OA7A 1XOBA 4MLYA 4XRDA 1TW9A 2GQMA 2YWIA 5IIZA 4MCUA 4ML6A 1K3OA 2RLIA 2DIYA 4TXVA 5AIVA 3M0FA 3FZ4A 4HDEA 1XZOA 1TK0B 3HDCA 2H6XA 2GZZA 3TKPA 4N11A 1HNCA 2KP1A 2GZYA 1BYEA 2VD1A 3RDWA 1TXXA 1NM3A 3TJGA 2YNXA 2A2RA 2DMLA 4MF6A 2RM6A 2VL2C 3DVXA 3GSSA 2QGVA 2DC5A 3TKSA 3G9BA 3ISOA 1FHEA 2PPTA 2B7KA 2CAIA 2H0IA 1ZCPA 1KEBA 1THOA 2DJ3A 4GF0A 5ECSA 1F9MA 3D6IA 5DALA 1B4PA 3UMAA 2YWOA 3ZREA 4K7NA 3PR8A 2P0GA 1G6YA 3BJ5A 4EDYA 4ZB8A 1SJZA 3MWHA 4ULXA 3GX8A 3F3RA 1FB6A 1T3BA 2PVQA 4EXJA 4FO5A 3F4SA 5IPGA 2M46A 2YCDA 1A23A 4JBBA 1XFLA 3CSJA 1HNBA 11GSA 1PL1A 2C3NA 2L4CA 1M7TA 2GVPA 4IW9A 1ZZYA 1TK5B 1SL1B 2B1LA 3ZITA 4AGSA 2BTOT 5H5QA 2C0FA 5KN2A 1K0CA 2B1KA 4I8BA 3C71A 3NZNA 1YDKA 2JZSA 4RQRA 4OO4A 3LGCA 4MABA 1MTCA 1VF3A 5CYYA 1ZL9A 3E9JB 2H01A 2BJXA 2VD0A 5ENUA 3GFKA 4HOJA 1T4YA 1GSQA 3IV4A 4EKZA 4WR5A 3L0HA 1B8XA 1K0NA 4ZL7A 4TXOB 1QQ2A 4LA1A 2NBSA 2E7PA 2FHEA 1UC7A 3TB2A 4ECCA 2PUKC 4LL4B 22GSA 1FOVA 5F06A 2HXKA 3APQA 4WF5A 20GSA 2VLVA 4OWYA 3RPPA 2ON5A 3J7Yb 3ZLPA 1X9MB 3FHKA 1OVNA 2DIZA 3UJ1A 2E2MA 3D22A 4J57E 1WOUA 2YV9A 4XS4B 1ZOFA 4V2LA 2H73A 2K18A 5DJLA 4D73B 4IJ3A 2E2GA 4IP6A 3EMPA 4HU7A 1R7HA 1GNEA 3ERFA 1SYXA 2GTUA 4KNDA 2FLSA 5L71A 1YZXA 4NV5A 2HZFA 4TKYA 1SD9A 4MJAA 6GSYA 1CQGA 2A4VA 2VCZA 4JE1A 3ZL5A 1PKZA 4JZQA 1TJDA 5ECIB 4GTUA 2VLUA 3FW2A 3PH9A 2LRNA 3ED3A 4OMVA 1OKTA 4I2UA 1BEDA 5IMVA 4TR3A 1T4ZA 1MDKA 3P8WA 1R4WA 2R4VA 3KM6A 3TJBA 3GKMA 4F9ZA 1YF0A 1EEJA 3QD9A 1BAYA 3ZMKA 4DVCA 1FAAA 4OFTA 3E3EA 1QXHA 3ME8A 5C00A 1OC9B 1GUMA 1V40A 2QSIA 3VWVA 1GSYA 4K9ZA 1PQNA 2TRCP 3CBUA 4ZL9A 2KHPA 2J23A 3UAPA 1TTZA 4JR6A 2F8AA 3G7IA 1V9WA 4K0GA 3HZ8A 2VCQA 4YQUA 2IFQB 4PNFA 2KP2A 3F63A 3W8JA 4NMUA 3A5WA 2H6ZA 8GSSA 9GSSA 3L4NA 1VF4A 2JZTA 3HVXA 1O81A 1MDIA 1JFUA 3TKRA 2PU9C 3P90A 3DVWA 5IO2A 10GSA 1SENA 2FWGA 5DQYA 3ZRDA 2AAWA 4BPYA 2GT6A 4OCFA 4FYUA 2ZCTA 2MMOA 1WWJA 3EC3A 3VWUA 1ABAA 4PNGA 1OKDA 4JR4A 1B9XC 4ECBA 2DJ0A 1PGTA 3BCIA 2B6MA 4EUYA 5J41A 2P5RA 2GLRA 1U88A 2JSZA 1JZWA 3IHQA 2X8CA 1M2DA 3G7YA 4F0CA 4WBJA 4MF7A 4IHUA 5G1LA 1O7UA 2V32A 3D21A 3EYTA 4DSQA 5EL8A 4Q5RA 4ZB6A 1DBYA 1UVZA 5J3RA 4POKA 3KIJA 3QOUA 2P31A 4L0UA 1BJXA 1LU4A 4PURA 1SYRA 2WS2A 5DDLA 2GQKA 2B3SA 1SK2A 5CRGA 3US3A 2CVBA 3LG6A 2PN8A 2NDOA 5G5FA 5AN1A 1URMA 2NPBA 4DSRA 3VPQA 5IMFA 2H1DA 3QAWA 1WPIA 3FYGA 2XBIA 2C3QA 3WD6A 3DIEA 3VI5A 4DSSB 1TU8A 1YF1A 1F2EA 5A4WA 2FUG2 1YKCA 1XW9A 4NV2A 3QPMA 4IGJA 3KTBA 3UARA 3ZIJA 3F3QA 4OO5A 3HYPA 2PGTA 3EURA 2B5YA 2CAQA 4PXOA 2XBQA 4ZILA 1Z7RA 1A8LA 2L5OA 4QL9A 1V57A 1J08A 4MA9A 1PRXA 1K0BA 4G19A 4E8EA 2OE3A 2R2JA 3QAGA 3F8UA 1EGOA 3TUEA 3Q74A 2NVLA 1K0AA 1NSWA 2AB6A 3GUSA 3GYKA 3IAM2 2IMIA 3DWVA 2PVOC 4F2IA 5DAKB 2GZPA 5ECNB 3RHCA 1AIUA 1PL2A 2O85A 4GCIA 3WYWA 2YJ7A 2RM5A 2N5FA 1KBNA 1TOFA 2YOIA 2VCTA 3U5RE 5DJMA 2VM2A 4MDCA 2I1UA 2RIIA 1M9AA 2C1YA 4POMA 4HEA2 3ME7A 4ZB9A 3GH9A 2B5EA 4O92A 4NAXA 4ECJA 1OC3A 1UN2A 4ACSA 3KMOA 2TIRA 4HI7A 5LD0A 3CYNA 2C0EA 3EMXA 1WJKA 3GTUA 3MDKA 2JZRA 3O76A 1GWCA 1ON4A 4GRFA 3VURA 1J0FA 5ABRA 1QUWA 2LSTA 2MZCA 1W4VA 4KB3A 1AQXA 1N2AA 1THXA 3P7XA 1Z7PA 4ZL8A 4TR1B 1XW6A 2DMMA 4KCAA 1R5AA 5KEJA 2R37A 1BG5A 6GSVA 5E59A 4WXTA 4AJ6A 1O6JA 2XC2A 1XW5A 4GWRA 1GSEA 2OJLA 4KX4A 3F4RA 4DEJA 3GV1A 3KCMA 1S3DA 3TKSC 1PN9A 1JZRA 2LJRA 4GSSA 3FEUA 1K0OA 6GSTA 3EVIA 5HR2A 1TK8B 4BWQA 2LQOA 2CQ9A 5H5SA 4ISDA 4X43A 5IMZA 3EINA 2ZUPA 3TOTA 1I9DA 3EU3A 2O7KA 2C4JA 4IS0A 3KEBA 2ZNMA 2VL3A 3KGKA 4ZBBA 1USBA 3DEXA 3L9VA 1DSBA 4G2EA 2H0GA 3Q6OA 4K1FA 5D96A 4XS6A 2LS5A 2WDUA 5JCUA 3H93A 2IIYA 2OE0A 3W6GA 5IMDA 4J56E 5ID2A 3IDVA 4FIWA 4ML1A 2H74A 3C1RA 1WMJA 2GQLA 1XWCA 4I2TA 1AUCA 1RQMA 2I9HA 3E0UA 4E8HA 2AYTA 2E0QA 2OACA 3QR6A 5E4WA 3KTLA 4IQ1A 3LYKA 3M9JA 3KZQA 1EGRA 3UOMA 2MBTA 1WRYA 3C1SA 5GSTA 4K6XA 2KUCA 3WT2A 3HJMA 4MF5A 5IM9A 1T00A 4HS1A 4MJCA 5CREA 13GSA 1IYHA 4L5OA 2JU5A 2VLTA 5KN1A 3QMXA 1T1VA 3GX0A 3DKSA 1A0RP 2CVKA 1H4OA 3Q18A 2PMTA 3IK7A 3L9SA 2HFDA 5IQYA 4MZWA 5D9VA 2LV3A 5CO3A 5IO0A 3DGQA 4EF0A 4MPFA 4CDOA 4EL1A 4IP1A 1X9SB 3ZFBA 2YV7A 4MJBA 4PQHA 1EEMA 4MH2A 1ERUA 4IJIA 3HJOA 2VOCA 3APSA 5B7CA 1K3YA 4KSOA 5ECLB 2F8FA 5INYA 3FZ9A 3GIXA 1V58A 4L5LA 4X0XA 5D9WA 3RBTA 2WULA 4IBPA 3CSIA 2DJKA 4JU5A 4O32A 2Z9SA 4TW5A 1SL0B 1X5CA 1A2LA 2LNTA 4HJMA 2HSYA 4TOPA 3VWWA 1A0FA 2HZEB 2NTOA 1O73A 2GGTA 3V1WA 2LQQA 1X0RA 3M1GA 5CRWA 2J9HA 2CX3A 3CXGA 2ES7A 5AISA 4GXZA 3QCPA 4GQFA 4N30A 1NHOA 4WETA 4ILFA 3UEMA 4KAEA 2H0HA 4EE0A 1KTEA 4G9HA 2AV4A 1K3LA 1PA3A 2G2QA 3IOSA 4WEYA 1NHYA 2B7JA 4PX1A 3TGZA 4FYCA 1Z6NA 3IC4A 2C0GA 2YWMA 2DJJA 2EIRA 7GSSA 3F9UA 3ERGA 1LJRA 1YY7A 2YZUA 3BOAA 1X5EA 2QC7A 3FRCA 5GZZB 4BVYA 3O6TA 4KE3A 3P2AA 2HYXA 2TRXA 1QFNA 2K8SA 2JADA 1XIYA 3KH7A 6GSWA 3LEFA 1HQOA 1EV9A 2F51A 2HSHA 2OE1A 3L78A 3HKRA 3KP8A 2IJYA 1T7PB 4EVMA 4K2DA 2CZ2A 3EWLA 5JCGA 5LCZA 2V6OA 5LNKe 3IPZA 3TJFA 3LJRA 2EC4A 1F37A 4NWYA 3I6AA 1QGVA 1R26A 1SJ6A 3BD2A 3FK8A 4MMMA 1WP0A 5DBQA 2FWEA 4XIHA 1SKRB 1Z3EA 2PWJA 2HRFA 4HUAA 4QQ7A 4MK3A 1OYJA 2FWFA 4TN8A 5ECOB 3BCKA 5DALB 2WB9A 2JSYA 3HY2A 1GTIA 3NOFA 1U3AA 1E2YA 4K7IA 2C0DA 3DYRA 3A2VA 5A4UA 5B8BA 2C3TA 1GNWA 5DVBA 2ALBA 4TR4A 3SBCA 1G6WA 2WCIA 1M99A 4YQVA 3VFIA 4L0WA 1OAZA 4KSMA 2VCVA 3C8EA 4YAPA 2H70A 1E6BA 2YWNA 3IBHA 3F4TA 2HI7A 3D5JA 1B48A 5J9BA 1XXUA 1SKSB 3ZFLA 4IQAA 1X9WB 4HJ2A 3FR6A 3ZYWA 1XVQA 1OC8A 2DJ2A 2PERA 3VI7A 1DE2A 4IN0A 2C8UA 5A5KA 1A8YA 1F6MC 4Z7XA 1PSQA 2A2SA 1GSUA 2AUVA 5D9TA 4BA7A 3VPTA 3KP9A 1GUHA 4V1Ap 3C73A 3HVVA 1Y25A 2FA4A 3FR3A 3GL3A 4P3YB 1V98A 1XVWA 2YP6A 4ZBAA 5JWRB 2BMXA 3WGXA 3SWLA 4YQMA 2L6CA 4KW6A 1ILOA 3H79A 1GTUA 4GQCA 3IRAA 3Q19A 1XOAA 3IK9A 1BQ7A 4L8EA 1RW1A 5C04A 3UBLA 2X8HA 2HNLA 1VGLA 3GL5A 3HD5A 4JRRA 1GTBA 6GSSA 4NXIA 3HXSA 2H19A 4TXOA 2VO4A 4K8MA 1GLPA 1GSFA 3KJYA 3N9JA 3U6VA 5AIXA 2H72A 4ZIJA 2IMKA 4LMVA 2QKEA 2FGXA 5HQPA 1SL2B 5B6NA 3FZ5A 4IELA 4POLA 3ZTLA 5EPFA 3D0ZA 5CNWA 4XS4A 3K8NA 1GL8A 3GMFA 3AY8A 4D73A 5H5RA 2FCHA 3BBYA 1Z9HA 2DJ1A 2V6KA 2X64A 4MPGA 2FD3A 3H4KA 1AXDA 3LWAA 5G5EA 1A24A 2CX4A 4PGTA 3QFAC 2H30A 1OE8A 3LORA 5AGYA 4K7OA 1EWXA 1FW1A 3FY7A 5ELGA 1RK4A 4BVXA 2R6KA 2XPDA 4K0NA 4KDUA 5EVOA 2O8VB 1MDJA 2C80A 1XWGA 3TRPA 1G0TA 3GA4A 3TCOA 4HZ2A 3TKQA 1MD4A 1SD8A 1J9BA 4PUFC 1B9YC 3UVHA 1TRWA 1OC9A 3GKNA 3LSZA 5J9CA 4OFMA 1HYUA 4BWSA 4LL1B 5IMCA 4GLTA 3MAKA 3TRXA 2YZHA 5DCGA 3I43A 4O5RA 2IFQA 1CQHA 2IPAA 4I97A 3HA9A 2MBSA 5HR3A 3HCZA 1UA5A 4MZCA 4XCSA 5DCHA 5D8IA 2I81A 2VAFA 5JWOB 4PQIA 3MSZA 2L57A 4Q5FA
chains in the Genus database with same CATH superfamily
5G31A 5ECQB 5HR0A 1Q98A 1GSDA 1TRUA 3C7MA 3W8SA 4YH2A 1AAZA 4V2NA 3FR9A 2HT9A 1XG8A 1EZKA 1OE7A 4EC0A 2GDRA 3LXTA 2G0FA 1XPVA 4BL7A 5COHA 2YJHA 5D93A 12GSA 2H1BA 1S3CA 3HJPA 1ZYEA 3GSTA 2N5AA 3RHBA 1ERVA 3GNJA 1AQVA 1XWBA 3I69A 5F07A 2VL2A 2RUEA 2X49A 1ERWA 2IMEA 2YN1A 4LMWA 1YJ6A 4F82A 2LKUA 4AF2A 4F03A 5KN0A 5G30A 3VLNA 1SK0A 1SJIA 1PX7A 1A2MA 4LLRA 4G10A 1TRSA 4N0ZA 3WT1A 4Z2UA 1GSSA 1XWAA 4WKWA 2VL9A 4N10A 2QA1A 2VCWA 3N5OA 4ZXGA 4CHSA 2WJUA 1TRVA 2MMAA 4A5PA 2OBKA 4AJ7A 5FT3A 4MJEA 1LBKA 2IL3A 5G2ZA 5HR1A 2GSQA 4OD7A 5IOWA 5A4VA 2XPEA 3S9FA 1PX6A 3FZAA 5ELAA 4QL7A 4XRAA 1KNGA 1GULA 1G7EA 3OR5A 4MZBA 3GN3A 4TR0A 4DSSA 1JLVA 2R0CA 3I9V2 5B8AA 3ZMLA 4GSTA 3VWXA 1WE0A 17GSA 1SKWB 1H75A 2H66A 4PQ1A 2FA8A 3M3MA 3UBKA 3H1NA 5B6MA 4H86A 3F6DA 2DKIA 1NW2A 2XHFA 4WF4A 5CAXA 2IN3A 3LYPA 3GKXA 3MIXA 1EP7A 2WFCA 3GH6A 2HE3A 1ACVA 1ZGNA 4KCEA 1ST9A 4KF9A 1MEKA 3CRUA 3ERWA 4IVFA 1FB0A 1GTAA 2CZ3A 3IR4A 1A2JA 4WR4A 4CY8A 3IA1A 2DSAA 1XWKA 1JLWA 1PMTA 2EIQA 4KA0A 3RPNA 2REMA 1Q4JA 4HQSA 1VF2A 1AQWA 1U87A 3ZVJD 5DAKA 4YAVA 1TP9A 1QK8A 2WRTA 2LRTA 2GSSA 1AW9A 3LXZA 2AJQB 2OKAA 1Z5YE 2I3YA 2KOKA 1PD21 3UVTA 2GS3A 1U6TA 1K0DA 1S3RA 1O85A 1ZYPA 3APOA 2IWTA 2K8VA 14GSA 2AHEA 3TDGA 1EOGA 3G7JA 4PTSA 4RUVA 2GSTA 5IPHA 1EOHA 1YEXA 4EO3A 4EIQA 3GTUB 3IXRA 1X5DA 1HNAA 2DKHA 3R3EA 1MD3A 4EDZA 2H1GA 5G1KA 1YQ1A 3TJKA 3ZVJA 1GRXA 2VIMA 4NHWA 3TKSE 1SU9A 6GSXA 1ERTA 2V41A 4PUAA 3GHAA 1FVKA 4Q5QA 4O5UA 4MP4A 2WGRA 3TOUA 1TI3A 19GSA 4TR1A 3QFBC 1M9BA 1YKAA 4HU9A 1Z6MA 4G0KA 1Y6EA 1O8WA 3HZ4A 4ZBDA 1JHBA 3F6FA 2JL4A 3CMIA 3LFLA 4CW9A 3ZZXA 4EIPA 2X8GA 1HD2A 1XBSA 2A4HA 3HVSA 1QMVA 2K6VA 4HQZA 1BX9A 2R5GA 4KH7A 3H8QA 5FHIA 1DUGA 3ZIVA 1M3IA 2V2GA 1FG4A 2LUSA 5HFKA 1TDIA 2X4AA 4MH3A 4YKFA 5ECPB 2LRCA 1VF1A 3FKFA 4JEDA 2CVDA 5CRDA 4POBA 1ML6A 2JACA 2MMNA 5ECKB 1JZDA 3DRNA 4KDYA 3R2QA 5ECMB 2YANA 3A2WA 5ECRB 3EU4A 3KXOA 2O87A 2LTKA 3KD0A 3UIWA 3D4TA 3L9UA 2FNOA 3RAZA 4ECIA 5CP1A 2GT5A 1S3AA 5HFGA 4K5SA 2LNSA 2F3MA 5ID2B 2YPMA 4XS1A 2WZ9A 2H76A 2M80A 3DMLA 1EP8A 5HFIA 2ON7A 5DQSA 5EY6A 3M8NA 1WIKA 3QDNA 4OFNA 1GUKA 3WGDA 4TVEA 1U3IA 4OCEA 4FH8A 2IMFA 3CRTA 1T8EB 1XCCA 1M2BA 4FYBA 4V1Ag 1V2AA 2FY6A 1TI1A 3DD3A 3CSHA 2K9FA 4RI6A 2L5LA 4WBRD 3A3TA 2I4AA 2R3XA 5JCWA 1DE1A 5GAPD 4F0BA 4HZ4A 1JZOA 3CTGA 2H6YA 4N0VA 1ZMAA 3GKKA 3KH9A 5F8BA 4ID0A 1FO5A 3TRQA 1N8JA 5CRHA 3KMNA 2MYGA 5D9XA 3JCML 2VCXA 3MNGA 3D4MA 1FVJA 4XHMA 1AC1A 1M2AA 1GP1A 5F0GA 2X99A 1B4QA 1K0MA 2H71A 2O89A 2H1AA 2OADA 5D73A 1O8XA 3CTFA 2F9SA 2PBJA 3NIVA 5BMUA 18GSA 1M0UA 1SK1A 2V1MA 2CA8A 2N5BA 2L59A 3LQ7A 5IOXA 16GSA 1GH2A 2CT6A 5FWGA 1TKDB 2UZ8A 4NPBA 1VRSD 2M72A 4I5QA 2KLXA 2HLSA 3GRXA 1F3BA 2LEGA 2HRNA 2DBCA 5GAND 4G0IA 5F05A 4IKHA 2CV4A 1PKWA 2B5XA 3UL3A 2D2ZA 5JWQB 1I5GA 4Q5NA 3PINA 3DXBA 4V2MA 5GSSA 3A2XA 4X1UA 4NHZA 2H8LA 2L4QA 4ICYA 2HZEA 4O7HA 2MMZA 2P5QA 3GURA 3VK9A 3IAS2 4XTSA 3HHVA 5IMAA 1YEPA 2LJAA 2RUFA 4GSNA 1ZYNA 3EE2A 2VUPA 5J4UA 2GSRA 5J5NA 4KDXA 1IYIA 2IMDA 3M9KA 4I6XA 3F0IA 1EV4A 2EIOA 1W89A 4RI7A 3WGEA 1TU7A 5ECHB 1F3AA 2H75A 4TRXA 4J2FA 3J7Yk 4BVYB 2L6DA 4KUNA 3IE3A 6GSUA 2LJKA 4KGIA 4AJ8A 5KN3A 1R5PA 2OBIA 1G7OA 3TJJA 4RQXA 3PGTA 1C72A 1GLQA 2FWHA 1ZYQB 3O3TA 3QAVA 2DLXA 2VM1A 2OA7A 1XOBA 4MLYA 4XRDA 1TW9A 2GQMA 2YWIA 5IIZA 4MCUA 4ML6A 1K3OA 2RLIA 2DIYA 4TXVA 3HVNA 5AIVA 3M0FA 3FZ4A 4HDEA 1XZOA 1TK0B 3HDCA 2H6XA 2GZZA 3TKPA 4N11A 1HNCA 2KP1A 2GZYA 1BYEA 4YKGA 2VD1A 3RDWA 1TXXA 1NM3A 3TJGA 2YNXA 2A2RA 2DMLA 4MF6A 2RM6A 2VL2C 3DVXA 3GSSA 2QGVA 2DC5A 3TKSA 3G9BA 3ISOA 1FHEA 2PPTA 2B7KA 2CAIA 2H0IA 1ZCPA 1KEBA 1THOA 2DJ3A 4GF0A 5ECSA 1F9MA 3D6IA 5DALA 1B4PA 3UMAA 2YWOA 3ZREA 4K7NA 3PR8A 2P0GA 1G6YA 3BJ5A 4EDYA 4ZB8A 1SJZA 3MWHA 4ULXA 3GX8A 3F3RA 1FB6A 1T3BA 2PVQA 4EXJA 4FO5A 3F4SA 5IPGA 2M46A 2YCDA 1A23A 4JBBA 1XFLA 3CSJA 1HNBA 11GSA 1PL1A 2C3NA 2L4CA 1M7TA 2GVPA 4IW9A 1ZZYA 1TK5B 1SL1B 2B1LA 3ZITA 4AGSA 2BTOT 5H5QA 2C0FA 5KN2A 1K0CA 2B1KA 4I8BA 3C71A 3NZNA 1YDKA 2R0GA 2JZSA 4RQRA 4OO4A 3LGCA 4MABA 1MTCA 1VF3A 5CYYA 1ZL9A 3E9JB 2H01A 2BJXA 2VD0A 5ENUA 3GFKA 4O5QA 4HOJA 1T4YA 1GSQA 3IV4A 4EKZA 4WR5A 3L0HA 1B8XA 1K0NA 4ZL7A 4TXOB 3EPTA 1QQ2A 4LA1A 2NBSA 2E7PA 2FHEA 1UC7A 3TB2A 4ECCA 2PUKC 4LL4B 22GSA 1FOVA 5F06A 2HXKA 3APQA 4WF5A 20GSA 1M3JA 2VLVA 4OWYA 3RPPA 2ON5A 3J7Yb 3ZLPA 1X9MB 3FHKA 1OVNA 2DIZA 3UJ1A 2E2MA 3D22A 4J57E 1WOUA 2YV9A 4XS4B 3MYDA 1ZOFA 4V2LA 2H73A 2K18A 5DJLA 4D73B 4IJ3A 2E2GA 4IP6A 3EMPA 4HU7A 1R7HA 1GNEA 3ERFA 1SYXA 2GTUA 4KNDA 2FLSA 5L71A 1YZXA 4NV5A 2HZFA 4TKYA 1SD9A 4MJAA 6GSYA 1CQGA 2A4VA 2VCZA 4JE1A 3ZL5A 1PKZA 4JZQA 1TJDA 4HSCX 4BVXB 5ECIB 4GTUA 4G0LA 2VLUA 3FW2A 3PH9A 2LRNA 3ED3A 4OMVA 1OKTA 4I2UA 1BEDA 5IMVA 4TR3A 1T4ZA 1MDKA 3P8WA 1R4WA 2R4VA 3KM6A 3TJBA 3GKMA 4F9ZA 1YF0A 1EEJA 3QD9A 1BAYA 3ZMKA 4DVCA 1FAAA 4OFTA 3E3EA 1QXHA 3ME8A 5C00A 1OC9B 1GUMA 2HSMA 1V40A 2QSIA 3VWVA 1GSYA 4K9ZA 1PQNA 2TRCP 3CBUA 4ZL9A 2KHPA 2J23A 3UAPA 1TTZA 4JR6A 4BIKA 2F8AA 3G7IA 1V9WA 4K0GA 3HZ8A 2VCQA 4YQUA 2IFQB 4PNFA 2KP2A 3F63A 3W8JA 4NMUA 3A5WA 2H6ZA 8GSSA 9GSSA 3L4NA 1VF4A 2JZTA 3HVXA 4CY6A 1O81A 1MDIA 1JFUA 3LW9A 3TKRA 2PU9C 3P90A 3DVWA 4USSA 5IO2A 10GSA 1SENA 2FWGA 5DQYA 3ZRDA 2AAWA 4BPYA 2GT6A 4OCFA 2HRAA 4FYUA 2ZCTA 2MMOA 1WWJA 3EC3A 3VWUA 1ABAA 4PNGA 1OKDA 4JR4A 1B9XC 4BL7B 4ECBA 2DJ0A 1PGTA 3BCIA 2B6MA 4EUYA 5J41A 2P5RA 2GLRA 1U88A 2JSZA 1JZWA 3IHQA 2X8CA 1M2DA 3G7YA 4F0CA 4WBJA 4MF7A 4IHUA 5G1LA 1O7UA 2V32A 3D21A 3EYTA 4DSQA 5EL8A 4Q5RA 4ZB6A 1DBYA 1UVZA 5J3RA 4POKA 3KIJA 3QOUA 2P31A 4L0UA 1BJXA 1LU4A 4PURA 1SYRA 2WS2A 5DDLA 2GQKA 2B3SA 1SK2A 5CRGA 3US3A 2CVBA 3LG6A 2PN8A 2HRKA 2NDOA 5G5FA 2QA2A 5AN1A 1URMA 4Z2RA 2NPBA 4DSRA 3VPQA 5IMFA 2H1DA 3QAWA 1WPIA 3FYGA 2XBIA 2C3QA 3WD6A 3DIEA 3VI5A 4DSSB 1TU8A 1YF1A 3CQFA 1F2EA 5A4WA 2FUG2 1YKCA 1XW9A 4NV2A 3QPMA 4IGJA 3KTBA 3UARA 3ZIJA 3F3QA 4OO5A 3HYPA 2PGTA 3EURA 2B5YA 2CAQA 4PXOA 2XBQA 4ZILA 1Z7RA 1A8LA 2L5OA 4QL9A 3FMWA 1V57A 1J08A 4MA9A 1PRXA 1K0BA 4G19A 4E8EA 2OE3A 2R2JA 3QAGA 3F8UA 1EGOA 3TUEA 3Q74A 2NVLA 1K0AA 1NSWA 2AB6A 3GUSA 3GYKA 3IAM2 2IMIA 3DWVA 2PVOC 4F2IA 5DAKB 2GZPA 5ECNB 3RHCA 1AIUA 1PL2A 2O85A 4GCIA 3WYWA 2YJ7A 2RM5A 2N5FA 1KBNA 1TOFA 2YOIA 2VCTA 3U5RE 5DJMA 2VM2A 4MDCA 2I1UA 2RIIA 1M9AA 2C1YA 4POMA 4HEA2 3ME7A 4ZB9A 3GH9A 4FQUA 2B5EA 4O92A 4NAXA 4ECJA 1OC3A 1UN2A 4ACSA 3KMOA 2TIRA 4HI7A 5LD0A 3CYNA 2C0EA 4X4JA 3EMXA 1WJKA 3GTUA 3MDKA 2JZRA 3O76A 1GWCA 1ON4A 4GRFA 3VURA 1J0FA 5ABRA 1QUWA 2LSTA 2MZCA 1W4VA 4KB3A 1AQXA 1N2AA 1THXA 3P7XA 1Z7PA 4ZL8A 4TR1B 1XW6A 2DMMA 4KCAA 1R5AA 5KEJA 2R37A 1BG5A 6GSVA 5E59A 4WXTA 4AJ6A 1O6JA 2XC2A 1XW5A 4GWRA 1GSEA 2OJLA 4KX4A 3F4RA 4DEJA 3GV1A 3KCMA 1S3DA 3TKSC 1PN9A 1JZRA 2LJRA 4GSSA 3FEUA 1K0OA 6GSTA 3EVIA 5HR2A 1TK8B 4BWQA 2LQOA 2CQ9A 5H5SA 4ISDA 4X43A 5IMZA 3EINA 2ZUPA 3TOTA 1I9DA 3EU3A 2O7KA 2R0PA 2C4JA 4IS0A 3KEBA 2ZNMA 2VL3A 3KGKA 4ZBBA 1USBA 3DEXA 3L9VA 1DSBA 4G2EA 2H0GA 3Q6OA 4K1FA 5D96A 4XS6A 2LS5A 2WDUA 5JCUA 3H93A 2IIYA 2OE0A 3W6GA 5IMDA 4J56E 5ID2A 3IDVA 4FIWA 4ML1A 2H74A 3C1RA 1WMJA 2GQLA 1XWCA 4I2TA 1AUCA 1RQMA 2I9HA 3E0UA 4E8HA 2AYTA 2E0QA 2OACA 3QR6A 5E4WA 3KTLA 4IQ1A 3LYKA 3M9JA 3KZQA 1EGRA 3UOMA 2MBTA 1WRYA 3C1SA 5GSTA 4K6XA 2KUCA 3WT2A 3HJMA 4MF5A 5IM9A 1T00A 4HS1A 4MJCA 5CREA 13GSA 1IYHA 4L5OA 2JU5A 2VLTA 5KN1A 3QMXA 1T1VA 3GX0A 3DKSA 1A0RP 2CVKA 1H4OA 3Q18A 2PMTA 3IK7A 3L9SA 2HFDA 5IQYA 4MZWA 5D9VA 2LV3A 5CO3A 5IO0A 3DGQA 4EF0A 4MPFA 4CDOA 4EL1A 4IP1A 1X9SB 3ZFBA 2YV7A 4MJBA 4PQHA 1EEMA 4MH2A 1ERUA 4IJIA 3HJOA 2VOCA 3APSA 5B7CA 1K3YA 4KSOA 5ECLB 2F8FA 5INYA 3FZ9A 3GIXA 1V58A 4L5LA 4X0XA 5D9WA 3RBTA 2WULA 4IBPA 3CSIA 2DJKA 4JU5A 4O32A 2Z9SA 4TW5A 1SL0B 1X5CA 1A2LA 2LNTA 4HJMA 2HSYA 4TOPA 3VWWA 1A0FA 2HZEB 2NTOA 1O73A 2GGTA 3V1WA 1PFOA 2LQQA 1X0RA 3M1GA 5CRWA 2J9HA 2CX3A 3CXGA 2ES7A 5AISA 4GXZA 3QCPA 4GQFA 4N30A 1NHOA 4WETA 4ILFA 3UEMA 4KAEA 2H0HA 4EE0A 1KTEA 4G9HA 2AV4A 1K3LA 1PA3A 2G2QA 3IOSA 4WEYA 1NHYA 2B7JA 4PX1A 3TGZA 4FYCA 1Z6NA 3IC4A 2C0GA 2YWMA 2DJJA 2EIRA 7GSSA 3F9UA 3ERGA 1LJRA 1YY7A 2YZUA 3BOAA 1X5EA 2QC7A 3FRCA 5GZZB 4BVYA 3O6TA 4KE3A 3P2AA 2HYXA 2TRXA 1QFNA 2A2PA 2K8SA 2JADA 1XIYA 3KH7A 6GSWA 3LEFA 1HQOA 1EV9A 2F51A 2HSHA 2OE1A 3L78A 3HKRA 3KP8A 2IJYA 1T7PB 4EVMA 4K2DA 2CZ2A 3EWLA 5JCGA 5LCZA 2V6OA 5LNKe 3IPZA 3TJFA 3LJRA 2EC4A 1F37A 4NWYA 4MNNA 3I6AA 1QGVA 1R26A 1SJ6A 3BD2A 3FK8A 4MMMA 1WP0A 5DBQA 1PN0A 2FWEA 4XIHA 1SKRB 1Z3EA 2PWJA 2HRFA 4HUAA 4QQ7A 4MK3A 1OYJA 2FWFA 4TN8A 5ECOB 3BCKA 5DALB 2WB9A 2JSYA 3HY2A 1GTIA 3NOFA 1U3AA 1E2YA 4K7IA 2C0DA 3DYRA 3A2VA 5A4UA 5B8BA 2C3TA 1GNWA 5DVBA 2ALBA 4TR4A 1FOHA 3SBCA 1G6WA 2WCIA 1M99A 4YQVA 3VFIA 4L0WA 1OAZA 4KSMA 2VCVA 3C8EA 4YAPA 2H70A 1E6BA 2YWNA 3IBHA 3F4TA 2HI7A 3D5JA 1B48A 5J9BA 1XXUA 1SKSB 3ZFLA 4IQAA 1X9WB 4HJ2A 3FR6A 3ZYWA 1XVQA 1OC8A 2DJ2A 2PERA 3VI7A 1DE2A 4IN0A 2C8UA 5A5KA 1A8YA 1F6MC 4Z7XA 1PSQA 2A2SA 1GSUA 2AUVA 5D9TA 4BA7A 3VPTA 3KP9A 1GUHA 4V1Ap 3C73A 3HVVA 1Y25A 2FA4A 3FR3A 3GL3A 4P3YB 1V98A 1XVWA 2YP6A 4ZBAA 5JWRB 2BMXA 3WGXA 4Z2TA 3SWLA 4YQMA 2L6CA 4KW6A 1ILOA 3H79A 1GTUA 4GQCA 3IRAA 3Q19A 1XOAA 3IK9A 3PPUA 1BQ7A 4L8EA 1RW1A 5C04A 3UBLA 2X8HA 2HNLA 1VGLA 3GL5A 3HD5A 4JRRA 1GTBA 6GSSA 4NXIA 3HXSA 2H19A 4TXOA 3IC8A 2VO4A 4K8MA 1GLPA 5KOXA 1GSFA 3KJYA 3N9JA 3U6VA 5AIXA 2H72A 4ZIJA 2IMKA 4LMVA 2QKEA 2FGXA 5HQPA 1SL2B 5KOWA 5B6NA 3FZ5A 4IELA 4POLA 3ZTLA 5EPFA 3D0ZA 5CNWA 4XS4A 3K8NA 1GL8A 3GMFA 3AY8A 4D73A 5H5RA 2FCHA 3BBYA 1Z9HA 2DJ1A 2V6KA 2X64A 4MPGA 2FD3A 3IHGA 3H4KA 1AXDA 3LWAA 5G5EA 1A24A 2CX4A 4PGTA 3QFAC 2H30A 1OE8A 3LORA 5AGYA 4K7OA 1EWXA 1FW1A 3FY7A 5ELGA 1RK4A 4BVXA 2R6KA 2XPDA 4K0NA 4KDUA 5EVOA 2O8VB 1MDJA 2C80A 1XWGA 3TRPA 1G0TA 3GA4A 3TCOA 4HZ2A 3TKQA 1MD4A 1SD8A 1J9BA 4PUFC 5BRTA 1B9YC 3UVHA 1TRWA 1OC9A 3GKNA 3LSZA 5J9CA 4OFMA 1HYUA 4BWSA 4LL1B 5IMCA 4GLTA 3MAKA 3TRXA 2YZHA 5DCGA 3I43A 4K2XA 4O5RA 4K5RA 2IFQA 1CQHA 2IPAA 4I97A 3HA9A 2MBSA 5HR3A 3A5IA 3HCZA 1UA5A 4MZCA 4XCSA 5DCHA 5D8IA 2I81A 2VAFA 5JWOB 4PQIA 3MSZA 2L57A 4Q5FA
chains in the Genus database with same CATH topology
5G31A 5ECQB 5HR0A 1Q98A 1GSDA 1TRUA 3C7MA 3W8SA 4YH2A 1AAZA 4V2NA 3FR9A 2HT9A 1EZKA 1OE7A 4EC0A 2GDRA 3LXTA 2G0FA 1XPVA 4BL7A 5COHA 2YJHA 5D93A 12GSA 2H1BA 1S3CA 3HJPA 1ZYEA 3GSTA 2N5AA 3RHBA 1ERVA 3GNJA 1AQVA 1XWBA 3I69A 5F07A 2VL2A 2RUEA 2X49A 1ERWA 2IMEA 2YN1A 4LMWA 1YJ6A 4F82A 2LKUA 4AF2A 4F03A 5KN0A 5G30A 3VLNA 1SK0A 1SJIA 1PX7A 1A2MA 4LLRA 4G10A 1TRSA 4N0ZA 3WT1A 4Z2UA 1GSSA 1XWAA 4WKWA 2VL9A 4N10A 2QA1A 2VCWA 3N5OA 4ZXGA 4CHSA 2WJUA 1TRVA 2MMAA 4A5PA 2OBKA 4AJ7A 5FT3A 4MJEA 1LBKA 2IL3A 5G2ZA 5HR1A 2GSQA 4OD7A 5IOWA 5A4VA 2XPEA 3S9FA 1PX6A 3FZAA 5ELAA 4QL7A 4XRAA 1KNGA 1GULA 1G7EA 3OR5A 4MZBA 3GN3A 4TR0A 4DSSA 1JLVA 2R0CA 3I9V2 5B8AA 3ZMLA 4GSTA 3VWXA 1WE0A 17GSA 1SKWB 1H75A 2H66A 4PQ1A 2FA8A 3M3MA 3UBKA 3H1NA 5B6MA 4H86A 3F6DA 2DKIA 1NW2A 2XHFA 4WF4A 5CAXA 2IN3A 3LYPA 3GKXA 3MIXA 1EP7A 2WFCA 3GH6A 2HE3A 1ACVA 1ZGNA 4KCEA 1ST9A 4KF9A 1MEKA 3CRUA 3ERWA 4IVFA 1FB0A 1GTAA 2CZ3A 3IR4A 1A2JA 4WR4A 4CY8A 3IA1A 2DSAA 1XWKA 1JLWA 1PMTA 2EIQA 4KA0A 3RPNA 2REMA 1Q4JA 4HQSA 1VF2A 1AQWA 1U87A 3ZVJD 5DAKA 4YAVA 1TP9A 1QK8A 2WRTA 2LRTA 2GSSA 1AW9A 3LXZA 2AJQB 2OKAA 1Z5YE 2I3YA 2KOKA 1PD21 3UVTA 2GS3A 1U6TA 1K0DA 1O85A 1ZYPA 3APOA 2IWTA 2K8VA 14GSA 2AHEA 3TDGA 1EOGA 3G7JA 4PTSA 4RUVA 2GSTA 5IPHA 1EOHA 1YEXA 4EO3A 4EIQA 3GTUB 3IXRA 1X5DA 1HNAA 2DKHA 3R3EA 1MD3A 4EDZA 2H1GA 5G1KA 1YQ1A 3TJKA 3ZVJA 1GRXA 2VIMA 4NHWA 3TKSE 1SU9A 6GSXA 1ERTA 2V41A 4PUAA 3GHAA 1FVKA 4Q5QA 4O5UA 4MP4A 2WGRA 3TOUA 1TI3A 19GSA 4TR1A 3QFBC 1M9BA 1YKAA 4HU9A 1Z6MA 4G0KA 1Y6EA 1O8WA 3HZ4A 4ZBDA 1JHBA 3F6FA 2JL4A 3CMIA 3LFLA 4CW9A 3ZZXA 4EIPA 2X8GA 1HD2A 1XBSA 2A4HA 3HVSA 1QMVA 2K6VA 4HQZA 1BX9A 2R5GA 4KH7A 3H8QA 5FHIA 1DUGA 3ZIVA 2V2GA 1FG4A 2LUSA 5HFKA 1TDIA 2X4AA 4MH3A 4YKFA 5ECPB 2LRCA 1VF1A 3FKFA 4JEDA 2CVDA 5CRDA 4POBA 1ML6A 2JACA 2MMNA 5ECKB 1JZDA 3DRNA 4KDYA 3R2QA 5ECMB 2YANA 3A2WA 5ECRB 3EU4A 3KXOA 2O87A 2LTKA 3KD0A 3UIWA 3D4TA 3L9UA 2FNOA 3RAZA 4ECIA 5CP1A 2GT5A 1S3AA 5HFGA 4K5SA 2LNSA 2F3MA 5ID2B 2YPMA 4XS1A 2WZ9A 2H76A 2M80A 3DMLA 1EP8A 5HFIA 2ON7A 5DQSA 5EY6A 3M8NA 1WIKA 3QDNA 4OFNA 1GUKA 3WGDA 4TVEA 1U3IA 4OCEA 4FH8A 2IMFA 3CRTA 1T8EB 1XCCA 1M2BA 4FYBA 4V1Ag 1V2AA 2FY6A 1TI1A 3DD3A 3CSHA 2K9FA 4RI6A 2L5LA 4WBRD 3A3TA 2I4AA 2R3XA 5JCWA 1DE1A 5GAPD 4F0BA 4HZ4A 1JZOA 3CTGA 2H6YA 4N0VA 1ZMAA 3GKKA 3KH9A 5F8BA 4ID0A 1FO5A 3TRQA 1N8JA 5CRHA 3KMNA 2MYGA 5D9XA 3JCML 2VCXA 3MNGA 3D4MA 1FVJA 4XHMA 1AC1A 1M2AA 1GP1A 5F0GA 2X99A 1B4QA 1K0MA 2H71A 2O89A 2H1AA 2OADA 5D73A 1O8XA 3CTFA 2F9SA 2PBJA 3NIVA 5BMUA 18GSA 1M0UA 1SK1A 2V1MA 2CA8A 2N5BA 2L59A 3LQ7A 5IOXA 16GSA 1GH2A 2CT6A 5FWGA 1TKDB 2UZ8A 4NPBA 1VRSD 2M72A 4I5QA 2KLXA 2HLSA 3GRXA 1F3BA 2LEGA 2HRNA 2DBCA 5GAND 4G0IA 5F05A 4IKHA 2CV4A 1PKWA 2B5XA 3UL3A 2D2ZA 5JWQB 1I5GA 4Q5NA 3PINA 3DXBA 4V2MA 5GSSA 3A2XA 4X1UA 4NHZA 2H8LA 2L4QA 4ICYA 2HZEA 4O7HA 2MMZA 2P5QA 3GURA 3VK9A 3IAS2 4XTSA 3HHVA 5IMAA 1YEPA 2LJAA 2RUFA 4GSNA 1ZYNA 3EE2A 2VUPA 5J4UA 2GSRA 5J5NA 4KDXA 1IYIA 2IMDA 3M9KA 4I6XA 3F0IA 1EV4A 2EIOA 1W89A 4RI7A 3WGEA 1TU7A 5ECHB 1F3AA 2H75A 4TRXA 4J2FA 3J7Yk 4BVYB 2L6DA 4KUNA 3IE3A 6GSUA 2LJKA 4KGIA 4AJ8A 5KN3A 1R5PA 2OBIA 1G7OA 3TJJA 4RQXA 3PGTA 1C72A 1GLQA 2FWHA 1ZYQB 3O3TA 3QAVA 2DLXA 2VM1A 2OA7A 1XOBA 4MLYA 4XRDA 1TW9A 2GQMA 2YWIA 5IIZA 4MCUA 4ML6A 1K3OA 2RLIA 2DIYA 4TXVA 5AIVA 3M0FA 3FZ4A 4HDEA 1XZOA 1TK0B 3HDCA 2H6XA 2GZZA 3TKPA 4N11A 1HNCA 2KP1A 2GZYA 1BYEA 4YKGA 2VD1A 3RDWA 1TXXA 1NM3A 3TJGA 2YNXA 2A2RA 2DMLA 4MF6A 2RM6A 2VL2C 3DVXA 3GSSA 2QGVA 2DC5A 3TKSA 3G9BA 3ISOA 1FHEA 2PPTA 2B7KA 2CAIA 2H0IA 1ZCPA 1KEBA 1THOA 2DJ3A 4GF0A 5ECSA 1F9MA 3D6IA 5DALA 1B4PA 3UMAA 2YWOA 3ZREA 4K7NA 3PR8A 2P0GA 1G6YA 3BJ5A 4EDYA 4ZB8A 1SJZA 3MWHA 4ULXA 3GX8A 3F3RA 1FB6A 1T3BA 2PVQA 4EXJA 4FO5A 3F4SA 5IPGA 2M46A 2YCDA 1A23A 4JBBA 1XFLA 3CSJA 1HNBA 11GSA 1PL1A 2C3NA 2L4CA 1M7TA 2GVPA 4IW9A 1ZZYA 1TK5B 1SL1B 2B1LA 3ZITA 4AGSA 2BTOT 5H5QA 2C0FA 5KN2A 1K0CA 2B1KA 4I8BA 3C71A 3NZNA 1YDKA 2R0GA 2JZSA 4RQRA 4OO4A 3LGCA 4MABA 1MTCA 1VF3A 5CYYA 1ZL9A 3E9JB 2H01A 2BJXA 2VD0A 5ENUA 3GFKA 4O5QA 4HOJA 1T4YA 1GSQA 3IV4A 4EKZA 4WR5A 3L0HA 1B8XA 1K0NA 4ZL7A 4TXOB 3EPTA 1QQ2A 4LA1A 2NBSA 2E7PA 2FHEA 1UC7A 3TB2A 4ECCA 2PUKC 4LL4B 22GSA 1FOVA 5F06A 2HXKA 3APQA 4WF5A 20GSA 2VLVA 4OWYA 3RPPA 2ON5A 3J7Yb 3ZLPA 1X9MB 3FHKA 1OVNA 2DIZA 3UJ1A 2E2MA 3D22A 4J57E 1WOUA 2YV9A 4XS4B 3MYDA 1ZOFA 4V2LA 2H73A 2K18A 5DJLA 4D73B 4IJ3A 2E2GA 4IP6A 3EMPA 4HU7A 1R7HA 1GNEA 3ERFA 1SYXA 2GTUA 4KNDA 2FLSA 5L71A 1YZXA 4NV5A 2HZFA 4TKYA 1SD9A 4MJAA 6GSYA 1CQGA 2A4VA 2VCZA 4JE1A 3ZL5A 1PKZA 4JZQA 1TJDA 4BVXB 5ECIB 4GTUA 4G0LA 2VLUA 3FW2A 3PH9A 2LRNA 3ED3A 4OMVA 1OKTA 4I2UA 1BEDA 5IMVA 4TR3A 1T4ZA 1MDKA 3P8WA 1R4WA 2R4VA 3KM6A 3TJBA 3GKMA 4F9ZA 1YF0A 1EEJA 3QD9A 1BAYA 3ZMKA 4DVCA 1FAAA 4OFTA 3E3EA 1QXHA 3ME8A 5C00A 1OC9B 1GUMA 2HSMA 1V40A 2QSIA 3VWVA 1GSYA 4K9ZA 1PQNA 2TRCP 3CBUA 4ZL9A 2KHPA 2J23A 3UAPA 1TTZA 4JR6A 2F8AA 3G7IA 1V9WA 4K0GA 3HZ8A 2VCQA 4YQUA 2IFQB 4PNFA 2KP2A 3F63A 3W8JA 4NMUA 3A5WA 2H6ZA 8GSSA 9GSSA 3L4NA 1VF4A 2JZTA 3HVXA 4CY6A 1O81A 1MDIA 1JFUA 3LW9A 3TKRA 2PU9C 3P90A 3DVWA 4USSA 5IO2A 10GSA 1SENA 2FWGA 5DQYA 3ZRDA 2AAWA 4BPYA 2GT6A 4OCFA 2HRAA 4FYUA 2ZCTA 2MMOA 1WWJA 3EC3A 3VWUA 1ABAA 4PNGA 1OKDA 4JR4A 1B9XC 4BL7B 4ECBA 2DJ0A 1PGTA 3BCIA 2B6MA 4EUYA 5J41A 2P5RA 2GLRA 1U88A 2JSZA 1JZWA 3IHQA 2X8CA 1M2DA 3G7YA 4F0CA 4WBJA 4MF7A 4IHUA 5G1LA 1O7UA 2V32A 3D21A 3EYTA 4DSQA 5EL8A 4Q5RA 4ZB6A 1DBYA 1UVZA 5J3RA 4POKA 3KIJA 3QOUA 2P31A 4L0UA 1BJXA 1LU4A 4PURA 1SYRA 2WS2A 5DDLA 2GQKA 2B3SA 1SK2A 5CRGA 3US3A 2CVBA 3LG6A 2PN8A 2HRKA 2NDOA 5G5FA 2QA2A 5AN1A 1URMA 4Z2RA 2NPBA 4DSRA 3VPQA 5IMFA 2H1DA 3QAWA 1WPIA 3FYGA 2XBIA 2C3QA 3WD6A 3DIEA 3VI5A 4DSSB 1TU8A 1YF1A 1F2EA 5A4WA 2FUG2 1YKCA 1XW9A 4NV2A 3QPMA 4IGJA 3KTBA 3UARA 3ZIJA 3F3QA 4OO5A 3HYPA 2PGTA 3EURA 2B5YA 2CAQA 4PXOA 2XBQA 4ZILA 1Z7RA 1A8LA 2L5OA 4QL9A 3FMWA 1V57A 1J08A 4MA9A 1PRXA 1K0BA 4G19A 4E8EA 2OE3A 2R2JA 3QAGA 3F8UA 1EGOA 3TUEA 3Q74A 2NVLA 1K0AA 1NSWA 2AB6A 3GUSA 3GYKA 3IAM2 2IMIA 3DWVA 2PVOC 4F2IA 5DAKB 2GZPA 5ECNB 3RHCA 1AIUA 1PL2A 2O85A 4GCIA 3WYWA 2YJ7A 2RM5A 2N5FA 1KBNA 1TOFA 2YOIA 2VCTA 3U5RE 5DJMA 2VM2A 4MDCA 2I1UA 2RIIA 1M9AA 2C1YA 4POMA 4HEA2 3ME7A 4ZB9A 3GH9A 4FQUA 2B5EA 4O92A 4NAXA 4ECJA 1OC3A 1UN2A 4ACSA 3KMOA 2TIRA 4HI7A 5LD0A 3CYNA 2C0EA 4X4JA 3EMXA 1WJKA 3GTUA 3MDKA 2JZRA 3O76A 1GWCA 1ON4A 4GRFA 3VURA 1J0FA 5ABRA 1QUWA 2LSTA 2MZCA 1W4VA 4KB3A 1AQXA 1N2AA 1THXA 3P7XA 1Z7PA 4ZL8A 4TR1B 1XW6A 2DMMA 4KCAA 1R5AA 5KEJA 2R37A 1BG5A 6GSVA 5E59A 4WXTA 4AJ6A 1O6JA 2XC2A 1XW5A 4GWRA 1GSEA 2OJLA 4KX4A 3F4RA 4DEJA 3GV1A 3KCMA 1S3DA 3TKSC 1PN9A 1JZRA 2LJRA 4GSSA 3FEUA 1K0OA 6GSTA 3EVIA 5HR2A 1TK8B 4BWQA 2LQOA 2CQ9A 5H5SA 4ISDA 4X43A 5IMZA 3EINA 2ZUPA 3TOTA 1I9DA 3EU3A 2O7KA 2R0PA 2C4JA 4IS0A 3KEBA 2ZNMA 2VL3A 3KGKA 4ZBBA 1USBA 3DEXA 3L9VA 1DSBA 4G2EA 2H0GA 3Q6OA 4K1FA 5D96A 4XS6A 2LS5A 2WDUA 5JCUA 3H93A 2IIYA 2OE0A 3W6GA 5IMDA 4J56E 5ID2A 3IDVA 4FIWA 4ML1A 2H74A 3C1RA 1WMJA 2GQLA 1XWCA 4I2TA 1AUCA 1RQMA 2I9HA 3E0UA 4E8HA 2AYTA 2E0QA 2OACA 3QR6A 5E4WA 3KTLA 4IQ1A 3LYKA 3M9JA 3KZQA 1EGRA 3UOMA 2MBTA 1WRYA 3C1SA 5GSTA 4K6XA 2KUCA 3WT2A 3HJMA 4MF5A 5IM9A 1T00A 4HS1A 4MJCA 5CREA 13GSA 1IYHA 4L5OA 2JU5A 2VLTA 5KN1A 3QMXA 1T1VA 3GX0A 3DKSA 1A0RP 2CVKA 1H4OA 3Q18A 2PMTA 3IK7A 3L9SA 2HFDA 5IQYA 4MZWA 5D9VA 2LV3A 5CO3A 5IO0A 3DGQA 4EF0A 4MPFA 4CDOA 4EL1A 4IP1A 1X9SB 3ZFBA 2YV7A 4MJBA 4PQHA 1EEMA 4MH2A 1ERUA 4IJIA 3HJOA 2VOCA 3APSA 5B7CA 1K3YA 4KSOA 5ECLB 2F8FA 5INYA 3FZ9A 3GIXA 1V58A 4L5LA 4X0XA 5D9WA 3RBTA 2WULA 4IBPA 3CSIA 2DJKA 4JU5A 4O32A 2Z9SA 4TW5A 1SL0B 1X5CA 1A2LA 2LNTA 4HJMA 2HSYA 4TOPA 3VWWA 1A0FA 2HZEB 2NTOA 1O73A 2GGTA 3V1WA 2LQQA 1X0RA 3M1GA 5CRWA 2J9HA 2CX3A 3CXGA 2ES7A 5AISA 4GXZA 3QCPA 4GQFA 4N30A 1NHOA 4WETA 4ILFA 3UEMA 4KAEA 2H0HA 4EE0A 1KTEA 4G9HA 2AV4A 1K3LA 1PA3A 2G2QA 3IOSA 4WEYA 1NHYA 2B7JA 4PX1A 3TGZA 4FYCA 1Z6NA 3IC4A 2C0GA 2YWMA 2DJJA 2EIRA 7GSSA 3F9UA 3ERGA 1LJRA 1YY7A 2YZUA 3BOAA 1X5EA 2QC7A 3FRCA 5GZZB 4BVYA 3O6TA 4KE3A 3P2AA 2HYXA 2TRXA 1QFNA 2A2PA 2K8SA 2JADA 1XIYA 3KH7A 6GSWA 3LEFA 1HQOA 1EV9A 2F51A 2HSHA 2OE1A 3L78A 3HKRA 3KP8A 2IJYA 1T7PB 4EVMA 4K2DA 2CZ2A 3EWLA 5JCGA 5LCZA 2V6OA 5LNKe 3IPZA 3TJFA 3LJRA 2EC4A 1F37A 4NWYA 4MNNA 3I6AA 1QGVA 1R26A 1SJ6A 3BD2A 3FK8A 4MMMA 1WP0A 5DBQA 1PN0A 2FWEA 4XIHA 1SKRB 1Z3EA 2PWJA 2HRFA 4HUAA 4QQ7A 4MK3A 1OYJA 2FWFA 4TN8A 5ECOB 3BCKA 5DALB 2WB9A 2JSYA 3HY2A 1GTIA 3NOFA 1U3AA 1E2YA 4K7IA 2C0DA 3DYRA 3A2VA 5A4UA 5B8BA 2C3TA 1GNWA 5DVBA 2ALBA 4TR4A 1FOHA 3SBCA 1G6WA 2WCIA 1M99A 4YQVA 3VFIA 4L0WA 1OAZA 4KSMA 2VCVA 3C8EA 4YAPA 2H70A 1E6BA 2YWNA 3IBHA 3F4TA 2HI7A 3D5JA 1B48A 5J9BA 1XXUA 1SKSB 3ZFLA 4IQAA 1X9WB 4HJ2A 3FR6A 3ZYWA 1XVQA 1OC8A 2DJ2A 2PERA 3VI7A 1DE2A 4IN0A 2C8UA 5A5KA 1A8YA 1F6MC 4Z7XA 1PSQA 2A2SA 1GSUA 2AUVA 5D9TA 4BA7A 3VPTA 3KP9A 1GUHA 4V1Ap 3C73A 3HVVA 1Y25A 2FA4A 3FR3A 3GL3A 4P3YB 1V98A 1XVWA 2YP6A 4ZBAA 5JWRB 2BMXA 3WGXA 4Z2TA 3SWLA 4YQMA 2L6CA 4KW6A 1ILOA 3H79A 1GTUA 4GQCA 3IRAA 3Q19A 1XOAA 3IK9A 3PPUA 1BQ7A 4L8EA 1RW1A 5C04A 3UBLA 2X8HA 2HNLA 1VGLA 3GL5A 3HD5A 4JRRA 1GTBA 6GSSA 4NXIA 3HXSA 2H19A 4TXOA 3IC8A 2VO4A 4K8MA 1GLPA 5KOXA 1GSFA 3KJYA 3N9JA 3U6VA 5AIXA 2H72A 4ZIJA 2IMKA 4LMVA 2QKEA 2FGXA 5HQPA 1SL2B 5KOWA 5B6NA 3FZ5A 4IELA 4POLA 3ZTLA 5EPFA 3D0ZA 5CNWA 4XS4A 3K8NA 1GL8A 3GMFA 3AY8A 4D73A 5H5RA 2FCHA 3BBYA 1Z9HA 2DJ1A 2V6KA 2X64A 4MPGA 2FD3A 3IHGA 3H4KA 1AXDA 3LWAA 5G5EA 1A24A 2CX4A 4PGTA 3QFAC 2H30A 1OE8A 3LORA 5AGYA 4K7OA 1EWXA 1FW1A 3FY7A 5ELGA 1RK4A 4BVXA 2R6KA 2XPDA 4K0NA 4KDUA 5EVOA 2O8VB 1MDJA 2C80A 1XWGA 3TRPA 1G0TA 3GA4A 3TCOA 4HZ2A 3TKQA 1MD4A 1SD8A 1J9BA 4PUFC 5BRTA 1B9YC 3UVHA 1TRWA 1OC9A 3GKNA 3LSZA 5J9CA 4OFMA 1HYUA 4BWSA 4LL1B 5IMCA 4GLTA 3MAKA 3TRXA 2YZHA 5DCGA 3I43A 4K2XA 4O5RA 4K5RA 2IFQA 1CQHA 2IPAA 4I97A 3HA9A 2MBSA 5HR3A 3A5IA 3HCZA 1UA5A 4MZCA 4XCSA 5DCHA 5D8IA 2I81A 2VAFA 5JWOB 4PQIA 3MSZA 2L57A 4Q5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G31 A;  5ECQ B;  5HR0 A;  1Q98 A;  1GSD A;  1TRU A;  3C7M A;  3W8S A;  4YH2 A;  1AAZ A;  4V2N A;  3FR9 A;  2HT9 A;  1EZK A;  1OE7 A;  4EC0 A;  2GDR A;  3LXT A;  2G0F A;  1XPV A;  4BL7 A;  5COH A;  2YJH A;  5D93 A;  12GS A;  2H1B A;  1S3C A;  3HJP A;  1ZYE A;  3GST A;  2N5A A;  3RHB A;  1ERV A;  3GNJ A;  1AQV A;  1XWB A;  3I69 A;  5F07 A;  2VL2 A;  2RUE A;  1ERW A;  2IME A;  2YN1 A;  4LMW A;  1YJ6 A;  4F82 A;  2LKU A;  4AF2 A;  4F03 A;  5KN0 A;  5G30 A;  3VLN A;  1SK0 A;  1SJI A;  1PX7 A;  1A2M A;  4LLR A;  4G10 A;  1TRS A;  4N0Z A;  3WT1 A;  1GSS A;  1XWA A;  4WKW A;  2VL9 A;  4N10 A;  2VCW A;  3N5O A;  4ZXG A;  4CHS A;  2WJU A;  1TRV A;  2MMA A;  2OBK A;  4AJ7 A;  5FT3 A;  4MJE A;  1LBK A;  2IL3 A;  5G2Z A;  5HR1 A;  2GSQ A;  4OD7 A;  5IOW A;  5A4V A;  2XPE A;  3S9F A;  1PX6 A;  3FZA A;  5ELA A;  4QL7 A;  4XRA A;  1KNG A;  1GUL A;  1G7E A;  3OR5 A;  4MZB A;  3GN3 A;  4TR0 A;  4DSS A;  1JLV A;  3I9V 2;  5B8A A;  3ZML A;  4GST A;  3VWX A;  1WE0 A;  17GS A;  1SKW B;  1H75 A;  2H66 A;  4PQ1 A;  2FA8 A;  3M3M A;  3UBK A;  3H1N A;  5B6M A;  4H86 A;  3F6D A;  1NW2 A;  2XHF A;  4WF4 A;  5CAX A;  2IN3 A;  3LYP A;  3GKX A;  1EP7 A;  2WFC A;  3GH6 A;  2HE3 A;  1ACV A;  1ZGN A;  4KCE A;  1ST9 A;  1MEK A;  3CRU A;  3ERW A;  4IVF A;  1FB0 A;  1GTA A;  2CZ3 A;  3IR4 A;  1A2J A;  4WR4 A;  3IA1 A;  2DSA A;  1XWK A;  1JLW A;  1PMT A;  2EIQ A;  4KA0 A;  3RPN A;  2REM A;  1Q4J A;  4HQS A;  1VF2 A;  1AQW A;  1U87 A;  3ZVJ D;  5DAK A;  4YAV A;  1TP9 A;  1QK8 A;  2WRT A;  2LRT A;  2GSS A;  1AW9 A;  3LXZ A;  2AJQ B;  2OKA A;  1Z5Y E;  2I3Y A;  2KOK A;  1PD2 1;  3UVT A;  2GS3 A;  1U6T A;  1K0D A;  1O85 A;  3APO A;  2IWT A;  2K8V A;  14GS A;  2AHE A;  3TDG A;  1EOG A;  3G7J A;  4RUV A;  2GST A;  5IPH A;  1EOH A;  1YEX A;  4EO3 A;  3GTU B;  3IXR A;  1X5D A;  1HNA A;  1MD3 A;  4EDZ A;  2H1G A;  5G1K A;  1YQ1 A;  3TJK A;  3ZVJ A;  1GRX A;  2VIM A;  4NHW A;  3TKS E;  1SU9 A;  6GSX A;  1ERT A;  2V41 A;  4PUA A;  3GHA A;  1FVK A;  4Q5Q A;  4MP4 A;  2WGR A;  3TOU A;  1TI3 A;  19GS A;  4TR1 A;  3QFB C;  1M9B A;  1YKA A;  4HU9 A;  1Z6M A;  1Y6E A;  1O8W A;  3HZ4 A;  4ZBD A;  1JHB A;  3F6F A;  2JL4 A;  3CMI A;  3LFL A;  4CW9 A;  3ZZX A;  2X8G A;  1HD2 A;  1XBS A;  3HVS A;  1QMV A;  2K6V A;  4HQZ A;  1BX9 A;  2R5G A;  4KH7 A;  3H8Q A;  5FHI A;  1DUG A;  3ZIV A;  2V2G A;  1FG4 A;  2LUS A;  5HFK A;  1TDI A;  4MH3 A;  5ECP B;  2LRC A;  1VF1 A;  3FKF A;  4JED A;  2CVD A;  5CRD A;  4POB A;  1ML6 A;  2JAC A;  2MMN A;  5ECK B;  1JZD A;  3DRN A;  4KDY A;  3R2Q A;  5ECM B;  2YAN A;  3A2W A;  5ECR B;  3EU4 A;  3KXO A;  2O87 A;  2LTK A;  3KD0 A;  3UIW A;  3D4T A;  3L9U A;  2FNO A;  3RAZ A;  4ECI A;  5CP1 A;  2GT5 A;  1S3A A;  5HFG A;  2LNS A;  2F3M A;  5ID2 B;  2YPM A;  4XS1 A;  2WZ9 A;  2H76 A;  2M80 A;  3DML A;  1EP8 A;  5HFI A;  2ON7 A;  5DQS A;  5EY6 A;  3M8N A;  1WIK A;  3QDN A;  4OFN A;  1GUK A;  3WGD A;  4TVE A;  1U3I A;  4OCE A;  4FH8 A;  2IMF A;  3CRT A;  1T8E B;  1XCC A;  1M2B A;  4FYB A;  4V1A g;  1V2A A;  2FY6 A;  1TI1 A;  3DD3 A;  3CSH A;  2K9F A;  4RI6 A;  2L5L A;  4WBR D;  3A3T A;  2I4A A;  2R3X A;  5JCW A;  1DE1 A;  5GAP D;  4F0B A;  4HZ4 A;  1JZO A;  3CTG A;  2H6Y A;  4N0V A;  1ZMA A;  3GKK A;  3KH9 A;  5F8B A;  4ID0 A;  1FO5 A;  3TRQ A;  1N8J A;  5CRH A;  3KMN A;  2MYG A;  5D9X A;  3JCM L;  2VCX A;  3MNG A;  3D4M A;  1FVJ A;  4XHM A;  1AC1 A;  1M2A A;  1GP1 A;  5F0G A;  2X99 A;  1B4Q A;  1K0M A;  2H71 A;  2O89 A;  2H1A A;  2OAD A;  5D73 A;  1O8X A;  3CTF A;  2F9S A;  2PBJ A;  3NIV A;  18GS A;  1M0U A;  1SK1 A;  2V1M A;  2CA8 A;  2N5B A;  2L59 A;  3LQ7 A;  5IOX A;  16GS A;  1GH2 A;  2CT6 A;  5FWG A;  1TKD B;  4NPB A;  1VRS D;  2M72 A;  4I5Q A;  2KLX A;  2HLS A;  3GRX A;  1F3B A;  2LEG A;  2HRN A;  2DBC A;  5GAN D;  5F05 A;  4IKH A;  2CV4 A;  1PKW A;  2B5X A;  3UL3 A;  2D2Z A;  5JWQ B;  1I5G A;  4Q5N A;  3PIN A;  3DXB A;  4V2M A;  5GSS A;  3A2X A;  4X1U A;  4NHZ A;  2H8L A;  2L4Q A;  2HZE A;  4O7H A;  2MMZ A;  2P5Q A;  3GUR A;  3VK9 A;  3IAS 2;  4XTS A;  3HHV A;  5IMA A;  1YEP A;  2LJA A;  2RUF A;  4GSN A;  3EE2 A;  2VUP A;  5J4U A;  2GSR A;  5J5N A;  4KDX A;  1IYI A;  2IMD A;  3M9K A;  4I6X A;  3F0I A;  1EV4 A;  2EIO A;  1W89 A;  4RI7 A;  3WGE A;  1TU7 A;  5ECH B;  1F3A A;  2H75 A;  4TRX A;  4J2F A;  3J7Y k;  2L6D A;  4KUN A;  3IE3 A;  6GSU A;  2LJK A;  4KGI A;  4AJ8 A;  5KN3 A;  1R5P A;  2OBI A;  1G7O A;  3TJJ A;  4RQX A;  3PGT A;  1C72 A;  1GLQ A;  2FWH A;  1ZYQ B;  3O3T A;  3QAV A;  2DLX A;  2VM1 A;  2OA7 A;  1XOB A;  4MLY A;  4XRD A;  1TW9 A;  2GQM A;  2YWI A;  5IIZ A;  4MCU A;  4ML6 A;  1K3O A;  2RLI A;  2DIY A;  4TXV A;  5AIV A;  3M0F A;  3FZ4 A;  4HDE A;  1XZO A;  1TK0 B;  3HDC A;  2H6X A;  2GZZ A;  3TKP A;  4N11 A;  1HNC A;  2KP1 A;  2GZY A;  1BYE A;  2VD1 A;  3RDW A;  1TXX A;  1NM3 A;  3TJG A;  2YNX A;  2A2R A;  2DML A;  4MF6 A;  2RM6 A;  2VL2 C;  3DVX A;  3GSS A;  2QGV A;  2DC5 A;  3TKS A;  3G9B A;  3ISO A;  1FHE A;  2PPT A;  2B7K A;  2CAI A;  2H0I A;  1ZCP A;  1KEB A;  1THO A;  2DJ3 A;  4GF0 A;  5ECS A;  1F9M A;  3D6I A;  5DAL A;  1B4P A;  3UMA A;  2YWO A;  3ZRE A;  4K7N A;  3PR8 A;  2P0G A;  1G6Y A;  3BJ5 A;  4EDY A;  4ZB8 A;  1SJZ A;  3MWH A;  4ULX A;  3GX8 A;  3F3R A;  1FB6 A;  1T3B A;  2PVQ A;  4EXJ A;  4FO5 A;  3F4S A;  5IPG A;  2M46 A;  2YCD A;  1A23 A;  4JBB A;  1XFL A;  3CSJ A;  1HNB A;  11GS A;  1PL1 A;  2C3N A;  2L4C A;  1M7T A;  2GVP A;  4IW9 A;  1ZZY A;  1TK5 B;  1SL1 B;  2B1L A;  3ZIT A;  4AGS A;  2BTO T;  5H5Q A;  2C0F A;  5KN2 A;  1K0C A;  2B1K A;  4I8B A;  3C71 A;  3NZN A;  1YDK A;  2JZS A;  4RQR A;  4OO4 A;  3LGC A;  4MAB A;  1MTC A;  1VF3 A;  5CYY A;  1ZL9 A;  3E9J B;  2H01 A;  2BJX A;  2VD0 A;  5ENU A;  3GFK A;  4HOJ A;  1T4Y A;  1GSQ A;  3IV4 A;  4EKZ A;  4WR5 A;  3L0H A;  1B8X A;  1K0N A;  4ZL7 A;  4TXO B;  1QQ2 A;  4LA1 A;  2NBS A;  2E7P A;  2FHE A;  1UC7 A;  3TB2 A;  4ECC A;  2PUK C;  4LL4 B;  22GS A;  1FOV A;  5F06 A;  2HXK A;  3APQ A;  4WF5 A;  20GS A;  2VLV A;  4OWY A;  3RPP A;  2ON5 A;  3J7Y b;  3ZLP A;  1X9M B;  3FHK A;  1OVN A;  2DIZ A;  3UJ1 A;  2E2M A;  3D22 A;  4J57 E;  1WOU A;  2YV9 A;  4XS4 B;  1ZOF A;  4V2L A;  2H73 A;  2K18 A;  5DJL A;  4D73 B;  4IJ3 A;  2E2G A;  4IP6 A;  3EMP A;  4HU7 A;  1R7H A;  1GNE A;  3ERF A;  1SYX A;  2GTU A;  4KND A;  2FLS A;  5L71 A;  1YZX A;  4NV5 A;  2HZF A;  4TKY A;  1SD9 A;  4MJA A;  6GSY A;  1CQG A;  2A4V A;  2VCZ A;  4JE1 A;  3ZL5 A;  1PKZ A;  4JZQ A;  1TJD A;  5ECI B;  4GTU A;  2VLU A;  3FW2 A;  3PH9 A;  2LRN A;  3ED3 A;  4OMV A;  1OKT A;  4I2U A;  1BED A;  5IMV A;  4TR3 A;  1T4Z A;  1MDK A;  3P8W A;  1R4W A;  2R4V A;  3KM6 A;  3TJB A;  3GKM A;  4F9Z A;  1YF0 A;  1EEJ A;  3QD9 A;  1BAY A;  3ZMK A;  4DVC A;  1FAA A;  4OFT A;  3E3E A;  1QXH A;  3ME8 A;  5C00 A;  1OC9 B;  1GUM A;  1V40 A;  2QSI A;  3VWV A;  1GSY A;  4K9Z A;  1PQN A;  2TRC P;  3CBU A;  4ZL9 A;  2KHP A;  2J23 A;  3UAP A;  1TTZ A;  4JR6 A;  2F8A A;  3G7I A;  1V9W A;  4K0G A;  3HZ8 A;  2VCQ A;  4YQU A;  2IFQ B;  4PNF A;  2KP2 A;  3F63 A;  3W8J A;  4NMU A;  3A5W A;  2H6Z A;  8GSS A;  9GSS A;  3L4N A;  1VF4 A;  2JZT A;  3HVX A;  1O81 A;  1MDI A;  1JFU A;  3TKR A;  2PU9 C;  3P90 A;  3DVW A;  5IO2 A;  10GS A;  1SEN A;  2FWG A;  5DQY A;  3ZRD A;  2AAW A;  4BPY A;  2GT6 A;  4OCF A;  4FYU A;  2ZCT A;  2MMO A;  1WWJ A;  3EC3 A;  3VWU A;  1ABA A;  4PNG A;  1OKD A;  4JR4 A;  1B9X C;  4ECB A;  2DJ0 A;  1PGT A;  3BCI A;  2B6M A;  4EUY A;  5J41 A;  2P5R A;  2GLR A;  1U88 A;  2JSZ A;  1JZW A;  3IHQ A;  2X8C A;  1M2D A;  3G7Y A;  4F0C A;  4WBJ A;  4MF7 A;  4IHU A;  5G1L A;  1O7U A;  2V32 A;  3D21 A;  3EYT A;  4DSQ A;  5EL8 A;  4Q5R A;  4ZB6 A;  1DBY A;  1UVZ A;  5J3R A;  4POK A;  3KIJ A;  3QOU A;  2P31 A;  4L0U A;  1BJX A;  1LU4 A;  4PUR A;  1SYR A;  2WS2 A;  5DDL A;  2GQK A;  2B3S A;  1SK2 A;  5CRG A;  3US3 A;  2CVB A;  3LG6 A;  2PN8 A;  2NDO A;  5G5F A;  5AN1 A;  1URM A;  2NPB A;  4DSR A;  3VPQ A;  5IMF A;  2H1D A;  3QAW A;  1WPI A;  3FYG A;  2XBI A;  2C3Q A;  3WD6 A;  3DIE A;  3VI5 A;  4DSS B;  1TU8 A;  1YF1 A;  1F2E A;  5A4W A;  2FUG 2;  1YKC A;  1XW9 A;  4NV2 A;  3QPM A;  4IGJ A;  3KTB A;  3UAR A;  3ZIJ A;  3F3Q A;  4OO5 A;  3HYP A;  2PGT A;  3EUR A;  2B5Y A;  2CAQ A;  4PXO A;  2XBQ A;  4ZIL A;  1Z7R A;  1A8L A;  2L5O A;  4QL9 A;  1V57 A;  1J08 A;  4MA9 A;  1PRX A;  1K0B A;  4G19 A;  4E8E A;  2OE3 A;  2R2J A;  3QAG A;  3F8U A;  1EGO A;  3TUE A;  3Q74 A;  2NVL A;  1K0A A;  1NSW A;  2AB6 A;  3GUS A;  3GYK A;  3IAM 2;  2IMI A;  3DWV A;  2PVO C;  4F2I A;  5DAK B;  2GZP A;  5ECN B;  3RHC A;  1AIU A;  1PL2 A;  2O85 A;  4GCI A;  3WYW A;  2YJ7 A;  2RM5 A;  2N5F A;  1KBN A;  1TOF A;  2YOI A;  2VCT A;  3U5R E;  5DJM A;  2VM2 A;  4MDC A;  2I1U A;  2RII A;  1M9A A;  2C1Y A;  4POM A;  4HEA 2;  3ME7 A;  4ZB9 A;  3GH9 A;  2B5E A;  4O92 A;  4NAX A;  4ECJ A;  1OC3 A;  1UN2 A;  4ACS A;  3KMO A;  2TIR A;  4HI7 A;  5LD0 A;  3CYN A;  2C0E A;  3EMX A;  1WJK A;  3GTU A;  3MDK A;  2JZR A;  3O76 A;  1GWC A;  1ON4 A;  4GRF A;  3VUR A;  1J0F A;  5ABR A;  1QUW A;  2LST A;  2MZC A;  1W4V A;  4KB3 A;  1AQX A;  1N2A A;  1THX A;  3P7X A;  1Z7P A;  4ZL8 A;  4TR1 B;  1XW6 A;  2DMM A;  4KCA A;  1R5A A;  5KEJ A;  2R37 A;  1BG5 A;  6GSV A;  5E59 A;  4WXT A;  4AJ6 A;  1O6J A;  2XC2 A;  1XW5 A;  4GWR A;  1GSE A;  2OJL A;  4KX4 A;  3F4R A;  4DEJ A;  3GV1 A;  3KCM A;  1S3D A;  3TKS C;  1PN9 A;  1JZR A;  2LJR A;  4GSS A;  3FEU A;  1K0O A;  6GST A;  3EVI A;  5HR2 A;  1TK8 B;  4BWQ A;  2LQO A;  2CQ9 A;  5H5S A;  4ISD A;  4X43 A;  5IMZ A;  3EIN A;  2ZUP A;  3TOT A;  1I9D A;  3EU3 A;  2O7K A;  2C4J A;  4IS0 A;  3KEB A;  2ZNM A;  2VL3 A;  3KGK A;  4ZBB A;  1USB A;  3DEX A;  3L9V A;  1DSB A;  4G2E A;  2H0G A;  3Q6O A;  4K1F A;  5D96 A;  4XS6 A;  2LS5 A;  2WDU A;  5JCU A;  3H93 A;  2IIY A;  2OE0 A;  3W6G A;  5IMD A;  4J56 E;  5ID2 A;  3IDV A;  4FIW A;  4ML1 A;  2H74 A;  3C1R A;  1WMJ A;  2GQL A;  1XWC A;  4I2T A;  1AUC A;  1RQM A;  2I9H A;  3E0U A;  4E8H A;  2AYT A;  2E0Q A;  2OAC A;  3QR6 A;  5E4W A;  3KTL A;  4IQ1 A;  3LYK A;  3M9J A;  3KZQ A;  1EGR A;  3UOM A;  2MBT A;  1WRY A;  3C1S A;  5GST A;  4K6X A;  2KUC A;  3WT2 A;  3HJM A;  4MF5 A;  5IM9 A;  1T00 A;  4HS1 A;  4MJC A;  5CRE A;  13GS A;  1IYH A;  4L5O A;  2JU5 A;  2VLT A;  5KN1 A;  3QMX A;  1T1V A;  3GX0 A;  3DKS A;  1A0R P;  2CVK A;  1H4O A;  3Q18 A;  2PMT A;  3IK7 A;  3L9S A;  2HFD A;  5IQY A;  4MZW A;  5D9V A;  2LV3 A;  5CO3 A;  5IO0 A;  3DGQ A;  4EF0 A;  4MPF A;  4CDO A;  4EL1 A;  4IP1 A;  1X9S B;  3ZFB A;  2YV7 A;  4MJB A;  4PQH A;  1EEM A;  4MH2 A;  1ERU A;  4IJI A;  3HJO A;  2VOC A;  3APS A;  5B7C A;  1K3Y A;  4KSO A;  5ECL B;  2F8F A;  5INY A;  3FZ9 A;  3GIX A;  1V58 A;  4L5L A;  4X0X A;  5D9W A;  3RBT A;  2WUL A;  4IBP A;  3CSI A;  2DJK A;  4JU5 A;  4O32 A;  2Z9S A;  4TW5 A;  1SL0 B;  1X5C A;  1A2L A;  2LNT A;  4HJM A;  2HSY A;  4TOP A;  3VWW A;  1A0F A;  2HZE B;  2NTO A;  1O73 A;  2GGT A;  3V1W A;  2LQQ A;  1X0R A;  3M1G A;  5CRW A;  2J9H A;  2CX3 A;  3CXG A;  2ES7 A;  5AIS A;  4GXZ A;  3QCP A;  4GQF A;  4N30 A;  1NHO A;  4WET A;  4ILF A;  3UEM A;  4KAE A;  2H0H A;  4EE0 A;  1KTE A;  4G9H A;  2AV4 A;  1K3L A;  1PA3 A;  2G2Q A;  3IOS A;  4WEY A;  1NHY A;  2B7J A;  4PX1 A;  3TGZ A;  4FYC A;  1Z6N A;  3IC4 A;  2C0G A;  2YWM A;  2DJJ A;  2EIR A;  7GSS A;  3F9U A;  3ERG A;  1LJR A;  1YY7 A;  2YZU A;  3BOA A;  1X5E A;  2QC7 A;  3FRC A;  5GZZ B;  4BVY A;  3O6T A;  4KE3 A;  3P2A A;  2HYX A;  2TRX A;  1QFN A;  2K8S A;  2JAD A;  1XIY A;  3KH7 A;  6GSW A;  3LEF A;  1HQO A;  1EV9 A;  2F51 A;  2HSH A;  2OE1 A;  3L78 A;  3HKR A;  3KP8 A;  2IJY A;  1T7P B;  4EVM A;  4K2D A;  2CZ2 A;  3EWL A;  5JCG A;  5LCZ A;  2V6O A;  5LNK e;  3IPZ A;  3TJF A;  3LJR A;  2EC4 A;  1F37 A;  4NWY A;  3I6A A;  1QGV A;  1R26 A;  1SJ6 A;  3BD2 A;  3FK8 A;  4MMM A;  1WP0 A;  5DBQ A;  2FWE A;  4XIH A;  1SKR B;  1Z3E A;  2PWJ A;  2HRF A;  4HUA A;  4QQ7 A;  4MK3 A;  1OYJ A;  2FWF A;  4TN8 A;  5ECO B;  3BCK A;  5DAL B;  2WB9 A;  2JSY A;  3HY2 A;  1GTI A;  3NOF A;  1U3A A;  1E2Y A;  4K7I A;  2C0D A;  3DYR A;  3A2V A;  5A4U A;  5B8B A;  2C3T A;  1GNW A;  5DVB A;  2ALB A;  4TR4 A;  3SBC A;  1G6W A;  2WCI A;  1M99 A;  4YQV A;  3VFI A;  4L0W A;  1OAZ A;  4KSM A;  2VCV A;  3C8E A;  4YAP A;  2H70 A;  1E6B A;  2YWN A;  3IBH A;  3F4T A;  2HI7 A;  3D5J A;  1B48 A;  5J9B A;  1XXU A;  1SKS B;  3ZFL A;  4IQA A;  1X9W B;  4HJ2 A;  3FR6 A;  3ZYW A;  1XVQ A;  1OC8 A;  2DJ2 A;  2PER A;  3VI7 A;  1DE2 A;  4IN0 A;  2C8U A;  5A5K A;  1A8Y A;  1F6M C;  4Z7X A;  1PSQ A;  2A2S A;  1GSU A;  2AUV A;  5D9T A;  4BA7 A;  3VPT A;  3KP9 A;  1GUH A;  4V1A p;  3C73 A;  3HVV A;  1Y25 A;  2FA4 A;  3FR3 A;  3GL3 A;  4P3Y B;  1V98 A;  1XVW A;  2YP6 A;  4ZBA A;  5JWR B;  2BMX A;  3WGX A;  3SWL A;  4YQM A;  2L6C A;  4KW6 A;  1ILO A;  3H79 A;  1GTU A;  4GQC A;  3IRA A;  3Q19 A;  1XOA A;  3IK9 A;  1BQ7 A;  4L8E A;  1RW1 A;  5C04 A;  3UBL A;  2X8H A;  2HNL A;  1VGL A;  3GL5 A;  3HD5 A;  4JRR A;  1GTB A;  6GSS A;  4NXI A;  3HXS A;  2H19 A;  4TXO A;  2VO4 A;  4K8M A;  1GLP A;  1GSF A;  3KJY A;  3N9J A;  3U6V A;  5AIX A;  2H72 A;  4ZIJ A;  2IMK A;  4LMV A;  2QKE A;  2FGX A;  5HQP A;  1SL2 B;  5B6N A;  3FZ5 A;  4IEL A;  4POL A;  3ZTL A;  5EPF A;  3D0Z A;  5CNW A;  4XS4 A;  3K8N A;  1GL8 A;  3GMF A;  3AY8 A;  4D73 A;  5H5R A;  2FCH A;  3BBY A;  1Z9H A;  2DJ1 A;  2V6K A;  2X64 A;  4MPG A;  2FD3 A;  3H4K A;  1AXD A;  3LWA A;  5G5E A;  1A24 A;  2CX4 A;  4PGT A;  3QFA C;  2H30 A;  1OE8 A;  3LOR A;  5AGY A;  4K7O A;  1EWX A;  1FW1 A;  3FY7 A;  5ELG A;  1RK4 A;  4BVX A;  2R6K A;  2XPD A;  4K0N A;  4KDU A;  5EVO A;  2O8V B;  1MDJ A;  2C80 A;  1XWG A;  3TRP A;  1G0T A;  3GA4 A;  3TCO A;  4HZ2 A;  3TKQ A;  1MD4 A;  1SD8 A;  1J9B A;  4PUF C;  1B9Y C;  3UVH A;  1TRW A;  1OC9 A;  3GKN A;  3LSZ A;  5J9C A;  4OFM A;  1HYU A;  4BWS A;  4LL1 B;  5IMC A;  4GLT A;  3MAK A;  3TRX A;  2YZH A;  5DCG A;  3I43 A;  4O5R A;  2IFQ A;  1CQH A;  2IPA A;  4I97 A;  3HA9 A;  2MBS A;  5HR3 A;  3HCZ A;  1UA5 A;  4MZC A;  4XCS A;  5DCH A;  5D8I A;  2I81 A;  2VAF A;  5JWO B;  4PQI A;  3MSZ A;  2L57 A;  4Q5F A; 
#chains in the Genus database with same CATH topology
 5G31 A;  5ECQ B;  5HR0 A;  1Q98 A;  1GSD A;  1TRU A;  3C7M A;  3W8S A;  4YH2 A;  1AAZ A;  4V2N A;  3FR9 A;  2HT9 A;  1XG8 A;  1EZK A;  1OE7 A;  4EC0 A;  2GDR A;  3LXT A;  2G0F A;  1XPV A;  4BL7 A;  5COH A;  2YJH A;  5D93 A;  12GS A;  2H1B A;  1S3C A;  3HJP A;  1ZYE A;  3GST A;  2N5A A;  3RHB A;  1ERV A;  3GNJ A;  1AQV A;  1XWB A;  3I69 A;  5F07 A;  2VL2 A;  2RUE A;  2X49 A;  1ERW A;  2IME A;  2YN1 A;  4LMW A;  1YJ6 A;  4F82 A;  2LKU A;  4AF2 A;  4F03 A;  5KN0 A;  5G30 A;  3VLN A;  1SK0 A;  1SJI A;  1PX7 A;  1A2M A;  4LLR A;  4G10 A;  1TRS A;  4N0Z A;  3WT1 A;  4Z2U A;  1GSS A;  1XWA A;  4WKW A;  2VL9 A;  4N10 A;  2QA1 A;  2VCW A;  3N5O A;  4ZXG A;  4CHS A;  2WJU A;  1TRV A;  2MMA A;  4A5P A;  2OBK A;  4AJ7 A;  5FT3 A;  4MJE A;  1LBK A;  2IL3 A;  5G2Z A;  5HR1 A;  2GSQ A;  4OD7 A;  5IOW A;  5A4V A;  2XPE A;  3S9F A;  1PX6 A;  3FZA A;  5ELA A;  4QL7 A;  4XRA A;  1KNG A;  1GUL A;  1G7E A;  3OR5 A;  4MZB A;  3GN3 A;  4TR0 A;  4DSS A;  1JLV A;  2R0C A;  3I9V 2;  5B8A A;  3ZML A;  4GST A;  3VWX A;  1WE0 A;  17GS A;  1SKW B;  1H75 A;  2H66 A;  4PQ1 A;  2FA8 A;  3M3M A;  3UBK A;  3H1N A;  5B6M A;  4H86 A;  3F6D A;  2DKI A;  1NW2 A;  2XHF A;  4WF4 A;  5CAX A;  2IN3 A;  3LYP A;  3GKX A;  3MIX A;  1EP7 A;  2WFC A;  3GH6 A;  2HE3 A;  1ACV A;  1ZGN A;  4KCE A;  1ST9 A;  4KF9 A;  1MEK A;  3CRU A;  3ERW A;  4IVF A;  1FB0 A;  1GTA A;  2CZ3 A;  3IR4 A;  1A2J A;  4WR4 A;  4CY8 A;  3IA1 A;  2DSA A;  1XWK A;  1JLW A;  1PMT A;  2EIQ A;  4KA0 A;  3RPN A;  2REM A;  1Q4J A;  4HQS A;  1VF2 A;  1AQW A;  1U87 A;  3ZVJ D;  5DAK A;  4YAV A;  1TP9 A;  1QK8 A;  2WRT A;  2LRT A;  2GSS A;  1AW9 A;  3LXZ A;  2AJQ B;  2OKA A;  1Z5Y E;  2I3Y A;  2KOK A;  1PD2 1;  3UVT A;  2GS3 A;  1U6T A;  1K0D A;  1S3R A;  1O85 A;  1ZYP A;  3APO A;  2IWT A;  2K8V A;  14GS A;  2AHE A;  3TDG A;  1EOG A;  3G7J A;  4PTS A;  4RUV A;  2GST A;  5IPH A;  1EOH A;  1YEX A;  4EO3 A;  4EIQ A;  3GTU B;  3IXR A;  1X5D A;  1HNA A;  2DKH A;  3R3E A;  1MD3 A;  4EDZ A;  2H1G A;  5G1K A;  1YQ1 A;  3TJK A;  3ZVJ A;  1GRX A;  2VIM A;  4NHW A;  3TKS E;  1SU9 A;  6GSX A;  1ERT A;  2V41 A;  4PUA A;  3GHA A;  1FVK A;  4Q5Q A;  4O5U A;  4MP4 A;  2WGR A;  3TOU A;  1TI3 A;  19GS A;  4TR1 A;  3QFB C;  1M9B A;  1YKA A;  4HU9 A;  1Z6M A;  4G0K A;  1Y6E A;  1O8W A;  3HZ4 A;  4ZBD A;  1JHB A;  3F6F A;  2JL4 A;  3CMI A;  3LFL A;  4CW9 A;  3ZZX A;  4EIP A;  2X8G A;  1HD2 A;  1XBS A;  2A4H A;  3HVS A;  1QMV A;  2K6V A;  4HQZ A;  1BX9 A;  2R5G A;  4KH7 A;  3H8Q A;  5FHI A;  1DUG A;  3ZIV A;  1M3I A;  2V2G A;  1FG4 A;  2LUS A;  5HFK A;  1TDI A;  2X4A A;  4MH3 A;  4YKF A;  5ECP B;  2LRC A;  1VF1 A;  3FKF A;  4JED A;  2CVD A;  5CRD A;  4POB A;  1ML6 A;  2JAC A;  2MMN A;  5ECK B;  1JZD A;  3DRN A;  4KDY A;  3R2Q A;  5ECM B;  2YAN A;  3A2W A;  5ECR B;  3EU4 A;  3KXO A;  2O87 A;  2LTK A;  3KD0 A;  3UIW A;  3D4T A;  3L9U A;  2FNO A;  3RAZ A;  4ECI A;  5CP1 A;  2GT5 A;  1S3A A;  5HFG A;  4K5S A;  2LNS A;  2F3M A;  5ID2 B;  2YPM A;  4XS1 A;  2WZ9 A;  2H76 A;  2M80 A;  3DML A;  1EP8 A;  5HFI A;  2ON7 A;  5DQS A;  5EY6 A;  3M8N A;  1WIK A;  3QDN A;  4OFN A;  1GUK A;  3WGD A;  4TVE A;  1U3I A;  4OCE A;  4FH8 A;  2IMF A;  3CRT A;  1T8E B;  1XCC A;  1M2B A;  4FYB A;  4V1A g;  1V2A A;  2FY6 A;  1TI1 A;  3DD3 A;  3CSH A;  2K9F A;  4RI6 A;  2L5L A;  4WBR D;  3A3T A;  2I4A A;  2R3X A;  5JCW A;  1DE1 A;  5GAP D;  4F0B A;  4HZ4 A;  1JZO A;  3CTG A;  2H6Y A;  4N0V A;  1ZMA A;  3GKK A;  3KH9 A;  5F8B A;  4ID0 A;  1FO5 A;  3TRQ A;  1N8J A;  5CRH A;  3KMN A;  2MYG A;  5D9X A;  3JCM L;  2VCX A;  3MNG A;  3D4M A;  1FVJ A;  4XHM A;  1AC1 A;  1M2A A;  1GP1 A;  5F0G A;  2X99 A;  1B4Q A;  1K0M A;  2H71 A;  2O89 A;  2H1A A;  2OAD A;  5D73 A;  1O8X A;  3CTF A;  2F9S A;  2PBJ A;  3NIV A;  5BMU A;  18GS A;  1M0U A;  1SK1 A;  2V1M A;  2CA8 A;  2N5B A;  2L59 A;  3LQ7 A;  5IOX A;  16GS A;  1GH2 A;  2CT6 A;  5FWG A;  1TKD B;  2UZ8 A;  4NPB A;  1VRS D;  2M72 A;  4I5Q A;  2KLX A;  2HLS A;  3GRX A;  1F3B A;  2LEG A;  2HRN A;  2DBC A;  5GAN D;  4G0I A;  5F05 A;  4IKH A;  2CV4 A;  1PKW A;  2B5X A;  3UL3 A;  2D2Z A;  5JWQ B;  1I5G A;  4Q5N A;  3PIN A;  3DXB A;  4V2M A;  5GSS A;  3A2X A;  4X1U A;  4NHZ A;  2H8L A;  2L4Q A;  4ICY A;  2HZE A;  4O7H A;  2MMZ A;  2P5Q A;  3GUR A;  3VK9 A;  3IAS 2;  4XTS A;  3HHV A;  5IMA A;  1YEP A;  2LJA A;  2RUF A;  4GSN A;  1ZYN A;  3EE2 A;  2VUP A;  5J4U A;  2GSR A;  5J5N A;  4KDX A;  1IYI A;  2IMD A;  3M9K A;  4I6X A;  3F0I A;  1EV4 A;  2EIO A;  1W89 A;  4RI7 A;  3WGE A;  1TU7 A;  5ECH B;  1F3A A;  2H75 A;  4TRX A;  4J2F A;  3J7Y k;  4BVY B;  2L6D A;  4KUN A;  3IE3 A;  6GSU A;  2LJK A;  4KGI A;  4AJ8 A;  5KN3 A;  1R5P A;  2OBI A;  1G7O A;  3TJJ A;  4RQX A;  3PGT A;  1C72 A;  1GLQ A;  2FWH A;  1ZYQ B;  3O3T A;  3QAV A;  2DLX A;  2VM1 A;  2OA7 A;  1XOB A;  4MLY A;  4XRD A;  1TW9 A;  2GQM A;  2YWI A;  5IIZ A;  4MCU A;  4ML6 A;  1K3O A;  2RLI A;  2DIY A;  4TXV A;  3HVN A;  5AIV A;  3M0F A;  3FZ4 A;  4HDE A;  1XZO A;  1TK0 B;  3HDC A;  2H6X A;  2GZZ A;  3TKP A;  4N11 A;  1HNC A;  2KP1 A;  2GZY A;  1BYE A;  4YKG A;  2VD1 A;  3RDW A;  1TXX A;  1NM3 A;  3TJG A;  2YNX A;  2A2R A;  2DML A;  4MF6 A;  2RM6 A;  2VL2 C;  3DVX A;  3GSS A;  2QGV A;  2DC5 A;  3TKS A;  3G9B A;  3ISO A;  1FHE A;  2PPT A;  2B7K A;  2CAI A;  2H0I A;  1ZCP A;  1KEB A;  1THO A;  2DJ3 A;  4GF0 A;  5ECS A;  1F9M A;  3D6I A;  5DAL A;  1B4P A;  3UMA A;  2YWO A;  3ZRE A;  4K7N A;  3PR8 A;  2P0G A;  1G6Y A;  3BJ5 A;  4EDY A;  4ZB8 A;  1SJZ A;  3MWH A;  4ULX A;  3GX8 A;  3F3R A;  1FB6 A;  1T3B A;  2PVQ A;  4EXJ A;  4FO5 A;  3F4S A;  5IPG A;  2M46 A;  2YCD A;  1A23 A;  4JBB A;  1XFL A;  3CSJ A;  1HNB A;  11GS A;  1PL1 A;  2C3N A;  2L4C A;  1M7T A;  2GVP A;  4IW9 A;  1ZZY A;  1TK5 B;  1SL1 B;  2B1L A;  3ZIT A;  4AGS A;  2BTO T;  5H5Q A;  2C0F A;  5KN2 A;  1K0C A;  2B1K A;  4I8B A;  3C71 A;  3NZN A;  1YDK A;  2R0G A;  2JZS A;  4RQR A;  4OO4 A;  3LGC A;  4MAB A;  1MTC A;  1VF3 A;  5CYY A;  1ZL9 A;  3E9J B;  2H01 A;  2BJX A;  2VD0 A;  5ENU A;  3GFK A;  4O5Q A;  4HOJ A;  1T4Y A;  1GSQ A;  3IV4 A;  4EKZ A;  4WR5 A;  3L0H A;  1B8X A;  1K0N A;  4ZL7 A;  4TXO B;  3EPT A;  1QQ2 A;  4LA1 A;  2NBS A;  2E7P A;  2FHE A;  1UC7 A;  3TB2 A;  4ECC A;  2PUK C;  4LL4 B;  22GS A;  1FOV A;  5F06 A;  2HXK A;  3APQ A;  4WF5 A;  20GS A;  1M3J A;  2VLV A;  4OWY A;  3RPP A;  2ON5 A;  3J7Y b;  3ZLP A;  1X9M B;  3FHK A;  1OVN A;  2DIZ A;  3UJ1 A;  2E2M A;  3D22 A;  4J57 E;  1WOU A;  2YV9 A;  4XS4 B;  3MYD A;  1ZOF A;  4V2L A;  2H73 A;  2K18 A;  5DJL A;  4D73 B;  4IJ3 A;  2E2G A;  4IP6 A;  3EMP A;  4HU7 A;  1R7H A;  1GNE A;  3ERF A;  1SYX A;  2GTU A;  4KND A;  2FLS A;  5L71 A;  1YZX A;  4NV5 A;  2HZF A;  4TKY A;  1SD9 A;  4MJA A;  6GSY A;  1CQG A;  2A4V A;  2VCZ A;  4JE1 A;  3ZL5 A;  1PKZ A;  4JZQ A;  1TJD A;  4HSC X;  4BVX B;  5ECI B;  4GTU A;  4G0L A;  2VLU A;  3FW2 A;  3PH9 A;  2LRN A;  3ED3 A;  4OMV A;  1OKT A;  4I2U A;  1BED A;  5IMV A;  4TR3 A;  1T4Z A;  1MDK A;  3P8W A;  1R4W A;  2R4V A;  3KM6 A;  3TJB A;  3GKM A;  4F9Z A;  1YF0 A;  1EEJ A;  3QD9 A;  1BAY A;  3ZMK A;  4DVC A;  1FAA A;  4OFT A;  3E3E A;  1QXH A;  3ME8 A;  5C00 A;  1OC9 B;  1GUM A;  2HSM A;  1V40 A;  2QSI A;  3VWV A;  1GSY A;  4K9Z A;  1PQN A;  2TRC P;  3CBU A;  4ZL9 A;  2KHP A;  2J23 A;  3UAP A;  1TTZ A;  4JR6 A;  4BIK A;  2F8A A;  3G7I A;  1V9W A;  4K0G A;  3HZ8 A;  2VCQ A;  4YQU A;  2IFQ B;  4PNF A;  2KP2 A;  3F63 A;  3W8J A;  4NMU A;  3A5W A;  2H6Z A;  8GSS A;  9GSS A;  3L4N A;  1VF4 A;  2JZT A;  3HVX A;  4CY6 A;  1O81 A;  1MDI A;  1JFU A;  3LW9 A;  3TKR A;  2PU9 C;  3P90 A;  3DVW A;  4USS A;  5IO2 A;  10GS A;  1SEN A;  2FWG A;  5DQY A;  3ZRD A;  2AAW A;  4BPY A;  2GT6 A;  4OCF A;  2HRA A;  4FYU A;  2ZCT A;  2MMO A;  1WWJ A;  3EC3 A;  3VWU A;  1ABA A;  4PNG A;  1OKD A;  4JR4 A;  1B9X C;  4BL7 B;  4ECB A;  2DJ0 A;  1PGT A;  3BCI A;  2B6M A;  4EUY A;  5J41 A;  2P5R A;  2GLR A;  1U88 A;  2JSZ A;  1JZW A;  3IHQ A;  2X8C A;  1M2D A;  3G7Y A;  4F0C A;  4WBJ A;  4MF7 A;  4IHU A;  5G1L A;  1O7U A;  2V32 A;  3D21 A;  3EYT A;  4DSQ A;  5EL8 A;  4Q5R A;  4ZB6 A;  1DBY A;  1UVZ A;  5J3R A;  4POK A;  3KIJ A;  3QOU A;  2P31 A;  4L0U A;  1BJX A;  1LU4 A;  4PUR A;  1SYR A;  2WS2 A;  5DDL A;  2GQK A;  2B3S A;  1SK2 A;  5CRG A;  3US3 A;  2CVB A;  3LG6 A;  2PN8 A;  2HRK A;  2NDO A;  5G5F A;  2QA2 A;  5AN1 A;  1URM A;  4Z2R A;  2NPB A;  4DSR A;  3VPQ A;  5IMF A;  2H1D A;  3QAW A;  1WPI A;  3FYG A;  2XBI A;  2C3Q A;  3WD6 A;  3DIE A;  3VI5 A;  4DSS B;  1TU8 A;  1YF1 A;  3CQF A;  1F2E A;  5A4W A;  2FUG 2;  1YKC A;  1XW9 A;  4NV2 A;  3QPM A;  4IGJ A;  3KTB A;  3UAR A;  3ZIJ A;  3F3Q A;  4OO5 A;  3HYP A;  2PGT A;  3EUR A;  2B5Y A;  2CAQ A;  4PXO A;  2XBQ A;  4ZIL A;  1Z7R A;  1A8L A;  2L5O A;  4QL9 A;  3FMW A;  1V57 A;  1J08 A;  4MA9 A;  1PRX A;  1K0B A;  4G19 A;  4E8E A;  2OE3 A;  2R2J A;  3QAG A;  3F8U A;  1EGO A;  3TUE A;  3Q74 A;  2NVL A;  1K0A A;  1NSW A;  2AB6 A;  3GUS A;  3GYK A;  3IAM 2;  2IMI A;  3DWV A;  2PVO C;  4F2I A;  5DAK B;  2GZP A;  5ECN B;  3RHC A;  1AIU A;  1PL2 A;  2O85 A;  4GCI A;  3WYW A;  2YJ7 A;  2RM5 A;  2N5F A;  1KBN A;  1TOF A;  2YOI A;  2VCT A;  3U5R E;  5DJM A;  2VM2 A;  4MDC A;  2I1U A;  2RII A;  1M9A A;  2C1Y A;  4POM A;  4HEA 2;  3ME7 A;  4ZB9 A;  3GH9 A;  4FQU A;  2B5E A;  4O92 A;  4NAX A;  4ECJ A;  1OC3 A;  1UN2 A;  4ACS A;  3KMO A;  2TIR A;  4HI7 A;  5LD0 A;  3CYN A;  2C0E A;  4X4J A;  3EMX A;  1WJK A;  3GTU A;  3MDK A;  2JZR A;  3O76 A;  1GWC A;  1ON4 A;  4GRF A;  3VUR A;  1J0F A;  5ABR A;  1QUW A;  2LST A;  2MZC A;  1W4V A;  4KB3 A;  1AQX A;  1N2A A;  1THX A;  3P7X A;  1Z7P A;  4ZL8 A;  4TR1 B;  1XW6 A;  2DMM A;  4KCA A;  1R5A A;  5KEJ A;  2R37 A;  1BG5 A;  6GSV A;  5E59 A;  4WXT A;  4AJ6 A;  1O6J A;  2XC2 A;  1XW5 A;  4GWR A;  1GSE A;  2OJL A;  4KX4 A;  3F4R A;  4DEJ A;  3GV1 A;  3KCM A;  1S3D A;  3TKS C;  1PN9 A;  1JZR A;  2LJR A;  4GSS A;  3FEU A;  1K0O A;  6GST A;  3EVI A;  5HR2 A;  1TK8 B;  4BWQ A;  2LQO A;  2CQ9 A;  5H5S A;  4ISD A;  4X43 A;  5IMZ A;  3EIN A;  2ZUP A;  3TOT A;  1I9D A;  3EU3 A;  2O7K A;  2R0P A;  2C4J A;  4IS0 A;  3KEB A;  2ZNM A;  2VL3 A;  3KGK A;  4ZBB A;  1USB A;  3DEX A;  3L9V A;  1DSB A;  4G2E A;  2H0G A;  3Q6O A;  4K1F A;  5D96 A;  4XS6 A;  2LS5 A;  2WDU A;  5JCU A;  3H93 A;  2IIY A;  2OE0 A;  3W6G A;  5IMD A;  4J56 E;  5ID2 A;  3IDV A;  4FIW A;  4ML1 A;  2H74 A;  3C1R A;  1WMJ A;  2GQL A;  1XWC A;  4I2T A;  1AUC A;  1RQM A;  2I9H A;  3E0U A;  4E8H A;  2AYT A;  2E0Q A;  2OAC A;  3QR6 A;  5E4W A;  3KTL A;  4IQ1 A;  3LYK A;  3M9J A;  3KZQ A;  1EGR A;  3UOM A;  2MBT A;  1WRY A;  3C1S A;  5GST A;  4K6X A;  2KUC A;  3WT2 A;  3HJM A;  4MF5 A;  5IM9 A;  1T00 A;  4HS1 A;  4MJC A;  5CRE A;  13GS A;  1IYH A;  4L5O A;  2JU5 A;  2VLT A;  5KN1 A;  3QMX A;  1T1V A;  3GX0 A;  3DKS A;  1A0R P;  2CVK A;  1H4O A;  3Q18 A;  2PMT A;  3IK7 A;  3L9S A;  2HFD A;  5IQY A;  4MZW A;  5D9V A;  2LV3 A;  5CO3 A;  5IO0 A;  3DGQ A;  4EF0 A;  4MPF A;  4CDO A;  4EL1 A;  4IP1 A;  1X9S B;  3ZFB A;  2YV7 A;  4MJB A;  4PQH A;  1EEM A;  4MH2 A;  1ERU A;  4IJI A;  3HJO A;  2VOC A;  3APS A;  5B7C A;  1K3Y A;  4KSO A;  5ECL B;  2F8F A;  5INY A;  3FZ9 A;  3GIX A;  1V58 A;  4L5L A;  4X0X A;  5D9W A;  3RBT A;  2WUL A;  4IBP A;  3CSI A;  2DJK A;  4JU5 A;  4O32 A;  2Z9S A;  4TW5 A;  1SL0 B;  1X5C A;  1A2L A;  2LNT A;  4HJM A;  2HSY A;  4TOP A;  3VWW A;  1A0F A;  2HZE B;  2NTO A;  1O73 A;  2GGT A;  3V1W A;  1PFO A;  2LQQ A;  1X0R A;  3M1G A;  5CRW A;  2J9H A;  2CX3 A;  3CXG A;  2ES7 A;  5AIS A;  4GXZ A;  3QCP A;  4GQF A;  4N30 A;  1NHO A;  4WET A;  4ILF A;  3UEM A;  4KAE A;  2H0H A;  4EE0 A;  1KTE A;  4G9H A;  2AV4 A;  1K3L A;  1PA3 A;  2G2Q A;  3IOS A;  4WEY A;  1NHY A;  2B7J A;  4PX1 A;  3TGZ A;  4FYC A;  1Z6N A;  3IC4 A;  2C0G A;  2YWM A;  2DJJ A;  2EIR A;  7GSS A;  3F9U A;  3ERG A;  1LJR A;  1YY7 A;  2YZU A;  3BOA A;  1X5E A;  2QC7 A;  3FRC A;  5GZZ B;  4BVY A;  3O6T A;  4KE3 A;  3P2A A;  2HYX A;  2TRX A;  1QFN A;  2A2P A;  2K8S A;  2JAD A;  1XIY A;  3KH7 A;  6GSW A;  3LEF A;  1HQO A;  1EV9 A;  2F51 A;  2HSH A;  2OE1 A;  3L78 A;  3HKR A;  3KP8 A;  2IJY A;  1T7P B;  4EVM A;  4K2D A;  2CZ2 A;  3EWL A;  5JCG A;  5LCZ A;  2V6O A;  5LNK e;  3IPZ A;  3TJF A;  3LJR A;  2EC4 A;  1F37 A;  4NWY A;  4MNN A;  3I6A A;  1QGV A;  1R26 A;  1SJ6 A;  3BD2 A;  3FK8 A;  4MMM A;  1WP0 A;  5DBQ A;  1PN0 A;  2FWE A;  4XIH A;  1SKR B;  1Z3E A;  2PWJ A;  2HRF A;  4HUA A;  4QQ7 A;  4MK3 A;  1OYJ A;  2FWF A;  4TN8 A;  5ECO B;  3BCK A;  5DAL B;  2WB9 A;  2JSY A;  3HY2 A;  1GTI A;  3NOF A;  1U3A A;  1E2Y A;  4K7I A;  2C0D A;  3DYR A;  3A2V A;  5A4U A;  5B8B A;  2C3T A;  1GNW A;  5DVB A;  2ALB A;  4TR4 A;  1FOH A;  3SBC A;  1G6W A;  2WCI A;  1M99 A;  4YQV A;  3VFI A;  4L0W A;  1OAZ A;  4KSM A;  2VCV A;  3C8E A;  4YAP A;  2H70 A;  1E6B A;  2YWN A;  3IBH A;  3F4T A;  2HI7 A;  3D5J A;  1B48 A;  5J9B A;  1XXU A;  1SKS B;  3ZFL A;  4IQA A;  1X9W B;  4HJ2 A;  3FR6 A;  3ZYW A;  1XVQ A;  1OC8 A;  2DJ2 A;  2PER A;  3VI7 A;  1DE2 A;  4IN0 A;  2C8U A;  5A5K A;  1A8Y A;  1F6M C;  4Z7X A;  1PSQ A;  2A2S A;  1GSU A;  2AUV A;  5D9T A;  4BA7 A;  3VPT A;  3KP9 A;  1GUH A;  4V1A p;  3C73 A;  3HVV A;  1Y25 A;  2FA4 A;  3FR3 A;  3GL3 A;  4P3Y B;  1V98 A;  1XVW A;  2YP6 A;  4ZBA A;  5JWR B;  2BMX A;  3WGX A;  4Z2T A;  3SWL A;  4YQM A;  2L6C A;  4KW6 A;  1ILO A;  3H79 A;  1GTU A;  4GQC A;  3IRA A;  3Q19 A;  1XOA A;  3IK9 A;  3PPU A;  1BQ7 A;  4L8E A;  1RW1 A;  5C04 A;  3UBL A;  2X8H A;  2HNL A;  1VGL A;  3GL5 A;  3HD5 A;  4JRR A;  1GTB A;  6GSS A;  4NXI A;  3HXS A;  2H19 A;  4TXO A;  3IC8 A;  2VO4 A;  4K8M A;  1GLP A;  5KOX A;  1GSF A;  3KJY A;  3N9J A;  3U6V A;  5AIX A;  2H72 A;  4ZIJ A;  2IMK A;  4LMV A;  2QKE A;  2FGX A;  5HQP A;  1SL2 B;  5KOW A;  5B6N A;  3FZ5 A;  4IEL A;  4POL A;  3ZTL A;  5EPF A;  3D0Z A;  5CNW A;  4XS4 A;  3K8N A;  1GL8 A;  3GMF A;  3AY8 A;  4D73 A;  5H5R A;  2FCH A;  3BBY A;  1Z9H A;  2DJ1 A;  2V6K A;  2X64 A;  4MPG A;  2FD3 A;  3IHG A;  3H4K A;  1AXD A;  3LWA A;  5G5E A;  1A24 A;  2CX4 A;  4PGT A;  3QFA C;  2H30 A;  1OE8 A;  3LOR A;  5AGY A;  4K7O A;  1EWX A;  1FW1 A;  3FY7 A;  5ELG A;  1RK4 A;  4BVX A;  2R6K A;  2XPD A;  4K0N A;  4KDU A;  5EVO A;  2O8V B;  1MDJ A;  2C80 A;  1XWG A;  3TRP A;  1G0T A;  3GA4 A;  3TCO A;  4HZ2 A;  3TKQ A;  1MD4 A;  1SD8 A;  1J9B A;  4PUF C;  5BRT A;  1B9Y C;  3UVH A;  1TRW A;  1OC9 A;  3GKN A;  3LSZ A;  5J9C A;  4OFM A;  1HYU A;  4BWS A;  4LL1 B;  5IMC A;  4GLT A;  3MAK A;  3TRX A;  2YZH A;  5DCG A;  3I43 A;  4K2X A;  4O5R A;  4K5R A;  2IFQ A;  1CQH A;  2IPA A;  4I97 A;  3HA9 A;  2MBS A;  5HR3 A;  3A5I A;  3HCZ A;  1UA5 A;  4MZC A;  4XCS A;  5DCH A;  5D8I A;  2I81 A;  2VAF A;  5JWO B;  4PQI A;  3MSZ A;  2L57 A;  4Q5F A; 
#chains in the Genus database with same CATH homology
 5G31 A;  5ECQ B;  5HR0 A;  1Q98 A;  1GSD A;  1TRU A;  3C7M A;  3W8S A;  4YH2 A;  1AAZ A;  4V2N A;  3FR9 A;  2HT9 A;  1EZK A;  1OE7 A;  4EC0 A;  2GDR A;  3LXT A;  2G0F A;  1XPV A;  4BL7 A;  5COH A;  2YJH A;  5D93 A;  12GS A;  2H1B A;  1S3C A;  3HJP A;  1ZYE A;  3GST A;  2N5A A;  3RHB A;  1ERV A;  3GNJ A;  1AQV A;  1XWB A;  3I69 A;  5F07 A;  2VL2 A;  2RUE A;  2X49 A;  1ERW A;  2IME A;  2YN1 A;  4LMW A;  1YJ6 A;  4F82 A;  2LKU A;  4AF2 A;  4F03 A;  5KN0 A;  5G30 A;  3VLN A;  1SK0 A;  1SJI A;  1PX7 A;  1A2M A;  4LLR A;  4G10 A;  1TRS A;  4N0Z A;  3WT1 A;  4Z2U A;  1GSS A;  1XWA A;  4WKW A;  2VL9 A;  4N10 A;  2QA1 A;  2VCW A;  3N5O A;  4ZXG A;  4CHS A;  2WJU A;  1TRV A;  2MMA A;  4A5P A;  2OBK A;  4AJ7 A;  5FT3 A;  4MJE A;  1LBK A;  2IL3 A;  5G2Z A;  5HR1 A;  2GSQ A;  4OD7 A;  5IOW A;  5A4V A;  2XPE A;  3S9F A;  1PX6 A;  3FZA A;  5ELA A;  4QL7 A;  4XRA A;  1KNG A;  1GUL A;  1G7E A;  3OR5 A;  4MZB A;  3GN3 A;  4TR0 A;  4DSS A;  1JLV A;  2R0C A;  3I9V 2;  5B8A A;  3ZML A;  4GST A;  3VWX A;  1WE0 A;  17GS A;  1SKW B;  1H75 A;  2H66 A;  4PQ1 A;  2FA8 A;  3M3M A;  3UBK A;  3H1N A;  5B6M A;  4H86 A;  3F6D A;  2DKI A;  1NW2 A;  2XHF A;  4WF4 A;  5CAX A;  2IN3 A;  3LYP A;  3GKX A;  3MIX A;  1EP7 A;  2WFC A;  3GH6 A;  2HE3 A;  1ACV A;  1ZGN A;  4KCE A;  1ST9 A;  4KF9 A;  1MEK A;  3CRU A;  3ERW A;  4IVF A;  1FB0 A;  1GTA A;  2CZ3 A;  3IR4 A;  1A2J A;  4WR4 A;  4CY8 A;  3IA1 A;  2DSA A;  1XWK A;  1JLW A;  1PMT A;  2EIQ A;  4KA0 A;  3RPN A;  2REM A;  1Q4J A;  4HQS A;  1VF2 A;  1AQW A;  1U87 A;  3ZVJ D;  5DAK A;  4YAV A;  1TP9 A;  1QK8 A;  2WRT A;  2LRT A;  2GSS A;  1AW9 A;  3LXZ A;  2AJQ B;  2OKA A;  1Z5Y E;  2I3Y A;  2KOK A;  1PD2 1;  3UVT A;  2GS3 A;  1U6T A;  1K0D A;  1O85 A;  1ZYP A;  3APO A;  2IWT A;  2K8V A;  14GS A;  2AHE A;  3TDG A;  1EOG A;  3G7J A;  4PTS A;  4RUV A;  2GST A;  5IPH A;  1EOH A;  1YEX A;  4EO3 A;  4EIQ A;  3GTU B;  3IXR A;  1X5D A;  1HNA A;  2DKH A;  3R3E A;  1MD3 A;  4EDZ A;  2H1G A;  5G1K A;  1YQ1 A;  3TJK A;  3ZVJ A;  1GRX A;  2VIM A;  4NHW A;  3TKS E;  1SU9 A;  6GSX A;  1ERT A;  2V41 A;  4PUA A;  3GHA A;  1FVK A;  4Q5Q A;  4O5U A;  4MP4 A;  2WGR A;  3TOU A;  1TI3 A;  19GS A;  4TR1 A;  3QFB C;  1M9B A;  1YKA A;  4HU9 A;  1Z6M A;  4G0K A;  1Y6E A;  1O8W A;  3HZ4 A;  4ZBD A;  1JHB A;  3F6F A;  2JL4 A;  3CMI A;  3LFL A;  4CW9 A;  3ZZX A;  4EIP A;  2X8G A;  1HD2 A;  1XBS A;  2A4H A;  3HVS A;  1QMV A;  2K6V A;  4HQZ A;  1BX9 A;  2R5G A;  4KH7 A;  3H8Q A;  5FHI A;  1DUG A;  3ZIV A;  2V2G A;  1FG4 A;  2LUS A;  5HFK A;  1TDI A;  2X4A A;  4MH3 A;  4YKF A;  5ECP B;  2LRC A;  1VF1 A;  3FKF A;  4JED A;  2CVD A;  5CRD A;  4POB A;  1ML6 A;  2JAC A;  2MMN A;  5ECK B;  1JZD A;  3DRN A;  4KDY A;  3R2Q A;  5ECM B;  2YAN A;  3A2W A;  5ECR B;  3EU4 A;  3KXO A;  2O87 A;  2LTK A;  3KD0 A;  3UIW A;  3D4T A;  3L9U A;  2FNO A;  3RAZ A;  4ECI A;  5CP1 A;  2GT5 A;  1S3A A;  5HFG A;  4K5S A;  2LNS A;  2F3M A;  5ID2 B;  2YPM A;  4XS1 A;  2WZ9 A;  2H76 A;  2M80 A;  3DML A;  1EP8 A;  5HFI A;  2ON7 A;  5DQS A;  5EY6 A;  3M8N A;  1WIK A;  3QDN A;  4OFN A;  1GUK A;  3WGD A;  4TVE A;  1U3I A;  4OCE A;  4FH8 A;  2IMF A;  3CRT A;  1T8E B;  1XCC A;  1M2B A;  4FYB A;  4V1A g;  1V2A A;  2FY6 A;  1TI1 A;  3DD3 A;  3CSH A;  2K9F A;  4RI6 A;  2L5L A;  4WBR D;  3A3T A;  2I4A A;  2R3X A;  5JCW A;  1DE1 A;  5GAP D;  4F0B A;  4HZ4 A;  1JZO A;  3CTG A;  2H6Y A;  4N0V A;  1ZMA A;  3GKK A;  3KH9 A;  5F8B A;  4ID0 A;  1FO5 A;  3TRQ A;  1N8J A;  5CRH A;  3KMN A;  2MYG A;  5D9X A;  3JCM L;  2VCX A;  3MNG A;  3D4M A;  1FVJ A;  4XHM A;  1AC1 A;  1M2A A;  1GP1 A;  5F0G A;  2X99 A;  1B4Q A;  1K0M A;  2H71 A;  2O89 A;  2H1A A;  2OAD A;  5D73 A;  1O8X A;  3CTF A;  2F9S A;  2PBJ A;  3NIV A;  5BMU A;  18GS A;  1M0U A;  1SK1 A;  2V1M A;  2CA8 A;  2N5B A;  2L59 A;  3LQ7 A;  5IOX A;  16GS A;  1GH2 A;  2CT6 A;  5FWG A;  1TKD B;  2UZ8 A;  4NPB A;  1VRS D;  2M72 A;  4I5Q A;  2KLX A;  2HLS A;  3GRX A;  1F3B A;  2LEG A;  2HRN A;  2DBC A;  5GAN D;  4G0I A;  5F05 A;  4IKH A;  2CV4 A;  1PKW A;  2B5X A;  3UL3 A;  2D2Z A;  5JWQ B;  1I5G A;  4Q5N A;  3PIN A;  3DXB A;  4V2M A;  5GSS A;  3A2X A;  4X1U A;  4NHZ A;  2H8L A;  2L4Q A;  4ICY A;  2HZE A;  4O7H A;  2MMZ A;  2P5Q A;  3GUR A;  3VK9 A;  3IAS 2;  4XTS A;  3HHV A;  5IMA A;  1YEP A;  2LJA A;  2RUF A;  4GSN A;  1ZYN A;  3EE2 A;  2VUP A;  5J4U A;  2GSR A;  5J5N A;  4KDX A;  1IYI A;  2IMD A;  3M9K A;  4I6X A;  3F0I A;  1EV4 A;  2EIO A;  1W89 A;  4RI7 A;  3WGE A;  1TU7 A;  5ECH B;  1F3A A;  2H75 A;  4TRX A;  4J2F A;  3J7Y k;  4BVY B;  2L6D A;  4KUN A;  3IE3 A;  6GSU A;  2LJK A;  4KGI A;  4AJ8 A;  5KN3 A;  1R5P A;  2OBI A;  1G7O A;  3TJJ A;  4RQX A;  3PGT A;  1C72 A;  1GLQ A;  2FWH A;  1ZYQ B;  3O3T A;  3QAV A;  2DLX A;  2VM1 A;  2OA7 A;  1XOB A;  4MLY A;  4XRD A;  1TW9 A;  2GQM A;  2YWI A;  5IIZ A;  4MCU A;  4ML6 A;  1K3O A;  2RLI A;  2DIY A;  4TXV A;  5AIV A;  3M0F A;  3FZ4 A;  4HDE A;  1XZO A;  1TK0 B;  3HDC A;  2H6X A;  2GZZ A;  3TKP A;  4N11 A;  1HNC A;  2KP1 A;  2GZY A;  1BYE A;  4YKG A;  2VD1 A;  3RDW A;  1TXX A;  1NM3 A;  3TJG A;  2YNX A;  2A2R A;  2DML A;  4MF6 A;  2RM6 A;  2VL2 C;  3DVX A;  3GSS A;  2QGV A;  2DC5 A;  3TKS A;  3G9B A;  3ISO A;  1FHE A;  2PPT A;  2B7K A;  2CAI A;  2H0I A;  1ZCP A;  1KEB A;  1THO A;  2DJ3 A;  4GF0 A;  5ECS A;  1F9M A;  3D6I A;  5DAL A;  1B4P A;  3UMA A;  2YWO A;  3ZRE A;  4K7N A;  3PR8 A;  2P0G A;  1G6Y A;  3BJ5 A;  4EDY A;  4ZB8 A;  1SJZ A;  3MWH A;  4ULX A;  3GX8 A;  3F3R A;  1FB6 A;  1T3B A;  2PVQ A;  4EXJ A;  4FO5 A;  3F4S A;  5IPG A;  2M46 A;  2YCD A;  1A23 A;  4JBB A;  1XFL A;  3CSJ A;  1HNB A;  11GS A;  1PL1 A;  2C3N A;  2L4C A;  1M7T A;  2GVP A;  4IW9 A;  1ZZY A;  1TK5 B;  1SL1 B;  2B1L A;  3ZIT A;  4AGS A;  2BTO T;  5H5Q A;  2C0F A;  5KN2 A;  1K0C A;  2B1K A;  4I8B A;  3C71 A;  3NZN A;  1YDK A;  2R0G A;  2JZS A;  4RQR A;  4OO4 A;  3LGC A;  4MAB A;  1MTC A;  1VF3 A;  5CYY A;  1ZL9 A;  3E9J B;  2H01 A;  2BJX A;  2VD0 A;  5ENU A;  3GFK A;  4O5Q A;  4HOJ A;  1T4Y A;  1GSQ A;  3IV4 A;  4EKZ A;  4WR5 A;  3L0H A;  1B8X A;  1K0N A;  4ZL7 A;  4TXO B;  3EPT A;  1QQ2 A;  4LA1 A;  2NBS A;  2E7P A;  2FHE A;  1UC7 A;  3TB2 A;  4ECC A;  2PUK C;  4LL4 B;  22GS A;  1FOV A;  5F06 A;  2HXK A;  3APQ A;  4WF5 A;  20GS A;  2VLV A;  4OWY A;  3RPP A;  2ON5 A;  3J7Y b;  3ZLP A;  1X9M B;  3FHK A;  1OVN A;  2DIZ A;  3UJ1 A;  2E2M A;  3D22 A;  4J57 E;  1WOU A;  2YV9 A;  4XS4 B;  3MYD A;  1ZOF A;  4V2L A;  2H73 A;  2K18 A;  5DJL A;  4D73 B;  4IJ3 A;  2E2G A;  4IP6 A;  3EMP A;  4HU7 A;  1R7H A;  1GNE A;  3ERF A;  1SYX A;  2GTU A;  4KND A;  2FLS A;  5L71 A;  1YZX A;  4NV5 A;  2HZF A;  4TKY A;  1SD9 A;  4MJA A;  6GSY A;  1CQG A;  2A4V A;  2VCZ A;  4JE1 A;  3ZL5 A;  1PKZ A;  4JZQ A;  1TJD A;  4BVX B;  5ECI B;  4GTU A;  4G0L A;  2VLU A;  3FW2 A;  3PH9 A;  2LRN A;  3ED3 A;  4OMV A;  1OKT A;  4I2U A;  1BED A;  5IMV A;  4TR3 A;  1T4Z A;  1MDK A;  3P8W A;  1R4W A;  2R4V A;  3KM6 A;  3TJB A;  3GKM A;  4F9Z A;  1YF0 A;  1EEJ A;  3QD9 A;  1BAY A;  3ZMK A;  4DVC A;  1FAA A;  4OFT A;  3E3E A;  1QXH A;  3ME8 A;  5C00 A;  1OC9 B;  1GUM A;  2HSM A;  1V40 A;  2QSI A;  3VWV A;  1GSY A;  4K9Z A;  1PQN A;  2TRC P;  3CBU A;  4ZL9 A;  2KHP A;  2J23 A;  3UAP A;  1TTZ A;  4JR6 A;  2F8A A;  3G7I A;  1V9W A;  4K0G A;  3HZ8 A;  2VCQ A;  4YQU A;  2IFQ B;  4PNF A;  2KP2 A;  3F63 A;  3W8J A;  4NMU A;  3A5W A;  2H6Z A;  8GSS A;  9GSS A;  3L4N A;  1VF4 A;  2JZT A;  3HVX A;  4CY6 A;  1O81 A;  1MDI A;  1JFU A;  3LW9 A;  3TKR A;  2PU9 C;  3P90 A;  3DVW A;  4USS A;  5IO2 A;  10GS A;  1SEN A;  2FWG A;  5DQY A;  3ZRD A;  2AAW A;  4BPY A;  2GT6 A;  4OCF A;  2HRA A;  4FYU A;  2ZCT A;  2MMO A;  1WWJ A;  3EC3 A;  3VWU A;  1ABA A;  4PNG A;  1OKD A;  4JR4 A;  1B9X C;  4BL7 B;  4ECB A;  2DJ0 A;  1PGT A;  3BCI A;  2B6M A;  4EUY A;  5J41 A;  2P5R A;  2GLR A;  1U88 A;  2JSZ A;  1JZW A;  3IHQ A;  2X8C A;  1M2D A;  3G7Y A;  4F0C A;  4WBJ A;  4MF7 A;  4IHU A;  5G1L A;  1O7U A;  2V32 A;  3D21 A;  3EYT A;  4DSQ A;  5EL8 A;  4Q5R A;  4ZB6 A;  1DBY A;  1UVZ A;  5J3R A;  4POK A;  3KIJ A;  3QOU A;  2P31 A;  4L0U A;  1BJX A;  1LU4 A;  4PUR A;  1SYR A;  2WS2 A;  5DDL A;  2GQK A;  2B3S A;  1SK2 A;  5CRG A;  3US3 A;  2CVB A;  3LG6 A;  2PN8 A;  2HRK A;  2NDO A;  5G5F A;  2QA2 A;  5AN1 A;  1URM A;  4Z2R A;  2NPB A;  4DSR A;  3VPQ A;  5IMF A;  2H1D A;  3QAW A;  1WPI A;  3FYG A;  2XBI A;  2C3Q A;  3WD6 A;  3DIE A;  3VI5 A;  4DSS B;  1TU8 A;  1YF1 A;  1F2E A;  5A4W A;  2FUG 2;  1YKC A;  1XW9 A;  4NV2 A;  3QPM A;  4IGJ A;  3KTB A;  3UAR A;  3ZIJ A;  3F3Q A;  4OO5 A;  3HYP A;  2PGT A;  3EUR A;  2B5Y A;  2CAQ A;  4PXO A;  2XBQ A;  4ZIL A;  1Z7R A;  1A8L A;  2L5O A;  4QL9 A;  3FMW A;  1V57 A;  1J08 A;  4MA9 A;  1PRX A;  1K0B A;  4G19 A;  4E8E A;  2OE3 A;  2R2J A;  3QAG A;  3F8U A;  1EGO A;  3TUE A;  3Q74 A;  2NVL A;  1K0A A;  1NSW A;  2AB6 A;  3GUS A;  3GYK A;  3IAM 2;  2IMI A;  3DWV A;  2PVO C;  4F2I A;  5DAK B;  2GZP A;  5ECN B;  3RHC A;  1AIU A;  1PL2 A;  2O85 A;  4GCI A;  3WYW A;  2YJ7 A;  2RM5 A;  2N5F A;  1KBN A;  1TOF A;  2YOI A;  2VCT A;  3U5R E;  5DJM A;  2VM2 A;  4MDC A;  2I1U A;  2RII A;  1M9A A;  2C1Y A;  4POM A;  4HEA 2;  3ME7 A;  4ZB9 A;  3GH9 A;  4FQU A;  2B5E A;  4O92 A;  4NAX A;  4ECJ A;  1OC3 A;  1UN2 A;  4ACS A;  3KMO A;  2TIR A;  4HI7 A;  5LD0 A;  3CYN A;  2C0E A;  4X4J A;  3EMX A;  1WJK A;  3GTU A;  3MDK A;  2JZR A;  3O76 A;  1GWC A;  1ON4 A;  4GRF A;  3VUR A;  1J0F A;  5ABR A;  1QUW A;  2LST A;  2MZC A;  1W4V A;  4KB3 A;  1AQX A;  1N2A A;  1THX A;  3P7X A;  1Z7P A;  4ZL8 A;  4TR1 B;  1XW6 A;  2DMM A;  4KCA A;  1R5A A;  5KEJ A;  2R37 A;  1BG5 A;  6GSV A;  5E59 A;  4WXT A;  4AJ6 A;  1O6J A;  2XC2 A;  1XW5 A;  4GWR A;  1GSE A;  2OJL A;  4KX4 A;  3F4R A;  4DEJ A;  3GV1 A;  3KCM A;  1S3D A;  3TKS C;  1PN9 A;  1JZR A;  2LJR A;  4GSS A;  3FEU A;  1K0O A;  6GST A;  3EVI A;  5HR2 A;  1TK8 B;  4BWQ A;  2LQO A;  2CQ9 A;  5H5S A;  4ISD A;  4X43 A;  5IMZ A;  3EIN A;  2ZUP A;  3TOT A;  1I9D A;  3EU3 A;  2O7K A;  2R0P A;  2C4J A;  4IS0 A;  3KEB A;  2ZNM A;  2VL3 A;  3KGK A;  4ZBB A;  1USB A;  3DEX A;  3L9V A;  1DSB A;  4G2E A;  2H0G A;  3Q6O A;  4K1F A;  5D96 A;  4XS6 A;  2LS5 A;  2WDU A;  5JCU A;  3H93 A;  2IIY A;  2OE0 A;  3W6G A;  5IMD A;  4J56 E;  5ID2 A;  3IDV A;  4FIW A;  4ML1 A;  2H74 A;  3C1R A;  1WMJ A;  2GQL A;  1XWC A;  4I2T A;  1AUC A;  1RQM A;  2I9H A;  3E0U A;  4E8H A;  2AYT A;  2E0Q A;  2OAC A;  3QR6 A;  5E4W A;  3KTL A;  4IQ1 A;  3LYK A;  3M9J A;  3KZQ A;  1EGR A;  3UOM A;  2MBT A;  1WRY A;  3C1S A;  5GST A;  4K6X A;  2KUC A;  3WT2 A;  3HJM A;  4MF5 A;  5IM9 A;  1T00 A;  4HS1 A;  4MJC A;  5CRE A;  13GS A;  1IYH A;  4L5O A;  2JU5 A;  2VLT A;  5KN1 A;  3QMX A;  1T1V A;  3GX0 A;  3DKS A;  1A0R P;  2CVK A;  1H4O A;  3Q18 A;  2PMT A;  3IK7 A;  3L9S A;  2HFD A;  5IQY A;  4MZW A;  5D9V A;  2LV3 A;  5CO3 A;  5IO0 A;  3DGQ A;  4EF0 A;  4MPF A;  4CDO A;  4EL1 A;  4IP1 A;  1X9S B;  3ZFB A;  2YV7 A;  4MJB A;  4PQH A;  1EEM A;  4MH2 A;  1ERU A;  4IJI A;  3HJO A;  2VOC A;  3APS A;  5B7C A;  1K3Y A;  4KSO A;  5ECL B;  2F8F A;  5INY A;  3FZ9 A;  3GIX A;  1V58 A;  4L5L A;  4X0X A;  5D9W A;  3RBT A;  2WUL A;  4IBP A;  3CSI A;  2DJK A;  4JU5 A;  4O32 A;  2Z9S A;  4TW5 A;  1SL0 B;  1X5C A;  1A2L A;  2LNT A;  4HJM A;  2HSY A;  4TOP A;  3VWW A;  1A0F A;  2HZE B;  2NTO A;  1O73 A;  2GGT A;  3V1W A;  2LQQ A;  1X0R A;  3M1G A;  5CRW A;  2J9H A;  2CX3 A;  3CXG A;  2ES7 A;  5AIS A;  4GXZ A;  3QCP A;  4GQF A;  4N30 A;  1NHO A;  4WET A;  4ILF A;  3UEM A;  4KAE A;  2H0H A;  4EE0 A;  1KTE A;  4G9H A;  2AV4 A;  1K3L A;  1PA3 A;  2G2Q A;  3IOS A;  4WEY A;  1NHY A;  2B7J A;  4PX1 A;  3TGZ A;  4FYC A;  1Z6N A;  3IC4 A;  2C0G A;  2YWM A;  2DJJ A;  2EIR A;  7GSS A;  3F9U A;  3ERG A;  1LJR A;  1YY7 A;  2YZU A;  3BOA A;  1X5E A;  2QC7 A;  3FRC A;  5GZZ B;  4BVY A;  3O6T A;  4KE3 A;  3P2A A;  2HYX A;  2TRX A;  1QFN A;  2A2P A;  2K8S A;  2JAD A;  1XIY A;  3KH7 A;  6GSW A;  3LEF A;  1HQO A;  1EV9 A;  2F51 A;  2HSH A;  2OE1 A;  3L78 A;  3HKR A;  3KP8 A;  2IJY A;  1T7P B;  4EVM A;  4K2D A;  2CZ2 A;  3EWL A;  5JCG A;  5LCZ A;  2V6O A;  5LNK e;  3IPZ A;  3TJF A;  3LJR A;  2EC4 A;  1F37 A;  4NWY A;  4MNN A;  3I6A A;  1QGV A;  1R26 A;  1SJ6 A;  3BD2 A;  3FK8 A;  4MMM A;  1WP0 A;  5DBQ A;  1PN0 A;  2FWE A;  4XIH A;  1SKR B;  1Z3E A;  2PWJ A;  2HRF A;  4HUA A;  4QQ7 A;  4MK3 A;  1OYJ A;  2FWF A;  4TN8 A;  5ECO B;  3BCK A;  5DAL B;  2WB9 A;  2JSY A;  3HY2 A;  1GTI A;  3NOF A;  1U3A A;  1E2Y A;  4K7I A;  2C0D A;  3DYR A;  3A2V A;  5A4U A;  5B8B A;  2C3T A;  1GNW A;  5DVB A;  2ALB A;  4TR4 A;  1FOH A;  3SBC A;  1G6W A;  2WCI A;  1M99 A;  4YQV A;  3VFI A;  4L0W A;  1OAZ A;  4KSM A;  2VCV A;  3C8E A;  4YAP A;  2H70 A;  1E6B A;  2YWN A;  3IBH A;  3F4T A;  2HI7 A;  3D5J A;  1B48 A;  5J9B A;  1XXU A;  1SKS B;  3ZFL A;  4IQA A;  1X9W B;  4HJ2 A;  3FR6 A;  3ZYW A;  1XVQ A;  1OC8 A;  2DJ2 A;  2PER A;  3VI7 A;  1DE2 A;  4IN0 A;  2C8U A;  5A5K A;  1A8Y A;  1F6M C;  4Z7X A;  1PSQ A;  2A2S A;  1GSU A;  2AUV A;  5D9T A;  4BA7 A;  3VPT A;  3KP9 A;  1GUH A;  4V1A p;  3C73 A;  3HVV A;  1Y25 A;  2FA4 A;  3FR3 A;  3GL3 A;  4P3Y B;  1V98 A;  1XVW A;  2YP6 A;  4ZBA A;  5JWR B;  2BMX A;  3WGX A;  4Z2T A;  3SWL A;  4YQM A;  2L6C A;  4KW6 A;  1ILO A;  3H79 A;  1GTU A;  4GQC A;  3IRA A;  3Q19 A;  1XOA A;  3IK9 A;  3PPU A;  1BQ7 A;  4L8E A;  1RW1 A;  5C04 A;  3UBL A;  2X8H A;  2HNL A;  1VGL A;  3GL5 A;  3HD5 A;  4JRR A;  1GTB A;  6GSS A;  4NXI A;  3HXS A;  2H19 A;  4TXO A;  3IC8 A;  2VO4 A;  4K8M A;  1GLP A;  5KOX A;  1GSF A;  3KJY A;  3N9J A;  3U6V A;  5AIX A;  2H72 A;  4ZIJ A;  2IMK A;  4LMV A;  2QKE A;  2FGX A;  5HQP A;  1SL2 B;  5KOW A;  5B6N A;  3FZ5 A;  4IEL A;  4POL A;  3ZTL A;  5EPF A;  3D0Z A;  5CNW A;  4XS4 A;  3K8N A;  1GL8 A;  3GMF A;  3AY8 A;  4D73 A;  5H5R A;  2FCH A;  3BBY A;  1Z9H A;  2DJ1 A;  2V6K A;  2X64 A;  4MPG A;  2FD3 A;  3IHG A;  3H4K A;  1AXD A;  3LWA A;  5G5E A;  1A24 A;  2CX4 A;  4PGT A;  3QFA C;  2H30 A;  1OE8 A;  3LOR A;  5AGY A;  4K7O A;  1EWX A;  1FW1 A;  3FY7 A;  5ELG A;  1RK4 A;  4BVX A;  2R6K A;  2XPD A;  4K0N A;  4KDU A;  5EVO A;  2O8V B;  1MDJ A;  2C80 A;  1XWG A;  3TRP A;  1G0T A;  3GA4 A;  3TCO A;  4HZ2 A;  3TKQ A;  1MD4 A;  1SD8 A;  1J9B A;  4PUF C;  5BRT A;  1B9Y C;  3UVH A;  1TRW A;  1OC9 A;  3GKN A;  3LSZ A;  5J9C A;  4OFM A;  1HYU A;  4BWS A;  4LL1 B;  5IMC A;  4GLT A;  3MAK A;  3TRX A;  2YZH A;  5DCG A;  3I43 A;  4K2X A;  4O5R A;  4K5R A;  2IFQ A;  1CQH A;  2IPA A;  4I97 A;  3HA9 A;  2MBS A;  5HR3 A;  3A5I A;  3HCZ A;  1UA5 A;  4MZC A;  4XCS A;  5DCH A;  5D8I A;  2I81 A;  2VAF A;  5JWO B;  4PQI A;  3MSZ A;  2L57 A;  4Q5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...