3VWUA

Crystal structure of peroxiredoxin 4 from m. musculus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
172
Chain Sequence
b'LSKAKISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKGVLRQITLNDLPVGRSVDETLRLVQAFQYTVCPAGWKPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin-4
publication title Synergistic cooperation of PDI family members in peroxiredoxin 4-driven oxidative protein folding
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase
total genus 49
structure length 172
sequence length 177
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vwuA00
3LGCA 2QGVA 3UEMA 5IMFA 1NM3A 5KN1A 2RIIA 2LQOA 4TR1A 3BCIA 1Z6NA 3GNJA 2HSYA 3D4MA 4IP6A 4D73B 2GSRA 2GZYA 2L5LA 3WGEA 4DSSA 1THXA 1U6TA 3D21A 1TOFA 2YP6A 3ZITA 2R3XA 3PINA 5D9XA 3LXTA 4HQSA 2LRCA 1GH2A 4FO5A 4PXOA 4POLA 3H4KA 1ST9A 1WMJA 2H0GA 3DVWA 3CXGA 2DJ1A 5H5SA 1Z9HA 2AUVA 4XTSA 2L57A 5FHIA 1T1VA 9GSSA 1PX6A 2CVDA 2H1GA 4ECBA 4YQVA 1NSWA 1XOBA 5D8IA 2GGTA 5ID2B 3IPZA 3GHAA 5AGYA 3F8UA 3P90A 3HD5A 4GRFA 1JLWA 1A23A 2VCVA 5B8AA 4IHUA 1BYEA 1VF2A 3E3EA 1ZL9A 2JSYA 1FVKA 4ZL9A 5C04A 5ECMB 4ZBAA 2VM1A 1GWCA 1TK5B 3DVXA 4IQAA 4OFNA 3TCOA 1ZCPA 2OE0A 2FWHA 1V9WA 3FZ4A 1TKDB 3F63A 1PKZA 2EIQA 4KCEA 5A5KA 2FWFA 2YJHA 4IJ3A 3IRAA 1DE1A 2B3SA 4OCEA 4G10A 1I9DA 4KSOA 2VO4A 3Q19A 5CRGA 1WPIA 1T00A 1XWAA 2RM6A 3KMOA 5JCUA 1ACVA 3A3TA 5D73A 2WB9A 1O81A 2C0EA 3ISOA 1SKSB 3DIEA 4OD7A 5GSTA 3M1GA 3ZREA 2I4AA 3Q74A 4IS0A 2VOCA 3FZ9A 1K0CA 3SBCA 4MK3A 1AW9A 1Y6EA 2XHFA 1EEMA 2OE1A 4F82A 1TU7A 3VWUA 5LNKe 1V58A 3RPNA 3ERGA 2VL3A 4MZWA 4CW9A 2FWGA 2J23A 3FEUA 4LMVA 5HR2A 3GH9A 5F0GA 2GQKA 1TK8B 1JHBA 3UARA 2CA8A 3ZIVA 3DMLA 3SWLA 2XPEA 3ME8A 1GSSA 1V2AA 2KP2A 1A8YA 5E59A 1G7EA 2H70A 3VURA 2CAQA 1QMVA 2O7KA 3NIVA 5CAXA 1PL2A 1XXUA 1XOAA 3TRPA 3L0HA 1EP8A 4JR4A 1S3CA 4H86A 3DXBA 1GTIA 2IMEA 2G2QA 1T4ZA 4GQFA 1BX9A 4XHMA 4GQCA 3TKRA 3QDNA 4OO5A 3IK7A 5AISA 1K0AA 4KCAA 3QCPA 1YF1A 1B48A 3E0UA 2HNLA 1FB0A 1ZYQB 1X5EA 1AAZA 1GSDA 2VAFA 1PX7A 3QFBC 4L5OA 4HZ4A 4FYCA 3F9UA 1OC9A 1OYJA 4L0WA 2HRNA 1TRWA 1EOHA 2IJYA 5FWGA 4WF5A 1AC1A 1Z6MA 4V1Ag 6GSXA 5D9WA 5H5RA 3EINA 5ECHB 1GRXA 2WRTA 3TOUA 1YDKA 2H01A 2E0QA 2PBJA 3IA1A 4K9ZA 1VF3A 5JCGA 4ZB9A 4GF0A 3L4NA 1R4WA 4TXVA 2GS3A 4K7NA 4BWQA 6GSTA 4IP1A 1A0RP 1Z3EA 3UBKA 4BVYA 2YNXA 2PVQA 1WOUA 1HD2A 3WGXA 1PMTA 6GSVA 2VCWA 2ON5A 3N5OA 11GSA 2NBSA 1LJRA 3US3A 1X5CA 3GTUB 1UA5A 2FWEA 3DWVA 4LMWA 1FB6A 1IYIA 5DVBA 2R37A 1EOGA 1SK2A 3FY7A 5B7CA 4ZB8A 2AB6A 3APSA 2REMA 5DBQA 5ABRA 2M72A 5AIXA 1NHYA 2HZEB 1GSUA 1SL2B 2JZTA 3KMNA 2A2SA 4KAEA 4IW9A 3WYWA 1B9XC 3WT1A 1GULA 1WJKA 1BG5A 6GSSA 2YPMA 5JWQB 3A2XA 3EYTA 1ERVA 4HI7A 3UL3A 1TTZA 1U88A 4OFMA 4I97A 3FKFA 2J9HA 5G5EA 3KZQA 3FR9A 4EDYA 2P0GA 3M9JA 1XIYA 1LBKA 3N9JA 4AJ7A 1JZRA 4RQRA 3LJRA 3FRCA 2GQMA 5CYYA 4YH2A 3EU3A 1RQMA 3HJPA 5DALA 2BJXA 3GTUA 4XS6A 1A0FA 1QGVA 2B6MA 4J57E 1FO5A 1M2AA 3RBTA 2LV3A 2O85A 1XVWA 4G19A 4G9HA 10GSA 3J7Yb 2MBTA 3DGQA 5IO2A 1K0NA 1PSQA 4ZL8A 5DCGA 4WR5A 3KXOA 4KDXA 4MF5A 2CZ3A 4V2NA 4MH2A 1SENA 1WWJA 3S9FA 3KM6A 3ZMKA 4J2FA 1K3LA 2HRFA 2OBIA 4K7OA 1O73A 2ALBA 4BL7A 3IAM2 4YQMA 3HJOA 3PR8A 4KUNA 2V6KA 4L0UA 3TJKA 2B1LA 4V2MA 5G31A 5J41A 2PERA 1H75A 2WS2A 1GSEA 3E9JB 5IMZA 5J9BA 1X9WB 4MJCA 3TRQA 2IMDA 5DQSA 1EGOA 1DBYA 4EUYA 3F6FA 3BJ5A 2YZHA 1XWCA 3KEBA 3IE3A 4CHSA 1J0FA 5INYA 2XBQA 2NPBA 4WR4A 19GSA 1TI1A 3VWWA 3LFLA 1EP7A 5ECPB 2TRCP 1S3AA 2HT9A 1GTBA 1C72A 3CYNA 4X0XA 2QSIA 2OKAA 1CQGA 4TR1B 1Z7PA 1MDJA 3IOSA 2V6OA 3ED3A 13GSA 4K2DA 4DSSB 3GIXA 3NZNA 2VCZA 1X9MB 1GNWA 1RW1A 5ECOB 1BAYA 3H8QA 5JCWA 4DSRA 2GT6A 2VCXA 3ZFLA 3AY8A 4K0GA 1EGRA 2H72A 1M0UA 2P5RA 1GLPA 3KTLA 4K6XA 1HNBA 2L5OA 2LS5A 1T3BA 4ZXGA 2NTOA 6GSWA 1HNCA 3LYKA 3APOA 1ERTA 1EV4A 1TK0B 2YWNA 4F03A 22GSA 2H75A 2N5AA 1N2AA 1WE0A 4O92A 2PUKC 3BCKA 4HEA2 4TRXA 1DUGA 1EEJA 3ERWA 3PH9A 2X8HA 2FGXA 2H6YA 2A4VA 3IV4A 3FYGA 2K6VA 3RAZA 5DDLA 2E7PA 2KLXA 5HFGA 2WFCA 5IMDA 1JLVA 1K3YA 4XS1A 2I1UA 2LSTA 3BBYA 2C3QA 1KTEA 1Q98A 5HR3A 4BPYA 4Q5NA 18GSA 3KP9A 5J3RA 12GSA 4ECJA 5ECQB 3FZAA 4ID0A 4ECIA 3Q18A 4TXOA 5FT3A 1PL1A 5IQYA 2V32A 2K9FA 1M2DA 2CX3A 1ZMAA 5L71A 5D93A 3QAVA 1TI3A 2I81A 3CSHA 5E4WA 1XFLA 4FH8A 3UMAA 1XPVA 4RQXA 5G5FA 3QAGA 2YV7A 2MMAA 3D0ZA 2DMLA 5IPGA 2X8GA 4NV2A 2IMKA 3J7Yk 3L9UA 3TKPA 3RHCA 3TOTA 1Z5YE 4EXJA 1B4PA 2AHEA 3H1NA 1ZZYA 5F8BA 14GSA 3FR3A 1SK0A 4MZBA 2ZNMA 4KDYA 5KN3A 3UBLA 3F4RA 2GSSA 2GSTA 2MBSA 3R2QA 2YWOA 1XZOA 4KDUA 4QL9A 4ZL7A 2LUSA 2B7KA 3D6IA 2VIMA 2K18A 2PGTA 4HZ2A 1AXDA 3IHQA 5AIVA 5ECLB 3LEFA 1AQVA 1ZGNA 3D5JA 4EF0A 4JZQA 4K7IA 4POMA 4NXIA 2IPAA 3C8EA 2IL3A 2C3TA 1K0MA 1F9MA 4GSTA 1SYRA 3A2VA 1QK8A 2H73A 5J9CA 4V2LA 2VL2C 4KGIA 1T8EB 3RHBA 3GKNA 2YN1A 3GN3A 4GSSA 2O87A 1PA3A 2C80A 1J9BA 4YAPA 2L59A 3FW2A 1MD4A 3FR6A 4LA1A 2O8VB 2MMZA 1OC9B 3F0IA 3IBHA 2F8FA 3ERFA 3ZIJA 2CAIA 5ENUA 1THOA 2BTOT 5IPHA 1R7HA 3UIWA 2EC4A 3EWLA 3LSZA 5LCZA 3TKSA 3EE2A 3GX0A 3MNGA 4GTUA 1R26A 4P3YB 3GKKA 1XWBA 3EURA 3C71A 1YY7A 3TJBA 2P5QA 3UJ1A 4EO3A 4PURA 1UVZA 3ZYWA 2GVPA 1M9AA 4HDEA 1LU4A 2DJ0A 4KB3A 2YJ7A 4F0CA 3LORA 1NHOA 4PNGA 2RM5A 4IVFA 1SJIA 2MMNA 3HJMA 1EV9A 4I8BA 1M2BA 1MEKA 2LJRA 4F0BA 3VPTA 1A2MA 3QMXA 4DSQA 4XRDA 5DJMA 2PPTA 3I6AA 1B4QA 1TRUA 4J56E 5J4UA 4I6XA 4HS1A 1XWKA 2QKEA 4I5QA 4N10A 3UOMA 1E2YA 4WKWA 2N5FA 3L9VA 1G7OA 3HDCA 4Q5RA 1SYXA 4JEDA 1F3AA 2L4CA 4X43A 5H5QA 4PGTA 1A24A 5DCHA 3UAPA 3HXSA 2VD1A 3O3TA 4PQHA 2VCQA 3Q6OA 1U3AA 2HI7A 1QXHA 4TR0A 1B9YC 4O32A 4RUVA 5DALB 1K0DA 2K8SA 4AJ6A 5CO3A 3VI5A 1WRYA 4EVMA 2YWIA 3M9KA 4WEYA 2H0HA 1MDIA 4LL4B 2IMIA 2FHEA 3TJGA 2G0FA 2XPDA 5ELAA 3C1SA 1SL0B 3CRTA 2VLVA 2IN3A 3I43A 1SU9A 1YZXA 1FVJA 2RUEA 1H4OA 2OBKA 2TIRA 16GSA 2OJLA 3JCML 4MPFA 1FOVA 1TXXA 2FCHA 2VUPA 5J5NA 1KBNA 3LG6A 4PX1A 3DRNA 2WCIA 4O5RA 3UVTA 5HR0A 1FG4A 1G0TA 3GX8A 3WD6A 4MZCA 2FUG2 3GURA 2B1KA 2PMTA 3IAS2 2YCDA 1MDKA 5HFIA 2FA8A 4BA7A 1OE7A 2DJ3A 4GWRA 3W8JA 3GL3A 3VI7A 3GV1A 2GZZA 3HVXA 1Q4JA 3GL5A 4I2UA 2FLSA 1HYUA 2IFQB 3TKSC 1M9BA 3D4TA 3I69A 4CDOA 2WJUA 4TKYA 2BMXA 1TDIA 2TRXA 4OMVA 5IOXA 2GSQA 3HHVA 4LL1B 1J08A 5A4WA 5IOWA 3W8SA 5ECRB 4V1Ap 1XVQA 2D2ZA 3ZRDA 2GQLA 2R5GA 2B5EA 4L5LA 1V98A 5GAND 3BD2A 2R6KA 2CVKA 3LXZA 5CRHA 1KNGA 3A2WA 2GT5A 4JU5A 2RUFA 5CP1A 2DC5A 2C0FA 5A4UA 4TW5A 1F2EA 3ZZXA 3M8NA 4MP4A 2MYGA 2H74A 2Z9SA 1VRSD 3M0FA 2HFDA 3DYRA 2IFQA 5IM9A 3VK9A 2OACA 1U87A 4ML6A 4OFTA 1MTCA 1OC8A 2WULA 4AGSA 5GZZB 4PUFC 1ILOA 4MH3A 5D9VA 4NAXA 5HQPA 2F51A 4FYBA 1FW1A 2C0GA 5ELGA 4JRRA 4MLYA 1TW9A 4XS4A 3GSTA 3EVIA 2CZ2A 3F6DA 4IELA 2KP1A 3HVVA 1YJ6A 4K0NA 2FY6A 3MAKA 4IBPA 2AYTA 1G6YA 4MPGA 2LKUA 2VLTA 4WXTA 2KOKA 2KUCA 4DVCA 3RPPA 3EC3A 3CMIA 1U3IA 5HR1A 4TXOB 4I2TA 2YZUA 2NDOA 3CTGA 1TRSA 4KSMA 3EMPA 3WT2A 2AV4A 3GA4A 1BEDA 3ZLPA 4MF6A 4KE3A 1XWGA 3F4SA 1M99A 4Q5QA 1ERUA 5LD0A 2E2GA 4PUAA 1ML6A 1K3OA 4QL7A 2H1DA 4KNDA 2PVOC 3QAWA 4ULXA 3VPQA 1AUCA 1F6MC 2CT6A 2X99A 3CSIA 2VLUA 4NPBA 5COHA 4TR4A 2IIYA 2C3NA 1JZDA 5CREA 3G7IA 4QQ7A 2H1AA 2H6ZA 4JBBA 2B5XA 4XIHA 2F3MA 3MSZA 2WDUA 4MABA 3WGDA 4NHZA 4WBRD 1BJXA 3H93A 4KW6A 2CVBA 4L8EA 3VWVA 1HNAA 8GSSA 4TOPA 5IO0A 1GUHA 3TRXA 1IYHA 2C0DA 1GSFA 3GMFA 4YAVA 4ECCA 3DKSA 4IGJA 5IMCA 3FHKA 5EPFA 1VGLA 1PGTA 4O7HA 2R2JA 2C4JA 1GSYA 3RDWA 5DQYA 4OWYA 20GSA 1SD8A 3ZMLA 2LJAA 4XRAA 4JR6A 1F37A 3NOFA 4PQIA 7GSSA 2LNTA 2LEGA 2EIOA 3BOAA 1O85A 1WIKA 2FD3A 1OC3A 2RLIA 1PQNA 2C1YA 2JL4A 3G7JA 2H76A 5B6NA 1O6JA 5G2ZA 2PWJA 2A2RA 2AJQB 3QD9A 1K0BA 3QPMA 5ECNB 4MCUA 4N11A 3LQ7A 4TVEA 4D73A 5D9TA 1AQWA 2P31A 1B8XA 5JWRB 1XW9A 2YWMA 1Y25A 3K8NA 2DBCA 2IMFA 1HQOA 1YEPA 1JZWA 2WZ9A 1SK1A 3GKXA 5HFKA 4ML1A 2FNOA 2HXKA 4EDZA 3W6GA 3MDKA 1TJDA 6GSYA 4KX4A 3O76A 2LRTA 1WP0A 2L6CA 1T7PB 3HKRA 1TU8A 2HZFA 3QFAC 1GL8A 2B7JA 1AQXA 1F3BA 4WBJA 1N8JA 5IIZA 1A2LA 1ZOFA 5ID2A 2JZRA 5IMAA 3U6VA 1GNEA 3HA9A 2L4QA 4HJMA 2YOIA 4N30A 3QR6A 4NWYA 4WETA 3KJYA 2MMOA 4NMUA 4IN0A 1XBSA 4NHWA 1PN9A 3ZVJA 1M7TA 2ZUPA 3C73A 2M80A 2M46A 1QQ2A 3HZ4A 1VF4A 5G30A 3C1RA 3H79A 5KN0A 2CV4A 3HZ8A 1E6BA 1NW2A 3PGTA 2WGRA 1JZOA 3GSSA 2GLRA 3GKMA 2DIYA 1YF0A 4EKZA 2N5BA 3CBUA 4GSNA 4DEJA 4ZB6A 2MZCA 4HQZA 1FAAA 2XBIA 1UC7A 2IWTA 2R4VA 5F06A 3TDGA 1W89A 4G2EA 4BWSA 2CX4A 3APQA 3IK9A 4AJ8A 2VM2A 5F05A 1XW5A 3HCZA 4N0ZA 4NV5A 3CSJA 1K0OA 2OADA 1YQ1A 1OVNA 2O89A 5IMVA 4YQUA 3TJJA 2LNSA 4MDCA 4MA9A 4RI6A 1SKRB 4ACSA 2B5YA 2HSHA 1S3DA 1X9SB 3OR5A 3O6TA 5AN1A 3IR4A 1O8WA 1ZYEA 3GFKA 5KN2A 1GUMA 2X64A 1T4YA 1PRXA 4F2IA 3TKSE 1RK4A 3VLNA 1SKWB 4E8HA 2X8CA 3KH7A 1URMA 2ZCTA 4HU9A 1OKDA 4IJIA 1R5PA 3TJFA 5EY6A 2LJKA 4KH7A 3U5RE 2JZSA 1O7UA 1XW6A 1A8LA 4K8MA 4EL1A 1ERWA 2V41A 5B8BA 3P7XA 5F07A 1ON4A 3D22A 2K8VA 2JSZA 4TR3A 2HLSA 2OA7A 2PU9C 3P8WA 4KA0A 4ZIJA 2GDRA 1YKAA 2H66A 2H6XA 1TP9A 2V2GA 1GUKA 3CTFA 4Q5FA 3GYKA 5CNWA 2LTKA 5ECIB 3G7YA 1EWXA 3HY2A 5G1LA 5EL8A 1G6WA 3ZL5A 2QC7A 3FK8A 1TRVA 2JU5A 4HU7A 3VFIA 4RI7A 2GZPA 1QFNA 4MJAA 2JADA 4BVXA 5EVOA 2ON7A 3MWHA 1I5GA 1SL1B 1O8XA 2F9SA 3M3MA 5KEJA 3GRXA 3A5WA 2XC2A 3ZVJD 3DD3A 3P2AA 1YKCA 1AIUA 3LYPA 3ZTLA 4EE0A 2YANA 4MF7A 5C00A 2NVLA 2H71A 4MJEA 4PQ1A 3TGZA 3KH9A 3L9SA 2FA4A 1R5AA 4TN8A 3DEXA 4AF2A 1QUWA 2H0IA 2EIRA 4IQ1A 4K1FA 2OE3A 2VD0A 2DJJA 4XCSA 4ISDA 2H19A 5GSSA 2DMMA 2AAWA 4ZBBA 4ZBDA 3V1WA 4HOJA 1BQ7A 1X5DA 2JACA 3IC4A 1SD9A 3TB2A 4XS4B 2CQ9A 1FHEA 5D96A 3KIJA 3CRUA 3ZFBA 4GLTA 2HZEA 2HYXA 4MJBA 1ABAA 4JE1A 1USBA 3QOUA 1JFUA 4ILFA 3KCMA 2F8AA 2DJ2A 4FYUA 1XCCA 2DIZA 1SJZA 5DJLA 1GSQA 5CRDA 3FZ5A 5A4VA 2YV9A 1X0RA 2ES7A 1GTAA 4MMMA 4N0VA 1GTUA 3F3RA 4OCFA 4F9ZA 4WF4A 2L6DA 4X1UA 3KTBA 2HE3A 1SJ6A 1Z7RA 2VL9A 3HVSA 3KGKA 1DSBA 5DAKB 1OAZA 3GUSA 4ZILA 2PN8A 3LWAA 3KD0A 4OO4A 2I9HA 4EC0A 3GH6A 2DSAA 1CQHA 4Z7XA 1YEXA 1UN2A 5ECSA 4GCIA 5G1KA 1PKWA 2H30A 3F3QA 3L78A 5CRWA 2LQQA 3G9BA 5ECKB 1OKTA 2KHPA 3C7MA 1W4VA 3UVHA 2E2MA 3HYPA 2C8UA 1MD3A 1PD21 5JWOB 3EMXA 2H8LA 4FIWA 1KEBA 2VCTA 4PNFA 4GXZA 3TUEA 3I9V2 5B6MA 2LRNA 4HJ2A 4POBA 3TKQA 1V57A 1A2JA 1DE2A 3ME7A 4LLRA 1V40A 3IDVA 2GTUA 2VL2A 1OE8A 2V1MA 3EU4A 5DAKA 1GP1A 4IKHA 1VF1A 2I3YA 6GSUA 3F4TA 2H1BA 1GLQA 3KP8A 4E8EA 1EZKA 3IXRA 4HUAA 2DLXA 5GAPD 2DJKA 17GSA 3VWXA 4POKA
chains in the Genus database with same CATH superfamily
3LGCA 2QGVA 3UEMA 5IMFA 1NM3A 5KN1A 2RIIA 2LQOA 4TR1A 3BCIA 1Z6NA 3GNJA 2HSYA 3D4MA 4IP6A 4D73B 2GSRA 2GZYA 2L5LA 3WGEA 4DSSA 1THXA 1U6TA 3D21A 1TOFA 2YP6A 3ZITA 2R3XA 3PINA 5D9XA 3LXTA 4HQSA 2LRCA 1GH2A 4FO5A 4PXOA 4POLA 3H4KA 1ST9A 1WMJA 2H0GA 3DVWA 3CXGA 2DJ1A 5H5SA 1Z9HA 2AUVA 4XTSA 2L57A 5FHIA 1T1VA 9GSSA 1PX6A 2CVDA 2H1GA 4ECBA 4YQVA 1NSWA 1XOBA 5D8IA 2GGTA 5ID2B 4G0IA 3IPZA 3GHAA 5AGYA 3F8UA 3P90A 3HD5A 4GRFA 1JLWA 1A23A 2VCVA 5B8AA 4IHUA 2X4AA 1BYEA 1VF2A 3E3EA 1ZL9A 2JSYA 1FVKA 4ZL9A 5C04A 5ECMB 4ZBAA 2VM1A 1GWCA 1TK5B 3DVXA 4IQAA 4OFNA 3TCOA 1ZCPA 2OE0A 2FWHA 1V9WA 3FZ4A 1TKDB 3F63A 1PKZA 2EIQA 4KCEA 5A5KA 2FWFA 2YJHA 4IJ3A 3IRAA 1DE1A 2B3SA 4OCEA 4G10A 2QA1A 1I9DA 4KSOA 2VO4A 2UZ8A 3Q19A 5CRGA 1WPIA 1T00A 1XWAA 2RM6A 3KMOA 5JCUA 1ACVA 3A3TA 5D73A 2WB9A 1O81A 2C0EA 3ISOA 1SKSB 3DIEA 4OD7A 5GSTA 3PPUA 3M1GA 3ZREA 2I4AA 3Q74A 4IS0A 2VOCA 3FZ9A 1K0CA 3SBCA 4MK3A 1AW9A 1Y6EA 2XHFA 1EEMA 2OE1A 4F82A 1TU7A 3VWUA 5LNKe 4O5UA 1V58A 3RPNA 3ERGA 2VL3A 4MZWA 4CW9A 2FWGA 2J23A 3FEUA 4LMVA 5HR2A 3GH9A 5F0GA 2GQKA 1TK8B 1JHBA 3UARA 4O5QA 2CA8A 3ZIVA 3DMLA 3SWLA 2XPEA 3ME8A 1GSSA 1V2AA 2KP2A 1A8YA 5E59A 1G7EA 2H70A 3VURA 2CAQA 1QMVA 2O7KA 3NIVA 5CAXA 1PL2A 1XXUA 1XOAA 3TRPA 3L0HA 1EP8A 4JR4A 1S3CA 4H86A 3DXBA 1GTIA 2IMEA 2A2PA 2G2QA 1T4ZA 4GQFA 1BX9A 4XHMA 4GQCA 3TKRA 3QDNA 4OO5A 3IK7A 5AISA 1K0AA 4KCAA 3QCPA 1YF1A 1B48A 3E0UA 2HNLA 1FB0A 1ZYQB 1X5EA 1AAZA 1GSDA 1PFOA 4BVXB 2VAFA 1PX7A 3QFBC 4L5OA 4HZ4A 4FYCA 3F9UA 1OC9A 1OYJA 4L0WA 2HRNA 1TRWA 1EOHA 2IJYA 5FWGA 4WF5A 1AC1A 1Z6MA 4V1Ag 6GSXA 5D9WA 5H5RA 3EINA 5ECHB 1GRXA 2WRTA 3TOUA 1YDKA 4HSCX 2H01A 2E0QA 2PBJA 3IA1A 4K9ZA 1VF3A 5JCGA 2X49A 4ZB9A 4GF0A 3L4NA 1R4WA 4TXVA 2GS3A 4K7NA 4BWQA 6GSTA 4IP1A 1A0RP 1Z3EA 3UBKA 4BVYA 2YNXA 2PVQA 1WOUA 1HD2A 3WGXA 1PMTA 6GSVA 2VCWA 2ON5A 3N5OA 11GSA 2NBSA 1LJRA 3US3A 1X5CA 3GTUB 1UA5A 2FWEA 3DWVA 4LMWA 1FB6A 1IYIA 5DVBA 2R37A 1EOGA 1SK2A 3FY7A 5B7CA 3EPTA 2AB6A 4ZB8A 3APSA 2REMA 5DBQA 5ABRA 4EIQA 2M72A 5AIXA 1NHYA 2HZEB 1GSUA 1SL2B 2JZTA 3KMNA 2A2SA 4KAEA 4IW9A 3WYWA 1B9XC 3WT1A 1GULA 1WJKA 1BG5A 6GSSA 2YPMA 5JWQB 3A2XA 3EYTA 1ERVA 4USSA 4HI7A 3UL3A 1TTZA 1U88A 4OFMA 4I97A 3FKFA 4Z2TA 2J9HA 5G5EA 3KZQA 3FR9A 4EDYA 2P0GA 3M9JA 1XIYA 1LBKA 3N9JA 4AJ7A 1JZRA 4RQRA 3LJRA 3FRCA 2GQMA 5CYYA 4YH2A 3EU3A 1RQMA 3HJPA 5DALA 2BJXA 3GTUA 4XS6A 1A0FA 1QGVA 2B6MA 4J57E 1FO5A 1M2AA 3RBTA 2LV3A 2O85A 1XVWA 4G19A 4G9HA 10GSA 3J7Yb 2MBTA 3DGQA 5IO2A 1K0NA 1PSQA 4ZL8A 5DCGA 4WR5A 3KXOA 4KDXA 4MF5A 2CZ3A 4V2NA 4MH2A 1SENA 1WWJA 3S9FA 3KM6A 3ZMKA 4J2FA 1K3LA 3CQFA 2HRFA 2OBIA 4K7OA 1O73A 2ALBA 4BL7A 3IAM2 4YQMA 3HJOA 3PR8A 4KUNA 2V6KA 3IHGA 4L0UA 3TJKA 2B1LA 4V2MA 5G31A 5J41A 2PERA 1H75A 2WS2A 1GSEA 3E9JB 5IMZA 5J9BA 1X9WB 4MJCA 3TRQA 2IMDA 5DQSA 1EGOA 1DBYA 4EUYA 3F6FA 3BJ5A 2YZHA 1XWCA 3KEBA 3IE3A 4CHSA 1J0FA 5INYA 2XBQA 2NPBA 4WR4A 19GSA 1TI1A 3VWWA 3LFLA 1EP7A 5ECPB 4K5SA 2TRCP 1S3AA 2HT9A 1GTBA 1C72A 3CYNA 4X0XA 2QSIA 2OKAA 1CQGA 4TR1B 1Z7PA 3MYDA 1MDJA 3IOSA 2V6OA 3ED3A 13GSA 4K2DA 4DSSB 3GIXA 3NZNA 2VCZA 1X9MB 1GNWA 1RW1A 5ECOB 1BAYA 3H8QA 5JCWA 3IC8A 4DSRA 2GT6A 2VCXA 3ZFLA 3AY8A 4K0GA 1EGRA 2H72A 1M0UA 2P5RA 1GLPA 3KTLA 4K6XA 1HNBA 2L5OA 2LS5A 1T3BA 4ZXGA 2NTOA 6GSWA 1HNCA 3LYKA 3APOA 2HRKA 1ERTA 1EV4A 1TK0B 2YWNA 4F03A 22GSA 2H75A 2N5AA 1N2AA 1WE0A 4O92A 2R0GA 2PUKC 3BCKA 4HEA2 4TRXA 1DUGA 1EEJA 3ERWA 3PH9A 2X8HA 2FGXA 2H6YA 2A4VA 4EIPA 3IV4A 3FYGA 2K6VA 3RAZA 5DDLA 2E7PA 2KLXA 5HFGA 2DKHA 2WFCA 5IMDA 1JLVA 1K3YA 4XS1A 2I1UA 2LSTA 3BBYA 2C3QA 1KTEA 1Q98A 5HR3A 4BPYA 4Q5NA 18GSA 3KP9A 5J3RA 12GSA 4ECJA 5ECQB 3FZAA 4ID0A 4ECIA 3Q18A 4TXOA 5FT3A 1PL1A 5IQYA 2V32A 2K9FA 1M2DA 2CX3A 1ZMAA 5L71A 5D93A 3QAVA 1TI3A 2I81A 3CSHA 5E4WA 1XFLA 4FH8A 3UMAA 1XPVA 4RQXA 5G5FA 3QAGA 4CY6A 2YV7A 2MMAA 2A4HA 3D0ZA 5KOWA 2DMLA 5IPGA 2X8GA 4NV2A 2IMKA 3J7Yk 3L9UA 3TKPA 3RHCA 3TOTA 1Z5YE 4EXJA 1B4PA 2AHEA 3H1NA 1ZZYA 5F8BA 14GSA 3FR3A 1SK0A 4MZBA 2ZNMA 4KDYA 5KN3A 3UBLA 3F4RA 2GSSA 2GSTA 2HRAA 2MBSA 3R2QA 2YWOA 1XZOA 4KDUA 4QL9A 4ZL7A 2LUSA 2B7KA 3D6IA 2VIMA 2K18A 2PGTA 4HZ2A 1AXDA 3IHQA 5AIVA 5ECLB 3LEFA 1AQVA 1ZGNA 3D5JA 4EF0A 4JZQA 4K7IA 4POMA 4NXIA 2IPAA 1M3JA 3C8EA 2IL3A 2C3TA 2HSMA 1K0MA 1F9MA 4GSTA 1SYRA 3A2VA 1QK8A 2H73A 5J9CA 4V2LA 2VL2C 4KGIA 1T8EB 3RHBA 3GKNA 2YN1A 3GN3A 4GSSA 2O87A 1PA3A 2C80A 1J9BA 4YAPA 2L59A 3FW2A 1MD4A 3FR6A 4LA1A 2O8VB 4ICYA 2MMZA 1OC9B 3F0IA 3IBHA 2F8FA 3ERFA 3ZIJA 2CAIA 3A5IA 5ENUA 1THOA 2BTOT 5IPHA 1R7HA 3UIWA 2EC4A 3EWLA 3LSZA 5LCZA 3TKSA 3EE2A 3GX0A 3MNGA 4GTUA 1R26A 4P3YB 3GKKA 1XWBA 3EURA 3C71A 1YY7A 3TJBA 2P5QA 3UJ1A 4EO3A 4BVYB 4PURA 1UVZA 3ZYWA 2GVPA 1M9AA 4HDEA 1LU4A 2DJ0A 4KB3A 2YJ7A 4F0CA 3LORA 1NHOA 4PNGA 2RM5A 4IVFA 1SJIA 2MMNA 3HJMA 1EV9A 4I8BA 1M2BA 1MEKA 2LJRA 4F0BA 3VPTA 4K5RA 1A2MA 3QMXA 3R3EA 4DSQA 4XRDA 5DJMA 2PPTA 3I6AA 1B4QA 1TRUA 4J56E 5J4UA 4I6XA 4HS1A 1XWKA 2QKEA 4I5QA 4N10A 3UOMA 1E2YA 4WKWA 2N5FA 3L9VA 1G7OA 3HDCA 4Q5RA 1SYXA 4JEDA 1F3AA 2L4CA 4X43A 5H5QA 4PGTA 1A24A 5DCHA 3UAPA 3HXSA 2VD1A 3O3TA 4PQHA 2VCQA 3Q6OA 1U3AA 2HI7A 1QXHA 4TR0A 1B9YC 4O32A 4RUVA 5DALB 1K0DA 2K8SA 4AJ6A 5CO3A 3VI5A 1WRYA 4EVMA 2YWIA 3M9KA 4WEYA 2H0HA 1MDIA 4LL4B 2IMIA 2FHEA 3TJGA 2G0FA 2XPDA 5ELAA 3C1SA 1SL0B 3CRTA 2VLVA 2IN3A 3I43A 1SU9A 1YZXA 1FVJA 2RUEA 1H4OA 2OBKA 2TIRA 16GSA 2OJLA 3JCML 4MPFA 1FOVA 1TXXA 2FCHA 2VUPA 5J5NA 1KBNA 3LG6A 4PX1A 3DRNA 2WCIA 4O5RA 3UVTA 5HR0A 4BL7B 1FG4A 4G0LA 1G0TA 3GX8A 3WD6A 5BRTA 4MZCA 2FUG2 3GURA 2B1KA 2PMTA 3IAS2 2YCDA 1MDKA 5HFIA 2FA8A 4BA7A 1OE7A 2DJ3A 4GWRA 3W8JA 3GL3A 3VI7A 3GV1A 2GZZA 3HVXA 1Q4JA 3GL5A 4I2UA 2FLSA 1HYUA 2IFQB 3TKSC 1M9BA 3D4TA 3I69A 4CDOA 2WJUA 4TKYA 2BMXA 1TDIA 2TRXA 4OMVA 5IOXA 2GSQA 3HHVA 4LL1B 1J08A 5A4WA 5IOWA 3W8SA 2QA2A 5ECRB 4V1Ap 1XVQA 2D2ZA 3ZRDA 2GQLA 2R5GA 2B5EA 2DKIA 4L5LA 1V98A 5GAND 3BD2A 2R6KA 2CVKA 3LXZA 5CRHA 1KNGA 3A2WA 2GT5A 4JU5A 2RUFA 5CP1A 2DC5A 2C0FA 5A4UA 4TW5A 1F2EA 3ZZXA 3M8NA 4MP4A 2MYGA 2H74A 2Z9SA 1VRSD 3M0FA 2HFDA 3DYRA 2IFQA 5IM9A 3VK9A 1PN0A 2OACA 1U87A 4ML6A 4OFTA 1MTCA 1OC8A 2WULA 4AGSA 5GZZB 4PUFC 1ILOA 4MH3A 5D9VA 4NAXA 5HQPA 2F51A 4FYBA 1FW1A 4YKFA 2C0GA 5ELGA 4JRRA 4MLYA 1TW9A 4XS4A 3GSTA 3EVIA 2CZ2A 3F6DA 4IELA 2KP1A 3HVVA 1YJ6A 4K0NA 2FY6A 3MAKA 4IBPA 2AYTA 1G6YA 4MPGA 2LKUA 2VLTA 4WXTA 2KOKA 2KUCA 4DVCA 3RPPA 3EC3A 3CMIA 1U3IA 5HR1A 4TXOB 4I2TA 2YZUA 2NDOA 3CTGA 1TRSA 4KSMA 3EMPA 3WT2A 2AV4A 3GA4A 1BEDA 3ZLPA 4MF6A 4KE3A 1XWGA 3F4SA 1M99A 4Q5QA 1ERUA 5LD0A 1FOHA 2E2GA 4PUAA 1ML6A 1K3OA 4QL7A 2H1DA 4KNDA 2PVOC 3QAWA 4ULXA 3VPQA 1AUCA 1F6MC 2CT6A 2X99A 3CSIA 2VLUA 4NPBA 5COHA 4TR4A 2IIYA 2C3NA 1JZDA 5CREA 3LW9A 3G7IA 4QQ7A 2H1AA 2H6ZA 4JBBA 2B5XA 4XIHA 2F3MA 3MSZA 2WDUA 4MABA 3WGDA 4NHZA 4WBRD 1BJXA 3H93A 4KW6A 2CVBA 4L8EA 3VWVA 5KOXA 1HNAA 8GSSA 4TOPA 5BMUA 5IO0A 1GUHA 3TRXA 1IYHA 4CY8A 2C0DA 1GSFA 3GMFA 4YAVA 4ECCA 3DKSA 4IGJA 5IMCA 3FHKA 5EPFA 1VGLA 1PGTA 4O7HA 2R2JA 2C4JA 1GSYA 3RDWA 5DQYA 4OWYA 20GSA 1SD8A 3ZMLA 2LJAA 4XRAA 4JR6A 2R0PA 1F37A 3NOFA 4PQIA 7GSSA 2LNTA 2LEGA 2EIOA 3BOAA 1O85A 1WIKA 2FD3A 1OC3A 2RLIA 1PQNA 2C1YA 2JL4A 3G7JA 2H76A 5B6NA 1O6JA 5G2ZA 2PWJA 2A2RA 2AJQB 3QD9A 1K0BA 3QPMA 5ECNB 4MCUA 4N11A 3LQ7A 4TVEA 4D73A 5D9TA 1AQWA 2P31A 1B8XA 5JWRB 1XW9A 2YWMA 1Y25A 3K8NA 2DBCA 2IMFA 1HQOA 1YEPA 1JZWA 2WZ9A 1SK1A 3GKXA 5HFKA 4ML1A 2FNOA 2HXKA 4EDZA 3W6GA 3MDKA 1TJDA 6GSYA 4KX4A 3O76A 2LRTA 1WP0A 2L6CA 1T7PB 3HKRA 1TU8A 2HZFA 3QFAC 1GL8A 2B7JA 1AQXA 1F3BA 4WBJA 1N8JA 5IIZA 1A2LA 1ZOFA 5ID2A 2JZRA 5IMAA 3U6VA 1GNEA 3HA9A 2L4QA 4HJMA 2YOIA 4N30A 3QR6A 4NWYA 4WETA 3KJYA 2MMOA 4NMUA 4IN0A 1XBSA 4NHWA 1PN9A 3ZVJA 4KF9A 1M7TA 2ZUPA 3C73A 2M80A 2M46A 1QQ2A 3HZ4A 1VF4A 5G30A 3C1RA 3H79A 5KN0A 2CV4A 3HZ8A 1E6BA 1NW2A 3PGTA 2WGRA 1JZOA 3GSSA 2GLRA 4X4JA 4Z2RA 3GKMA 2DIYA 1YF0A 4EKZA 2N5BA 3CBUA 2R0CA 4GSNA 4DEJA 4ZB6A 2MZCA 4HQZA 1FAAA 2XBIA 1UC7A 2IWTA 2R4VA 5F06A 3TDGA 4K2XA 1W89A 4G2EA 4BWSA 2CX4A 3APQA 3IK9A 4AJ8A 2VM2A 5F05A 1XW5A 3HCZA 4N0ZA 4NV5A 3CSJA 1K0OA 2OADA 1YQ1A 1OVNA 2O89A 5IMVA 4YQUA 3TJJA 2LNSA 4MDCA 1M3IA 4MA9A 4RI6A 1XG8A 1SKRB 4ACSA 2B5YA 2HSHA 1S3DA 1X9SB 3OR5A 3O6TA 5AN1A 3IR4A 1O8WA 1ZYEA 3GFKA 4Z2UA 5KN2A 1GUMA 2X64A 1T4YA 1PRXA 4F2IA 3TKSE 1RK4A 3VLNA 1SKWB 4E8HA 2X8CA 3KH7A 1URMA 2ZCTA 4HU9A 1OKDA 4IJIA 1R5PA 3TJFA 5EY6A 2LJKA 4KH7A 3U5RE 2JZSA 1O7UA 1XW6A 1A8LA 4K8MA 4EL1A 1ERWA 2V41A 5B8BA 3P7XA 5F07A 1ON4A 3D22A 2K8VA 2JSZA 4TR3A 2HLSA 2OA7A 2PU9C 3P8WA 4KA0A 4ZIJA 2GDRA 1YKAA 2H66A 2H6XA 1TP9A 2V2GA 1GUKA 1ZYNA 3CTFA 4FQUA 4Q5FA 3GYKA 5CNWA 2LTKA 5ECIB 3G7YA 1EWXA 3HY2A 5G1LA 5EL8A 1G6WA 3ZL5A 2QC7A 3FK8A 1TRVA 2JU5A 4HU7A 3VFIA 4RI7A 2GZPA 1QFNA 4MJAA 2JADA 4BVXA 5EVOA 2ON7A 3MWHA 1I5GA 1SL1B 1O8XA 2F9SA 3M3MA 5KEJA 3GRXA 3A5WA 2XC2A 3ZVJD 3DD3A 3P2AA 1YKCA 1AIUA 3LYPA 3ZTLA 4EE0A 2YANA 4MF7A 5C00A 2NVLA 2H71A 4MJEA 4PQ1A 3TGZA 3KH9A 3L9SA 2FA4A 1R5AA 4TN8A 3DEXA 4AF2A 1QUWA 2H0IA 2EIRA 4IQ1A 4K1FA 2OE3A 2VD0A 2DJJA 4XCSA 4ISDA 4YKGA 2H19A 5GSSA 2DMMA 2AAWA 1ZYPA 4ZBBA 4ZBDA 3V1WA 4HOJA 1BQ7A 1X5DA 2JACA 3IC4A 1SD9A 3TB2A 4XS4B 2CQ9A 1FHEA 5D96A 3KIJA 3CRUA 3ZFBA 4GLTA 2HZEA 2HYXA 4MJBA 1ABAA 4JE1A 1USBA 3QOUA 3FMWA 1JFUA 4ILFA 3KCMA 2F8AA 2DJ2A 4FYUA 1XCCA 2DIZA 1SJZA 4PTSA 5DJLA 1GSQA 5CRDA 3FZ5A 5A4VA 2YV9A 1X0RA 2ES7A 1GTAA 1S3RA 4MMMA 4N0VA 1GTUA 3F3RA 4OCFA 4F9ZA 4WF4A 2L6DA 4X1UA 3KTBA 2HE3A 1SJ6A 1Z7RA 2VL9A 3HVSA 3KGKA 1DSBA 5DAKB 1OAZA 3GUSA 4ZILA 2PN8A 3LWAA 3KD0A 4OO4A 2I9HA 4EC0A 3GH6A 2DSAA 1CQHA 4Z7XA 1YEXA 1UN2A 5ECSA 4GCIA 5G1KA 1PKWA 4BIKA 2H30A 3F3QA 3L78A 5CRWA 3MIXA 2LQQA 3G9BA 5ECKB 1OKTA 2KHPA 3C7MA 1W4VA 3UVHA 2E2MA 3HYPA 2C8UA 1MD3A 1PD21 3HVNA 5JWOB 3EMXA 2H8LA 4FIWA 1KEBA 2VCTA 4PNFA 4GXZA 3TUEA 3I9V2 5B6MA 2LRNA 4MNNA 4HJ2A 4POBA 3TKQA 1V57A 1A2JA 1DE2A 3ME7A 4LLRA 1V40A 3IDVA 2GTUA 2VL2A 1OE8A 2V1MA 4A5PA 3EU4A 5DAKA 1GP1A 4G0KA 4IKHA 1VF1A 2I3YA 6GSUA 3F4TA 2H1BA 1GLQA 3KP8A 4E8EA 1EZKA 3IXRA 4HUAA 2DLXA 5GAPD 2DJKA 17GSA 3VWXA 4POKA
chains in the Genus database with same CATH topology
3LGCA 2QGVA 3UEMA 5IMFA 1NM3A 5KN1A 2RIIA 2LQOA 4TR1A 3BCIA 1Z6NA 3GNJA 2HSYA 3D4MA 4IP6A 4D73B 2GSRA 2GZYA 2L5LA 3WGEA 4DSSA 1THXA 1U6TA 3D21A 1TOFA 2YP6A 3ZITA 2R3XA 3PINA 5D9XA 3LXTA 4HQSA 2LRCA 1GH2A 4FO5A 4PXOA 4POLA 3H4KA 1ST9A 1WMJA 2H0GA 3DVWA 3CXGA 2DJ1A 5H5SA 1Z9HA 2AUVA 4XTSA 2L57A 5FHIA 1T1VA 9GSSA 1PX6A 2CVDA 2H1GA 4ECBA 4YQVA 1NSWA 1XOBA 5D8IA 2GGTA 5ID2B 4G0IA 3IPZA 3GHAA 5AGYA 3F8UA 3P90A 3HD5A 4GRFA 1JLWA 1A23A 2VCVA 5B8AA 4IHUA 2X4AA 1BYEA 1VF2A 3E3EA 1ZL9A 2JSYA 1FVKA 4ZL9A 5C04A 5ECMB 4ZBAA 2VM1A 1GWCA 1TK5B 3DVXA 4IQAA 4OFNA 3TCOA 1ZCPA 2OE0A 2FWHA 1V9WA 3FZ4A 1TKDB 3F63A 1PKZA 2EIQA 4KCEA 5A5KA 2FWFA 2YJHA 4IJ3A 3IRAA 1DE1A 2B3SA 4OCEA 4G10A 2QA1A 1I9DA 4KSOA 2VO4A 2UZ8A 3Q19A 5CRGA 1WPIA 1T00A 1XWAA 2RM6A 3KMOA 5JCUA 1ACVA 3A3TA 5D73A 2WB9A 1O81A 2C0EA 3ISOA 1SKSB 3DIEA 4OD7A 5GSTA 3PPUA 3M1GA 3ZREA 2I4AA 3Q74A 4IS0A 2VOCA 3FZ9A 1K0CA 3SBCA 4MK3A 1AW9A 1Y6EA 2XHFA 1EEMA 2OE1A 4F82A 1TU7A 3VWUA 5LNKe 4O5UA 1V58A 3RPNA 3ERGA 2VL3A 4MZWA 4CW9A 2FWGA 2J23A 3FEUA 4LMVA 5HR2A 3GH9A 5F0GA 2GQKA 1TK8B 1JHBA 3UARA 4O5QA 2CA8A 3ZIVA 3DMLA 3SWLA 2XPEA 3ME8A 1GSSA 1V2AA 2KP2A 1A8YA 5E59A 1G7EA 2H70A 3VURA 2CAQA 1QMVA 2O7KA 3NIVA 5CAXA 1PL2A 1XXUA 1XOAA 3TRPA 3L0HA 1EP8A 4JR4A 1S3CA 4H86A 3DXBA 1GTIA 2IMEA 2A2PA 2G2QA 1T4ZA 4GQFA 1BX9A 4XHMA 4GQCA 3TKRA 3QDNA 4OO5A 3IK7A 5AISA 1K0AA 4KCAA 3QCPA 1YF1A 1B48A 3E0UA 2HNLA 1FB0A 1ZYQB 1X5EA 1AAZA 1GSDA 4BVXB 2VAFA 1PX7A 3QFBC 4L5OA 4HZ4A 4FYCA 3F9UA 1OC9A 1OYJA 4L0WA 2HRNA 1TRWA 1EOHA 2IJYA 5FWGA 4WF5A 1AC1A 1Z6MA 4V1Ag 6GSXA 5D9WA 5H5RA 3EINA 5ECHB 1GRXA 2WRTA 3TOUA 1YDKA 2H01A 2E0QA 2PBJA 3IA1A 4K9ZA 1VF3A 5JCGA 2X49A 4ZB9A 4GF0A 3L4NA 1R4WA 4TXVA 2GS3A 4K7NA 4BWQA 6GSTA 4IP1A 1A0RP 1Z3EA 3UBKA 4BVYA 2YNXA 2PVQA 1WOUA 1HD2A 3WGXA 1PMTA 6GSVA 2VCWA 2ON5A 3N5OA 11GSA 2NBSA 1LJRA 3US3A 1X5CA 3GTUB 1UA5A 2FWEA 3DWVA 4LMWA 1FB6A 1IYIA 5DVBA 2R37A 1EOGA 1SK2A 3FY7A 5B7CA 3EPTA 2AB6A 4ZB8A 3APSA 2REMA 5DBQA 5ABRA 4EIQA 2M72A 5AIXA 1NHYA 2HZEB 1GSUA 1SL2B 2JZTA 3KMNA 2A2SA 4KAEA 4IW9A 3WYWA 1B9XC 3WT1A 1GULA 1WJKA 1BG5A 6GSSA 2YPMA 5JWQB 3A2XA 3EYTA 1ERVA 4USSA 4HI7A 3UL3A 1TTZA 1U88A 4OFMA 4I97A 3FKFA 4Z2TA 2J9HA 5G5EA 3KZQA 3FR9A 4EDYA 2P0GA 3M9JA 1XIYA 1LBKA 3N9JA 4AJ7A 1JZRA 4RQRA 3LJRA 3FRCA 2GQMA 5CYYA 4YH2A 3EU3A 1RQMA 3HJPA 5DALA 2BJXA 3GTUA 4XS6A 1A0FA 1QGVA 2B6MA 4J57E 1FO5A 1M2AA 3RBTA 2LV3A 2O85A 1XVWA 4G19A 4G9HA 10GSA 3J7Yb 2MBTA 3DGQA 5IO2A 1K0NA 1PSQA 4ZL8A 5DCGA 4WR5A 3KXOA 4KDXA 4MF5A 2CZ3A 4V2NA 4MH2A 1SENA 1WWJA 3S9FA 3KM6A 3ZMKA 4J2FA 1K3LA 2HRFA 2OBIA 4K7OA 1O73A 2ALBA 4BL7A 3IAM2 4YQMA 3HJOA 3PR8A 4KUNA 2V6KA 3IHGA 4L0UA 3TJKA 2B1LA 4V2MA 5G31A 5J41A 2PERA 1H75A 2WS2A 1GSEA 3E9JB 5IMZA 5J9BA 1X9WB 4MJCA 3TRQA 2IMDA 5DQSA 1EGOA 1DBYA 4EUYA 3F6FA 3BJ5A 2YZHA 1XWCA 3KEBA 3IE3A 4CHSA 1J0FA 5INYA 2XBQA 2NPBA 4WR4A 19GSA 1TI1A 3VWWA 3LFLA 1EP7A 5ECPB 4K5SA 2TRCP 1S3AA 2HT9A 1GTBA 1C72A 3CYNA 4X0XA 2QSIA 2OKAA 1CQGA 4TR1B 1Z7PA 3MYDA 1MDJA 3IOSA 2V6OA 3ED3A 13GSA 4K2DA 4DSSB 3GIXA 3NZNA 2VCZA 1X9MB 1GNWA 1RW1A 5ECOB 1BAYA 3H8QA 5JCWA 3IC8A 4DSRA 2GT6A 2VCXA 3ZFLA 3AY8A 4K0GA 1EGRA 2H72A 1M0UA 2P5RA 1GLPA 3KTLA 4K6XA 1HNBA 2L5OA 2LS5A 1T3BA 4ZXGA 2NTOA 6GSWA 1HNCA 3LYKA 3APOA 2HRKA 1ERTA 1EV4A 1TK0B 2YWNA 4F03A 22GSA 2H75A 2N5AA 1N2AA 1WE0A 4O92A 2R0GA 2PUKC 3BCKA 4HEA2 4TRXA 1DUGA 1EEJA 3ERWA 3PH9A 2X8HA 2FGXA 2H6YA 2A4VA 4EIPA 3IV4A 3FYGA 2K6VA 3RAZA 5DDLA 2E7PA 2KLXA 5HFGA 2DKHA 2WFCA 5IMDA 1JLVA 1K3YA 4XS1A 2I1UA 2LSTA 3BBYA 2C3QA 1KTEA 1Q98A 5HR3A 4BPYA 4Q5NA 18GSA 3KP9A 5J3RA 12GSA 4ECJA 5ECQB 3FZAA 4ID0A 4ECIA 3Q18A 4TXOA 5FT3A 1PL1A 5IQYA 2V32A 2K9FA 1M2DA 2CX3A 1ZMAA 5L71A 5D93A 3QAVA 1TI3A 2I81A 3CSHA 5E4WA 1XFLA 4FH8A 3UMAA 1XPVA 4RQXA 5G5FA 3QAGA 4CY6A 2YV7A 2MMAA 2A4HA 3D0ZA 5KOWA 2DMLA 5IPGA 2X8GA 4NV2A 2IMKA 3J7Yk 3L9UA 3TKPA 3RHCA 3TOTA 1Z5YE 4EXJA 1B4PA 2AHEA 3H1NA 1ZZYA 5F8BA 14GSA 3FR3A 1SK0A 4MZBA 2ZNMA 4KDYA 5KN3A 3UBLA 3F4RA 2GSSA 2GSTA 2HRAA 2MBSA 3R2QA 2YWOA 1XZOA 4KDUA 4QL9A 4ZL7A 2LUSA 2B7KA 3D6IA 2VIMA 2K18A 2PGTA 4HZ2A 1AXDA 3IHQA 5AIVA 5ECLB 3LEFA 1AQVA 1ZGNA 3D5JA 4EF0A 4JZQA 4K7IA 4POMA 4NXIA 2IPAA 3C8EA 2IL3A 2C3TA 2HSMA 1K0MA 1F9MA 4GSTA 1SYRA 3A2VA 1QK8A 2H73A 5J9CA 4V2LA 2VL2C 4KGIA 1T8EB 3RHBA 3GKNA 2YN1A 3GN3A 4GSSA 2O87A 1PA3A 2C80A 1J9BA 4YAPA 2L59A 3FW2A 1MD4A 3FR6A 4LA1A 2O8VB 4ICYA 2MMZA 1OC9B 3F0IA 3IBHA 2F8FA 3ERFA 3ZIJA 2CAIA 3A5IA 5ENUA 1THOA 2BTOT 5IPHA 1R7HA 3UIWA 2EC4A 3EWLA 3LSZA 5LCZA 3TKSA 3EE2A 3GX0A 3MNGA 4GTUA 1R26A 4P3YB 3GKKA 1XWBA 3EURA 3C71A 1YY7A 3TJBA 2P5QA 3UJ1A 4EO3A 4BVYB 4PURA 1UVZA 3ZYWA 2GVPA 1M9AA 4HDEA 1LU4A 2DJ0A 4KB3A 2YJ7A 4F0CA 3LORA 1NHOA 4PNGA 2RM5A 4IVFA 1SJIA 2MMNA 3HJMA 1EV9A 4I8BA 1M2BA 1MEKA 2LJRA 4F0BA 3VPTA 4K5RA 1A2MA 3QMXA 3R3EA 4DSQA 4XRDA 5DJMA 2PPTA 3I6AA 1B4QA 1TRUA 4J56E 5J4UA 4I6XA 4HS1A 1XWKA 2QKEA 4I5QA 4N10A 3UOMA 1E2YA 4WKWA 2N5FA 3L9VA 1G7OA 3HDCA 4Q5RA 1SYXA 4JEDA 1F3AA 2L4CA 4X43A 5H5QA 4PGTA 1A24A 5DCHA 3UAPA 3HXSA 2VD1A 3O3TA 4PQHA 2VCQA 3Q6OA 1U3AA 2HI7A 1QXHA 4TR0A 1B9YC 4O32A 4RUVA 5DALB 1K0DA 2K8SA 4AJ6A 5CO3A 3VI5A 1WRYA 4EVMA 2YWIA 3M9KA 4WEYA 2H0HA 1MDIA 4LL4B 2IMIA 2FHEA 3TJGA 2G0FA 2XPDA 5ELAA 3C1SA 1SL0B 3CRTA 2VLVA 2IN3A 3I43A 1SU9A 1YZXA 1FVJA 2RUEA 1H4OA 2OBKA 2TIRA 16GSA 2OJLA 3JCML 4MPFA 1FOVA 1TXXA 2FCHA 2VUPA 5J5NA 1KBNA 3LG6A 4PX1A 3DRNA 2WCIA 4O5RA 3UVTA 5HR0A 4BL7B 1FG4A 4G0LA 1G0TA 3GX8A 3WD6A 5BRTA 4MZCA 2FUG2 3GURA 2B1KA 2PMTA 3IAS2 2YCDA 1MDKA 5HFIA 2FA8A 4BA7A 1OE7A 2DJ3A 4GWRA 3W8JA 3GL3A 3VI7A 3GV1A 2GZZA 3HVXA 1Q4JA 3GL5A 4I2UA 2FLSA 1HYUA 2IFQB 3TKSC 1M9BA 3D4TA 3I69A 4CDOA 2WJUA 4TKYA 2BMXA 1TDIA 2TRXA 4OMVA 5IOXA 2GSQA 3HHVA 4LL1B 1J08A 5A4WA 5IOWA 3W8SA 2QA2A 5ECRB 4V1Ap 1XVQA 2D2ZA 3ZRDA 2GQLA 2R5GA 2B5EA 2DKIA 4L5LA 1V98A 5GAND 3BD2A 2R6KA 2CVKA 3LXZA 5CRHA 1KNGA 3A2WA 2GT5A 4JU5A 2RUFA 5CP1A 2DC5A 2C0FA 5A4UA 4TW5A 1F2EA 3ZZXA 3M8NA 4MP4A 2MYGA 2H74A 2Z9SA 1VRSD 3M0FA 2HFDA 3DYRA 2IFQA 5IM9A 3VK9A 1PN0A 2OACA 1U87A 4ML6A 4OFTA 1MTCA 1OC8A 2WULA 4AGSA 5GZZB 4PUFC 1ILOA 4MH3A 5D9VA 4NAXA 5HQPA 2F51A 4FYBA 1FW1A 4YKFA 2C0GA 5ELGA 4JRRA 4MLYA 1TW9A 4XS4A 3GSTA 3EVIA 2CZ2A 3F6DA 4IELA 2KP1A 3HVVA 1YJ6A 4K0NA 2FY6A 3MAKA 4IBPA 2AYTA 1G6YA 4MPGA 2LKUA 2VLTA 4WXTA 2KOKA 2KUCA 4DVCA 3RPPA 3EC3A 3CMIA 1U3IA 5HR1A 4TXOB 4I2TA 2YZUA 2NDOA 3CTGA 1TRSA 4KSMA 3EMPA 3WT2A 2AV4A 3GA4A 1BEDA 3ZLPA 4MF6A 4KE3A 1XWGA 3F4SA 1M99A 4Q5QA 1ERUA 5LD0A 1FOHA 2E2GA 4PUAA 1ML6A 1K3OA 4QL7A 2H1DA 4KNDA 2PVOC 3QAWA 4ULXA 3VPQA 1AUCA 1F6MC 2CT6A 2X99A 3CSIA 2VLUA 4NPBA 5COHA 4TR4A 2IIYA 2C3NA 1JZDA 5CREA 3LW9A 3G7IA 4QQ7A 2H1AA 2H6ZA 4JBBA 2B5XA 4XIHA 2F3MA 3MSZA 2WDUA 4MABA 3WGDA 4NHZA 4WBRD 1BJXA 3H93A 4KW6A 2CVBA 4L8EA 3VWVA 5KOXA 1HNAA 8GSSA 4TOPA 5BMUA 5IO0A 1GUHA 3TRXA 1IYHA 4CY8A 2C0DA 1GSFA 3GMFA 4YAVA 4ECCA 3DKSA 4IGJA 5IMCA 3FHKA 5EPFA 1VGLA 1PGTA 4O7HA 2R2JA 2C4JA 1GSYA 3RDWA 5DQYA 4OWYA 20GSA 1SD8A 3ZMLA 2LJAA 4XRAA 4JR6A 2R0PA 1F37A 3NOFA 4PQIA 7GSSA 2LNTA 2LEGA 2EIOA 3BOAA 1O85A 1WIKA 2FD3A 1OC3A 2RLIA 1PQNA 2C1YA 2JL4A 3G7JA 2H76A 5B6NA 1O6JA 5G2ZA 2PWJA 2A2RA 2AJQB 3QD9A 1K0BA 3QPMA 5ECNB 4MCUA 4N11A 3LQ7A 4TVEA 4D73A 5D9TA 1AQWA 2P31A 1B8XA 5JWRB 1XW9A 2YWMA 1Y25A 3K8NA 2DBCA 2IMFA 1HQOA 1YEPA 1JZWA 2WZ9A 1SK1A 3GKXA 5HFKA 4ML1A 2FNOA 2HXKA 4EDZA 3W6GA 3MDKA 1TJDA 6GSYA 4KX4A 3O76A 2LRTA 1WP0A 2L6CA 1T7PB 3HKRA 1TU8A 2HZFA 3QFAC 1GL8A 2B7JA 1AQXA 1F3BA 4WBJA 1N8JA 5IIZA 1A2LA 1ZOFA 5ID2A 2JZRA 5IMAA 3U6VA 1GNEA 3HA9A 2L4QA 4HJMA 2YOIA 4N30A 3QR6A 4NWYA 4WETA 3KJYA 2MMOA 4NMUA 4IN0A 1XBSA 4NHWA 1PN9A 3ZVJA 4KF9A 1M7TA 2ZUPA 3C73A 2M80A 2M46A 1QQ2A 3HZ4A 1VF4A 5G30A 3C1RA 3H79A 5KN0A 2CV4A 3HZ8A 1E6BA 1NW2A 3PGTA 2WGRA 1JZOA 3GSSA 2GLRA 4X4JA 4Z2RA 3GKMA 2DIYA 1YF0A 4EKZA 2N5BA 3CBUA 2R0CA 4GSNA 4DEJA 4ZB6A 2MZCA 4HQZA 1FAAA 2XBIA 1UC7A 2IWTA 2R4VA 5F06A 3TDGA 4K2XA 1W89A 4G2EA 4BWSA 2CX4A 3APQA 3IK9A 4AJ8A 2VM2A 5F05A 1XW5A 3HCZA 4N0ZA 4NV5A 3CSJA 1K0OA 2OADA 1YQ1A 1OVNA 2O89A 5IMVA 4YQUA 3TJJA 2LNSA 4MDCA 4MA9A 4RI6A 1SKRB 4ACSA 2B5YA 2HSHA 1S3DA 1X9SB 3OR5A 3O6TA 5AN1A 3IR4A 1O8WA 1ZYEA 3GFKA 4Z2UA 5KN2A 1GUMA 2X64A 1T4YA 1PRXA 4F2IA 3TKSE 1RK4A 3VLNA 1SKWB 4E8HA 2X8CA 3KH7A 1URMA 2ZCTA 4HU9A 1OKDA 4IJIA 1R5PA 3TJFA 5EY6A 2LJKA 4KH7A 3U5RE 2JZSA 1O7UA 1XW6A 1A8LA 4K8MA 4EL1A 1ERWA 2V41A 5B8BA 3P7XA 5F07A 1ON4A 3D22A 2K8VA 2JSZA 4TR3A 2HLSA 2OA7A 2PU9C 3P8WA 4KA0A 4ZIJA 2GDRA 1YKAA 2H66A 2H6XA 1TP9A 2V2GA 1GUKA 1ZYNA 3CTFA 4FQUA 4Q5FA 3GYKA 5CNWA 2LTKA 5ECIB 3G7YA 1EWXA 3HY2A 5G1LA 5EL8A 1G6WA 3ZL5A 2QC7A 3FK8A 1TRVA 2JU5A 4HU7A 3VFIA 4RI7A 2GZPA 1QFNA 4MJAA 2JADA 4BVXA 5EVOA 2ON7A 3MWHA 1I5GA 1SL1B 1O8XA 2F9SA 3M3MA 5KEJA 3GRXA 3A5WA 2XC2A 3ZVJD 3DD3A 3P2AA 1YKCA 1AIUA 3LYPA 3ZTLA 4EE0A 2YANA 4MF7A 5C00A 2NVLA 2H71A 4MJEA 4PQ1A 3TGZA 3KH9A 3L9SA 2FA4A 1R5AA 4TN8A 3DEXA 4AF2A 1QUWA 2H0IA 2EIRA 4IQ1A 4K1FA 2OE3A 2VD0A 2DJJA 4XCSA 4ISDA 4YKGA 2H19A 5GSSA 2DMMA 2AAWA 1ZYPA 4ZBBA 4ZBDA 3V1WA 4HOJA 1BQ7A 1X5DA 2JACA 3IC4A 1SD9A 3TB2A 4XS4B 2CQ9A 1FHEA 5D96A 3KIJA 3CRUA 3ZFBA 4GLTA 2HZEA 2HYXA 4MJBA 1ABAA 4JE1A 1USBA 3QOUA 3FMWA 1JFUA 4ILFA 3KCMA 2F8AA 2DJ2A 4FYUA 1XCCA 2DIZA 1SJZA 4PTSA 5DJLA 1GSQA 5CRDA 3FZ5A 5A4VA 2YV9A 1X0RA 2ES7A 1GTAA 4MMMA 4N0VA 1GTUA 3F3RA 4OCFA 4F9ZA 4WF4A 2L6DA 4X1UA 3KTBA 2HE3A 1SJ6A 1Z7RA 2VL9A 3HVSA 3KGKA 1DSBA 5DAKB 1OAZA 3GUSA 4ZILA 2PN8A 3LWAA 3KD0A 4OO4A 2I9HA 4EC0A 3GH6A 2DSAA 1CQHA 4Z7XA 1YEXA 1UN2A 5ECSA 4GCIA 5G1KA 1PKWA 2H30A 3F3QA 3L78A 5CRWA 3MIXA 2LQQA 3G9BA 5ECKB 1OKTA 2KHPA 3C7MA 1W4VA 3UVHA 2E2MA 3HYPA 2C8UA 1MD3A 1PD21 5JWOB 3EMXA 2H8LA 4FIWA 1KEBA 2VCTA 4PNFA 4GXZA 3TUEA 3I9V2 5B6MA 2LRNA 4MNNA 4HJ2A 4POBA 3TKQA 1V57A 1A2JA 1DE2A 3ME7A 4LLRA 1V40A 3IDVA 2GTUA 2VL2A 1OE8A 2V1MA 4A5PA 3EU4A 5DAKA 1GP1A 4G0KA 4IKHA 1VF1A 2I3YA 6GSUA 3F4TA 2H1BA 1GLQA 3KP8A 4E8EA 1EZKA 3IXRA 4HUAA 2DLXA 5GAPD 2DJKA 17GSA 3VWXA 4POKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGC A;  2QGV A;  3UEM A;  5IMF A;  1NM3 A;  5KN1 A;  2RII A;  2LQO A;  4TR1 A;  3BCI A;  1Z6N A;  3GNJ A;  2HSY A;  3D4M A;  4IP6 A;  4D73 B;  2GSR A;  2GZY A;  2L5L A;  3WGE A;  4DSS A;  1THX A;  1U6T A;  3D21 A;  1TOF A;  2YP6 A;  3ZIT A;  2R3X A;  3PIN A;  5D9X A;  3LXT A;  4HQS A;  2LRC A;  1GH2 A;  4FO5 A;  4PXO A;  4POL A;  3H4K A;  1ST9 A;  1WMJ A;  2H0G A;  3DVW A;  3CXG A;  2DJ1 A;  5H5S A;  1Z9H A;  2AUV A;  4XTS A;  2L57 A;  5FHI A;  1T1V A;  9GSS A;  1PX6 A;  2CVD A;  2H1G A;  4ECB A;  4YQV A;  1NSW A;  1XOB A;  5D8I A;  2GGT A;  5ID2 B;  3IPZ A;  3GHA A;  5AGY A;  3F8U A;  3P90 A;  3HD5 A;  4GRF A;  1JLW A;  1A23 A;  2VCV A;  5B8A A;  4IHU A;  1BYE A;  1VF2 A;  3E3E A;  1ZL9 A;  2JSY A;  1FVK A;  4ZL9 A;  5C04 A;  5ECM B;  4ZBA A;  2VM1 A;  1GWC A;  1TK5 B;  3DVX A;  4IQA A;  4OFN A;  3TCO A;  1ZCP A;  2OE0 A;  2FWH A;  1V9W A;  3FZ4 A;  1TKD B;  3F63 A;  1PKZ A;  2EIQ A;  4KCE A;  5A5K A;  2FWF A;  2YJH A;  4IJ3 A;  3IRA A;  1DE1 A;  2B3S A;  4OCE A;  4G10 A;  1I9D A;  4KSO A;  2VO4 A;  3Q19 A;  5CRG A;  1WPI A;  1T00 A;  1XWA A;  2RM6 A;  3KMO A;  5JCU A;  1ACV A;  3A3T A;  5D73 A;  2WB9 A;  1O81 A;  2C0E A;  3ISO A;  1SKS B;  3DIE A;  4OD7 A;  5GST A;  3M1G A;  3ZRE A;  2I4A A;  3Q74 A;  4IS0 A;  2VOC A;  3FZ9 A;  1K0C A;  3SBC A;  4MK3 A;  1AW9 A;  1Y6E A;  2XHF A;  1EEM A;  2OE1 A;  4F82 A;  1TU7 A;  3VWU A;  5LNK e;  1V58 A;  3RPN A;  3ERG A;  2VL3 A;  4MZW A;  4CW9 A;  2FWG A;  2J23 A;  3FEU A;  4LMV A;  5HR2 A;  3GH9 A;  5F0G A;  2GQK A;  1TK8 B;  1JHB A;  3UAR A;  2CA8 A;  3ZIV A;  3DML A;  3SWL A;  2XPE A;  3ME8 A;  1GSS A;  1V2A A;  2KP2 A;  1A8Y A;  5E59 A;  1G7E A;  2H70 A;  3VUR A;  2CAQ A;  1QMV A;  2O7K A;  3NIV A;  5CAX A;  1PL2 A;  1XXU A;  1XOA A;  3TRP A;  3L0H A;  1EP8 A;  4JR4 A;  1S3C A;  4H86 A;  3DXB A;  1GTI A;  2IME A;  2G2Q A;  1T4Z A;  4GQF A;  1BX9 A;  4XHM A;  4GQC A;  3TKR A;  3QDN A;  4OO5 A;  3IK7 A;  5AIS A;  1K0A A;  4KCA A;  3QCP A;  1YF1 A;  1B48 A;  3E0U A;  2HNL A;  1FB0 A;  1ZYQ B;  1X5E A;  1AAZ A;  1GSD A;  2VAF A;  1PX7 A;  3QFB C;  4L5O A;  4HZ4 A;  4FYC A;  3F9U A;  1OC9 A;  1OYJ A;  4L0W A;  2HRN A;  1TRW A;  1EOH A;  2IJY A;  5FWG A;  4WF5 A;  1AC1 A;  1Z6M A;  4V1A g;  6GSX A;  5D9W A;  5H5R A;  3EIN A;  5ECH B;  1GRX A;  2WRT A;  3TOU A;  1YDK A;  2H01 A;  2E0Q A;  2PBJ A;  3IA1 A;  4K9Z A;  1VF3 A;  5JCG A;  4ZB9 A;  4GF0 A;  3L4N A;  1R4W A;  4TXV A;  2GS3 A;  4K7N A;  4BWQ A;  6GST A;  4IP1 A;  1A0R P;  1Z3E A;  3UBK A;  4BVY A;  2YNX A;  2PVQ A;  1WOU A;  1HD2 A;  3WGX A;  1PMT A;  6GSV A;  2VCW A;  2ON5 A;  3N5O A;  11GS A;  2NBS A;  1LJR A;  3US3 A;  1X5C A;  3GTU B;  1UA5 A;  2FWE A;  3DWV A;  4LMW A;  1FB6 A;  1IYI A;  5DVB A;  2R37 A;  1EOG A;  1SK2 A;  3FY7 A;  5B7C A;  4ZB8 A;  2AB6 A;  3APS A;  2REM A;  5DBQ A;  5ABR A;  2M72 A;  5AIX A;  1NHY A;  2HZE B;  1GSU A;  1SL2 B;  2JZT A;  3KMN A;  2A2S A;  4KAE A;  4IW9 A;  3WYW A;  1B9X C;  3WT1 A;  1GUL A;  1WJK A;  1BG5 A;  6GSS A;  2YPM A;  5JWQ B;  3A2X A;  3EYT A;  1ERV A;  4HI7 A;  3UL3 A;  1TTZ A;  1U88 A;  4OFM A;  4I97 A;  3FKF A;  2J9H A;  5G5E A;  3KZQ A;  3FR9 A;  4EDY A;  2P0G A;  3M9J A;  1XIY A;  1LBK A;  3N9J A;  4AJ7 A;  1JZR A;  4RQR A;  3LJR A;  3FRC A;  2GQM A;  5CYY A;  4YH2 A;  3EU3 A;  1RQM A;  3HJP A;  5DAL A;  2BJX A;  3GTU A;  4XS6 A;  1A0F A;  1QGV A;  2B6M A;  4J57 E;  1FO5 A;  1M2A A;  3RBT A;  2LV3 A;  2O85 A;  1XVW A;  4G19 A;  4G9H A;  10GS A;  3J7Y b;  2MBT A;  3DGQ A;  5IO2 A;  1K0N A;  1PSQ A;  4ZL8 A;  5DCG A;  4WR5 A;  3KXO A;  4KDX A;  4MF5 A;  2CZ3 A;  4V2N A;  4MH2 A;  1SEN A;  1WWJ A;  3S9F A;  3KM6 A;  3ZMK A;  4J2F A;  1K3L A;  2HRF A;  2OBI A;  4K7O A;  1O73 A;  2ALB A;  4BL7 A;  3IAM 2;  4YQM A;  3HJO A;  3PR8 A;  4KUN A;  2V6K A;  4L0U A;  3TJK A;  2B1L A;  4V2M A;  5G31 A;  5J41 A;  2PER A;  1H75 A;  2WS2 A;  1GSE A;  3E9J B;  5IMZ A;  5J9B A;  1X9W B;  4MJC A;  3TRQ A;  2IMD A;  5DQS A;  1EGO A;  1DBY A;  4EUY A;  3F6F A;  3BJ5 A;  2YZH A;  1XWC A;  3KEB A;  3IE3 A;  4CHS A;  1J0F A;  5INY A;  2XBQ A;  2NPB A;  4WR4 A;  19GS A;  1TI1 A;  3VWW A;  3LFL A;  1EP7 A;  5ECP B;  2TRC P;  1S3A A;  2HT9 A;  1GTB A;  1C72 A;  3CYN A;  4X0X A;  2QSI A;  2OKA A;  1CQG A;  4TR1 B;  1Z7P A;  1MDJ A;  3IOS A;  2V6O A;  3ED3 A;  13GS A;  4K2D A;  4DSS B;  3GIX A;  3NZN A;  2VCZ A;  1X9M B;  1GNW A;  1RW1 A;  5ECO B;  1BAY A;  3H8Q A;  5JCW A;  4DSR A;  2GT6 A;  2VCX A;  3ZFL A;  3AY8 A;  4K0G A;  1EGR A;  2H72 A;  1M0U A;  2P5R A;  1GLP A;  3KTL A;  4K6X A;  1HNB A;  2L5O A;  2LS5 A;  1T3B A;  4ZXG A;  2NTO A;  6GSW A;  1HNC A;  3LYK A;  3APO A;  1ERT A;  1EV4 A;  1TK0 B;  2YWN A;  4F03 A;  22GS A;  2H75 A;  2N5A A;  1N2A A;  1WE0 A;  4O92 A;  2PUK C;  3BCK A;  4HEA 2;  4TRX A;  1DUG A;  1EEJ A;  3ERW A;  3PH9 A;  2X8H A;  2FGX A;  2H6Y A;  2A4V A;  3IV4 A;  3FYG A;  2K6V A;  3RAZ A;  5DDL A;  2E7P A;  2KLX A;  5HFG A;  2WFC A;  5IMD A;  1JLV A;  1K3Y A;  4XS1 A;  2I1U A;  2LST A;  3BBY A;  2C3Q A;  1KTE A;  1Q98 A;  5HR3 A;  4BPY A;  4Q5N A;  18GS A;  3KP9 A;  5J3R A;  12GS A;  4ECJ A;  5ECQ B;  3FZA A;  4ID0 A;  4ECI A;  3Q18 A;  4TXO A;  5FT3 A;  1PL1 A;  5IQY A;  2V32 A;  2K9F A;  1M2D A;  2CX3 A;  1ZMA A;  5L71 A;  5D93 A;  3QAV A;  1TI3 A;  2I81 A;  3CSH A;  5E4W A;  1XFL A;  4FH8 A;  3UMA A;  1XPV A;  4RQX A;  5G5F A;  3QAG A;  2YV7 A;  2MMA A;  3D0Z A;  2DML A;  5IPG A;  2X8G A;  4NV2 A;  2IMK A;  3J7Y k;  3L9U A;  3TKP A;  3RHC A;  3TOT A;  1Z5Y E;  4EXJ A;  1B4P A;  2AHE A;  3H1N A;  1ZZY A;  5F8B A;  14GS A;  3FR3 A;  1SK0 A;  4MZB A;  2ZNM A;  4KDY A;  5KN3 A;  3UBL A;  3F4R A;  2GSS A;  2GST A;  2MBS A;  3R2Q A;  2YWO A;  1XZO A;  4KDU A;  4QL9 A;  4ZL7 A;  2LUS A;  2B7K A;  3D6I A;  2VIM A;  2K18 A;  2PGT A;  4HZ2 A;  1AXD A;  3IHQ A;  5AIV A;  5ECL B;  3LEF A;  1AQV A;  1ZGN A;  3D5J A;  4EF0 A;  4JZQ A;  4K7I A;  4POM A;  4NXI A;  2IPA A;  3C8E A;  2IL3 A;  2C3T A;  1K0M A;  1F9M A;  4GST A;  1SYR A;  3A2V A;  1QK8 A;  2H73 A;  5J9C A;  4V2L A;  2VL2 C;  4KGI A;  1T8E B;  3RHB A;  3GKN A;  2YN1 A;  3GN3 A;  4GSS A;  2O87 A;  1PA3 A;  2C80 A;  1J9B A;  4YAP A;  2L59 A;  3FW2 A;  1MD4 A;  3FR6 A;  4LA1 A;  2O8V B;  2MMZ A;  1OC9 B;  3F0I A;  3IBH A;  2F8F A;  3ERF A;  3ZIJ A;  2CAI A;  5ENU A;  1THO A;  2BTO T;  5IPH A;  1R7H A;  3UIW A;  2EC4 A;  3EWL A;  3LSZ A;  5LCZ A;  3TKS A;  3EE2 A;  3GX0 A;  3MNG A;  4GTU A;  1R26 A;  4P3Y B;  3GKK A;  1XWB A;  3EUR A;  3C71 A;  1YY7 A;  3TJB A;  2P5Q A;  3UJ1 A;  4EO3 A;  4PUR A;  1UVZ A;  3ZYW A;  2GVP A;  1M9A A;  4HDE A;  1LU4 A;  2DJ0 A;  4KB3 A;  2YJ7 A;  4F0C A;  3LOR A;  1NHO A;  4PNG A;  2RM5 A;  4IVF A;  1SJI A;  2MMN A;  3HJM A;  1EV9 A;  4I8B A;  1M2B A;  1MEK A;  2LJR A;  4F0B A;  3VPT A;  1A2M A;  3QMX A;  4DSQ A;  4XRD A;  5DJM A;  2PPT A;  3I6A A;  1B4Q A;  1TRU A;  4J56 E;  5J4U A;  4I6X A;  4HS1 A;  1XWK A;  2QKE A;  4I5Q A;  4N10 A;  3UOM A;  1E2Y A;  4WKW A;  2N5F A;  3L9V A;  1G7O A;  3HDC A;  4Q5R A;  1SYX A;  4JED A;  1F3A A;  2L4C A;  4X43 A;  5H5Q A;  4PGT A;  1A24 A;  5DCH A;  3UAP A;  3HXS A;  2VD1 A;  3O3T A;  4PQH A;  2VCQ A;  3Q6O A;  1U3A A;  2HI7 A;  1QXH A;  4TR0 A;  1B9Y C;  4O32 A;  4RUV A;  5DAL B;  1K0D A;  2K8S A;  4AJ6 A;  5CO3 A;  3VI5 A;  1WRY A;  4EVM A;  2YWI A;  3M9K A;  4WEY A;  2H0H A;  1MDI A;  4LL4 B;  2IMI A;  2FHE A;  3TJG A;  2G0F A;  2XPD A;  5ELA A;  3C1S A;  1SL0 B;  3CRT A;  2VLV A;  2IN3 A;  3I43 A;  1SU9 A;  1YZX A;  1FVJ A;  2RUE A;  1H4O A;  2OBK A;  2TIR A;  16GS A;  2OJL A;  3JCM L;  4MPF A;  1FOV A;  1TXX A;  2FCH A;  2VUP A;  5J5N A;  1KBN A;  3LG6 A;  4PX1 A;  3DRN A;  2WCI A;  4O5R A;  3UVT A;  5HR0 A;  1FG4 A;  1G0T A;  3GX8 A;  3WD6 A;  4MZC A;  2FUG 2;  3GUR A;  2B1K A;  2PMT A;  3IAS 2;  2YCD A;  1MDK A;  5HFI A;  2FA8 A;  4BA7 A;  1OE7 A;  2DJ3 A;  4GWR A;  3W8J A;  3GL3 A;  3VI7 A;  3GV1 A;  2GZZ A;  3HVX A;  1Q4J A;  3GL5 A;  4I2U A;  2FLS A;  1HYU A;  2IFQ B;  3TKS C;  1M9B A;  3D4T A;  3I69 A;  4CDO A;  2WJU A;  4TKY A;  2BMX A;  1TDI A;  2TRX A;  4OMV A;  5IOX A;  2GSQ A;  3HHV A;  4LL1 B;  1J08 A;  5A4W A;  5IOW A;  3W8S A;  5ECR B;  4V1A p;  1XVQ A;  2D2Z A;  3ZRD A;  2GQL A;  2R5G A;  2B5E A;  4L5L A;  1V98 A;  5GAN D;  3BD2 A;  2R6K A;  2CVK A;  3LXZ A;  5CRH A;  1KNG A;  3A2W A;  2GT5 A;  4JU5 A;  2RUF A;  5CP1 A;  2DC5 A;  2C0F A;  5A4U A;  4TW5 A;  1F2E A;  3ZZX A;  3M8N A;  4MP4 A;  2MYG A;  2H74 A;  2Z9S A;  1VRS D;  3M0F A;  2HFD A;  3DYR A;  2IFQ A;  5IM9 A;  3VK9 A;  2OAC A;  1U87 A;  4ML6 A;  4OFT A;  1MTC A;  1OC8 A;  2WUL A;  4AGS A;  5GZZ B;  4PUF C;  1ILO A;  4MH3 A;  5D9V A;  4NAX A;  5HQP A;  2F51 A;  4FYB A;  1FW1 A;  2C0G A;  5ELG A;  4JRR A;  4MLY A;  1TW9 A;  4XS4 A;  3GST A;  3EVI A;  2CZ2 A;  3F6D A;  4IEL A;  2KP1 A;  3HVV A;  1YJ6 A;  4K0N A;  2FY6 A;  3MAK A;  4IBP A;  2AYT A;  1G6Y A;  4MPG A;  2LKU A;  2VLT A;  4WXT A;  2KOK A;  2KUC A;  4DVC A;  3RPP A;  3EC3 A;  3CMI A;  1U3I A;  5HR1 A;  4TXO B;  4I2T A;  2YZU A;  2NDO A;  3CTG A;  1TRS A;  4KSM A;  3EMP A;  3WT2 A;  2AV4 A;  3GA4 A;  1BED A;  3ZLP A;  4MF6 A;  4KE3 A;  1XWG A;  3F4S A;  1M99 A;  4Q5Q A;  1ERU A;  5LD0 A;  2E2G A;  4PUA A;  1ML6 A;  1K3O A;  4QL7 A;  2H1D A;  4KND A;  2PVO C;  3QAW A;  4ULX A;  3VPQ A;  1AUC A;  1F6M C;  2CT6 A;  2X99 A;  3CSI A;  2VLU A;  4NPB A;  5COH A;  4TR4 A;  2IIY A;  2C3N A;  1JZD A;  5CRE A;  3G7I A;  4QQ7 A;  2H1A A;  2H6Z A;  4JBB A;  2B5X A;  4XIH A;  2F3M A;  3MSZ A;  2WDU A;  4MAB A;  3WGD A;  4NHZ A;  4WBR D;  1BJX A;  3H93 A;  4KW6 A;  2CVB A;  4L8E A;  3VWV A;  1HNA A;  8GSS A;  4TOP A;  5IO0 A;  1GUH A;  3TRX A;  1IYH A;  2C0D A;  1GSF A;  3GMF A;  4YAV A;  4ECC A;  3DKS A;  4IGJ A;  5IMC A;  3FHK A;  5EPF A;  1VGL A;  1PGT A;  4O7H A;  2R2J A;  2C4J A;  1GSY A;  3RDW A;  5DQY A;  4OWY A;  20GS A;  1SD8 A;  3ZML A;  2LJA A;  4XRA A;  4JR6 A;  1F37 A;  3NOF A;  4PQI A;  7GSS A;  2LNT A;  2LEG A;  2EIO A;  3BOA A;  1O85 A;  1WIK A;  2FD3 A;  1OC3 A;  2RLI A;  1PQN A;  2C1Y A;  2JL4 A;  3G7J A;  2H76 A;  5B6N A;  1O6J A;  5G2Z A;  2PWJ A;  2A2R A;  2AJQ B;  3QD9 A;  1K0B A;  3QPM A;  5ECN B;  4MCU A;  4N11 A;  3LQ7 A;  4TVE A;  4D73 A;  5D9T A;  1AQW A;  2P31 A;  1B8X A;  5JWR B;  1XW9 A;  2YWM A;  1Y25 A;  3K8N A;  2DBC A;  2IMF A;  1HQO A;  1YEP A;  1JZW A;  2WZ9 A;  1SK1 A;  3GKX A;  5HFK A;  4ML1 A;  2FNO A;  2HXK A;  4EDZ A;  3W6G A;  3MDK A;  1TJD A;  6GSY A;  4KX4 A;  3O76 A;  2LRT A;  1WP0 A;  2L6C A;  1T7P B;  3HKR A;  1TU8 A;  2HZF A;  3QFA C;  1GL8 A;  2B7J A;  1AQX A;  1F3B A;  4WBJ A;  1N8J A;  5IIZ A;  1A2L A;  1ZOF A;  5ID2 A;  2JZR A;  5IMA A;  3U6V A;  1GNE A;  3HA9 A;  2L4Q A;  4HJM A;  2YOI A;  4N30 A;  3QR6 A;  4NWY A;  4WET A;  3KJY A;  2MMO A;  4NMU A;  4IN0 A;  1XBS A;  4NHW A;  1PN9 A;  3ZVJ A;  1M7T A;  2ZUP A;  3C73 A;  2M80 A;  2M46 A;  1QQ2 A;  3HZ4 A;  1VF4 A;  5G30 A;  3C1R A;  3H79 A;  5KN0 A;  2CV4 A;  3HZ8 A;  1E6B A;  1NW2 A;  3PGT A;  2WGR A;  1JZO A;  3GSS A;  2GLR A;  3GKM A;  2DIY A;  1YF0 A;  4EKZ A;  2N5B A;  3CBU A;  4GSN A;  4DEJ A;  4ZB6 A;  2MZC A;  4HQZ A;  1FAA A;  2XBI A;  1UC7 A;  2IWT A;  2R4V A;  5F06 A;  3TDG A;  1W89 A;  4G2E A;  4BWS A;  2CX4 A;  3APQ A;  3IK9 A;  4AJ8 A;  2VM2 A;  5F05 A;  1XW5 A;  3HCZ A;  4N0Z A;  4NV5 A;  3CSJ A;  1K0O A;  2OAD A;  1YQ1 A;  1OVN A;  2O89 A;  5IMV A;  4YQU A;  3TJJ A;  2LNS A;  4MDC A;  4MA9 A;  4RI6 A;  1SKR B;  4ACS A;  2B5Y A;  2HSH A;  1S3D A;  1X9S B;  3OR5 A;  3O6T A;  5AN1 A;  3IR4 A;  1O8W A;  1ZYE A;  3GFK A;  5KN2 A;  1GUM A;  2X64 A;  1T4Y A;  1PRX A;  4F2I A;  3TKS E;  1RK4 A;  3VLN A;  1SKW B;  4E8H A;  2X8C A;  3KH7 A;  1URM A;  2ZCT A;  4HU9 A;  1OKD A;  4IJI A;  1R5P A;  3TJF A;  5EY6 A;  2LJK A;  4KH7 A;  3U5R E;  2JZS A;  1O7U A;  1XW6 A;  1A8L A;  4K8M A;  4EL1 A;  1ERW A;  2V41 A;  5B8B A;  3P7X A;  5F07 A;  1ON4 A;  3D22 A;  2K8V A;  2JSZ A;  4TR3 A;  2HLS A;  2OA7 A;  2PU9 C;  3P8W A;  4KA0 A;  4ZIJ A;  2GDR A;  1YKA A;  2H66 A;  2H6X A;  1TP9 A;  2V2G A;  1GUK A;  3CTF A;  4Q5F A;  3GYK A;  5CNW A;  2LTK A;  5ECI B;  3G7Y A;  1EWX A;  3HY2 A;  5G1L A;  5EL8 A;  1G6W A;  3ZL5 A;  2QC7 A;  3FK8 A;  1TRV A;  2JU5 A;  4HU7 A;  3VFI A;  4RI7 A;  2GZP A;  1QFN A;  4MJA A;  2JAD A;  4BVX A;  5EVO A;  2ON7 A;  3MWH A;  1I5G A;  1SL1 B;  1O8X A;  2F9S A;  3M3M A;  5KEJ A;  3GRX A;  3A5W A;  2XC2 A;  3ZVJ D;  3DD3 A;  3P2A A;  1YKC A;  1AIU A;  3LYP A;  3ZTL A;  4EE0 A;  2YAN A;  4MF7 A;  5C00 A;  2NVL A;  2H71 A;  4MJE A;  4PQ1 A;  3TGZ A;  3KH9 A;  3L9S A;  2FA4 A;  1R5A A;  4TN8 A;  3DEX A;  4AF2 A;  1QUW A;  2H0I A;  2EIR A;  4IQ1 A;  4K1F A;  2OE3 A;  2VD0 A;  2DJJ A;  4XCS A;  4ISD A;  2H19 A;  5GSS A;  2DMM A;  2AAW A;  4ZBB A;  4ZBD A;  3V1W A;  4HOJ A;  1BQ7 A;  1X5D A;  2JAC A;  3IC4 A;  1SD9 A;  3TB2 A;  4XS4 B;  2CQ9 A;  1FHE A;  5D96 A;  3KIJ A;  3CRU A;  3ZFB A;  4GLT A;  2HZE A;  2HYX A;  4MJB A;  1ABA A;  4JE1 A;  1USB A;  3QOU A;  1JFU A;  4ILF A;  3KCM A;  2F8A A;  2DJ2 A;  4FYU A;  1XCC A;  2DIZ A;  1SJZ A;  5DJL A;  1GSQ A;  5CRD A;  3FZ5 A;  5A4V A;  2YV9 A;  1X0R A;  2ES7 A;  1GTA A;  4MMM A;  4N0V A;  1GTU A;  3F3R A;  4OCF A;  4F9Z A;  4WF4 A;  2L6D A;  4X1U A;  3KTB A;  2HE3 A;  1SJ6 A;  1Z7R A;  2VL9 A;  3HVS A;  3KGK A;  1DSB A;  5DAK B;  1OAZ A;  3GUS A;  4ZIL A;  2PN8 A;  3LWA A;  3KD0 A;  4OO4 A;  2I9H A;  4EC0 A;  3GH6 A;  2DSA A;  1CQH A;  4Z7X A;  1YEX A;  1UN2 A;  5ECS A;  4GCI A;  5G1K A;  1PKW A;  2H30 A;  3F3Q A;  3L78 A;  5CRW A;  2LQQ A;  3G9B A;  5ECK B;  1OKT A;  2KHP A;  3C7M A;  1W4V A;  3UVH A;  2E2M A;  3HYP A;  2C8U A;  1MD3 A;  1PD2 1;  5JWO B;  3EMX A;  2H8L A;  4FIW A;  1KEB A;  2VCT A;  4PNF A;  4GXZ A;  3TUE A;  3I9V 2;  5B6M A;  2LRN A;  4HJ2 A;  4POB A;  3TKQ A;  1V57 A;  1A2J A;  1DE2 A;  3ME7 A;  4LLR A;  1V40 A;  3IDV A;  2GTU A;  2VL2 A;  1OE8 A;  2V1M A;  3EU4 A;  5DAK A;  1GP1 A;  4IKH A;  1VF1 A;  2I3Y A;  6GSU A;  3F4T A;  2H1B A;  1GLQ A;  3KP8 A;  4E8E A;  1EZK A;  3IXR A;  4HUA A;  2DLX A;  5GAP D;  2DJK A;  17GS A;  3VWX A;  4POK A; 
#chains in the Genus database with same CATH topology
 3LGC A;  2QGV A;  3UEM A;  5IMF A;  1NM3 A;  5KN1 A;  2RII A;  2LQO A;  4TR1 A;  3BCI A;  1Z6N A;  3GNJ A;  2HSY A;  3D4M A;  4IP6 A;  4D73 B;  2GSR A;  2GZY A;  2L5L A;  3WGE A;  4DSS A;  1THX A;  1U6T A;  3D21 A;  1TOF A;  2YP6 A;  3ZIT A;  2R3X A;  3PIN A;  5D9X A;  3LXT A;  4HQS A;  2LRC A;  1GH2 A;  4FO5 A;  4PXO A;  4POL A;  3H4K A;  1ST9 A;  1WMJ A;  2H0G A;  3DVW A;  3CXG A;  2DJ1 A;  5H5S A;  1Z9H A;  2AUV A;  4XTS A;  2L57 A;  5FHI A;  1T1V A;  9GSS A;  1PX6 A;  2CVD A;  2H1G A;  4ECB A;  4YQV A;  1NSW A;  1XOB A;  5D8I A;  2GGT A;  5ID2 B;  4G0I A;  3IPZ A;  3GHA A;  5AGY A;  3F8U A;  3P90 A;  3HD5 A;  4GRF A;  1JLW A;  1A23 A;  2VCV A;  5B8A A;  4IHU A;  2X4A A;  1BYE A;  1VF2 A;  3E3E A;  1ZL9 A;  2JSY A;  1FVK A;  4ZL9 A;  5C04 A;  5ECM B;  4ZBA A;  2VM1 A;  1GWC A;  1TK5 B;  3DVX A;  4IQA A;  4OFN A;  3TCO A;  1ZCP A;  2OE0 A;  2FWH A;  1V9W A;  3FZ4 A;  1TKD B;  3F63 A;  1PKZ A;  2EIQ A;  4KCE A;  5A5K A;  2FWF A;  2YJH A;  4IJ3 A;  3IRA A;  1DE1 A;  2B3S A;  4OCE A;  4G10 A;  2QA1 A;  1I9D A;  4KSO A;  2VO4 A;  2UZ8 A;  3Q19 A;  5CRG A;  1WPI A;  1T00 A;  1XWA A;  2RM6 A;  3KMO A;  5JCU A;  1ACV A;  3A3T A;  5D73 A;  2WB9 A;  1O81 A;  2C0E A;  3ISO A;  1SKS B;  3DIE A;  4OD7 A;  5GST A;  3PPU A;  3M1G A;  3ZRE A;  2I4A A;  3Q74 A;  4IS0 A;  2VOC A;  3FZ9 A;  1K0C A;  3SBC A;  4MK3 A;  1AW9 A;  1Y6E A;  2XHF A;  1EEM A;  2OE1 A;  4F82 A;  1TU7 A;  3VWU A;  5LNK e;  4O5U A;  1V58 A;  3RPN A;  3ERG A;  2VL3 A;  4MZW A;  4CW9 A;  2FWG A;  2J23 A;  3FEU A;  4LMV A;  5HR2 A;  3GH9 A;  5F0G A;  2GQK A;  1TK8 B;  1JHB A;  3UAR A;  4O5Q A;  2CA8 A;  3ZIV A;  3DML A;  3SWL A;  2XPE A;  3ME8 A;  1GSS A;  1V2A A;  2KP2 A;  1A8Y A;  5E59 A;  1G7E A;  2H70 A;  3VUR A;  2CAQ A;  1QMV A;  2O7K A;  3NIV A;  5CAX A;  1PL2 A;  1XXU A;  1XOA A;  3TRP A;  3L0H A;  1EP8 A;  4JR4 A;  1S3C A;  4H86 A;  3DXB A;  1GTI A;  2IME A;  2A2P A;  2G2Q A;  1T4Z A;  4GQF A;  1BX9 A;  4XHM A;  4GQC A;  3TKR A;  3QDN A;  4OO5 A;  3IK7 A;  5AIS A;  1K0A A;  4KCA A;  3QCP A;  1YF1 A;  1B48 A;  3E0U A;  2HNL A;  1FB0 A;  1ZYQ B;  1X5E A;  1AAZ A;  1GSD A;  1PFO A;  4BVX B;  2VAF A;  1PX7 A;  3QFB C;  4L5O A;  4HZ4 A;  4FYC A;  3F9U A;  1OC9 A;  1OYJ A;  4L0W A;  2HRN A;  1TRW A;  1EOH A;  2IJY A;  5FWG A;  4WF5 A;  1AC1 A;  1Z6M A;  4V1A g;  6GSX A;  5D9W A;  5H5R A;  3EIN A;  5ECH B;  1GRX A;  2WRT A;  3TOU A;  1YDK A;  4HSC X;  2H01 A;  2E0Q A;  2PBJ A;  3IA1 A;  4K9Z A;  1VF3 A;  5JCG A;  2X49 A;  4ZB9 A;  4GF0 A;  3L4N A;  1R4W A;  4TXV A;  2GS3 A;  4K7N A;  4BWQ A;  6GST A;  4IP1 A;  1A0R P;  1Z3E A;  3UBK A;  4BVY A;  2YNX A;  2PVQ A;  1WOU A;  1HD2 A;  3WGX A;  1PMT A;  6GSV A;  2VCW A;  2ON5 A;  3N5O A;  11GS A;  2NBS A;  1LJR A;  3US3 A;  1X5C A;  3GTU B;  1UA5 A;  2FWE A;  3DWV A;  4LMW A;  1FB6 A;  1IYI A;  5DVB A;  2R37 A;  1EOG A;  1SK2 A;  3FY7 A;  5B7C A;  3EPT A;  2AB6 A;  4ZB8 A;  3APS A;  2REM A;  5DBQ A;  5ABR A;  4EIQ A;  2M72 A;  5AIX A;  1NHY A;  2HZE B;  1GSU A;  1SL2 B;  2JZT A;  3KMN A;  2A2S A;  4KAE A;  4IW9 A;  3WYW A;  1B9X C;  3WT1 A;  1GUL A;  1WJK A;  1BG5 A;  6GSS A;  2YPM A;  5JWQ B;  3A2X A;  3EYT A;  1ERV A;  4USS A;  4HI7 A;  3UL3 A;  1TTZ A;  1U88 A;  4OFM A;  4I97 A;  3FKF A;  4Z2T A;  2J9H A;  5G5E A;  3KZQ A;  3FR9 A;  4EDY A;  2P0G A;  3M9J A;  1XIY A;  1LBK A;  3N9J A;  4AJ7 A;  1JZR A;  4RQR A;  3LJR A;  3FRC A;  2GQM A;  5CYY A;  4YH2 A;  3EU3 A;  1RQM A;  3HJP A;  5DAL A;  2BJX A;  3GTU A;  4XS6 A;  1A0F A;  1QGV A;  2B6M A;  4J57 E;  1FO5 A;  1M2A A;  3RBT A;  2LV3 A;  2O85 A;  1XVW A;  4G19 A;  4G9H A;  10GS A;  3J7Y b;  2MBT A;  3DGQ A;  5IO2 A;  1K0N A;  1PSQ A;  4ZL8 A;  5DCG A;  4WR5 A;  3KXO A;  4KDX A;  4MF5 A;  2CZ3 A;  4V2N A;  4MH2 A;  1SEN A;  1WWJ A;  3S9F A;  3KM6 A;  3ZMK A;  4J2F A;  1K3L A;  3CQF A;  2HRF A;  2OBI A;  4K7O A;  1O73 A;  2ALB A;  4BL7 A;  3IAM 2;  4YQM A;  3HJO A;  3PR8 A;  4KUN A;  2V6K A;  3IHG A;  4L0U A;  3TJK A;  2B1L A;  4V2M A;  5G31 A;  5J41 A;  2PER A;  1H75 A;  2WS2 A;  1GSE A;  3E9J B;  5IMZ A;  5J9B A;  1X9W B;  4MJC A;  3TRQ A;  2IMD A;  5DQS A;  1EGO A;  1DBY A;  4EUY A;  3F6F A;  3BJ5 A;  2YZH A;  1XWC A;  3KEB A;  3IE3 A;  4CHS A;  1J0F A;  5INY A;  2XBQ A;  2NPB A;  4WR4 A;  19GS A;  1TI1 A;  3VWW A;  3LFL A;  1EP7 A;  5ECP B;  4K5S A;  2TRC P;  1S3A A;  2HT9 A;  1GTB A;  1C72 A;  3CYN A;  4X0X A;  2QSI A;  2OKA A;  1CQG A;  4TR1 B;  1Z7P A;  3MYD A;  1MDJ A;  3IOS A;  2V6O A;  3ED3 A;  13GS A;  4K2D A;  4DSS B;  3GIX A;  3NZN A;  2VCZ A;  1X9M B;  1GNW A;  1RW1 A;  5ECO B;  1BAY A;  3H8Q A;  5JCW A;  3IC8 A;  4DSR A;  2GT6 A;  2VCX A;  3ZFL A;  3AY8 A;  4K0G A;  1EGR A;  2H72 A;  1M0U A;  2P5R A;  1GLP A;  3KTL A;  4K6X A;  1HNB A;  2L5O A;  2LS5 A;  1T3B A;  4ZXG A;  2NTO A;  6GSW A;  1HNC A;  3LYK A;  3APO A;  2HRK A;  1ERT A;  1EV4 A;  1TK0 B;  2YWN A;  4F03 A;  22GS A;  2H75 A;  2N5A A;  1N2A A;  1WE0 A;  4O92 A;  2R0G A;  2PUK C;  3BCK A;  4HEA 2;  4TRX A;  1DUG A;  1EEJ A;  3ERW A;  3PH9 A;  2X8H A;  2FGX A;  2H6Y A;  2A4V A;  4EIP A;  3IV4 A;  3FYG A;  2K6V A;  3RAZ A;  5DDL A;  2E7P A;  2KLX A;  5HFG A;  2DKH A;  2WFC A;  5IMD A;  1JLV A;  1K3Y A;  4XS1 A;  2I1U A;  2LST A;  3BBY A;  2C3Q A;  1KTE A;  1Q98 A;  5HR3 A;  4BPY A;  4Q5N A;  18GS A;  3KP9 A;  5J3R A;  12GS A;  4ECJ A;  5ECQ B;  3FZA A;  4ID0 A;  4ECI A;  3Q18 A;  4TXO A;  5FT3 A;  1PL1 A;  5IQY A;  2V32 A;  2K9F A;  1M2D A;  2CX3 A;  1ZMA A;  5L71 A;  5D93 A;  3QAV A;  1TI3 A;  2I81 A;  3CSH A;  5E4W A;  1XFL A;  4FH8 A;  3UMA A;  1XPV A;  4RQX A;  5G5F A;  3QAG A;  4CY6 A;  2YV7 A;  2MMA A;  2A4H A;  3D0Z A;  5KOW A;  2DML A;  5IPG A;  2X8G A;  4NV2 A;  2IMK A;  3J7Y k;  3L9U A;  3TKP A;  3RHC A;  3TOT A;  1Z5Y E;  4EXJ A;  1B4P A;  2AHE A;  3H1N A;  1ZZY A;  5F8B A;  14GS A;  3FR3 A;  1SK0 A;  4MZB A;  2ZNM A;  4KDY A;  5KN3 A;  3UBL A;  3F4R A;  2GSS A;  2GST A;  2HRA A;  2MBS A;  3R2Q A;  2YWO A;  1XZO A;  4KDU A;  4QL9 A;  4ZL7 A;  2LUS A;  2B7K A;  3D6I A;  2VIM A;  2K18 A;  2PGT A;  4HZ2 A;  1AXD A;  3IHQ A;  5AIV A;  5ECL B;  3LEF A;  1AQV A;  1ZGN A;  3D5J A;  4EF0 A;  4JZQ A;  4K7I A;  4POM A;  4NXI A;  2IPA A;  1M3J A;  3C8E A;  2IL3 A;  2C3T A;  2HSM A;  1K0M A;  1F9M A;  4GST A;  1SYR A;  3A2V A;  1QK8 A;  2H73 A;  5J9C A;  4V2L A;  2VL2 C;  4KGI A;  1T8E B;  3RHB A;  3GKN A;  2YN1 A;  3GN3 A;  4GSS A;  2O87 A;  1PA3 A;  2C80 A;  1J9B A;  4YAP A;  2L59 A;  3FW2 A;  1MD4 A;  3FR6 A;  4LA1 A;  2O8V B;  4ICY A;  2MMZ A;  1OC9 B;  3F0I A;  3IBH A;  2F8F A;  3ERF A;  3ZIJ A;  2CAI A;  3A5I A;  5ENU A;  1THO A;  2BTO T;  5IPH A;  1R7H A;  3UIW A;  2EC4 A;  3EWL A;  3LSZ A;  5LCZ A;  3TKS A;  3EE2 A;  3GX0 A;  3MNG A;  4GTU A;  1R26 A;  4P3Y B;  3GKK A;  1XWB A;  3EUR A;  3C71 A;  1YY7 A;  3TJB A;  2P5Q A;  3UJ1 A;  4EO3 A;  4BVY B;  4PUR A;  1UVZ A;  3ZYW A;  2GVP A;  1M9A A;  4HDE A;  1LU4 A;  2DJ0 A;  4KB3 A;  2YJ7 A;  4F0C A;  3LOR A;  1NHO A;  4PNG A;  2RM5 A;  4IVF A;  1SJI A;  2MMN A;  3HJM A;  1EV9 A;  4I8B A;  1M2B A;  1MEK A;  2LJR A;  4F0B A;  3VPT A;  4K5R A;  1A2M A;  3QMX A;  3R3E A;  4DSQ A;  4XRD A;  5DJM A;  2PPT A;  3I6A A;  1B4Q A;  1TRU A;  4J56 E;  5J4U A;  4I6X A;  4HS1 A;  1XWK A;  2QKE A;  4I5Q A;  4N10 A;  3UOM A;  1E2Y A;  4WKW A;  2N5F A;  3L9V A;  1G7O A;  3HDC A;  4Q5R A;  1SYX A;  4JED A;  1F3A A;  2L4C A;  4X43 A;  5H5Q A;  4PGT A;  1A24 A;  5DCH A;  3UAP A;  3HXS A;  2VD1 A;  3O3T A;  4PQH A;  2VCQ A;  3Q6O A;  1U3A A;  2HI7 A;  1QXH A;  4TR0 A;  1B9Y C;  4O32 A;  4RUV A;  5DAL B;  1K0D A;  2K8S A;  4AJ6 A;  5CO3 A;  3VI5 A;  1WRY A;  4EVM A;  2YWI A;  3M9K A;  4WEY A;  2H0H A;  1MDI A;  4LL4 B;  2IMI A;  2FHE A;  3TJG A;  2G0F A;  2XPD A;  5ELA A;  3C1S A;  1SL0 B;  3CRT A;  2VLV A;  2IN3 A;  3I43 A;  1SU9 A;  1YZX A;  1FVJ A;  2RUE A;  1H4O A;  2OBK A;  2TIR A;  16GS A;  2OJL A;  3JCM L;  4MPF A;  1FOV A;  1TXX A;  2FCH A;  2VUP A;  5J5N A;  1KBN A;  3LG6 A;  4PX1 A;  3DRN A;  2WCI A;  4O5R A;  3UVT A;  5HR0 A;  4BL7 B;  1FG4 A;  4G0L A;  1G0T A;  3GX8 A;  3WD6 A;  5BRT A;  4MZC A;  2FUG 2;  3GUR A;  2B1K A;  2PMT A;  3IAS 2;  2YCD A;  1MDK A;  5HFI A;  2FA8 A;  4BA7 A;  1OE7 A;  2DJ3 A;  4GWR A;  3W8J A;  3GL3 A;  3VI7 A;  3GV1 A;  2GZZ A;  3HVX A;  1Q4J A;  3GL5 A;  4I2U A;  2FLS A;  1HYU A;  2IFQ B;  3TKS C;  1M9B A;  3D4T A;  3I69 A;  4CDO A;  2WJU A;  4TKY A;  2BMX A;  1TDI A;  2TRX A;  4OMV A;  5IOX A;  2GSQ A;  3HHV A;  4LL1 B;  1J08 A;  5A4W A;  5IOW A;  3W8S A;  2QA2 A;  5ECR B;  4V1A p;  1XVQ A;  2D2Z A;  3ZRD A;  2GQL A;  2R5G A;  2B5E A;  2DKI A;  4L5L A;  1V98 A;  5GAN D;  3BD2 A;  2R6K A;  2CVK A;  3LXZ A;  5CRH A;  1KNG A;  3A2W A;  2GT5 A;  4JU5 A;  2RUF A;  5CP1 A;  2DC5 A;  2C0F A;  5A4U A;  4TW5 A;  1F2E A;  3ZZX A;  3M8N A;  4MP4 A;  2MYG A;  2H74 A;  2Z9S A;  1VRS D;  3M0F A;  2HFD A;  3DYR A;  2IFQ A;  5IM9 A;  3VK9 A;  1PN0 A;  2OAC A;  1U87 A;  4ML6 A;  4OFT A;  1MTC A;  1OC8 A;  2WUL A;  4AGS A;  5GZZ B;  4PUF C;  1ILO A;  4MH3 A;  5D9V A;  4NAX A;  5HQP A;  2F51 A;  4FYB A;  1FW1 A;  4YKF A;  2C0G A;  5ELG A;  4JRR A;  4MLY A;  1TW9 A;  4XS4 A;  3GST A;  3EVI A;  2CZ2 A;  3F6D A;  4IEL A;  2KP1 A;  3HVV A;  1YJ6 A;  4K0N A;  2FY6 A;  3MAK A;  4IBP A;  2AYT A;  1G6Y A;  4MPG A;  2LKU A;  2VLT A;  4WXT A;  2KOK A;  2KUC A;  4DVC A;  3RPP A;  3EC3 A;  3CMI A;  1U3I A;  5HR1 A;  4TXO B;  4I2T A;  2YZU A;  2NDO A;  3CTG A;  1TRS A;  4KSM A;  3EMP A;  3WT2 A;  2AV4 A;  3GA4 A;  1BED A;  3ZLP A;  4MF6 A;  4KE3 A;  1XWG A;  3F4S A;  1M99 A;  4Q5Q A;  1ERU A;  5LD0 A;  1FOH A;  2E2G A;  4PUA A;  1ML6 A;  1K3O A;  4QL7 A;  2H1D A;  4KND A;  2PVO C;  3QAW A;  4ULX A;  3VPQ A;  1AUC A;  1F6M C;  2CT6 A;  2X99 A;  3CSI A;  2VLU A;  4NPB A;  5COH A;  4TR4 A;  2IIY A;  2C3N A;  1JZD A;  5CRE A;  3LW9 A;  3G7I A;  4QQ7 A;  2H1A A;  2H6Z A;  4JBB A;  2B5X A;  4XIH A;  2F3M A;  3MSZ A;  2WDU A;  4MAB A;  3WGD A;  4NHZ A;  4WBR D;  1BJX A;  3H93 A;  4KW6 A;  2CVB A;  4L8E A;  3VWV A;  5KOX A;  1HNA A;  8GSS A;  4TOP A;  5BMU A;  5IO0 A;  1GUH A;  3TRX A;  1IYH A;  4CY8 A;  2C0D A;  1GSF A;  3GMF A;  4YAV A;  4ECC A;  3DKS A;  4IGJ A;  5IMC A;  3FHK A;  5EPF A;  1VGL A;  1PGT A;  4O7H A;  2R2J A;  2C4J A;  1GSY A;  3RDW A;  5DQY A;  4OWY A;  20GS A;  1SD8 A;  3ZML A;  2LJA A;  4XRA A;  4JR6 A;  2R0P A;  1F37 A;  3NOF A;  4PQI A;  7GSS A;  2LNT A;  2LEG A;  2EIO A;  3BOA A;  1O85 A;  1WIK A;  2FD3 A;  1OC3 A;  2RLI A;  1PQN A;  2C1Y A;  2JL4 A;  3G7J A;  2H76 A;  5B6N A;  1O6J A;  5G2Z A;  2PWJ A;  2A2R A;  2AJQ B;  3QD9 A;  1K0B A;  3QPM A;  5ECN B;  4MCU A;  4N11 A;  3LQ7 A;  4TVE A;  4D73 A;  5D9T A;  1AQW A;  2P31 A;  1B8X A;  5JWR B;  1XW9 A;  2YWM A;  1Y25 A;  3K8N A;  2DBC A;  2IMF A;  1HQO A;  1YEP A;  1JZW A;  2WZ9 A;  1SK1 A;  3GKX A;  5HFK A;  4ML1 A;  2FNO A;  2HXK A;  4EDZ A;  3W6G A;  3MDK A;  1TJD A;  6GSY A;  4KX4 A;  3O76 A;  2LRT A;  1WP0 A;  2L6C A;  1T7P B;  3HKR A;  1TU8 A;  2HZF A;  3QFA C;  1GL8 A;  2B7J A;  1AQX A;  1F3B A;  4WBJ A;  1N8J A;  5IIZ A;  1A2L A;  1ZOF A;  5ID2 A;  2JZR A;  5IMA A;  3U6V A;  1GNE A;  3HA9 A;  2L4Q A;  4HJM A;  2YOI A;  4N30 A;  3QR6 A;  4NWY A;  4WET A;  3KJY A;  2MMO A;  4NMU A;  4IN0 A;  1XBS A;  4NHW A;  1PN9 A;  3ZVJ A;  4KF9 A;  1M7T A;  2ZUP A;  3C73 A;  2M80 A;  2M46 A;  1QQ2 A;  3HZ4 A;  1VF4 A;  5G30 A;  3C1R A;  3H79 A;  5KN0 A;  2CV4 A;  3HZ8 A;  1E6B A;  1NW2 A;  3PGT A;  2WGR A;  1JZO A;  3GSS A;  2GLR A;  4X4J A;  4Z2R A;  3GKM A;  2DIY A;  1YF0 A;  4EKZ A;  2N5B A;  3CBU A;  2R0C A;  4GSN A;  4DEJ A;  4ZB6 A;  2MZC A;  4HQZ A;  1FAA A;  2XBI A;  1UC7 A;  2IWT A;  2R4V A;  5F06 A;  3TDG A;  4K2X A;  1W89 A;  4G2E A;  4BWS A;  2CX4 A;  3APQ A;  3IK9 A;  4AJ8 A;  2VM2 A;  5F05 A;  1XW5 A;  3HCZ A;  4N0Z A;  4NV5 A;  3CSJ A;  1K0O A;  2OAD A;  1YQ1 A;  1OVN A;  2O89 A;  5IMV A;  4YQU A;  3TJJ A;  2LNS A;  4MDC A;  1M3I A;  4MA9 A;  4RI6 A;  1XG8 A;  1SKR B;  4ACS A;  2B5Y A;  2HSH A;  1S3D A;  1X9S B;  3OR5 A;  3O6T A;  5AN1 A;  3IR4 A;  1O8W A;  1ZYE A;  3GFK A;  4Z2U A;  5KN2 A;  1GUM A;  2X64 A;  1T4Y A;  1PRX A;  4F2I A;  3TKS E;  1RK4 A;  3VLN A;  1SKW B;  4E8H A;  2X8C A;  3KH7 A;  1URM A;  2ZCT A;  4HU9 A;  1OKD A;  4IJI A;  1R5P A;  3TJF A;  5EY6 A;  2LJK A;  4KH7 A;  3U5R E;  2JZS A;  1O7U A;  1XW6 A;  1A8L A;  4K8M A;  4EL1 A;  1ERW A;  2V41 A;  5B8B A;  3P7X A;  5F07 A;  1ON4 A;  3D22 A;  2K8V A;  2JSZ A;  4TR3 A;  2HLS A;  2OA7 A;  2PU9 C;  3P8W A;  4KA0 A;  4ZIJ A;  2GDR A;  1YKA A;  2H66 A;  2H6X A;  1TP9 A;  2V2G A;  1GUK A;  1ZYN A;  3CTF A;  4FQU A;  4Q5F A;  3GYK A;  5CNW A;  2LTK A;  5ECI B;  3G7Y A;  1EWX A;  3HY2 A;  5G1L A;  5EL8 A;  1G6W A;  3ZL5 A;  2QC7 A;  3FK8 A;  1TRV A;  2JU5 A;  4HU7 A;  3VFI A;  4RI7 A;  2GZP A;  1QFN A;  4MJA A;  2JAD A;  4BVX A;  5EVO A;  2ON7 A;  3MWH A;  1I5G A;  1SL1 B;  1O8X A;  2F9S A;  3M3M A;  5KEJ A;  3GRX A;  3A5W A;  2XC2 A;  3ZVJ D;  3DD3 A;  3P2A A;  1YKC A;  1AIU A;  3LYP A;  3ZTL A;  4EE0 A;  2YAN A;  4MF7 A;  5C00 A;  2NVL A;  2H71 A;  4MJE A;  4PQ1 A;  3TGZ A;  3KH9 A;  3L9S A;  2FA4 A;  1R5A A;  4TN8 A;  3DEX A;  4AF2 A;  1QUW A;  2H0I A;  2EIR A;  4IQ1 A;  4K1F A;  2OE3 A;  2VD0 A;  2DJJ A;  4XCS A;  4ISD A;  4YKG A;  2H19 A;  5GSS A;  2DMM A;  2AAW A;  1ZYP A;  4ZBB A;  4ZBD A;  3V1W A;  4HOJ A;  1BQ7 A;  1X5D A;  2JAC A;  3IC4 A;  1SD9 A;  3TB2 A;  4XS4 B;  2CQ9 A;  1FHE A;  5D96 A;  3KIJ A;  3CRU A;  3ZFB A;  4GLT A;  2HZE A;  2HYX A;  4MJB A;  1ABA A;  4JE1 A;  1USB A;  3QOU A;  3FMW A;  1JFU A;  4ILF A;  3KCM A;  2F8A A;  2DJ2 A;  4FYU A;  1XCC A;  2DIZ A;  1SJZ A;  4PTS A;  5DJL A;  1GSQ A;  5CRD A;  3FZ5 A;  5A4V A;  2YV9 A;  1X0R A;  2ES7 A;  1GTA A;  1S3R A;  4MMM A;  4N0V A;  1GTU A;  3F3R A;  4OCF A;  4F9Z A;  4WF4 A;  2L6D A;  4X1U A;  3KTB A;  2HE3 A;  1SJ6 A;  1Z7R A;  2VL9 A;  3HVS A;  3KGK A;  1DSB A;  5DAK B;  1OAZ A;  3GUS A;  4ZIL A;  2PN8 A;  3LWA A;  3KD0 A;  4OO4 A;  2I9H A;  4EC0 A;  3GH6 A;  2DSA A;  1CQH A;  4Z7X A;  1YEX A;  1UN2 A;  5ECS A;  4GCI A;  5G1K A;  1PKW A;  4BIK A;  2H30 A;  3F3Q A;  3L78 A;  5CRW A;  3MIX A;  2LQQ A;  3G9B A;  5ECK B;  1OKT A;  2KHP A;  3C7M A;  1W4V A;  3UVH A;  2E2M A;  3HYP A;  2C8U A;  1MD3 A;  1PD2 1;  3HVN A;  5JWO B;  3EMX A;  2H8L A;  4FIW A;  1KEB A;  2VCT A;  4PNF A;  4GXZ A;  3TUE A;  3I9V 2;  5B6M A;  2LRN A;  4MNN A;  4HJ2 A;  4POB A;  3TKQ A;  1V57 A;  1A2J A;  1DE2 A;  3ME7 A;  4LLR A;  1V40 A;  3IDV A;  2GTU A;  2VL2 A;  1OE8 A;  2V1M A;  4A5P A;  3EU4 A;  5DAK A;  1GP1 A;  4G0K A;  4IKH A;  1VF1 A;  2I3Y A;  6GSU A;  3F4T A;  2H1B A;  1GLQ A;  3KP8 A;  4E8E A;  1EZK A;  3IXR A;  4HUA A;  2DLX A;  5GAP D;  2DJK A;  17GS A;  3VWX A;  4POK A; 
#chains in the Genus database with same CATH homology
 3LGC A;  2QGV A;  3UEM A;  5IMF A;  1NM3 A;  5KN1 A;  2RII A;  2LQO A;  4TR1 A;  3BCI A;  1Z6N A;  3GNJ A;  2HSY A;  3D4M A;  4IP6 A;  4D73 B;  2GSR A;  2GZY A;  2L5L A;  3WGE A;  4DSS A;  1THX A;  1U6T A;  3D21 A;  1TOF A;  2YP6 A;  3ZIT A;  2R3X A;  3PIN A;  5D9X A;  3LXT A;  4HQS A;  2LRC A;  1GH2 A;  4FO5 A;  4PXO A;  4POL A;  3H4K A;  1ST9 A;  1WMJ A;  2H0G A;  3DVW A;  3CXG A;  2DJ1 A;  5H5S A;  1Z9H A;  2AUV A;  4XTS A;  2L57 A;  5FHI A;  1T1V A;  9GSS A;  1PX6 A;  2CVD A;  2H1G A;  4ECB A;  4YQV A;  1NSW A;  1XOB A;  5D8I A;  2GGT A;  5ID2 B;  4G0I A;  3IPZ A;  3GHA A;  5AGY A;  3F8U A;  3P90 A;  3HD5 A;  4GRF A;  1JLW A;  1A23 A;  2VCV A;  5B8A A;  4IHU A;  2X4A A;  1BYE A;  1VF2 A;  3E3E A;  1ZL9 A;  2JSY A;  1FVK A;  4ZL9 A;  5C04 A;  5ECM B;  4ZBA A;  2VM1 A;  1GWC A;  1TK5 B;  3DVX A;  4IQA A;  4OFN A;  3TCO A;  1ZCP A;  2OE0 A;  2FWH A;  1V9W A;  3FZ4 A;  1TKD B;  3F63 A;  1PKZ A;  2EIQ A;  4KCE A;  5A5K A;  2FWF A;  2YJH A;  4IJ3 A;  3IRA A;  1DE1 A;  2B3S A;  4OCE A;  4G10 A;  2QA1 A;  1I9D A;  4KSO A;  2VO4 A;  2UZ8 A;  3Q19 A;  5CRG A;  1WPI A;  1T00 A;  1XWA A;  2RM6 A;  3KMO A;  5JCU A;  1ACV A;  3A3T A;  5D73 A;  2WB9 A;  1O81 A;  2C0E A;  3ISO A;  1SKS B;  3DIE A;  4OD7 A;  5GST A;  3PPU A;  3M1G A;  3ZRE A;  2I4A A;  3Q74 A;  4IS0 A;  2VOC A;  3FZ9 A;  1K0C A;  3SBC A;  4MK3 A;  1AW9 A;  1Y6E A;  2XHF A;  1EEM A;  2OE1 A;  4F82 A;  1TU7 A;  3VWU A;  5LNK e;  4O5U A;  1V58 A;  3RPN A;  3ERG A;  2VL3 A;  4MZW A;  4CW9 A;  2FWG A;  2J23 A;  3FEU A;  4LMV A;  5HR2 A;  3GH9 A;  5F0G A;  2GQK A;  1TK8 B;  1JHB A;  3UAR A;  4O5Q A;  2CA8 A;  3ZIV A;  3DML A;  3SWL A;  2XPE A;  3ME8 A;  1GSS A;  1V2A A;  2KP2 A;  1A8Y A;  5E59 A;  1G7E A;  2H70 A;  3VUR A;  2CAQ A;  1QMV A;  2O7K A;  3NIV A;  5CAX A;  1PL2 A;  1XXU A;  1XOA A;  3TRP A;  3L0H A;  1EP8 A;  4JR4 A;  1S3C A;  4H86 A;  3DXB A;  1GTI A;  2IME A;  2A2P A;  2G2Q A;  1T4Z A;  4GQF A;  1BX9 A;  4XHM A;  4GQC A;  3TKR A;  3QDN A;  4OO5 A;  3IK7 A;  5AIS A;  1K0A A;  4KCA A;  3QCP A;  1YF1 A;  1B48 A;  3E0U A;  2HNL A;  1FB0 A;  1ZYQ B;  1X5E A;  1AAZ A;  1GSD A;  4BVX B;  2VAF A;  1PX7 A;  3QFB C;  4L5O A;  4HZ4 A;  4FYC A;  3F9U A;  1OC9 A;  1OYJ A;  4L0W A;  2HRN A;  1TRW A;  1EOH A;  2IJY A;  5FWG A;  4WF5 A;  1AC1 A;  1Z6M A;  4V1A g;  6GSX A;  5D9W A;  5H5R A;  3EIN A;  5ECH B;  1GRX A;  2WRT A;  3TOU A;  1YDK A;  2H01 A;  2E0Q A;  2PBJ A;  3IA1 A;  4K9Z A;  1VF3 A;  5JCG A;  2X49 A;  4ZB9 A;  4GF0 A;  3L4N A;  1R4W A;  4TXV A;  2GS3 A;  4K7N A;  4BWQ A;  6GST A;  4IP1 A;  1A0R P;  1Z3E A;  3UBK A;  4BVY A;  2YNX A;  2PVQ A;  1WOU A;  1HD2 A;  3WGX A;  1PMT A;  6GSV A;  2VCW A;  2ON5 A;  3N5O A;  11GS A;  2NBS A;  1LJR A;  3US3 A;  1X5C A;  3GTU B;  1UA5 A;  2FWE A;  3DWV A;  4LMW A;  1FB6 A;  1IYI A;  5DVB A;  2R37 A;  1EOG A;  1SK2 A;  3FY7 A;  5B7C A;  3EPT A;  2AB6 A;  4ZB8 A;  3APS A;  2REM A;  5DBQ A;  5ABR A;  4EIQ A;  2M72 A;  5AIX A;  1NHY A;  2HZE B;  1GSU A;  1SL2 B;  2JZT A;  3KMN A;  2A2S A;  4KAE A;  4IW9 A;  3WYW A;  1B9X C;  3WT1 A;  1GUL A;  1WJK A;  1BG5 A;  6GSS A;  2YPM A;  5JWQ B;  3A2X A;  3EYT A;  1ERV A;  4USS A;  4HI7 A;  3UL3 A;  1TTZ A;  1U88 A;  4OFM A;  4I97 A;  3FKF A;  4Z2T A;  2J9H A;  5G5E A;  3KZQ A;  3FR9 A;  4EDY A;  2P0G A;  3M9J A;  1XIY A;  1LBK A;  3N9J A;  4AJ7 A;  1JZR A;  4RQR A;  3LJR A;  3FRC A;  2GQM A;  5CYY A;  4YH2 A;  3EU3 A;  1RQM A;  3HJP A;  5DAL A;  2BJX A;  3GTU A;  4XS6 A;  1A0F A;  1QGV A;  2B6M A;  4J57 E;  1FO5 A;  1M2A A;  3RBT A;  2LV3 A;  2O85 A;  1XVW A;  4G19 A;  4G9H A;  10GS A;  3J7Y b;  2MBT A;  3DGQ A;  5IO2 A;  1K0N A;  1PSQ A;  4ZL8 A;  5DCG A;  4WR5 A;  3KXO A;  4KDX A;  4MF5 A;  2CZ3 A;  4V2N A;  4MH2 A;  1SEN A;  1WWJ A;  3S9F A;  3KM6 A;  3ZMK A;  4J2F A;  1K3L A;  2HRF A;  2OBI A;  4K7O A;  1O73 A;  2ALB A;  4BL7 A;  3IAM 2;  4YQM A;  3HJO A;  3PR8 A;  4KUN A;  2V6K A;  3IHG A;  4L0U A;  3TJK A;  2B1L A;  4V2M A;  5G31 A;  5J41 A;  2PER A;  1H75 A;  2WS2 A;  1GSE A;  3E9J B;  5IMZ A;  5J9B A;  1X9W B;  4MJC A;  3TRQ A;  2IMD A;  5DQS A;  1EGO A;  1DBY A;  4EUY A;  3F6F A;  3BJ5 A;  2YZH A;  1XWC A;  3KEB A;  3IE3 A;  4CHS A;  1J0F A;  5INY A;  2XBQ A;  2NPB A;  4WR4 A;  19GS A;  1TI1 A;  3VWW A;  3LFL A;  1EP7 A;  5ECP B;  4K5S A;  2TRC P;  1S3A A;  2HT9 A;  1GTB A;  1C72 A;  3CYN A;  4X0X A;  2QSI A;  2OKA A;  1CQG A;  4TR1 B;  1Z7P A;  3MYD A;  1MDJ A;  3IOS A;  2V6O A;  3ED3 A;  13GS A;  4K2D A;  4DSS B;  3GIX A;  3NZN A;  2VCZ A;  1X9M B;  1GNW A;  1RW1 A;  5ECO B;  1BAY A;  3H8Q A;  5JCW A;  3IC8 A;  4DSR A;  2GT6 A;  2VCX A;  3ZFL A;  3AY8 A;  4K0G A;  1EGR A;  2H72 A;  1M0U A;  2P5R A;  1GLP A;  3KTL A;  4K6X A;  1HNB A;  2L5O A;  2LS5 A;  1T3B A;  4ZXG A;  2NTO A;  6GSW A;  1HNC A;  3LYK A;  3APO A;  2HRK A;  1ERT A;  1EV4 A;  1TK0 B;  2YWN A;  4F03 A;  22GS A;  2H75 A;  2N5A A;  1N2A A;  1WE0 A;  4O92 A;  2R0G A;  2PUK C;  3BCK A;  4HEA 2;  4TRX A;  1DUG A;  1EEJ A;  3ERW A;  3PH9 A;  2X8H A;  2FGX A;  2H6Y A;  2A4V A;  4EIP A;  3IV4 A;  3FYG A;  2K6V A;  3RAZ A;  5DDL A;  2E7P A;  2KLX A;  5HFG A;  2DKH A;  2WFC A;  5IMD A;  1JLV A;  1K3Y A;  4XS1 A;  2I1U A;  2LST A;  3BBY A;  2C3Q A;  1KTE A;  1Q98 A;  5HR3 A;  4BPY A;  4Q5N A;  18GS A;  3KP9 A;  5J3R A;  12GS A;  4ECJ A;  5ECQ B;  3FZA A;  4ID0 A;  4ECI A;  3Q18 A;  4TXO A;  5FT3 A;  1PL1 A;  5IQY A;  2V32 A;  2K9F A;  1M2D A;  2CX3 A;  1ZMA A;  5L71 A;  5D93 A;  3QAV A;  1TI3 A;  2I81 A;  3CSH A;  5E4W A;  1XFL A;  4FH8 A;  3UMA A;  1XPV A;  4RQX A;  5G5F A;  3QAG A;  4CY6 A;  2YV7 A;  2MMA A;  2A4H A;  3D0Z A;  5KOW A;  2DML A;  5IPG A;  2X8G A;  4NV2 A;  2IMK A;  3J7Y k;  3L9U A;  3TKP A;  3RHC A;  3TOT A;  1Z5Y E;  4EXJ A;  1B4P A;  2AHE A;  3H1N A;  1ZZY A;  5F8B A;  14GS A;  3FR3 A;  1SK0 A;  4MZB A;  2ZNM A;  4KDY A;  5KN3 A;  3UBL A;  3F4R A;  2GSS A;  2GST A;  2HRA A;  2MBS A;  3R2Q A;  2YWO A;  1XZO A;  4KDU A;  4QL9 A;  4ZL7 A;  2LUS A;  2B7K A;  3D6I A;  2VIM A;  2K18 A;  2PGT A;  4HZ2 A;  1AXD A;  3IHQ A;  5AIV A;  5ECL B;  3LEF A;  1AQV A;  1ZGN A;  3D5J A;  4EF0 A;  4JZQ A;  4K7I A;  4POM A;  4NXI A;  2IPA A;  3C8E A;  2IL3 A;  2C3T A;  2HSM A;  1K0M A;  1F9M A;  4GST A;  1SYR A;  3A2V A;  1QK8 A;  2H73 A;  5J9C A;  4V2L A;  2VL2 C;  4KGI A;  1T8E B;  3RHB A;  3GKN A;  2YN1 A;  3GN3 A;  4GSS A;  2O87 A;  1PA3 A;  2C80 A;  1J9B A;  4YAP A;  2L59 A;  3FW2 A;  1MD4 A;  3FR6 A;  4LA1 A;  2O8V B;  4ICY A;  2MMZ A;  1OC9 B;  3F0I A;  3IBH A;  2F8F A;  3ERF A;  3ZIJ A;  2CAI A;  3A5I A;  5ENU A;  1THO A;  2BTO T;  5IPH A;  1R7H A;  3UIW A;  2EC4 A;  3EWL A;  3LSZ A;  5LCZ A;  3TKS A;  3EE2 A;  3GX0 A;  3MNG A;  4GTU A;  1R26 A;  4P3Y B;  3GKK A;  1XWB A;  3EUR A;  3C71 A;  1YY7 A;  3TJB A;  2P5Q A;  3UJ1 A;  4EO3 A;  4BVY B;  4PUR A;  1UVZ A;  3ZYW A;  2GVP A;  1M9A A;  4HDE A;  1LU4 A;  2DJ0 A;  4KB3 A;  2YJ7 A;  4F0C A;  3LOR A;  1NHO A;  4PNG A;  2RM5 A;  4IVF A;  1SJI A;  2MMN A;  3HJM A;  1EV9 A;  4I8B A;  1M2B A;  1MEK A;  2LJR A;  4F0B A;  3VPT A;  4K5R A;  1A2M A;  3QMX A;  3R3E A;  4DSQ A;  4XRD A;  5DJM A;  2PPT A;  3I6A A;  1B4Q A;  1TRU A;  4J56 E;  5J4U A;  4I6X A;  4HS1 A;  1XWK A;  2QKE A;  4I5Q A;  4N10 A;  3UOM A;  1E2Y A;  4WKW A;  2N5F A;  3L9V A;  1G7O A;  3HDC A;  4Q5R A;  1SYX A;  4JED A;  1F3A A;  2L4C A;  4X43 A;  5H5Q A;  4PGT A;  1A24 A;  5DCH A;  3UAP A;  3HXS A;  2VD1 A;  3O3T A;  4PQH A;  2VCQ A;  3Q6O A;  1U3A A;  2HI7 A;  1QXH A;  4TR0 A;  1B9Y C;  4O32 A;  4RUV A;  5DAL B;  1K0D A;  2K8S A;  4AJ6 A;  5CO3 A;  3VI5 A;  1WRY A;  4EVM A;  2YWI A;  3M9K A;  4WEY A;  2H0H A;  1MDI A;  4LL4 B;  2IMI A;  2FHE A;  3TJG A;  2G0F A;  2XPD A;  5ELA A;  3C1S A;  1SL0 B;  3CRT A;  2VLV A;  2IN3 A;  3I43 A;  1SU9 A;  1YZX A;  1FVJ A;  2RUE A;  1H4O A;  2OBK A;  2TIR A;  16GS A;  2OJL A;  3JCM L;  4MPF A;  1FOV A;  1TXX A;  2FCH A;  2VUP A;  5J5N A;  1KBN A;  3LG6 A;  4PX1 A;  3DRN A;  2WCI A;  4O5R A;  3UVT A;  5HR0 A;  4BL7 B;  1FG4 A;  4G0L A;  1G0T A;  3GX8 A;  3WD6 A;  5BRT A;  4MZC A;  2FUG 2;  3GUR A;  2B1K A;  2PMT A;  3IAS 2;  2YCD A;  1MDK A;  5HFI A;  2FA8 A;  4BA7 A;  1OE7 A;  2DJ3 A;  4GWR A;  3W8J A;  3GL3 A;  3VI7 A;  3GV1 A;  2GZZ A;  3HVX A;  1Q4J A;  3GL5 A;  4I2U A;  2FLS A;  1HYU A;  2IFQ B;  3TKS C;  1M9B A;  3D4T A;  3I69 A;  4CDO A;  2WJU A;  4TKY A;  2BMX A;  1TDI A;  2TRX A;  4OMV A;  5IOX A;  2GSQ A;  3HHV A;  4LL1 B;  1J08 A;  5A4W A;  5IOW A;  3W8S A;  2QA2 A;  5ECR B;  4V1A p;  1XVQ A;  2D2Z A;  3ZRD A;  2GQL A;  2R5G A;  2B5E A;  2DKI A;  4L5L A;  1V98 A;  5GAN D;  3BD2 A;  2R6K A;  2CVK A;  3LXZ A;  5CRH A;  1KNG A;  3A2W A;  2GT5 A;  4JU5 A;  2RUF A;  5CP1 A;  2DC5 A;  2C0F A;  5A4U A;  4TW5 A;  1F2E A;  3ZZX A;  3M8N A;  4MP4 A;  2MYG A;  2H74 A;  2Z9S A;  1VRS D;  3M0F A;  2HFD A;  3DYR A;  2IFQ A;  5IM9 A;  3VK9 A;  1PN0 A;  2OAC A;  1U87 A;  4ML6 A;  4OFT A;  1MTC A;  1OC8 A;  2WUL A;  4AGS A;  5GZZ B;  4PUF C;  1ILO A;  4MH3 A;  5D9V A;  4NAX A;  5HQP A;  2F51 A;  4FYB A;  1FW1 A;  4YKF A;  2C0G A;  5ELG A;  4JRR A;  4MLY A;  1TW9 A;  4XS4 A;  3GST A;  3EVI A;  2CZ2 A;  3F6D A;  4IEL A;  2KP1 A;  3HVV A;  1YJ6 A;  4K0N A;  2FY6 A;  3MAK A;  4IBP A;  2AYT A;  1G6Y A;  4MPG A;  2LKU A;  2VLT A;  4WXT A;  2KOK A;  2KUC A;  4DVC A;  3RPP A;  3EC3 A;  3CMI A;  1U3I A;  5HR1 A;  4TXO B;  4I2T A;  2YZU A;  2NDO A;  3CTG A;  1TRS A;  4KSM A;  3EMP A;  3WT2 A;  2AV4 A;  3GA4 A;  1BED A;  3ZLP A;  4MF6 A;  4KE3 A;  1XWG A;  3F4S A;  1M99 A;  4Q5Q A;  1ERU A;  5LD0 A;  1FOH A;  2E2G A;  4PUA A;  1ML6 A;  1K3O A;  4QL7 A;  2H1D A;  4KND A;  2PVO C;  3QAW A;  4ULX A;  3VPQ A;  1AUC A;  1F6M C;  2CT6 A;  2X99 A;  3CSI A;  2VLU A;  4NPB A;  5COH A;  4TR4 A;  2IIY A;  2C3N A;  1JZD A;  5CRE A;  3LW9 A;  3G7I A;  4QQ7 A;  2H1A A;  2H6Z A;  4JBB A;  2B5X A;  4XIH A;  2F3M A;  3MSZ A;  2WDU A;  4MAB A;  3WGD A;  4NHZ A;  4WBR D;  1BJX A;  3H93 A;  4KW6 A;  2CVB A;  4L8E A;  3VWV A;  5KOX A;  1HNA A;  8GSS A;  4TOP A;  5BMU A;  5IO0 A;  1GUH A;  3TRX A;  1IYH A;  4CY8 A;  2C0D A;  1GSF A;  3GMF A;  4YAV A;  4ECC A;  3DKS A;  4IGJ A;  5IMC A;  3FHK A;  5EPF A;  1VGL A;  1PGT A;  4O7H A;  2R2J A;  2C4J A;  1GSY A;  3RDW A;  5DQY A;  4OWY A;  20GS A;  1SD8 A;  3ZML A;  2LJA A;  4XRA A;  4JR6 A;  2R0P A;  1F37 A;  3NOF A;  4PQI A;  7GSS A;  2LNT A;  2LEG A;  2EIO A;  3BOA A;  1O85 A;  1WIK A;  2FD3 A;  1OC3 A;  2RLI A;  1PQN A;  2C1Y A;  2JL4 A;  3G7J A;  2H76 A;  5B6N A;  1O6J A;  5G2Z A;  2PWJ A;  2A2R A;  2AJQ B;  3QD9 A;  1K0B A;  3QPM A;  5ECN B;  4MCU A;  4N11 A;  3LQ7 A;  4TVE A;  4D73 A;  5D9T A;  1AQW A;  2P31 A;  1B8X A;  5JWR B;  1XW9 A;  2YWM A;  1Y25 A;  3K8N A;  2DBC A;  2IMF A;  1HQO A;  1YEP A;  1JZW A;  2WZ9 A;  1SK1 A;  3GKX A;  5HFK A;  4ML1 A;  2FNO A;  2HXK A;  4EDZ A;  3W6G A;  3MDK A;  1TJD A;  6GSY A;  4KX4 A;  3O76 A;  2LRT A;  1WP0 A;  2L6C A;  1T7P B;  3HKR A;  1TU8 A;  2HZF A;  3QFA C;  1GL8 A;  2B7J A;  1AQX A;  1F3B A;  4WBJ A;  1N8J A;  5IIZ A;  1A2L A;  1ZOF A;  5ID2 A;  2JZR A;  5IMA A;  3U6V A;  1GNE A;  3HA9 A;  2L4Q A;  4HJM A;  2YOI A;  4N30 A;  3QR6 A;  4NWY A;  4WET A;  3KJY A;  2MMO A;  4NMU A;  4IN0 A;  1XBS A;  4NHW A;  1PN9 A;  3ZVJ A;  4KF9 A;  1M7T A;  2ZUP A;  3C73 A;  2M80 A;  2M46 A;  1QQ2 A;  3HZ4 A;  1VF4 A;  5G30 A;  3C1R A;  3H79 A;  5KN0 A;  2CV4 A;  3HZ8 A;  1E6B A;  1NW2 A;  3PGT A;  2WGR A;  1JZO A;  3GSS A;  2GLR A;  4X4J A;  4Z2R A;  3GKM A;  2DIY A;  1YF0 A;  4EKZ A;  2N5B A;  3CBU A;  2R0C A;  4GSN A;  4DEJ A;  4ZB6 A;  2MZC A;  4HQZ A;  1FAA A;  2XBI A;  1UC7 A;  2IWT A;  2R4V A;  5F06 A;  3TDG A;  4K2X A;  1W89 A;  4G2E A;  4BWS A;  2CX4 A;  3APQ A;  3IK9 A;  4AJ8 A;  2VM2 A;  5F05 A;  1XW5 A;  3HCZ A;  4N0Z A;  4NV5 A;  3CSJ A;  1K0O A;  2OAD A;  1YQ1 A;  1OVN A;  2O89 A;  5IMV A;  4YQU A;  3TJJ A;  2LNS A;  4MDC A;  4MA9 A;  4RI6 A;  1SKR B;  4ACS A;  2B5Y A;  2HSH A;  1S3D A;  1X9S B;  3OR5 A;  3O6T A;  5AN1 A;  3IR4 A;  1O8W A;  1ZYE A;  3GFK A;  4Z2U A;  5KN2 A;  1GUM A;  2X64 A;  1T4Y A;  1PRX A;  4F2I A;  3TKS E;  1RK4 A;  3VLN A;  1SKW B;  4E8H A;  2X8C A;  3KH7 A;  1URM A;  2ZCT A;  4HU9 A;  1OKD A;  4IJI A;  1R5P A;  3TJF A;  5EY6 A;  2LJK A;  4KH7 A;  3U5R E;  2JZS A;  1O7U A;  1XW6 A;  1A8L A;  4K8M A;  4EL1 A;  1ERW A;  2V41 A;  5B8B A;  3P7X A;  5F07 A;  1ON4 A;  3D22 A;  2K8V A;  2JSZ A;  4TR3 A;  2HLS A;  2OA7 A;  2PU9 C;  3P8W A;  4KA0 A;  4ZIJ A;  2GDR A;  1YKA A;  2H66 A;  2H6X A;  1TP9 A;  2V2G A;  1GUK A;  1ZYN A;  3CTF A;  4FQU A;  4Q5F A;  3GYK A;  5CNW A;  2LTK A;  5ECI B;  3G7Y A;  1EWX A;  3HY2 A;  5G1L A;  5EL8 A;  1G6W A;  3ZL5 A;  2QC7 A;  3FK8 A;  1TRV A;  2JU5 A;  4HU7 A;  3VFI A;  4RI7 A;  2GZP A;  1QFN A;  4MJA A;  2JAD A;  4BVX A;  5EVO A;  2ON7 A;  3MWH A;  1I5G A;  1SL1 B;  1O8X A;  2F9S A;  3M3M A;  5KEJ A;  3GRX A;  3A5W A;  2XC2 A;  3ZVJ D;  3DD3 A;  3P2A A;  1YKC A;  1AIU A;  3LYP A;  3ZTL A;  4EE0 A;  2YAN A;  4MF7 A;  5C00 A;  2NVL A;  2H71 A;  4MJE A;  4PQ1 A;  3TGZ A;  3KH9 A;  3L9S A;  2FA4 A;  1R5A A;  4TN8 A;  3DEX A;  4AF2 A;  1QUW A;  2H0I A;  2EIR A;  4IQ1 A;  4K1F A;  2OE3 A;  2VD0 A;  2DJJ A;  4XCS A;  4ISD A;  4YKG A;  2H19 A;  5GSS A;  2DMM A;  2AAW A;  1ZYP A;  4ZBB A;  4ZBD A;  3V1W A;  4HOJ A;  1BQ7 A;  1X5D A;  2JAC A;  3IC4 A;  1SD9 A;  3TB2 A;  4XS4 B;  2CQ9 A;  1FHE A;  5D96 A;  3KIJ A;  3CRU A;  3ZFB A;  4GLT A;  2HZE A;  2HYX A;  4MJB A;  1ABA A;  4JE1 A;  1USB A;  3QOU A;  3FMW A;  1JFU A;  4ILF A;  3KCM A;  2F8A A;  2DJ2 A;  4FYU A;  1XCC A;  2DIZ A;  1SJZ A;  4PTS A;  5DJL A;  1GSQ A;  5CRD A;  3FZ5 A;  5A4V A;  2YV9 A;  1X0R A;  2ES7 A;  1GTA A;  4MMM A;  4N0V A;  1GTU A;  3F3R A;  4OCF A;  4F9Z A;  4WF4 A;  2L6D A;  4X1U A;  3KTB A;  2HE3 A;  1SJ6 A;  1Z7R A;  2VL9 A;  3HVS A;  3KGK A;  1DSB A;  5DAK B;  1OAZ A;  3GUS A;  4ZIL A;  2PN8 A;  3LWA A;  3KD0 A;  4OO4 A;  2I9H A;  4EC0 A;  3GH6 A;  2DSA A;  1CQH A;  4Z7X A;  1YEX A;  1UN2 A;  5ECS A;  4GCI A;  5G1K A;  1PKW A;  2H30 A;  3F3Q A;  3L78 A;  5CRW A;  3MIX A;  2LQQ A;  3G9B A;  5ECK B;  1OKT A;  2KHP A;  3C7M A;  1W4V A;  3UVH A;  2E2M A;  3HYP A;  2C8U A;  1MD3 A;  1PD2 1;  5JWO B;  3EMX A;  2H8L A;  4FIW A;  1KEB A;  2VCT A;  4PNF A;  4GXZ A;  3TUE A;  3I9V 2;  5B6M A;  2LRN A;  4MNN A;  4HJ2 A;  4POB A;  3TKQ A;  1V57 A;  1A2J A;  1DE2 A;  3ME7 A;  4LLR A;  1V40 A;  3IDV A;  2GTU A;  2VL2 A;  1OE8 A;  2V1M A;  4A5P A;  3EU4 A;  5DAK A;  1GP1 A;  4G0K A;  4IKH A;  1VF1 A;  2I3Y A;  6GSU A;  3F4T A;  2H1B A;  1GLQ A;  3KP8 A;  4E8E A;  1EZK A;  3IXR A;  4HUA A;  2DLX A;  5GAP D;  2DJK A;  17GS A;  3VWX A;  4POK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...