3VWUA

Crystal structure of peroxiredoxin 4 from m. musculus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
177
structure length
172
Chain Sequence
LSKAKISKPAPYWEGTAVINGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRIEEFKSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLNHQISKDYGVYLEDSGHTLRGLFIIDDKGVLRQITLNDLPVGRSVDETLRLVQAFQYTVCPAGWKPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin-4
publication title Synergistic cooperation of PDI family members in peroxiredoxin 4-driven oxidative protein folding
pubmed doi rcsb
source organism Mus musculus
total genus 49
structure length 172
sequence length 177
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vwuA00
1S3CA 4ZXGA 2RIIA 4NWYA 3C73A 3KTLA 1MTCA 5G1LA 3PGTA 2EIRA 3I9V2 1TU8A 5IPHA 12GSA 3BCKA 3ME8A 3EE2A 5DBQA 1F9MA 1K3YA 1N8JA 3IOSA 3IA1A 2CT6A 1A0RP 2E0QA 1AQWA 3NZNA 4J57E 2DIYA 3FW2A 1OKTA 3H4KA 3MNGA 4MJCA 3IE3A 5CYYA 2YNXA 5KEJA 3DMLA 2CA8A 4IN0A 1GL8A 2DJ1A 1UVZA 1V9WA 1F37A 1XOAA 4RUVA 4K7IA 1PKWA 2MMNA 4K9ZA 2N5AA 1ERUA 2CAQA 1R7HA 1ZOFA 5DALB 3M3MA 2MMZA 3EVIA 5ID2B 1BJXA 4TOPA 1TRSA 2PBJA 1XFLA 2HT9A 1PQNA 4JU5A 1U3IA 3Q74A 2LSTA 4J2FA 2NVLA 1WOUA 3ZMKA 1HD2A 1YKAA 3UARA 5J3RA 1G6WA 4QL9A 3DKSA 4HS1A 2HYXA 3EINA 4LL4B 5CNWA 2F3MA 4EUYA 2DMLA 4ECBA 3GNJA 4PUFC 5GAND 2VLTA 2CX4A 5LCZA 3GUSA 1XVQA 1V2AA 3A3TA 5KN2A 5F8BA 2YJ7A 4XTSA 2HXKA 1B9YC 4F2IA 4ZBAA 4AJ8A 3HZ8A 2DLXA 4EKZA 3TRQA 5IMZA 3ERFA 2FWHA 3BJ5A 4WF4A 1GUHA 1GSYA 2O7KA 2ZNMA 2WGRA 1J08A 2B7KA 2YV9A 3C71A 1TRWA 5F06A 4P3YB 3UVHA 3D6IA 5HR0A 2H19A 2HRNA 2FY6A 4MK3A 3ISOA 2H72A 2X8HA 1KEBA 2C3NA 2QC7A 1TK5B 1QQ2A 3DWVA 4HEA2 3GX8A 5DJMA 2IMIA 1WE0A 5DQYA 2K6VA 2GGTA 2WCIA 1BAYA 5FWGA 4WETA 17GSA 2VCTA 2H73A 5A4VA 1K0MA 2GVPA 3RAZA 3D4TA 3UOMA 4X43A 2FWEA 3KZQA 4JEDA 3F3RA 5IPGA 4K7NA 2DBCA 1WRYA 1HNBA 3FZAA 2XBIA 4X0XA 4ISDA 2HZEA 2YZHA 3GTUA 2OACA 4MCUA 4GSNA 2ES7A 4G19A 4PGTA 4TR0A 2K18A 3TJFA 2GZZA 3GSTA 2KP1A 1BEDA 4K2DA 4KA0A 5IOWA 1ZMAA 4IVFA 4IBPA 2VCWA 3A2VA 1NHOA 3GSSA 4GXZA 3TJKA 5ECQB 1UN2A 4ZB8A 3HVXA 4PNFA 13GSA 5IO2A 3C8EA 4MF5A 2NDOA 5ECNB 1A0FA 2FD3A 3F9UA 1O85A 3IRAA 2CQ9A 2YWOA 1JHBA 5IIZA 2GZYA 3HA9A 3GTUB 2JL4A 2XPEA 1OVNA 1YZXA 2D2ZA 5B7CA 3FRCA 2C0DA 5DAKA 2NTOA 1B4PA 1EV4A 1JLWA 4G2EA 1SYRA 3ERWA 3LQ7A 3WYWA 1GLQA 2GZPA 4XCSA 1R5AA 2AV4A 5A4WA 1GNEA 2ON7A 3F6DA 1O8WA 2PERA 6GSVA 3TKSC 1XW5A 4ZL7A 1ERVA 5ECHB 4POMA 2LJKA 3BBYA 4HU7A 1MDJA 1T4ZA 1TKDB 1BG5A 3HJPA 3L9UA 1PL1A 1XZOA 2X8GA 1I9DA 3HHVA 5DAKB 1WWJA 3P7XA 1I5GA 1X9MB 5IQYA 1GH2A 5CRHA 1SD9A 2IMEA 2JU5A 2XHFA 1XWCA 5AIXA 2REMA 4ZL8A 1G6YA 2C0FA 1SJZA 4HJ2A 4EVMA 4PXOA 3GMFA 3ZIJA 3G7IA 2VCVA 2PGTA 4L0WA 4GF0A 4LLRA 1NSWA 4XS6A 2LRNA 4KAEA 4IHUA 1OC9A 1DBYA 3LGCA 1FAAA 4TR3A 4ECIA 3WD6A 2B1LA 1YJ6A 4GSTA 2X64A 2HNLA 3TKQA 1T3BA 4POKA 4TR1B 3J7Yk 3HKRA 3G7YA 5D9WA 1TOFA 1SJ6A 4F9ZA 2WZ9A 1YDKA 4JE1A 1YQ1A 3D5JA 4V1Ap 2O89A 5A5KA 1XWGA 2H66A 1LJRA 2L4QA 3FHKA 2IMKA 5HR2A 2K8VA 2H6YA 2EIOA 3RHCA 1OC9B 3FY7A 5GSSA 2VUPA 1EP8A 2MMAA 3IV4A 5CREA 3QAGA 4G9HA 4KDYA 5AISA 4IELA 2DMMA 3GKNA 1R4WA 1FB0A 2BTOT 3DGQA 1K3OA 3H8QA 5CO3A 5ECSA 1YEPA 4TXVA 3HDCA 4HZ4A 3APQA 16GSA 3M1GA 3LFLA 3UBLA 2R37A 1ZYQB 3KTBA 4AJ7A 4N11A 2LJRA 2N5FA 1YKCA 3FR3A 4AJ6A 1XWAA 2FCHA 4K0GA 4L0UA 2QKEA 2VO4A 3ZFLA 5ECIB 4IQ1A 4WEYA 3QFBC 2I3YA 2FWGA 3QFAC 1YEXA 5H5RA 4PNGA 3U6VA 3FZ5A 5HR1A 2VL9A 2P5QA 2WB9A 1K0AA 4ILFA 3C1RA 3A2XA 3GL5A 4POLA 1PKZA 1QGVA 1QUWA 1OKDA 4WR5A 1Z5YE 4XS4A 4MJBA 1M7TA 5G31A 1GWCA 3TOUA 3LWAA 4KDUA 4RQXA 4PQ1A 3VI5A 4BWSA 2FA8A 4TKYA 3P8WA 3TDGA 4IJ3A 3CSJA 4MABA 3HD5A 9GSSA 1BQ7A 3TRPA 5IMAA 3KIJA 4XIHA 4GTUA 3V1WA 1B9XC 3APSA 2VAFA 3US3A 2LRTA 2HFDA 3UJ1A 3W6GA 4GQCA 2FUG2 4OO4A 1GSDA 3IR4A 1A24A 2B1KA 3QAVA 3G7JA 3RPNA 4MZWA 2X99A 1HNAA 1USBA 3VWVA 4YH2A 4XS4B 4ECCA 4BWQA 1ZYEA 4ID0A 1T00A 5CRWA 5G1KA 1AW9A 1U6TA 1K0DA 1LBKA 4I97A 3FR9A 4K8MA 1H75A 2TIRA 4TN8A 4Q5RA 5AGYA 4ML1A 2VIMA 2AHEA 1SL0B 5COHA 2GT6A 3HZ4A 2BJXA 4L5LA 3HXSA 1U3AA 4Z7XA 1M2AA 1X9SB 2MZCA 2QSIA 1M0UA 4LMVA 2OJLA 3HCZA 1XOBA 3UBKA 3ZZXA 4HZ2A 3ZREA 4O92A 1JZWA 2O85A 4KCEA 4EDYA 2YV7A 1FHEA 1GUKA 1OC3A 5J5NA 3ZL5A 3KMNA 1TW9A 3PR8A 4MZBA 1JLVA 1N2AA 2CAIA 2AYTA 1EZKA 2LKUA 1XIYA 4WF5A 5AN1A 4LA1A 2B5YA 1EWXA 1SK1A 1IYHA 4F82A 1TU7A 3QCPA 3VWUA 4HI7A 2CZ2A 3H93A 3I6AA 1ILOA 2LNTA 3P90A 1GTUA 3HY2A 4MMMA 2VD1A 3KCMA 1SKRB 4NHWA 2VM1A 4MP4A 4DEJA 1F3AA 1DSBA 5L71A 1FG4A 3DEXA 2DJ2A 4O32A 5CAXA 3NIVA 1PSQA 5ECMB 3KD0A 3A5WA 4FYBA 2P5RA 3QD9A 4XRDA 2PU9C 2CVKA 4MJAA 2J9HA 1M2BA 4J56E 1GULA 5CP1A 1M2DA 5ELGA 3GA4A 2DSAA 2ZCTA 3VPTA 2BMXA 4GQFA 5G2ZA 1OE7A 2HSYA 4MPGA 4E8EA 3TGZA 1S3DA 5B8BA 2YANA 3E3EA 3EURA 4YAPA 1F3BA 3IDVA 1R26A 3FKFA 3EWLA 3TB2A 1BX9A 4N0VA 5D73A 3CYNA 3GV1A 3SWLA 2GS3A 2GT5A 4ZB6A 2OBKA 2VL3A 3UL3A 3UAPA 4JZQA 4LMWA 1LU4A 4YQMA 2H0IA 1X5DA 4IKHA 1J0FA 4Q5NA 3QDNA 1SKWB 2KP2A 4TW5A 2LS5A 2JZRA 1XPVA 4V2NA 2DJJA 4ZILA 1GP1A 3LYPA 1PD21 1SU9A 1DE2A 1V98A 1FOVA 3HVVA 1Z6MA 5C04A 2F8AA 4HQZA 2M46A 3E9JB 4KCAA 1TTZA 4WBRD 1T4YA 4KB3A 2CZ3A 1EGOA 2JZSA 1GSQA 3DRNA 2HSHA 1SL2B 4EC0A 1A2MA 6GSUA 2OKAA 5B6NA 4HOJA 1TRVA 4K0NA 1Q4JA 3IC4A 11GSA 2ALBA 3F0IA 2ON5A 3GIXA 4I5QA 1ZGNA 4IS0A 1X5CA 3WGXA 1M99A 4IP6A 2G0FA 1S3AA 1XVWA 2V1MA 1VF4A 2JSZA 2M80A 2V2GA 4IGJA 2NBSA 4ZL9A 2C3TA 2HE3A 1VF1A 1TK0B 3FZ4A 4IP1A 4EXJA 4EL1A 1KTEA 1XW9A 4TR4A 2HZEB 3VFIA 1ML6A 5IMFA 3HJMA 3MSZA 4AF2A 1X9WB 2MBTA 1RK4A 4XS1A 3NOFA 4YQVA 1EGRA 2WULA 1EV9A 2HRFA 1AXDA 2OE3A 5AIVA 3GFKA 4PQHA 3FK8A 5IMVA 1K0CA 3E0UA 3I69A 5HFKA 1FW1A 1PX6A 4G10A 5J9BA 3HVSA 5KN1A 1THOA 5IM9A 2PPTA 10GSA 2K8SA 2H1BA 4IW9A 4MPFA 4OFNA 3F4SA 2H75A 2L4CA 1EEJA 3GL3A 4CW9A 5IMCA 1GTBA 2B7JA 3DYRA 3F8UA 3ZTLA 1GSFA 3DD3A 4EO3A 5ECOB 4FO5A 5IOXA 4F0BA 3QR6A 2I1UA 3R2QA 2H0GA 3F6FA 4TRXA 7GSSA 3IHQA 1QK8A 1PN9A 2LV3A 2NPBA 2VCXA 5HQPA 4WBJA 2LNSA 2YWIA 3O76A 1X0RA 2EIQA 1YY7A 2HZFA 2YOIA 2IN3A 1GRXA 5HFIA 3GH6A 4FH8A 5H5QA 4BVYA 3G9BA 2VLVA 3ZLPA 2KUCA 1U87A 3TKRA 4OCFA 5B6MA 1EEMA 4K7OA 5D9TA 2YP6A 4E8HA 2C0GA 5DQSA 4DSSA 3M0FA 1MD3A 2GSQA 5FHIA 5ECRB 2TRXA 2LJAA 3CSIA 2LQOA 4NXIA 4N10A 2C0EA 1F2EA 3KM6A 3L9SA 1GTIA 2H1DA 4OFTA 3GURA 3GRXA 3EC3A 4O7HA 2H0HA 2FHEA 3TJBA 2WRTA 2YN1A 3TJGA 4KE3A 5G30A 1T8EB 4HQSA 1O7UA 5E4WA 2H1GA 1NM3A 1WMJA 2KLXA 6GSWA 3PH9A 4V1Ag 3CRUA 3IPZA 3WT1A 1PX7A 5DJLA 3L0HA 1V57A 2E7PA 2MMOA 4NV2A 5JCUA 1ON4A 2LTKA 2GDRA 1JZOA 2K9FA 3CSHA 4FYUA 3WGEA 1WIKA 5D93A 2B5XA 4WR4A 4GLTA 2C3QA 1Q98A 1SKSB 1ABAA 2RM5A 4PURA 3D21A 2R5GA 5EPFA 3AY8A 5D9VA 4K6XA 3ED3A 5ECPB 3O6TA 2FWFA 4BA7A 5J4UA 5ELAA 4I2TA 2LUSA 2VD0A 3IBHA 5ECKB 3OR5A 1XWKA 1JZDA 2I4AA 5E59A 1A2LA 5H5SA 3CBUA 4JRRA 1EOGA 1JFUA 4JR4A 1FVJA 3DXBA 2XC2A 3Q19A 4K1FA 1V40A 1PMTA 2QGVA 2PVOC 2IFQA 2AUVA 4L5OA 4N0ZA 3TRXA 3KGKA 4TXOA 4MF7A 3I43A 2L5LA 1CQGA 1FVKA 3O3TA 3F3QA 2H76A 3TOTA 1K0NA 3J7Yb 2YJHA 2H74A 4BVXA 1SK2A 3IK9A 1MDIA 4KUNA 4NHZA 2IPAA 2FLSA 5ECLB 3ERGA 1Z9HA 4RI7A 2A2SA 5KN0A 3QPMA 4JR6A 2IFQB 18GSA 2PUKC 1MD4A 2EC4A 3VURA 19GSA 2GSTA 3ZYWA 2C80A 3H1NA 4TXOB 4NMUA 3DIEA 2LEGA 1YF1A 20GSA 1C72A 1OAZA 2F51A 2YWMA 5JCWA 5IO0A 5JCGA 1Z6NA 2WJUA 4H86A 1TK8B 2VOCA 5DALA 5B8AA 1PA3A 2L59A 5ID2A 3GH9A 4EF0A 1ERTA 3UVTA 4EDZA 3MDKA 1ERWA 4MH2A 2RM6A 2VL2A 2G2QA 2X8CA 1T1VA 4HUAA 1K0BA 2FGXA 5ENUA 4POBA 2I81A 4F03A 22GSA 4KW6A 3TUEA 2H01A 1O73A 4TVEA 3GKXA 2TRCP 4Q5QA 3LXZA 1B48A 1ZL9A 2L6CA 4CHSA 4OMVA 3N9JA 1G7OA 3ZIVA 2DJ0A 2E2GA 4X1UA 2VM2A 1G0TA 4QL7A 3RDWA 2PVQA 1AQXA 1GTAA 5F05A 3GYKA 1T7PB 4PUAA 1A2JA 3ZFBA 1QXHA 2VLUA 4XHMA 3ZVJA 3MAKA 2R4VA 4JBBA 2N5BA 4YQUA 4FIWA 2M72A 2PWJA 2XBQA 1TI1A 1URMA 2HLSA 3K8NA 2YWNA 2A4VA 4KSMA 2GQLA 4I6XA 5KN3A 1TP9A 3UEMA 3TKSE 1UC7A 1GLPA 5IMDA 1NW2A 3KJYA 2DJ3A 2IMFA 4N30A 1FB6A 3RBTA 4KH7A 5EY6A 4HU9A 5INYA 2KHPA 3IXRA 3N5OA 4Q5FA 2OE1A 2H1AA 3KH7A 2AJQB 3F4RA 1AIUA 5D9XA 2IJYA 5HFGA 1XCCA 2FA4A 5EVOA 1O8XA 3KXOA 2CVDA 1DUGA 4ZBDA 4V2MA 1XXUA 2V6KA 4FYCA 1PL2A 1R5PA 5C00A 4GWRA 2F9SA 1A8LA 5J41A 1XBSA 2A2RA 5D96A 1PRXA 2WDUA 1TJDA 3U5RE 3HYPA 1CQHA 4HDEA 6GSTA 2V32A 1KNGA 1J9BA 2V6OA 1M9BA 1NHYA 3WGDA 3QOUA 3TKPA 1UA5A 1VF2A 3CXGA 2H30A 2MBSA 2AAWA 4MJEA 4HJMA 4ECJA 4I8BA 4ACSA 2H71A 1MEKA 1Z7RA 3P2AA 3MWHA 2IMDA 2DIZA 3D0ZA 4LL1B 4AGSA 2GQMA 1B8XA 1U88A 5J9CA 2YCDA 1AUCA 1VRSD 4L8EA 3SBCA 3CTFA 1O81A 2RUFA 3KH9A 2Z9SA 3Q18A 5ABRA 3W8JA 3BD2A 3C1SA 4GSSA 5FT3A 3ZVJD 3W8SA 1QMVA 1HYUA 3LEFA 1XW6A 3F4TA 2R2JA 2GSSA 2WS2A 3ME7A 1TI3A 4PQIA 1GSSA 2RLIA 1HQOA 5D8IA 1AC1A 5JWQB 5LD0A 3EYTA 2IL3A 2YZUA 3GHAA 2YPMA 1X5EA 5JWOB 1THXA 3CTGA 1F6MC 3FYGA 4MDCA 4YAVA 3LXTA 2I9HA 2C8UA 2ZUPA 2DC5A 1YF0A 4GCIA 3VK9A 3QMXA 3A2WA 3TJJA 1XWBA 4O5RA 3FZ9A 2CX3A 5DVBA 1TDIA 4GRFA 1TXXA 3L78A 2H70A 5GAPD 3WT2A 2KOKA 3M9KA 1SYXA 5F0GA 2DJKA 1GNWA 3FEUA 4DSRA 1V58A 3GX0A 2XPDA 1OE8A 5DDLA 3KP9A 1KBNA 3VPQA 3EMXA 4OD7A 1ZCPA 4MLYA 1G7EA 4OFMA 3GKKA 3BOAA 3IAS2 5JWRB 2RUEA 1EP7A 2CV4A 3L9VA 4DVCA 4CDOA 1Y6EA 2MYGA 3VLNA 2R6KA 3IK7A 2C4JA 3TCOA 3QAWA 1ST9A 2GSRA 4TR1A 3M8NA 1AQVA 8GSSA 3ZRDA 3CMIA 1WPIA 4KX4A 1ACVA 5LNKe 3VWWA 3D4MA 4BPYA 2V41A 3LJRA 4RQRA 2VCZA 2VCQA 3EMPA 1B4QA 2PMTA 2OBIA 1E6BA 1EOHA 1WJKA 4MH3A 1VGLA 3FR6A 4XRAA 3KMOA 1QFNA 6GSXA 1OYJA 1Z3EA 5DCHA 1W4VA 2R3XA 4DSQA 1O6JA 1Y25A 3VI7A 2VL2C 3LORA 5GSTA 5GZZB 4MZCA 3ZITA 1Z7PA 1MDKA 3M9JA 3GN3A 3JCML 2P0GA 3H79A 2B6MA 2JACA 1ZZYA 2LRCA 1RW1A 4DSSB 1BYEA 1E2YA 3EU4A 4BL7A 2L57A 3BCIA 6GSSA 2IWTA 2J23A 2L5OA 2OADA 2JADA 2O87A 2F8FA 3DVXA 4KDXA 2FNOA 5CRDA 3LSZA 4IQAA 3ZMLA 4KGIA 4V2LA 2P31A 1RQMA 3Q6OA 4NPBA 3APOA 2B3SA 1OC8A 1PGTA 1SENA 3L4NA 2CVBA 2H6XA 2AB6A 4F0CA 1VF3A 3VWXA 1FO5A 4D73A 3S9FA 1M9AA 2B5EA 2HI7A 3EU3A 3DVWA 4RI6A 3UIWA 1SJIA 5G5EA 4ZBBA 3KP8A 2E2MA 3C7MA 4WKWA 4MF6A 1GUMA 3UMAA 1K0OA 4IJIA 5HR3A 1TRUA 4KSOA 4OO5A 2JSYA 1W89A 2IIYA 4NV5A 5A4UA 2O8VB 1H4OA 3LYKA 5EL8A 2GTUA 1K3LA 2GQKA 1SL1B 1SK0A 2OE0A 2GLRA 1GSEA 4ML6A 4D73B 3RHBA 3TKSA 1GSUA 4EE0A 3LG6A 2L6DA 4MA9A 2LQQA 1SD8A 3KEBA 3IAM2 6GSYA 5DCGA 4ZB9A 4I2UA 2OA7A 2H8LA 5F07A 1HNCA 3CRTA 4QQ7A 2C1YA 1IYIA 4ZIJA 4PX1A 3RPPA 4KNDA 1AAZA 4OWYA 14GSA 3HJOA 5CRGA 1A23A 4WXTA 1DE1A 2WFCA 4ULXA 4OCEA 3PINA 1A8YA 2PN8A 5G5FA 3F63A 2JZTA 4NAXA 3D22A 1JZRA 3GKMA 2H6ZA 1WP0A
chains in the Genus database with same CATH superfamily
1S3CA 4ZXGA 2RIIA 4NWYA 4K5RA 3C73A 3KTLA 4BVXB 1MTCA 5G1LA 3PGTA 2EIRA 3I9V2 1TU8A 5IPHA 12GSA 3BCKA 3ME8A 3EE2A 5DBQA 1F9MA 1K3YA 1N8JA 3IOSA 3IA1A 2CT6A 1A0RP 2E0QA 1AQWA 3NZNA 4J57E 2DIYA 3FW2A 1OKTA 3H4KA 3MNGA 4MJCA 3IE3A 5CYYA 2YNXA 5KEJA 3DMLA 2CA8A 4IN0A 1GL8A 2DJ1A 1UVZA 1V9WA 1F37A 1XOAA 4RUVA 4K7IA 1PKWA 2MMNA 4K9ZA 2N5AA 1ERUA 2CAQA 1R7HA 1ZOFA 5DALB 3M3MA 2MMZA 3EVIA 5ID2B 1BJXA 4TOPA 1TRSA 2PBJA 1XFLA 2HT9A 1PQNA 4JU5A 1U3IA 3Q74A 2LSTA 4J2FA 2NVLA 1WOUA 3ZMKA 1HD2A 1YKAA 3UARA 5J3RA 1G6WA 4QL9A 3DKSA 4HS1A 2HYXA 3EINA 4LL4B 5CNWA 2F3MA 4EUYA 2DMLA 4ECBA 3GNJA 4PUFC 5GAND 2VLTA 2CX4A 5LCZA 3GUSA 1XVQA 1V2AA 3A3TA 5KN2A 5F8BA 2YJ7A 4XTSA 2HXKA 1B9YC 4F2IA 4ZBAA 4AJ8A 3HZ8A 2DLXA 4EKZA 4G0IA 3TRQA 5IMZA 3ERFA 2FWHA 3BJ5A 4WF4A 1GUHA 1GSYA 2O7KA 2ZNMA 2WGRA 1J08A 2B7KA 2YV9A 3C71A 1TRWA 5F06A 4P3YB 3UVHA 3D6IA 5HR0A 2H19A 2HRNA 2FY6A 4MK3A 3ISOA 2H72A 2X8HA 1KEBA 2C3NA 2QC7A 1TK5B 1QQ2A 3DWVA 4HEA2 3GX8A 5DJMA 2IMIA 1WE0A 5DQYA 2K6VA 2GGTA 2WCIA 1BAYA 2A2PA 5FWGA 4WETA 17GSA 2VCTA 2H73A 5A4VA 1K0MA 2GVPA 3RAZA 3D4TA 3UOMA 4X43A 2FWEA 3KZQA 4JEDA 3F3RA 5IPGA 4K7NA 2DBCA 1WRYA 1HNBA 3FZAA 2XBIA 1M3IA 4X0XA 4ISDA 2HZEA 2YZHA 3GTUA 2OACA 4MCUA 4GSNA 2ES7A 4G19A 4PGTA 4TR0A 2K18A 3TJFA 2GZZA 3GSTA 2KP1A 1BEDA 4K2DA 4KA0A 5IOWA 3FMWA 1ZMAA 4IVFA 4IBPA 2VCWA 3A2VA 1NHOA 3GSSA 4GXZA 3TJKA 5ECQB 1UN2A 4ZB8A 3HVXA 4PNFA 13GSA 5IO2A 3C8EA 4MF5A 2NDOA 5ECNB 1A0FA 2FD3A 3F9UA 1O85A 3IRAA 2CQ9A 2YWOA 1JHBA 5IIZA 4K2XA 2GZYA 3HA9A 3GTUB 2JL4A 2XPEA 1OVNA 1YZXA 2D2ZA 5B7CA 3FRCA 2C0DA 5DAKA 2NTOA 1B4PA 1EV4A 1JLWA 4G2EA 1SYRA 3ERWA 3LQ7A 3WYWA 1GLQA 2GZPA 4XCSA 3IC8A 1R5AA 2AV4A 5A4WA 1GNEA 2ON7A 3F6DA 1O8WA 3LW9A 3R3EA 2DKIA 2PERA 6GSVA 3TKSC 1XW5A 4ZL7A 1ERVA 5ECHB 4POMA 2LJKA 3BBYA 4HU7A 1MDJA 1T4ZA 1TKDB 1BG5A 3HJPA 3L9UA 1PL1A 1XZOA 2X8GA 1I9DA 3HHVA 5DAKB 1WWJA 3P7XA 1I5GA 1X9MB 5IQYA 1GH2A 5CRHA 1SD9A 2IMEA 2JU5A 2XHFA 1XWCA 5AIXA 2REMA 4ZL8A 1G6YA 2C0FA 1SJZA 4HJ2A 4EVMA 4PXOA 3GMFA 3ZIJA 3G7IA 2VCVA 2PGTA 4L0WA 4GF0A 4LLRA 1NSWA 4XS6A 2LRNA 4KAEA 4A5PA 4IHUA 1OC9A 1DBYA 3LGCA 1FAAA 2A4HA 4TR3A 4ECIA 3WD6A 2B1LA 1YJ6A 4GSTA 2X64A 2HNLA 3TKQA 2R0PA 1T3BA 4POKA 4TR1B 3J7Yk 2HSMA 3HKRA 3G7YA 5D9WA 1TOFA 1SJ6A 4F9ZA 2WZ9A 1YDKA 4JE1A 1YQ1A 3D5JA 4V1Ap 2O89A 5A5KA 1XWGA 2H66A 1LJRA 2L4QA 3FHKA 2IMKA 5HR2A 2K8VA 2H6YA 2EIOA 3RHCA 1OC9B 3FY7A 5GSSA 2VUPA 1EP8A 2MMAA 3IV4A 5CREA 3QAGA 4G9HA 4KDYA 5AISA 4IELA 2DMMA 3GKNA 1R4WA 1FB0A 2BTOT 3DGQA 1K3OA 3H8QA 5CO3A 5ECSA 1YEPA 4TXVA 3HDCA 4HZ4A 3APQA 16GSA 3M1GA 1ZYNA 3LFLA 4PTSA 3UBLA 4BIKA 2R37A 1ZYQB 3KTBA 4AJ7A 4N11A 2LJRA 2N5FA 1YKCA 3FR3A 4AJ6A 1XWAA 2FCHA 4K0GA 4L0UA 2QKEA 2VO4A 3ZFLA 4BL7B 5ECIB 4IQ1A 4WEYA 3QFBC 2I3YA 2FWGA 3QFAC 1YEXA 5H5RA 4PNGA 3U6VA 3FZ5A 5HR1A 2VL9A 2P5QA 2WB9A 1K0AA 4ILFA 3C1RA 3A2XA 3GL5A 4POLA 1PKZA 1QGVA 1QUWA 1OKDA 4WR5A 1Z5YE 4XS4A 4MJBA 1M7TA 5G31A 1GWCA 3TOUA 3LWAA 4KDUA 4RQXA 4PQ1A 3VI5A 4BWSA 2FA8A 4TKYA 3P8WA 3TDGA 4IJ3A 3CSJA 4MABA 3HD5A 9GSSA 1BQ7A 3TRPA 5IMAA 3KIJA 4XIHA 4GTUA 3V1WA 1B9XC 3APSA 2VAFA 3US3A 2LRTA 2HFDA 3UJ1A 3W6GA 4GQCA 2FUG2 4OO4A 1GSDA 3IR4A 1A24A 2B1KA 1XG8A 3QAVA 3G7JA 3RPNA 4MZWA 2X99A 1HNAA 1USBA 3VWVA 4YH2A 4XS4B 4ECCA 4BWQA 1ZYEA 4ID0A 1T00A 5CRWA 4Z2RA 5G1KA 1AW9A 1U6TA 1K0DA 1LBKA 4I97A 3FR9A 4K8MA 4ICYA 1H75A 2TIRA 2X49A 4TN8A 1S3RA 4Q5RA 5AGYA 4ML1A 2VIMA 4O5QA 2AHEA 1SL0B 5COHA 2R0GA 2GT6A 3HZ4A 2BJXA 4L5LA 3HXSA 1U3AA 4Z7XA 1M2AA 1X9SB 2MZCA 2QSIA 1M0UA 4LMVA 3CQFA 2OJLA 3HCZA 1XOBA 3UBKA 3ZZXA 4HZ2A 3ZREA 4O92A 1JZWA 2O85A 4KCEA 4EDYA 2YV7A 4MNNA 1FHEA 1GUKA 2HRAA 1OC3A 5J5NA 3ZL5A 3KMNA 1TW9A 3PR8A 4MZBA 1JLVA 1N2AA 2CAIA 2AYTA 1EZKA 2LKUA 1XIYA 4WF5A 5AN1A 4LA1A 2B5YA 1EWXA 1SK1A 1IYHA 4F82A 1TU7A 3QCPA 3VWUA 4HI7A 2CZ2A 3H93A 3I6AA 1ILOA 2LNTA 5KOWA 3P90A 1GTUA 3HY2A 4MMMA 2VD1A 3KCMA 1SKRB 4NHWA 2VM1A 4MP4A 4DEJA 1F3AA 1DSBA 5L71A 1FG4A 3DEXA 2DJ2A 4O32A 5CAXA 3NIVA 4CY8A 1PSQA 5ECMB 3KD0A 3A5WA 4FYBA 2P5RA 3QD9A 4XRDA 2PU9C 2CVKA 4MJAA 2J9HA 1M2BA 4J56E 1GULA 5CP1A 1M2DA 5ELGA 3GA4A 2DSAA 2ZCTA 3VPTA 2BMXA 4GQFA 5G2ZA 1OE7A 2HSYA 4MPGA 4E8EA 3TGZA 1S3DA 5B8BA 2YANA 3E3EA 3EURA 4YAPA 1F3BA 3IDVA 1R26A 3FKFA 3EWLA 3TB2A 1BX9A 4N0VA 5D73A 3CYNA 3GV1A 3SWLA 2GS3A 2GT5A 4ZB6A 2OBKA 2VL3A 3UL3A 3UAPA 4JZQA 4LMWA 1LU4A 4YQMA 2H0IA 1X5DA 4IKHA 1J0FA 4Q5NA 3QDNA 3IHGA 2KP2A 1SKWB 4TW5A 2LS5A 2JZRA 1XPVA 4V2NA 2DJJA 4ZILA 1GP1A 3LYPA 1PD21 1SU9A 1DE2A 1V98A 1FOVA 3HVVA 1Z6MA 5C04A 2F8AA 4HQZA 2M46A 3E9JB 4KCAA 1TTZA 4WBRD 1T4YA 4KB3A 2CZ3A 1EGOA 2JZSA 1GSQA 3DRNA 2HSHA 1SL2B 4EC0A 1A2MA 6GSUA 2QA2A 2OKAA 5B6NA 4HOJA 1TRVA 4K0NA 1Q4JA 3IC4A 11GSA 2ALBA 3F0IA 2ON5A 3GIXA 4I5QA 1ZGNA 4IS0A 1X5CA 3WGXA 1M99A 4IP6A 2G0FA 1S3AA 1XVWA 2V1MA 1VF4A 2JSZA 2M80A 2V2GA 4IGJA 2NBSA 4ZL9A 2C3TA 2HE3A 1VF1A 1TK0B 3FZ4A 4IP1A 4EXJA 4EL1A 1KTEA 1XW9A 1M3JA 4TR4A 2HZEB 3VFIA 1ML6A 4G0KA 5IMFA 3HJMA 3MSZA 3MIXA 4AF2A 1X9WB 2MBTA 1RK4A 4XS1A 3NOFA 4YQVA 1EGRA 2WULA 1EV9A 2HRFA 1AXDA 2OE3A 5AIVA 3GFKA 4PQHA 3FK8A 5IMVA 1K0CA 3E0UA 3I69A 5HFKA 1FW1A 1PX6A 4G10A 5J9BA 3HVSA 5KN1A 1THOA 5IM9A 2PPTA 10GSA 2K8SA 2H1BA 4IW9A 4MPFA 4OFNA 3F4SA 2H75A 2L4CA 1EEJA 3GL3A 4CW9A 5IMCA 1GTBA 2B7JA 3DYRA 3F8UA 3ZTLA 3HVNA 1GSFA 3DD3A 4Z2TA 4G0LA 4EO3A 5ECOB 4FO5A 5IOXA 4F0BA 3QR6A 2R0CA 2I1UA 3R2QA 2H0GA 3F6FA 4TRXA 7GSSA 3IHQA 1QK8A 1PN9A 2LV3A 2NPBA 2VCXA 5HQPA 4WBJA 2LNSA 2YWIA 3O76A 1X0RA 2EIQA 1YY7A 2HZFA 2YOIA 2IN3A 1GRXA 5HFIA 3GH6A 4FH8A 5H5QA 4BVYA 3G9BA 2VLVA 3ZLPA 2KUCA 1U87A 3TKRA 4OCFA 5B6MA 1EEMA 4K7OA 5D9TA 2YP6A 4E8HA 2C0GA 5DQSA 4DSSA 2UZ8A 3M0FA 1MD3A 2GSQA 5FHIA 5ECRB 2TRXA 2LJAA 3CSIA 2LQOA 4NXIA 4N10A 2C0EA 1F2EA 3KM6A 3L9SA 1GTIA 2H1DA 4OFTA 3GURA 3GRXA 3EC3A 4Z2UA 4O7HA 2H0HA 2FHEA 3TJBA 2WRTA 2YN1A 3TJGA 4YKGA 4KE3A 4CY6A 5G30A 1T8EB 4HQSA 1O7UA 5E4WA 2H1GA 1NM3A 1WMJA 2KLXA 6GSWA 3PH9A 3MYDA 4V1Ag 3CRUA 4K5SA 3IPZA 3WT1A 1PX7A 5DJLA 3L0HA 1V57A 2E7PA 2MMOA 4NV2A 5JCUA 1ON4A 2LTKA 2GDRA 1JZOA 2K9FA 3CSHA 4FYUA 3WGEA 1WIKA 5D93A 2B5XA 4WR4A 4GLTA 2C3QA 1Q98A 1SKSB 1ABAA 2RM5A 4PURA 3D21A 2R5GA 5EPFA 3AY8A 5D9VA 4K6XA 3ED3A 5ECPB 3O6TA 2FWFA 4BA7A 5J4UA 5ELAA 4I2TA 2LUSA 2VD0A 3IBHA 5ECKB 3OR5A 1XWKA 1JZDA 3EPTA 2I4AA 5E59A 1A2LA 5H5SA 3CBUA 4JRRA 1EOGA 1JFUA 4JR4A 1FVJA 3DXBA 2XC2A 3Q19A 4K1FA 1V40A 1PMTA 2QGVA 2PVOC 2IFQA 2AUVA 4L5OA 4N0ZA 3TRXA 3KGKA 4TXOA 4MF7A 3I43A 2L5LA 4EIPA 1CQGA 1FVKA 3O3TA 3F3QA 2H76A 3TOTA 1K0NA 3J7Yb 2YJHA 2H74A 4BVXA 1SK2A 3IK9A 1MDIA 4KUNA 4NHZA 2IPAA 2FLSA 5ECLB 3ERGA 1Z9HA 4RI7A 2A2SA 5KN0A 3QPMA 4JR6A 2IFQB 18GSA 2PUKC 1MD4A 2EC4A 3VURA 19GSA 2GSTA 3ZYWA 2C80A 3H1NA 4TXOB 4NMUA 3DIEA 2LEGA 1YF1A 20GSA 1C72A 1OAZA 2F51A 2YWMA 5JCWA 5IO0A 5JCGA 1Z6NA 2WJUA 4H86A 1TK8B 2VOCA 5DALA 5B8AA 1PA3A 2L59A 5ID2A 3GH9A 4EF0A 1ERTA 3UVTA 4KF9A 4EDZA 3MDKA 1ERWA 4MH2A 2RM6A 2VL2A 2G2QA 3PPUA 2X8CA 1T1VA 4HUAA 1K0BA 4X4JA 2FGXA 5ENUA 4POBA 2I81A 4F03A 22GSA 4KW6A 3TUEA 2H01A 1O73A 4TVEA 3GKXA 1PN0A 2TRCP 4Q5QA 3LXZA 1B48A 1ZL9A 2L6CA 4CHSA 4OMVA 3N9JA 1G7OA 3ZIVA 2DJ0A 2E2GA 4X1UA 2VM2A 1G0TA 4QL7A 3RDWA 2PVQA 1AQXA 1GTAA 5F05A 3GYKA 1T7PB 4PUAA 1A2JA 3ZFBA 1QXHA 2VLUA 4USSA 4XHMA 3ZVJA 3MAKA 2R4VA 4JBBA 2N5BA 4YQUA 4FIWA 2M72A 2PWJA 2XBQA 1TI1A 1URMA 2HLSA 3K8NA 2YWNA 2A4VA 4KSMA 2GQLA 4I6XA 5KN3A 1TP9A 3UEMA 3TKSE 1UC7A 1GLPA 5IMDA 1NW2A 3KJYA 4O5UA 2DJ3A 2IMFA 4N30A 1FB6A 3RBTA 4KH7A 5EY6A 4HU9A 5INYA 2KHPA 3IXRA 3N5OA 4Q5FA 1ZYPA 2OE1A 2H1AA 3KH7A 2AJQB 3F4RA 1AIUA 5D9XA 2IJYA 5HFGA 1XCCA 2FA4A 4YKFA 5EVOA 1O8XA 3KXOA 2CVDA 1DUGA 4ZBDA 4V2MA 1XXUA 2V6KA 4FYCA 1PL2A 1R5PA 5C00A 4GWRA 2F9SA 1A8LA 5J41A 1XBSA 2A2RA 5D96A 1PRXA 2WDUA 1TJDA 3U5RE 3HYPA 1CQHA 4HDEA 6GSTA 2V32A 1KNGA 1J9BA 2V6OA 1M9BA 1NHYA 3WGDA 3QOUA 3TKPA 1UA5A 1VF2A 3CXGA 2H30A 2MBSA 4FQUA 2AAWA 4MJEA 4HJMA 4ECJA 4I8BA 4ACSA 2H71A 1MEKA 1Z7RA 3P2AA 3MWHA 2IMDA 2DIZA 3D0ZA 4LL1B 4AGSA 2GQMA 1B8XA 1U88A 5J9CA 2YCDA 1AUCA 1VRSD 4L8EA 3SBCA 3CTFA 1O81A 2RUFA 3KH9A 2Z9SA 3Q18A 5ABRA 3W8JA 3BD2A 3C1SA 4GSSA 5FT3A 3ZVJD 3W8SA 1QMVA 1HYUA 3LEFA 1XW6A 3F4TA 2R2JA 2GSSA 2WS2A 3ME7A 1TI3A 4PQIA 1GSSA 2RLIA 1HQOA 5D8IA 1AC1A 5JWQB 5LD0A 3EYTA 2IL3A 2YZUA 3GHAA 2YPMA 1X5EA 5JWOB 1THXA 3CTGA 1F6MC 3FYGA 4MDCA 4YAVA 1FOHA 3LXTA 2I9HA 2C8UA 2ZUPA 2DC5A 1YF0A 4GCIA 3VK9A 3QMXA 3A2WA 3TJJA 1XWBA 4O5RA 3FZ9A 2CX3A 5DVBA 1TDIA 4GRFA 1TXXA 3L78A 2H70A 5GAPD 3WT2A 4EIQA 2KOKA 5KOXA 3M9KA 1SYXA 5F0GA 2DJKA 1GNWA 3FEUA 4DSRA 1V58A 3GX0A 2XPDA 1OE8A 5DDLA 3KP9A 1KBNA 3VPQA 3EMXA 4OD7A 1ZCPA 4MLYA 1G7EA 4OFMA 3GKKA 3BOAA 3IAS2 5JWRB 2RUEA 1EP7A 2CV4A 3L9VA 4DVCA 4CDOA 1Y6EA 2MYGA 3VLNA 2R6KA 3IK7A 2C4JA 3TCOA 3QAWA 1ST9A 2X4AA 2GSRA 4TR1A 3M8NA 2DKHA 1AQVA 8GSSA 3ZRDA 3CMIA 1WPIA 4KX4A 1ACVA 5LNKe 3VWWA 3D4MA 4BPYA 2V41A 3LJRA 4RQRA 2VCZA 2VCQA 3EMPA 1B4QA 4HSCX 2PMTA 2OBIA 1E6BA 1EOHA 1WJKA 4MH3A 1PFOA 1VGLA 3FR6A 4XRAA 3KMOA 1QFNA 6GSXA 5BMUA 1OYJA 1Z3EA 5DCHA 1W4VA 2R3XA 4DSQA 1O6JA 1Y25A 3VI7A 2VL2C 3LORA 5GSTA 5GZZB 4MZCA 3ZITA 1Z7PA 4BVYB 1MDKA 3M9JA 3GN3A 3JCML 2P0GA 3H79A 2B6MA 2JACA 1ZZYA 2LRCA 1RW1A 4DSSB 1BYEA 1E2YA 3EU4A 4BL7A 2L57A 3BCIA 6GSSA 2IWTA 2J23A 2L5OA 2OADA 2JADA 2O87A 2F8FA 3DVXA 4KDXA 2FNOA 2QA1A 5CRDA 3LSZA 4IQAA 3ZMLA 4KGIA 4V2LA 2P31A 1RQMA 3Q6OA 4NPBA 3APOA 2B3SA 1OC8A 1PGTA 1SENA 3L4NA 2CVBA 2H6XA 2AB6A 4F0CA 1VF3A 3VWXA 1FO5A 4D73A 3S9FA 1M9AA 2B5EA 2HI7A 3EU3A 3DVWA 4RI6A 3UIWA 1SJIA 5G5EA 4ZBBA 3KP8A 2E2MA 3C7MA 4WKWA 4MF6A 3A5IA 1GUMA 3UMAA 1K0OA 4IJIA 5HR3A 1TRUA 4KSOA 4OO5A 2JSYA 1W89A 2IIYA 4NV5A 5A4UA 2O8VB 1H4OA 3LYKA 5EL8A 2GTUA 1K3LA 2GQKA 1SL1B 1SK0A 2OE0A 2GLRA 1GSEA 4ML6A 4D73B 3RHBA 3TKSA 1GSUA 4EE0A 3LG6A 2L6DA 4MA9A 2LQQA 1SD8A 3KEBA 3IAM2 6GSYA 5DCGA 4ZB9A 4I2UA 2OA7A 2H8LA 5F07A 1HNCA 3CRTA 4QQ7A 2C1YA 1IYIA 4ZIJA 4PX1A 3RPPA 4KNDA 1AAZA 4OWYA 14GSA 3HJOA 5CRGA 1A23A 5BRTA 4WXTA 1DE1A 2WFCA 2HRKA 4ULXA 4OCEA 3PINA 1A8YA 2PN8A 5G5FA 3F63A 2JZTA 4NAXA 3D22A 1JZRA 3GKMA 2H6ZA 1WP0A
chains in the Genus database with same CATH topology
1S3CA 4ZXGA 2RIIA 4NWYA 4K5RA 3C73A 3KTLA 4BVXB 1MTCA 5G1LA 3PGTA 2EIRA 3I9V2 1TU8A 5IPHA 12GSA 3BCKA 3ME8A 3EE2A 5DBQA 1F9MA 1K3YA 1N8JA 3IOSA 3IA1A 2CT6A 1A0RP 2E0QA 1AQWA 3NZNA 4J57E 2DIYA 3FW2A 1OKTA 3H4KA 3MNGA 4MJCA 3IE3A 5CYYA 2YNXA 5KEJA 3DMLA 2CA8A 4IN0A 1GL8A 2DJ1A 1UVZA 1V9WA 1F37A 1XOAA 4RUVA 4K7IA 1PKWA 2MMNA 4K9ZA 2N5AA 1ERUA 2CAQA 1R7HA 1ZOFA 5DALB 3M3MA 2MMZA 3EVIA 5ID2B 1BJXA 4TOPA 1TRSA 2PBJA 1XFLA 2HT9A 1PQNA 4JU5A 1U3IA 3Q74A 2LSTA 4J2FA 2NVLA 1WOUA 3ZMKA 1HD2A 1YKAA 3UARA 5J3RA 1G6WA 4QL9A 3DKSA 4HS1A 2HYXA 3EINA 4LL4B 5CNWA 2F3MA 4EUYA 2DMLA 4ECBA 3GNJA 4PUFC 5GAND 2VLTA 2CX4A 5LCZA 3GUSA 1XVQA 1V2AA 3A3TA 5KN2A 5F8BA 2YJ7A 4XTSA 2HXKA 1B9YC 4F2IA 4ZBAA 4AJ8A 3HZ8A 2DLXA 4EKZA 4G0IA 3TRQA 5IMZA 3ERFA 2FWHA 3BJ5A 4WF4A 1GUHA 1GSYA 2O7KA 2ZNMA 2WGRA 1J08A 2B7KA 2YV9A 3C71A 1TRWA 5F06A 4P3YB 3UVHA 3D6IA 5HR0A 2H19A 2HRNA 2FY6A 4MK3A 3ISOA 2H72A 2X8HA 1KEBA 2C3NA 2QC7A 1TK5B 1QQ2A 3DWVA 4HEA2 3GX8A 5DJMA 2IMIA 1WE0A 5DQYA 2K6VA 2GGTA 2WCIA 1BAYA 2A2PA 5FWGA 4WETA 17GSA 2VCTA 2H73A 5A4VA 1K0MA 2GVPA 3RAZA 3D4TA 3UOMA 4X43A 2FWEA 3KZQA 4JEDA 3F3RA 5IPGA 4K7NA 2DBCA 1WRYA 1HNBA 3FZAA 2XBIA 4X0XA 4ISDA 2HZEA 2YZHA 3GTUA 2OACA 4MCUA 4GSNA 2ES7A 4G19A 4PGTA 4TR0A 2K18A 3TJFA 2GZZA 3GSTA 2KP1A 1BEDA 4K2DA 4KA0A 5IOWA 3FMWA 1ZMAA 4IVFA 4IBPA 2VCWA 3A2VA 1NHOA 3GSSA 4GXZA 3TJKA 5ECQB 1UN2A 4ZB8A 3HVXA 4PNFA 13GSA 5IO2A 3C8EA 4MF5A 2NDOA 5ECNB 1A0FA 2FD3A 3F9UA 1O85A 3IRAA 2CQ9A 2YWOA 1JHBA 5IIZA 4K2XA 2GZYA 3HA9A 3GTUB 2JL4A 2XPEA 1OVNA 1YZXA 2D2ZA 5B7CA 3FRCA 2C0DA 5DAKA 2NTOA 1B4PA 1EV4A 1JLWA 4G2EA 1SYRA 3ERWA 3LQ7A 3WYWA 1GLQA 2GZPA 4XCSA 3IC8A 1R5AA 2AV4A 5A4WA 1GNEA 2ON7A 3F6DA 1O8WA 3LW9A 3R3EA 2DKIA 2PERA 6GSVA 3TKSC 1XW5A 4ZL7A 1ERVA 5ECHB 4POMA 2LJKA 3BBYA 4HU7A 1MDJA 1T4ZA 1TKDB 1BG5A 3HJPA 3L9UA 1PL1A 1XZOA 2X8GA 1I9DA 3HHVA 5DAKB 1WWJA 3P7XA 1I5GA 1X9MB 5IQYA 1GH2A 5CRHA 1SD9A 2IMEA 2JU5A 2XHFA 5AIXA 1XWCA 2REMA 4ZL8A 1G6YA 2C0FA 1SJZA 4HJ2A 4EVMA 4PXOA 3GMFA 3ZIJA 3G7IA 2VCVA 2PGTA 4L0WA 4GF0A 4LLRA 1NSWA 4XS6A 2LRNA 4KAEA 4A5PA 4IHUA 1OC9A 1DBYA 3LGCA 1FAAA 2A4HA 4TR3A 4ECIA 3WD6A 2B1LA 1YJ6A 4GSTA 2X64A 2HNLA 3TKQA 2R0PA 1T3BA 4POKA 4TR1B 3J7Yk 2HSMA 3HKRA 3G7YA 5D9WA 1TOFA 1SJ6A 4F9ZA 2WZ9A 1YDKA 4JE1A 1YQ1A 3D5JA 4V1Ap 2O89A 5A5KA 1XWGA 2H66A 1LJRA 2L4QA 3FHKA 2IMKA 5HR2A 2K8VA 2H6YA 2EIOA 3RHCA 1OC9B 3FY7A 5GSSA 2VUPA 1EP8A 2MMAA 3IV4A 5CREA 3QAGA 4G9HA 4KDYA 5AISA 4IELA 2DMMA 3GKNA 1R4WA 1FB0A 2BTOT 3DGQA 1K3OA 3H8QA 5CO3A 5ECSA 1YEPA 4TXVA 3HDCA 4HZ4A 3APQA 16GSA 3M1GA 1ZYNA 3LFLA 4PTSA 3UBLA 2R37A 1ZYQB 3KTBA 4AJ7A 4N11A 2LJRA 2N5FA 1YKCA 3FR3A 4AJ6A 1XWAA 2FCHA 4K0GA 4L0UA 2QKEA 2VO4A 3ZFLA 4BL7B 5ECIB 4IQ1A 4WEYA 3QFBC 2I3YA 2FWGA 3QFAC 1YEXA 5H5RA 4PNGA 3U6VA 3FZ5A 5HR1A 2VL9A 2P5QA 2WB9A 1K0AA 4ILFA 3C1RA 3A2XA 3GL5A 4POLA 1PKZA 1QGVA 1QUWA 1OKDA 4WR5A 1Z5YE 4XS4A 4MJBA 1M7TA 5G31A 1GWCA 3TOUA 3LWAA 4KDUA 4RQXA 4PQ1A 3VI5A 4BWSA 2FA8A 4TKYA 3P8WA 3TDGA 4IJ3A 3CSJA 4MABA 3HD5A 9GSSA 1BQ7A 3TRPA 5IMAA 3KIJA 4XIHA 4GTUA 3V1WA 1B9XC 3APSA 2VAFA 3US3A 2LRTA 2HFDA 3UJ1A 3W6GA 4GQCA 2FUG2 4OO4A 1GSDA 3IR4A 1A24A 2B1KA 3QAVA 3G7JA 3RPNA 4MZWA 2X99A 1HNAA 1USBA 3VWVA 4YH2A 4XS4B 4ECCA 4BWQA 1ZYEA 4ID0A 1T00A 5CRWA 4Z2RA 5G1KA 1AW9A 1U6TA 1K0DA 1LBKA 4I97A 3FR9A 4K8MA 4ICYA 1H75A 2TIRA 2X49A 4TN8A 4Q5RA 5AGYA 4ML1A 2VIMA 4O5QA 2AHEA 1SL0B 5COHA 2R0GA 2GT6A 3HZ4A 2BJXA 4L5LA 3HXSA 1U3AA 4Z7XA 1M2AA 1X9SB 2MZCA 2QSIA 1M0UA 4LMVA 2OJLA 3HCZA 1XOBA 3UBKA 3ZZXA 4HZ2A 3ZREA 4O92A 1JZWA 2O85A 4KCEA 4EDYA 2YV7A 4MNNA 1FHEA 1GUKA 2HRAA 1OC3A 5J5NA 3ZL5A 3KMNA 1TW9A 3PR8A 4MZBA 1JLVA 1N2AA 2CAIA 2AYTA 1EZKA 2LKUA 1XIYA 4WF5A 5AN1A 4LA1A 2B5YA 1EWXA 1SK1A 1IYHA 4F82A 1TU7A 3QCPA 3VWUA 4HI7A 2CZ2A 3H93A 3I6AA 1ILOA 2LNTA 5KOWA 3P90A 1GTUA 3HY2A 4MMMA 2VD1A 3KCMA 1SKRB 4NHWA 2VM1A 4MP4A 4DEJA 1F3AA 1DSBA 5L71A 1FG4A 3DEXA 2DJ2A 4O32A 5CAXA 3NIVA 4CY8A 1PSQA 5ECMB 3KD0A 3A5WA 4FYBA 2P5RA 3QD9A 4XRDA 2PU9C 2CVKA 4MJAA 2J9HA 1M2BA 4J56E 1GULA 5CP1A 1M2DA 5ELGA 3GA4A 2DSAA 2ZCTA 3VPTA 2BMXA 4GQFA 5G2ZA 1OE7A 2HSYA 4MPGA 4E8EA 3TGZA 1S3DA 5B8BA 2YANA 3E3EA 3EURA 4YAPA 1F3BA 3IDVA 1R26A 3FKFA 3EWLA 3TB2A 1BX9A 4N0VA 5D73A 3CYNA 3GV1A 3SWLA 2GS3A 2GT5A 4ZB6A 2OBKA 2VL3A 3UL3A 3UAPA 4JZQA 4LMWA 1LU4A 4YQMA 2H0IA 1X5DA 4IKHA 1J0FA 4Q5NA 3QDNA 3IHGA 2KP2A 1SKWB 4TW5A 2LS5A 2JZRA 1XPVA 4V2NA 2DJJA 4ZILA 1GP1A 3LYPA 1PD21 1SU9A 1DE2A 1V98A 1FOVA 3HVVA 1Z6MA 5C04A 2F8AA 4HQZA 2M46A 3E9JB 4KCAA 1TTZA 4WBRD 1T4YA 4KB3A 2CZ3A 1EGOA 2JZSA 1GSQA 3DRNA 2HSHA 1SL2B 4EC0A 1A2MA 6GSUA 2QA2A 2OKAA 5B6NA 4HOJA 1TRVA 4K0NA 1Q4JA 3IC4A 11GSA 2ALBA 3F0IA 2ON5A 3GIXA 4I5QA 1ZGNA 4IS0A 1X5CA 3WGXA 1M99A 4IP6A 2G0FA 1S3AA 1XVWA 2V1MA 1VF4A 2JSZA 2M80A 2V2GA 4IGJA 2NBSA 4ZL9A 2C3TA 2HE3A 1VF1A 1TK0B 3FZ4A 4IP1A 4EXJA 4EL1A 1KTEA 1XW9A 4TR4A 2HZEB 3VFIA 1ML6A 4G0KA 5IMFA 3HJMA 3MSZA 3MIXA 4AF2A 1X9WB 2MBTA 1RK4A 4XS1A 3NOFA 4YQVA 1EGRA 2WULA 1EV9A 2HRFA 1AXDA 2OE3A 5AIVA 3GFKA 4PQHA 3FK8A 5IMVA 1K0CA 3E0UA 3I69A 5HFKA 1FW1A 1PX6A 4G10A 5J9BA 3HVSA 5KN1A 1THOA 5IM9A 2PPTA 10GSA 2K8SA 2H1BA 4IW9A 4MPFA 4OFNA 3F4SA 2H75A 2L4CA 1EEJA 3GL3A 4CW9A 5IMCA 1GTBA 2B7JA 3DYRA 3F8UA 3ZTLA 1GSFA 3DD3A 4Z2TA 4G0LA 4EO3A 5ECOB 4FO5A 5IOXA 4F0BA 3QR6A 2R0CA 2I1UA 3R2QA 2H0GA 3F6FA 4TRXA 7GSSA 3IHQA 1QK8A 1PN9A 2LV3A 2NPBA 2VCXA 5HQPA 4WBJA 2LNSA 2YWIA 3O76A 1X0RA 2EIQA 1YY7A 2HZFA 2YOIA 2IN3A 1GRXA 5HFIA 3GH6A 4FH8A 5H5QA 4BVYA 3G9BA 2VLVA 3ZLPA 2KUCA 1U87A 3TKRA 4OCFA 5B6MA 1EEMA 4K7OA 5D9TA 2YP6A 4E8HA 2C0GA 5DQSA 4DSSA 2UZ8A 3M0FA 1MD3A 2GSQA 5FHIA 5ECRB 2TRXA 2LJAA 3CSIA 2LQOA 4NXIA 4N10A 2C0EA 1F2EA 3KM6A 3L9SA 1GTIA 2H1DA 4OFTA 3GURA 3GRXA 3EC3A 4Z2UA 4O7HA 2H0HA 2FHEA 3TJBA 2WRTA 2YN1A 3TJGA 4YKGA 4KE3A 4CY6A 5G30A 1T8EB 4HQSA 1O7UA 5E4WA 2H1GA 1NM3A 1WMJA 2KLXA 6GSWA 3PH9A 3MYDA 4V1Ag 3CRUA 4K5SA 3IPZA 3WT1A 1PX7A 5DJLA 3L0HA 1V57A 2E7PA 2MMOA 4NV2A 5JCUA 1ON4A 2LTKA 2GDRA 1JZOA 2K9FA 3CSHA 4FYUA 3WGEA 1WIKA 5D93A 2B5XA 4WR4A 4GLTA 2C3QA 1Q98A 1SKSB 1ABAA 2RM5A 4PURA 3D21A 2R5GA 5EPFA 3AY8A 5D9VA 4K6XA 3ED3A 5ECPB 3O6TA 2FWFA 4BA7A 5J4UA 5ELAA 4I2TA 2LUSA 2VD0A 3IBHA 5ECKB 3OR5A 1XWKA 1JZDA 3EPTA 2I4AA 5E59A 1A2LA 5H5SA 3CBUA 4JRRA 1EOGA 1JFUA 4JR4A 1FVJA 3DXBA 2XC2A 3Q19A 4K1FA 1V40A 1PMTA 2QGVA 2PVOC 2IFQA 2AUVA 4L5OA 4N0ZA 3TRXA 3KGKA 4TXOA 4MF7A 3I43A 2L5LA 4EIPA 1CQGA 1FVKA 3O3TA 3F3QA 2H76A 3TOTA 1K0NA 3J7Yb 2YJHA 2H74A 4BVXA 1SK2A 3IK9A 1MDIA 4KUNA 4NHZA 2IPAA 2FLSA 5ECLB 3ERGA 1Z9HA 4RI7A 2A2SA 5KN0A 3QPMA 4JR6A 2IFQB 18GSA 2PUKC 1MD4A 2EC4A 3VURA 19GSA 2GSTA 3ZYWA 2C80A 3H1NA 4TXOB 4NMUA 3DIEA 2LEGA 1YF1A 20GSA 1C72A 1OAZA 2F51A 2YWMA 5JCWA 5IO0A 5JCGA 1Z6NA 2WJUA 4H86A 1TK8B 2VOCA 5DALA 5B8AA 1PA3A 2L59A 5ID2A 3GH9A 4EF0A 1ERTA 3UVTA 4KF9A 4EDZA 3MDKA 1ERWA 4MH2A 2RM6A 2VL2A 2G2QA 3PPUA 2X8CA 1T1VA 4HUAA 1K0BA 4X4JA 2FGXA 5ENUA 4POBA 2I81A 4F03A 22GSA 4KW6A 3TUEA 2H01A 1O73A 4TVEA 3GKXA 1PN0A 2TRCP 4Q5QA 3LXZA 1B48A 1ZL9A 2L6CA 4CHSA 4OMVA 3N9JA 1G7OA 3ZIVA 2DJ0A 2E2GA 4X1UA 2VM2A 1G0TA 4QL7A 3RDWA 2PVQA 1AQXA 1GTAA 5F05A 3GYKA 1T7PB 4PUAA 1A2JA 3ZFBA 1QXHA 2VLUA 4USSA 4XHMA 3ZVJA 3MAKA 2R4VA 4JBBA 2N5BA 4YQUA 4FIWA 2M72A 2PWJA 2XBQA 1TI1A 1URMA 2HLSA 3K8NA 2YWNA 2A4VA 4KSMA 2GQLA 4I6XA 5KN3A 1TP9A 3UEMA 3TKSE 1UC7A 1GLPA 5IMDA 1NW2A 3KJYA 4O5UA 2DJ3A 2IMFA 4N30A 1FB6A 3RBTA 4KH7A 5EY6A 4HU9A 5INYA 2KHPA 3IXRA 3N5OA 4Q5FA 1ZYPA 2OE1A 2H1AA 3KH7A 2AJQB 3F4RA 1AIUA 5D9XA 2IJYA 5HFGA 1XCCA 2FA4A 4YKFA 5EVOA 1O8XA 3KXOA 2CVDA 1DUGA 4ZBDA 4V2MA 1XXUA 2V6KA 4FYCA 1PL2A 1R5PA 5C00A 4GWRA 2F9SA 1A8LA 5J41A 1XBSA 2A2RA 5D96A 1PRXA 2WDUA 1TJDA 3U5RE 3HYPA 1CQHA 4HDEA 6GSTA 2V32A 1KNGA 1J9BA 2V6OA 1M9BA 1NHYA 3WGDA 3QOUA 3TKPA 1UA5A 1VF2A 3CXGA 2H30A 2MBSA 4FQUA 2AAWA 4MJEA 4HJMA 4ECJA 4I8BA 4ACSA 2H71A 1MEKA 1Z7RA 3P2AA 3MWHA 2IMDA 2DIZA 3D0ZA 4LL1B 4AGSA 2GQMA 1B8XA 1U88A 5J9CA 2YCDA 1AUCA 1VRSD 4L8EA 3SBCA 3CTFA 1O81A 2RUFA 3KH9A 2Z9SA 3Q18A 5ABRA 3W8JA 3BD2A 3C1SA 4GSSA 5FT3A 3ZVJD 3W8SA 1QMVA 1HYUA 3LEFA 1XW6A 3F4TA 2R2JA 2GSSA 2WS2A 3ME7A 1TI3A 4PQIA 1GSSA 2RLIA 1HQOA 5D8IA 1AC1A 5JWQB 5LD0A 3EYTA 2IL3A 2YZUA 3GHAA 2YPMA 1X5EA 5JWOB 1THXA 3CTGA 1F6MC 3FYGA 4MDCA 4YAVA 1FOHA 3LXTA 2I9HA 2C8UA 2ZUPA 2DC5A 1YF0A 4GCIA 3VK9A 3QMXA 3A2WA 3TJJA 1XWBA 4O5RA 3FZ9A 2CX3A 5DVBA 1TDIA 4GRFA 1TXXA 3L78A 2H70A 5GAPD 3WT2A 4EIQA 2KOKA 5KOXA 3M9KA 1SYXA 5F0GA 2DJKA 1GNWA 3FEUA 4DSRA 1V58A 3GX0A 2XPDA 1OE8A 5DDLA 3KP9A 1KBNA 3VPQA 3EMXA 4OD7A 1ZCPA 4MLYA 1G7EA 4OFMA 3GKKA 3BOAA 3IAS2 5JWRB 2RUEA 1EP7A 2CV4A 3L9VA 4DVCA 4CDOA 1Y6EA 2MYGA 3VLNA 2R6KA 3IK7A 2C4JA 3TCOA 3QAWA 1ST9A 2X4AA 2GSRA 4TR1A 3M8NA 2DKHA 1AQVA 8GSSA 3ZRDA 3CMIA 1WPIA 4KX4A 1ACVA 5LNKe 3VWWA 3D4MA 4BPYA 2V41A 3LJRA 4RQRA 2VCZA 2VCQA 3EMPA 1B4QA 2PMTA 2OBIA 1E6BA 1EOHA 1WJKA 4MH3A 1VGLA 3FR6A 4XRAA 3KMOA 1QFNA 6GSXA 5BMUA 1OYJA 1Z3EA 5DCHA 1W4VA 2R3XA 4DSQA 1O6JA 1Y25A 3VI7A 2VL2C 3LORA 5GSTA 5GZZB 4MZCA 3ZITA 1Z7PA 4BVYB 1MDKA 3M9JA 3GN3A 3JCML 2P0GA 3H79A 2B6MA 2JACA 1ZZYA 2LRCA 1RW1A 4DSSB 1BYEA 1E2YA 3EU4A 4BL7A 2L57A 3BCIA 6GSSA 2IWTA 2J23A 2L5OA 2OADA 2JADA 2O87A 2F8FA 3DVXA 4KDXA 2FNOA 2QA1A 5CRDA 3LSZA 4IQAA 3ZMLA 4KGIA 4V2LA 2P31A 1RQMA 3Q6OA 4NPBA 3APOA 2B3SA 1OC8A 1PGTA 1SENA 3L4NA 2CVBA 2H6XA 2AB6A 4F0CA 1VF3A 3VWXA 1FO5A 4D73A 3S9FA 1M9AA 2B5EA 2HI7A 3EU3A 3DVWA 4RI6A 3UIWA 1SJIA 5G5EA 4ZBBA 3KP8A 2E2MA 3C7MA 4WKWA 4MF6A 3A5IA 1GUMA 3UMAA 1K0OA 4IJIA 5HR3A 1TRUA 4KSOA 4OO5A 2JSYA 1W89A 2IIYA 4NV5A 5A4UA 2O8VB 1H4OA 3LYKA 5EL8A 2GTUA 1K3LA 2GQKA 1SL1B 1SK0A 2OE0A 2GLRA 1GSEA 4ML6A 4D73B 3RHBA 3TKSA 1GSUA 4EE0A 3LG6A 2L6DA 4MA9A 2LQQA 1SD8A 3KEBA 3IAM2 6GSYA 5DCGA 4ZB9A 4I2UA 2OA7A 2H8LA 5F07A 1HNCA 3CRTA 4QQ7A 2C1YA 1IYIA 4ZIJA 4PX1A 3RPPA 4KNDA 1AAZA 4OWYA 14GSA 3HJOA 5CRGA 1A23A 5BRTA 4WXTA 1DE1A 2WFCA 2HRKA 4ULXA 4OCEA 3PINA 1A8YA 2PN8A 5G5FA 3F63A 2JZTA 4NAXA 3D22A 1JZRA 3GKMA 2H6ZA 1WP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S3C A;  4ZXG A;  2RII A;  4NWY A;  3C73 A;  3KTL A;  1MTC A;  5G1L A;  3PGT A;  2EIR A;  3I9V 2;  1TU8 A;  5IPH A;  12GS A;  3BCK A;  3ME8 A;  3EE2 A;  5DBQ A;  1F9M A;  1K3Y A;  1N8J A;  3IOS A;  3IA1 A;  2CT6 A;  1A0R P;  2E0Q A;  1AQW A;  3NZN A;  4J57 E;  2DIY A;  3FW2 A;  1OKT A;  3H4K A;  3MNG A;  4MJC A;  3IE3 A;  5CYY A;  2YNX A;  5KEJ A;  3DML A;  2CA8 A;  4IN0 A;  1GL8 A;  2DJ1 A;  1UVZ A;  1V9W A;  1F37 A;  1XOA A;  4RUV A;  4K7I A;  1PKW A;  2MMN A;  4K9Z A;  2N5A A;  1ERU A;  2CAQ A;  1R7H A;  1ZOF A;  5DAL B;  3M3M A;  2MMZ A;  3EVI A;  5ID2 B;  1BJX A;  4TOP A;  1TRS A;  2PBJ A;  1XFL A;  2HT9 A;  1PQN A;  4JU5 A;  1U3I A;  3Q74 A;  2LST A;  4J2F A;  2NVL A;  1WOU A;  3ZMK A;  1HD2 A;  1YKA A;  3UAR A;  5J3R A;  1G6W A;  4QL9 A;  3DKS A;  4HS1 A;  2HYX A;  3EIN A;  4LL4 B;  5CNW A;  2F3M A;  4EUY A;  2DML A;  4ECB A;  3GNJ A;  4PUF C;  5GAN D;  2VLT A;  2CX4 A;  5LCZ A;  3GUS A;  1XVQ A;  1V2A A;  3A3T A;  5KN2 A;  5F8B A;  2YJ7 A;  4XTS A;  2HXK A;  1B9Y C;  4F2I A;  4ZBA A;  4AJ8 A;  3HZ8 A;  2DLX A;  4EKZ A;  3TRQ A;  5IMZ A;  3ERF A;  2FWH A;  3BJ5 A;  4WF4 A;  1GUH A;  1GSY A;  2O7K A;  2ZNM A;  2WGR A;  1J08 A;  2B7K A;  2YV9 A;  3C71 A;  1TRW A;  5F06 A;  4P3Y B;  3UVH A;  3D6I A;  5HR0 A;  2H19 A;  2HRN A;  2FY6 A;  4MK3 A;  3ISO A;  2H72 A;  2X8H A;  1KEB A;  2C3N A;  2QC7 A;  1TK5 B;  1QQ2 A;  3DWV A;  4HEA 2;  3GX8 A;  5DJM A;  2IMI A;  1WE0 A;  5DQY A;  2K6V A;  2GGT A;  2WCI A;  1BAY A;  5FWG A;  4WET A;  17GS A;  2VCT A;  2H73 A;  5A4V A;  1K0M A;  2GVP A;  3RAZ A;  3D4T A;  3UOM A;  4X43 A;  2FWE A;  3KZQ A;  4JED A;  3F3R A;  5IPG A;  4K7N A;  2DBC A;  1WRY A;  1HNB A;  3FZA A;  2XBI A;  4X0X A;  4ISD A;  2HZE A;  2YZH A;  3GTU A;  2OAC A;  4MCU A;  4GSN A;  2ES7 A;  4G19 A;  4PGT A;  4TR0 A;  2K18 A;  3TJF A;  2GZZ A;  3GST A;  2KP1 A;  1BED A;  4K2D A;  4KA0 A;  5IOW A;  1ZMA A;  4IVF A;  4IBP A;  2VCW A;  3A2V A;  1NHO A;  3GSS A;  4GXZ A;  3TJK A;  5ECQ B;  1UN2 A;  4ZB8 A;  3HVX A;  4PNF A;  13GS A;  5IO2 A;  3C8E A;  4MF5 A;  2NDO A;  5ECN B;  1A0F A;  2FD3 A;  3F9U A;  1O85 A;  3IRA A;  2CQ9 A;  2YWO A;  1JHB A;  5IIZ A;  2GZY A;  3HA9 A;  3GTU B;  2JL4 A;  2XPE A;  1OVN A;  1YZX A;  2D2Z A;  5B7C A;  3FRC A;  2C0D A;  5DAK A;  2NTO A;  1B4P A;  1EV4 A;  1JLW A;  4G2E A;  1SYR A;  3ERW A;  3LQ7 A;  3WYW A;  1GLQ A;  2GZP A;  4XCS A;  1R5A A;  2AV4 A;  5A4W A;  1GNE A;  2ON7 A;  3F6D A;  1O8W A;  2PER A;  6GSV A;  3TKS C;  1XW5 A;  4ZL7 A;  1ERV A;  5ECH B;  4POM A;  2LJK A;  3BBY A;  4HU7 A;  1MDJ A;  1T4Z A;  1TKD B;  1BG5 A;  3HJP A;  3L9U A;  1PL1 A;  1XZO A;  2X8G A;  1I9D A;  3HHV A;  5DAK B;  1WWJ A;  3P7X A;  1I5G A;  1X9M B;  5IQY A;  1GH2 A;  5CRH A;  1SD9 A;  2IME A;  2JU5 A;  2XHF A;  1XWC A;  5AIX A;  2REM A;  4ZL8 A;  1G6Y A;  2C0F A;  1SJZ A;  4HJ2 A;  4EVM A;  4PXO A;  3GMF A;  3ZIJ A;  3G7I A;  2VCV A;  2PGT A;  4L0W A;  4GF0 A;  4LLR A;  1NSW A;  4XS6 A;  2LRN A;  4KAE A;  4IHU A;  1OC9 A;  1DBY A;  3LGC A;  1FAA A;  4TR3 A;  4ECI A;  3WD6 A;  2B1L A;  1YJ6 A;  4GST A;  2X64 A;  2HNL A;  3TKQ A;  1T3B A;  4POK A;  4TR1 B;  3J7Y k;  3HKR A;  3G7Y A;  5D9W A;  1TOF A;  1SJ6 A;  4F9Z A;  2WZ9 A;  1YDK A;  4JE1 A;  1YQ1 A;  3D5J A;  4V1A p;  2O89 A;  5A5K A;  1XWG A;  2H66 A;  1LJR A;  2L4Q A;  3FHK A;  2IMK A;  5HR2 A;  2K8V A;  2H6Y A;  2EIO A;  3RHC A;  1OC9 B;  3FY7 A;  5GSS A;  2VUP A;  1EP8 A;  2MMA A;  3IV4 A;  5CRE A;  3QAG A;  4G9H A;  4KDY A;  5AIS A;  4IEL A;  2DMM A;  3GKN A;  1R4W A;  1FB0 A;  2BTO T;  3DGQ A;  1K3O A;  3H8Q A;  5CO3 A;  5ECS A;  1YEP A;  4TXV A;  3HDC A;  4HZ4 A;  3APQ A;  16GS A;  3M1G A;  3LFL A;  3UBL A;  2R37 A;  1ZYQ B;  3KTB A;  4AJ7 A;  4N11 A;  2LJR A;  2N5F A;  1YKC A;  3FR3 A;  4AJ6 A;  1XWA A;  2FCH A;  4K0G A;  4L0U A;  2QKE A;  2VO4 A;  3ZFL A;  5ECI B;  4IQ1 A;  4WEY A;  3QFB C;  2I3Y A;  2FWG A;  3QFA C;  1YEX A;  5H5R A;  4PNG A;  3U6V A;  3FZ5 A;  5HR1 A;  2VL9 A;  2P5Q A;  2WB9 A;  1K0A A;  4ILF A;  3C1R A;  3A2X A;  3GL5 A;  4POL A;  1PKZ A;  1QGV A;  1QUW A;  1OKD A;  4WR5 A;  1Z5Y E;  4XS4 A;  4MJB A;  1M7T A;  5G31 A;  1GWC A;  3TOU A;  3LWA A;  4KDU A;  4RQX A;  4PQ1 A;  3VI5 A;  4BWS A;  2FA8 A;  4TKY A;  3P8W A;  3TDG A;  4IJ3 A;  3CSJ A;  4MAB A;  3HD5 A;  9GSS A;  1BQ7 A;  3TRP A;  5IMA A;  3KIJ A;  4XIH A;  4GTU A;  3V1W A;  1B9X C;  3APS A;  2VAF A;  3US3 A;  2LRT A;  2HFD A;  3UJ1 A;  3W6G A;  4GQC A;  2FUG 2;  4OO4 A;  1GSD A;  3IR4 A;  1A24 A;  2B1K A;  3QAV A;  3G7J A;  3RPN A;  4MZW A;  2X99 A;  1HNA A;  1USB A;  3VWV A;  4YH2 A;  4XS4 B;  4ECC A;  4BWQ A;  1ZYE A;  4ID0 A;  1T00 A;  5CRW A;  5G1K A;  1AW9 A;  1U6T A;  1K0D A;  1LBK A;  4I97 A;  3FR9 A;  4K8M A;  1H75 A;  2TIR A;  4TN8 A;  4Q5R A;  5AGY A;  4ML1 A;  2VIM A;  2AHE A;  1SL0 B;  5COH A;  2GT6 A;  3HZ4 A;  2BJX A;  4L5L A;  3HXS A;  1U3A A;  4Z7X A;  1M2A A;  1X9S B;  2MZC A;  2QSI A;  1M0U A;  4LMV A;  2OJL A;  3HCZ A;  1XOB A;  3UBK A;  3ZZX A;  4HZ2 A;  3ZRE A;  4O92 A;  1JZW A;  2O85 A;  4KCE A;  4EDY A;  2YV7 A;  1FHE A;  1GUK A;  1OC3 A;  5J5N A;  3ZL5 A;  3KMN A;  1TW9 A;  3PR8 A;  4MZB A;  1JLV A;  1N2A A;  2CAI A;  2AYT A;  1EZK A;  2LKU A;  1XIY A;  4WF5 A;  5AN1 A;  4LA1 A;  2B5Y A;  1EWX A;  1SK1 A;  1IYH A;  4F82 A;  1TU7 A;  3QCP A;  3VWU A;  4HI7 A;  2CZ2 A;  3H93 A;  3I6A A;  1ILO A;  2LNT A;  3P90 A;  1GTU A;  3HY2 A;  4MMM A;  2VD1 A;  3KCM A;  1SKR B;  4NHW A;  2VM1 A;  4MP4 A;  4DEJ A;  1F3A A;  1DSB A;  5L71 A;  1FG4 A;  3DEX A;  2DJ2 A;  4O32 A;  5CAX A;  3NIV A;  1PSQ A;  5ECM B;  3KD0 A;  3A5W A;  4FYB A;  2P5R A;  3QD9 A;  4XRD A;  2PU9 C;  2CVK A;  4MJA A;  2J9H A;  1M2B A;  4J56 E;  1GUL A;  5CP1 A;  1M2D A;  5ELG A;  3GA4 A;  2DSA A;  2ZCT A;  3VPT A;  2BMX A;  4GQF A;  5G2Z A;  1OE7 A;  2HSY A;  4MPG A;  4E8E A;  3TGZ A;  1S3D A;  5B8B A;  2YAN A;  3E3E A;  3EUR A;  4YAP A;  1F3B A;  3IDV A;  1R26 A;  3FKF A;  3EWL A;  3TB2 A;  1BX9 A;  4N0V A;  5D73 A;  3CYN A;  3GV1 A;  3SWL A;  2GS3 A;  2GT5 A;  4ZB6 A;  2OBK A;  2VL3 A;  3UL3 A;  3UAP A;  4JZQ A;  4LMW A;  1LU4 A;  4YQM A;  2H0I A;  1X5D A;  4IKH A;  1J0F A;  4Q5N A;  3QDN A;  1SKW B;  2KP2 A;  4TW5 A;  2LS5 A;  2JZR A;  1XPV A;  4V2N A;  2DJJ A;  4ZIL A;  1GP1 A;  3LYP A;  1PD2 1;  1SU9 A;  1DE2 A;  1V98 A;  1FOV A;  3HVV A;  1Z6M A;  5C04 A;  2F8A A;  4HQZ A;  2M46 A;  3E9J B;  4KCA A;  1TTZ A;  4WBR D;  1T4Y A;  4KB3 A;  2CZ3 A;  1EGO A;  2JZS A;  1GSQ A;  3DRN A;  2HSH A;  1SL2 B;  4EC0 A;  1A2M A;  6GSU A;  2OKA A;  5B6N A;  4HOJ A;  1TRV A;  4K0N A;  1Q4J A;  3IC4 A;  11GS A;  2ALB A;  3F0I A;  2ON5 A;  3GIX A;  4I5Q A;  1ZGN A;  4IS0 A;  1X5C A;  3WGX A;  1M99 A;  4IP6 A;  2G0F A;  1S3A A;  1XVW A;  2V1M A;  1VF4 A;  2JSZ A;  2M80 A;  2V2G A;  4IGJ A;  2NBS A;  4ZL9 A;  2C3T A;  2HE3 A;  1VF1 A;  1TK0 B;  3FZ4 A;  4IP1 A;  4EXJ A;  4EL1 A;  1KTE A;  1XW9 A;  4TR4 A;  2HZE B;  3VFI A;  1ML6 A;  5IMF A;  3HJM A;  3MSZ A;  4AF2 A;  1X9W B;  2MBT A;  1RK4 A;  4XS1 A;  3NOF A;  4YQV A;  1EGR A;  2WUL A;  1EV9 A;  2HRF A;  1AXD A;  2OE3 A;  5AIV A;  3GFK A;  4PQH A;  3FK8 A;  5IMV A;  1K0C A;  3E0U A;  3I69 A;  5HFK A;  1FW1 A;  1PX6 A;  4G10 A;  5J9B A;  3HVS A;  5KN1 A;  1THO A;  5IM9 A;  2PPT A;  10GS A;  2K8S A;  2H1B A;  4IW9 A;  4MPF A;  4OFN A;  3F4S A;  2H75 A;  2L4C A;  1EEJ A;  3GL3 A;  4CW9 A;  5IMC A;  1GTB A;  2B7J A;  3DYR A;  3F8U A;  3ZTL A;  1GSF A;  3DD3 A;  4EO3 A;  5ECO B;  4FO5 A;  5IOX A;  4F0B A;  3QR6 A;  2I1U A;  3R2Q A;  2H0G A;  3F6F A;  4TRX A;  7GSS A;  3IHQ A;  1QK8 A;  1PN9 A;  2LV3 A;  2NPB A;  2VCX A;  5HQP A;  4WBJ A;  2LNS A;  2YWI A;  3O76 A;  1X0R A;  2EIQ A;  1YY7 A;  2HZF A;  2YOI A;  2IN3 A;  1GRX A;  5HFI A;  3GH6 A;  4FH8 A;  5H5Q A;  4BVY A;  3G9B A;  2VLV A;  3ZLP A;  2KUC A;  1U87 A;  3TKR A;  4OCF A;  5B6M A;  1EEM A;  4K7O A;  5D9T A;  2YP6 A;  4E8H A;  2C0G A;  5DQS A;  4DSS A;  3M0F A;  1MD3 A;  2GSQ A;  5FHI A;  5ECR B;  2TRX A;  2LJA A;  3CSI A;  2LQO A;  4NXI A;  4N10 A;  2C0E A;  1F2E A;  3KM6 A;  3L9S A;  1GTI A;  2H1D A;  4OFT A;  3GUR A;  3GRX A;  3EC3 A;  4O7H A;  2H0H A;  2FHE A;  3TJB A;  2WRT A;  2YN1 A;  3TJG A;  4KE3 A;  5G30 A;  1T8E B;  4HQS A;  1O7U A;  5E4W A;  2H1G A;  1NM3 A;  1WMJ A;  2KLX A;  6GSW A;  3PH9 A;  4V1A g;  3CRU A;  3IPZ A;  3WT1 A;  1PX7 A;  5DJL A;  3L0H A;  1V57 A;  2E7P A;  2MMO A;  4NV2 A;  5JCU A;  1ON4 A;  2LTK A;  2GDR A;  1JZO A;  2K9F A;  3CSH A;  4FYU A;  3WGE A;  1WIK A;  5D93 A;  2B5X A;  4WR4 A;  4GLT A;  2C3Q A;  1Q98 A;  1SKS B;  1ABA A;  2RM5 A;  4PUR A;  3D21 A;  2R5G A;  5EPF A;  3AY8 A;  5D9V A;  4K6X A;  3ED3 A;  5ECP B;  3O6T A;  2FWF A;  4BA7 A;  5J4U A;  5ELA A;  4I2T A;  2LUS A;  2VD0 A;  3IBH A;  5ECK B;  3OR5 A;  1XWK A;  1JZD A;  2I4A A;  5E59 A;  1A2L A;  5H5S A;  3CBU A;  4JRR A;  1EOG A;  1JFU A;  4JR4 A;  1FVJ A;  3DXB A;  2XC2 A;  3Q19 A;  4K1F A;  1V40 A;  1PMT A;  2QGV A;  2PVO C;  2IFQ A;  2AUV A;  4L5O A;  4N0Z A;  3TRX A;  3KGK A;  4TXO A;  4MF7 A;  3I43 A;  2L5L A;  1CQG A;  1FVK A;  3O3T A;  3F3Q A;  2H76 A;  3TOT A;  1K0N A;  3J7Y b;  2YJH A;  2H74 A;  4BVX A;  1SK2 A;  3IK9 A;  1MDI A;  4KUN A;  4NHZ A;  2IPA A;  2FLS A;  5ECL B;  3ERG A;  1Z9H A;  4RI7 A;  2A2S A;  5KN0 A;  3QPM A;  4JR6 A;  2IFQ B;  18GS A;  2PUK C;  1MD4 A;  2EC4 A;  3VUR A;  19GS A;  2GST A;  3ZYW A;  2C80 A;  3H1N A;  4TXO B;  4NMU A;  3DIE A;  2LEG A;  1YF1 A;  20GS A;  1C72 A;  1OAZ A;  2F51 A;  2YWM A;  5JCW A;  5IO0 A;  5JCG A;  1Z6N A;  2WJU A;  4H86 A;  1TK8 B;  2VOC A;  5DAL A;  5B8A A;  1PA3 A;  2L59 A;  5ID2 A;  3GH9 A;  4EF0 A;  1ERT A;  3UVT A;  4EDZ A;  3MDK A;  1ERW A;  4MH2 A;  2RM6 A;  2VL2 A;  2G2Q A;  2X8C A;  1T1V A;  4HUA A;  1K0B A;  2FGX A;  5ENU A;  4POB A;  2I81 A;  4F03 A;  22GS A;  4KW6 A;  3TUE A;  2H01 A;  1O73 A;  4TVE A;  3GKX A;  2TRC P;  4Q5Q A;  3LXZ A;  1B48 A;  1ZL9 A;  2L6C A;  4CHS A;  4OMV A;  3N9J A;  1G7O A;  3ZIV A;  2DJ0 A;  2E2G A;  4X1U A;  2VM2 A;  1G0T A;  4QL7 A;  3RDW A;  2PVQ A;  1AQX A;  1GTA A;  5F05 A;  3GYK A;  1T7P B;  4PUA A;  1A2J A;  3ZFB A;  1QXH A;  2VLU A;  4XHM A;  3ZVJ A;  3MAK A;  2R4V A;  4JBB A;  2N5B A;  4YQU A;  4FIW A;  2M72 A;  2PWJ A;  2XBQ A;  1TI1 A;  1URM A;  2HLS A;  3K8N A;  2YWN A;  2A4V A;  4KSM A;  2GQL A;  4I6X A;  5KN3 A;  1TP9 A;  3UEM A;  3TKS E;  1UC7 A;  1GLP A;  5IMD A;  1NW2 A;  3KJY A;  2DJ3 A;  2IMF A;  4N30 A;  1FB6 A;  3RBT A;  4KH7 A;  5EY6 A;  4HU9 A;  5INY A;  2KHP A;  3IXR A;  3N5O A;  4Q5F A;  2OE1 A;  2H1A A;  3KH7 A;  2AJQ B;  3F4R A;  1AIU A;  5D9X A;  2IJY A;  5HFG A;  1XCC A;  2FA4 A;  5EVO A;  1O8X A;  3KXO A;  2CVD A;  1DUG A;  4ZBD A;  4V2M A;  1XXU A;  2V6K A;  4FYC A;  1PL2 A;  1R5P A;  5C00 A;  4GWR A;  2F9S A;  1A8L A;  5J41 A;  1XBS A;  2A2R A;  5D96 A;  1PRX A;  2WDU A;  1TJD A;  3U5R E;  3HYP A;  1CQH A;  4HDE A;  6GST A;  2V32 A;  1KNG A;  1J9B A;  2V6O A;  1M9B A;  1NHY A;  3WGD A;  3QOU A;  3TKP A;  1UA5 A;  1VF2 A;  3CXG A;  2H30 A;  2MBS A;  2AAW A;  4MJE A;  4HJM A;  4ECJ A;  4I8B A;  4ACS A;  2H71 A;  1MEK A;  1Z7R A;  3P2A A;  3MWH A;  2IMD A;  2DIZ A;  3D0Z A;  4LL1 B;  4AGS A;  2GQM A;  1B8X A;  1U88 A;  5J9C A;  2YCD A;  1AUC A;  1VRS D;  4L8E A;  3SBC A;  3CTF A;  1O81 A;  2RUF A;  3KH9 A;  2Z9S A;  3Q18 A;  5ABR A;  3W8J A;  3BD2 A;  3C1S A;  4GSS A;  5FT3 A;  3ZVJ D;  3W8S A;  1QMV A;  1HYU A;  3LEF A;  1XW6 A;  3F4T A;  2R2J A;  2GSS A;  2WS2 A;  3ME7 A;  1TI3 A;  4PQI A;  1GSS A;  2RLI A;  1HQO A;  5D8I A;  1AC1 A;  5JWQ B;  5LD0 A;  3EYT A;  2IL3 A;  2YZU A;  3GHA A;  2YPM A;  1X5E A;  5JWO B;  1THX A;  3CTG A;  1F6M C;  3FYG A;  4MDC A;  4YAV A;  3LXT A;  2I9H A;  2C8U A;  2ZUP A;  2DC5 A;  1YF0 A;  4GCI A;  3VK9 A;  3QMX A;  3A2W A;  3TJJ A;  1XWB A;  4O5R A;  3FZ9 A;  2CX3 A;  5DVB A;  1TDI A;  4GRF A;  1TXX A;  3L78 A;  2H70 A;  5GAP D;  3WT2 A;  2KOK A;  3M9K A;  1SYX A;  5F0G A;  2DJK A;  1GNW A;  3FEU A;  4DSR A;  1V58 A;  3GX0 A;  2XPD A;  1OE8 A;  5DDL A;  3KP9 A;  1KBN A;  3VPQ A;  3EMX A;  4OD7 A;  1ZCP A;  4MLY A;  1G7E A;  4OFM A;  3GKK A;  3BOA A;  3IAS 2;  5JWR B;  2RUE A;  1EP7 A;  2CV4 A;  3L9V A;  4DVC A;  4CDO A;  1Y6E A;  2MYG A;  3VLN A;  2R6K A;  3IK7 A;  2C4J A;  3TCO A;  3QAW A;  1ST9 A;  2GSR A;  4TR1 A;  3M8N A;  1AQV A;  8GSS A;  3ZRD A;  3CMI A;  1WPI A;  4KX4 A;  1ACV A;  5LNK e;  3VWW A;  3D4M A;  4BPY A;  2V41 A;  3LJR A;  4RQR A;  2VCZ A;  2VCQ A;  3EMP A;  1B4Q A;  2PMT A;  2OBI A;  1E6B A;  1EOH A;  1WJK A;  4MH3 A;  1VGL A;  3FR6 A;  4XRA A;  3KMO A;  1QFN A;  6GSX A;  1OYJ A;  1Z3E A;  5DCH A;  1W4V A;  2R3X A;  4DSQ A;  1O6J A;  1Y25 A;  3VI7 A;  2VL2 C;  3LOR A;  5GST A;  5GZZ B;  4MZC A;  3ZIT A;  1Z7P A;  1MDK A;  3M9J A;  3GN3 A;  3JCM L;  2P0G A;  3H79 A;  2B6M A;  2JAC A;  1ZZY A;  2LRC A;  1RW1 A;  4DSS B;  1BYE A;  1E2Y A;  3EU4 A;  4BL7 A;  2L57 A;  3BCI A;  6GSS A;  2IWT A;  2J23 A;  2L5O A;  2OAD A;  2JAD A;  2O87 A;  2F8F A;  3DVX A;  4KDX A;  2FNO A;  5CRD A;  3LSZ A;  4IQA A;  3ZML A;  4KGI A;  4V2L A;  2P31 A;  1RQM A;  3Q6O A;  4NPB A;  3APO A;  2B3S A;  1OC8 A;  1PGT A;  1SEN A;  3L4N A;  2CVB A;  2H6X A;  2AB6 A;  4F0C A;  1VF3 A;  3VWX A;  1FO5 A;  4D73 A;  3S9F A;  1M9A A;  2B5E A;  2HI7 A;  3EU3 A;  3DVW A;  4RI6 A;  3UIW A;  1SJI A;  5G5E A;  4ZBB A;  3KP8 A;  2E2M A;  3C7M A;  4WKW A;  4MF6 A;  1GUM A;  3UMA A;  1K0O A;  4IJI A;  5HR3 A;  1TRU A;  4KSO A;  4OO5 A;  2JSY A;  1W89 A;  2IIY A;  4NV5 A;  5A4U A;  2O8V B;  1H4O A;  3LYK A;  5EL8 A;  2GTU A;  1K3L A;  2GQK A;  1SL1 B;  1SK0 A;  2OE0 A;  2GLR A;  1GSE A;  4ML6 A;  4D73 B;  3RHB A;  3TKS A;  1GSU A;  4EE0 A;  3LG6 A;  2L6D A;  4MA9 A;  2LQQ A;  1SD8 A;  3KEB A;  3IAM 2;  6GSY A;  5DCG A;  4ZB9 A;  4I2U A;  2OA7 A;  2H8L A;  5F07 A;  1HNC A;  3CRT A;  4QQ7 A;  2C1Y A;  1IYI A;  4ZIJ A;  4PX1 A;  3RPP A;  4KND A;  1AAZ A;  4OWY A;  14GS A;  3HJO A;  5CRG A;  1A23 A;  4WXT A;  1DE1 A;  2WFC A;  4ULX A;  4OCE A;  3PIN A;  1A8Y A;  2PN8 A;  5G5F A;  3F63 A;  2JZT A;  4NAX A;  3D22 A;  1JZR A;  3GKM A;  2H6Z A;  1WP0 A; 
#chains in the Genus database with same CATH topology
 1S3C A;  4ZXG A;  2RII A;  4NWY A;  4K5R A;  3C73 A;  3KTL A;  4BVX B;  1MTC A;  5G1L A;  3PGT A;  2EIR A;  3I9V 2;  1TU8 A;  5IPH A;  12GS A;  3BCK A;  3ME8 A;  3EE2 A;  5DBQ A;  1F9M A;  1K3Y A;  1N8J A;  3IOS A;  3IA1 A;  2CT6 A;  1A0R P;  2E0Q A;  1AQW A;  3NZN A;  4J57 E;  2DIY A;  3FW2 A;  1OKT A;  3H4K A;  3MNG A;  4MJC A;  3IE3 A;  5CYY A;  2YNX A;  5KEJ A;  3DML A;  2CA8 A;  4IN0 A;  1GL8 A;  2DJ1 A;  1UVZ A;  1V9W A;  1F37 A;  1XOA A;  4RUV A;  4K7I A;  1PKW A;  2MMN A;  4K9Z A;  2N5A A;  1ERU A;  2CAQ A;  1R7H A;  1ZOF A;  5DAL B;  3M3M A;  2MMZ A;  3EVI A;  5ID2 B;  1BJX A;  4TOP A;  1TRS A;  2PBJ A;  1XFL A;  2HT9 A;  1PQN A;  4JU5 A;  1U3I A;  3Q74 A;  2LST A;  4J2F A;  2NVL A;  1WOU A;  3ZMK A;  1HD2 A;  1YKA A;  3UAR A;  5J3R A;  1G6W A;  4QL9 A;  3DKS A;  4HS1 A;  2HYX A;  3EIN A;  4LL4 B;  5CNW A;  2F3M A;  4EUY A;  2DML A;  4ECB A;  3GNJ A;  4PUF C;  5GAN D;  2VLT A;  2CX4 A;  5LCZ A;  3GUS A;  1XVQ A;  1V2A A;  3A3T A;  5KN2 A;  5F8B A;  2YJ7 A;  4XTS A;  2HXK A;  1B9Y C;  4F2I A;  4ZBA A;  4AJ8 A;  3HZ8 A;  2DLX A;  4EKZ A;  4G0I A;  3TRQ A;  5IMZ A;  3ERF A;  2FWH A;  3BJ5 A;  4WF4 A;  1GUH A;  1GSY A;  2O7K A;  2ZNM A;  2WGR A;  1J08 A;  2B7K A;  2YV9 A;  3C71 A;  1TRW A;  5F06 A;  4P3Y B;  3UVH A;  3D6I A;  5HR0 A;  2H19 A;  2HRN A;  2FY6 A;  4MK3 A;  3ISO A;  2H72 A;  2X8H A;  1KEB A;  2C3N A;  2QC7 A;  1TK5 B;  1QQ2 A;  3DWV A;  4HEA 2;  3GX8 A;  5DJM A;  2IMI A;  1WE0 A;  5DQY A;  2K6V A;  2GGT A;  2WCI A;  1BAY A;  2A2P A;  5FWG A;  4WET A;  17GS A;  2VCT A;  2H73 A;  5A4V A;  1K0M A;  2GVP A;  3RAZ A;  3D4T A;  3UOM A;  4X43 A;  2FWE A;  3KZQ A;  4JED A;  3F3R A;  5IPG A;  4K7N A;  2DBC A;  1WRY A;  1HNB A;  3FZA A;  2XBI A;  1M3I A;  4X0X A;  4ISD A;  2HZE A;  2YZH A;  3GTU A;  2OAC A;  4MCU A;  4GSN A;  2ES7 A;  4G19 A;  4PGT A;  4TR0 A;  2K18 A;  3TJF A;  2GZZ A;  3GST A;  2KP1 A;  1BED A;  4K2D A;  4KA0 A;  5IOW A;  3FMW A;  1ZMA A;  4IVF A;  4IBP A;  2VCW A;  3A2V A;  1NHO A;  3GSS A;  4GXZ A;  3TJK A;  5ECQ B;  1UN2 A;  4ZB8 A;  3HVX A;  4PNF A;  13GS A;  5IO2 A;  3C8E A;  4MF5 A;  2NDO A;  5ECN B;  1A0F A;  2FD3 A;  3F9U A;  1O85 A;  3IRA A;  2CQ9 A;  2YWO A;  1JHB A;  5IIZ A;  4K2X A;  2GZY A;  3HA9 A;  3GTU B;  2JL4 A;  2XPE A;  1OVN A;  1YZX A;  2D2Z A;  5B7C A;  3FRC A;  2C0D A;  5DAK A;  2NTO A;  1B4P A;  1EV4 A;  1JLW A;  4G2E A;  1SYR A;  3ERW A;  3LQ7 A;  3WYW A;  1GLQ A;  2GZP A;  4XCS A;  3IC8 A;  1R5A A;  2AV4 A;  5A4W A;  1GNE A;  2ON7 A;  3F6D A;  1O8W A;  3LW9 A;  3R3E A;  2DKI A;  2PER A;  6GSV A;  3TKS C;  1XW5 A;  4ZL7 A;  1ERV A;  5ECH B;  4POM A;  2LJK A;  3BBY A;  4HU7 A;  1MDJ A;  1T4Z A;  1TKD B;  1BG5 A;  3HJP A;  3L9U A;  1PL1 A;  1XZO A;  2X8G A;  1I9D A;  3HHV A;  5DAK B;  1WWJ A;  3P7X A;  1I5G A;  1X9M B;  5IQY A;  1GH2 A;  5CRH A;  1SD9 A;  2IME A;  2JU5 A;  2XHF A;  1XWC A;  5AIX A;  2REM A;  4ZL8 A;  1G6Y A;  2C0F A;  1SJZ A;  4HJ2 A;  4EVM A;  4PXO A;  3GMF A;  3ZIJ A;  3G7I A;  2VCV A;  2PGT A;  4L0W A;  4GF0 A;  4LLR A;  1NSW A;  4XS6 A;  2LRN A;  4KAE A;  4A5P A;  4IHU A;  1OC9 A;  1DBY A;  3LGC A;  1FAA A;  2A4H A;  4TR3 A;  4ECI A;  3WD6 A;  2B1L A;  1YJ6 A;  4GST A;  2X64 A;  2HNL A;  3TKQ A;  2R0P A;  1T3B A;  4POK A;  4TR1 B;  3J7Y k;  2HSM A;  3HKR A;  3G7Y A;  5D9W A;  1TOF A;  1SJ6 A;  4F9Z A;  2WZ9 A;  1YDK A;  4JE1 A;  1YQ1 A;  3D5J A;  4V1A p;  2O89 A;  5A5K A;  1XWG A;  2H66 A;  1LJR A;  2L4Q A;  3FHK A;  2IMK A;  5HR2 A;  2K8V A;  2H6Y A;  2EIO A;  3RHC A;  1OC9 B;  3FY7 A;  5GSS A;  2VUP A;  1EP8 A;  2MMA A;  3IV4 A;  5CRE A;  3QAG A;  4G9H A;  4KDY A;  5AIS A;  4IEL A;  2DMM A;  3GKN A;  1R4W A;  1FB0 A;  2BTO T;  3DGQ A;  1K3O A;  3H8Q A;  5CO3 A;  5ECS A;  1YEP A;  4TXV A;  3HDC A;  4HZ4 A;  3APQ A;  16GS A;  3M1G A;  1ZYN A;  3LFL A;  4PTS A;  3UBL A;  4BIK A;  2R37 A;  1ZYQ B;  3KTB A;  4AJ7 A;  4N11 A;  2LJR A;  2N5F A;  1YKC A;  3FR3 A;  4AJ6 A;  1XWA A;  2FCH A;  4K0G A;  4L0U A;  2QKE A;  2VO4 A;  3ZFL A;  4BL7 B;  5ECI B;  4IQ1 A;  4WEY A;  3QFB C;  2I3Y A;  2FWG A;  3QFA C;  1YEX A;  5H5R A;  4PNG A;  3U6V A;  3FZ5 A;  5HR1 A;  2VL9 A;  2P5Q A;  2WB9 A;  1K0A A;  4ILF A;  3C1R A;  3A2X A;  3GL5 A;  4POL A;  1PKZ A;  1QGV A;  1QUW A;  1OKD A;  4WR5 A;  1Z5Y E;  4XS4 A;  4MJB A;  1M7T A;  5G31 A;  1GWC A;  3TOU A;  3LWA A;  4KDU A;  4RQX A;  4PQ1 A;  3VI5 A;  4BWS A;  2FA8 A;  4TKY A;  3P8W A;  3TDG A;  4IJ3 A;  3CSJ A;  4MAB A;  3HD5 A;  9GSS A;  1BQ7 A;  3TRP A;  5IMA A;  3KIJ A;  4XIH A;  4GTU A;  3V1W A;  1B9X C;  3APS A;  2VAF A;  3US3 A;  2LRT A;  2HFD A;  3UJ1 A;  3W6G A;  4GQC A;  2FUG 2;  4OO4 A;  1GSD A;  3IR4 A;  1A24 A;  2B1K A;  1XG8 A;  3QAV A;  3G7J A;  3RPN A;  4MZW A;  2X99 A;  1HNA A;  1USB A;  3VWV A;  4YH2 A;  4XS4 B;  4ECC A;  4BWQ A;  1ZYE A;  4ID0 A;  1T00 A;  5CRW A;  4Z2R A;  5G1K A;  1AW9 A;  1U6T A;  1K0D A;  1LBK A;  4I97 A;  3FR9 A;  4K8M A;  4ICY A;  1H75 A;  2TIR A;  2X49 A;  4TN8 A;  1S3R A;  4Q5R A;  5AGY A;  4ML1 A;  2VIM A;  4O5Q A;  2AHE A;  1SL0 B;  5COH A;  2R0G A;  2GT6 A;  3HZ4 A;  2BJX A;  4L5L A;  3HXS A;  1U3A A;  4Z7X A;  1M2A A;  1X9S B;  2MZC A;  2QSI A;  1M0U A;  4LMV A;  3CQF A;  2OJL A;  3HCZ A;  1XOB A;  3UBK A;  3ZZX A;  4HZ2 A;  3ZRE A;  4O92 A;  1JZW A;  2O85 A;  4KCE A;  4EDY A;  2YV7 A;  4MNN A;  1FHE A;  1GUK A;  2HRA A;  1OC3 A;  5J5N A;  3ZL5 A;  3KMN A;  1TW9 A;  3PR8 A;  4MZB A;  1JLV A;  1N2A A;  2CAI A;  2AYT A;  1EZK A;  2LKU A;  1XIY A;  4WF5 A;  5AN1 A;  4LA1 A;  2B5Y A;  1EWX A;  1SK1 A;  1IYH A;  4F82 A;  1TU7 A;  3QCP A;  3VWU A;  4HI7 A;  2CZ2 A;  3H93 A;  3I6A A;  1ILO A;  2LNT A;  5KOW A;  3P90 A;  1GTU A;  3HY2 A;  4MMM A;  2VD1 A;  3KCM A;  1SKR B;  4NHW A;  2VM1 A;  4MP4 A;  4DEJ A;  1F3A A;  1DSB A;  5L71 A;  1FG4 A;  3DEX A;  2DJ2 A;  4O32 A;  5CAX A;  3NIV A;  4CY8 A;  1PSQ A;  5ECM B;  3KD0 A;  3A5W A;  4FYB A;  2P5R A;  3QD9 A;  4XRD A;  2PU9 C;  2CVK A;  4MJA A;  2J9H A;  1M2B A;  4J56 E;  1GUL A;  5CP1 A;  1M2D A;  5ELG A;  3GA4 A;  2DSA A;  2ZCT A;  3VPT A;  2BMX A;  4GQF A;  5G2Z A;  1OE7 A;  2HSY A;  4MPG A;  4E8E A;  3TGZ A;  1S3D A;  5B8B A;  2YAN A;  3E3E A;  3EUR A;  4YAP A;  1F3B A;  3IDV A;  1R26 A;  3FKF A;  3EWL A;  3TB2 A;  1BX9 A;  4N0V A;  5D73 A;  3CYN A;  3GV1 A;  3SWL A;  2GS3 A;  2GT5 A;  4ZB6 A;  2OBK A;  2VL3 A;  3UL3 A;  3UAP A;  4JZQ A;  4LMW A;  1LU4 A;  4YQM A;  2H0I A;  1X5D A;  4IKH A;  1J0F A;  4Q5N A;  3QDN A;  3IHG A;  2KP2 A;  1SKW B;  4TW5 A;  2LS5 A;  2JZR A;  1XPV A;  4V2N A;  2DJJ A;  4ZIL A;  1GP1 A;  3LYP A;  1PD2 1;  1SU9 A;  1DE2 A;  1V98 A;  1FOV A;  3HVV A;  1Z6M A;  5C04 A;  2F8A A;  4HQZ A;  2M46 A;  3E9J B;  4KCA A;  1TTZ A;  4WBR D;  1T4Y A;  4KB3 A;  2CZ3 A;  1EGO A;  2JZS A;  1GSQ A;  3DRN A;  2HSH A;  1SL2 B;  4EC0 A;  1A2M A;  6GSU A;  2QA2 A;  2OKA A;  5B6N A;  4HOJ A;  1TRV A;  4K0N A;  1Q4J A;  3IC4 A;  11GS A;  2ALB A;  3F0I A;  2ON5 A;  3GIX A;  4I5Q A;  1ZGN A;  4IS0 A;  1X5C A;  3WGX A;  1M99 A;  4IP6 A;  2G0F A;  1S3A A;  1XVW A;  2V1M A;  1VF4 A;  2JSZ A;  2M80 A;  2V2G A;  4IGJ A;  2NBS A;  4ZL9 A;  2C3T A;  2HE3 A;  1VF1 A;  1TK0 B;  3FZ4 A;  4IP1 A;  4EXJ A;  4EL1 A;  1KTE A;  1XW9 A;  1M3J A;  4TR4 A;  2HZE B;  3VFI A;  1ML6 A;  4G0K A;  5IMF A;  3HJM A;  3MSZ A;  3MIX A;  4AF2 A;  1X9W B;  2MBT A;  1RK4 A;  4XS1 A;  3NOF A;  4YQV A;  1EGR A;  2WUL A;  1EV9 A;  2HRF A;  1AXD A;  2OE3 A;  5AIV A;  3GFK A;  4PQH A;  3FK8 A;  5IMV A;  1K0C A;  3E0U A;  3I69 A;  5HFK A;  1FW1 A;  1PX6 A;  4G10 A;  5J9B A;  3HVS A;  5KN1 A;  1THO A;  5IM9 A;  2PPT A;  10GS A;  2K8S A;  2H1B A;  4IW9 A;  4MPF A;  4OFN A;  3F4S A;  2H75 A;  2L4C A;  1EEJ A;  3GL3 A;  4CW9 A;  5IMC A;  1GTB A;  2B7J A;  3DYR A;  3F8U A;  3ZTL A;  3HVN A;  1GSF A;  3DD3 A;  4Z2T A;  4G0L A;  4EO3 A;  5ECO B;  4FO5 A;  5IOX A;  4F0B A;  3QR6 A;  2R0C A;  2I1U A;  3R2Q A;  2H0G A;  3F6F A;  4TRX A;  7GSS A;  3IHQ A;  1QK8 A;  1PN9 A;  2LV3 A;  2NPB A;  2VCX A;  5HQP A;  4WBJ A;  2LNS A;  2YWI A;  3O76 A;  1X0R A;  2EIQ A;  1YY7 A;  2HZF A;  2YOI A;  2IN3 A;  1GRX A;  5HFI A;  3GH6 A;  4FH8 A;  5H5Q A;  4BVY A;  3G9B A;  2VLV A;  3ZLP A;  2KUC A;  1U87 A;  3TKR A;  4OCF A;  5B6M A;  1EEM A;  4K7O A;  5D9T A;  2YP6 A;  4E8H A;  2C0G A;  5DQS A;  4DSS A;  2UZ8 A;  3M0F A;  1MD3 A;  2GSQ A;  5FHI A;  5ECR B;  2TRX A;  2LJA A;  3CSI A;  2LQO A;  4NXI A;  4N10 A;  2C0E A;  1F2E A;  3KM6 A;  3L9S A;  1GTI A;  2H1D A;  4OFT A;  3GUR A;  3GRX A;  3EC3 A;  4Z2U A;  4O7H A;  2H0H A;  2FHE A;  3TJB A;  2WRT A;  2YN1 A;  3TJG A;  4YKG A;  4KE3 A;  4CY6 A;  5G30 A;  1T8E B;  4HQS A;  1O7U A;  5E4W A;  2H1G A;  1NM3 A;  1WMJ A;  2KLX A;  6GSW A;  3PH9 A;  3MYD A;  4V1A g;  3CRU A;  4K5S A;  3IPZ A;  3WT1 A;  1PX7 A;  5DJL A;  3L0H A;  1V57 A;  2E7P A;  2MMO A;  4NV2 A;  5JCU A;  1ON4 A;  2LTK A;  2GDR A;  1JZO A;  2K9F A;  3CSH A;  4FYU A;  3WGE A;  1WIK A;  5D93 A;  2B5X A;  4WR4 A;  4GLT A;  2C3Q A;  1Q98 A;  1SKS B;  1ABA A;  2RM5 A;  4PUR A;  3D21 A;  2R5G A;  5EPF A;  3AY8 A;  5D9V A;  4K6X A;  3ED3 A;  5ECP B;  3O6T A;  2FWF A;  4BA7 A;  5J4U A;  5ELA A;  4I2T A;  2LUS A;  2VD0 A;  3IBH A;  5ECK B;  3OR5 A;  1XWK A;  1JZD A;  3EPT A;  2I4A A;  5E59 A;  1A2L A;  5H5S A;  3CBU A;  4JRR A;  1EOG A;  1JFU A;  4JR4 A;  1FVJ A;  3DXB A;  2XC2 A;  3Q19 A;  4K1F A;  1V40 A;  1PMT A;  2QGV A;  2PVO C;  2IFQ A;  2AUV A;  4L5O A;  4N0Z A;  3TRX A;  3KGK A;  4TXO A;  4MF7 A;  3I43 A;  2L5L A;  4EIP A;  1CQG A;  1FVK A;  3O3T A;  3F3Q A;  2H76 A;  3TOT A;  1K0N A;  3J7Y b;  2YJH A;  2H74 A;  4BVX A;  1SK2 A;  3IK9 A;  1MDI A;  4KUN A;  4NHZ A;  2IPA A;  2FLS A;  5ECL B;  3ERG A;  1Z9H A;  4RI7 A;  2A2S A;  5KN0 A;  3QPM A;  4JR6 A;  2IFQ B;  18GS A;  2PUK C;  1MD4 A;  2EC4 A;  3VUR A;  19GS A;  2GST A;  3ZYW A;  2C80 A;  3H1N A;  4TXO B;  4NMU A;  3DIE A;  2LEG A;  1YF1 A;  20GS A;  1C72 A;  1OAZ A;  2F51 A;  2YWM A;  5JCW A;  5IO0 A;  5JCG A;  1Z6N A;  2WJU A;  4H86 A;  1TK8 B;  2VOC A;  5DAL A;  5B8A A;  1PA3 A;  2L59 A;  5ID2 A;  3GH9 A;  4EF0 A;  1ERT A;  3UVT A;  4KF9 A;  4EDZ A;  3MDK A;  1ERW A;  4MH2 A;  2RM6 A;  2VL2 A;  2G2Q A;  3PPU A;  2X8C A;  1T1V A;  4HUA A;  1K0B A;  4X4J A;  2FGX A;  5ENU A;  4POB A;  2I81 A;  4F03 A;  22GS A;  4KW6 A;  3TUE A;  2H01 A;  1O73 A;  4TVE A;  3GKX A;  1PN0 A;  2TRC P;  4Q5Q A;  3LXZ A;  1B48 A;  1ZL9 A;  2L6C A;  4CHS A;  4OMV A;  3N9J A;  1G7O A;  3ZIV A;  2DJ0 A;  2E2G A;  4X1U A;  2VM2 A;  1G0T A;  4QL7 A;  3RDW A;  2PVQ A;  1AQX A;  1GTA A;  5F05 A;  3GYK A;  1T7P B;  4PUA A;  1A2J A;  3ZFB A;  1QXH A;  2VLU A;  4USS A;  4XHM A;  3ZVJ A;  3MAK A;  2R4V A;  4JBB A;  2N5B A;  4YQU A;  4FIW A;  2M72 A;  2PWJ A;  2XBQ A;  1TI1 A;  1URM A;  2HLS A;  3K8N A;  2YWN A;  2A4V A;  4KSM A;  2GQL A;  4I6X A;  5KN3 A;  1TP9 A;  3UEM A;  3TKS E;  1UC7 A;  1GLP A;  5IMD A;  1NW2 A;  3KJY A;  4O5U A;  2DJ3 A;  2IMF A;  4N30 A;  1FB6 A;  3RBT A;  4KH7 A;  5EY6 A;  4HU9 A;  5INY A;  2KHP A;  3IXR A;  3N5O A;  4Q5F A;  1ZYP A;  2OE1 A;  2H1A A;  3KH7 A;  2AJQ B;  3F4R A;  1AIU A;  5D9X A;  2IJY A;  5HFG A;  1XCC A;  2FA4 A;  4YKF A;  5EVO A;  1O8X A;  3KXO A;  2CVD A;  1DUG A;  4ZBD A;  4V2M A;  1XXU A;  2V6K A;  4FYC A;  1PL2 A;  1R5P A;  5C00 A;  4GWR A;  2F9S A;  1A8L A;  5J41 A;  1XBS A;  2A2R A;  5D96 A;  1PRX A;  2WDU A;  1TJD A;  3U5R E;  3HYP A;  1CQH A;  4HDE A;  6GST A;  2V32 A;  1KNG A;  1J9B A;  2V6O A;  1M9B A;  1NHY A;  3WGD A;  3QOU A;  3TKP A;  1UA5 A;  1VF2 A;  3CXG A;  2H30 A;  2MBS A;  4FQU A;  2AAW A;  4MJE A;  4HJM A;  4ECJ A;  4I8B A;  4ACS A;  2H71 A;  1MEK A;  1Z7R A;  3P2A A;  3MWH A;  2IMD A;  2DIZ A;  3D0Z A;  4LL1 B;  4AGS A;  2GQM A;  1B8X A;  1U88 A;  5J9C A;  2YCD A;  1AUC A;  1VRS D;  4L8E A;  3SBC A;  3CTF A;  1O81 A;  2RUF A;  3KH9 A;  2Z9S A;  3Q18 A;  5ABR A;  3W8J A;  3BD2 A;  3C1S A;  4GSS A;  5FT3 A;  3ZVJ D;  3W8S A;  1QMV A;  1HYU A;  3LEF A;  1XW6 A;  3F4T A;  2R2J A;  2GSS A;  2WS2 A;  3ME7 A;  1TI3 A;  4PQI A;  1GSS A;  2RLI A;  1HQO A;  5D8I A;  1AC1 A;  5JWQ B;  5LD0 A;  3EYT A;  2IL3 A;  2YZU A;  3GHA A;  2YPM A;  1X5E A;  5JWO B;  1THX A;  3CTG A;  1F6M C;  3FYG A;  4MDC A;  4YAV A;  1FOH A;  3LXT A;  2I9H A;  2C8U A;  2ZUP A;  2DC5 A;  1YF0 A;  4GCI A;  3VK9 A;  3QMX A;  3A2W A;  3TJJ A;  1XWB A;  4O5R A;  3FZ9 A;  2CX3 A;  5DVB A;  1TDI A;  4GRF A;  1TXX A;  3L78 A;  2H70 A;  5GAP D;  3WT2 A;  4EIQ A;  2KOK A;  5KOX A;  3M9K A;  1SYX A;  5F0G A;  2DJK A;  1GNW A;  3FEU A;  4DSR A;  1V58 A;  3GX0 A;  2XPD A;  1OE8 A;  5DDL A;  3KP9 A;  1KBN A;  3VPQ A;  3EMX A;  4OD7 A;  1ZCP A;  4MLY A;  1G7E A;  4OFM A;  3GKK A;  3BOA A;  3IAS 2;  5JWR B;  2RUE A;  1EP7 A;  2CV4 A;  3L9V A;  4DVC A;  4CDO A;  1Y6E A;  2MYG A;  3VLN A;  2R6K A;  3IK7 A;  2C4J A;  3TCO A;  3QAW A;  1ST9 A;  2X4A A;  2GSR A;  4TR1 A;  3M8N A;  2DKH A;  1AQV A;  8GSS A;  3ZRD A;  3CMI A;  1WPI A;  4KX4 A;  1ACV A;  5LNK e;  3VWW A;  3D4M A;  4BPY A;  2V41 A;  3LJR A;  4RQR A;  2VCZ A;  2VCQ A;  3EMP A;  1B4Q A;  4HSC X;  2PMT A;  2OBI A;  1E6B A;  1EOH A;  1WJK A;  4MH3 A;  1PFO A;  1VGL A;  3FR6 A;  4XRA A;  3KMO A;  1QFN A;  6GSX A;  5BMU A;  1OYJ A;  1Z3E A;  5DCH A;  1W4V A;  2R3X A;  4DSQ A;  1O6J A;  1Y25 A;  3VI7 A;  2VL2 C;  3LOR A;  5GST A;  5GZZ B;  4MZC A;  3ZIT A;  1Z7P A;  4BVY B;  1MDK A;  3M9J A;  3GN3 A;  3JCM L;  2P0G A;  3H79 A;  2B6M A;  2JAC A;  1ZZY A;  2LRC A;  1RW1 A;  4DSS B;  1BYE A;  1E2Y A;  3EU4 A;  4BL7 A;  2L57 A;  3BCI A;  6GSS A;  2IWT A;  2J23 A;  2L5O A;  2OAD A;  2JAD A;  2O87 A;  2F8F A;  3DVX A;  4KDX A;  2FNO A;  2QA1 A;  5CRD A;  3LSZ A;  4IQA A;  3ZML A;  4KGI A;  4V2L A;  2P31 A;  1RQM A;  3Q6O A;  4NPB A;  3APO A;  2B3S A;  1OC8 A;  1PGT A;  1SEN A;  3L4N A;  2CVB A;  2H6X A;  2AB6 A;  4F0C A;  1VF3 A;  3VWX A;  1FO5 A;  4D73 A;  3S9F A;  1M9A A;  2B5E A;  2HI7 A;  3EU3 A;  3DVW A;  4RI6 A;  3UIW A;  1SJI A;  5G5E A;  4ZBB A;  3KP8 A;  2E2M A;  3C7M A;  4WKW A;  4MF6 A;  3A5I A;  1GUM A;  3UMA A;  1K0O A;  4IJI A;  5HR3 A;  1TRU A;  4KSO A;  4OO5 A;  2JSY A;  1W89 A;  2IIY A;  4NV5 A;  5A4U A;  2O8V B;  1H4O A;  3LYK A;  5EL8 A;  2GTU A;  1K3L A;  2GQK A;  1SL1 B;  1SK0 A;  2OE0 A;  2GLR A;  1GSE A;  4ML6 A;  4D73 B;  3RHB A;  3TKS A;  1GSU A;  4EE0 A;  3LG6 A;  2L6D A;  4MA9 A;  2LQQ A;  1SD8 A;  3KEB A;  3IAM 2;  6GSY A;  5DCG A;  4ZB9 A;  4I2U A;  2OA7 A;  2H8L A;  5F07 A;  1HNC A;  3CRT A;  4QQ7 A;  2C1Y A;  1IYI A;  4ZIJ A;  4PX1 A;  3RPP A;  4KND A;  1AAZ A;  4OWY A;  14GS A;  3HJO A;  5CRG A;  1A23 A;  5BRT A;  4WXT A;  1DE1 A;  2WFC A;  2HRK A;  4ULX A;  4OCE A;  3PIN A;  1A8Y A;  2PN8 A;  5G5F A;  3F63 A;  2JZT A;  4NAX A;  3D22 A;  1JZR A;  3GKM A;  2H6Z A;  1WP0 A; 
#chains in the Genus database with same CATH homology
 1S3C A;  4ZXG A;  2RII A;  4NWY A;  4K5R A;  3C73 A;  3KTL A;  4BVX B;  1MTC A;  5G1L A;  3PGT A;  2EIR A;  3I9V 2;  1TU8 A;  5IPH A;  12GS A;  3BCK A;  3ME8 A;  3EE2 A;  5DBQ A;  1F9M A;  1K3Y A;  1N8J A;  3IOS A;  3IA1 A;  2CT6 A;  1A0R P;  2E0Q A;  1AQW A;  3NZN A;  4J57 E;  2DIY A;  3FW2 A;  1OKT A;  3H4K A;  3MNG A;  4MJC A;  3IE3 A;  5CYY A;  2YNX A;  5KEJ A;  3DML A;  2CA8 A;  4IN0 A;  1GL8 A;  2DJ1 A;  1UVZ A;  1V9W A;  1F37 A;  1XOA A;  4RUV A;  4K7I A;  1PKW A;  2MMN A;  4K9Z A;  2N5A A;  1ERU A;  2CAQ A;  1R7H A;  1ZOF A;  5DAL B;  3M3M A;  2MMZ A;  3EVI A;  5ID2 B;  1BJX A;  4TOP A;  1TRS A;  2PBJ A;  1XFL A;  2HT9 A;  1PQN A;  4JU5 A;  1U3I A;  3Q74 A;  2LST A;  4J2F A;  2NVL A;  1WOU A;  3ZMK A;  1HD2 A;  1YKA A;  3UAR A;  5J3R A;  1G6W A;  4QL9 A;  3DKS A;  4HS1 A;  2HYX A;  3EIN A;  4LL4 B;  5CNW A;  2F3M A;  4EUY A;  2DML A;  4ECB A;  3GNJ A;  4PUF C;  5GAN D;  2VLT A;  2CX4 A;  5LCZ A;  3GUS A;  1XVQ A;  1V2A A;  3A3T A;  5KN2 A;  5F8B A;  2YJ7 A;  4XTS A;  2HXK A;  1B9Y C;  4F2I A;  4ZBA A;  4AJ8 A;  3HZ8 A;  2DLX A;  4EKZ A;  4G0I A;  3TRQ A;  5IMZ A;  3ERF A;  2FWH A;  3BJ5 A;  4WF4 A;  1GUH A;  1GSY A;  2O7K A;  2ZNM A;  2WGR A;  1J08 A;  2B7K A;  2YV9 A;  3C71 A;  1TRW A;  5F06 A;  4P3Y B;  3UVH A;  3D6I A;  5HR0 A;  2H19 A;  2HRN A;  2FY6 A;  4MK3 A;  3ISO A;  2H72 A;  2X8H A;  1KEB A;  2C3N A;  2QC7 A;  1TK5 B;  1QQ2 A;  3DWV A;  4HEA 2;  3GX8 A;  5DJM A;  2IMI A;  1WE0 A;  5DQY A;  2K6V A;  2GGT A;  2WCI A;  1BAY A;  2A2P A;  5FWG A;  4WET A;  17GS A;  2VCT A;  2H73 A;  5A4V A;  1K0M A;  2GVP A;  3RAZ A;  3D4T A;  3UOM A;  4X43 A;  2FWE A;  3KZQ A;  4JED A;  3F3R A;  5IPG A;  4K7N A;  2DBC A;  1WRY A;  1HNB A;  3FZA A;  2XBI A;  4X0X A;  4ISD A;  2HZE A;  2YZH A;  3GTU A;  2OAC A;  4MCU A;  4GSN A;  2ES7 A;  4G19 A;  4PGT A;  4TR0 A;  2K18 A;  3TJF A;  2GZZ A;  3GST A;  2KP1 A;  1BED A;  4K2D A;  4KA0 A;  5IOW A;  3FMW A;  1ZMA A;  4IVF A;  4IBP A;  2VCW A;  3A2V A;  1NHO A;  3GSS A;  4GXZ A;  3TJK A;  5ECQ B;  1UN2 A;  4ZB8 A;  3HVX A;  4PNF A;  13GS A;  5IO2 A;  3C8E A;  4MF5 A;  2NDO A;  5ECN B;  1A0F A;  2FD3 A;  3F9U A;  1O85 A;  3IRA A;  2CQ9 A;  2YWO A;  1JHB A;  5IIZ A;  4K2X A;  2GZY A;  3HA9 A;  3GTU B;  2JL4 A;  2XPE A;  1OVN A;  1YZX A;  2D2Z A;  5B7C A;  3FRC A;  2C0D A;  5DAK A;  2NTO A;  1B4P A;  1EV4 A;  1JLW A;  4G2E A;  1SYR A;  3ERW A;  3LQ7 A;  3WYW A;  1GLQ A;  2GZP A;  4XCS A;  3IC8 A;  1R5A A;  2AV4 A;  5A4W A;  1GNE A;  2ON7 A;  3F6D A;  1O8W A;  3LW9 A;  3R3E A;  2DKI A;  2PER A;  6GSV A;  3TKS C;  1XW5 A;  4ZL7 A;  1ERV A;  5ECH B;  4POM A;  2LJK A;  3BBY A;  4HU7 A;  1MDJ A;  1T4Z A;  1TKD B;  1BG5 A;  3HJP A;  3L9U A;  1PL1 A;  1XZO A;  2X8G A;  1I9D A;  3HHV A;  5DAK B;  1WWJ A;  3P7X A;  1I5G A;  1X9M B;  5IQY A;  1GH2 A;  5CRH A;  1SD9 A;  2IME A;  2JU5 A;  2XHF A;  5AIX A;  1XWC A;  2REM A;  4ZL8 A;  1G6Y A;  2C0F A;  1SJZ A;  4HJ2 A;  4EVM A;  4PXO A;  3GMF A;  3ZIJ A;  3G7I A;  2VCV A;  2PGT A;  4L0W A;  4GF0 A;  4LLR A;  1NSW A;  4XS6 A;  2LRN A;  4KAE A;  4A5P A;  4IHU A;  1OC9 A;  1DBY A;  3LGC A;  1FAA A;  2A4H A;  4TR3 A;  4ECI A;  3WD6 A;  2B1L A;  1YJ6 A;  4GST A;  2X64 A;  2HNL A;  3TKQ A;  2R0P A;  1T3B A;  4POK A;  4TR1 B;  3J7Y k;  2HSM A;  3HKR A;  3G7Y A;  5D9W A;  1TOF A;  1SJ6 A;  4F9Z A;  2WZ9 A;  1YDK A;  4JE1 A;  1YQ1 A;  3D5J A;  4V1A p;  2O89 A;  5A5K A;  1XWG A;  2H66 A;  1LJR A;  2L4Q A;  3FHK A;  2IMK A;  5HR2 A;  2K8V A;  2H6Y A;  2EIO A;  3RHC A;  1OC9 B;  3FY7 A;  5GSS A;  2VUP A;  1EP8 A;  2MMA A;  3IV4 A;  5CRE A;  3QAG A;  4G9H A;  4KDY A;  5AIS A;  4IEL A;  2DMM A;  3GKN A;  1R4W A;  1FB0 A;  2BTO T;  3DGQ A;  1K3O A;  3H8Q A;  5CO3 A;  5ECS A;  1YEP A;  4TXV A;  3HDC A;  4HZ4 A;  3APQ A;  16GS A;  3M1G A;  1ZYN A;  3LFL A;  4PTS A;  3UBL A;  2R37 A;  1ZYQ B;  3KTB A;  4AJ7 A;  4N11 A;  2LJR A;  2N5F A;  1YKC A;  3FR3 A;  4AJ6 A;  1XWA A;  2FCH A;  4K0G A;  4L0U A;  2QKE A;  2VO4 A;  3ZFL A;  4BL7 B;  5ECI B;  4IQ1 A;  4WEY A;  3QFB C;  2I3Y A;  2FWG A;  3QFA C;  1YEX A;  5H5R A;  4PNG A;  3U6V A;  3FZ5 A;  5HR1 A;  2VL9 A;  2P5Q A;  2WB9 A;  1K0A A;  4ILF A;  3C1R A;  3A2X A;  3GL5 A;  4POL A;  1PKZ A;  1QGV A;  1QUW A;  1OKD A;  4WR5 A;  1Z5Y E;  4XS4 A;  4MJB A;  1M7T A;  5G31 A;  1GWC A;  3TOU A;  3LWA A;  4KDU A;  4RQX A;  4PQ1 A;  3VI5 A;  4BWS A;  2FA8 A;  4TKY A;  3P8W A;  3TDG A;  4IJ3 A;  3CSJ A;  4MAB A;  3HD5 A;  9GSS A;  1BQ7 A;  3TRP A;  5IMA A;  3KIJ A;  4XIH A;  4GTU A;  3V1W A;  1B9X C;  3APS A;  2VAF A;  3US3 A;  2LRT A;  2HFD A;  3UJ1 A;  3W6G A;  4GQC A;  2FUG 2;  4OO4 A;  1GSD A;  3IR4 A;  1A24 A;  2B1K A;  3QAV A;  3G7J A;  3RPN A;  4MZW A;  2X99 A;  1HNA A;  1USB A;  3VWV A;  4YH2 A;  4XS4 B;  4ECC A;  4BWQ A;  1ZYE A;  4ID0 A;  1T00 A;  5CRW A;  4Z2R A;  5G1K A;  1AW9 A;  1U6T A;  1K0D A;  1LBK A;  4I97 A;  3FR9 A;  4K8M A;  4ICY A;  1H75 A;  2TIR A;  2X49 A;  4TN8 A;  4Q5R A;  5AGY A;  4ML1 A;  2VIM A;  4O5Q A;  2AHE A;  1SL0 B;  5COH A;  2R0G A;  2GT6 A;  3HZ4 A;  2BJX A;  4L5L A;  3HXS A;  1U3A A;  4Z7X A;  1M2A A;  1X9S B;  2MZC A;  2QSI A;  1M0U A;  4LMV A;  2OJL A;  3HCZ A;  1XOB A;  3UBK A;  3ZZX A;  4HZ2 A;  3ZRE A;  4O92 A;  1JZW A;  2O85 A;  4KCE A;  4EDY A;  2YV7 A;  4MNN A;  1FHE A;  1GUK A;  2HRA A;  1OC3 A;  5J5N A;  3ZL5 A;  3KMN A;  1TW9 A;  3PR8 A;  4MZB A;  1JLV A;  1N2A A;  2CAI A;  2AYT A;  1EZK A;  2LKU A;  1XIY A;  4WF5 A;  5AN1 A;  4LA1 A;  2B5Y A;  1EWX A;  1SK1 A;  1IYH A;  4F82 A;  1TU7 A;  3QCP A;  3VWU A;  4HI7 A;  2CZ2 A;  3H93 A;  3I6A A;  1ILO A;  2LNT A;  5KOW A;  3P90 A;  1GTU A;  3HY2 A;  4MMM A;  2VD1 A;  3KCM A;  1SKR B;  4NHW A;  2VM1 A;  4MP4 A;  4DEJ A;  1F3A A;  1DSB A;  5L71 A;  1FG4 A;  3DEX A;  2DJ2 A;  4O32 A;  5CAX A;  3NIV A;  4CY8 A;  1PSQ A;  5ECM B;  3KD0 A;  3A5W A;  4FYB A;  2P5R A;  3QD9 A;  4XRD A;  2PU9 C;  2CVK A;  4MJA A;  2J9H A;  1M2B A;  4J56 E;  1GUL A;  5CP1 A;  1M2D A;  5ELG A;  3GA4 A;  2DSA A;  2ZCT A;  3VPT A;  2BMX A;  4GQF A;  5G2Z A;  1OE7 A;  2HSY A;  4MPG A;  4E8E A;  3TGZ A;  1S3D A;  5B8B A;  2YAN A;  3E3E A;  3EUR A;  4YAP A;  1F3B A;  3IDV A;  1R26 A;  3FKF A;  3EWL A;  3TB2 A;  1BX9 A;  4N0V A;  5D73 A;  3CYN A;  3GV1 A;  3SWL A;  2GS3 A;  2GT5 A;  4ZB6 A;  2OBK A;  2VL3 A;  3UL3 A;  3UAP A;  4JZQ A;  4LMW A;  1LU4 A;  4YQM A;  2H0I A;  1X5D A;  4IKH A;  1J0F A;  4Q5N A;  3QDN A;  3IHG A;  2KP2 A;  1SKW B;  4TW5 A;  2LS5 A;  2JZR A;  1XPV A;  4V2N A;  2DJJ A;  4ZIL A;  1GP1 A;  3LYP A;  1PD2 1;  1SU9 A;  1DE2 A;  1V98 A;  1FOV A;  3HVV A;  1Z6M A;  5C04 A;  2F8A A;  4HQZ A;  2M46 A;  3E9J B;  4KCA A;  1TTZ A;  4WBR D;  1T4Y A;  4KB3 A;  2CZ3 A;  1EGO A;  2JZS A;  1GSQ A;  3DRN A;  2HSH A;  1SL2 B;  4EC0 A;  1A2M A;  6GSU A;  2QA2 A;  2OKA A;  5B6N A;  4HOJ A;  1TRV A;  4K0N A;  1Q4J A;  3IC4 A;  11GS A;  2ALB A;  3F0I A;  2ON5 A;  3GIX A;  4I5Q A;  1ZGN A;  4IS0 A;  1X5C A;  3WGX A;  1M99 A;  4IP6 A;  2G0F A;  1S3A A;  1XVW A;  2V1M A;  1VF4 A;  2JSZ A;  2M80 A;  2V2G A;  4IGJ A;  2NBS A;  4ZL9 A;  2C3T A;  2HE3 A;  1VF1 A;  1TK0 B;  3FZ4 A;  4IP1 A;  4EXJ A;  4EL1 A;  1KTE A;  1XW9 A;  4TR4 A;  2HZE B;  3VFI A;  1ML6 A;  4G0K A;  5IMF A;  3HJM A;  3MSZ A;  3MIX A;  4AF2 A;  1X9W B;  2MBT A;  1RK4 A;  4XS1 A;  3NOF A;  4YQV A;  1EGR A;  2WUL A;  1EV9 A;  2HRF A;  1AXD A;  2OE3 A;  5AIV A;  3GFK A;  4PQH A;  3FK8 A;  5IMV A;  1K0C A;  3E0U A;  3I69 A;  5HFK A;  1FW1 A;  1PX6 A;  4G10 A;  5J9B A;  3HVS A;  5KN1 A;  1THO A;  5IM9 A;  2PPT A;  10GS A;  2K8S A;  2H1B A;  4IW9 A;  4MPF A;  4OFN A;  3F4S A;  2H75 A;  2L4C A;  1EEJ A;  3GL3 A;  4CW9 A;  5IMC A;  1GTB A;  2B7J A;  3DYR A;  3F8U A;  3ZTL A;  1GSF A;  3DD3 A;  4Z2T A;  4G0L A;  4EO3 A;  5ECO B;  4FO5 A;  5IOX A;  4F0B A;  3QR6 A;  2R0C A;  2I1U A;  3R2Q A;  2H0G A;  3F6F A;  4TRX A;  7GSS A;  3IHQ A;  1QK8 A;  1PN9 A;  2LV3 A;  2NPB A;  2VCX A;  5HQP A;  4WBJ A;  2LNS A;  2YWI A;  3O76 A;  1X0R A;  2EIQ A;  1YY7 A;  2HZF A;  2YOI A;  2IN3 A;  1GRX A;  5HFI A;  3GH6 A;  4FH8 A;  5H5Q A;  4BVY A;  3G9B A;  2VLV A;  3ZLP A;  2KUC A;  1U87 A;  3TKR A;  4OCF A;  5B6M A;  1EEM A;  4K7O A;  5D9T A;  2YP6 A;  4E8H A;  2C0G A;  5DQS A;  4DSS A;  2UZ8 A;  3M0F A;  1MD3 A;  2GSQ A;  5FHI A;  5ECR B;  2TRX A;  2LJA A;  3CSI A;  2LQO A;  4NXI A;  4N10 A;  2C0E A;  1F2E A;  3KM6 A;  3L9S A;  1GTI A;  2H1D A;  4OFT A;  3GUR A;  3GRX A;  3EC3 A;  4Z2U A;  4O7H A;  2H0H A;  2FHE A;  3TJB A;  2WRT A;  2YN1 A;  3TJG A;  4YKG A;  4KE3 A;  4CY6 A;  5G30 A;  1T8E B;  4HQS A;  1O7U A;  5E4W A;  2H1G A;  1NM3 A;  1WMJ A;  2KLX A;  6GSW A;  3PH9 A;  3MYD A;  4V1A g;  3CRU A;  4K5S A;  3IPZ A;  3WT1 A;  1PX7 A;  5DJL A;  3L0H A;  1V57 A;  2E7P A;  2MMO A;  4NV2 A;  5JCU A;  1ON4 A;  2LTK A;  2GDR A;  1JZO A;  2K9F A;  3CSH A;  4FYU A;  3WGE A;  1WIK A;  5D93 A;  2B5X A;  4WR4 A;  4GLT A;  2C3Q A;  1Q98 A;  1SKS B;  1ABA A;  2RM5 A;  4PUR A;  3D21 A;  2R5G A;  5EPF A;  3AY8 A;  5D9V A;  4K6X A;  3ED3 A;  5ECP B;  3O6T A;  2FWF A;  4BA7 A;  5J4U A;  5ELA A;  4I2T A;  2LUS A;  2VD0 A;  3IBH A;  5ECK B;  3OR5 A;  1XWK A;  1JZD A;  3EPT A;  2I4A A;  5E59 A;  1A2L A;  5H5S A;  3CBU A;  4JRR A;  1EOG A;  1JFU A;  4JR4 A;  1FVJ A;  3DXB A;  2XC2 A;  3Q19 A;  4K1F A;  1V40 A;  1PMT A;  2QGV A;  2PVO C;  2IFQ A;  2AUV A;  4L5O A;  4N0Z A;  3TRX A;  3KGK A;  4TXO A;  4MF7 A;  3I43 A;  2L5L A;  4EIP A;  1CQG A;  1FVK A;  3O3T A;  3F3Q A;  2H76 A;  3TOT A;  1K0N A;  3J7Y b;  2YJH A;  2H74 A;  4BVX A;  1SK2 A;  3IK9 A;  1MDI A;  4KUN A;  4NHZ A;  2IPA A;  2FLS A;  5ECL B;  3ERG A;  1Z9H A;  4RI7 A;  2A2S A;  5KN0 A;  3QPM A;  4JR6 A;  2IFQ B;  18GS A;  2PUK C;  1MD4 A;  2EC4 A;  3VUR A;  19GS A;  2GST A;  3ZYW A;  2C80 A;  3H1N A;  4TXO B;  4NMU A;  3DIE A;  2LEG A;  1YF1 A;  20GS A;  1C72 A;  1OAZ A;  2F51 A;  2YWM A;  5JCW A;  5IO0 A;  5JCG A;  1Z6N A;  2WJU A;  4H86 A;  1TK8 B;  2VOC A;  5DAL A;  5B8A A;  1PA3 A;  2L59 A;  5ID2 A;  3GH9 A;  4EF0 A;  1ERT A;  3UVT A;  4KF9 A;  4EDZ A;  3MDK A;  1ERW A;  4MH2 A;  2RM6 A;  2VL2 A;  2G2Q A;  3PPU A;  2X8C A;  1T1V A;  4HUA A;  1K0B A;  4X4J A;  2FGX A;  5ENU A;  4POB A;  2I81 A;  4F03 A;  22GS A;  4KW6 A;  3TUE A;  2H01 A;  1O73 A;  4TVE A;  3GKX A;  1PN0 A;  2TRC P;  4Q5Q A;  3LXZ A;  1B48 A;  1ZL9 A;  2L6C A;  4CHS A;  4OMV A;  3N9J A;  1G7O A;  3ZIV A;  2DJ0 A;  2E2G A;  4X1U A;  2VM2 A;  1G0T A;  4QL7 A;  3RDW A;  2PVQ A;  1AQX A;  1GTA A;  5F05 A;  3GYK A;  1T7P B;  4PUA A;  1A2J A;  3ZFB A;  1QXH A;  2VLU A;  4USS A;  4XHM A;  3ZVJ A;  3MAK A;  2R4V A;  4JBB A;  2N5B A;  4YQU A;  4FIW A;  2M72 A;  2PWJ A;  2XBQ A;  1TI1 A;  1URM A;  2HLS A;  3K8N A;  2YWN A;  2A4V A;  4KSM A;  2GQL A;  4I6X A;  5KN3 A;  1TP9 A;  3UEM A;  3TKS E;  1UC7 A;  1GLP A;  5IMD A;  1NW2 A;  3KJY A;  4O5U A;  2DJ3 A;  2IMF A;  4N30 A;  1FB6 A;  3RBT A;  4KH7 A;  5EY6 A;  4HU9 A;  5INY A;  2KHP A;  3IXR A;  3N5O A;  4Q5F A;  1ZYP A;  2OE1 A;  2H1A A;  3KH7 A;  2AJQ B;  3F4R A;  1AIU A;  5D9X A;  2IJY A;  5HFG A;  1XCC A;  2FA4 A;  4YKF A;  5EVO A;  1O8X A;  3KXO A;  2CVD A;  1DUG A;  4ZBD A;  4V2M A;  1XXU A;  2V6K A;  4FYC A;  1PL2 A;  1R5P A;  5C00 A;  4GWR A;  2F9S A;  1A8L A;  5J41 A;  1XBS A;  2A2R A;  5D96 A;  1PRX A;  2WDU A;  1TJD A;  3U5R E;  3HYP A;  1CQH A;  4HDE A;  6GST A;  2V32 A;  1KNG A;  1J9B A;  2V6O A;  1M9B A;  1NHY A;  3WGD A;  3QOU A;  3TKP A;  1UA5 A;  1VF2 A;  3CXG A;  2H30 A;  2MBS A;  4FQU A;  2AAW A;  4MJE A;  4HJM A;  4ECJ A;  4I8B A;  4ACS A;  2H71 A;  1MEK A;  1Z7R A;  3P2A A;  3MWH A;  2IMD A;  2DIZ A;  3D0Z A;  4LL1 B;  4AGS A;  2GQM A;  1B8X A;  1U88 A;  5J9C A;  2YCD A;  1AUC A;  1VRS D;  4L8E A;  3SBC A;  3CTF A;  1O81 A;  2RUF A;  3KH9 A;  2Z9S A;  3Q18 A;  5ABR A;  3W8J A;  3BD2 A;  3C1S A;  4GSS A;  5FT3 A;  3ZVJ D;  3W8S A;  1QMV A;  1HYU A;  3LEF A;  1XW6 A;  3F4T A;  2R2J A;  2GSS A;  2WS2 A;  3ME7 A;  1TI3 A;  4PQI A;  1GSS A;  2RLI A;  1HQO A;  5D8I A;  1AC1 A;  5JWQ B;  5LD0 A;  3EYT A;  2IL3 A;  2YZU A;  3GHA A;  2YPM A;  1X5E A;  5JWO B;  1THX A;  3CTG A;  1F6M C;  3FYG A;  4MDC A;  4YAV A;  1FOH A;  3LXT A;  2I9H A;  2C8U A;  2ZUP A;  2DC5 A;  1YF0 A;  4GCI A;  3VK9 A;  3QMX A;  3A2W A;  3TJJ A;  1XWB A;  4O5R A;  3FZ9 A;  2CX3 A;  5DVB A;  1TDI A;  4GRF A;  1TXX A;  3L78 A;  2H70 A;  5GAP D;  3WT2 A;  4EIQ A;  2KOK A;  5KOX A;  3M9K A;  1SYX A;  5F0G A;  2DJK A;  1GNW A;  3FEU A;  4DSR A;  1V58 A;  3GX0 A;  2XPD A;  1OE8 A;  5DDL A;  3KP9 A;  1KBN A;  3VPQ A;  3EMX A;  4OD7 A;  1ZCP A;  4MLY A;  1G7E A;  4OFM A;  3GKK A;  3BOA A;  3IAS 2;  5JWR B;  2RUE A;  1EP7 A;  2CV4 A;  3L9V A;  4DVC A;  4CDO A;  1Y6E A;  2MYG A;  3VLN A;  2R6K A;  3IK7 A;  2C4J A;  3TCO A;  3QAW A;  1ST9 A;  2X4A A;  2GSR A;  4TR1 A;  3M8N A;  2DKH A;  1AQV A;  8GSS A;  3ZRD A;  3CMI A;  1WPI A;  4KX4 A;  1ACV A;  5LNK e;  3VWW A;  3D4M A;  4BPY A;  2V41 A;  3LJR A;  4RQR A;  2VCZ A;  2VCQ A;  3EMP A;  1B4Q A;  2PMT A;  2OBI A;  1E6B A;  1EOH A;  1WJK A;  4MH3 A;  1VGL A;  3FR6 A;  4XRA A;  3KMO A;  1QFN A;  6GSX A;  5BMU A;  1OYJ A;  1Z3E A;  5DCH A;  1W4V A;  2R3X A;  4DSQ A;  1O6J A;  1Y25 A;  3VI7 A;  2VL2 C;  3LOR A;  5GST A;  5GZZ B;  4MZC A;  3ZIT A;  1Z7P A;  4BVY B;  1MDK A;  3M9J A;  3GN3 A;  3JCM L;  2P0G A;  3H79 A;  2B6M A;  2JAC A;  1ZZY A;  2LRC A;  1RW1 A;  4DSS B;  1BYE A;  1E2Y A;  3EU4 A;  4BL7 A;  2L57 A;  3BCI A;  6GSS A;  2IWT A;  2J23 A;  2L5O A;  2OAD A;  2JAD A;  2O87 A;  2F8F A;  3DVX A;  4KDX A;  2FNO A;  2QA1 A;  5CRD A;  3LSZ A;  4IQA A;  3ZML A;  4KGI A;  4V2L A;  2P31 A;  1RQM A;  3Q6O A;  4NPB A;  3APO A;  2B3S A;  1OC8 A;  1PGT A;  1SEN A;  3L4N A;  2CVB A;  2H6X A;  2AB6 A;  4F0C A;  1VF3 A;  3VWX A;  1FO5 A;  4D73 A;  3S9F A;  1M9A A;  2B5E A;  2HI7 A;  3EU3 A;  3DVW A;  4RI6 A;  3UIW A;  1SJI A;  5G5E A;  4ZBB A;  3KP8 A;  2E2M A;  3C7M A;  4WKW A;  4MF6 A;  3A5I A;  1GUM A;  3UMA A;  1K0O A;  4IJI A;  5HR3 A;  1TRU A;  4KSO A;  4OO5 A;  2JSY A;  1W89 A;  2IIY A;  4NV5 A;  5A4U A;  2O8V B;  1H4O A;  3LYK A;  5EL8 A;  2GTU A;  1K3L A;  2GQK A;  1SL1 B;  1SK0 A;  2OE0 A;  2GLR A;  1GSE A;  4ML6 A;  4D73 B;  3RHB A;  3TKS A;  1GSU A;  4EE0 A;  3LG6 A;  2L6D A;  4MA9 A;  2LQQ A;  1SD8 A;  3KEB A;  3IAM 2;  6GSY A;  5DCG A;  4ZB9 A;  4I2U A;  2OA7 A;  2H8L A;  5F07 A;  1HNC A;  3CRT A;  4QQ7 A;  2C1Y A;  1IYI A;  4ZIJ A;  4PX1 A;  3RPP A;  4KND A;  1AAZ A;  4OWY A;  14GS A;  3HJO A;  5CRG A;  1A23 A;  5BRT A;  4WXT A;  1DE1 A;  2WFC A;  2HRK A;  4ULX A;  4OCE A;  3PIN A;  1A8Y A;  2PN8 A;  5G5F A;  3F63 A;  2JZT A;  4NAX A;  3D22 A;  1JZR A;  3GKM A;  2H6Z A;  1WP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...