4V1Ap

Structure of the large subunit of the mammalian mitoribosome, part 2 of 2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
AAALARLGLRAVKQVRVQFCPFEKNVESTRTFLQAVSSEKVRCTNLNCSVIADVRHDGSEPCVDVLFGDGHRLIMRGAHLTAQEMLTAFASHIQARG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords MITORIBOSOMAL PROTEIN ML37, MRPL37
publication title The Complete Structure of the Large Subunit of the Mammalian Mitochondrial Ribosome
pubmed doi rcsb
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2014-09-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4v1ap00
4PNFA 1KTEA 1ZOFA 7GSSA 3W8SA 3RHBA 4WBJA 2CT6A 2GQKA 3GURA 5DDLA 3F3QA 1Z5YE 1JZDA 4GWRA 2PERA 4WF4A 3BCIA 1GSYA 1B9XC 1A0RP 4HUAA 1O73A 3NOFA 1SL1B 1OAZA 2GDRA 3H4KA 2AUVA 1V2AA 3TOUA 1XWKA 2O8VB 1MD3A 4HU9A 1YEXA 3IV4A 5FT3A 3UAPA 1TKDB 19GSA 2F9SA 5B8BA 2YV9A 5IIZA 1MDJA 2XHFA 5KN3A 4FH8A 3FK8A 4IW9A 2F3MA 4D73A 1A24A 3KP8A 4JRRA 3BCKA 1AQXA 3CMIA 4TOPA 2GSRA 4N10A 3UOMA 5D9TA 3FRCA 4BWSA 1BJXA 3C71A 1K3YA 4JE1A 1U88A 5CRWA 2GQLA 9GSSA 2VL2A 3IK7A 4IGJA 1V57A 1VGLA 4KDUA 1TRUA 3QFAC 4KSMA 3EU3A 1AIUA 2VL2C 3LFLA 2YV7A 2O89A 2HSYA 2BTOT 3KH9A 2VOCA 4KNDA 2HFDA 5JCWA 3TJJA 2EIRA 3TJKA 3EE2A 3C1RA 1S3DA 5F05A 5DCHA 1FVKA 3ERWA 2FWGA 2RM6A 2RM5A 5IMFA 2H0GA 4WEYA 2IJYA 2G0FA 4J56E 2FD3A 1SJ6A 1WRYA 6GSTA 3CXGA 3LEFA 4MH2A 1B4QA 4L0UA 1YJ6A 1OC9A 3F8UA 2CA8A 2WZ9A 2C80A 3FYGA 1PD21 3O3TA 2IMKA 1DBYA 4GQFA 5A4WA 5IOWA 1GTUA 2V2GA 3DXBA 3ZIVA 1XFLA 1GLPA 1OC8A 2JSZA 4V1Ag 4BWQA 1AW9A 1EP7A 1FB0A 2R6KA 1K0DA 2HSHA 2M46A 3PGTA 1EEJA 2PU9C 3A2WA 2B6MA 2V41A 5COHA 4O5RA 4DSQA 2HZEB 1V9WA 2EC4A 5C00A 3A5WA 2AAWA 3DVWA 1E2YA 5GSTA 2GSSA 1T7PB 1ACVA 3FHKA 2JL4A 1R4WA 5DAKB 2M80A 3ME7A 1WP0A 1YKCA 4K9ZA 5ECNB 3VK9A 2X64A 3P8WA 2WB9A 5F8BA 1EEMA 2VM2A 2H75A 1VF4A 5D73A 1FOVA 4YQVA 2LJKA 2LTKA 3FR9A 1F3BA 2DBCA 2N5BA 4WR4A 1M2DA 1ERVA 2YWIA 3CSIA 3QR6A 1HNBA 1TI1A 3D0ZA 5HR0A 2FY6A 3KEBA 1SENA 2QKEA 2VM1A 3WD6A 4MZWA 4KB3A 3O76A 1ABAA 1SJZA 3P90A 2H1AA 3ZTLA 1R7HA 2HZEA 1FO5A 1GP1A 1QMVA 2LRCA 4KCEA 4OCEA 3TJFA 2IPAA 4MLYA 4EL1A 2LS5A 1ML6A 1GNWA 4TR1A 4QQ7A 6GSSA 2HRFA 2FGXA 3N5OA 1G6WA 5HQPA 4KW6A 3BD2A 3IDVA 1DUGA 4ZB9A 3UARA 1TK0B 3HVVA 2DSAA 6GSUA 2LNTA 3HVSA 3F9UA 3S9FA 3EYTA 3U6VA 2WFCA 3DYRA 4IP1A 4KAEA 2FA4A 2WCIA 1PL1A 5GSSA 5ENUA 1O7UA 5ELGA 4ZL8A 4ISDA 4MJEA 3GTUA 3KGKA 3DD3A 3H1NA 1T1VA 4NAXA 2TIRA 3J7Yb 3ZRDA 4WKWA 2DC5A 4PUAA 2VCTA 1ZZYA 1GUKA 5HR1A 1SYRA 1O8WA 4YQMA 3DEXA 2H0IA 4PX1A 2E2MA 6GSWA 2OA7A 1SYXA 3D4TA 4OO5A 5KN1A 4MP4A 2X8GA 5HR3A 1F9MA 1TXXA 3GKNA 2IIYA 4POMA 3IAS2 4JR4A 1M2AA 1TRVA 2B7KA 1JZRA 3TRPA 5ECRB 1GTBA 1T8EB 2ES7A 3CTFA 2GZZA 1TU8A 3GKMA 5D96A 2B5YA 3C8EA 1GLQA 2JZTA 3DWVA 1HQOA 5IMDA 2FCHA 1PX6A 2H76A 5DJLA 3WGEA 1F6MC 3GSSA 1DE1A 4RI6A 1W4VA 2OE3A 4OO4A 5ELAA 2CX3A 2C3NA 1MDIA 1V98A 3IA1A 4G9HA 2KOKA 4HJ2A 1T3BA 4WXTA 2HXKA 2HE3A 2B5EA 2NTOA 2MBSA 1C72A 4MMMA 1A0FA 3LWAA 3EMPA 3LORA 2VCQA 2PGTA 1OC3A 2OBIA 2E7PA 3I43A 5ABRA 2JACA 3KD0A 2LRNA 1UVZA 3VWXA 4AJ6A 3HVXA 1XPVA 4F9ZA 2XPDA 2KP2A 1NHYA 4V2NA 1CQGA 1QXHA 1T4ZA 3WT2A 1CQHA 2JSYA 3MNGA 1W89A 1GSUA 1R26A 2I81A 4DSSB 3QFBC 1AQWA 3FEUA 1ILOA 4H86A 4GSSA 1G7EA 3PR8A 2RIIA 1SKRB 2VIMA 2P5QA 4TVEA 3IAM2 3TRXA 1BYEA 3GL3A 2YPMA 4G2EA 3UMAA 3J7Yk 1B4PA 1YEPA 5IO0A 4POLA 1LU4A 5GAND 5CYYA 4YH2A 2VL3A 5ECSA 2F51A 2I1UA 4ML6A 2H6ZA 2DIYA 1TRWA 2L4CA 2C0FA 3LYKA 4ZL9A 1RK4A 1M2BA 3GKXA 3HCZA 1WWJA 4HDEA 8GSSA 3KCMA 3AY8A 4O92A 1EV9A 3TKQA 3VWWA 1YF1A 4NWYA 1NW2A 4AGSA 1X9WB 2H1BA 3VI5A 5H5QA 3US3A 3ZIJA 1TDIA 3KM6A 4TXOB 2WDUA 4L5OA 1THXA 4I6XA 2GSQA 5FHIA 2IN3A 5J5NA 3ZMKA 3CRUA 3TGZA 4MPFA 5AIXA 4POKA 4E8EA 4EKZA 4I2TA 2K8SA 1JZOA 4DSSA 3CRTA 1X0RA 3M3MA 1ERUA 5ECMB 2VO4A 2HT9A 2R37A 4ZBDA 3QMXA 3G7IA 2CZ2A 3L0HA 3KTLA 2CV4A 1HNAA 3TKPA 1PQNA 4JEDA 4V1Ap 4JZQA 2GS3A 1XXUA 2DJ2A 3W8JA 5DVBA 1TK8B 2DJKA 3KMNA 1GSEA 3WT1A 3WGXA 2PVOC 3F4TA 1O6JA 5IMVA 3VWUA 1XBSA 3CBUA 4GTUA 2RUEA 4GXZA 1YKAA 5A4VA 1PX7A 2MYGA 1X9MB 1ST9A 4YAVA 3ZL5A 1J0FA 1EOHA 4F82A 5D93A 4IJIA 2FLSA 2MMAA 3F3RA 1PSQA 2C0GA 2O7KA 3F4SA 4HQSA 3CSHA 3IRAA 1TI3A 3HZ4A 2PMTA 1Z7PA 4HJMA 5J9BA 2X99A 5G1LA 2WJUA 1XIYA 1PMTA 2HNLA 3M0FA 2EIQA 4NXIA 5H5SA 1J08A 2DMLA 3GFKA 5IM9A 5JWRB 2K18A 2IMEA 2CVDA 1XOBA 1M0UA 2MMNA 1SD8A 5GZZB 1XWGA 2CZ3A 2I3YA 5D9VA 3GRXA 4TKYA 4CDOA 3TKSA 3LG6A 3K8NA 5JWOB 2XBQA 5CREA 3R2QA 1J9BA 2C8UA 2IFQB 3TKSC 4WR5A 2YNXA 1G0TA 1BAYA 2LQQA 1ZYEA 4ZB8A 3C7MA 4ZBBA 1THOA 4N0VA 5IMZA 3DRNA 3HY2A 4HQZA 3TUEA 2LUSA 3Q19A 3OR5A 1TJDA 5CP1A 3VURA 2O85A 3M9JA 2CVBA 4NPBA 5KN0A 5G5FA 4LL1B 5F0GA 4MJAA 2P0GA 1JLVA 5CO3A 5B8AA 2OE0A 3P2AA 2YZHA 2CVKA 2YWOA 5C04A 2MBTA 3KZQA 3W6GA 1XWCA 1Z3EA 3LGCA 3TDGA 2L4QA 2ON5A 5DALB 1X5DA 3U5RE 5AN1A 1K0AA 2RLIA 2JZSA 2AHEA 5F07A 1WE0A 3VI7A 4K0GA 5IMCA 2N5AA 3IE3A 1TW9A 4GF0A 5D9WA 1I5GA 5CRDA 3GH6A 3DKSA 2DJJA 3CTGA 1OE8A 2A4VA 3LSZA 3MSZA 2GLRA 2KLXA 1T4YA 4KDYA 4EDYA 1B48A 4EUYA 4XHMA 4HZ4A 1IYHA 4G19A 4ZL7A 1USBA 3TKSE 2VCZA 4F0BA 4ECCA 5ECPB 4Q5NA 4JU5A 3IR4A 4ACSA 5CAXA 2PUKC 4P3YB 2IWTA 4V2LA 4XS6A 4MF6A 1XZOA 3QAVA 4XRDA 3GNJA 2PVQA 1XWAA 4TR3A 4DSRA 3SBCA 5G1KA 3VWVA 5L71A 2PBJA 1FHEA 1R5AA 2ALBA 3NIVA 5HFIA 4TXVA 5ECHB 3TB2A 3QPMA 4K7NA 2FWHA 1K0OA 3KMOA 1EZKA 22GSA 4Q5RA 4OFNA 3FZ5A 3HJOA 5E4WA 5DAKA 1PGTA 4K6XA 2OBKA 2B5XA 5IO2A 4K8MA 1EP8A 1R5PA 2H01A 1JZWA 1GL8A 1SJIA 3UL3A 1OVNA 3Q18A 3DGQA 1I9DA 2YZUA 1U6TA 4MJCA 2OADA 1S3CA 2H71A 5CRGA 1K0MA 4X0XA 2I9HA 3E0UA 4F03A 2FA8A 4HS1A 2H1DA 2KHPA 1UA5A 3IBHA 1EGOA 2Z9SA 3Q74A 2A2SA 3L4NA 3G7YA 4O32A 4MA9A 1GWCA 3M8NA 2YJHA 4MF7A 1Z6MA 4JR6A 2AYTA 2YCDA 4KE3A 5KEJA 2GSTA 3ED3A 1IYIA 2C4JA 2IMIA 1GTAA 1PL2A 1PN9A 2OJLA 3QOUA 1A2MA 3RBTA 4XTSA 5ID2B 3QDNA 1SKWB 4OWYA 2ZCTA 20GSA 1V58A 5A5KA 2P5RA 2P31A 3D6IA 2FWEA 2GT5A 2YWNA 1AUCA 2GTUA 1N8JA 4N0ZA 1K0CA 3HA9A 1FVJA 3F0IA 4EF0A 3F6DA 2PN8A 4GQCA 3ZFLA 5FWGA 2V32A 4XS4B 3UJ1A 5ECKB 4ZB6A 4V2MA 3FZAA 2IMFA 3TJBA 4KX4A 3A3TA 5F06A 3GX0A 3GV1A 3GMFA 4HZ2A 4ECBA 5LD0A 1WOUA 5J9CA 4PQIA 3GKKA 1AXDA 2N5FA 3BOAA 3F6FA 4MZCA 1A23A 4TR0A 3GN3A 2VLUA 1GNEA 2BJXA 3I9V2 2YN1A 1QGVA 3MWHA 3TKRA 5HFGA 3I6AA 4IJ3A 4ECIA 4BPYA 4NHZA 2HZFA 1BQ7A 13GSA 18GSA 1HD2A 2GZPA 3ERGA 1K0BA 3EMXA 2J9HA 1A2JA 4IVFA 2H66A 4EDZA 2MMOA 4IQAA 2H6XA 2FUG2 1XVWA 4MPGA 4GRFA 1XW5A 2NBSA 1Q98A 4XIHA 3MDKA 4O7HA 2KP1A 2CAIA 1WIKA 4I97A 5IMAA 2H19A 3RPPA 2X8CA 2I4AA 2NPBA 4IS0A 3UVHA 2CX4A 3QD9A 5AIVA 5EL8A 2YOIA 4CW9A 1S3AA 3HHVA 3GIXA 4MCUA 1F37A 1FW1A 1G6YA 2A2RA 1GSDA 2RUFA 3GHAA 4K7IA 2YWMA 2QGVA 2R3XA 1K0NA 2WS2A 1G7OA 2CAQA 4TRXA 1GH2A 2R2JA 3ISOA 2HLSA 1M9BA 5JCGA 4YAPA 3UIWA 3BBYA 3A2VA 4FO5A 2CQ9A 4Z7XA 2MMZA 1H75A 1VF2A 4KUNA 1ZYQB 2GQMA 5ECOB 2H0HA 1KEBA 1PKZA 3N9JA 3EINA 3EVIA 2HI7A 1VF3A 1WMJA 4K2DA 1MEKA 4D73B 4WETA 5J3RA 1KNGA 2WULA 3IPZA 1Y6EA 3DIEA 4MZBA 2GGTA 4PNGA 5G2ZA 5EPFA 1EV4A 2J23A 2R5GA 4RQXA 2K8VA 5B6NA 2VCVA 1GSSA 1M99A 5G31A 2LEGA 4OFTA 1XW6A 3CYNA 4IHUA 3WGDA 2DJ1A 2AJQB 2AB6A 2C0DA 1H4OA 4KDXA 4QL7A 4MK3A 3IHQA 17GSA 3DVXA 1E6BA 2VLVA 4N11A 1EGRA 2L6CA 3A2XA 5CNWA 1T00A 4F2IA 3CSJA 2ZNMA 3EWLA 5AISA 4KCAA 4Q5QA 3MAKA 3FKFA 4KH7A 1BG5A 3WYWA 3E3EA 1SU9A 3H79A 1F2EA 4RUVA 4EXJA 1HNCA 1Z6NA 3QAWA 2VCWA 2FNOA 1HYUA 1SKSB 3L9SA 4LLRA 4NV2A 4F0CA 4TXOA 2F8AA 3TJGA 5CRHA 2C0EA 1U87A 4IKHA 2XBIA 1OC9B 3H8QA 1XWBA 4BL7A 2OACA 3IXRA 4HEA2 3ERFA 1ZMAA 4IN0A 3D5JA 4FYBA 4TR4A 4FYUA 5D9XA 3I69A 1A2LA 2H8LA 2DLXA 1OKTA 1QFNA 4IBPA 3ZITA 1UN2A 1PRXA 2LSTA 3FZ4A 2C3QA 2HRNA 3UBLA 2X8HA 4ZIJA 3LXZA 5DBQA 3KJYA 1QUWA 1A8LA 2B3SA 3ZVJD 1SK1A 3C73A 4MH3A 3D22A 3FW2A 4XCSA 5DQSA 3GUSA 3L9VA 2B1KA 2F8FA 2JADA 3ME8A 1AAZA 1ON4A 4EO3A 3KH7A 5E59A 3NZNA 1AC1A 4ZILA 3KTBA 5EY6A 1Y25A 4IELA 3F63A 2LKUA 5IPHA 1OYJA 16GSA 1K3OA 4XRAA 3FZ9A 4NV5A 2DJ3A 6GSVA 4PURA 3RHCA 3RDWA 3QCPA 2VLTA 11GSA 1SL0B 4K1FA 2G2QA 3HJMA 1ERTA 4CHSA 2L5LA 1Q4JA 2QC7A 1O85A 4RQRA 1SL2B 5ECLB 2V6KA 4GSNA 1B9YC 4PGTA 4ULXA 5G30A 5A4UA 5AGYA 2LRTA 2LJAA 4HOJA 3HXSA 2H1GA 5J4UA 2DJ0A 4ILFA 1OE7A 2TRCP 2FHEA 3D21A 2K6VA 4TR1B 4LMVA 4I2UA 12GSA 1Z9HA 1VRSD 4TW5A 3ZREA 1M7TA 1GULA 4L5LA 1FAAA 2IFQA 1URMA 3FR3A 4TN8A 4OFMA 1BX9A 4JBBA 4MDCA 5ECIB 2E0QA 1OKDA 1X9SB 2GZYA 5ECQB 4L0WA 4YQUA 1JLWA 2V1MA 1TRSA 3GL5A 4PQHA 1QK8A 3GTUB 1RW1A 4EVMA 4PXOA 2TRXA 2OE1A 2JZRA 2QSIA 1GUMA 1O8XA 2V6OA 4KSOA 2L59A 1TK5B 3PH9A 3IOSA 4L8EA 3APSA 3LXTA 3G7JA 3PINA 1UC7A 3G9BA 2M72A 2XC2A 4MF5A 2R4VA 5D8IA 1SK0A 2H6YA 3GYKA 2H72A 1YZXA 3TRQA 5DALA 5IOXA 2L6DA 4BA7A 4IP6A 2WGRA 4OCFA 4NHWA 3HZ8A 1DSBA 1GUHA 1MDKA 1WJKA 1YY7A 1DE2A 2D2ZA 2NDOA 3ZFBA 2IMDA 4GCIA 3P7XA 1A8YA 1RQMA 3H93A 1JHBA 2REMA 4FIWA 4AF2A 5KN2A 2PPTA 2VUPA 3ZMLA 2DIZA 3RAZA 2XPEA 1U3AA 1WPIA 2PWJA 3L9UA 4E8HA 1EOGA 4OD7A 1PA3A 3LYPA 3KP9A 1TP9A 3RPNA 1XVQA 2LV3A 3HKRA 4ZXGA 2MZCA 4QL9A 2H30A 4ZBAA 1ERWA 4PQ1A 1FB6A 1X5EA 4NMUA 3UEMA 2C3TA 4LMWA 1K3LA 4PUFC 4DEJA 5B6MA 1F3AA 3M9KA 2B7JA 3DMLA 1GSQA 4K0NA 2YJ7A 1GTIA 6GSYA 2DMMA 3IC4A 5GAPD 5DQYA 1GRXA 1N2AA 2BMXA 2EIOA 2IL3A 2LNSA 4Q5FA 2LJRA 1ZCPA 2OKAA 3D4MA 1XW9A 1JFUA 1YF0A 2L5OA 5H5RA 1EWXA 3APQA 4GSTA 4BVYA 2JU5A 10GSA 4HI7A 2KUCA 4KA0A 4MJBA 5INYA 5IQYA 1QQ2A 3HDCA 1FG4A 3VPTA 3KIJA 4WF5A 2L57A 3E9JB 4FYCA 1X5CA 5LCZA 2VL9A 1TTZA 3QAGA 4ML1A 2H73A 4AJ7A 5JWQB 3EURA 5JCUA 3LQ7A 3V1WA 3LJRA 1AQVA 2WRTA 5DCGA 1LJRA 2LQOA 4BVXA 3VLNA 1Z7RA 2VCXA 2AV4A 4KGIA 2GT6A 6GSXA 5ID2A 3KXOA 4J2FA 3TOTA 4POBA 1SD9A 2ZUPA 4AJ8A 2C1YA 4X1UA 5HR2A 4X43A 1XOAA 2GVPA 3EU4A 1V40A 2VD1A 5IPGA 3UBKA 1U3IA 3O6TA 3ZZXA 2HYXA 4OMVA 3TCOA 2O87A 1YDKA 1O81A 2VD0A 1GSFA 4G10A 4J57E 14GSA 3M1GA 4XS4A 3VFIA 1M9AA 4WBRD 4DVCA 3GSTA 1XCCA 3UVTA 1NHOA 2VAFA 1BEDA 3HJPA 2K9FA 4ECJA 4LA1A 4RI7A 5LNKe 3ZLPA 2H70A 3Q6OA 1MTCA 4N30A 3APOA 1NM3A 3FY7A 2ON7A 4IQ1A 1VF1A 4MABA 1TU7A 4LL4B 4EE0A 3C1SA 5HFKA 5EVOA 5J41A 1PKWA 5B7CA 3IK9A 3GH9A 4GLTA 3EC3A 4K7OA 4HU7A 3FR6A 5DJMA 2YANA 3VPQA 3JCML 1LBKA 3BJ5A 1TOFA 3L78A 3ZYWA 4EC0A 3GA4A 3ZVJA 1B8XA 2FWFA 4I8BA 4I5QA 1SK2A 3F4RA 4XS1A 1NSWA 5G5EA 1YQ1A 1ZGNA 2B1LA 3HYPA 3SWLA 3HD5A 1KBNA 2YP6A 1ZL9A 2H74A 4ID0A 2NVLA 2E2GA 3GX8A 1MD4A
chains in the Genus database with same CATH superfamily
4PNFA 1KTEA 1ZOFA 7GSSA 3W8SA 3RHBA 4WBJA 2CT6A 2GQKA 3GURA 5DDLA 3F3QA 1Z5YE 1JZDA 4GWRA 2PERA 4WF4A 3BCIA 1GSYA 1B9XC 1A0RP 4HUAA 1O73A 3NOFA 1SL1B 1OAZA 2GDRA 3H4KA 1XG8A 2AUVA 1V2AA 3TOUA 1XWKA 2O8VB 1MD3A 4HU9A 1YEXA 3IV4A 5FT3A 3UAPA 1TKDB 19GSA 2F9SA 5B8BA 2YV9A 5IIZA 1MDJA 2XHFA 5KN3A 4FH8A 3FK8A 4IW9A 2F3MA 4D73A 1A24A 3KP8A 4JRRA 3BCKA 1AQXA 3CMIA 4TOPA 2GSRA 4N10A 3UOMA 5D9TA 3FRCA 4BWSA 1BJXA 2HRAA 3C71A 1K3YA 4JE1A 1U88A 5CRWA 2GQLA 9GSSA 2VL2A 3IK7A 4IGJA 1V57A 1VGLA 4KDUA 1TRUA 3QFAC 4KSMA 3EU3A 1AIUA 2VL2C 3LFLA 2YV7A 2O89A 2HSYA 2BTOT 3KH9A 2VOCA 4KNDA 2HFDA 5JCWA 3TJJA 2EIRA 3TJKA 3EE2A 3C1RA 1S3DA 5F05A 5DCHA 1FVKA 3ERWA 2FWGA 2RM6A 2RM5A 5IMFA 2H0GA 4WEYA 2IJYA 2G0FA 4J56E 2FD3A 1SJ6A 1WRYA 6GSTA 3CXGA 3LEFA 4MH2A 1B4QA 4L0UA 1YJ6A 1OC9A 3F8UA 2CA8A 2WZ9A 3IHGA 2C80A 3FYGA 1PD21 3O3TA 2IMKA 4X4JA 4GQFA 5A4WA 1DBYA 5IOWA 1GTUA 2V2GA 3DXBA 3ZIVA 1XFLA 1GLPA 1OC8A 4A5PA 2JSZA 4V1Ag 4BWQA 1AW9A 1EP7A 1FB0A 2R6KA 1K0DA 2HSHA 2M46A 3PGTA 1EEJA 2PU9C 3A2WA 2B6MA 2V41A 5COHA 4O5RA 4DSQA 2HZEB 1V9WA 2EC4A 5C00A 3A5WA 2AAWA 3DVWA 1E2YA 5GSTA 2GSSA 1T7PB 1ACVA 3FHKA 2JL4A 1R4WA 5DAKB 2M80A 3ME7A 1WP0A 1YKCA 4K9ZA 5ECNB 3VK9A 2X64A 3P8WA 2WB9A 4USSA 5F8BA 1EEMA 2VM2A 2H75A 1VF4A 5D73A 1FOVA 4YQVA 2LJKA 2LTKA 3FR9A 1F3BA 2DBCA 2N5BA 4WR4A 1M2DA 1ERVA 2YWIA 3CSIA 3QR6A 1ZYNA 1HNBA 1TI1A 3D0ZA 5HR0A 2FY6A 3KEBA 1SENA 2QKEA 2VM1A 3WD6A 4MZWA 4KB3A 4K5RA 3O76A 1ABAA 1SJZA 3P90A 2H1AA 3ZTLA 1R7HA 2HZEA 1FO5A 1GP1A 1QMVA 2LRCA 4KCEA 4OCEA 3TJFA 2IPAA 4MLYA 4EL1A 2LS5A 1ML6A 1GNWA 4TR1A 4QQ7A 6GSSA 2HRFA 2FGXA 3N5OA 1G6WA 5HQPA 4KW6A 3BD2A 3IDVA 1DUGA 4ZB9A 3UARA 1TK0B 3HVVA 2DSAA 6GSUA 2LNTA 3HVSA 3F9UA 3S9FA 3EYTA 3U6VA 2WFCA 3DYRA 4IP1A 4KAEA 2FA4A 2WCIA 1PL1A 5GSSA 5ENUA 2R0GA 1O7UA 5ELGA 2A2PA 4ZL8A 4ISDA 4MJEA 3GTUA 3KGKA 3DD3A 3H1NA 1T1VA 4NAXA 2TIRA 3J7Yb 3ZRDA 4WKWA 2DC5A 4Z2UA 4PUAA 2VCTA 1ZZYA 1GUKA 5HR1A 1SYRA 1O8WA 4YQMA 3DEXA 2H0IA 4PX1A 2E2MA 6GSWA 2OA7A 1SYXA 3D4TA 4EIPA 4OO5A 5KN1A 4MP4A 2X8GA 5HR3A 1F9MA 1TXXA 3GKNA 2IIYA 4POMA 3IAS2 4JR4A 1M2AA 1TRVA 2B7KA 1JZRA 3TRPA 5ECRB 1GTBA 1T8EB 2ES7A 3CTFA 2GZZA 1TU8A 3GKMA 4YKGA 5D96A 2B5YA 3C8EA 4G0KA 2R0PA 1GLQA 2JZTA 3DWVA 1HQOA 4K5SA 5IMDA 2FCHA 1PX6A 2H76A 5DJLA 3WGEA 1F6MC 3GSSA 1DE1A 4RI6A 1W4VA 2OE3A 4OO4A 5ELAA 2CX3A 2C3NA 1MDIA 1V98A 3IA1A 4G9HA 2KOKA 4HJ2A 1T3BA 4WXTA 2HXKA 2HE3A 2B5EA 2NTOA 2MBSA 5BMUA 1C72A 4MMMA 1A0FA 3LWAA 3EMPA 3LORA 2VCQA 2PGTA 1OC3A 2OBIA 2E7PA 3I43A 5ABRA 2JACA 3KD0A 2LRNA 1UVZA 3VWXA 4AJ6A 3MYDA 3HVXA 1XPVA 4F9ZA 4HSCX 2XPDA 2KP2A 1NHYA 4V2NA 1CQGA 4G0IA 1QXHA 1T4ZA 3WT2A 1CQHA 2JSYA 3MNGA 3CQFA 3FMWA 1W89A 1GSUA 1R26A 2I81A 4DSSB 3QFBC 1AQWA 3FEUA 1ILOA 4H86A 4GSSA 1G7EA 3PR8A 2RIIA 1SKRB 2VIMA 2P5QA 4TVEA 3IAM2 3TRXA 1BYEA 3GL3A 2YPMA 4G2EA 3UMAA 3J7Yk 1B4PA 1YEPA 5IO0A 4POLA 1LU4A 5GAND 5CYYA 4YH2A 2VL3A 5ECSA 2F51A 2I1UA 4ML6A 2H6ZA 2DIYA 1TRWA 2L4CA 2C0FA 3LYKA 4ZL9A 1RK4A 1M2BA 3GKXA 3HCZA 1WWJA 4HDEA 8GSSA 3KCMA 3AY8A 4O92A 1EV9A 3TKQA 3VWWA 1YF1A 4NWYA 1NW2A 4AGSA 1X9WB 2H1BA 3VI5A 5H5QA 3US3A 3ZIJA 1TDIA 3KM6A 4TXOB 2WDUA 4L5OA 1THXA 4I6XA 2GSQA 5FHIA 2IN3A 4BL7B 5J5NA 3ZMKA 3CRUA 3TGZA 4MPFA 5AIXA 4POKA 4E8EA 4EKZA 4I2TA 2K8SA 1JZOA 4DSSA 3CRTA 1X0RA 3M3MA 1ERUA 5ECMB 2VO4A 2HT9A 2R37A 4ZBDA 3QMXA 4O5QA 3G7IA 2CZ2A 3L0HA 3KTLA 2CV4A 1HNAA 3TKPA 1PQNA 4JEDA 4V1Ap 4JZQA 2GS3A 1XXUA 2DJ2A 3W8JA 5DVBA 1TK8B 2DJKA 3KMNA 1GSEA 3WT1A 3WGXA 1ZYPA 2PVOC 3F4TA 1O6JA 5IMVA 3VWUA 1XBSA 3CBUA 4GTUA 2RUEA 4GXZA 1YKAA 5A4VA 1PX7A 2MYGA 1X9MB 1ST9A 4YAVA 3ZL5A 1J0FA 1EOHA 4F82A 5D93A 4IJIA 2FLSA 2MMAA 3F3RA 1PSQA 2C0GA 2O7KA 3F4SA 4HQSA 3CSHA 2UZ8A 3IRAA 1TI3A 3HZ4A 2PMTA 1Z7PA 4HJMA 5J9BA 2X99A 5G1LA 2WJUA 2X4AA 1XIYA 1PMTA 2HNLA 3M0FA 2EIQA 4NXIA 5H5SA 1J08A 2DMLA 3GFKA 5IM9A 1M3IA 5JWRB 2K18A 2IMEA 2CVDA 1XOBA 1M0UA 2MMNA 1SD8A 5GZZB 1XWGA 2CZ3A 2I3YA 5D9VA 3GRXA 4TKYA 4CDOA 3TKSA 3LG6A 3K8NA 4MNNA 5JWOB 2XBQA 5CREA 3R2QA 1J9BA 2C8UA 2IFQB 3TKSC 4WR5A 4Z2TA 2YNXA 1G0TA 1BAYA 2LQQA 1ZYEA 4ZB8A 3C7MA 4ZBBA 1THOA 4N0VA 5IMZA 3DRNA 3HY2A 4HQZA 3TUEA 2LUSA 3Q19A 3OR5A 1TJDA 5CP1A 3VURA 2O85A 3M9JA 2CVBA 2DKHA 4NPBA 5KN0A 1PFOA 5G5FA 4LL1B 5F0GA 4MJAA 2QA1A 2P0GA 1JLVA 5CO3A 5B8AA 2OE0A 3P2AA 2YZHA 2CVKA 2YWOA 5C04A 2MBTA 3KZQA 3W6GA 1XWCA 1Z3EA 3LGCA 3TDGA 2L4QA 2ON5A 5DALB 1X5DA 3U5RE 5AN1A 1K0AA 2RLIA 2JZSA 2AHEA 5F07A 1WE0A 3VI7A 4K0GA 5IMCA 2N5AA 3IE3A 1TW9A 4GF0A 5D9WA 1I5GA 5CRDA 3GH6A 3DKSA 2DJJA 3CTGA 1OE8A 2A4VA 3LSZA 3MSZA 2GLRA 2KLXA 1T4YA 4KDYA 4EDYA 1B48A 4EUYA 4XHMA 4HZ4A 1IYHA 4G19A 4ZL7A 1USBA 3TKSE 2VCZA 3PPUA 4F0BA 4ECCA 5ECPB 4Q5NA 4JU5A 3IR4A 4ACSA 5CAXA 2PUKC 4P3YB 2IWTA 4V2LA 4XS6A 4MF6A 1XZOA 3QAVA 4XRDA 3GNJA 2PVQA 1XWAA 4TR3A 4DSRA 3SBCA 5G1KA 3VWVA 5L71A 2PBJA 1FHEA 1R5AA 2ALBA 3NIVA 5HFIA 4TXVA 5ECHB 3TB2A 3QPMA 4K7NA 2FWHA 1K0OA 3KMOA 1EZKA 22GSA 4Q5RA 4OFNA 3FZ5A 3HJOA 5E4WA 5DAKA 1PGTA 4K6XA 2OBKA 2B5XA 5IO2A 4K8MA 1EP8A 1R5PA 2H01A 2A4HA 1JZWA 1GL8A 4BVYB 1SJIA 3UL3A 1OVNA 3Q18A 3DGQA 4K2XA 1I9DA 2YZUA 1U6TA 4MJCA 2OADA 1S3CA 2H71A 5CRGA 1K0MA 4X0XA 2I9HA 3E0UA 4F03A 2FA8A 4HS1A 2H1DA 2KHPA 1UA5A 3IBHA 1EGOA 2Z9SA 3Q74A 2A2SA 3L4NA 3G7YA 4O32A 4MA9A 1GWCA 1M3JA 3M8NA 2YJHA 4MF7A 1Z6MA 4JR6A 2AYTA 2YCDA 4KE3A 5KEJA 2GSTA 3ED3A 1IYIA 2C4JA 2IMIA 1GTAA 1PL2A 1PN9A 2OJLA 3QOUA 1A2MA 3RBTA 4XTSA 5ID2B 3QDNA 1SKWB 4OWYA 2ZCTA 20GSA 1V58A 5A5KA 2P5RA 2P31A 3D6IA 2FWEA 2GT5A 4ICYA 2YWNA 1AUCA 2GTUA 1N8JA 4N0ZA 1K0CA 3HA9A 1FVJA 3F0IA 4EF0A 3F6DA 2PN8A 4GQCA 3ZFLA 5FWGA 2V32A 4XS4B 3UJ1A 5ECKB 4ZB6A 4V2MA 3FZAA 2IMFA 3TJBA 4KX4A 3A3TA 5F06A 3GX0A 3GV1A 3GMFA 4HZ2A 4ECBA 5LD0A 1WOUA 5J9CA 4PQIA 3GKKA 1AXDA 4KF9A 2N5FA 3BOAA 3F6FA 4MZCA 1A23A 4TR0A 3GN3A 2VLUA 1GNEA 2X49A 2BJXA 3I9V2 2YN1A 1QGVA 3MWHA 3TKRA 5HFGA 3I6AA 4IJ3A 4ECIA 4BPYA 4NHZA 2HZFA 1BQ7A 13GSA 18GSA 1HD2A 2GZPA 3ERGA 1K0BA 3EMXA 2J9HA 1A2JA 4IVFA 3EPTA 2H66A 4EDZA 2MMOA 4IQAA 2H6XA 2FUG2 1XVWA 4MPGA 4GRFA 1XW5A 4Z2RA 2NBSA 1Q98A 4XIHA 3MDKA 4O7HA 2KP1A 2CAIA 1WIKA 4I97A 5IMAA 2H19A 3RPPA 2HRKA 2X8CA 2I4AA 2NPBA 4IS0A 3UVHA 2CX4A 3QD9A 5AIVA 5EL8A 2YOIA 4CW9A 1S3AA 3HHVA 3GIXA 4MCUA 1F37A 1FW1A 1G6YA 2A2RA 1GSDA 2RUFA 3GHAA 4K7IA 2YWMA 2QGVA 2R3XA 1K0NA 2WS2A 1G7OA 2CAQA 4TRXA 1GH2A 2R2JA 3ISOA 2HLSA 1M9BA 5JCGA 4YAPA 3UIWA 3BBYA 3A2VA 4FO5A 2CQ9A 4Z7XA 2MMZA 1H75A 1VF2A 4KUNA 1ZYQB 2GQMA 3R3EA 5ECOB 2H0HA 1KEBA 1PKZA 3N9JA 3EINA 3EVIA 2HI7A 1VF3A 1WMJA 3MIXA 4K2DA 1MEKA 4D73B 4WETA 5BRTA 5J3RA 1KNGA 2WULA 3IPZA 1Y6EA 3DIEA 4MZBA 2GGTA 4PNGA 5G2ZA 5EPFA 3LW9A 1EV4A 2J23A 2R5GA 4RQXA 2K8VA 5B6NA 2VCVA 1GSSA 1M99A 5G31A 2LEGA 4OFTA 1XW6A 3CYNA 4IHUA 3WGDA 2DJ1A 2AJQB 2AB6A 2C0DA 1H4OA 4KDXA 4QL7A 4MK3A 3IHQA 17GSA 3DVXA 1E6BA 2VLVA 4N11A 1EGRA 2L6CA 3A2XA 5CNWA 1T00A 4F2IA 3CSJA 2ZNMA 3EWLA 5AISA 4KCAA 4Q5QA 3MAKA 3FKFA 4KH7A 1BG5A 3WYWA 3E3EA 1SU9A 3H79A 1F2EA 4RUVA 4EXJA 1HNCA 1Z6NA 3QAWA 2VCWA 2FNOA 1HYUA 1SKSB 3L9SA 4LLRA 4NV2A 5KOWA 4F0CA 4TXOA 2F8AA 3TJGA 5CRHA 2C0EA 1U87A 4IKHA 2XBIA 1OC9B 3H8QA 1XWBA 4BL7A 2OACA 3IXRA 4HEA2 3ERFA 1ZMAA 4IN0A 4PTSA 1S3RA 1FOHA 3D5JA 4FYBA 4TR4A 4FYUA 5D9XA 3I69A 1A2LA 2H8LA 2DLXA 1OKTA 1QFNA 4IBPA 3ZITA 4CY8A 1UN2A 5KOXA 1PRXA 2LSTA 3FZ4A 2C3QA 2HRNA 3UBLA 2X8HA 4ZIJA 3LXZA 5DBQA 3KJYA 1QUWA 1A8LA 2B3SA 3ZVJD 1SK1A 3C73A 4MH3A 3D22A 3FW2A 4XCSA 5DQSA 3GUSA 3L9VA 2B1KA 2F8FA 2JADA 3ME8A 1AAZA 1ON4A 4EO3A 3KH7A 5E59A 3NZNA 1AC1A 4ZILA 3KTBA 5EY6A 1Y25A 4IELA 3F63A 2LKUA 5IPHA 1OYJA 16GSA 1K3OA 4XRAA 4YKFA 3FZ9A 4NV5A 2DJ3A 6GSVA 4PURA 3RHCA 3RDWA 3QCPA 2VLTA 11GSA 1SL0B 4K1FA 2G2QA 3HJMA 1ERTA 4CHSA 2L5LA 1Q4JA 2QC7A 1O85A 4RQRA 1SL2B 5ECLB 2V6KA 4GSNA 1B9YC 3HVNA 4PGTA 4ULXA 5G30A 5A4UA 5AGYA 2LRTA 2LJAA 4HOJA 3HXSA 2H1GA 5J4UA 2DJ0A 4ILFA 1OE7A 2TRCP 2FHEA 3D21A 2K6VA 4TR1B 4LMVA 4I2UA 12GSA 1Z9HA 1VRSD 4TW5A 3ZREA 1M7TA 1GULA 4L5LA 1FAAA 2IFQA 1URMA 3FR3A 4TN8A 4OFMA 1BX9A 3IC8A 4JBBA 4MDCA 5ECIB 2E0QA 1OKDA 1X9SB 2GZYA 5ECQB 4L0WA 4YQUA 1JLWA 2V1MA 1TRSA 3GL5A 4PQHA 1QK8A 3GTUB 1RW1A 4EVMA 4PXOA 2TRXA 2OE1A 2JZRA 2QSIA 1GUMA 1O8XA 2V6OA 4KSOA 2L59A 1TK5B 3PH9A 3IOSA 4L8EA 3APSA 3LXTA 3G7JA 3PINA 1UC7A 3G9BA 2M72A 2XC2A 4MF5A 2R4VA 5D8IA 1SK0A 2H6YA 3GYKA 2H72A 1YZXA 3TRQA 5DALA 5IOXA 2L6DA 4BA7A 4IP6A 2DKIA 2WGRA 4OCFA 4NHWA 3HZ8A 1DSBA 1GUHA 1MDKA 1WJKA 1YY7A 1DE2A 2D2ZA 2NDOA 3ZFBA 2IMDA 4GCIA 3P7XA 1A8YA 1RQMA 3H93A 1JHBA 2REMA 4FIWA 4AF2A 5KN2A 2PPTA 2VUPA 3ZMLA 2DIZA 3RAZA 2XPEA 1U3AA 1WPIA 2PWJA 3L9UA 4G0LA 4E8HA 1EOGA 4OD7A 1PA3A 3LYPA 3KP9A 1TP9A 3RPNA 1XVQA 2LV3A 3HKRA 4ZXGA 2MZCA 4QL9A 2H30A 4ZBAA 1ERWA 4PQ1A 1FB6A 1X5EA 4NMUA 3UEMA 4BVXB 2C3TA 3A5IA 4LMWA 1K3LA 4PUFC 4DEJA 5B6MA 1F3AA 3M9KA 2B7JA 4CY6A 3DMLA 1GSQA 4K0NA 2YJ7A 4EIQA 1GTIA 6GSYA 2DMMA 3IC4A 5GAPD 5DQYA 1GRXA 1N2AA 2BMXA 2EIOA 2IL3A 2LNSA 4Q5FA 2LJRA 1ZCPA 2OKAA 3D4MA 1XW9A 1JFUA 1YF0A 2L5OA 1PN0A 5H5RA 1EWXA 3APQA 4GSTA 4BVYA 2JU5A 10GSA 4HI7A 2KUCA 4KA0A 4MJBA 5INYA 5IQYA 1QQ2A 3HDCA 1FG4A 3VPTA 3KIJA 2HSMA 4WF5A 2L57A 3E9JB 4FYCA 4BIKA 1X5CA 5LCZA 2VL9A 1TTZA 3QAGA 4ML1A 2H73A 4AJ7A 5JWQB 3EURA 5JCUA 3LQ7A 3V1WA 3LJRA 1AQVA 2WRTA 5DCGA 1LJRA 2LQOA 4BVXA 3VLNA 1Z7RA 2VCXA 2AV4A 4KGIA 2GT6A 2QA2A 6GSXA 5ID2A 3KXOA 4J2FA 3TOTA 4POBA 1SD9A 2ZUPA 4AJ8A 2C1YA 4X1UA 5HR2A 4X43A 1XOAA 2GVPA 3EU4A 1V40A 2VD1A 5IPGA 3UBKA 1U3IA 3O6TA 3ZZXA 2HYXA 4OMVA 3TCOA 2O87A 1YDKA 1O81A 2VD0A 1GSFA 4G10A 4J57E 14GSA 3M1GA 4XS4A 3VFIA 1M9AA 4WBRD 4DVCA 3GSTA 1XCCA 3UVTA 1NHOA 2VAFA 1BEDA 3HJPA 2K9FA 4ECJA 4LA1A 4RI7A 5LNKe 3ZLPA 2H70A 3Q6OA 1MTCA 4N30A 3APOA 1NM3A 3FY7A 2ON7A 4IQ1A 1VF1A 4MABA 1TU7A 4LL4B 4EE0A 3C1SA 5HFKA 5EVOA 5J41A 1PKWA 5B7CA 3IK9A 3GH9A 4GLTA 3EC3A 4K7OA 4HU7A 3FR6A 5DJMA 2YANA 3VPQA 3JCML 1LBKA 3BJ5A 1TOFA 3L78A 3ZYWA 4EC0A 3GA4A 4FQUA 3ZVJA 1B8XA 2FWFA 4I8BA 4I5QA 1SK2A 3F4RA 4XS1A 1NSWA 5G5EA 1YQ1A 1ZGNA 4O5UA 2B1LA 2R0CA 3HYPA 3SWLA 3HD5A 1KBNA 2YP6A 1ZL9A 2H74A 4ID0A 2NVLA 2E2GA 3GX8A 1MD4A
chains in the Genus database with same CATH topology
4PNFA 1KTEA 1ZOFA 7GSSA 3W8SA 3RHBA 4WBJA 2CT6A 2GQKA 3GURA 5DDLA 3F3QA 1Z5YE 1JZDA 4GWRA 2PERA 4WF4A 3BCIA 1GSYA 1B9XC 1A0RP 4HUAA 1O73A 3NOFA 1SL1B 1OAZA 2GDRA 3H4KA 2AUVA 1V2AA 3TOUA 1XWKA 2O8VB 1MD3A 4HU9A 1YEXA 3IV4A 5FT3A 3UAPA 1TKDB 19GSA 2F9SA 5B8BA 2YV9A 5IIZA 1MDJA 2XHFA 5KN3A 4FH8A 3FK8A 4IW9A 2F3MA 4D73A 1A24A 3KP8A 4JRRA 3BCKA 1AQXA 3CMIA 4TOPA 2GSRA 4N10A 3UOMA 5D9TA 3FRCA 4BWSA 1BJXA 2HRAA 3C71A 1K3YA 4JE1A 1U88A 5CRWA 2GQLA 9GSSA 2VL2A 3IK7A 4IGJA 1V57A 1VGLA 4KDUA 1TRUA 3QFAC 4KSMA 3EU3A 1AIUA 2VL2C 3LFLA 2YV7A 2O89A 2HSYA 2BTOT 3KH9A 2VOCA 4KNDA 2HFDA 5JCWA 3TJJA 2EIRA 3TJKA 3EE2A 3C1RA 1S3DA 5F05A 5DCHA 1FVKA 3ERWA 2FWGA 2RM6A 2RM5A 5IMFA 2H0GA 4WEYA 2IJYA 2G0FA 4J56E 2FD3A 1SJ6A 1WRYA 6GSTA 3CXGA 3LEFA 4MH2A 1B4QA 4L0UA 1YJ6A 1OC9A 3F8UA 2CA8A 2WZ9A 3IHGA 2C80A 3FYGA 1PD21 3O3TA 2IMKA 4X4JA 4GQFA 5A4WA 1DBYA 5IOWA 1GTUA 2V2GA 3DXBA 3ZIVA 1XFLA 1GLPA 1OC8A 4A5PA 2JSZA 4V1Ag 4BWQA 1AW9A 1EP7A 1FB0A 2R6KA 1K0DA 2HSHA 2M46A 3PGTA 1EEJA 2PU9C 3A2WA 2B6MA 2V41A 5COHA 4O5RA 4DSQA 2HZEB 1V9WA 2EC4A 5C00A 3A5WA 2AAWA 3DVWA 1E2YA 5GSTA 2GSSA 1T7PB 1ACVA 3FHKA 2JL4A 1R4WA 5DAKB 2M80A 3ME7A 1WP0A 1YKCA 4K9ZA 5ECNB 3VK9A 2X64A 3P8WA 2WB9A 4USSA 5F8BA 1EEMA 2VM2A 2H75A 1VF4A 5D73A 1FOVA 4YQVA 2LJKA 2LTKA 3FR9A 1F3BA 2DBCA 2N5BA 4WR4A 1M2DA 1ERVA 2YWIA 3CSIA 3QR6A 1ZYNA 1HNBA 1TI1A 3D0ZA 5HR0A 2FY6A 3KEBA 1SENA 2QKEA 2VM1A 3WD6A 4MZWA 4KB3A 4K5RA 3O76A 1ABAA 1SJZA 3P90A 2H1AA 3ZTLA 1R7HA 2HZEA 1FO5A 1GP1A 1QMVA 2LRCA 4KCEA 4OCEA 3TJFA 2IPAA 4MLYA 4EL1A 2LS5A 1ML6A 1GNWA 4TR1A 4QQ7A 6GSSA 2HRFA 2FGXA 3N5OA 1G6WA 5HQPA 4KW6A 3BD2A 3IDVA 1DUGA 4ZB9A 3UARA 1TK0B 3HVVA 2DSAA 6GSUA 2LNTA 3HVSA 3F9UA 3S9FA 3EYTA 3U6VA 2WFCA 3DYRA 4IP1A 4KAEA 2FA4A 2WCIA 1PL1A 5GSSA 5ENUA 2R0GA 1O7UA 5ELGA 2A2PA 4ZL8A 4ISDA 4MJEA 3GTUA 3KGKA 3DD3A 3H1NA 1T1VA 4NAXA 2TIRA 3J7Yb 3ZRDA 4WKWA 2DC5A 4Z2UA 4PUAA 2VCTA 1ZZYA 1GUKA 5HR1A 1SYRA 1O8WA 4YQMA 3DEXA 2H0IA 4PX1A 2E2MA 6GSWA 2OA7A 1SYXA 3D4TA 4EIPA 4OO5A 5KN1A 4MP4A 2X8GA 5HR3A 1F9MA 1TXXA 3GKNA 2IIYA 4POMA 3IAS2 4JR4A 1M2AA 1TRVA 2B7KA 1JZRA 3TRPA 5ECRB 1GTBA 1T8EB 2ES7A 3CTFA 2GZZA 1TU8A 3GKMA 4YKGA 5D96A 2B5YA 3C8EA 4G0KA 2R0PA 1GLQA 2JZTA 3DWVA 1HQOA 4K5SA 5IMDA 2FCHA 1PX6A 2H76A 5DJLA 3WGEA 1F6MC 3GSSA 1DE1A 4RI6A 1W4VA 2OE3A 4OO4A 5ELAA 2CX3A 2C3NA 1MDIA 1V98A 3IA1A 4G9HA 2KOKA 4HJ2A 1T3BA 4WXTA 2HXKA 2HE3A 2B5EA 2NTOA 2MBSA 5BMUA 1C72A 4MMMA 1A0FA 3LWAA 3EMPA 3LORA 2VCQA 2PGTA 1OC3A 2OBIA 2E7PA 3I43A 5ABRA 2JACA 3KD0A 2LRNA 1UVZA 3VWXA 4AJ6A 3MYDA 3HVXA 1XPVA 4F9ZA 2XPDA 2KP2A 1NHYA 4V2NA 1CQGA 4G0IA 1QXHA 1T4ZA 3WT2A 1CQHA 2JSYA 3MNGA 3FMWA 1W89A 1GSUA 1R26A 2I81A 4DSSB 3QFBC 1AQWA 3FEUA 1ILOA 4H86A 4GSSA 1G7EA 3PR8A 2RIIA 1SKRB 2VIMA 2P5QA 4TVEA 3IAM2 3TRXA 1BYEA 3GL3A 2YPMA 4G2EA 3UMAA 3J7Yk 1B4PA 1YEPA 5IO0A 4POLA 1LU4A 5GAND 5CYYA 4YH2A 2VL3A 5ECSA 2F51A 2I1UA 4ML6A 2H6ZA 2DIYA 1TRWA 2L4CA 2C0FA 3LYKA 4ZL9A 1RK4A 1M2BA 3GKXA 3HCZA 1WWJA 4HDEA 8GSSA 3KCMA 3AY8A 4O92A 1EV9A 3TKQA 3VWWA 1YF1A 4NWYA 1NW2A 4AGSA 1X9WB 2H1BA 3VI5A 5H5QA 3US3A 3ZIJA 1TDIA 3KM6A 4TXOB 2WDUA 4L5OA 1THXA 4I6XA 2GSQA 5FHIA 2IN3A 4BL7B 5J5NA 3ZMKA 3CRUA 3TGZA 4MPFA 5AIXA 4POKA 4E8EA 4EKZA 4I2TA 2K8SA 1JZOA 4DSSA 3CRTA 1X0RA 3M3MA 1ERUA 5ECMB 2VO4A 2HT9A 2R37A 4ZBDA 3QMXA 4O5QA 3G7IA 2CZ2A 3L0HA 3KTLA 2CV4A 1HNAA 3TKPA 1PQNA 4JEDA 4V1Ap 4JZQA 2GS3A 1XXUA 2DJ2A 3W8JA 5DVBA 1TK8B 2DJKA 3KMNA 1GSEA 3WT1A 3WGXA 1ZYPA 2PVOC 3F4TA 1O6JA 5IMVA 3VWUA 1XBSA 3CBUA 4GTUA 2RUEA 4GXZA 1YKAA 5A4VA 1PX7A 2MYGA 1X9MB 1ST9A 4YAVA 3ZL5A 1J0FA 1EOHA 4F82A 5D93A 4IJIA 2FLSA 2MMAA 3F3RA 1PSQA 2C0GA 2O7KA 3F4SA 4HQSA 3CSHA 2UZ8A 3IRAA 1TI3A 3HZ4A 2PMTA 1Z7PA 4HJMA 5J9BA 2X99A 5G1LA 2WJUA 2X4AA 1XIYA 1PMTA 2HNLA 3M0FA 2EIQA 4NXIA 5H5SA 1J08A 2DMLA 3GFKA 5IM9A 5JWRB 2K18A 2IMEA 2CVDA 1XOBA 1M0UA 2MMNA 1SD8A 5GZZB 1XWGA 2CZ3A 2I3YA 5D9VA 3GRXA 4TKYA 4CDOA 3TKSA 3LG6A 3K8NA 4MNNA 5JWOB 2XBQA 5CREA 3R2QA 1J9BA 2C8UA 2IFQB 3TKSC 4WR5A 4Z2TA 2YNXA 1G0TA 1BAYA 2LQQA 1ZYEA 4ZB8A 3C7MA 4ZBBA 1THOA 4N0VA 5IMZA 3DRNA 3HY2A 4HQZA 3TUEA 2LUSA 3Q19A 3OR5A 1TJDA 5CP1A 3VURA 2O85A 3M9JA 2CVBA 2DKHA 4NPBA 5KN0A 5G5FA 4LL1B 5F0GA 4MJAA 2QA1A 2P0GA 1JLVA 5CO3A 5B8AA 2OE0A 3P2AA 2YZHA 2CVKA 2YWOA 5C04A 2MBTA 3KZQA 3W6GA 1XWCA 1Z3EA 3LGCA 3TDGA 2L4QA 2ON5A 5DALB 1X5DA 3U5RE 5AN1A 1K0AA 2RLIA 2JZSA 2AHEA 5F07A 1WE0A 3VI7A 4K0GA 5IMCA 2N5AA 3IE3A 1TW9A 4GF0A 5D9WA 1I5GA 5CRDA 3GH6A 3DKSA 2DJJA 3CTGA 1OE8A 2A4VA 3LSZA 3MSZA 2GLRA 2KLXA 1T4YA 4KDYA 4EDYA 1B48A 4EUYA 4XHMA 4HZ4A 1IYHA 4G19A 4ZL7A 1USBA 3TKSE 2VCZA 3PPUA 4F0BA 4ECCA 5ECPB 4Q5NA 4JU5A 3IR4A 4ACSA 5CAXA 2PUKC 4P3YB 2IWTA 4V2LA 4XS6A 4MF6A 1XZOA 3QAVA 4XRDA 3GNJA 2PVQA 1XWAA 4TR3A 4DSRA 3SBCA 5G1KA 3VWVA 5L71A 2PBJA 1FHEA 1R5AA 2ALBA 3NIVA 5HFIA 4TXVA 5ECHB 3TB2A 3QPMA 4K7NA 2FWHA 1K0OA 3KMOA 1EZKA 22GSA 4Q5RA 4OFNA 3FZ5A 3HJOA 5E4WA 5DAKA 1PGTA 4K6XA 2OBKA 2B5XA 5IO2A 4K8MA 1EP8A 1R5PA 2H01A 2A4HA 1JZWA 1GL8A 4BVYB 1SJIA 3UL3A 1OVNA 3Q18A 3DGQA 4K2XA 1I9DA 2YZUA 1U6TA 4MJCA 2OADA 1S3CA 2H71A 5CRGA 1K0MA 4X0XA 2I9HA 3E0UA 4F03A 2FA8A 4HS1A 2H1DA 2KHPA 1UA5A 3IBHA 1EGOA 2Z9SA 3Q74A 2A2SA 3L4NA 3G7YA 4O32A 4MA9A 1GWCA 3M8NA 2YJHA 4MF7A 1Z6MA 4JR6A 2AYTA 2YCDA 4KE3A 5KEJA 2GSTA 3ED3A 1IYIA 2C4JA 2IMIA 1GTAA 1PL2A 1PN9A 2OJLA 3QOUA 1A2MA 3RBTA 4XTSA 5ID2B 3QDNA 1SKWB 4OWYA 2ZCTA 20GSA 1V58A 5A5KA 2P5RA 2P31A 3D6IA 2FWEA 2GT5A 4ICYA 2YWNA 1AUCA 2GTUA 1N8JA 4N0ZA 1K0CA 3HA9A 1FVJA 3F0IA 4EF0A 3F6DA 2PN8A 4GQCA 3ZFLA 5FWGA 2V32A 4XS4B 3UJ1A 5ECKB 4ZB6A 4V2MA 3FZAA 2IMFA 3TJBA 4KX4A 3A3TA 5F06A 3GX0A 3GV1A 3GMFA 4HZ2A 4ECBA 5LD0A 1WOUA 5J9CA 4PQIA 3GKKA 1AXDA 4KF9A 2N5FA 3BOAA 3F6FA 4MZCA 1A23A 4TR0A 3GN3A 2VLUA 1GNEA 2X49A 2BJXA 3I9V2 2YN1A 1QGVA 3MWHA 3TKRA 5HFGA 3I6AA 4IJ3A 4ECIA 4BPYA 4NHZA 2HZFA 1BQ7A 13GSA 18GSA 1HD2A 2GZPA 3ERGA 1K0BA 3EMXA 2J9HA 1A2JA 4IVFA 3EPTA 2H66A 4EDZA 2MMOA 4IQAA 2H6XA 2FUG2 1XVWA 4MPGA 4GRFA 1XW5A 4Z2RA 2NBSA 1Q98A 4XIHA 3MDKA 4O7HA 2KP1A 2CAIA 1WIKA 4I97A 5IMAA 2H19A 3RPPA 2HRKA 2X8CA 2I4AA 2NPBA 4IS0A 3UVHA 2CX4A 3QD9A 5AIVA 5EL8A 2YOIA 4CW9A 1S3AA 3HHVA 3GIXA 4MCUA 1F37A 1FW1A 1G6YA 2A2RA 1GSDA 2RUFA 3GHAA 4K7IA 2YWMA 2QGVA 2R3XA 1K0NA 2WS2A 1G7OA 2CAQA 4TRXA 1GH2A 2R2JA 3ISOA 2HLSA 1M9BA 5JCGA 4YAPA 3UIWA 3BBYA 3A2VA 4FO5A 2CQ9A 4Z7XA 2MMZA 1H75A 1VF2A 4KUNA 1ZYQB 2GQMA 3R3EA 5ECOB 2H0HA 1KEBA 1PKZA 3N9JA 3EINA 3EVIA 2HI7A 1VF3A 1WMJA 3MIXA 4K2DA 1MEKA 4D73B 4WETA 5BRTA 5J3RA 1KNGA 2WULA 3IPZA 1Y6EA 3DIEA 4MZBA 2GGTA 4PNGA 5G2ZA 5EPFA 3LW9A 1EV4A 2J23A 2R5GA 4RQXA 2K8VA 5B6NA 2VCVA 1GSSA 1M99A 5G31A 2LEGA 4OFTA 1XW6A 3CYNA 4IHUA 3WGDA 2DJ1A 2AJQB 2AB6A 2C0DA 1H4OA 4KDXA 4QL7A 4MK3A 3IHQA 17GSA 3DVXA 1E6BA 2VLVA 4N11A 1EGRA 2L6CA 3A2XA 5CNWA 1T00A 4F2IA 3CSJA 2ZNMA 3EWLA 5AISA 4KCAA 4Q5QA 3MAKA 3FKFA 4KH7A 1BG5A 3WYWA 3E3EA 1SU9A 3H79A 1F2EA 4RUVA 4EXJA 1HNCA 1Z6NA 3QAWA 2VCWA 2FNOA 1HYUA 1SKSB 3L9SA 4LLRA 4NV2A 5KOWA 4F0CA 4TXOA 2F8AA 3TJGA 5CRHA 2C0EA 1U87A 4IKHA 2XBIA 1OC9B 3H8QA 1XWBA 4BL7A 2OACA 3IXRA 4HEA2 3ERFA 1ZMAA 4IN0A 4PTSA 1FOHA 3D5JA 4FYBA 4TR4A 4FYUA 5D9XA 3I69A 1A2LA 2H8LA 2DLXA 1OKTA 1QFNA 4IBPA 3ZITA 4CY8A 1UN2A 5KOXA 1PRXA 2LSTA 3FZ4A 2C3QA 2HRNA 3UBLA 2X8HA 4ZIJA 3LXZA 5DBQA 3KJYA 1QUWA 1A8LA 2B3SA 3ZVJD 1SK1A 3C73A 4MH3A 3D22A 3FW2A 4XCSA 5DQSA 3GUSA 3L9VA 2B1KA 2F8FA 2JADA 3ME8A 1AAZA 1ON4A 4EO3A 3KH7A 5E59A 3NZNA 1AC1A 4ZILA 3KTBA 5EY6A 1Y25A 4IELA 3F63A 2LKUA 5IPHA 1OYJA 16GSA 1K3OA 4XRAA 4YKFA 3FZ9A 4NV5A 2DJ3A 6GSVA 4PURA 3RHCA 3RDWA 3QCPA 2VLTA 11GSA 1SL0B 4K1FA 2G2QA 3HJMA 1ERTA 4CHSA 2L5LA 1Q4JA 2QC7A 1O85A 4RQRA 1SL2B 5ECLB 2V6KA 4GSNA 1B9YC 4PGTA 4ULXA 5G30A 5A4UA 5AGYA 2LRTA 2LJAA 4HOJA 3HXSA 2H1GA 5J4UA 2DJ0A 4ILFA 1OE7A 2TRCP 2FHEA 3D21A 2K6VA 4TR1B 4LMVA 4I2UA 12GSA 1Z9HA 1VRSD 4TW5A 3ZREA 1M7TA 1GULA 4L5LA 1FAAA 2IFQA 1URMA 3FR3A 4TN8A 4OFMA 1BX9A 3IC8A 4JBBA 4MDCA 5ECIB 2E0QA 1OKDA 1X9SB 2GZYA 5ECQB 4L0WA 4YQUA 1JLWA 2V1MA 1TRSA 3GL5A 4PQHA 1QK8A 3GTUB 1RW1A 4EVMA 4PXOA 2TRXA 2OE1A 2JZRA 2QSIA 1GUMA 1O8XA 2V6OA 4KSOA 2L59A 1TK5B 3PH9A 3IOSA 4L8EA 3APSA 3LXTA 3G7JA 3PINA 1UC7A 3G9BA 2M72A 2XC2A 4MF5A 2R4VA 5D8IA 1SK0A 2H6YA 3GYKA 2H72A 1YZXA 3TRQA 5DALA 5IOXA 2L6DA 4BA7A 4IP6A 2DKIA 2WGRA 4OCFA 4NHWA 3HZ8A 1DSBA 1GUHA 1MDKA 1WJKA 1YY7A 1DE2A 2D2ZA 2NDOA 3ZFBA 2IMDA 4GCIA 3P7XA 1A8YA 1RQMA 3H93A 1JHBA 2REMA 4FIWA 4AF2A 5KN2A 2PPTA 2VUPA 3ZMLA 2DIZA 3RAZA 2XPEA 1U3AA 1WPIA 2PWJA 3L9UA 4G0LA 4E8HA 1EOGA 4OD7A 1PA3A 3LYPA 3KP9A 1TP9A 3RPNA 1XVQA 2LV3A 3HKRA 4ZXGA 2MZCA 4QL9A 2H30A 4ZBAA 1ERWA 4PQ1A 1FB6A 1X5EA 4NMUA 3UEMA 4BVXB 2C3TA 3A5IA 4LMWA 1K3LA 4PUFC 4DEJA 5B6MA 1F3AA 3M9KA 2B7JA 4CY6A 3DMLA 1GSQA 4K0NA 2YJ7A 4EIQA 1GTIA 6GSYA 2DMMA 3IC4A 5GAPD 5DQYA 1GRXA 1N2AA 2BMXA 2EIOA 2IL3A 2LNSA 4Q5FA 2LJRA 1ZCPA 2OKAA 3D4MA 1XW9A 1JFUA 1YF0A 2L5OA 1PN0A 5H5RA 1EWXA 3APQA 4GSTA 4BVYA 2JU5A 10GSA 4HI7A 2KUCA 4KA0A 4MJBA 5INYA 5IQYA 1QQ2A 3HDCA 1FG4A 3VPTA 3KIJA 2HSMA 4WF5A 2L57A 3E9JB 4FYCA 1X5CA 5LCZA 2VL9A 1TTZA 3QAGA 4ML1A 2H73A 4AJ7A 5JWQB 3EURA 5JCUA 3LQ7A 3V1WA 3LJRA 1AQVA 2WRTA 5DCGA 1LJRA 2LQOA 4BVXA 3VLNA 1Z7RA 2VCXA 2AV4A 4KGIA 2GT6A 2QA2A 6GSXA 5ID2A 3KXOA 4J2FA 3TOTA 4POBA 1SD9A 2ZUPA 4AJ8A 2C1YA 4X1UA 5HR2A 4X43A 1XOAA 2GVPA 3EU4A 1V40A 2VD1A 5IPGA 3UBKA 1U3IA 3O6TA 3ZZXA 2HYXA 4OMVA 3TCOA 2O87A 1YDKA 1O81A 2VD0A 1GSFA 4G10A 4J57E 14GSA 3M1GA 4XS4A 3VFIA 1M9AA 4WBRD 4DVCA 3GSTA 1XCCA 3UVTA 1NHOA 2VAFA 1BEDA 3HJPA 2K9FA 4ECJA 4LA1A 4RI7A 5LNKe 3ZLPA 2H70A 3Q6OA 1MTCA 4N30A 3APOA 1NM3A 3FY7A 2ON7A 4IQ1A 1VF1A 4MABA 1TU7A 4LL4B 4EE0A 3C1SA 5HFKA 5EVOA 5J41A 1PKWA 5B7CA 3IK9A 3GH9A 4GLTA 3EC3A 4K7OA 4HU7A 3FR6A 5DJMA 2YANA 3VPQA 3JCML 1LBKA 3BJ5A 1TOFA 3L78A 3ZYWA 4EC0A 3GA4A 4FQUA 3ZVJA 1B8XA 2FWFA 4I8BA 4I5QA 1SK2A 3F4RA 4XS1A 1NSWA 5G5EA 1YQ1A 1ZGNA 4O5UA 2B1LA 2R0CA 3HYPA 3SWLA 3HD5A 1KBNA 2YP6A 1ZL9A 2H74A 4ID0A 2NVLA 2E2GA 3GX8A 1MD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNF A;  1KTE A;  1ZOF A;  7GSS A;  3W8S A;  3RHB A;  4WBJ A;  2CT6 A;  2GQK A;  3GUR A;  5DDL A;  3F3Q A;  1Z5Y E;  1JZD A;  4GWR A;  2PER A;  4WF4 A;  3BCI A;  1GSY A;  1B9X C;  1A0R P;  4HUA A;  1O73 A;  3NOF A;  1SL1 B;  1OAZ A;  2GDR A;  3H4K A;  2AUV A;  1V2A A;  3TOU A;  1XWK A;  2O8V B;  1MD3 A;  4HU9 A;  1YEX A;  3IV4 A;  5FT3 A;  3UAP A;  1TKD B;  19GS A;  2F9S A;  5B8B A;  2YV9 A;  5IIZ A;  1MDJ A;  2XHF A;  5KN3 A;  4FH8 A;  3FK8 A;  4IW9 A;  2F3M A;  4D73 A;  1A24 A;  3KP8 A;  4JRR A;  3BCK A;  1AQX A;  3CMI A;  4TOP A;  2GSR A;  4N10 A;  3UOM A;  5D9T A;  3FRC A;  4BWS A;  1BJX A;  3C71 A;  1K3Y A;  4JE1 A;  1U88 A;  5CRW A;  2GQL A;  9GSS A;  2VL2 A;  3IK7 A;  4IGJ A;  1V57 A;  1VGL A;  4KDU A;  1TRU A;  3QFA C;  4KSM A;  3EU3 A;  1AIU A;  2VL2 C;  3LFL A;  2YV7 A;  2O89 A;  2HSY A;  2BTO T;  3KH9 A;  2VOC A;  4KND A;  2HFD A;  5JCW A;  3TJJ A;  2EIR A;  3TJK A;  3EE2 A;  3C1R A;  1S3D A;  5F05 A;  5DCH A;  1FVK A;  3ERW A;  2FWG A;  2RM6 A;  2RM5 A;  5IMF A;  2H0G A;  4WEY A;  2IJY A;  2G0F A;  4J56 E;  2FD3 A;  1SJ6 A;  1WRY A;  6GST A;  3CXG A;  3LEF A;  4MH2 A;  1B4Q A;  4L0U A;  1YJ6 A;  1OC9 A;  3F8U A;  2CA8 A;  2WZ9 A;  2C80 A;  3FYG A;  1PD2 1;  3O3T A;  2IMK A;  1DBY A;  4GQF A;  5A4W A;  5IOW A;  1GTU A;  2V2G A;  3DXB A;  3ZIV A;  1XFL A;  1GLP A;  1OC8 A;  2JSZ A;  4V1A g;  4BWQ A;  1AW9 A;  1EP7 A;  1FB0 A;  2R6K A;  1K0D A;  2HSH A;  2M46 A;  3PGT A;  1EEJ A;  2PU9 C;  3A2W A;  2B6M A;  2V41 A;  5COH A;  4O5R A;  4DSQ A;  2HZE B;  1V9W A;  2EC4 A;  5C00 A;  3A5W A;  2AAW A;  3DVW A;  1E2Y A;  5GST A;  2GSS A;  1T7P B;  1ACV A;  3FHK A;  2JL4 A;  1R4W A;  5DAK B;  2M80 A;  3ME7 A;  1WP0 A;  1YKC A;  4K9Z A;  5ECN B;  3VK9 A;  2X64 A;  3P8W A;  2WB9 A;  5F8B A;  1EEM A;  2VM2 A;  2H75 A;  1VF4 A;  5D73 A;  1FOV A;  4YQV A;  2LJK A;  2LTK A;  3FR9 A;  1F3B A;  2DBC A;  2N5B A;  4WR4 A;  1M2D A;  1ERV A;  2YWI A;  3CSI A;  3QR6 A;  1HNB A;  1TI1 A;  3D0Z A;  5HR0 A;  2FY6 A;  3KEB A;  1SEN A;  2QKE A;  2VM1 A;  3WD6 A;  4MZW A;  4KB3 A;  3O76 A;  1ABA A;  1SJZ A;  3P90 A;  2H1A A;  3ZTL A;  1R7H A;  2HZE A;  1FO5 A;  1GP1 A;  1QMV A;  2LRC A;  4KCE A;  4OCE A;  3TJF A;  2IPA A;  4MLY A;  4EL1 A;  2LS5 A;  1ML6 A;  1GNW A;  4TR1 A;  4QQ7 A;  6GSS A;  2HRF A;  2FGX A;  3N5O A;  1G6W A;  5HQP A;  4KW6 A;  3BD2 A;  3IDV A;  1DUG A;  4ZB9 A;  3UAR A;  1TK0 B;  3HVV A;  2DSA A;  6GSU A;  2LNT A;  3HVS A;  3F9U A;  3S9F A;  3EYT A;  3U6V A;  2WFC A;  3DYR A;  4IP1 A;  4KAE A;  2FA4 A;  2WCI A;  1PL1 A;  5GSS A;  5ENU A;  1O7U A;  5ELG A;  4ZL8 A;  4ISD A;  4MJE A;  3GTU A;  3KGK A;  3DD3 A;  3H1N A;  1T1V A;  4NAX A;  2TIR A;  3J7Y b;  3ZRD A;  4WKW A;  2DC5 A;  4PUA A;  2VCT A;  1ZZY A;  1GUK A;  5HR1 A;  1SYR A;  1O8W A;  4YQM A;  3DEX A;  2H0I A;  4PX1 A;  2E2M A;  6GSW A;  2OA7 A;  1SYX A;  3D4T A;  4OO5 A;  5KN1 A;  4MP4 A;  2X8G A;  5HR3 A;  1F9M A;  1TXX A;  3GKN A;  2IIY A;  4POM A;  3IAS 2;  4JR4 A;  1M2A A;  1TRV A;  2B7K A;  1JZR A;  3TRP A;  5ECR B;  1GTB A;  1T8E B;  2ES7 A;  3CTF A;  2GZZ A;  1TU8 A;  3GKM A;  5D96 A;  2B5Y A;  3C8E A;  1GLQ A;  2JZT A;  3DWV A;  1HQO A;  5IMD A;  2FCH A;  1PX6 A;  2H76 A;  5DJL A;  3WGE A;  1F6M C;  3GSS A;  1DE1 A;  4RI6 A;  1W4V A;  2OE3 A;  4OO4 A;  5ELA A;  2CX3 A;  2C3N A;  1MDI A;  1V98 A;  3IA1 A;  4G9H A;  2KOK A;  4HJ2 A;  1T3B A;  4WXT A;  2HXK A;  2HE3 A;  2B5E A;  2NTO A;  2MBS A;  1C72 A;  4MMM A;  1A0F A;  3LWA A;  3EMP A;  3LOR A;  2VCQ A;  2PGT A;  1OC3 A;  2OBI A;  2E7P A;  3I43 A;  5ABR A;  2JAC A;  3KD0 A;  2LRN A;  1UVZ A;  3VWX A;  4AJ6 A;  3HVX A;  1XPV A;  4F9Z A;  2XPD A;  2KP2 A;  1NHY A;  4V2N A;  1CQG A;  1QXH A;  1T4Z A;  3WT2 A;  1CQH A;  2JSY A;  3MNG A;  1W89 A;  1GSU A;  1R26 A;  2I81 A;  4DSS B;  3QFB C;  1AQW A;  3FEU A;  1ILO A;  4H86 A;  4GSS A;  1G7E A;  3PR8 A;  2RII A;  1SKR B;  2VIM A;  2P5Q A;  4TVE A;  3IAM 2;  3TRX A;  1BYE A;  3GL3 A;  2YPM A;  4G2E A;  3UMA A;  3J7Y k;  1B4P A;  1YEP A;  5IO0 A;  4POL A;  1LU4 A;  5GAN D;  5CYY A;  4YH2 A;  2VL3 A;  5ECS A;  2F51 A;  2I1U A;  4ML6 A;  2H6Z A;  2DIY A;  1TRW A;  2L4C A;  2C0F A;  3LYK A;  4ZL9 A;  1RK4 A;  1M2B A;  3GKX A;  3HCZ A;  1WWJ A;  4HDE A;  8GSS A;  3KCM A;  3AY8 A;  4O92 A;  1EV9 A;  3TKQ A;  3VWW A;  1YF1 A;  4NWY A;  1NW2 A;  4AGS A;  1X9W B;  2H1B A;  3VI5 A;  5H5Q A;  3US3 A;  3ZIJ A;  1TDI A;  3KM6 A;  4TXO B;  2WDU A;  4L5O A;  1THX A;  4I6X A;  2GSQ A;  5FHI A;  2IN3 A;  5J5N A;  3ZMK A;  3CRU A;  3TGZ A;  4MPF A;  5AIX A;  4POK A;  4E8E A;  4EKZ A;  4I2T A;  2K8S A;  1JZO A;  4DSS A;  3CRT A;  1X0R A;  3M3M A;  1ERU A;  5ECM B;  2VO4 A;  2HT9 A;  2R37 A;  4ZBD A;  3QMX A;  3G7I A;  2CZ2 A;  3L0H A;  3KTL A;  2CV4 A;  1HNA A;  3TKP A;  1PQN A;  4JED A;  4V1A p;  4JZQ A;  2GS3 A;  1XXU A;  2DJ2 A;  3W8J A;  5DVB A;  1TK8 B;  2DJK A;  3KMN A;  1GSE A;  3WT1 A;  3WGX A;  2PVO C;  3F4T A;  1O6J A;  5IMV A;  3VWU A;  1XBS A;  3CBU A;  4GTU A;  2RUE A;  4GXZ A;  1YKA A;  5A4V A;  1PX7 A;  2MYG A;  1X9M B;  1ST9 A;  4YAV A;  3ZL5 A;  1J0F A;  1EOH A;  4F82 A;  5D93 A;  4IJI A;  2FLS A;  2MMA A;  3F3R A;  1PSQ A;  2C0G A;  2O7K A;  3F4S A;  4HQS A;  3CSH A;  3IRA A;  1TI3 A;  3HZ4 A;  2PMT A;  1Z7P A;  4HJM A;  5J9B A;  2X99 A;  5G1L A;  2WJU A;  1XIY A;  1PMT A;  2HNL A;  3M0F A;  2EIQ A;  4NXI A;  5H5S A;  1J08 A;  2DML A;  3GFK A;  5IM9 A;  5JWR B;  2K18 A;  2IME A;  2CVD A;  1XOB A;  1M0U A;  2MMN A;  1SD8 A;  5GZZ B;  1XWG A;  2CZ3 A;  2I3Y A;  5D9V A;  3GRX A;  4TKY A;  4CDO A;  3TKS A;  3LG6 A;  3K8N A;  5JWO B;  2XBQ A;  5CRE A;  3R2Q A;  1J9B A;  2C8U A;  2IFQ B;  3TKS C;  4WR5 A;  2YNX A;  1G0T A;  1BAY A;  2LQQ A;  1ZYE A;  4ZB8 A;  3C7M A;  4ZBB A;  1THO A;  4N0V A;  5IMZ A;  3DRN A;  3HY2 A;  4HQZ A;  3TUE A;  2LUS A;  3Q19 A;  3OR5 A;  1TJD A;  5CP1 A;  3VUR A;  2O85 A;  3M9J A;  2CVB A;  4NPB A;  5KN0 A;  5G5F A;  4LL1 B;  5F0G A;  4MJA A;  2P0G A;  1JLV A;  5CO3 A;  5B8A A;  2OE0 A;  3P2A A;  2YZH A;  2CVK A;  2YWO A;  5C04 A;  2MBT A;  3KZQ A;  3W6G A;  1XWC A;  1Z3E A;  3LGC A;  3TDG A;  2L4Q A;  2ON5 A;  5DAL B;  1X5D A;  3U5R E;  5AN1 A;  1K0A A;  2RLI A;  2JZS A;  2AHE A;  5F07 A;  1WE0 A;  3VI7 A;  4K0G A;  5IMC A;  2N5A A;  3IE3 A;  1TW9 A;  4GF0 A;  5D9W A;  1I5G A;  5CRD A;  3GH6 A;  3DKS A;  2DJJ A;  3CTG A;  1OE8 A;  2A4V A;  3LSZ A;  3MSZ A;  2GLR A;  2KLX A;  1T4Y A;  4KDY A;  4EDY A;  1B48 A;  4EUY A;  4XHM A;  4HZ4 A;  1IYH A;  4G19 A;  4ZL7 A;  1USB A;  3TKS E;  2VCZ A;  4F0B A;  4ECC A;  5ECP B;  4Q5N A;  4JU5 A;  3IR4 A;  4ACS A;  5CAX A;  2PUK C;  4P3Y B;  2IWT A;  4V2L A;  4XS6 A;  4MF6 A;  1XZO A;  3QAV A;  4XRD A;  3GNJ A;  2PVQ A;  1XWA A;  4TR3 A;  4DSR A;  3SBC A;  5G1K A;  3VWV A;  5L71 A;  2PBJ A;  1FHE A;  1R5A A;  2ALB A;  3NIV A;  5HFI A;  4TXV A;  5ECH B;  3TB2 A;  3QPM A;  4K7N A;  2FWH A;  1K0O A;  3KMO A;  1EZK A;  22GS A;  4Q5R A;  4OFN A;  3FZ5 A;  3HJO A;  5E4W A;  5DAK A;  1PGT A;  4K6X A;  2OBK A;  2B5X A;  5IO2 A;  4K8M A;  1EP8 A;  1R5P A;  2H01 A;  1JZW A;  1GL8 A;  1SJI A;  3UL3 A;  1OVN A;  3Q18 A;  3DGQ A;  1I9D A;  2YZU A;  1U6T A;  4MJC A;  2OAD A;  1S3C A;  2H71 A;  5CRG A;  1K0M A;  4X0X A;  2I9H A;  3E0U A;  4F03 A;  2FA8 A;  4HS1 A;  2H1D A;  2KHP A;  1UA5 A;  3IBH A;  1EGO A;  2Z9S A;  3Q74 A;  2A2S A;  3L4N A;  3G7Y A;  4O32 A;  4MA9 A;  1GWC A;  3M8N A;  2YJH A;  4MF7 A;  1Z6M A;  4JR6 A;  2AYT A;  2YCD A;  4KE3 A;  5KEJ A;  2GST A;  3ED3 A;  1IYI A;  2C4J A;  2IMI A;  1GTA A;  1PL2 A;  1PN9 A;  2OJL A;  3QOU A;  1A2M A;  3RBT A;  4XTS A;  5ID2 B;  3QDN A;  1SKW B;  4OWY A;  2ZCT A;  20GS A;  1V58 A;  5A5K A;  2P5R A;  2P31 A;  3D6I A;  2FWE A;  2GT5 A;  2YWN A;  1AUC A;  2GTU A;  1N8J A;  4N0Z A;  1K0C A;  3HA9 A;  1FVJ A;  3F0I A;  4EF0 A;  3F6D A;  2PN8 A;  4GQC A;  3ZFL A;  5FWG A;  2V32 A;  4XS4 B;  3UJ1 A;  5ECK B;  4ZB6 A;  4V2M A;  3FZA A;  2IMF A;  3TJB A;  4KX4 A;  3A3T A;  5F06 A;  3GX0 A;  3GV1 A;  3GMF A;  4HZ2 A;  4ECB A;  5LD0 A;  1WOU A;  5J9C A;  4PQI A;  3GKK A;  1AXD A;  2N5F A;  3BOA A;  3F6F A;  4MZC A;  1A23 A;  4TR0 A;  3GN3 A;  2VLU A;  1GNE A;  2BJX A;  3I9V 2;  2YN1 A;  1QGV A;  3MWH A;  3TKR A;  5HFG A;  3I6A A;  4IJ3 A;  4ECI A;  4BPY A;  4NHZ A;  2HZF A;  1BQ7 A;  13GS A;  18GS A;  1HD2 A;  2GZP A;  3ERG A;  1K0B A;  3EMX A;  2J9H A;  1A2J A;  4IVF A;  2H66 A;  4EDZ A;  2MMO A;  4IQA A;  2H6X A;  2FUG 2;  1XVW A;  4MPG A;  4GRF A;  1XW5 A;  2NBS A;  1Q98 A;  4XIH A;  3MDK A;  4O7H A;  2KP1 A;  2CAI A;  1WIK A;  4I97 A;  5IMA A;  2H19 A;  3RPP A;  2X8C A;  2I4A A;  2NPB A;  4IS0 A;  3UVH A;  2CX4 A;  3QD9 A;  5AIV A;  5EL8 A;  2YOI A;  4CW9 A;  1S3A A;  3HHV A;  3GIX A;  4MCU A;  1F37 A;  1FW1 A;  1G6Y A;  2A2R A;  1GSD A;  2RUF A;  3GHA A;  4K7I A;  2YWM A;  2QGV A;  2R3X A;  1K0N A;  2WS2 A;  1G7O A;  2CAQ A;  4TRX A;  1GH2 A;  2R2J A;  3ISO A;  2HLS A;  1M9B A;  5JCG A;  4YAP A;  3UIW A;  3BBY A;  3A2V A;  4FO5 A;  2CQ9 A;  4Z7X A;  2MMZ A;  1H75 A;  1VF2 A;  4KUN A;  1ZYQ B;  2GQM A;  5ECO B;  2H0H A;  1KEB A;  1PKZ A;  3N9J A;  3EIN A;  3EVI A;  2HI7 A;  1VF3 A;  1WMJ A;  4K2D A;  1MEK A;  4D73 B;  4WET A;  5J3R A;  1KNG A;  2WUL A;  3IPZ A;  1Y6E A;  3DIE A;  4MZB A;  2GGT A;  4PNG A;  5G2Z A;  5EPF A;  1EV4 A;  2J23 A;  2R5G A;  4RQX A;  2K8V A;  5B6N A;  2VCV A;  1GSS A;  1M99 A;  5G31 A;  2LEG A;  4OFT A;  1XW6 A;  3CYN A;  4IHU A;  3WGD A;  2DJ1 A;  2AJQ B;  2AB6 A;  2C0D A;  1H4O A;  4KDX A;  4QL7 A;  4MK3 A;  3IHQ A;  17GS A;  3DVX A;  1E6B A;  2VLV A;  4N11 A;  1EGR A;  2L6C A;  3A2X A;  5CNW A;  1T00 A;  4F2I A;  3CSJ A;  2ZNM A;  3EWL A;  5AIS A;  4KCA A;  4Q5Q A;  3MAK A;  3FKF A;  4KH7 A;  1BG5 A;  3WYW A;  3E3E A;  1SU9 A;  3H79 A;  1F2E A;  4RUV A;  4EXJ A;  1HNC A;  1Z6N A;  3QAW A;  2VCW A;  2FNO A;  1HYU A;  1SKS B;  3L9S A;  4LLR A;  4NV2 A;  4F0C A;  4TXO A;  2F8A A;  3TJG A;  5CRH A;  2C0E A;  1U87 A;  4IKH A;  2XBI A;  1OC9 B;  3H8Q A;  1XWB A;  4BL7 A;  2OAC A;  3IXR A;  4HEA 2;  3ERF A;  1ZMA A;  4IN0 A;  3D5J A;  4FYB A;  4TR4 A;  4FYU A;  5D9X A;  3I69 A;  1A2L A;  2H8L A;  2DLX A;  1OKT A;  1QFN A;  4IBP A;  3ZIT A;  1UN2 A;  1PRX A;  2LST A;  3FZ4 A;  2C3Q A;  2HRN A;  3UBL A;  2X8H A;  4ZIJ A;  3LXZ A;  5DBQ A;  3KJY A;  1QUW A;  1A8L A;  2B3S A;  3ZVJ D;  1SK1 A;  3C73 A;  4MH3 A;  3D22 A;  3FW2 A;  4XCS A;  5DQS A;  3GUS A;  3L9V A;  2B1K A;  2F8F A;  2JAD A;  3ME8 A;  1AAZ A;  1ON4 A;  4EO3 A;  3KH7 A;  5E59 A;  3NZN A;  1AC1 A;  4ZIL A;  3KTB A;  5EY6 A;  1Y25 A;  4IEL A;  3F63 A;  2LKU A;  5IPH A;  1OYJ A;  16GS A;  1K3O A;  4XRA A;  3FZ9 A;  4NV5 A;  2DJ3 A;  6GSV A;  4PUR A;  3RHC A;  3RDW A;  3QCP A;  2VLT A;  11GS A;  1SL0 B;  4K1F A;  2G2Q A;  3HJM A;  1ERT A;  4CHS A;  2L5L A;  1Q4J A;  2QC7 A;  1O85 A;  4RQR A;  1SL2 B;  5ECL B;  2V6K A;  4GSN A;  1B9Y C;  4PGT A;  4ULX A;  5G30 A;  5A4U A;  5AGY A;  2LRT A;  2LJA A;  4HOJ A;  3HXS A;  2H1G A;  5J4U A;  2DJ0 A;  4ILF A;  1OE7 A;  2TRC P;  2FHE A;  3D21 A;  2K6V A;  4TR1 B;  4LMV A;  4I2U A;  12GS A;  1Z9H A;  1VRS D;  4TW5 A;  3ZRE A;  1M7T A;  1GUL A;  4L5L A;  1FAA A;  2IFQ A;  1URM A;  3FR3 A;  4TN8 A;  4OFM A;  1BX9 A;  4JBB A;  4MDC A;  5ECI B;  2E0Q A;  1OKD A;  1X9S B;  2GZY A;  5ECQ B;  4L0W A;  4YQU A;  1JLW A;  2V1M A;  1TRS A;  3GL5 A;  4PQH A;  1QK8 A;  3GTU B;  1RW1 A;  4EVM A;  4PXO A;  2TRX A;  2OE1 A;  2JZR A;  2QSI A;  1GUM A;  1O8X A;  2V6O A;  4KSO A;  2L59 A;  1TK5 B;  3PH9 A;  3IOS A;  4L8E A;  3APS A;  3LXT A;  3G7J A;  3PIN A;  1UC7 A;  3G9B A;  2M72 A;  2XC2 A;  4MF5 A;  2R4V A;  5D8I A;  1SK0 A;  2H6Y A;  3GYK A;  2H72 A;  1YZX A;  3TRQ A;  5DAL A;  5IOX A;  2L6D A;  4BA7 A;  4IP6 A;  2WGR A;  4OCF A;  4NHW A;  3HZ8 A;  1DSB A;  1GUH A;  1MDK A;  1WJK A;  1YY7 A;  1DE2 A;  2D2Z A;  2NDO A;  3ZFB A;  2IMD A;  4GCI A;  3P7X A;  1A8Y A;  1RQM A;  3H93 A;  1JHB A;  2REM A;  4FIW A;  4AF2 A;  5KN2 A;  2PPT A;  2VUP A;  3ZML A;  2DIZ A;  3RAZ A;  2XPE A;  1U3A A;  1WPI A;  2PWJ A;  3L9U A;  4E8H A;  1EOG A;  4OD7 A;  1PA3 A;  3LYP A;  3KP9 A;  1TP9 A;  3RPN A;  1XVQ A;  2LV3 A;  3HKR A;  4ZXG A;  2MZC A;  4QL9 A;  2H30 A;  4ZBA A;  1ERW A;  4PQ1 A;  1FB6 A;  1X5E A;  4NMU A;  3UEM A;  2C3T A;  4LMW A;  1K3L A;  4PUF C;  4DEJ A;  5B6M A;  1F3A A;  3M9K A;  2B7J A;  3DML A;  1GSQ A;  4K0N A;  2YJ7 A;  1GTI A;  6GSY A;  2DMM A;  3IC4 A;  5GAP D;  5DQY A;  1GRX A;  1N2A A;  2BMX A;  2EIO A;  2IL3 A;  2LNS A;  4Q5F A;  2LJR A;  1ZCP A;  2OKA A;  3D4M A;  1XW9 A;  1JFU A;  1YF0 A;  2L5O A;  5H5R A;  1EWX A;  3APQ A;  4GST A;  4BVY A;  2JU5 A;  10GS A;  4HI7 A;  2KUC A;  4KA0 A;  4MJB A;  5INY A;  5IQY A;  1QQ2 A;  3HDC A;  1FG4 A;  3VPT A;  3KIJ A;  4WF5 A;  2L57 A;  3E9J B;  4FYC A;  1X5C A;  5LCZ A;  2VL9 A;  1TTZ A;  3QAG A;  4ML1 A;  2H73 A;  4AJ7 A;  5JWQ B;  3EUR A;  5JCU A;  3LQ7 A;  3V1W A;  3LJR A;  1AQV A;  2WRT A;  5DCG A;  1LJR A;  2LQO A;  4BVX A;  3VLN A;  1Z7R A;  2VCX A;  2AV4 A;  4KGI A;  2GT6 A;  6GSX A;  5ID2 A;  3KXO A;  4J2F A;  3TOT A;  4POB A;  1SD9 A;  2ZUP A;  4AJ8 A;  2C1Y A;  4X1U A;  5HR2 A;  4X43 A;  1XOA A;  2GVP A;  3EU4 A;  1V40 A;  2VD1 A;  5IPG A;  3UBK A;  1U3I A;  3O6T A;  3ZZX A;  2HYX A;  4OMV A;  3TCO A;  2O87 A;  1YDK A;  1O81 A;  2VD0 A;  1GSF A;  4G10 A;  4J57 E;  14GS A;  3M1G A;  4XS4 A;  3VFI A;  1M9A A;  4WBR D;  4DVC A;  3GST A;  1XCC A;  3UVT A;  1NHO A;  2VAF A;  1BED A;  3HJP A;  2K9F A;  4ECJ A;  4LA1 A;  4RI7 A;  5LNK e;  3ZLP A;  2H70 A;  3Q6O A;  1MTC A;  4N30 A;  3APO A;  1NM3 A;  3FY7 A;  2ON7 A;  4IQ1 A;  1VF1 A;  4MAB A;  1TU7 A;  4LL4 B;  4EE0 A;  3C1S A;  5HFK A;  5EVO A;  5J41 A;  1PKW A;  5B7C A;  3IK9 A;  3GH9 A;  4GLT A;  3EC3 A;  4K7O A;  4HU7 A;  3FR6 A;  5DJM A;  2YAN A;  3VPQ A;  3JCM L;  1LBK A;  3BJ5 A;  1TOF A;  3L78 A;  3ZYW A;  4EC0 A;  3GA4 A;  3ZVJ A;  1B8X A;  2FWF A;  4I8B A;  4I5Q A;  1SK2 A;  3F4R A;  4XS1 A;  1NSW A;  5G5E A;  1YQ1 A;  1ZGN A;  2B1L A;  3HYP A;  3SWL A;  3HD5 A;  1KBN A;  2YP6 A;  1ZL9 A;  2H74 A;  4ID0 A;  2NVL A;  2E2G A;  3GX8 A;  1MD4 A; 
#chains in the Genus database with same CATH topology
 4PNF A;  1KTE A;  1ZOF A;  7GSS A;  3W8S A;  3RHB A;  4WBJ A;  2CT6 A;  2GQK A;  3GUR A;  5DDL A;  3F3Q A;  1Z5Y E;  1JZD A;  4GWR A;  2PER A;  4WF4 A;  3BCI A;  1GSY A;  1B9X C;  1A0R P;  4HUA A;  1O73 A;  3NOF A;  1SL1 B;  1OAZ A;  2GDR A;  3H4K A;  1XG8 A;  2AUV A;  1V2A A;  3TOU A;  1XWK A;  2O8V B;  1MD3 A;  4HU9 A;  1YEX A;  3IV4 A;  5FT3 A;  3UAP A;  1TKD B;  19GS A;  2F9S A;  5B8B A;  2YV9 A;  5IIZ A;  1MDJ A;  2XHF A;  5KN3 A;  4FH8 A;  3FK8 A;  4IW9 A;  2F3M A;  4D73 A;  1A24 A;  3KP8 A;  4JRR A;  3BCK A;  1AQX A;  3CMI A;  4TOP A;  2GSR A;  4N10 A;  3UOM A;  5D9T A;  3FRC A;  4BWS A;  1BJX A;  2HRA A;  3C71 A;  1K3Y A;  4JE1 A;  1U88 A;  5CRW A;  2GQL A;  9GSS A;  2VL2 A;  3IK7 A;  4IGJ A;  1V57 A;  1VGL A;  4KDU A;  1TRU A;  3QFA C;  4KSM A;  3EU3 A;  1AIU A;  2VL2 C;  3LFL A;  2YV7 A;  2O89 A;  2HSY A;  2BTO T;  3KH9 A;  2VOC A;  4KND A;  2HFD A;  5JCW A;  3TJJ A;  2EIR A;  3TJK A;  3EE2 A;  3C1R A;  1S3D A;  5F05 A;  5DCH A;  1FVK A;  3ERW A;  2FWG A;  2RM6 A;  2RM5 A;  5IMF A;  2H0G A;  4WEY A;  2IJY A;  2G0F A;  4J56 E;  2FD3 A;  1SJ6 A;  1WRY A;  6GST A;  3CXG A;  3LEF A;  4MH2 A;  1B4Q A;  4L0U A;  1YJ6 A;  1OC9 A;  3F8U A;  2CA8 A;  2WZ9 A;  3IHG A;  2C80 A;  3FYG A;  1PD2 1;  3O3T A;  2IMK A;  4X4J A;  4GQF A;  5A4W A;  1DBY A;  5IOW A;  1GTU A;  2V2G A;  3DXB A;  3ZIV A;  1XFL A;  1GLP A;  1OC8 A;  4A5P A;  2JSZ A;  4V1A g;  4BWQ A;  1AW9 A;  1EP7 A;  1FB0 A;  2R6K A;  1K0D A;  2HSH A;  2M46 A;  3PGT A;  1EEJ A;  2PU9 C;  3A2W A;  2B6M A;  2V41 A;  5COH A;  4O5R A;  4DSQ A;  2HZE B;  1V9W A;  2EC4 A;  5C00 A;  3A5W A;  2AAW A;  3DVW A;  1E2Y A;  5GST A;  2GSS A;  1T7P B;  1ACV A;  3FHK A;  2JL4 A;  1R4W A;  5DAK B;  2M80 A;  3ME7 A;  1WP0 A;  1YKC A;  4K9Z A;  5ECN B;  3VK9 A;  2X64 A;  3P8W A;  2WB9 A;  4USS A;  5F8B A;  1EEM A;  2VM2 A;  2H75 A;  1VF4 A;  5D73 A;  1FOV A;  4YQV A;  2LJK A;  2LTK A;  3FR9 A;  1F3B A;  2DBC A;  2N5B A;  4WR4 A;  1M2D A;  1ERV A;  2YWI A;  3CSI A;  3QR6 A;  1ZYN A;  1HNB A;  1TI1 A;  3D0Z A;  5HR0 A;  2FY6 A;  3KEB A;  1SEN A;  2QKE A;  2VM1 A;  3WD6 A;  4MZW A;  4KB3 A;  4K5R A;  3O76 A;  1ABA A;  1SJZ A;  3P90 A;  2H1A A;  3ZTL A;  1R7H A;  2HZE A;  1FO5 A;  1GP1 A;  1QMV A;  2LRC A;  4KCE A;  4OCE A;  3TJF A;  2IPA A;  4MLY A;  4EL1 A;  2LS5 A;  1ML6 A;  1GNW A;  4TR1 A;  4QQ7 A;  6GSS A;  2HRF A;  2FGX A;  3N5O A;  1G6W A;  5HQP A;  4KW6 A;  3BD2 A;  3IDV A;  1DUG A;  4ZB9 A;  3UAR A;  1TK0 B;  3HVV A;  2DSA A;  6GSU A;  2LNT A;  3HVS A;  3F9U A;  3S9F A;  3EYT A;  3U6V A;  2WFC A;  3DYR A;  4IP1 A;  4KAE A;  2FA4 A;  2WCI A;  1PL1 A;  5GSS A;  5ENU A;  2R0G A;  1O7U A;  5ELG A;  2A2P A;  4ZL8 A;  4ISD A;  4MJE A;  3GTU A;  3KGK A;  3DD3 A;  3H1N A;  1T1V A;  4NAX A;  2TIR A;  3J7Y b;  3ZRD A;  4WKW A;  2DC5 A;  4Z2U A;  4PUA A;  2VCT A;  1ZZY A;  1GUK A;  5HR1 A;  1SYR A;  1O8W A;  4YQM A;  3DEX A;  2H0I A;  4PX1 A;  2E2M A;  6GSW A;  2OA7 A;  1SYX A;  3D4T A;  4EIP A;  4OO5 A;  5KN1 A;  4MP4 A;  2X8G A;  5HR3 A;  1F9M A;  1TXX A;  3GKN A;  2IIY A;  4POM A;  3IAS 2;  4JR4 A;  1M2A A;  1TRV A;  2B7K A;  1JZR A;  3TRP A;  5ECR B;  1GTB A;  1T8E B;  2ES7 A;  3CTF A;  2GZZ A;  1TU8 A;  3GKM A;  4YKG A;  5D96 A;  2B5Y A;  3C8E A;  4G0K A;  2R0P A;  1GLQ A;  2JZT A;  3DWV A;  1HQO A;  4K5S A;  5IMD A;  2FCH A;  1PX6 A;  2H76 A;  5DJL A;  3WGE A;  1F6M C;  3GSS A;  1DE1 A;  4RI6 A;  1W4V A;  2OE3 A;  4OO4 A;  5ELA A;  2CX3 A;  2C3N A;  1MDI A;  1V98 A;  3IA1 A;  4G9H A;  2KOK A;  4HJ2 A;  1T3B A;  4WXT A;  2HXK A;  2HE3 A;  2B5E A;  2NTO A;  2MBS A;  5BMU A;  1C72 A;  4MMM A;  1A0F A;  3LWA A;  3EMP A;  3LOR A;  2VCQ A;  2PGT A;  1OC3 A;  2OBI A;  2E7P A;  3I43 A;  5ABR A;  2JAC A;  3KD0 A;  2LRN A;  1UVZ A;  3VWX A;  4AJ6 A;  3MYD A;  3HVX A;  1XPV A;  4F9Z A;  4HSC X;  2XPD A;  2KP2 A;  1NHY A;  4V2N A;  1CQG A;  4G0I A;  1QXH A;  1T4Z A;  3WT2 A;  1CQH A;  2JSY A;  3MNG A;  3CQF A;  3FMW A;  1W89 A;  1GSU A;  1R26 A;  2I81 A;  4DSS B;  3QFB C;  1AQW A;  3FEU A;  1ILO A;  4H86 A;  4GSS A;  1G7E A;  3PR8 A;  2RII A;  1SKR B;  2VIM A;  2P5Q A;  4TVE A;  3IAM 2;  3TRX A;  1BYE A;  3GL3 A;  2YPM A;  4G2E A;  3UMA A;  3J7Y k;  1B4P A;  1YEP A;  5IO0 A;  4POL A;  1LU4 A;  5GAN D;  5CYY A;  4YH2 A;  2VL3 A;  5ECS A;  2F51 A;  2I1U A;  4ML6 A;  2H6Z A;  2DIY A;  1TRW A;  2L4C A;  2C0F A;  3LYK A;  4ZL9 A;  1RK4 A;  1M2B A;  3GKX A;  3HCZ A;  1WWJ A;  4HDE A;  8GSS A;  3KCM A;  3AY8 A;  4O92 A;  1EV9 A;  3TKQ A;  3VWW A;  1YF1 A;  4NWY A;  1NW2 A;  4AGS A;  1X9W B;  2H1B A;  3VI5 A;  5H5Q A;  3US3 A;  3ZIJ A;  1TDI A;  3KM6 A;  4TXO B;  2WDU A;  4L5O A;  1THX A;  4I6X A;  2GSQ A;  5FHI A;  2IN3 A;  4BL7 B;  5J5N A;  3ZMK A;  3CRU A;  3TGZ A;  4MPF A;  5AIX A;  4POK A;  4E8E A;  4EKZ A;  4I2T A;  2K8S A;  1JZO A;  4DSS A;  3CRT A;  1X0R A;  3M3M A;  1ERU A;  5ECM B;  2VO4 A;  2HT9 A;  2R37 A;  4ZBD A;  3QMX A;  4O5Q A;  3G7I A;  2CZ2 A;  3L0H A;  3KTL A;  2CV4 A;  1HNA A;  3TKP A;  1PQN A;  4JED A;  4V1A p;  4JZQ A;  2GS3 A;  1XXU A;  2DJ2 A;  3W8J A;  5DVB A;  1TK8 B;  2DJK A;  3KMN A;  1GSE A;  3WT1 A;  3WGX A;  1ZYP A;  2PVO C;  3F4T A;  1O6J A;  5IMV A;  3VWU A;  1XBS A;  3CBU A;  4GTU A;  2RUE A;  4GXZ A;  1YKA A;  5A4V A;  1PX7 A;  2MYG A;  1X9M B;  1ST9 A;  4YAV A;  3ZL5 A;  1J0F A;  1EOH A;  4F82 A;  5D93 A;  4IJI A;  2FLS A;  2MMA A;  3F3R A;  1PSQ A;  2C0G A;  2O7K A;  3F4S A;  4HQS A;  3CSH A;  2UZ8 A;  3IRA A;  1TI3 A;  3HZ4 A;  2PMT A;  1Z7P A;  4HJM A;  5J9B A;  2X99 A;  5G1L A;  2WJU A;  2X4A A;  1XIY A;  1PMT A;  2HNL A;  3M0F A;  2EIQ A;  4NXI A;  5H5S A;  1J08 A;  2DML A;  3GFK A;  5IM9 A;  1M3I A;  5JWR B;  2K18 A;  2IME A;  2CVD A;  1XOB A;  1M0U A;  2MMN A;  1SD8 A;  5GZZ B;  1XWG A;  2CZ3 A;  2I3Y A;  5D9V A;  3GRX A;  4TKY A;  4CDO A;  3TKS A;  3LG6 A;  3K8N A;  4MNN A;  5JWO B;  2XBQ A;  5CRE A;  3R2Q A;  1J9B A;  2C8U A;  2IFQ B;  3TKS C;  4WR5 A;  4Z2T A;  2YNX A;  1G0T A;  1BAY A;  2LQQ A;  1ZYE A;  4ZB8 A;  3C7M A;  4ZBB A;  1THO A;  4N0V A;  5IMZ A;  3DRN A;  3HY2 A;  4HQZ A;  3TUE A;  2LUS A;  3Q19 A;  3OR5 A;  1TJD A;  5CP1 A;  3VUR A;  2O85 A;  3M9J A;  2CVB A;  2DKH A;  4NPB A;  5KN0 A;  1PFO A;  5G5F A;  4LL1 B;  5F0G A;  4MJA A;  2QA1 A;  2P0G A;  1JLV A;  5CO3 A;  5B8A A;  2OE0 A;  3P2A A;  2YZH A;  2CVK A;  2YWO A;  5C04 A;  2MBT A;  3KZQ A;  3W6G A;  1XWC A;  1Z3E A;  3LGC A;  3TDG A;  2L4Q A;  2ON5 A;  5DAL B;  1X5D A;  3U5R E;  5AN1 A;  1K0A A;  2RLI A;  2JZS A;  2AHE A;  5F07 A;  1WE0 A;  3VI7 A;  4K0G A;  5IMC A;  2N5A A;  3IE3 A;  1TW9 A;  4GF0 A;  5D9W A;  1I5G A;  5CRD A;  3GH6 A;  3DKS A;  2DJJ A;  3CTG A;  1OE8 A;  2A4V A;  3LSZ A;  3MSZ A;  2GLR A;  2KLX A;  1T4Y A;  4KDY A;  4EDY A;  1B48 A;  4EUY A;  4XHM A;  4HZ4 A;  1IYH A;  4G19 A;  4ZL7 A;  1USB A;  3TKS E;  2VCZ A;  3PPU A;  4F0B A;  4ECC A;  5ECP B;  4Q5N A;  4JU5 A;  3IR4 A;  4ACS A;  5CAX A;  2PUK C;  4P3Y B;  2IWT A;  4V2L A;  4XS6 A;  4MF6 A;  1XZO A;  3QAV A;  4XRD A;  3GNJ A;  2PVQ A;  1XWA A;  4TR3 A;  4DSR A;  3SBC A;  5G1K A;  3VWV A;  5L71 A;  2PBJ A;  1FHE A;  1R5A A;  2ALB A;  3NIV A;  5HFI A;  4TXV A;  5ECH B;  3TB2 A;  3QPM A;  4K7N A;  2FWH A;  1K0O A;  3KMO A;  1EZK A;  22GS A;  4Q5R A;  4OFN A;  3FZ5 A;  3HJO A;  5E4W A;  5DAK A;  1PGT A;  4K6X A;  2OBK A;  2B5X A;  5IO2 A;  4K8M A;  1EP8 A;  1R5P A;  2H01 A;  2A4H A;  1JZW A;  1GL8 A;  4BVY B;  1SJI A;  3UL3 A;  1OVN A;  3Q18 A;  3DGQ A;  4K2X A;  1I9D A;  2YZU A;  1U6T A;  4MJC A;  2OAD A;  1S3C A;  2H71 A;  5CRG A;  1K0M A;  4X0X A;  2I9H A;  3E0U A;  4F03 A;  2FA8 A;  4HS1 A;  2H1D A;  2KHP A;  1UA5 A;  3IBH A;  1EGO A;  2Z9S A;  3Q74 A;  2A2S A;  3L4N A;  3G7Y A;  4O32 A;  4MA9 A;  1GWC A;  1M3J A;  3M8N A;  2YJH A;  4MF7 A;  1Z6M A;  4JR6 A;  2AYT A;  2YCD A;  4KE3 A;  5KEJ A;  2GST A;  3ED3 A;  1IYI A;  2C4J A;  2IMI A;  1GTA A;  1PL2 A;  1PN9 A;  2OJL A;  3QOU A;  1A2M A;  3RBT A;  4XTS A;  5ID2 B;  3QDN A;  1SKW B;  4OWY A;  2ZCT A;  20GS A;  1V58 A;  5A5K A;  2P5R A;  2P31 A;  3D6I A;  2FWE A;  2GT5 A;  4ICY A;  2YWN A;  1AUC A;  2GTU A;  1N8J A;  4N0Z A;  1K0C A;  3HA9 A;  1FVJ A;  3F0I A;  4EF0 A;  3F6D A;  2PN8 A;  4GQC A;  3ZFL A;  5FWG A;  2V32 A;  4XS4 B;  3UJ1 A;  5ECK B;  4ZB6 A;  4V2M A;  3FZA A;  2IMF A;  3TJB A;  4KX4 A;  3A3T A;  5F06 A;  3GX0 A;  3GV1 A;  3GMF A;  4HZ2 A;  4ECB A;  5LD0 A;  1WOU A;  5J9C A;  4PQI A;  3GKK A;  1AXD A;  4KF9 A;  2N5F A;  3BOA A;  3F6F A;  4MZC A;  1A23 A;  4TR0 A;  3GN3 A;  2VLU A;  1GNE A;  2X49 A;  2BJX A;  3I9V 2;  2YN1 A;  1QGV A;  3MWH A;  3TKR A;  5HFG A;  3I6A A;  4IJ3 A;  4ECI A;  4BPY A;  4NHZ A;  2HZF A;  1BQ7 A;  13GS A;  18GS A;  1HD2 A;  2GZP A;  3ERG A;  1K0B A;  3EMX A;  2J9H A;  1A2J A;  4IVF A;  3EPT A;  2H66 A;  4EDZ A;  2MMO A;  4IQA A;  2H6X A;  2FUG 2;  1XVW A;  4MPG A;  4GRF A;  1XW5 A;  4Z2R A;  2NBS A;  1Q98 A;  4XIH A;  3MDK A;  4O7H A;  2KP1 A;  2CAI A;  1WIK A;  4I97 A;  5IMA A;  2H19 A;  3RPP A;  2HRK A;  2X8C A;  2I4A A;  2NPB A;  4IS0 A;  3UVH A;  2CX4 A;  3QD9 A;  5AIV A;  5EL8 A;  2YOI A;  4CW9 A;  1S3A A;  3HHV A;  3GIX A;  4MCU A;  1F37 A;  1FW1 A;  1G6Y A;  2A2R A;  1GSD A;  2RUF A;  3GHA A;  4K7I A;  2YWM A;  2QGV A;  2R3X A;  1K0N A;  2WS2 A;  1G7O A;  2CAQ A;  4TRX A;  1GH2 A;  2R2J A;  3ISO A;  2HLS A;  1M9B A;  5JCG A;  4YAP A;  3UIW A;  3BBY A;  3A2V A;  4FO5 A;  2CQ9 A;  4Z7X A;  2MMZ A;  1H75 A;  1VF2 A;  4KUN A;  1ZYQ B;  2GQM A;  3R3E A;  5ECO B;  2H0H A;  1KEB A;  1PKZ A;  3N9J A;  3EIN A;  3EVI A;  2HI7 A;  1VF3 A;  1WMJ A;  3MIX A;  4K2D A;  1MEK A;  4D73 B;  4WET A;  5BRT A;  5J3R A;  1KNG A;  2WUL A;  3IPZ A;  1Y6E A;  3DIE A;  4MZB A;  2GGT A;  4PNG A;  5G2Z A;  5EPF A;  3LW9 A;  1EV4 A;  2J23 A;  2R5G A;  4RQX A;  2K8V A;  5B6N A;  2VCV A;  1GSS A;  1M99 A;  5G31 A;  2LEG A;  4OFT A;  1XW6 A;  3CYN A;  4IHU A;  3WGD A;  2DJ1 A;  2AJQ B;  2AB6 A;  2C0D A;  1H4O A;  4KDX A;  4QL7 A;  4MK3 A;  3IHQ A;  17GS A;  3DVX A;  1E6B A;  2VLV A;  4N11 A;  1EGR A;  2L6C A;  3A2X A;  5CNW A;  1T00 A;  4F2I A;  3CSJ A;  2ZNM A;  3EWL A;  5AIS A;  4KCA A;  4Q5Q A;  3MAK A;  3FKF A;  4KH7 A;  1BG5 A;  3WYW A;  3E3E A;  1SU9 A;  3H79 A;  1F2E A;  4RUV A;  4EXJ A;  1HNC A;  1Z6N A;  3QAW A;  2VCW A;  2FNO A;  1HYU A;  1SKS B;  3L9S A;  4LLR A;  4NV2 A;  5KOW A;  4F0C A;  4TXO A;  2F8A A;  3TJG A;  5CRH A;  2C0E A;  1U87 A;  4IKH A;  2XBI A;  1OC9 B;  3H8Q A;  1XWB A;  4BL7 A;  2OAC A;  3IXR A;  4HEA 2;  3ERF A;  1ZMA A;  4IN0 A;  4PTS A;  1S3R A;  1FOH A;  3D5J A;  4FYB A;  4TR4 A;  4FYU A;  5D9X A;  3I69 A;  1A2L A;  2H8L A;  2DLX A;  1OKT A;  1QFN A;  4IBP A;  3ZIT A;  4CY8 A;  1UN2 A;  5KOX A;  1PRX A;  2LST A;  3FZ4 A;  2C3Q A;  2HRN A;  3UBL A;  2X8H A;  4ZIJ A;  3LXZ A;  5DBQ A;  3KJY A;  1QUW A;  1A8L A;  2B3S A;  3ZVJ D;  1SK1 A;  3C73 A;  4MH3 A;  3D22 A;  3FW2 A;  4XCS A;  5DQS A;  3GUS A;  3L9V A;  2B1K A;  2F8F A;  2JAD A;  3ME8 A;  1AAZ A;  1ON4 A;  4EO3 A;  3KH7 A;  5E59 A;  3NZN A;  1AC1 A;  4ZIL A;  3KTB A;  5EY6 A;  1Y25 A;  4IEL A;  3F63 A;  2LKU A;  5IPH A;  1OYJ A;  16GS A;  1K3O A;  4XRA A;  4YKF A;  3FZ9 A;  4NV5 A;  2DJ3 A;  6GSV A;  4PUR A;  3RHC A;  3RDW A;  3QCP A;  2VLT A;  11GS A;  1SL0 B;  4K1F A;  2G2Q A;  3HJM A;  1ERT A;  4CHS A;  2L5L A;  1Q4J A;  2QC7 A;  1O85 A;  4RQR A;  1SL2 B;  5ECL B;  2V6K A;  4GSN A;  1B9Y C;  3HVN A;  4PGT A;  4ULX A;  5G30 A;  5A4U A;  5AGY A;  2LRT A;  2LJA A;  4HOJ A;  3HXS A;  2H1G A;  5J4U A;  2DJ0 A;  4ILF A;  1OE7 A;  2TRC P;  2FHE A;  3D21 A;  2K6V A;  4TR1 B;  4LMV A;  4I2U A;  12GS A;  1Z9H A;  1VRS D;  4TW5 A;  3ZRE A;  1M7T A;  1GUL A;  4L5L A;  1FAA A;  2IFQ A;  1URM A;  3FR3 A;  4TN8 A;  4OFM A;  1BX9 A;  3IC8 A;  4JBB A;  4MDC A;  5ECI B;  2E0Q A;  1OKD A;  1X9S B;  2GZY A;  5ECQ B;  4L0W A;  4YQU A;  1JLW A;  2V1M A;  1TRS A;  3GL5 A;  4PQH A;  1QK8 A;  3GTU B;  1RW1 A;  4EVM A;  4PXO A;  2TRX A;  2OE1 A;  2JZR A;  2QSI A;  1GUM A;  1O8X A;  2V6O A;  4KSO A;  2L59 A;  1TK5 B;  3PH9 A;  3IOS A;  4L8E A;  3APS A;  3LXT A;  3G7J A;  3PIN A;  1UC7 A;  3G9B A;  2M72 A;  2XC2 A;  4MF5 A;  2R4V A;  5D8I A;  1SK0 A;  2H6Y A;  3GYK A;  2H72 A;  1YZX A;  3TRQ A;  5DAL A;  5IOX A;  2L6D A;  4BA7 A;  4IP6 A;  2DKI A;  2WGR A;  4OCF A;  4NHW A;  3HZ8 A;  1DSB A;  1GUH A;  1MDK A;  1WJK A;  1YY7 A;  1DE2 A;  2D2Z A;  2NDO A;  3ZFB A;  2IMD A;  4GCI A;  3P7X A;  1A8Y A;  1RQM A;  3H93 A;  1JHB A;  2REM A;  4FIW A;  4AF2 A;  5KN2 A;  2PPT A;  2VUP A;  3ZML A;  2DIZ A;  3RAZ A;  2XPE A;  1U3A A;  1WPI A;  2PWJ A;  3L9U A;  4G0L A;  4E8H A;  1EOG A;  4OD7 A;  1PA3 A;  3LYP A;  3KP9 A;  1TP9 A;  3RPN A;  1XVQ A;  2LV3 A;  3HKR A;  4ZXG A;  2MZC A;  4QL9 A;  2H30 A;  4ZBA A;  1ERW A;  4PQ1 A;  1FB6 A;  1X5E A;  4NMU A;  3UEM A;  4BVX B;  2C3T A;  3A5I A;  4LMW A;  1K3L A;  4PUF C;  4DEJ A;  5B6M A;  1F3A A;  3M9K A;  2B7J A;  4CY6 A;  3DML A;  1GSQ A;  4K0N A;  2YJ7 A;  4EIQ A;  1GTI A;  6GSY A;  2DMM A;  3IC4 A;  5GAP D;  5DQY A;  1GRX A;  1N2A A;  2BMX A;  2EIO A;  2IL3 A;  2LNS A;  4Q5F A;  2LJR A;  1ZCP A;  2OKA A;  3D4M A;  1XW9 A;  1JFU A;  1YF0 A;  2L5O A;  1PN0 A;  5H5R A;  1EWX A;  3APQ A;  4GST A;  4BVY A;  2JU5 A;  10GS A;  4HI7 A;  2KUC A;  4KA0 A;  4MJB A;  5INY A;  5IQY A;  1QQ2 A;  3HDC A;  1FG4 A;  3VPT A;  3KIJ A;  2HSM A;  4WF5 A;  2L57 A;  3E9J B;  4FYC A;  4BIK A;  1X5C A;  5LCZ A;  2VL9 A;  1TTZ A;  3QAG A;  4ML1 A;  2H73 A;  4AJ7 A;  5JWQ B;  3EUR A;  5JCU A;  3LQ7 A;  3V1W A;  3LJR A;  1AQV A;  2WRT A;  5DCG A;  1LJR A;  2LQO A;  4BVX A;  3VLN A;  1Z7R A;  2VCX A;  2AV4 A;  4KGI A;  2GT6 A;  2QA2 A;  6GSX A;  5ID2 A;  3KXO A;  4J2F A;  3TOT A;  4POB A;  1SD9 A;  2ZUP A;  4AJ8 A;  2C1Y A;  4X1U A;  5HR2 A;  4X43 A;  1XOA A;  2GVP A;  3EU4 A;  1V40 A;  2VD1 A;  5IPG A;  3UBK A;  1U3I A;  3O6T A;  3ZZX A;  2HYX A;  4OMV A;  3TCO A;  2O87 A;  1YDK A;  1O81 A;  2VD0 A;  1GSF A;  4G10 A;  4J57 E;  14GS A;  3M1G A;  4XS4 A;  3VFI A;  1M9A A;  4WBR D;  4DVC A;  3GST A;  1XCC A;  3UVT A;  1NHO A;  2VAF A;  1BED A;  3HJP A;  2K9F A;  4ECJ A;  4LA1 A;  4RI7 A;  5LNK e;  3ZLP A;  2H70 A;  3Q6O A;  1MTC A;  4N30 A;  3APO A;  1NM3 A;  3FY7 A;  2ON7 A;  4IQ1 A;  1VF1 A;  4MAB A;  1TU7 A;  4LL4 B;  4EE0 A;  3C1S A;  5HFK A;  5EVO A;  5J41 A;  1PKW A;  5B7C A;  3IK9 A;  3GH9 A;  4GLT A;  3EC3 A;  4K7O A;  4HU7 A;  3FR6 A;  5DJM A;  2YAN A;  3VPQ A;  3JCM L;  1LBK A;  3BJ5 A;  1TOF A;  3L78 A;  3ZYW A;  4EC0 A;  3GA4 A;  4FQU A;  3ZVJ A;  1B8X A;  2FWF A;  4I8B A;  4I5Q A;  1SK2 A;  3F4R A;  4XS1 A;  1NSW A;  5G5E A;  1YQ1 A;  1ZGN A;  4O5U A;  2B1L A;  2R0C A;  3HYP A;  3SWL A;  3HD5 A;  1KBN A;  2YP6 A;  1ZL9 A;  2H74 A;  4ID0 A;  2NVL A;  2E2G A;  3GX8 A;  1MD4 A; 
#chains in the Genus database with same CATH homology
 4PNF A;  1KTE A;  1ZOF A;  7GSS A;  3W8S A;  3RHB A;  4WBJ A;  2CT6 A;  2GQK A;  3GUR A;  5DDL A;  3F3Q A;  1Z5Y E;  1JZD A;  4GWR A;  2PER A;  4WF4 A;  3BCI A;  1GSY A;  1B9X C;  1A0R P;  4HUA A;  1O73 A;  3NOF A;  1SL1 B;  1OAZ A;  2GDR A;  3H4K A;  2AUV A;  1V2A A;  3TOU A;  1XWK A;  2O8V B;  1MD3 A;  4HU9 A;  1YEX A;  3IV4 A;  5FT3 A;  3UAP A;  1TKD B;  19GS A;  2F9S A;  5B8B A;  2YV9 A;  5IIZ A;  1MDJ A;  2XHF A;  5KN3 A;  4FH8 A;  3FK8 A;  4IW9 A;  2F3M A;  4D73 A;  1A24 A;  3KP8 A;  4JRR A;  3BCK A;  1AQX A;  3CMI A;  4TOP A;  2GSR A;  4N10 A;  3UOM A;  5D9T A;  3FRC A;  4BWS A;  1BJX A;  2HRA A;  3C71 A;  1K3Y A;  4JE1 A;  1U88 A;  5CRW A;  2GQL A;  9GSS A;  2VL2 A;  3IK7 A;  4IGJ A;  1V57 A;  1VGL A;  4KDU A;  1TRU A;  3QFA C;  4KSM A;  3EU3 A;  1AIU A;  2VL2 C;  3LFL A;  2YV7 A;  2O89 A;  2HSY A;  2BTO T;  3KH9 A;  2VOC A;  4KND A;  2HFD A;  5JCW A;  3TJJ A;  2EIR A;  3TJK A;  3EE2 A;  3C1R A;  1S3D A;  5F05 A;  5DCH A;  1FVK A;  3ERW A;  2FWG A;  2RM6 A;  2RM5 A;  5IMF A;  2H0G A;  4WEY A;  2IJY A;  2G0F A;  4J56 E;  2FD3 A;  1SJ6 A;  1WRY A;  6GST A;  3CXG A;  3LEF A;  4MH2 A;  1B4Q A;  4L0U A;  1YJ6 A;  1OC9 A;  3F8U A;  2CA8 A;  2WZ9 A;  3IHG A;  2C80 A;  3FYG A;  1PD2 1;  3O3T A;  2IMK A;  4X4J A;  4GQF A;  5A4W A;  1DBY A;  5IOW A;  1GTU A;  2V2G A;  3DXB A;  3ZIV A;  1XFL A;  1GLP A;  1OC8 A;  4A5P A;  2JSZ A;  4V1A g;  4BWQ A;  1AW9 A;  1EP7 A;  1FB0 A;  2R6K A;  1K0D A;  2HSH A;  2M46 A;  3PGT A;  1EEJ A;  2PU9 C;  3A2W A;  2B6M A;  2V41 A;  5COH A;  4O5R A;  4DSQ A;  2HZE B;  1V9W A;  2EC4 A;  5C00 A;  3A5W A;  2AAW A;  3DVW A;  1E2Y A;  5GST A;  2GSS A;  1T7P B;  1ACV A;  3FHK A;  2JL4 A;  1R4W A;  5DAK B;  2M80 A;  3ME7 A;  1WP0 A;  1YKC A;  4K9Z A;  5ECN B;  3VK9 A;  2X64 A;  3P8W A;  2WB9 A;  4USS A;  5F8B A;  1EEM A;  2VM2 A;  2H75 A;  1VF4 A;  5D73 A;  1FOV A;  4YQV A;  2LJK A;  2LTK A;  3FR9 A;  1F3B A;  2DBC A;  2N5B A;  4WR4 A;  1M2D A;  1ERV A;  2YWI A;  3CSI A;  3QR6 A;  1ZYN A;  1HNB A;  1TI1 A;  3D0Z A;  5HR0 A;  2FY6 A;  3KEB A;  1SEN A;  2QKE A;  2VM1 A;  3WD6 A;  4MZW A;  4KB3 A;  4K5R A;  3O76 A;  1ABA A;  1SJZ A;  3P90 A;  2H1A A;  3ZTL A;  1R7H A;  2HZE A;  1FO5 A;  1GP1 A;  1QMV A;  2LRC A;  4KCE A;  4OCE A;  3TJF A;  2IPA A;  4MLY A;  4EL1 A;  2LS5 A;  1ML6 A;  1GNW A;  4TR1 A;  4QQ7 A;  6GSS A;  2HRF A;  2FGX A;  3N5O A;  1G6W A;  5HQP A;  4KW6 A;  3BD2 A;  3IDV A;  1DUG A;  4ZB9 A;  3UAR A;  1TK0 B;  3HVV A;  2DSA A;  6GSU A;  2LNT A;  3HVS A;  3F9U A;  3S9F A;  3EYT A;  3U6V A;  2WFC A;  3DYR A;  4IP1 A;  4KAE A;  2FA4 A;  2WCI A;  1PL1 A;  5GSS A;  5ENU A;  2R0G A;  1O7U A;  5ELG A;  2A2P A;  4ZL8 A;  4ISD A;  4MJE A;  3GTU A;  3KGK A;  3DD3 A;  3H1N A;  1T1V A;  4NAX A;  2TIR A;  3J7Y b;  3ZRD A;  4WKW A;  2DC5 A;  4Z2U A;  4PUA A;  2VCT A;  1ZZY A;  1GUK A;  5HR1 A;  1SYR A;  1O8W A;  4YQM A;  3DEX A;  2H0I A;  4PX1 A;  2E2M A;  6GSW A;  2OA7 A;  1SYX A;  3D4T A;  4EIP A;  4OO5 A;  5KN1 A;  4MP4 A;  2X8G A;  5HR3 A;  1F9M A;  1TXX A;  3GKN A;  2IIY A;  4POM A;  3IAS 2;  4JR4 A;  1M2A A;  1TRV A;  2B7K A;  1JZR A;  3TRP A;  5ECR B;  1GTB A;  1T8E B;  2ES7 A;  3CTF A;  2GZZ A;  1TU8 A;  3GKM A;  4YKG A;  5D96 A;  2B5Y A;  3C8E A;  4G0K A;  2R0P A;  1GLQ A;  2JZT A;  3DWV A;  1HQO A;  4K5S A;  5IMD A;  2FCH A;  1PX6 A;  2H76 A;  5DJL A;  3WGE A;  1F6M C;  3GSS A;  1DE1 A;  4RI6 A;  1W4V A;  2OE3 A;  4OO4 A;  5ELA A;  2CX3 A;  2C3N A;  1MDI A;  1V98 A;  3IA1 A;  4G9H A;  2KOK A;  4HJ2 A;  1T3B A;  4WXT A;  2HXK A;  2HE3 A;  2B5E A;  2NTO A;  2MBS A;  5BMU A;  1C72 A;  4MMM A;  1A0F A;  3LWA A;  3EMP A;  3LOR A;  2VCQ A;  2PGT A;  1OC3 A;  2OBI A;  2E7P A;  3I43 A;  5ABR A;  2JAC A;  3KD0 A;  2LRN A;  1UVZ A;  3VWX A;  4AJ6 A;  3MYD A;  3HVX A;  1XPV A;  4F9Z A;  2XPD A;  2KP2 A;  1NHY A;  4V2N A;  1CQG A;  4G0I A;  1QXH A;  1T4Z A;  3WT2 A;  1CQH A;  2JSY A;  3MNG A;  3FMW A;  1W89 A;  1GSU A;  1R26 A;  2I81 A;  4DSS B;  3QFB C;  1AQW A;  3FEU A;  1ILO A;  4H86 A;  4GSS A;  1G7E A;  3PR8 A;  2RII A;  1SKR B;  2VIM A;  2P5Q A;  4TVE A;  3IAM 2;  3TRX A;  1BYE A;  3GL3 A;  2YPM A;  4G2E A;  3UMA A;  3J7Y k;  1B4P A;  1YEP A;  5IO0 A;  4POL A;  1LU4 A;  5GAN D;  5CYY A;  4YH2 A;  2VL3 A;  5ECS A;  2F51 A;  2I1U A;  4ML6 A;  2H6Z A;  2DIY A;  1TRW A;  2L4C A;  2C0F A;  3LYK A;  4ZL9 A;  1RK4 A;  1M2B A;  3GKX A;  3HCZ A;  1WWJ A;  4HDE A;  8GSS A;  3KCM A;  3AY8 A;  4O92 A;  1EV9 A;  3TKQ A;  3VWW A;  1YF1 A;  4NWY A;  1NW2 A;  4AGS A;  1X9W B;  2H1B A;  3VI5 A;  5H5Q A;  3US3 A;  3ZIJ A;  1TDI A;  3KM6 A;  4TXO B;  2WDU A;  4L5O A;  1THX A;  4I6X A;  2GSQ A;  5FHI A;  2IN3 A;  4BL7 B;  5J5N A;  3ZMK A;  3CRU A;  3TGZ A;  4MPF A;  5AIX A;  4POK A;  4E8E A;  4EKZ A;  4I2T A;  2K8S A;  1JZO A;  4DSS A;  3CRT A;  1X0R A;  3M3M A;  1ERU A;  5ECM B;  2VO4 A;  2HT9 A;  2R37 A;  4ZBD A;  3QMX A;  4O5Q A;  3G7I A;  2CZ2 A;  3L0H A;  3KTL A;  2CV4 A;  1HNA A;  3TKP A;  1PQN A;  4JED A;  4V1A p;  4JZQ A;  2GS3 A;  1XXU A;  2DJ2 A;  3W8J A;  5DVB A;  1TK8 B;  2DJK A;  3KMN A;  1GSE A;  3WT1 A;  3WGX A;  1ZYP A;  2PVO C;  3F4T A;  1O6J A;  5IMV A;  3VWU A;  1XBS A;  3CBU A;  4GTU A;  2RUE A;  4GXZ A;  1YKA A;  5A4V A;  1PX7 A;  2MYG A;  1X9M B;  1ST9 A;  4YAV A;  3ZL5 A;  1J0F A;  1EOH A;  4F82 A;  5D93 A;  4IJI A;  2FLS A;  2MMA A;  3F3R A;  1PSQ A;  2C0G A;  2O7K A;  3F4S A;  4HQS A;  3CSH A;  2UZ8 A;  3IRA A;  1TI3 A;  3HZ4 A;  2PMT A;  1Z7P A;  4HJM A;  5J9B A;  2X99 A;  5G1L A;  2WJU A;  2X4A A;  1XIY A;  1PMT A;  2HNL A;  3M0F A;  2EIQ A;  4NXI A;  5H5S A;  1J08 A;  2DML A;  3GFK A;  5IM9 A;  5JWR B;  2K18 A;  2IME A;  2CVD A;  1XOB A;  1M0U A;  2MMN A;  1SD8 A;  5GZZ B;  1XWG A;  2CZ3 A;  2I3Y A;  5D9V A;  3GRX A;  4TKY A;  4CDO A;  3TKS A;  3LG6 A;  3K8N A;  4MNN A;  5JWO B;  2XBQ A;  5CRE A;  3R2Q A;  1J9B A;  2C8U A;  2IFQ B;  3TKS C;  4WR5 A;  4Z2T A;  2YNX A;  1G0T A;  1BAY A;  2LQQ A;  1ZYE A;  4ZB8 A;  3C7M A;  4ZBB A;  1THO A;  4N0V A;  5IMZ A;  3DRN A;  3HY2 A;  4HQZ A;  3TUE A;  2LUS A;  3Q19 A;  3OR5 A;  1TJD A;  5CP1 A;  3VUR A;  2O85 A;  3M9J A;  2CVB A;  2DKH A;  4NPB A;  5KN0 A;  5G5F A;  4LL1 B;  5F0G A;  4MJA A;  2QA1 A;  2P0G A;  1JLV A;  5CO3 A;  5B8A A;  2OE0 A;  3P2A A;  2YZH A;  2CVK A;  2YWO A;  5C04 A;  2MBT A;  3KZQ A;  3W6G A;  1XWC A;  1Z3E A;  3LGC A;  3TDG A;  2L4Q A;  2ON5 A;  5DAL B;  1X5D A;  3U5R E;  5AN1 A;  1K0A A;  2RLI A;  2JZS A;  2AHE A;  5F07 A;  1WE0 A;  3VI7 A;  4K0G A;  5IMC A;  2N5A A;  3IE3 A;  1TW9 A;  4GF0 A;  5D9W A;  1I5G A;  5CRD A;  3GH6 A;  3DKS A;  2DJJ A;  3CTG A;  1OE8 A;  2A4V A;  3LSZ A;  3MSZ A;  2GLR A;  2KLX A;  1T4Y A;  4KDY A;  4EDY A;  1B48 A;  4EUY A;  4XHM A;  4HZ4 A;  1IYH A;  4G19 A;  4ZL7 A;  1USB A;  3TKS E;  2VCZ A;  3PPU A;  4F0B A;  4ECC A;  5ECP B;  4Q5N A;  4JU5 A;  3IR4 A;  4ACS A;  5CAX A;  2PUK C;  4P3Y B;  2IWT A;  4V2L A;  4XS6 A;  4MF6 A;  1XZO A;  3QAV A;  4XRD A;  3GNJ A;  2PVQ A;  1XWA A;  4TR3 A;  4DSR A;  3SBC A;  5G1K A;  3VWV A;  5L71 A;  2PBJ A;  1FHE A;  1R5A A;  2ALB A;  3NIV A;  5HFI A;  4TXV A;  5ECH B;  3TB2 A;  3QPM A;  4K7N A;  2FWH A;  1K0O A;  3KMO A;  1EZK A;  22GS A;  4Q5R A;  4OFN A;  3FZ5 A;  3HJO A;  5E4W A;  5DAK A;  1PGT A;  4K6X A;  2OBK A;  2B5X A;  5IO2 A;  4K8M A;  1EP8 A;  1R5P A;  2H01 A;  2A4H A;  1JZW A;  1GL8 A;  4BVY B;  1SJI A;  3UL3 A;  1OVN A;  3Q18 A;  3DGQ A;  4K2X A;  1I9D A;  2YZU A;  1U6T A;  4MJC A;  2OAD A;  1S3C A;  2H71 A;  5CRG A;  1K0M A;  4X0X A;  2I9H A;  3E0U A;  4F03 A;  2FA8 A;  4HS1 A;  2H1D A;  2KHP A;  1UA5 A;  3IBH A;  1EGO A;  2Z9S A;  3Q74 A;  2A2S A;  3L4N A;  3G7Y A;  4O32 A;  4MA9 A;  1GWC A;  3M8N A;  2YJH A;  4MF7 A;  1Z6M A;  4JR6 A;  2AYT A;  2YCD A;  4KE3 A;  5KEJ A;  2GST A;  3ED3 A;  1IYI A;  2C4J A;  2IMI A;  1GTA A;  1PL2 A;  1PN9 A;  2OJL A;  3QOU A;  1A2M A;  3RBT A;  4XTS A;  5ID2 B;  3QDN A;  1SKW B;  4OWY A;  2ZCT A;  20GS A;  1V58 A;  5A5K A;  2P5R A;  2P31 A;  3D6I A;  2FWE A;  2GT5 A;  4ICY A;  2YWN A;  1AUC A;  2GTU A;  1N8J A;  4N0Z A;  1K0C A;  3HA9 A;  1FVJ A;  3F0I A;  4EF0 A;  3F6D A;  2PN8 A;  4GQC A;  3ZFL A;  5FWG A;  2V32 A;  4XS4 B;  3UJ1 A;  5ECK B;  4ZB6 A;  4V2M A;  3FZA A;  2IMF A;  3TJB A;  4KX4 A;  3A3T A;  5F06 A;  3GX0 A;  3GV1 A;  3GMF A;  4HZ2 A;  4ECB A;  5LD0 A;  1WOU A;  5J9C A;  4PQI A;  3GKK A;  1AXD A;  4KF9 A;  2N5F A;  3BOA A;  3F6F A;  4MZC A;  1A23 A;  4TR0 A;  3GN3 A;  2VLU A;  1GNE A;  2X49 A;  2BJX A;  3I9V 2;  2YN1 A;  1QGV A;  3MWH A;  3TKR A;  5HFG A;  3I6A A;  4IJ3 A;  4ECI A;  4BPY A;  4NHZ A;  2HZF A;  1BQ7 A;  13GS A;  18GS A;  1HD2 A;  2GZP A;  3ERG A;  1K0B A;  3EMX A;  2J9H A;  1A2J A;  4IVF A;  3EPT A;  2H66 A;  4EDZ A;  2MMO A;  4IQA A;  2H6X A;  2FUG 2;  1XVW A;  4MPG A;  4GRF A;  1XW5 A;  4Z2R A;  2NBS A;  1Q98 A;  4XIH A;  3MDK A;  4O7H A;  2KP1 A;  2CAI A;  1WIK A;  4I97 A;  5IMA A;  2H19 A;  3RPP A;  2HRK A;  2X8C A;  2I4A A;  2NPB A;  4IS0 A;  3UVH A;  2CX4 A;  3QD9 A;  5AIV A;  5EL8 A;  2YOI A;  4CW9 A;  1S3A A;  3HHV A;  3GIX A;  4MCU A;  1F37 A;  1FW1 A;  1G6Y A;  2A2R A;  1GSD A;  2RUF A;  3GHA A;  4K7I A;  2YWM A;  2QGV A;  2R3X A;  1K0N A;  2WS2 A;  1G7O A;  2CAQ A;  4TRX A;  1GH2 A;  2R2J A;  3ISO A;  2HLS A;  1M9B A;  5JCG A;  4YAP A;  3UIW A;  3BBY A;  3A2V A;  4FO5 A;  2CQ9 A;  4Z7X A;  2MMZ A;  1H75 A;  1VF2 A;  4KUN A;  1ZYQ B;  2GQM A;  3R3E A;  5ECO B;  2H0H A;  1KEB A;  1PKZ A;  3N9J A;  3EIN A;  3EVI A;  2HI7 A;  1VF3 A;  1WMJ A;  3MIX A;  4K2D A;  1MEK A;  4D73 B;  4WET A;  5BRT A;  5J3R A;  1KNG A;  2WUL A;  3IPZ A;  1Y6E A;  3DIE A;  4MZB A;  2GGT A;  4PNG A;  5G2Z A;  5EPF A;  3LW9 A;  1EV4 A;  2J23 A;  2R5G A;  4RQX A;  2K8V A;  5B6N A;  2VCV A;  1GSS A;  1M99 A;  5G31 A;  2LEG A;  4OFT A;  1XW6 A;  3CYN A;  4IHU A;  3WGD A;  2DJ1 A;  2AJQ B;  2AB6 A;  2C0D A;  1H4O A;  4KDX A;  4QL7 A;  4MK3 A;  3IHQ A;  17GS A;  3DVX A;  1E6B A;  2VLV A;  4N11 A;  1EGR A;  2L6C A;  3A2X A;  5CNW A;  1T00 A;  4F2I A;  3CSJ A;  2ZNM A;  3EWL A;  5AIS A;  4KCA A;  4Q5Q A;  3MAK A;  3FKF A;  4KH7 A;  1BG5 A;  3WYW A;  3E3E A;  1SU9 A;  3H79 A;  1F2E A;  4RUV A;  4EXJ A;  1HNC A;  1Z6N A;  3QAW A;  2VCW A;  2FNO A;  1HYU A;  1SKS B;  3L9S A;  4LLR A;  4NV2 A;  5KOW A;  4F0C A;  4TXO A;  2F8A A;  3TJG A;  5CRH A;  2C0E A;  1U87 A;  4IKH A;  2XBI A;  1OC9 B;  3H8Q A;  1XWB A;  4BL7 A;  2OAC A;  3IXR A;  4HEA 2;  3ERF A;  1ZMA A;  4IN0 A;  4PTS A;  1FOH A;  3D5J A;  4FYB A;  4TR4 A;  4FYU A;  5D9X A;  3I69 A;  1A2L A;  2H8L A;  2DLX A;  1OKT A;  1QFN A;  4IBP A;  3ZIT A;  4CY8 A;  1UN2 A;  5KOX A;  1PRX A;  2LST A;  3FZ4 A;  2C3Q A;  2HRN A;  3UBL A;  2X8H A;  4ZIJ A;  3LXZ A;  5DBQ A;  3KJY A;  1QUW A;  1A8L A;  2B3S A;  3ZVJ D;  1SK1 A;  3C73 A;  4MH3 A;  3D22 A;  3FW2 A;  4XCS A;  5DQS A;  3GUS A;  3L9V A;  2B1K A;  2F8F A;  2JAD A;  3ME8 A;  1AAZ A;  1ON4 A;  4EO3 A;  3KH7 A;  5E59 A;  3NZN A;  1AC1 A;  4ZIL A;  3KTB A;  5EY6 A;  1Y25 A;  4IEL A;  3F63 A;  2LKU A;  5IPH A;  1OYJ A;  16GS A;  1K3O A;  4XRA A;  4YKF A;  3FZ9 A;  4NV5 A;  2DJ3 A;  6GSV A;  4PUR A;  3RHC A;  3RDW A;  3QCP A;  2VLT A;  11GS A;  1SL0 B;  4K1F A;  2G2Q A;  3HJM A;  1ERT A;  4CHS A;  2L5L A;  1Q4J A;  2QC7 A;  1O85 A;  4RQR A;  1SL2 B;  5ECL B;  2V6K A;  4GSN A;  1B9Y C;  4PGT A;  4ULX A;  5G30 A;  5A4U A;  5AGY A;  2LRT A;  2LJA A;  4HOJ A;  3HXS A;  2H1G A;  5J4U A;  2DJ0 A;  4ILF A;  1OE7 A;  2TRC P;  2FHE A;  3D21 A;  2K6V A;  4TR1 B;  4LMV A;  4I2U A;  12GS A;  1Z9H A;  1VRS D;  4TW5 A;  3ZRE A;  1M7T A;  1GUL A;  4L5L A;  1FAA A;  2IFQ A;  1URM A;  3FR3 A;  4TN8 A;  4OFM A;  1BX9 A;  3IC8 A;  4JBB A;  4MDC A;  5ECI B;  2E0Q A;  1OKD A;  1X9S B;  2GZY A;  5ECQ B;  4L0W A;  4YQU A;  1JLW A;  2V1M A;  1TRS A;  3GL5 A;  4PQH A;  1QK8 A;  3GTU B;  1RW1 A;  4EVM A;  4PXO A;  2TRX A;  2OE1 A;  2JZR A;  2QSI A;  1GUM A;  1O8X A;  2V6O A;  4KSO A;  2L59 A;  1TK5 B;  3PH9 A;  3IOS A;  4L8E A;  3APS A;  3LXT A;  3G7J A;  3PIN A;  1UC7 A;  3G9B A;  2M72 A;  2XC2 A;  4MF5 A;  2R4V A;  5D8I A;  1SK0 A;  2H6Y A;  3GYK A;  2H72 A;  1YZX A;  3TRQ A;  5DAL A;  5IOX A;  2L6D A;  4BA7 A;  4IP6 A;  2DKI A;  2WGR A;  4OCF A;  4NHW A;  3HZ8 A;  1DSB A;  1GUH A;  1MDK A;  1WJK A;  1YY7 A;  1DE2 A;  2D2Z A;  2NDO A;  3ZFB A;  2IMD A;  4GCI A;  3P7X A;  1A8Y A;  1RQM A;  3H93 A;  1JHB A;  2REM A;  4FIW A;  4AF2 A;  5KN2 A;  2PPT A;  2VUP A;  3ZML A;  2DIZ A;  3RAZ A;  2XPE A;  1U3A A;  1WPI A;  2PWJ A;  3L9U A;  4G0L A;  4E8H A;  1EOG A;  4OD7 A;  1PA3 A;  3LYP A;  3KP9 A;  1TP9 A;  3RPN A;  1XVQ A;  2LV3 A;  3HKR A;  4ZXG A;  2MZC A;  4QL9 A;  2H30 A;  4ZBA A;  1ERW A;  4PQ1 A;  1FB6 A;  1X5E A;  4NMU A;  3UEM A;  4BVX B;  2C3T A;  3A5I A;  4LMW A;  1K3L A;  4PUF C;  4DEJ A;  5B6M A;  1F3A A;  3M9K A;  2B7J A;  4CY6 A;  3DML A;  1GSQ A;  4K0N A;  2YJ7 A;  4EIQ A;  1GTI A;  6GSY A;  2DMM A;  3IC4 A;  5GAP D;  5DQY A;  1GRX A;  1N2A A;  2BMX A;  2EIO A;  2IL3 A;  2LNS A;  4Q5F A;  2LJR A;  1ZCP A;  2OKA A;  3D4M A;  1XW9 A;  1JFU A;  1YF0 A;  2L5O A;  1PN0 A;  5H5R A;  1EWX A;  3APQ A;  4GST A;  4BVY A;  2JU5 A;  10GS A;  4HI7 A;  2KUC A;  4KA0 A;  4MJB A;  5INY A;  5IQY A;  1QQ2 A;  3HDC A;  1FG4 A;  3VPT A;  3KIJ A;  2HSM A;  4WF5 A;  2L57 A;  3E9J B;  4FYC A;  1X5C A;  5LCZ A;  2VL9 A;  1TTZ A;  3QAG A;  4ML1 A;  2H73 A;  4AJ7 A;  5JWQ B;  3EUR A;  5JCU A;  3LQ7 A;  3V1W A;  3LJR A;  1AQV A;  2WRT A;  5DCG A;  1LJR A;  2LQO A;  4BVX A;  3VLN A;  1Z7R A;  2VCX A;  2AV4 A;  4KGI A;  2GT6 A;  2QA2 A;  6GSX A;  5ID2 A;  3KXO A;  4J2F A;  3TOT A;  4POB A;  1SD9 A;  2ZUP A;  4AJ8 A;  2C1Y A;  4X1U A;  5HR2 A;  4X43 A;  1XOA A;  2GVP A;  3EU4 A;  1V40 A;  2VD1 A;  5IPG A;  3UBK A;  1U3I A;  3O6T A;  3ZZX A;  2HYX A;  4OMV A;  3TCO A;  2O87 A;  1YDK A;  1O81 A;  2VD0 A;  1GSF A;  4G10 A;  4J57 E;  14GS A;  3M1G A;  4XS4 A;  3VFI A;  1M9A A;  4WBR D;  4DVC A;  3GST A;  1XCC A;  3UVT A;  1NHO A;  2VAF A;  1BED A;  3HJP A;  2K9F A;  4ECJ A;  4LA1 A;  4RI7 A;  5LNK e;  3ZLP A;  2H70 A;  3Q6O A;  1MTC A;  4N30 A;  3APO A;  1NM3 A;  3FY7 A;  2ON7 A;  4IQ1 A;  1VF1 A;  4MAB A;  1TU7 A;  4LL4 B;  4EE0 A;  3C1S A;  5HFK A;  5EVO A;  5J41 A;  1PKW A;  5B7C A;  3IK9 A;  3GH9 A;  4GLT A;  3EC3 A;  4K7O A;  4HU7 A;  3FR6 A;  5DJM A;  2YAN A;  3VPQ A;  3JCM L;  1LBK A;  3BJ5 A;  1TOF A;  3L78 A;  3ZYW A;  4EC0 A;  3GA4 A;  4FQU A;  3ZVJ A;  1B8X A;  2FWF A;  4I8B A;  4I5Q A;  1SK2 A;  3F4R A;  4XS1 A;  1NSW A;  5G5E A;  1YQ1 A;  1ZGN A;  4O5U A;  2B1L A;  2R0C A;  3HYP A;  3SWL A;  3HD5 A;  1KBN A;  2YP6 A;  1ZL9 A;  2H74 A;  4ID0 A;  2NVL A;  2E2G A;  3GX8 A;  1MD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...