5J9CA

Crystal structure of peroxiredoxin asp f3 c31s/c61s variant
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
167
structure length
167
Chain Sequence
GLKAGDSFPSDVVFSYIPWSEDKGEITASGIPINYNASKEWADKKVILFALPGAFTPVSSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHLH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords peroxiredoxin Asp f3
publication title The Crystal Structure of Peroxiredoxin Asp f3 Provides Mechanistic Insight into Oxidative Stress Resistance and Virulence of Aspergillus fumigatus.
pubmed doi rcsb
source organism Neosartorya fumigata (strain atcc mya-4609 / af293 / cbs 101355 / fgsc a1100)
total genus 48
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2016-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5j9cA00
3NZNA 5HR1A 3CRTA 4AF2A 3FKFA 3RHCA 3TB2A 1QMVA 2DSAA 1BAYA 3US3A 4BWQA 5ID2B 2ZUPA 4N10A 3VFIA 3F63A 1N8JA 2VL2A 1JZWA 2VOCA 1FHEA 2H76A 4GQCA 2GSRA 2GTUA 2ALBA 1JHBA 1IYHA 1KTEA 6GSYA 1WWJA 3UJ1A 2N5AA 1LJRA 1ZZYA 3U5RE 4FH8A 1OKTA 2NPBA 2CQ9A 1K0BA 3MWHA 5D9WA 4EVMA 5D93A 1M2AA 3HYPA 4K7OA 4TVEA 4KDXA 1H75A 3J7Yb 2AYTA 3A2VA 5CRDA 2F51A 2GSSA 2HFDA 4K0NA 3HD5A 3ZIVA 3BOAA 2LJKA 3HVSA 5ENUA 2VL2C 3GURA 1HNCA 2H1AA 1RK4A 4MK3A 2WB9A 3L9UA 4I2TA 4L5LA 3KEBA 2C80A 4GQFA 4ZB6A 3KCMA 4L8EA 2HRFA 2V6KA 5KEJA 1VRSD 1ABAA 1YKCA 3HXSA 1GUMA 4AJ6A 2FHEA 4ECBA 1TKDB 3ZRDA 4ECCA 1T00A 2YZHA 1B48A 1JZRA 4WKWA 1G6WA 2GZPA 12GSA 1ON4A 5B6MA 2GZYA 3APQA 1TU7A 3TJKA 5A5KA 1V98A 3L0HA 3L4NA 4JZQA 1GP1A 4Q5FA 4NV2A 2OBIA 4CW9A 3U6VA 4LA1A 5IMAA 5J3RA 3ERFA 2O87A 2OA7A 5FWGA 4NV5A 4ML1A 2GSQA 4IQAA 5L71A 4TXOB 4AJ8A 3DIEA 3APSA 1DE2A 2PPTA 3VI7A 5KN2A 2F8FA 4IQ1A 3TKSA 4PXOA 2H0GA 2NTOA 3D0ZA 3QAWA 5B8AA 2VM2A 1A2LA 2O85A 1PSQA 1ML6A 3IAM2 4LLRA 3KIJA 4ACSA 1V57A 4KCEA 4N0ZA 1R5PA 16GSA 1N2AA 3D4MA 2XPDA 4TW5A 3I69A 4V1Ap 13GSA 2FWHA 4IKHA 2GQMA 4X43A 2D2ZA 2LSTA 3PGTA 1GH2A 4MF6A 2F9SA 1MD3A 2LJRA 3KH9A 3ZYWA 2YWNA 3ZVJA 2LKUA 4FYUA 2EIRA 5DAKA 3VPQA 3EC3A 4YH2A 3FEUA 2L6DA 2VLVA 1HD2A 2DJKA 5GAPD 1UA5A 1OC9A 4OO5A 4ZILA 5C04A 1ZYQB 4D73A 1B8XA 4EL1A 4TR4A 3TCOA 1GLPA 5JWQB 1W89A 2O7KA 1YJ6A 1EEMA 3KD0A 1XWAA 4K0GA 4J2FA 3IE3A 1WP0A 1OYJA 2QGVA 1O81A 1TOFA 5AIVA 2E2MA 3HZ4A 1AAZA 2KHPA 1FOVA 4KCAA 3Q19A 4I97A 1Z6MA 1NSWA 1QXHA 2AUVA 5CP1A 3GMFA 5G1LA 3F9UA 2C0GA 1BX9A 1I9DA 3UARA 2GT6A 1ST9A 2DJ3A 3UL3A 4RQXA 18GSA 1XW5A 3EINA 5JWOB 3LYPA 4GTUA 4ZL8A 2LNTA 2CVBA 1FVJA 3Q74A 4N0VA 1GULA 3ED3A 1PN9A 5HR3A 3TJBA 3TJFA 4TR0A 4E8EA 3F3QA 1VF4A 2PVQA 3FR3A 3CBUA 1MD4A 3ZFBA 1AQXA 2MMOA 4JU5A 2A2SA 2R5GA 3ZL5A 4AJ7A 5B7CA 3EMPA 1A2JA 3GKNA 4MLYA 5CNWA 2L59A 4MABA 2B1LA 3TJJA 2CAQA 4CHSA 3MAKA 2GLRA 3UOMA 3RPNA 2HXKA 4OWYA 2VD0A 1EZKA 2C4JA 2FD3A 2ON5A 3IRAA 3H4KA 1XBSA 3WGDA 5ECQB 5D8IA 3VWUA 4L5OA 1EP7A 1GNWA 4MJBA 2GZZA 4J56E 4KW6A 5G30A 5F06A 3LXZA 5EPFA 2RM5A 1FO5A 2MMAA 3ZLPA 2AB6A 3HJOA 3F6DA 3M8NA 1B4QA 3PINA 3HKRA 2B5YA 5D73A 3JCML 1GL8A 3UMAA 2QSIA 2C0DA 4K6XA 3ZREA 4F03A 1M0UA 2HRNA 4EXJA 4TKYA 3IK7A 3LXTA 4ZBAA 3I6AA 3KXOA 2JU5A 2CA8A 3IDVA 2HSHA 2XPEA 2MZCA 4G10A 2HZFA 3EVIA 1TP9A 3EYTA 4G9HA 4E8HA 3I9V2 3CSJA 4ID0A 1Z7RA 2FY6A 1BQ7A 2DIYA 4MH2A 2JL4A 1M2DA 2DMLA 5ECKB 2H70A 3IXRA 1A8YA 1A2MA 1BJXA 1YDKA 2AJQB 4F2IA 2GQKA 2LRNA 3C73A 1G0TA 1EV9A 4F9ZA 1ZMAA 2KOKA 4LL1B 3DD3A 5D96A 3F4TA 2YWMA 4FO5A 4XS6A 2WS2A 2REMA 1AW9A 1MDJA 14GSA 5F8BA 2CVDA 4NAXA 3GHAA 1K3OA 4JEDA 4EDYA 4PURA 5CYYA 4I8BA 2DJ1A 2DJ2A 1Q4JA 1WE0A 4EKZA 3IOSA 1X5EA 2C3NA 2H6YA 4I5QA 1UN2A 4PQ1A 2H8LA 4XS4B 5IQYA 3KP9A 1GUKA 2MMNA 1PA3A 4K1FA 4ISDA 1THXA 1A24A 3HJPA 3CSHA 1PL1A 2HLSA 3F8UA 2H0IA 5E4WA 4JR4A 4ZBDA 3C8EA 2R3XA 3O76A 5DALB 2L4CA 1H4OA 2YV7A 4HZ4A 3TOTA 5HFIA 4IGJA 1K3LA 3DWVA 3IV4A 4MZBA 2H75A 4HJMA 2OE1A 2RIIA 1RQMA 3W6GA 4OFNA 3GH6A 3GX0A 2DMMA 3FZ4A 5F05A 1XIYA 2A2RA 1T4YA 3EURA 2ZNMA 1J08A 3UBKA 3C1RA 2P31A 3EWLA 1OC8A 2WRTA 3HCZA 2JSYA 1ERTA 2H19A 2RUFA 4NXIA 4PQHA 1VF2A 5IOXA 4IP1A 3CTFA 2O8VB 3OR5A 1FB0A 2FLSA 1TJDA 3LSZA 4F82A 2HI7A 1O7UA 2JZTA 1U3AA 5KN3A 4V1Ag 3A2WA 5IMFA 1XW6A 5DCHA 2WCIA 4ZL7A 1FVKA 2X8HA 2M46A 2IMKA 5ELGA 2TRXA 1YKAA 1TW9A 5A4VA 1E6BA 2YJ7A 5AN1A 3ZTLA 2CAIA 1XWGA 3TDGA 3DEXA 1UVZA 4I6XA 1XWBA 4DSQA 4GSTA 1Y6EA 4POLA 2LJAA 2H1DA 3GNJA 1XWCA 1B9XC 4NHWA 2PWJA 3GTUA 2FGXA 1X9SB 1A0FA 1QK8A 2R2JA 2PMTA 2V32A 4MMMA 3CXGA 5IPHA 3UIWA 3G7YA 5D9VA 2WJUA 1YEPA 3M9JA 2GVPA 3D4TA 2HNLA 3GX8A 5B8BA 3FK8A 2HYXA 4PX1A 2B6MA 3VK9A 5JCGA 1JZOA 2X99A 4WETA 2H71A 3IK9A 2OACA 3ZZXA 1F3BA 4HEA2 3O6TA 3LGCA 4O92A 4K9ZA 4GRFA 3VLNA 1XW9A 2VUPA 2I9HA 3IHQA 2M72A 3AY8A 4K7NA 2DC5A 4PNFA 2R4VA 3ISOA 3RPPA 1EV4A 2N5FA 3IAS2 4GCIA 4NHZA 2C8UA 2KP2A 2VL3A 4V2MA 2NBSA 1PQNA 4XHMA 3FW2A 2ES7A 2AAWA 2PGTA 4ZL9A 4G19A 4TR1A 5LNKe 5LCZA 3P7XA 3D5JA 3TUEA 1TK8B 3E3EA 1Z9HA 1GSEA 3M0FA 1MTCA 4OFMA 5DJMA 1AQVA 1C72A 5ECOB 1MDIA 2KUCA 5DQSA 2OKAA 3F3RA 2DLXA 4QQ7A 2YANA 3DRNA 1VGLA 3C71A 2FWEA 3EU4A 4GSNA 5F07A 4TN8A 4HQZA 3ME7A 3QAVA 5ECIB 2LS5A 3L9SA 3VWWA 5ELAA 2PERA 4EO3A 3FR9A 1O8XA 2IMIA 4FIWA 3VWVA 4TXVA 3HA9A 2C3TA 5G5FA 2XBQA 2LV3A 5LD0A 2GT5A 20GSA 5DJLA 17GSA 2VLUA 1SD8A 5EL8A 1U6TA 3KP8A 1XCCA 2L6CA 2CX4A 1T3BA 2C3QA 3CTGA 3TKSC 1ZCPA 3ZITA 1TRUA 4ULXA 4XIHA 4XTSA 4POBA 1YF0A 2TRCP 5H5RA 2E0QA 2QKEA 5EY6A 6GSWA 1YQ1A 1M99A 4WF5A 4OO4A 3LORA 2YPMA 4X1UA 2B5XA 3SWLA 3IPZA 2IMFA 2CVKA 4MF7A 1V40A 2RUEA 2JZRA 3UBLA 3MNGA 4BWSA 1URMA 2YNXA 5G2ZA 1SJZA 5DAKB 5H5QA 1R5AA 2IFQA 5ECNB 1GSSA 4MJEA 1KNGA 5HR0A 1OC9B 2QC7A 4GF0A 2PU9C 1I5GA 1V9WA 3DXBA 1XVQA 4IS0A 3TKQA 3ZMKA 3QD9A 3H93A 3IC4A 1F6MC 1ERWA 2EIOA 2JADA 1HNAA 2B1KA 3QCPA 1G7OA 1PRXA 2H74A 3QFAC 2LQQA 4HI7A 3FZ5A 1U87A 3M3MA 3TKSE 2NDOA 2X8CA 2M80A 4QL7A 1RW1A 3KJYA 4DSSA 4DEJA 3KMNA 1M9AA 2J23A 5H5SA 4Q5NA 5G5EA 4K8MA 3F4RA 4RUVA 3HDCA 2IMDA 2IWTA 6GSTA 5J9CA 2K8SA 2I4AA 3KTBA 5IIZA 2YJHA 3FYGA 6GSXA 4BVYA 1OAZA 1X5CA 2YWIA 3DGQA 1JLVA 2R37A 1FG4A 2ON7A 3CRUA 2HE3A 2VO4A 5ECLB 3GYKA 3BD2A 3GL3A 2HZEB 1TI1A 1OE7A 1FAAA 1NHOA 4J57E 3LQ7A 3A3TA 1ZYEA 5GSTA 2YV9A 2AHEA 1TRWA 2MYGA 3IR4A 2FA8A 1ERUA 4KGIA 5G31A 2IIYA 2FWFA 5AIXA 4HJ2A 4ZB9A 1EOGA 3Q18A 2NVLA 4GSSA 1SL1B 3J7Yk 3EE2A 2JZSA 2VD1A 3WYWA 5C00A 4BPYA 2O89A 1ZL9A 2XHFA 4Z7XA 1Y25A 2G0FA 5EVOA 4HDEA 5D9TA 2LNSA 2VCZA 1DUGA 3D6IA 2CV4A 2I3YA 2PBJA 2H6XA 4AGSA 3UEMA 1JFUA 2L57A 3G9BA 5KN1A 4Q5RA 3QR6A 5JWRB 1G6YA 1K0NA 4KAEA 4RI6A 3GV1A 3F4SA 1ZOFA 1LU4A 4EUYA 4OD7A 1LBKA 1ACVA 5JCUA 2IL3A 3H1NA 1O85A 4ZXGA 2WDUA 4ECIA 1SKSB 4HU7A 4F0BA 5CAXA 4QL9A 3RBTA 3ZIJA 6GSSA 1WMJA 2YN1A 1KBNA 4NPBA 5FHIA 3VURA 1K0OA 3RAZA 3KGKA 4XRDA 3UVHA 3VI5A 4POKA 1SYXA 4PNGA 1X9WB 4HOJA 1G7EA 2IN3A 9GSSA 1QGVA 5CRWA 2H0HA 4JBBA 3P8WA 2FNOA 3WT1A 4V2NA 3TJGA 4IVFA 2X64A 1T4ZA 2I81A 2B7KA 3GIXA 4GLTA 4HQSA 1V58A 3ERGA 3QMXA 2H30A 3QOUA 1K0AA 4LL4B 4TR3A 4IJ3A 1O73A 4PUAA 1X9MB 1GSQA 5A4UA 3TRXA 3N5OA 3ZFLA 1WOUA 3A2XA 2XBIA 4MZWA 1ERVA 4FYCA 5DALA 3GA4A 4MP4A 5HR2A 3QFBC 4PQIA 4KDYA 2YWOA 3LG6A 4O32A 2YP6A 4KA0A 1PX6A 3KMOA 1FB6A 1A8LA 3N9JA 4PGTA 5COHA 4O7HA 3C1SA 1BYEA 3FR6A 1XFLA 1PGTA 5GZZB 1QUWA 2BJXA 2VCVA 4WBRD 3TKPA 3IA1A 3Q6OA 4KDUA 2WFCA 2V41A 1K0CA 1X0RA 5A4WA 1DBYA 2C0FA 1AIUA 1HYUA 4FYBA 4HUAA 2V1MA 2H66A 1PD21 4KB3A 2V6OA 5ABRA 3GUSA 1YF1A 5ID2A 11GSA 4X0XA 1PKZA 5HFKA 1Z3EA 1IYIA 2KP1A 2CX3A 2R6KA 5IOWA 3WGXA 1CQHA 1GSFA 1DSBA 2G2QA 4DVCA 3G7IA 1XOBA 3GKXA 1VF3A 1SK1A 1TTZA 2DIZA 1PL2A 5CRGA 5AISA 1JLWA 5IMVA 1DE1A 3R2QA 2YCDA 4ILFA 3W8JA 1S3DA 3LYKA 1GTAA 4JR6A 2HT9A 5GSSA 2CZ3A 3GH9A 1EWXA 2FWGA 4MCUA 4YQMA 2B3SA 2WZ9A 1M2BA 4F0CA 4Q5QA 1F37A 3QPMA 1V2AA 2E7PA 4KH7A 2MBSA 1B9YC 4N11A 2H1BA 2Z9SA 5JCWA 2X8GA 4L0WA 3GKMA 2WULA 5J5NA 4K7IA 2DBCA 5IMDA 3APOA 5IMZA 3HJMA 3QAGA 3KZQA 19GSA 3LFLA 4KSOA 1S3CA 3HY2A 2GS3A 3LEFA 3MSZA 3CMIA 1U88A 1WRYA 3WD6A 4POMA 2PVOC 4MPGA 4YAVA 3K8NA 4XRAA 3E0UA 2EIQA 3EU3A 1K0MA 3KH7A 5IO2A 10GSA 1XVWA 8GSSA 2C0EA 3RHBA 1GLQA 2OBKA 2P5QA 4IHUA 3GTUB 4MJAA 4TRXA 1AC1A 4V2LA 4TXOA 4BL7A 1TU8A 1FW1A 4XCSA 2GGTA 4EC0A 1CQGA 2CT6A 2VLTA 4IN0A 1T1VA 2RLIA 4MF5A 1K3YA 3VWXA 4OCFA 2OE0A 2FA4A 3ERWA 4BVXA 4WR5A 4P3YB 2IJYA 2LTKA 1WJKA 2AV4A 3TRPA 1TK5B 1GTIA 4GWRA 2OJLA 4MPFA 5DCGA 5ECMB 3F6FA 3BBYA 4IJIA 1R26A 3G7JA 5ECSA 1TK0B 4IELA 1O8WA 1SJ6A 1OC3A 3FZ9A 1B4PA 5J41A 4YAPA 1WIKA 1F2EA 3GSSA 1SK0A 4KE3A 3EMXA 4TR1B 1GSYA 1BEDA 2YOIA 3FZAA 5AGYA 1ZGNA 4NMUA 1X5DA 4ML6A 3ZVJD 1OVNA 3P2AA 5DQYA 3C7MA 2K18A 2K8VA 1AXDA 2GDRA 1QQ2A 4O5RA 1NM3A 3WGEA 5HQPA 1M9BA 3KTLA 1TRVA 3M9KA 3PH9A 3FHKA 3UVTA 3LWAA 1HNBA 3UAPA 4XS1A 4EDZA 2B5EA 4TOPA 4IW9A 7GSSA 2VL9A 2IMEA 2KLXA 1PX7A 5INYA 1PMTA 2VM1A 2L4QA 4GXZA 2F8AA 3NOFA 1XXUA 1SJIA 1BG5A 1XZOA 1JZDA 3DVWA 3V1WA 1Q98A 4D73B 3I43A 2ZCTA 5FT3A 1QFNA 4MDCA 4RQRA 4HU9A 1F3AA 2CZ2A 4LMWA 2F3MA 1Z6NA 5ECPB 1S3AA 4OFTA 3L9VA 5E59A 4YQUA 1U3IA 4BA7A 2N5BA 4PUFC 2YZUA 5HFGA 4WBJA 3GRXA 4MH3A 2HZEA 1GSDA 2WGRA 2IFQB 3TKRA 1J9BA 3CYNA 1K0DA 2H72A 4WF4A 1OKDA 4JRRA 3HZ8A 1R7HA 1KEBA 4KUNA 1SK2A 5IO0A 1T8EB 1GTUA 2FUG2 4HS1A 1OE8A 5IPGA 5J4UA 1M7TA 1E2YA 1W4VA 1SYRA 4ZBBA 2H6ZA 4YQVA 5GAND 4IBPA 2L5LA 1WPIA 1F9MA 3BCKA 3GSTA 4I2UA 2A4VA 4DSSB 3W8SA 3FY7A 2RM6A 2K9FA 4WR4A 4L0UA 3F0IA 3MDKA 5J9BA 3DKSA 3D22A 2P0GA 3H79A 2HSYA 3HVXA 3BCIA 5IMCA 1MDKA 2J9HA 1A23A 2OE3A 1AUCA 3IBHA 2PN8A 1PKWA 1EP8A 1EGRA 5B6NA 3DMLA 1YEXA 1O6JA 2IPAA 4ZB8A 1VF1A 2EC4A 3SBCA 1J0FA 2DJJA 3GL5A 4DSRA 5ECRB 1HQOA 2VIMA 2GQLA 5DDLA 3DYRA 5CREA 4G2EA 2K6VA 1THOA 5IM9A 2H01A 2OADA 3GFKA 2LEGA 2VCXA 4H86A 2XC2A 4KSMA 3L78A 2MMZA 2VCWA 1AQWA 22GSA 4K2DA 1XOAA 2I1UA 3PR8A 1SL2B 2LQOA 1SU9A 2VCTA 2FCHA 1R4WA 1SKRB 3GKKA 5DBQA 3ME8A 1GWCA 4NWYA 5KN0A 3DVXA 5DVBA 3QDNA 1XWKA 2LUSA 1A0RP 4OMVA 1Z7PA 2H1GA 3BJ5A 4CDOA 1GRXA 2VCQA 6GSVA 1UC7A 4XS4A 1TRSA 1USBA 3TRQA 1YY7A 5F0GA 3ZMLA 1T7PB 4JE1A 3FRCA 2L5OA 3O3TA 4LMVA 4MZCA 3WT2A 4MJCA 3P90A 2LRTA 3A5WA 4ECJA 1SL0B 2E2GA 1EGOA 4OCEA 4WXTA 4KNDA 1YZXA 4IP6A 2LRCA 1MEKA 1EEJA 3E9JB 5CO3A 3D21A 1ILOA 2B7JA 3RDWA 2JACA 2V2GA 2BMXA 1Z5YE 1SKWB 3CSIA 4WEYA 1TDIA 5ECHB 3TGZA 4KX4A 3VPTA 4ZIJA 4MA9A 2VAFA 4EE0A 2BTOT 3GN3A 3KM6A 4RI7A 3TOUA 2P5RA 1GNEA 4N30A 5CRHA 1TI3A 2H73A 1EOHA 3HHVA 5G1KA 1GSUA 2C1YA 3LJRA 5D9XA 3HVVA 3NIVA 1TXXA 1SD9A 1GUHA 2MBTA 1NW2A 3H8QA 2PUKC 3S9FA 1XPVA 2JSZA 1NHYA 4HZ2A 2DJ0A 4EF0A 2GSTA 3M1GA 2TIRA 1SENA 6GSUA 1GTBA
chains in the Genus database with same CATH superfamily
3NZNA 5HR1A 3CRTA 4AF2A 3FKFA 3RHCA 3TB2A 1QMVA 2DSAA 1BAYA 3US3A 4BWQA 5ID2B 2ZUPA 4N10A 3VFIA 3F63A 1N8JA 2VL2A 1JZWA 2VOCA 1FHEA 2H76A 4GQCA 2GSRA 2GTUA 2ALBA 1JHBA 1IYHA 1KTEA 6GSYA 1WWJA 3UJ1A 2N5AA 1LJRA 1ZZYA 3U5RE 4FH8A 1OKTA 2NPBA 2CQ9A 1K0BA 3MWHA 5D9WA 4EVMA 5D93A 1M2AA 1S3RA 3HYPA 4K7OA 4TVEA 4KDXA 1H75A 3J7Yb 2AYTA 3A2VA 5CRDA 2F51A 2GSSA 2HFDA 4K0NA 3HD5A 3ZIVA 3BOAA 2LJKA 3HVSA 5ENUA 2VL2C 3GURA 1HNCA 2H1AA 1RK4A 4HSCX 4MK3A 2WB9A 1M3JA 3L9UA 4I2TA 4L5LA 3KEBA 2C80A 4GQFA 4ZB6A 3KCMA 4L8EA 2HRFA 2V6KA 5KEJA 1VRSD 1ABAA 1YKCA 3HXSA 1GUMA 4AJ6A 2FHEA 4ECBA 1TKDB 3ZRDA 4ECCA 1T00A 2YZHA 1B48A 1JZRA 4WKWA 1G6WA 2GZPA 4ICYA 12GSA 1ON4A 5B6MA 2GZYA 3APQA 1TU7A 3TJKA 5A5KA 1V98A 3L0HA 3L4NA 4JZQA 1GP1A 4Q5FA 4NV2A 2OBIA 4CW9A 3U6VA 4LA1A 5IMAA 5J3RA 3ERFA 2O87A 2OA7A 5FWGA 4NV5A 4ML1A 2GSQA 4IQAA 5L71A 4TXOB 4BL7B 4AJ8A 3DIEA 4YKGA 3APSA 1DE2A 2PPTA 3VI7A 5KN2A 2F8FA 4IQ1A 3TKSA 4PXOA 2H0GA 2NTOA 3D0ZA 3QAWA 5B8AA 2VM2A 1A2LA 2O85A 1PSQA 1ML6A 3IAM2 4LLRA 4BVXB 3KIJA 4ACSA 1V57A 4KCEA 4N0ZA 1R5PA 16GSA 1N2AA 3D4MA 2XPDA 4TW5A 3I69A 4V1Ap 13GSA 2FWHA 4IKHA 1ZYPA 2GQMA 4X43A 2D2ZA 2LSTA 3PGTA 1GH2A 4MF6A 2F9SA 1MD3A 2LJRA 3KH9A 3ZYWA 2YWNA 3ZVJA 2LKUA 4FYUA 2EIRA 5DAKA 3VPQA 3EC3A 4YH2A 3FEUA 2L6DA 2VLVA 1HD2A 2DJKA 5GAPD 1UA5A 1OC9A 4OO5A 4ZILA 5C04A 1ZYQB 4D73A 1B8XA 4EL1A 4TR4A 3TCOA 1GLPA 5JWQB 1W89A 2O7KA 1YJ6A 1EEMA 3KD0A 1XWAA 4K0GA 4J2FA 3IE3A 1WP0A 1OYJA 2QGVA 1O81A 1TOFA 4EIPA 5AIVA 2E2MA 3HZ4A 1AAZA 2KHPA 1FOVA 4KCAA 3Q19A 4I97A 1Z6MA 1NSWA 1QXHA 2R0CA 2AUVA 5CP1A 3GMFA 5G1LA 3F9UA 2C0GA 1BX9A 1I9DA 3UARA 1FOHA 2GT6A 1ST9A 2DJ3A 3UL3A 4RQXA 18GSA 1XW5A 3EINA 5JWOB 3LYPA 4GTUA 4ZL8A 2LNTA 2CVBA 1FVJA 3Q74A 4N0VA 1GULA 3ED3A 3MYDA 1PN9A 5HR3A 3TJBA 3TJFA 4TR0A 4E8EA 3F3QA 1VF4A 2PVQA 3FR3A 3CBUA 1MD4A 3ZFBA 1AQXA 2MMOA 4JU5A 2A2SA 2R5GA 3ZL5A 4AJ7A 5B7CA 3EMPA 1A2JA 3GKNA 4MLYA 5CNWA 2L59A 4MABA 2B1LA 3TJJA 2CAQA 4CHSA 3MAKA 2GLRA 2HRKA 3UOMA 3RPNA 3LW9A 2HXKA 4OWYA 2VD0A 1EZKA 2C4JA 2FD3A 2ON5A 3IRAA 3H4KA 1XBSA 3WGDA 5ECQB 5D8IA 3VWUA 4L5OA 1EP7A 1GNWA 4MJBA 2GZZA 4J56E 4KW6A 5G30A 5F06A 3LXZA 5EPFA 2RM5A 1FO5A 2MMAA 3ZLPA 4EIQA 4K5SA 2AB6A 3HJOA 3F6DA 3M8NA 1B4QA 3PINA 2HRAA 3HKRA 2B5YA 5D73A 3JCML 4KF9A 1GL8A 3UMAA 2QSIA 2C0DA 4K6XA 3ZREA 4F03A 1M0UA 2HRNA 4EXJA 4TKYA 3IK7A 3LXTA 4ZBAA 3I6AA 3KXOA 2JU5A 2CA8A 3IDVA 2HSHA 2XPEA 2MZCA 4G10A 2HZFA 3EVIA 1TP9A 3EYTA 4G9HA 4E8HA 3I9V2 3CSJA 4ID0A 1Z7RA 2FY6A 1BQ7A 1XG8A 2DIYA 4MH2A 2JL4A 1M2DA 2DMLA 5ECKB 2H70A 3IXRA 1A8YA 1A2MA 1BJXA 1YDKA 2AJQB 4F2IA 2GQKA 2LRNA 3C73A 1G0TA 1EV9A 4F9ZA 1ZMAA 2KOKA 4LL1B 3DD3A 5D96A 3F4TA 2YWMA 4FO5A 4XS6A 2WS2A 2REMA 1AW9A 1MDJA 14GSA 5F8BA 2CVDA 4NAXA 3GHAA 1K3OA 4JEDA 4EDYA 4Z2UA 4PURA 5CYYA 4I8BA 2DJ1A 2DJ2A 1Q4JA 1WE0A 4EKZA 3IOSA 1X5EA 2C3NA 2H6YA 4I5QA 1UN2A 4PQ1A 2H8LA 4XS4B 5IQYA 3KP9A 1GUKA 2MMNA 1PA3A 2A2PA 4K1FA 4ISDA 1THXA 1A24A 3HJPA 3CSHA 1PL1A 2HLSA 3F8UA 2H0IA 5E4WA 4JR4A 4ZBDA 3C8EA 2R3XA 3O76A 5DALB 2L4CA 1H4OA 2YV7A 4HZ4A 3TOTA 5HFIA 4IGJA 1K3LA 3DWVA 3IV4A 4MZBA 2H75A 4HJMA 4PTSA 2OE1A 2RIIA 1RQMA 3W6GA 4OFNA 3GH6A 3GX0A 2DMMA 4Z2RA 3FZ4A 5F05A 1XIYA 2A2RA 1T4YA 3EURA 2ZNMA 5BRTA 1J08A 3UBKA 3C1RA 2P31A 3EWLA 1OC8A 2WRTA 3HCZA 2JSYA 1ERTA 2H19A 2RUFA 4NXIA 1ZYNA 4PQHA 1VF2A 5IOXA 4IP1A 3CTFA 2O8VB 3OR5A 1FB0A 2FLSA 1TJDA 3LSZA 4F82A 2HI7A 1O7UA 2JZTA 1U3AA 5KN3A 4V1Ag 3A2WA 5IMFA 1XW6A 5DCHA 2WCIA 4ZL7A 1FVKA 2X8HA 2M46A 2IMKA 5ELGA 2TRXA 1YKAA 1TW9A 5A4VA 1E6BA 2YJ7A 5AN1A 3ZTLA 2CAIA 1XWGA 3TDGA 3DEXA 1UVZA 4I6XA 1XWBA 4DSQA 4GSTA 1Y6EA 4POLA 2LJAA 2H1DA 3GNJA 1XWCA 1B9XC 4NHWA 2PWJA 3GTUA 2FGXA 1X9SB 1A0FA 1QK8A 2R2JA 2PMTA 2V32A 4MMMA 3CXGA 5IPHA 3UIWA 3G7YA 5D9VA 3MIXA 2WJUA 1YEPA 3M9JA 2GVPA 3D4TA 2HNLA 3GX8A 5B8BA 3FK8A 2HYXA 4CY8A 4PX1A 2B6MA 3VK9A 5JCGA 1JZOA 2X99A 4WETA 2H71A 3IK9A 2OACA 3ZZXA 1F3BA 4HEA2 3O6TA 3LGCA 4O92A 4K9ZA 4GRFA 3VLNA 1XW9A 2VUPA 2I9HA 3IHQA 2M72A 3AY8A 4K7NA 2DC5A 2DKIA 4PNFA 2R4VA 3ISOA 3RPPA 1EV4A 2N5FA 3IAS2 4GCIA 4O5UA 4NHZA 2C8UA 2KP2A 2VL3A 4V2MA 2NBSA 1PQNA 4XHMA 3FW2A 2ES7A 2AAWA 2PGTA 4ZL9A 4G19A 4TR1A 5LNKe 5LCZA 4Z2TA 3P7XA 3D5JA 3TUEA 1TK8B 3E3EA 1Z9HA 1GSEA 3M0FA 1MTCA 4OFMA 5DJMA 1AQVA 1C72A 5ECOB 1MDIA 2KUCA 5DQSA 2OKAA 3F3RA 2DLXA 4QQ7A 2YANA 3DRNA 1VGLA 3C71A 2FWEA 3EU4A 4GSNA 5F07A 4TN8A 4HQZA 3ME7A 3QAVA 5ECIB 2LS5A 3L9SA 3VWWA 5ELAA 2PERA 4EO3A 3FR9A 1O8XA 2IMIA 4FIWA 3VWVA 4TXVA 3HA9A 2C3TA 5G5FA 2XBQA 2LV3A 5LD0A 2GT5A 20GSA 5DJLA 17GSA 1PFOA 2VLUA 1SD8A 5EL8A 1U6TA 3KP8A 1XCCA 4K2XA 2L6CA 2CX4A 1T3BA 2C3QA 3CTGA 3TKSC 1ZCPA 3ZITA 1TRUA 4ULXA 4XIHA 4XTSA 4POBA 1YF0A 2TRCP 5H5RA 2E0QA 2QKEA 5EY6A 6GSWA 1YQ1A 1M99A 4WF5A 4OO4A 3LORA 2YPMA 4X1UA 2B5XA 3SWLA 3IPZA 2IMFA 2CVKA 4MF7A 1V40A 2RUEA 2JZRA 3UBLA 5KOWA 3MNGA 4BWSA 1URMA 2YNXA 5G2ZA 1SJZA 5DAKB 5H5QA 1R5AA 2IFQA 3CQFA 5ECNB 1GSSA 4MJEA 1KNGA 5HR0A 1OC9B 2QC7A 4GF0A 2PU9C 1I5GA 1V9WA 3DXBA 1XVQA 4IS0A 3TKQA 3ZMKA 3QD9A 3H93A 3IC4A 1F6MC 1ERWA 2EIOA 2JADA 1HNAA 2B1KA 3QCPA 1G7OA 1PRXA 2H74A 3QFAC 2LQQA 4HI7A 3FZ5A 1U87A 3M3MA 3TKSE 2NDOA 2X8CA 2M80A 4QL7A 1RW1A 3KJYA 4DSSA 4DEJA 3KMNA 1M9AA 2J23A 2X4AA 5H5SA 4Q5NA 5G5EA 4K8MA 3F4RA 4RUVA 3HDCA 2IMDA 2IWTA 6GSTA 5J9CA 2K8SA 2I4AA 3KTBA 5IIZA 2YJHA 3FYGA 6GSXA 4BVYA 1OAZA 1X5CA 2YWIA 3DGQA 1JLVA 2R37A 1FG4A 2ON7A 3CRUA 2HE3A 2VO4A 5ECLB 3GYKA 3BD2A 3GL3A 2HZEB 1TI1A 1OE7A 1FAAA 1NHOA 4J57E 3LQ7A 3A3TA 1ZYEA 5GSTA 2YV9A 2AHEA 1TRWA 2MYGA 3IR4A 2FA8A 1ERUA 4KGIA 5G31A 2IIYA 2FWFA 5AIXA 4HJ2A 4ZB9A 1EOGA 3Q18A 2NVLA 4GSSA 1SL1B 3J7Yk 3EE2A 2JZSA 2VD1A 3WYWA 5C00A 4BPYA 2O89A 1ZL9A 2XHFA 4Z7XA 1Y25A 2G0FA 5EVOA 4HDEA 5D9TA 2LNSA 2VCZA 1DUGA 3D6IA 2CV4A 2I3YA 2PBJA 2H6XA 4AGSA 3UEMA 1JFUA 2L57A 3G9BA 5KN1A 4Q5RA 3QR6A 5JWRB 4MNNA 1G6YA 1K0NA 4KAEA 4RI6A 3GV1A 3F4SA 1ZOFA 1LU4A 4EUYA 4OD7A 1LBKA 1ACVA 5JCUA 2IL3A 3H1NA 1O85A 4ZXGA 2WDUA 4G0LA 2A4HA 4ECIA 1SKSB 4HU7A 4F0BA 5CAXA 4QL9A 3RBTA 3ZIJA 6GSSA 1WMJA 2YN1A 1KBNA 4NPBA 5FHIA 3VURA 1K0OA 3RAZA 3KGKA 4XRDA 3UVHA 4CY6A 3VI5A 4POKA 1SYXA 4PNGA 1X9WB 4HOJA 1G7EA 2IN3A 9GSSA 1QGVA 4G0IA 5CRWA 2H0HA 4JBBA 3P8WA 2FNOA 3WT1A 4V2NA 3TJGA 4IVFA 2X64A 1T4ZA 2I81A 2B7KA 3GIXA 4GLTA 4HQSA 1V58A 3ERGA 3QMXA 2H30A 3QOUA 1K0AA 4LL4B 4TR3A 4IJ3A 1O73A 4PUAA 1X9MB 1GSQA 5A4UA 3TRXA 3N5OA 3ZFLA 1WOUA 3A2XA 2XBIA 4MZWA 1ERVA 4FYCA 5DALA 3GA4A 4MP4A 5HR2A 3QFBC 4PQIA 4KDYA 2YWOA 3LG6A 4O32A 2YP6A 4KA0A 1PX6A 3KMOA 1FB6A 1A8LA 3N9JA 2R0GA 4PGTA 5COHA 4O7HA 3C1SA 1BYEA 3FR6A 1XFLA 1PGTA 5GZZB 1QUWA 2BJXA 2VCVA 4WBRD 3A5IA 3IA1A 3TKPA 3Q6OA 4KDUA 2WFCA 2V41A 1K0CA 1X0RA 5A4WA 1DBYA 2C0FA 1AIUA 1HYUA 4FYBA 4HUAA 5BMUA 2QA2A 2V1MA 2H66A 1PD21 4KB3A 2V6OA 5ABRA 3GUSA 1YF1A 5ID2A 11GSA 4X0XA 1PKZA 5HFKA 1Z3EA 1IYIA 2KP1A 2CX3A 2R6KA 5IOWA 3WGXA 1CQHA 1GSFA 1DSBA 2G2QA 4DVCA 3G7IA 1XOBA 3GKXA 1VF3A 1SK1A 1TTZA 2DIZA 1PL2A 5CRGA 5AISA 1JLWA 5IMVA 1DE1A 3R2QA 2YCDA 4ILFA 3W8JA 1S3DA 3LYKA 1GTAA 4JR6A 2HT9A 5GSSA 2CZ3A 3GH9A 3R3EA 1EWXA 2FWGA 4MCUA 4YQMA 2B3SA 2WZ9A 1M2BA 4F0CA 4Q5QA 1F37A 3QPMA 3PPUA 1V2AA 2E7PA 4KH7A 2MBSA 1B9YC 4N11A 2H1BA 2Z9SA 5JCWA 2X8GA 4L0WA 3GKMA 2WULA 5J5NA 4K7IA 2DBCA 5IMDA 3APOA 5IMZA 3HJMA 3QAGA 3KZQA 19GSA 3LFLA 4KSOA 1S3CA 3HY2A 4FQUA 3IC8A 2GS3A 3LEFA 3MSZA 3CMIA 1U88A 1WRYA 3WD6A 4POMA 2PVOC 4MPGA 4YAVA 3K8NA 4XRAA 3E0UA 2EIQA 3EU3A 1K0MA 3KH7A 5IO2A 10GSA 1XVWA 8GSSA 2C0EA 3RHBA 1GLQA 2OBKA 2P5QA 4IHUA 3GTUB 4MJAA 4TRXA 1AC1A 4V2LA 4TXOA 4BL7A 1TU8A 1FW1A 4XCSA 2GGTA 4EC0A 1CQGA 2CT6A 2VLTA 4IN0A 1T1VA 2RLIA 4MF5A 2X49A 1K3YA 3VWXA 4OCFA 2OE0A 2FA4A 3ERWA 4BIKA 4WR5A 4BVXA 4P3YB 2IJYA 2LTKA 1WJKA 2AV4A 3TRPA 1TK5B 1GTIA 4GWRA 2OJLA 4MPFA 5DCGA 5ECMB 3F6FA 3BBYA 4IJIA 1R26A 3G7JA 5ECSA 1TK0B 4IELA 1O8WA 1SJ6A 1OC3A 3FZ9A 1B4PA 5J41A 4YAPA 1WIKA 1F2EA 3GSSA 1SK0A 4KE3A 3EMXA 4TR1B 1GSYA 1BEDA 2YOIA 3FZAA 5AGYA 1ZGNA 4NMUA 1X5DA 4ML6A 3ZVJD 4G0KA 1OVNA 3P2AA 5DQYA 3C7MA 2K18A 2K8VA 1AXDA 2GDRA 1QQ2A 4O5RA 4USSA 1PN0A 1NM3A 3WGEA 5HQPA 1M9BA 3KTLA 1TRVA 3M9KA 3PH9A 3FHKA 3UVTA 3LWAA 1HNBA 3UAPA 4XS1A 4EDZA 2B5EA 4TOPA 4IW9A 7GSSA 2VL9A 2IMEA 2KLXA 1PX7A 5INYA 1PMTA 2VM1A 2L4QA 4GXZA 2F8AA 3NOFA 1XXUA 1SJIA 1BG5A 1XZOA 1JZDA 3DVWA 3V1WA 1Q98A 4D73B 3I43A 2ZCTA 5FT3A 1QFNA 4MDCA 4RQRA 4HU9A 1F3AA 2CZ2A 4LMWA 2F3MA 1Z6NA 4X4JA 5ECPB 1S3AA 4OFTA 3L9VA 5E59A 4YQUA 1U3IA 4BA7A 2N5BA 4PUFC 2YZUA 5HFGA 4K5RA 4WBJA 3GRXA 4MH3A 2HZEA 1GSDA 2WGRA 2IFQB 3TKRA 1J9BA 3CYNA 1K0DA 2H72A 4WF4A 1OKDA 4JRRA 3HZ8A 1R7HA 1KEBA 4KUNA 1SK2A 5IO0A 1T8EB 1GTUA 2FUG2 4HS1A 1OE8A 5IPGA 5J4UA 1M7TA 1E2YA 1W4VA 1SYRA 4ZBBA 2H6ZA 4YQVA 5GAND 4IBPA 2L5LA 1WPIA 1F9MA 3BCKA 3GSTA 4I2UA 4YKFA 2A4VA 4DSSB 3W8SA 3FY7A 2RM6A 2K9FA 4WR4A 4L0UA 3F0IA 3MDKA 5J9BA 3DKSA 3D22A 2P0GA 3H79A 2HSYA 3HVXA 3BCIA 5IMCA 1MDKA 3HVNA 2QA1A 2J9HA 1A23A 2OE3A 1AUCA 3IBHA 2PN8A 4BVYB 1PKWA 1EP8A 1EGRA 5B6NA 5KOXA 3DMLA 1YEXA 1O6JA 2IPAA 4ZB8A 1VF1A 2EC4A 4O5QA 3SBCA 1J0FA 2DJJA 3GL5A 4DSRA 5ECRB 1HQOA 2DKHA 2VIMA 2GQLA 5DDLA 3DYRA 5CREA 4G2EA 2K6VA 1THOA 5IM9A 2H01A 2OADA 3GFKA 2LEGA 2VCXA 4H86A 2XC2A 4KSMA 3L78A 2MMZA 2VCWA 1AQWA 22GSA 4K2DA 1XOAA 2I1UA 3PR8A 1SL2B 2LQOA 1SU9A 2VCTA 2FCHA 1R4WA 1SKRB 3GKKA 5DBQA 3ME8A 1GWCA 4NWYA 5KN0A 3DVXA 5DVBA 3QDNA 1XWKA 2LUSA 3FMWA 1A0RP 4OMVA 1Z7PA 2H1GA 3BJ5A 3EPTA 4CDOA 1GRXA 2VCQA 6GSVA 1UC7A 4XS4A 1TRSA 1USBA 3TRQA 1YY7A 5F0GA 3ZMLA 1T7PB 4JE1A 3FRCA 2L5OA 3O3TA 4LMVA 4MZCA 3WT2A 4MJCA 3P90A 2LRTA 3A5WA 4ECJA 1SL0B 2E2GA 1EGOA 2R0PA 4OCEA 4WXTA 4KNDA 1YZXA 4IP6A 2LRCA 4A5PA 1MEKA 1EEJA 3E9JB 5CO3A 3D21A 1ILOA 2B7JA 3RDWA 3IHGA 2JACA 2V2GA 2BMXA 1Z5YE 1SKWB 3CSIA 4WEYA 1TDIA 5ECHB 3TGZA 4KX4A 3VPTA 4ZIJA 4MA9A 2VAFA 4EE0A 2BTOT 3GN3A 3KM6A 4RI7A 3TOUA 2P5RA 1GNEA 4N30A 5CRHA 1TI3A 2H73A 1M3IA 1EOHA 3HHVA 5G1KA 1GSUA 2C1YA 3LJRA 5D9XA 3HVVA 3NIVA 1TXXA 1SD9A 1GUHA 2MBTA 1NW2A 3H8QA 2PUKC 3S9FA 1XPVA 2JSZA 1NHYA 4HZ2A 2HSMA 2DJ0A 4EF0A 2GSTA 3M1GA 2TIRA 1SENA 2UZ8A 6GSUA 1GTBA
chains in the Genus database with same CATH topology
3NZNA 5HR1A 3CRTA 4AF2A 3FKFA 3RHCA 3TB2A 1QMVA 2DSAA 1BAYA 3US3A 4BWQA 5ID2B 2ZUPA 4N10A 3VFIA 3F63A 1N8JA 2VL2A 1JZWA 2VOCA 1FHEA 2H76A 4GQCA 2GSRA 2GTUA 2ALBA 1JHBA 1IYHA 1KTEA 6GSYA 1WWJA 3UJ1A 2N5AA 1LJRA 1ZZYA 3U5RE 4FH8A 1OKTA 2NPBA 2CQ9A 1K0BA 3MWHA 5D9WA 4EVMA 5D93A 1M2AA 3HYPA 4K7OA 4TVEA 4KDXA 1H75A 3J7Yb 2AYTA 3A2VA 5CRDA 2F51A 2GSSA 2HFDA 4K0NA 3HD5A 3ZIVA 3BOAA 2LJKA 3HVSA 5ENUA 2VL2C 3GURA 1HNCA 2H1AA 1RK4A 4MK3A 2WB9A 3L9UA 4I2TA 4L5LA 3KEBA 2C80A 4GQFA 4ZB6A 3KCMA 4L8EA 2HRFA 2V6KA 5KEJA 1VRSD 1ABAA 1YKCA 3HXSA 1GUMA 4AJ6A 2FHEA 4ECBA 1TKDB 3ZRDA 4ECCA 1T00A 2YZHA 1B48A 1JZRA 4WKWA 1G6WA 2GZPA 4ICYA 12GSA 1ON4A 5B6MA 2GZYA 3APQA 1TU7A 3TJKA 5A5KA 1V98A 3L0HA 3L4NA 4JZQA 1GP1A 4Q5FA 4NV2A 2OBIA 4CW9A 3U6VA 4LA1A 5IMAA 5J3RA 3ERFA 2O87A 2OA7A 5FWGA 4NV5A 4ML1A 2GSQA 4IQAA 5L71A 4TXOB 4BL7B 4AJ8A 3DIEA 4YKGA 3APSA 1DE2A 2PPTA 3VI7A 5KN2A 2F8FA 4IQ1A 3TKSA 4PXOA 2H0GA 2NTOA 3D0ZA 3QAWA 5B8AA 2VM2A 1A2LA 2O85A 1PSQA 1ML6A 3IAM2 4LLRA 4BVXB 3KIJA 4ACSA 1V57A 4KCEA 4N0ZA 1R5PA 16GSA 1N2AA 3D4MA 2XPDA 4TW5A 3I69A 4V1Ap 13GSA 2FWHA 4IKHA 1ZYPA 2GQMA 4X43A 2D2ZA 2LSTA 3PGTA 1GH2A 4MF6A 2F9SA 1MD3A 2LJRA 3KH9A 3ZYWA 2YWNA 3ZVJA 2LKUA 4FYUA 2EIRA 5DAKA 3VPQA 3EC3A 4YH2A 3FEUA 2L6DA 2VLVA 1HD2A 2DJKA 5GAPD 1UA5A 1OC9A 4OO5A 4ZILA 5C04A 1ZYQB 4D73A 1B8XA 4EL1A 4TR4A 3TCOA 1GLPA 5JWQB 1W89A 2O7KA 1YJ6A 1EEMA 3KD0A 1XWAA 4K0GA 4J2FA 3IE3A 1WP0A 1OYJA 2QGVA 1O81A 1TOFA 4EIPA 5AIVA 2E2MA 3HZ4A 1AAZA 2KHPA 1FOVA 4KCAA 3Q19A 4I97A 1Z6MA 1NSWA 1QXHA 2R0CA 2AUVA 5CP1A 3GMFA 5G1LA 3F9UA 2C0GA 1BX9A 1I9DA 3UARA 1FOHA 2GT6A 1ST9A 2DJ3A 3UL3A 4RQXA 18GSA 1XW5A 3EINA 5JWOB 3LYPA 4GTUA 4ZL8A 2LNTA 2CVBA 1FVJA 3Q74A 4N0VA 1GULA 3ED3A 3MYDA 1PN9A 5HR3A 3TJBA 3TJFA 4TR0A 4E8EA 3F3QA 1VF4A 2PVQA 3FR3A 3CBUA 1MD4A 3ZFBA 1AQXA 2MMOA 4JU5A 2A2SA 2R5GA 3ZL5A 4AJ7A 5B7CA 3EMPA 1A2JA 3GKNA 4MLYA 5CNWA 2L59A 4MABA 2B1LA 3TJJA 2CAQA 4CHSA 3MAKA 2GLRA 2HRKA 3UOMA 3RPNA 3LW9A 2HXKA 4OWYA 2VD0A 1EZKA 2C4JA 2FD3A 2ON5A 3IRAA 3H4KA 1XBSA 3WGDA 5ECQB 5D8IA 3VWUA 4L5OA 1EP7A 1GNWA 4MJBA 2GZZA 4J56E 4KW6A 5G30A 5F06A 3LXZA 5EPFA 2RM5A 1FO5A 2MMAA 3ZLPA 4EIQA 4K5SA 2AB6A 3HJOA 3F6DA 3M8NA 1B4QA 3PINA 2HRAA 3HKRA 2B5YA 5D73A 3JCML 4KF9A 1GL8A 3UMAA 2QSIA 2C0DA 4K6XA 3ZREA 4F03A 1M0UA 2HRNA 4EXJA 4TKYA 3IK7A 3LXTA 4ZBAA 3I6AA 3KXOA 2JU5A 2CA8A 3IDVA 2HSHA 2XPEA 2MZCA 4G10A 2HZFA 3EVIA 1TP9A 3EYTA 4G9HA 4E8HA 3I9V2 3CSJA 4ID0A 1Z7RA 2FY6A 1BQ7A 2DIYA 4MH2A 2JL4A 1M2DA 2DMLA 5ECKB 2H70A 3IXRA 1A8YA 1A2MA 1BJXA 1YDKA 2AJQB 4F2IA 2GQKA 2LRNA 3C73A 1G0TA 1EV9A 4F9ZA 1ZMAA 2KOKA 4LL1B 3DD3A 5D96A 3F4TA 2YWMA 4FO5A 4XS6A 2WS2A 2REMA 1AW9A 1MDJA 14GSA 5F8BA 2CVDA 4NAXA 3GHAA 1K3OA 4JEDA 4EDYA 4Z2UA 4PURA 5CYYA 4I8BA 2DJ1A 2DJ2A 1Q4JA 1WE0A 4EKZA 3IOSA 1X5EA 2C3NA 2H6YA 4I5QA 1UN2A 4PQ1A 2H8LA 4XS4B 5IQYA 3KP9A 1GUKA 2MMNA 1PA3A 2A2PA 4K1FA 4ISDA 1THXA 1A24A 3HJPA 3CSHA 1PL1A 2HLSA 3F8UA 2H0IA 5E4WA 4JR4A 4ZBDA 3C8EA 2R3XA 3O76A 5DALB 2L4CA 1H4OA 2YV7A 4HZ4A 3TOTA 5HFIA 4IGJA 1K3LA 3DWVA 3IV4A 4MZBA 2H75A 4HJMA 4PTSA 2OE1A 2RIIA 1RQMA 3W6GA 4OFNA 3GH6A 3GX0A 2DMMA 4Z2RA 3FZ4A 5F05A 1XIYA 2A2RA 1T4YA 3EURA 2ZNMA 5BRTA 1J08A 3UBKA 3C1RA 2P31A 3EWLA 1OC8A 2WRTA 3HCZA 2JSYA 1ERTA 2H19A 2RUFA 4NXIA 1ZYNA 4PQHA 1VF2A 5IOXA 4IP1A 3CTFA 2O8VB 3OR5A 1FB0A 2FLSA 1TJDA 3LSZA 4F82A 2HI7A 1O7UA 2JZTA 1U3AA 5KN3A 4V1Ag 3A2WA 5IMFA 1XW6A 5DCHA 2WCIA 4ZL7A 1FVKA 2X8HA 2M46A 2IMKA 5ELGA 2TRXA 1YKAA 1TW9A 5A4VA 1E6BA 2YJ7A 5AN1A 3ZTLA 2CAIA 1XWGA 3TDGA 3DEXA 1UVZA 4I6XA 1XWBA 4DSQA 4GSTA 1Y6EA 4POLA 2LJAA 2H1DA 3GNJA 1XWCA 1B9XC 4NHWA 2PWJA 3GTUA 2FGXA 1X9SB 1A0FA 1QK8A 2R2JA 2PMTA 2V32A 4MMMA 3CXGA 5IPHA 3UIWA 3G7YA 5D9VA 3MIXA 2WJUA 1YEPA 3M9JA 2GVPA 3D4TA 2HNLA 3GX8A 5B8BA 3FK8A 2HYXA 4CY8A 4PX1A 2B6MA 3VK9A 5JCGA 1JZOA 2X99A 4WETA 2H71A 3IK9A 2OACA 3ZZXA 1F3BA 4HEA2 3O6TA 3LGCA 4O92A 4K9ZA 4GRFA 3VLNA 1XW9A 2VUPA 2I9HA 3IHQA 2M72A 3AY8A 4K7NA 2DC5A 2DKIA 4PNFA 2R4VA 3ISOA 3RPPA 1EV4A 2N5FA 3IAS2 4GCIA 4O5UA 4NHZA 2C8UA 2KP2A 2VL3A 4V2MA 2NBSA 1PQNA 4XHMA 3FW2A 2ES7A 2AAWA 2PGTA 4ZL9A 4G19A 4TR1A 5LNKe 5LCZA 4Z2TA 3P7XA 3D5JA 3TUEA 1TK8B 3E3EA 1Z9HA 1GSEA 3M0FA 1MTCA 4OFMA 5DJMA 1AQVA 1C72A 5ECOB 1MDIA 2KUCA 5DQSA 2OKAA 3F3RA 2DLXA 4QQ7A 2YANA 3DRNA 1VGLA 3C71A 2FWEA 3EU4A 4GSNA 5F07A 4TN8A 4HQZA 3ME7A 3QAVA 5ECIB 2LS5A 3L9SA 3VWWA 5ELAA 2PERA 4EO3A 3FR9A 1O8XA 2IMIA 4FIWA 3VWVA 4TXVA 3HA9A 2C3TA 5G5FA 2XBQA 2LV3A 5LD0A 2GT5A 20GSA 5DJLA 17GSA 2VLUA 1SD8A 5EL8A 1U6TA 3KP8A 1XCCA 4K2XA 2L6CA 2CX4A 1T3BA 2C3QA 3CTGA 3TKSC 1ZCPA 3ZITA 1TRUA 4ULXA 4XIHA 4XTSA 4POBA 1YF0A 2TRCP 5H5RA 2E0QA 2QKEA 5EY6A 6GSWA 1YQ1A 1M99A 4WF5A 4OO4A 3LORA 2YPMA 4X1UA 2B5XA 3SWLA 3IPZA 2IMFA 2CVKA 4MF7A 1V40A 2RUEA 2JZRA 3UBLA 5KOWA 3MNGA 4BWSA 1URMA 2YNXA 5G2ZA 1SJZA 5DAKB 5H5QA 1R5AA 2IFQA 5ECNB 1GSSA 4MJEA 1KNGA 5HR0A 1OC9B 2QC7A 4GF0A 2PU9C 1I5GA 1V9WA 3DXBA 1XVQA 4IS0A 3TKQA 3ZMKA 3QD9A 3H93A 3IC4A 1F6MC 1ERWA 2EIOA 2JADA 1HNAA 2B1KA 3QCPA 1G7OA 1PRXA 2H74A 3QFAC 2LQQA 4HI7A 3FZ5A 1U87A 3M3MA 3TKSE 2NDOA 2X8CA 2M80A 4QL7A 1RW1A 3KJYA 4DSSA 4DEJA 3KMNA 1M9AA 2J23A 2X4AA 5H5SA 4Q5NA 5G5EA 4K8MA 3F4RA 4RUVA 3HDCA 2IMDA 2IWTA 6GSTA 5J9CA 2K8SA 2I4AA 3KTBA 5IIZA 2YJHA 3FYGA 6GSXA 4BVYA 1OAZA 1X5CA 2YWIA 3DGQA 1JLVA 2R37A 1FG4A 2ON7A 3CRUA 2HE3A 2VO4A 5ECLB 3GYKA 3BD2A 3GL3A 2HZEB 1TI1A 1OE7A 1FAAA 1NHOA 4J57E 3LQ7A 3A3TA 1ZYEA 5GSTA 2YV9A 2AHEA 1TRWA 2MYGA 3IR4A 2FA8A 1ERUA 4KGIA 5G31A 2IIYA 2FWFA 5AIXA 4HJ2A 4ZB9A 1EOGA 3Q18A 2NVLA 4GSSA 1SL1B 3J7Yk 3EE2A 2JZSA 2VD1A 3WYWA 5C00A 4BPYA 2O89A 1ZL9A 2XHFA 4Z7XA 1Y25A 2G0FA 5EVOA 4HDEA 5D9TA 2LNSA 2VCZA 1DUGA 3D6IA 2CV4A 2I3YA 2PBJA 2H6XA 4AGSA 3UEMA 1JFUA 2L57A 3G9BA 5KN1A 4Q5RA 3QR6A 5JWRB 4MNNA 1G6YA 1K0NA 4KAEA 4RI6A 3GV1A 3F4SA 1ZOFA 1LU4A 4EUYA 4OD7A 1LBKA 1ACVA 5JCUA 2IL3A 3H1NA 1O85A 4ZXGA 2WDUA 4G0LA 2A4HA 4ECIA 1SKSB 4HU7A 4F0BA 5CAXA 4QL9A 3RBTA 3ZIJA 6GSSA 1WMJA 2YN1A 1KBNA 4NPBA 5FHIA 3VURA 1K0OA 3RAZA 3KGKA 4XRDA 3UVHA 4CY6A 3VI5A 4POKA 1SYXA 4PNGA 1X9WB 4HOJA 1G7EA 2IN3A 9GSSA 1QGVA 4G0IA 5CRWA 2H0HA 4JBBA 3P8WA 2FNOA 3WT1A 4V2NA 3TJGA 4IVFA 2X64A 1T4ZA 2I81A 2B7KA 3GIXA 4GLTA 4HQSA 1V58A 3ERGA 3QMXA 2H30A 3QOUA 1K0AA 4LL4B 4TR3A 4IJ3A 1O73A 4PUAA 1X9MB 1GSQA 5A4UA 3TRXA 3N5OA 3ZFLA 1WOUA 3A2XA 2XBIA 4MZWA 1ERVA 4FYCA 5DALA 3GA4A 4MP4A 5HR2A 3QFBC 4PQIA 4KDYA 2YWOA 3LG6A 4O32A 2YP6A 4KA0A 1PX6A 3KMOA 1FB6A 1A8LA 3N9JA 2R0GA 4PGTA 5COHA 4O7HA 3C1SA 1BYEA 3FR6A 1XFLA 1PGTA 5GZZB 1QUWA 2BJXA 2VCVA 4WBRD 3A5IA 3IA1A 3TKPA 3Q6OA 4KDUA 2WFCA 2V41A 1K0CA 1X0RA 5A4WA 1DBYA 2C0FA 1AIUA 1HYUA 4FYBA 4HUAA 5BMUA 2QA2A 2V1MA 2H66A 1PD21 4KB3A 2V6OA 5ABRA 3GUSA 1YF1A 5ID2A 11GSA 4X0XA 1PKZA 5HFKA 1Z3EA 1IYIA 2KP1A 2CX3A 2R6KA 5IOWA 3WGXA 1CQHA 1GSFA 1DSBA 2G2QA 4DVCA 3G7IA 1XOBA 3GKXA 1VF3A 1SK1A 1TTZA 2DIZA 1PL2A 5CRGA 5AISA 1JLWA 5IMVA 1DE1A 3R2QA 2YCDA 4ILFA 3W8JA 1S3DA 3LYKA 1GTAA 4JR6A 2HT9A 5GSSA 2CZ3A 3GH9A 3R3EA 1EWXA 2FWGA 4MCUA 4YQMA 2B3SA 2WZ9A 1M2BA 4F0CA 4Q5QA 1F37A 3QPMA 3PPUA 1V2AA 2E7PA 4KH7A 2MBSA 1B9YC 4N11A 2H1BA 2Z9SA 5JCWA 2X8GA 4L0WA 3GKMA 2WULA 5J5NA 4K7IA 2DBCA 5IMDA 3APOA 5IMZA 3HJMA 3QAGA 3KZQA 19GSA 3LFLA 4KSOA 1S3CA 3HY2A 4FQUA 3IC8A 2GS3A 3LEFA 3MSZA 3CMIA 1U88A 1WRYA 3WD6A 4POMA 2PVOC 4MPGA 4YAVA 3K8NA 4XRAA 3E0UA 2EIQA 3EU3A 1K0MA 3KH7A 5IO2A 10GSA 1XVWA 8GSSA 2C0EA 3RHBA 1GLQA 2OBKA 2P5QA 4IHUA 3GTUB 4MJAA 4TRXA 1AC1A 4V2LA 4TXOA 4BL7A 1TU8A 1FW1A 4XCSA 2GGTA 4EC0A 1CQGA 2CT6A 2VLTA 4IN0A 1T1VA 2RLIA 4MF5A 2X49A 1K3YA 3VWXA 4OCFA 2OE0A 2FA4A 3ERWA 4BVXA 4WR5A 4P3YB 2IJYA 2LTKA 1WJKA 2AV4A 3TRPA 1TK5B 1GTIA 4GWRA 2OJLA 4MPFA 5DCGA 5ECMB 3F6FA 3BBYA 4IJIA 1R26A 3G7JA 5ECSA 1TK0B 4IELA 1O8WA 1SJ6A 1OC3A 3FZ9A 1B4PA 5J41A 4YAPA 1WIKA 1F2EA 3GSSA 1SK0A 4KE3A 3EMXA 4TR1B 1GSYA 1BEDA 2YOIA 3FZAA 5AGYA 1ZGNA 4NMUA 1X5DA 4ML6A 3ZVJD 4G0KA 1OVNA 3P2AA 5DQYA 3C7MA 2K18A 2K8VA 1AXDA 2GDRA 1QQ2A 4O5RA 4USSA 1PN0A 1NM3A 3WGEA 5HQPA 1M9BA 3KTLA 1TRVA 3M9KA 3PH9A 3FHKA 3UVTA 3LWAA 1HNBA 3UAPA 4XS1A 4EDZA 2B5EA 4TOPA 4IW9A 7GSSA 2VL9A 2IMEA 2KLXA 1PX7A 5INYA 1PMTA 2VM1A 2L4QA 4GXZA 2F8AA 3NOFA 1XXUA 1SJIA 1BG5A 1XZOA 1JZDA 3DVWA 3V1WA 1Q98A 4D73B 3I43A 2ZCTA 5FT3A 1QFNA 4MDCA 4RQRA 4HU9A 1F3AA 2CZ2A 4LMWA 2F3MA 1Z6NA 4X4JA 5ECPB 1S3AA 4OFTA 3L9VA 5E59A 4YQUA 1U3IA 4BA7A 2N5BA 4PUFC 2YZUA 5HFGA 4K5RA 4WBJA 3GRXA 4MH3A 2HZEA 1GSDA 2WGRA 2IFQB 3TKRA 1J9BA 3CYNA 1K0DA 2H72A 4WF4A 1OKDA 4JRRA 3HZ8A 1R7HA 1KEBA 4KUNA 1SK2A 5IO0A 1T8EB 1GTUA 2FUG2 4HS1A 1OE8A 5IPGA 5J4UA 1M7TA 1E2YA 1W4VA 1SYRA 4ZBBA 2H6ZA 4YQVA 5GAND 4IBPA 2L5LA 1WPIA 1F9MA 3BCKA 3GSTA 4I2UA 4YKFA 2A4VA 4DSSB 3W8SA 3FY7A 2RM6A 2K9FA 4WR4A 4L0UA 3F0IA 3MDKA 5J9BA 3DKSA 3D22A 2P0GA 3H79A 2HSYA 3HVXA 3BCIA 5IMCA 1MDKA 2QA1A 2J9HA 1A23A 2OE3A 1AUCA 3IBHA 2PN8A 4BVYB 1PKWA 1EP8A 1EGRA 5B6NA 5KOXA 3DMLA 1YEXA 1O6JA 2IPAA 4ZB8A 1VF1A 2EC4A 4O5QA 3SBCA 1J0FA 2DJJA 3GL5A 4DSRA 5ECRB 1HQOA 2DKHA 2VIMA 2GQLA 5DDLA 3DYRA 5CREA 4G2EA 2K6VA 1THOA 5IM9A 2H01A 2OADA 3GFKA 2LEGA 2VCXA 4H86A 2XC2A 4KSMA 3L78A 2MMZA 2VCWA 1AQWA 22GSA 4K2DA 1XOAA 2I1UA 3PR8A 1SL2B 2LQOA 1SU9A 2VCTA 2FCHA 1R4WA 1SKRB 3GKKA 5DBQA 3ME8A 1GWCA 4NWYA 5KN0A 3DVXA 5DVBA 3QDNA 1XWKA 2LUSA 3FMWA 1A0RP 4OMVA 1Z7PA 2H1GA 3BJ5A 3EPTA 4CDOA 1GRXA 2VCQA 6GSVA 1UC7A 4XS4A 1TRSA 1USBA 3TRQA 1YY7A 5F0GA 3ZMLA 1T7PB 4JE1A 3FRCA 2L5OA 3O3TA 4LMVA 4MZCA 3WT2A 4MJCA 3P90A 2LRTA 3A5WA 4ECJA 1SL0B 2E2GA 1EGOA 2R0PA 4OCEA 4WXTA 4KNDA 1YZXA 4IP6A 2LRCA 4A5PA 1MEKA 1EEJA 3E9JB 5CO3A 3D21A 1ILOA 2B7JA 3RDWA 3IHGA 2JACA 2V2GA 2BMXA 1Z5YE 1SKWB 3CSIA 4WEYA 1TDIA 5ECHB 3TGZA 4KX4A 3VPTA 4ZIJA 4MA9A 2VAFA 4EE0A 2BTOT 3GN3A 3KM6A 4RI7A 3TOUA 2P5RA 1GNEA 4N30A 5CRHA 1TI3A 2H73A 1EOHA 3HHVA 5G1KA 1GSUA 2C1YA 3LJRA 5D9XA 3HVVA 3NIVA 1TXXA 1SD9A 1GUHA 2MBTA 1NW2A 3H8QA 2PUKC 3S9FA 1XPVA 2JSZA 1NHYA 4HZ2A 2HSMA 2DJ0A 4EF0A 2GSTA 3M1GA 2TIRA 1SENA 2UZ8A 6GSUA 1GTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NZN A;  5HR1 A;  3CRT A;  4AF2 A;  3FKF A;  3RHC A;  3TB2 A;  1QMV A;  2DSA A;  1BAY A;  3US3 A;  4BWQ A;  5ID2 B;  2ZUP A;  4N10 A;  3VFI A;  3F63 A;  1N8J A;  2VL2 A;  1JZW A;  2VOC A;  1FHE A;  2H76 A;  4GQC A;  2GSR A;  2GTU A;  2ALB A;  1JHB A;  1IYH A;  1KTE A;  6GSY A;  1WWJ A;  3UJ1 A;  2N5A A;  1LJR A;  1ZZY A;  3U5R E;  4FH8 A;  1OKT A;  2NPB A;  2CQ9 A;  1K0B A;  3MWH A;  5D9W A;  4EVM A;  5D93 A;  1M2A A;  3HYP A;  4K7O A;  4TVE A;  4KDX A;  1H75 A;  3J7Y b;  2AYT A;  3A2V A;  5CRD A;  2F51 A;  2GSS A;  2HFD A;  4K0N A;  3HD5 A;  3ZIV A;  3BOA A;  2LJK A;  3HVS A;  5ENU A;  2VL2 C;  3GUR A;  1HNC A;  2H1A A;  1RK4 A;  4MK3 A;  2WB9 A;  3L9U A;  4I2T A;  4L5L A;  3KEB A;  2C80 A;  4GQF A;  4ZB6 A;  3KCM A;  4L8E A;  2HRF A;  2V6K A;  5KEJ A;  1VRS D;  1ABA A;  1YKC A;  3HXS A;  1GUM A;  4AJ6 A;  2FHE A;  4ECB A;  1TKD B;  3ZRD A;  4ECC A;  1T00 A;  2YZH A;  1B48 A;  1JZR A;  4WKW A;  1G6W A;  2GZP A;  12GS A;  1ON4 A;  5B6M A;  2GZY A;  3APQ A;  1TU7 A;  3TJK A;  5A5K A;  1V98 A;  3L0H A;  3L4N A;  4JZQ A;  1GP1 A;  4Q5F A;  4NV2 A;  2OBI A;  4CW9 A;  3U6V A;  4LA1 A;  5IMA A;  5J3R A;  3ERF A;  2O87 A;  2OA7 A;  5FWG A;  4NV5 A;  4ML1 A;  2GSQ A;  4IQA A;  5L71 A;  4TXO B;  4AJ8 A;  3DIE A;  3APS A;  1DE2 A;  2PPT A;  3VI7 A;  5KN2 A;  2F8F A;  4IQ1 A;  3TKS A;  4PXO A;  2H0G A;  2NTO A;  3D0Z A;  3QAW A;  5B8A A;  2VM2 A;  1A2L A;  2O85 A;  1PSQ A;  1ML6 A;  3IAM 2;  4LLR A;  3KIJ A;  4ACS A;  1V57 A;  4KCE A;  4N0Z A;  1R5P A;  16GS A;  1N2A A;  3D4M A;  2XPD A;  4TW5 A;  3I69 A;  4V1A p;  13GS A;  2FWH A;  4IKH A;  2GQM A;  4X43 A;  2D2Z A;  2LST A;  3PGT A;  1GH2 A;  4MF6 A;  2F9S A;  1MD3 A;  2LJR A;  3KH9 A;  3ZYW A;  2YWN A;  3ZVJ A;  2LKU A;  4FYU A;  2EIR A;  5DAK A;  3VPQ A;  3EC3 A;  4YH2 A;  3FEU A;  2L6D A;  2VLV A;  1HD2 A;  2DJK A;  5GAP D;  1UA5 A;  1OC9 A;  4OO5 A;  4ZIL A;  5C04 A;  1ZYQ B;  4D73 A;  1B8X A;  4EL1 A;  4TR4 A;  3TCO A;  1GLP A;  5JWQ B;  1W89 A;  2O7K A;  1YJ6 A;  1EEM A;  3KD0 A;  1XWA A;  4K0G A;  4J2F A;  3IE3 A;  1WP0 A;  1OYJ A;  2QGV A;  1O81 A;  1TOF A;  5AIV A;  2E2M A;  3HZ4 A;  1AAZ A;  2KHP A;  1FOV A;  4KCA A;  3Q19 A;  4I97 A;  1Z6M A;  1NSW A;  1QXH A;  2AUV A;  5CP1 A;  3GMF A;  5G1L A;  3F9U A;  2C0G A;  1BX9 A;  1I9D A;  3UAR A;  2GT6 A;  1ST9 A;  2DJ3 A;  3UL3 A;  4RQX A;  18GS A;  1XW5 A;  3EIN A;  5JWO B;  3LYP A;  4GTU A;  4ZL8 A;  2LNT A;  2CVB A;  1FVJ A;  3Q74 A;  4N0V A;  1GUL A;  3ED3 A;  1PN9 A;  5HR3 A;  3TJB A;  3TJF A;  4TR0 A;  4E8E A;  3F3Q A;  1VF4 A;  2PVQ A;  3FR3 A;  3CBU A;  1MD4 A;  3ZFB A;  1AQX A;  2MMO A;  4JU5 A;  2A2S A;  2R5G A;  3ZL5 A;  4AJ7 A;  5B7C A;  3EMP A;  1A2J A;  3GKN A;  4MLY A;  5CNW A;  2L59 A;  4MAB A;  2B1L A;  3TJJ A;  2CAQ A;  4CHS A;  3MAK A;  2GLR A;  3UOM A;  3RPN A;  2HXK A;  4OWY A;  2VD0 A;  1EZK A;  2C4J A;  2FD3 A;  2ON5 A;  3IRA A;  3H4K A;  1XBS A;  3WGD A;  5ECQ B;  5D8I A;  3VWU A;  4L5O A;  1EP7 A;  1GNW A;  4MJB A;  2GZZ A;  4J56 E;  4KW6 A;  5G30 A;  5F06 A;  3LXZ A;  5EPF A;  2RM5 A;  1FO5 A;  2MMA A;  3ZLP A;  2AB6 A;  3HJO A;  3F6D A;  3M8N A;  1B4Q A;  3PIN A;  3HKR A;  2B5Y A;  5D73 A;  3JCM L;  1GL8 A;  3UMA A;  2QSI A;  2C0D A;  4K6X A;  3ZRE A;  4F03 A;  1M0U A;  2HRN A;  4EXJ A;  4TKY A;  3IK7 A;  3LXT A;  4ZBA A;  3I6A A;  3KXO A;  2JU5 A;  2CA8 A;  3IDV A;  2HSH A;  2XPE A;  2MZC A;  4G10 A;  2HZF A;  3EVI A;  1TP9 A;  3EYT A;  4G9H A;  4E8H A;  3I9V 2;  3CSJ A;  4ID0 A;  1Z7R A;  2FY6 A;  1BQ7 A;  2DIY A;  4MH2 A;  2JL4 A;  1M2D A;  2DML A;  5ECK B;  2H70 A;  3IXR A;  1A8Y A;  1A2M A;  1BJX A;  1YDK A;  2AJQ B;  4F2I A;  2GQK A;  2LRN A;  3C73 A;  1G0T A;  1EV9 A;  4F9Z A;  1ZMA A;  2KOK A;  4LL1 B;  3DD3 A;  5D96 A;  3F4T A;  2YWM A;  4FO5 A;  4XS6 A;  2WS2 A;  2REM A;  1AW9 A;  1MDJ A;  14GS A;  5F8B A;  2CVD A;  4NAX A;  3GHA A;  1K3O A;  4JED A;  4EDY A;  4PUR A;  5CYY A;  4I8B A;  2DJ1 A;  2DJ2 A;  1Q4J A;  1WE0 A;  4EKZ A;  3IOS A;  1X5E A;  2C3N A;  2H6Y A;  4I5Q A;  1UN2 A;  4PQ1 A;  2H8L A;  4XS4 B;  5IQY A;  3KP9 A;  1GUK A;  2MMN A;  1PA3 A;  4K1F A;  4ISD A;  1THX A;  1A24 A;  3HJP A;  3CSH A;  1PL1 A;  2HLS A;  3F8U A;  2H0I A;  5E4W A;  4JR4 A;  4ZBD A;  3C8E A;  2R3X A;  3O76 A;  5DAL B;  2L4C A;  1H4O A;  2YV7 A;  4HZ4 A;  3TOT A;  5HFI A;  4IGJ A;  1K3L A;  3DWV A;  3IV4 A;  4MZB A;  2H75 A;  4HJM A;  2OE1 A;  2RII A;  1RQM A;  3W6G A;  4OFN A;  3GH6 A;  3GX0 A;  2DMM A;  3FZ4 A;  5F05 A;  1XIY A;  2A2R A;  1T4Y A;  3EUR A;  2ZNM A;  1J08 A;  3UBK A;  3C1R A;  2P31 A;  3EWL A;  1OC8 A;  2WRT A;  3HCZ A;  2JSY A;  1ERT A;  2H19 A;  2RUF A;  4NXI A;  4PQH A;  1VF2 A;  5IOX A;  4IP1 A;  3CTF A;  2O8V B;  3OR5 A;  1FB0 A;  2FLS A;  1TJD A;  3LSZ A;  4F82 A;  2HI7 A;  1O7U A;  2JZT A;  1U3A A;  5KN3 A;  4V1A g;  3A2W A;  5IMF A;  1XW6 A;  5DCH A;  2WCI A;  4ZL7 A;  1FVK A;  2X8H A;  2M46 A;  2IMK A;  5ELG A;  2TRX A;  1YKA A;  1TW9 A;  5A4V A;  1E6B A;  2YJ7 A;  5AN1 A;  3ZTL A;  2CAI A;  1XWG A;  3TDG A;  3DEX A;  1UVZ A;  4I6X A;  1XWB A;  4DSQ A;  4GST A;  1Y6E A;  4POL A;  2LJA A;  2H1D A;  3GNJ A;  1XWC A;  1B9X C;  4NHW A;  2PWJ A;  3GTU A;  2FGX A;  1X9S B;  1A0F A;  1QK8 A;  2R2J A;  2PMT A;  2V32 A;  4MMM A;  3CXG A;  5IPH A;  3UIW A;  3G7Y A;  5D9V A;  2WJU A;  1YEP A;  3M9J A;  2GVP A;  3D4T A;  2HNL A;  3GX8 A;  5B8B A;  3FK8 A;  2HYX A;  4PX1 A;  2B6M A;  3VK9 A;  5JCG A;  1JZO A;  2X99 A;  4WET A;  2H71 A;  3IK9 A;  2OAC A;  3ZZX A;  1F3B A;  4HEA 2;  3O6T A;  3LGC A;  4O92 A;  4K9Z A;  4GRF A;  3VLN A;  1XW9 A;  2VUP A;  2I9H A;  3IHQ A;  2M72 A;  3AY8 A;  4K7N A;  2DC5 A;  4PNF A;  2R4V A;  3ISO A;  3RPP A;  1EV4 A;  2N5F A;  3IAS 2;  4GCI A;  4NHZ A;  2C8U A;  2KP2 A;  2VL3 A;  4V2M A;  2NBS A;  1PQN A;  4XHM A;  3FW2 A;  2ES7 A;  2AAW A;  2PGT A;  4ZL9 A;  4G19 A;  4TR1 A;  5LNK e;  5LCZ A;  3P7X A;  3D5J A;  3TUE A;  1TK8 B;  3E3E A;  1Z9H A;  1GSE A;  3M0F A;  1MTC A;  4OFM A;  5DJM A;  1AQV A;  1C72 A;  5ECO B;  1MDI A;  2KUC A;  5DQS A;  2OKA A;  3F3R A;  2DLX A;  4QQ7 A;  2YAN A;  3DRN A;  1VGL A;  3C71 A;  2FWE A;  3EU4 A;  4GSN A;  5F07 A;  4TN8 A;  4HQZ A;  3ME7 A;  3QAV A;  5ECI B;  2LS5 A;  3L9S A;  3VWW A;  5ELA A;  2PER A;  4EO3 A;  3FR9 A;  1O8X A;  2IMI A;  4FIW A;  3VWV A;  4TXV A;  3HA9 A;  2C3T A;  5G5F A;  2XBQ A;  2LV3 A;  5LD0 A;  2GT5 A;  20GS A;  5DJL A;  17GS A;  2VLU A;  1SD8 A;  5EL8 A;  1U6T A;  3KP8 A;  1XCC A;  2L6C A;  2CX4 A;  1T3B A;  2C3Q A;  3CTG A;  3TKS C;  1ZCP A;  3ZIT A;  1TRU A;  4ULX A;  4XIH A;  4XTS A;  4POB A;  1YF0 A;  2TRC P;  5H5R A;  2E0Q A;  2QKE A;  5EY6 A;  6GSW A;  1YQ1 A;  1M99 A;  4WF5 A;  4OO4 A;  3LOR A;  2YPM A;  4X1U A;  2B5X A;  3SWL A;  3IPZ A;  2IMF A;  2CVK A;  4MF7 A;  1V40 A;  2RUE A;  2JZR A;  3UBL A;  3MNG A;  4BWS A;  1URM A;  2YNX A;  5G2Z A;  1SJZ A;  5DAK B;  5H5Q A;  1R5A A;  2IFQ A;  5ECN B;  1GSS A;  4MJE A;  1KNG A;  5HR0 A;  1OC9 B;  2QC7 A;  4GF0 A;  2PU9 C;  1I5G A;  1V9W A;  3DXB A;  1XVQ A;  4IS0 A;  3TKQ A;  3ZMK A;  3QD9 A;  3H93 A;  3IC4 A;  1F6M C;  1ERW A;  2EIO A;  2JAD A;  1HNA A;  2B1K A;  3QCP A;  1G7O A;  1PRX A;  2H74 A;  3QFA C;  2LQQ A;  4HI7 A;  3FZ5 A;  1U87 A;  3M3M A;  3TKS E;  2NDO A;  2X8C A;  2M80 A;  4QL7 A;  1RW1 A;  3KJY A;  4DSS A;  4DEJ A;  3KMN A;  1M9A A;  2J23 A;  5H5S A;  4Q5N A;  5G5E A;  4K8M A;  3F4R A;  4RUV A;  3HDC A;  2IMD A;  2IWT A;  6GST A;  5J9C A;  2K8S A;  2I4A A;  3KTB A;  5IIZ A;  2YJH A;  3FYG A;  6GSX A;  4BVY A;  1OAZ A;  1X5C A;  2YWI A;  3DGQ A;  1JLV A;  2R37 A;  1FG4 A;  2ON7 A;  3CRU A;  2HE3 A;  2VO4 A;  5ECL B;  3GYK A;  3BD2 A;  3GL3 A;  2HZE B;  1TI1 A;  1OE7 A;  1FAA A;  1NHO A;  4J57 E;  3LQ7 A;  3A3T A;  1ZYE A;  5GST A;  2YV9 A;  2AHE A;  1TRW A;  2MYG A;  3IR4 A;  2FA8 A;  1ERU A;  4KGI A;  5G31 A;  2IIY A;  2FWF A;  5AIX A;  4HJ2 A;  4ZB9 A;  1EOG A;  3Q18 A;  2NVL A;  4GSS A;  1SL1 B;  3J7Y k;  3EE2 A;  2JZS A;  2VD1 A;  3WYW A;  5C00 A;  4BPY A;  2O89 A;  1ZL9 A;  2XHF A;  4Z7X A;  1Y25 A;  2G0F A;  5EVO A;  4HDE A;  5D9T A;  2LNS A;  2VCZ A;  1DUG A;  3D6I A;  2CV4 A;  2I3Y A;  2PBJ A;  2H6X A;  4AGS A;  3UEM A;  1JFU A;  2L57 A;  3G9B A;  5KN1 A;  4Q5R A;  3QR6 A;  5JWR B;  1G6Y A;  1K0N A;  4KAE A;  4RI6 A;  3GV1 A;  3F4S A;  1ZOF A;  1LU4 A;  4EUY A;  4OD7 A;  1LBK A;  1ACV A;  5JCU A;  2IL3 A;  3H1N A;  1O85 A;  4ZXG A;  2WDU A;  4ECI A;  1SKS B;  4HU7 A;  4F0B A;  5CAX A;  4QL9 A;  3RBT A;  3ZIJ A;  6GSS A;  1WMJ A;  2YN1 A;  1KBN A;  4NPB A;  5FHI A;  3VUR A;  1K0O A;  3RAZ A;  3KGK A;  4XRD A;  3UVH A;  3VI5 A;  4POK A;  1SYX A;  4PNG A;  1X9W B;  4HOJ A;  1G7E A;  2IN3 A;  9GSS A;  1QGV A;  5CRW A;  2H0H A;  4JBB A;  3P8W A;  2FNO A;  3WT1 A;  4V2N A;  3TJG A;  4IVF A;  2X64 A;  1T4Z A;  2I81 A;  2B7K A;  3GIX A;  4GLT A;  4HQS A;  1V58 A;  3ERG A;  3QMX A;  2H30 A;  3QOU A;  1K0A A;  4LL4 B;  4TR3 A;  4IJ3 A;  1O73 A;  4PUA A;  1X9M B;  1GSQ A;  5A4U A;  3TRX A;  3N5O A;  3ZFL A;  1WOU A;  3A2X A;  2XBI A;  4MZW A;  1ERV A;  4FYC A;  5DAL A;  3GA4 A;  4MP4 A;  5HR2 A;  3QFB C;  4PQI A;  4KDY A;  2YWO A;  3LG6 A;  4O32 A;  2YP6 A;  4KA0 A;  1PX6 A;  3KMO A;  1FB6 A;  1A8L A;  3N9J A;  4PGT A;  5COH A;  4O7H A;  3C1S A;  1BYE A;  3FR6 A;  1XFL A;  1PGT A;  5GZZ B;  1QUW A;  2BJX A;  2VCV A;  4WBR D;  3TKP A;  3IA1 A;  3Q6O A;  4KDU A;  2WFC A;  2V41 A;  1K0C A;  1X0R A;  5A4W A;  1DBY A;  2C0F A;  1AIU A;  1HYU A;  4FYB A;  4HUA A;  2V1M A;  2H66 A;  1PD2 1;  4KB3 A;  2V6O A;  5ABR A;  3GUS A;  1YF1 A;  5ID2 A;  11GS A;  4X0X A;  1PKZ A;  5HFK A;  1Z3E A;  1IYI A;  2KP1 A;  2CX3 A;  2R6K A;  5IOW A;  3WGX A;  1CQH A;  1GSF A;  1DSB A;  2G2Q A;  4DVC A;  3G7I A;  1XOB A;  3GKX A;  1VF3 A;  1SK1 A;  1TTZ A;  2DIZ A;  1PL2 A;  5CRG A;  5AIS A;  1JLW A;  5IMV A;  1DE1 A;  3R2Q A;  2YCD A;  4ILF A;  3W8J A;  1S3D A;  3LYK A;  1GTA A;  4JR6 A;  2HT9 A;  5GSS A;  2CZ3 A;  3GH9 A;  1EWX A;  2FWG A;  4MCU A;  4YQM A;  2B3S A;  2WZ9 A;  1M2B A;  4F0C A;  4Q5Q A;  1F37 A;  3QPM A;  1V2A A;  2E7P A;  4KH7 A;  2MBS A;  1B9Y C;  4N11 A;  2H1B A;  2Z9S A;  5JCW A;  2X8G A;  4L0W A;  3GKM A;  2WUL A;  5J5N A;  4K7I A;  2DBC A;  5IMD A;  3APO A;  5IMZ A;  3HJM A;  3QAG A;  3KZQ A;  19GS A;  3LFL A;  4KSO A;  1S3C A;  3HY2 A;  2GS3 A;  3LEF A;  3MSZ A;  3CMI A;  1U88 A;  1WRY A;  3WD6 A;  4POM A;  2PVO C;  4MPG A;  4YAV A;  3K8N A;  4XRA A;  3E0U A;  2EIQ A;  3EU3 A;  1K0M A;  3KH7 A;  5IO2 A;  10GS A;  1XVW A;  8GSS A;  2C0E A;  3RHB A;  1GLQ A;  2OBK A;  2P5Q A;  4IHU A;  3GTU B;  4MJA A;  4TRX A;  1AC1 A;  4V2L A;  4TXO A;  4BL7 A;  1TU8 A;  1FW1 A;  4XCS A;  2GGT A;  4EC0 A;  1CQG A;  2CT6 A;  2VLT A;  4IN0 A;  1T1V A;  2RLI A;  4MF5 A;  1K3Y A;  3VWX A;  4OCF A;  2OE0 A;  2FA4 A;  3ERW A;  4BVX A;  4WR5 A;  4P3Y B;  2IJY A;  2LTK A;  1WJK A;  2AV4 A;  3TRP A;  1TK5 B;  1GTI A;  4GWR A;  2OJL A;  4MPF A;  5DCG A;  5ECM B;  3F6F A;  3BBY A;  4IJI A;  1R26 A;  3G7J A;  5ECS A;  1TK0 B;  4IEL A;  1O8W A;  1SJ6 A;  1OC3 A;  3FZ9 A;  1B4P A;  5J41 A;  4YAP A;  1WIK A;  1F2E A;  3GSS A;  1SK0 A;  4KE3 A;  3EMX A;  4TR1 B;  1GSY A;  1BED A;  2YOI A;  3FZA A;  5AGY A;  1ZGN A;  4NMU A;  1X5D A;  4ML6 A;  3ZVJ D;  1OVN A;  3P2A A;  5DQY A;  3C7M A;  2K18 A;  2K8V A;  1AXD A;  2GDR A;  1QQ2 A;  4O5R A;  1NM3 A;  3WGE A;  5HQP A;  1M9B A;  3KTL A;  1TRV A;  3M9K A;  3PH9 A;  3FHK A;  3UVT A;  3LWA A;  1HNB A;  3UAP A;  4XS1 A;  4EDZ A;  2B5E A;  4TOP A;  4IW9 A;  7GSS A;  2VL9 A;  2IME A;  2KLX A;  1PX7 A;  5INY A;  1PMT A;  2VM1 A;  2L4Q A;  4GXZ A;  2F8A A;  3NOF A;  1XXU A;  1SJI A;  1BG5 A;  1XZO A;  1JZD A;  3DVW A;  3V1W A;  1Q98 A;  4D73 B;  3I43 A;  2ZCT A;  5FT3 A;  1QFN A;  4MDC A;  4RQR A;  4HU9 A;  1F3A A;  2CZ2 A;  4LMW A;  2F3M A;  1Z6N A;  5ECP B;  1S3A A;  4OFT A;  3L9V A;  5E59 A;  4YQU A;  1U3I A;  4BA7 A;  2N5B A;  4PUF C;  2YZU A;  5HFG A;  4WBJ A;  3GRX A;  4MH3 A;  2HZE A;  1GSD A;  2WGR A;  2IFQ B;  3TKR A;  1J9B A;  3CYN A;  1K0D A;  2H72 A;  4WF4 A;  1OKD A;  4JRR A;  3HZ8 A;  1R7H A;  1KEB A;  4KUN A;  1SK2 A;  5IO0 A;  1T8E B;  1GTU A;  2FUG 2;  4HS1 A;  1OE8 A;  5IPG A;  5J4U A;  1M7T A;  1E2Y A;  1W4V A;  1SYR A;  4ZBB A;  2H6Z A;  4YQV A;  5GAN D;  4IBP A;  2L5L A;  1WPI A;  1F9M A;  3BCK A;  3GST A;  4I2U A;  2A4V A;  4DSS B;  3W8S A;  3FY7 A;  2RM6 A;  2K9F A;  4WR4 A;  4L0U A;  3F0I A;  3MDK A;  5J9B A;  3DKS A;  3D22 A;  2P0G A;  3H79 A;  2HSY A;  3HVX A;  3BCI A;  5IMC A;  1MDK A;  2J9H A;  1A23 A;  2OE3 A;  1AUC A;  3IBH A;  2PN8 A;  1PKW A;  1EP8 A;  1EGR A;  5B6N A;  3DML A;  1YEX A;  1O6J A;  2IPA A;  4ZB8 A;  1VF1 A;  2EC4 A;  3SBC A;  1J0F A;  2DJJ A;  3GL5 A;  4DSR A;  5ECR B;  1HQO A;  2VIM A;  2GQL A;  5DDL A;  3DYR A;  5CRE A;  4G2E A;  2K6V A;  1THO A;  5IM9 A;  2H01 A;  2OAD A;  3GFK A;  2LEG A;  2VCX A;  4H86 A;  2XC2 A;  4KSM A;  3L78 A;  2MMZ A;  2VCW A;  1AQW A;  22GS A;  4K2D A;  1XOA A;  2I1U A;  3PR8 A;  1SL2 B;  2LQO A;  1SU9 A;  2VCT A;  2FCH A;  1R4W A;  1SKR B;  3GKK A;  5DBQ A;  3ME8 A;  1GWC A;  4NWY A;  5KN0 A;  3DVX A;  5DVB A;  3QDN A;  1XWK A;  2LUS A;  1A0R P;  4OMV A;  1Z7P A;  2H1G A;  3BJ5 A;  4CDO A;  1GRX A;  2VCQ A;  6GSV A;  1UC7 A;  4XS4 A;  1TRS A;  1USB A;  3TRQ A;  1YY7 A;  5F0G A;  3ZML A;  1T7P B;  4JE1 A;  3FRC A;  2L5O A;  3O3T A;  4LMV A;  4MZC A;  3WT2 A;  4MJC A;  3P90 A;  2LRT A;  3A5W A;  4ECJ A;  1SL0 B;  2E2G A;  1EGO A;  4OCE A;  4WXT A;  4KND A;  1YZX A;  4IP6 A;  2LRC A;  1MEK A;  1EEJ A;  3E9J B;  5CO3 A;  3D21 A;  1ILO A;  2B7J A;  3RDW A;  2JAC A;  2V2G A;  2BMX A;  1Z5Y E;  1SKW B;  3CSI A;  4WEY A;  1TDI A;  5ECH B;  3TGZ A;  4KX4 A;  3VPT A;  4ZIJ A;  4MA9 A;  2VAF A;  4EE0 A;  2BTO T;  3GN3 A;  3KM6 A;  4RI7 A;  3TOU A;  2P5R A;  1GNE A;  4N30 A;  5CRH A;  1TI3 A;  2H73 A;  1EOH A;  3HHV A;  5G1K A;  1GSU A;  2C1Y A;  3LJR A;  5D9X A;  3HVV A;  3NIV A;  1TXX A;  1SD9 A;  1GUH A;  2MBT A;  1NW2 A;  3H8Q A;  2PUK C;  3S9F A;  1XPV A;  2JSZ A;  1NHY A;  4HZ2 A;  2DJ0 A;  4EF0 A;  2GST A;  3M1G A;  2TIR A;  1SEN A;  6GSU A;  1GTB A; 
#chains in the Genus database with same CATH topology
 3NZN A;  5HR1 A;  3CRT A;  4AF2 A;  3FKF A;  3RHC A;  3TB2 A;  1QMV A;  2DSA A;  1BAY A;  3US3 A;  4BWQ A;  5ID2 B;  2ZUP A;  4N10 A;  3VFI A;  3F63 A;  1N8J A;  2VL2 A;  1JZW A;  2VOC A;  1FHE A;  2H76 A;  4GQC A;  2GSR A;  2GTU A;  2ALB A;  1JHB A;  1IYH A;  1KTE A;  6GSY A;  1WWJ A;  3UJ1 A;  2N5A A;  1LJR A;  1ZZY A;  3U5R E;  4FH8 A;  1OKT A;  2NPB A;  2CQ9 A;  1K0B A;  3MWH A;  5D9W A;  4EVM A;  5D93 A;  1M2A A;  1S3R A;  3HYP A;  4K7O A;  4TVE A;  4KDX A;  1H75 A;  3J7Y b;  2AYT A;  3A2V A;  5CRD A;  2F51 A;  2GSS A;  2HFD A;  4K0N A;  3HD5 A;  3ZIV A;  3BOA A;  2LJK A;  3HVS A;  5ENU A;  2VL2 C;  3GUR A;  1HNC A;  2H1A A;  1RK4 A;  4HSC X;  4MK3 A;  2WB9 A;  1M3J A;  3L9U A;  4I2T A;  4L5L A;  3KEB A;  2C80 A;  4GQF A;  4ZB6 A;  3KCM A;  4L8E A;  2HRF A;  2V6K A;  5KEJ A;  1VRS D;  1ABA A;  1YKC A;  3HXS A;  1GUM A;  4AJ6 A;  2FHE A;  4ECB A;  1TKD B;  3ZRD A;  4ECC A;  1T00 A;  2YZH A;  1B48 A;  1JZR A;  4WKW A;  1G6W A;  2GZP A;  4ICY A;  12GS A;  1ON4 A;  5B6M A;  2GZY A;  3APQ A;  1TU7 A;  3TJK A;  5A5K A;  1V98 A;  3L0H A;  3L4N A;  4JZQ A;  1GP1 A;  4Q5F A;  4NV2 A;  2OBI A;  4CW9 A;  3U6V A;  4LA1 A;  5IMA A;  5J3R A;  3ERF A;  2O87 A;  2OA7 A;  5FWG A;  4NV5 A;  4ML1 A;  2GSQ A;  4IQA A;  5L71 A;  4TXO B;  4BL7 B;  4AJ8 A;  3DIE A;  4YKG A;  3APS A;  1DE2 A;  2PPT A;  3VI7 A;  5KN2 A;  2F8F A;  4IQ1 A;  3TKS A;  4PXO A;  2H0G A;  2NTO A;  3D0Z A;  3QAW A;  5B8A A;  2VM2 A;  1A2L A;  2O85 A;  1PSQ A;  1ML6 A;  3IAM 2;  4LLR A;  4BVX B;  3KIJ A;  4ACS A;  1V57 A;  4KCE A;  4N0Z A;  1R5P A;  16GS A;  1N2A A;  3D4M A;  2XPD A;  4TW5 A;  3I69 A;  4V1A p;  13GS A;  2FWH A;  4IKH A;  1ZYP A;  2GQM A;  4X43 A;  2D2Z A;  2LST A;  3PGT A;  1GH2 A;  4MF6 A;  2F9S A;  1MD3 A;  2LJR A;  3KH9 A;  3ZYW A;  2YWN A;  3ZVJ A;  2LKU A;  4FYU A;  2EIR A;  5DAK A;  3VPQ A;  3EC3 A;  4YH2 A;  3FEU A;  2L6D A;  2VLV A;  1HD2 A;  2DJK A;  5GAP D;  1UA5 A;  1OC9 A;  4OO5 A;  4ZIL A;  5C04 A;  1ZYQ B;  4D73 A;  1B8X A;  4EL1 A;  4TR4 A;  3TCO A;  1GLP A;  5JWQ B;  1W89 A;  2O7K A;  1YJ6 A;  1EEM A;  3KD0 A;  1XWA A;  4K0G A;  4J2F A;  3IE3 A;  1WP0 A;  1OYJ A;  2QGV A;  1O81 A;  1TOF A;  4EIP A;  5AIV A;  2E2M A;  3HZ4 A;  1AAZ A;  2KHP A;  1FOV A;  4KCA A;  3Q19 A;  4I97 A;  1Z6M A;  1NSW A;  1QXH A;  2R0C A;  2AUV A;  5CP1 A;  3GMF A;  5G1L A;  3F9U A;  2C0G A;  1BX9 A;  1I9D A;  3UAR A;  1FOH A;  2GT6 A;  1ST9 A;  2DJ3 A;  3UL3 A;  4RQX A;  18GS A;  1XW5 A;  3EIN A;  5JWO B;  3LYP A;  4GTU A;  4ZL8 A;  2LNT A;  2CVB A;  1FVJ A;  3Q74 A;  4N0V A;  1GUL A;  3ED3 A;  3MYD A;  1PN9 A;  5HR3 A;  3TJB A;  3TJF A;  4TR0 A;  4E8E A;  3F3Q A;  1VF4 A;  2PVQ A;  3FR3 A;  3CBU A;  1MD4 A;  3ZFB A;  1AQX A;  2MMO A;  4JU5 A;  2A2S A;  2R5G A;  3ZL5 A;  4AJ7 A;  5B7C A;  3EMP A;  1A2J A;  3GKN A;  4MLY A;  5CNW A;  2L59 A;  4MAB A;  2B1L A;  3TJJ A;  2CAQ A;  4CHS A;  3MAK A;  2GLR A;  2HRK A;  3UOM A;  3RPN A;  3LW9 A;  2HXK A;  4OWY A;  2VD0 A;  1EZK A;  2C4J A;  2FD3 A;  2ON5 A;  3IRA A;  3H4K A;  1XBS A;  3WGD A;  5ECQ B;  5D8I A;  3VWU A;  4L5O A;  1EP7 A;  1GNW A;  4MJB A;  2GZZ A;  4J56 E;  4KW6 A;  5G30 A;  5F06 A;  3LXZ A;  5EPF A;  2RM5 A;  1FO5 A;  2MMA A;  3ZLP A;  4EIQ A;  4K5S A;  2AB6 A;  3HJO A;  3F6D A;  3M8N A;  1B4Q A;  3PIN A;  2HRA A;  3HKR A;  2B5Y A;  5D73 A;  3JCM L;  4KF9 A;  1GL8 A;  3UMA A;  2QSI A;  2C0D A;  4K6X A;  3ZRE A;  4F03 A;  1M0U A;  2HRN A;  4EXJ A;  4TKY A;  3IK7 A;  3LXT A;  4ZBA A;  3I6A A;  3KXO A;  2JU5 A;  2CA8 A;  3IDV A;  2HSH A;  2XPE A;  2MZC A;  4G10 A;  2HZF A;  3EVI A;  1TP9 A;  3EYT A;  4G9H A;  4E8H A;  3I9V 2;  3CSJ A;  4ID0 A;  1Z7R A;  2FY6 A;  1BQ7 A;  1XG8 A;  2DIY A;  4MH2 A;  2JL4 A;  1M2D A;  2DML A;  5ECK B;  2H70 A;  3IXR A;  1A8Y A;  1A2M A;  1BJX A;  1YDK A;  2AJQ B;  4F2I A;  2GQK A;  2LRN A;  3C73 A;  1G0T A;  1EV9 A;  4F9Z A;  1ZMA A;  2KOK A;  4LL1 B;  3DD3 A;  5D96 A;  3F4T A;  2YWM A;  4FO5 A;  4XS6 A;  2WS2 A;  2REM A;  1AW9 A;  1MDJ A;  14GS A;  5F8B A;  2CVD A;  4NAX A;  3GHA A;  1K3O A;  4JED A;  4EDY A;  4Z2U A;  4PUR A;  5CYY A;  4I8B A;  2DJ1 A;  2DJ2 A;  1Q4J A;  1WE0 A;  4EKZ A;  3IOS A;  1X5E A;  2C3N A;  2H6Y A;  4I5Q A;  1UN2 A;  4PQ1 A;  2H8L A;  4XS4 B;  5IQY A;  3KP9 A;  1GUK A;  2MMN A;  1PA3 A;  2A2P A;  4K1F A;  4ISD A;  1THX A;  1A24 A;  3HJP A;  3CSH A;  1PL1 A;  2HLS A;  3F8U A;  2H0I A;  5E4W A;  4JR4 A;  4ZBD A;  3C8E A;  2R3X A;  3O76 A;  5DAL B;  2L4C A;  1H4O A;  2YV7 A;  4HZ4 A;  3TOT A;  5HFI A;  4IGJ A;  1K3L A;  3DWV A;  3IV4 A;  4MZB A;  2H75 A;  4HJM A;  4PTS A;  2OE1 A;  2RII A;  1RQM A;  3W6G A;  4OFN A;  3GH6 A;  3GX0 A;  2DMM A;  4Z2R A;  3FZ4 A;  5F05 A;  1XIY A;  2A2R A;  1T4Y A;  3EUR A;  2ZNM A;  5BRT A;  1J08 A;  3UBK A;  3C1R A;  2P31 A;  3EWL A;  1OC8 A;  2WRT A;  3HCZ A;  2JSY A;  1ERT A;  2H19 A;  2RUF A;  4NXI A;  1ZYN A;  4PQH A;  1VF2 A;  5IOX A;  4IP1 A;  3CTF A;  2O8V B;  3OR5 A;  1FB0 A;  2FLS A;  1TJD A;  3LSZ A;  4F82 A;  2HI7 A;  1O7U A;  2JZT A;  1U3A A;  5KN3 A;  4V1A g;  3A2W A;  5IMF A;  1XW6 A;  5DCH A;  2WCI A;  4ZL7 A;  1FVK A;  2X8H A;  2M46 A;  2IMK A;  5ELG A;  2TRX A;  1YKA A;  1TW9 A;  5A4V A;  1E6B A;  2YJ7 A;  5AN1 A;  3ZTL A;  2CAI A;  1XWG A;  3TDG A;  3DEX A;  1UVZ A;  4I6X A;  1XWB A;  4DSQ A;  4GST A;  1Y6E A;  4POL A;  2LJA A;  2H1D A;  3GNJ A;  1XWC A;  1B9X C;  4NHW A;  2PWJ A;  3GTU A;  2FGX A;  1X9S B;  1A0F A;  1QK8 A;  2R2J A;  2PMT A;  2V32 A;  4MMM A;  3CXG A;  5IPH A;  3UIW A;  3G7Y A;  5D9V A;  3MIX A;  2WJU A;  1YEP A;  3M9J A;  2GVP A;  3D4T A;  2HNL A;  3GX8 A;  5B8B A;  3FK8 A;  2HYX A;  4CY8 A;  4PX1 A;  2B6M A;  3VK9 A;  5JCG A;  1JZO A;  2X99 A;  4WET A;  2H71 A;  3IK9 A;  2OAC A;  3ZZX A;  1F3B A;  4HEA 2;  3O6T A;  3LGC A;  4O92 A;  4K9Z A;  4GRF A;  3VLN A;  1XW9 A;  2VUP A;  2I9H A;  3IHQ A;  2M72 A;  3AY8 A;  4K7N A;  2DC5 A;  2DKI A;  4PNF A;  2R4V A;  3ISO A;  3RPP A;  1EV4 A;  2N5F A;  3IAS 2;  4GCI A;  4O5U A;  4NHZ A;  2C8U A;  2KP2 A;  2VL3 A;  4V2M A;  2NBS A;  1PQN A;  4XHM A;  3FW2 A;  2ES7 A;  2AAW A;  2PGT A;  4ZL9 A;  4G19 A;  4TR1 A;  5LNK e;  5LCZ A;  4Z2T A;  3P7X A;  3D5J A;  3TUE A;  1TK8 B;  3E3E A;  1Z9H A;  1GSE A;  3M0F A;  1MTC A;  4OFM A;  5DJM A;  1AQV A;  1C72 A;  5ECO B;  1MDI A;  2KUC A;  5DQS A;  2OKA A;  3F3R A;  2DLX A;  4QQ7 A;  2YAN A;  3DRN A;  1VGL A;  3C71 A;  2FWE A;  3EU4 A;  4GSN A;  5F07 A;  4TN8 A;  4HQZ A;  3ME7 A;  3QAV A;  5ECI B;  2LS5 A;  3L9S A;  3VWW A;  5ELA A;  2PER A;  4EO3 A;  3FR9 A;  1O8X A;  2IMI A;  4FIW A;  3VWV A;  4TXV A;  3HA9 A;  2C3T A;  5G5F A;  2XBQ A;  2LV3 A;  5LD0 A;  2GT5 A;  20GS A;  5DJL A;  17GS A;  1PFO A;  2VLU A;  1SD8 A;  5EL8 A;  1U6T A;  3KP8 A;  1XCC A;  4K2X A;  2L6C A;  2CX4 A;  1T3B A;  2C3Q A;  3CTG A;  3TKS C;  1ZCP A;  3ZIT A;  1TRU A;  4ULX A;  4XIH A;  4XTS A;  4POB A;  1YF0 A;  2TRC P;  5H5R A;  2E0Q A;  2QKE A;  5EY6 A;  6GSW A;  1YQ1 A;  1M99 A;  4WF5 A;  4OO4 A;  3LOR A;  2YPM A;  4X1U A;  2B5X A;  3SWL A;  3IPZ A;  2IMF A;  2CVK A;  4MF7 A;  1V40 A;  2RUE A;  2JZR A;  3UBL A;  5KOW A;  3MNG A;  4BWS A;  1URM A;  2YNX A;  5G2Z A;  1SJZ A;  5DAK B;  5H5Q A;  1R5A A;  2IFQ A;  3CQF A;  5ECN B;  1GSS A;  4MJE A;  1KNG A;  5HR0 A;  1OC9 B;  2QC7 A;  4GF0 A;  2PU9 C;  1I5G A;  1V9W A;  3DXB A;  1XVQ A;  4IS0 A;  3TKQ A;  3ZMK A;  3QD9 A;  3H93 A;  3IC4 A;  1F6M C;  1ERW A;  2EIO A;  2JAD A;  1HNA A;  2B1K A;  3QCP A;  1G7O A;  1PRX A;  2H74 A;  3QFA C;  2LQQ A;  4HI7 A;  3FZ5 A;  1U87 A;  3M3M A;  3TKS E;  2NDO A;  2X8C A;  2M80 A;  4QL7 A;  1RW1 A;  3KJY A;  4DSS A;  4DEJ A;  3KMN A;  1M9A A;  2J23 A;  2X4A A;  5H5S A;  4Q5N A;  5G5E A;  4K8M A;  3F4R A;  4RUV A;  3HDC A;  2IMD A;  2IWT A;  6GST A;  5J9C A;  2K8S A;  2I4A A;  3KTB A;  5IIZ A;  2YJH A;  3FYG A;  6GSX A;  4BVY A;  1OAZ A;  1X5C A;  2YWI A;  3DGQ A;  1JLV A;  2R37 A;  1FG4 A;  2ON7 A;  3CRU A;  2HE3 A;  2VO4 A;  5ECL B;  3GYK A;  3BD2 A;  3GL3 A;  2HZE B;  1TI1 A;  1OE7 A;  1FAA A;  1NHO A;  4J57 E;  3LQ7 A;  3A3T A;  1ZYE A;  5GST A;  2YV9 A;  2AHE A;  1TRW A;  2MYG A;  3IR4 A;  2FA8 A;  1ERU A;  4KGI A;  5G31 A;  2IIY A;  2FWF A;  5AIX A;  4HJ2 A;  4ZB9 A;  1EOG A;  3Q18 A;  2NVL A;  4GSS A;  1SL1 B;  3J7Y k;  3EE2 A;  2JZS A;  2VD1 A;  3WYW A;  5C00 A;  4BPY A;  2O89 A;  1ZL9 A;  2XHF A;  4Z7X A;  1Y25 A;  2G0F A;  5EVO A;  4HDE A;  5D9T A;  2LNS A;  2VCZ A;  1DUG A;  3D6I A;  2CV4 A;  2I3Y A;  2PBJ A;  2H6X A;  4AGS A;  3UEM A;  1JFU A;  2L57 A;  3G9B A;  5KN1 A;  4Q5R A;  3QR6 A;  5JWR B;  4MNN A;  1G6Y A;  1K0N A;  4KAE A;  4RI6 A;  3GV1 A;  3F4S A;  1ZOF A;  1LU4 A;  4EUY A;  4OD7 A;  1LBK A;  1ACV A;  5JCU A;  2IL3 A;  3H1N A;  1O85 A;  4ZXG A;  2WDU A;  4G0L A;  2A4H A;  4ECI A;  1SKS B;  4HU7 A;  4F0B A;  5CAX A;  4QL9 A;  3RBT A;  3ZIJ A;  6GSS A;  1WMJ A;  2YN1 A;  1KBN A;  4NPB A;  5FHI A;  3VUR A;  1K0O A;  3RAZ A;  3KGK A;  4XRD A;  3UVH A;  4CY6 A;  3VI5 A;  4POK A;  1SYX A;  4PNG A;  1X9W B;  4HOJ A;  1G7E A;  2IN3 A;  9GSS A;  1QGV A;  4G0I A;  5CRW A;  2H0H A;  4JBB A;  3P8W A;  2FNO A;  3WT1 A;  4V2N A;  3TJG A;  4IVF A;  2X64 A;  1T4Z A;  2I81 A;  2B7K A;  3GIX A;  4GLT A;  4HQS A;  1V58 A;  3ERG A;  3QMX A;  2H30 A;  3QOU A;  1K0A A;  4LL4 B;  4TR3 A;  4IJ3 A;  1O73 A;  4PUA A;  1X9M B;  1GSQ A;  5A4U A;  3TRX A;  3N5O A;  3ZFL A;  1WOU A;  3A2X A;  2XBI A;  4MZW A;  1ERV A;  4FYC A;  5DAL A;  3GA4 A;  4MP4 A;  5HR2 A;  3QFB C;  4PQI A;  4KDY A;  2YWO A;  3LG6 A;  4O32 A;  2YP6 A;  4KA0 A;  1PX6 A;  3KMO A;  1FB6 A;  1A8L A;  3N9J A;  2R0G A;  4PGT A;  5COH A;  4O7H A;  3C1S A;  1BYE A;  3FR6 A;  1XFL A;  1PGT A;  5GZZ B;  1QUW A;  2BJX A;  2VCV A;  4WBR D;  3A5I A;  3IA1 A;  3TKP A;  3Q6O A;  4KDU A;  2WFC A;  2V41 A;  1K0C A;  1X0R A;  5A4W A;  1DBY A;  2C0F A;  1AIU A;  1HYU A;  4FYB A;  4HUA A;  5BMU A;  2QA2 A;  2V1M A;  2H66 A;  1PD2 1;  4KB3 A;  2V6O A;  5ABR A;  3GUS A;  1YF1 A;  5ID2 A;  11GS A;  4X0X A;  1PKZ A;  5HFK A;  1Z3E A;  1IYI A;  2KP1 A;  2CX3 A;  2R6K A;  5IOW A;  3WGX A;  1CQH A;  1GSF A;  1DSB A;  2G2Q A;  4DVC A;  3G7I A;  1XOB A;  3GKX A;  1VF3 A;  1SK1 A;  1TTZ A;  2DIZ A;  1PL2 A;  5CRG A;  5AIS A;  1JLW A;  5IMV A;  1DE1 A;  3R2Q A;  2YCD A;  4ILF A;  3W8J A;  1S3D A;  3LYK A;  1GTA A;  4JR6 A;  2HT9 A;  5GSS A;  2CZ3 A;  3GH9 A;  3R3E A;  1EWX A;  2FWG A;  4MCU A;  4YQM A;  2B3S A;  2WZ9 A;  1M2B A;  4F0C A;  4Q5Q A;  1F37 A;  3QPM A;  3PPU A;  1V2A A;  2E7P A;  4KH7 A;  2MBS A;  1B9Y C;  4N11 A;  2H1B A;  2Z9S A;  5JCW A;  2X8G A;  4L0W A;  3GKM A;  2WUL A;  5J5N A;  4K7I A;  2DBC A;  5IMD A;  3APO A;  5IMZ A;  3HJM A;  3QAG A;  3KZQ A;  19GS A;  3LFL A;  4KSO A;  1S3C A;  3HY2 A;  4FQU A;  3IC8 A;  2GS3 A;  3LEF A;  3MSZ A;  3CMI A;  1U88 A;  1WRY A;  3WD6 A;  4POM A;  2PVO C;  4MPG A;  4YAV A;  3K8N A;  4XRA A;  3E0U A;  2EIQ A;  3EU3 A;  1K0M A;  3KH7 A;  5IO2 A;  10GS A;  1XVW A;  8GSS A;  2C0E A;  3RHB A;  1GLQ A;  2OBK A;  2P5Q A;  4IHU A;  3GTU B;  4MJA A;  4TRX A;  1AC1 A;  4V2L A;  4TXO A;  4BL7 A;  1TU8 A;  1FW1 A;  4XCS A;  2GGT A;  4EC0 A;  1CQG A;  2CT6 A;  2VLT A;  4IN0 A;  1T1V A;  2RLI A;  4MF5 A;  2X49 A;  1K3Y A;  3VWX A;  4OCF A;  2OE0 A;  2FA4 A;  3ERW A;  4BIK A;  4WR5 A;  4BVX A;  4P3Y B;  2IJY A;  2LTK A;  1WJK A;  2AV4 A;  3TRP A;  1TK5 B;  1GTI A;  4GWR A;  2OJL A;  4MPF A;  5DCG A;  5ECM B;  3F6F A;  3BBY A;  4IJI A;  1R26 A;  3G7J A;  5ECS A;  1TK0 B;  4IEL A;  1O8W A;  1SJ6 A;  1OC3 A;  3FZ9 A;  1B4P A;  5J41 A;  4YAP A;  1WIK A;  1F2E A;  3GSS A;  1SK0 A;  4KE3 A;  3EMX A;  4TR1 B;  1GSY A;  1BED A;  2YOI A;  3FZA A;  5AGY A;  1ZGN A;  4NMU A;  1X5D A;  4ML6 A;  3ZVJ D;  4G0K A;  1OVN A;  3P2A A;  5DQY A;  3C7M A;  2K18 A;  2K8V A;  1AXD A;  2GDR A;  1QQ2 A;  4O5R A;  4USS A;  1PN0 A;  1NM3 A;  3WGE A;  5HQP A;  1M9B A;  3KTL A;  1TRV A;  3M9K A;  3PH9 A;  3FHK A;  3UVT A;  3LWA A;  1HNB A;  3UAP A;  4XS1 A;  4EDZ A;  2B5E A;  4TOP A;  4IW9 A;  7GSS A;  2VL9 A;  2IME A;  2KLX A;  1PX7 A;  5INY A;  1PMT A;  2VM1 A;  2L4Q A;  4GXZ A;  2F8A A;  3NOF A;  1XXU A;  1SJI A;  1BG5 A;  1XZO A;  1JZD A;  3DVW A;  3V1W A;  1Q98 A;  4D73 B;  3I43 A;  2ZCT A;  5FT3 A;  1QFN A;  4MDC A;  4RQR A;  4HU9 A;  1F3A A;  2CZ2 A;  4LMW A;  2F3M A;  1Z6N A;  4X4J A;  5ECP B;  1S3A A;  4OFT A;  3L9V A;  5E59 A;  4YQU A;  1U3I A;  4BA7 A;  2N5B A;  4PUF C;  2YZU A;  5HFG A;  4K5R A;  4WBJ A;  3GRX A;  4MH3 A;  2HZE A;  1GSD A;  2WGR A;  2IFQ B;  3TKR A;  1J9B A;  3CYN A;  1K0D A;  2H72 A;  4WF4 A;  1OKD A;  4JRR A;  3HZ8 A;  1R7H A;  1KEB A;  4KUN A;  1SK2 A;  5IO0 A;  1T8E B;  1GTU A;  2FUG 2;  4HS1 A;  1OE8 A;  5IPG A;  5J4U A;  1M7T A;  1E2Y A;  1W4V A;  1SYR A;  4ZBB A;  2H6Z A;  4YQV A;  5GAN D;  4IBP A;  2L5L A;  1WPI A;  1F9M A;  3BCK A;  3GST A;  4I2U A;  4YKF A;  2A4V A;  4DSS B;  3W8S A;  3FY7 A;  2RM6 A;  2K9F A;  4WR4 A;  4L0U A;  3F0I A;  3MDK A;  5J9B A;  3DKS A;  3D22 A;  2P0G A;  3H79 A;  2HSY A;  3HVX A;  3BCI A;  5IMC A;  1MDK A;  3HVN A;  2QA1 A;  2J9H A;  1A23 A;  2OE3 A;  1AUC A;  3IBH A;  2PN8 A;  4BVY B;  1PKW A;  1EP8 A;  1EGR A;  5B6N A;  5KOX A;  3DML A;  1YEX A;  1O6J A;  2IPA A;  4ZB8 A;  1VF1 A;  2EC4 A;  4O5Q A;  3SBC A;  1J0F A;  2DJJ A;  3GL5 A;  4DSR A;  5ECR B;  1HQO A;  2DKH A;  2VIM A;  2GQL A;  5DDL A;  3DYR A;  5CRE A;  4G2E A;  2K6V A;  1THO A;  5IM9 A;  2H01 A;  2OAD A;  3GFK A;  2LEG A;  2VCX A;  4H86 A;  2XC2 A;  4KSM A;  3L78 A;  2MMZ A;  2VCW A;  1AQW A;  22GS A;  4K2D A;  1XOA A;  2I1U A;  3PR8 A;  1SL2 B;  2LQO A;  1SU9 A;  2VCT A;  2FCH A;  1R4W A;  1SKR B;  3GKK A;  5DBQ A;  3ME8 A;  1GWC A;  4NWY A;  5KN0 A;  3DVX A;  5DVB A;  3QDN A;  1XWK A;  2LUS A;  3FMW A;  1A0R P;  4OMV A;  1Z7P A;  2H1G A;  3BJ5 A;  3EPT A;  4CDO A;  1GRX A;  2VCQ A;  6GSV A;  1UC7 A;  4XS4 A;  1TRS A;  1USB A;  3TRQ A;  1YY7 A;  5F0G A;  3ZML A;  1T7P B;  4JE1 A;  3FRC A;  2L5O A;  3O3T A;  4LMV A;  4MZC A;  3WT2 A;  4MJC A;  3P90 A;  2LRT A;  3A5W A;  4ECJ A;  1SL0 B;  2E2G A;  1EGO A;  2R0P A;  4OCE A;  4WXT A;  4KND A;  1YZX A;  4IP6 A;  2LRC A;  4A5P A;  1MEK A;  1EEJ A;  3E9J B;  5CO3 A;  3D21 A;  1ILO A;  2B7J A;  3RDW A;  3IHG A;  2JAC A;  2V2G A;  2BMX A;  1Z5Y E;  1SKW B;  3CSI A;  4WEY A;  1TDI A;  5ECH B;  3TGZ A;  4KX4 A;  3VPT A;  4ZIJ A;  4MA9 A;  2VAF A;  4EE0 A;  2BTO T;  3GN3 A;  3KM6 A;  4RI7 A;  3TOU A;  2P5R A;  1GNE A;  4N30 A;  5CRH A;  1TI3 A;  2H73 A;  1M3I A;  1EOH A;  3HHV A;  5G1K A;  1GSU A;  2C1Y A;  3LJR A;  5D9X A;  3HVV A;  3NIV A;  1TXX A;  1SD9 A;  1GUH A;  2MBT A;  1NW2 A;  3H8Q A;  2PUK C;  3S9F A;  1XPV A;  2JSZ A;  1NHY A;  4HZ2 A;  2HSM A;  2DJ0 A;  4EF0 A;  2GST A;  3M1G A;  2TIR A;  1SEN A;  2UZ8 A;  6GSU A;  1GTB A; 
#chains in the Genus database with same CATH homology
 3NZN A;  5HR1 A;  3CRT A;  4AF2 A;  3FKF A;  3RHC A;  3TB2 A;  1QMV A;  2DSA A;  1BAY A;  3US3 A;  4BWQ A;  5ID2 B;  2ZUP A;  4N10 A;  3VFI A;  3F63 A;  1N8J A;  2VL2 A;  1JZW A;  2VOC A;  1FHE A;  2H76 A;  4GQC A;  2GSR A;  2GTU A;  2ALB A;  1JHB A;  1IYH A;  1KTE A;  6GSY A;  1WWJ A;  3UJ1 A;  2N5A A;  1LJR A;  1ZZY A;  3U5R E;  4FH8 A;  1OKT A;  2NPB A;  2CQ9 A;  1K0B A;  3MWH A;  5D9W A;  4EVM A;  5D93 A;  1M2A A;  3HYP A;  4K7O A;  4TVE A;  4KDX A;  1H75 A;  3J7Y b;  2AYT A;  3A2V A;  5CRD A;  2F51 A;  2GSS A;  2HFD A;  4K0N A;  3HD5 A;  3ZIV A;  3BOA A;  2LJK A;  3HVS A;  5ENU A;  2VL2 C;  3GUR A;  1HNC A;  2H1A A;  1RK4 A;  4MK3 A;  2WB9 A;  3L9U A;  4I2T A;  4L5L A;  3KEB A;  2C80 A;  4GQF A;  4ZB6 A;  3KCM A;  4L8E A;  2HRF A;  2V6K A;  5KEJ A;  1VRS D;  1ABA A;  1YKC A;  3HXS A;  1GUM A;  4AJ6 A;  2FHE A;  4ECB A;  1TKD B;  3ZRD A;  4ECC A;  1T00 A;  2YZH A;  1B48 A;  1JZR A;  4WKW A;  1G6W A;  2GZP A;  4ICY A;  12GS A;  1ON4 A;  5B6M A;  2GZY A;  3APQ A;  1TU7 A;  3TJK A;  5A5K A;  1V98 A;  3L0H A;  3L4N A;  4JZQ A;  1GP1 A;  4Q5F A;  4NV2 A;  2OBI A;  4CW9 A;  3U6V A;  4LA1 A;  5IMA A;  5J3R A;  3ERF A;  2O87 A;  2OA7 A;  5FWG A;  4NV5 A;  4ML1 A;  2GSQ A;  4IQA A;  5L71 A;  4TXO B;  4BL7 B;  4AJ8 A;  3DIE A;  4YKG A;  3APS A;  1DE2 A;  2PPT A;  3VI7 A;  5KN2 A;  2F8F A;  4IQ1 A;  3TKS A;  4PXO A;  2H0G A;  2NTO A;  3D0Z A;  3QAW A;  5B8A A;  2VM2 A;  1A2L A;  2O85 A;  1PSQ A;  1ML6 A;  3IAM 2;  4LLR A;  4BVX B;  3KIJ A;  4ACS A;  1V57 A;  4KCE A;  4N0Z A;  1R5P A;  16GS A;  1N2A A;  3D4M A;  2XPD A;  4TW5 A;  3I69 A;  4V1A p;  13GS A;  2FWH A;  4IKH A;  1ZYP A;  2GQM A;  4X43 A;  2D2Z A;  2LST A;  3PGT A;  1GH2 A;  4MF6 A;  2F9S A;  1MD3 A;  2LJR A;  3KH9 A;  3ZYW A;  2YWN A;  3ZVJ A;  2LKU A;  4FYU A;  2EIR A;  5DAK A;  3VPQ A;  3EC3 A;  4YH2 A;  3FEU A;  2L6D A;  2VLV A;  1HD2 A;  2DJK A;  5GAP D;  1UA5 A;  1OC9 A;  4OO5 A;  4ZIL A;  5C04 A;  1ZYQ B;  4D73 A;  1B8X A;  4EL1 A;  4TR4 A;  3TCO A;  1GLP A;  5JWQ B;  1W89 A;  2O7K A;  1YJ6 A;  1EEM A;  3KD0 A;  1XWA A;  4K0G A;  4J2F A;  3IE3 A;  1WP0 A;  1OYJ A;  2QGV A;  1O81 A;  1TOF A;  4EIP A;  5AIV A;  2E2M A;  3HZ4 A;  1AAZ A;  2KHP A;  1FOV A;  4KCA A;  3Q19 A;  4I97 A;  1Z6M A;  1NSW A;  1QXH A;  2R0C A;  2AUV A;  5CP1 A;  3GMF A;  5G1L A;  3F9U A;  2C0G A;  1BX9 A;  1I9D A;  3UAR A;  1FOH A;  2GT6 A;  1ST9 A;  2DJ3 A;  3UL3 A;  4RQX A;  18GS A;  1XW5 A;  3EIN A;  5JWO B;  3LYP A;  4GTU A;  4ZL8 A;  2LNT A;  2CVB A;  1FVJ A;  3Q74 A;  4N0V A;  1GUL A;  3ED3 A;  3MYD A;  1PN9 A;  5HR3 A;  3TJB A;  3TJF A;  4TR0 A;  4E8E A;  3F3Q A;  1VF4 A;  2PVQ A;  3FR3 A;  3CBU A;  1MD4 A;  3ZFB A;  1AQX A;  2MMO A;  4JU5 A;  2A2S A;  2R5G A;  3ZL5 A;  4AJ7 A;  5B7C A;  3EMP A;  1A2J A;  3GKN A;  4MLY A;  5CNW A;  2L59 A;  4MAB A;  2B1L A;  3TJJ A;  2CAQ A;  4CHS A;  3MAK A;  2GLR A;  2HRK A;  3UOM A;  3RPN A;  3LW9 A;  2HXK A;  4OWY A;  2VD0 A;  1EZK A;  2C4J A;  2FD3 A;  2ON5 A;  3IRA A;  3H4K A;  1XBS A;  3WGD A;  5ECQ B;  5D8I A;  3VWU A;  4L5O A;  1EP7 A;  1GNW A;  4MJB A;  2GZZ A;  4J56 E;  4KW6 A;  5G30 A;  5F06 A;  3LXZ A;  5EPF A;  2RM5 A;  1FO5 A;  2MMA A;  3ZLP A;  4EIQ A;  4K5S A;  2AB6 A;  3HJO A;  3F6D A;  3M8N A;  1B4Q A;  3PIN A;  2HRA A;  3HKR A;  2B5Y A;  5D73 A;  3JCM L;  4KF9 A;  1GL8 A;  3UMA A;  2QSI A;  2C0D A;  4K6X A;  3ZRE A;  4F03 A;  1M0U A;  2HRN A;  4EXJ A;  4TKY A;  3IK7 A;  3LXT A;  4ZBA A;  3I6A A;  3KXO A;  2JU5 A;  2CA8 A;  3IDV A;  2HSH A;  2XPE A;  2MZC A;  4G10 A;  2HZF A;  3EVI A;  1TP9 A;  3EYT A;  4G9H A;  4E8H A;  3I9V 2;  3CSJ A;  4ID0 A;  1Z7R A;  2FY6 A;  1BQ7 A;  2DIY A;  4MH2 A;  2JL4 A;  1M2D A;  2DML A;  5ECK B;  2H70 A;  3IXR A;  1A8Y A;  1A2M A;  1BJX A;  1YDK A;  2AJQ B;  4F2I A;  2GQK A;  2LRN A;  3C73 A;  1G0T A;  1EV9 A;  4F9Z A;  1ZMA A;  2KOK A;  4LL1 B;  3DD3 A;  5D96 A;  3F4T A;  2YWM A;  4FO5 A;  4XS6 A;  2WS2 A;  2REM A;  1AW9 A;  1MDJ A;  14GS A;  5F8B A;  2CVD A;  4NAX A;  3GHA A;  1K3O A;  4JED A;  4EDY A;  4Z2U A;  4PUR A;  5CYY A;  4I8B A;  2DJ1 A;  2DJ2 A;  1Q4J A;  1WE0 A;  4EKZ A;  3IOS A;  1X5E A;  2C3N A;  2H6Y A;  4I5Q A;  1UN2 A;  4PQ1 A;  2H8L A;  4XS4 B;  5IQY A;  3KP9 A;  1GUK A;  2MMN A;  1PA3 A;  2A2P A;  4K1F A;  4ISD A;  1THX A;  1A24 A;  3HJP A;  3CSH A;  1PL1 A;  2HLS A;  3F8U A;  2H0I A;  5E4W A;  4JR4 A;  4ZBD A;  3C8E A;  2R3X A;  3O76 A;  5DAL B;  2L4C A;  1H4O A;  2YV7 A;  4HZ4 A;  3TOT A;  5HFI A;  4IGJ A;  1K3L A;  3DWV A;  3IV4 A;  4MZB A;  2H75 A;  4HJM A;  4PTS A;  2OE1 A;  2RII A;  1RQM A;  3W6G A;  4OFN A;  3GH6 A;  3GX0 A;  2DMM A;  4Z2R A;  3FZ4 A;  5F05 A;  1XIY A;  2A2R A;  1T4Y A;  3EUR A;  2ZNM A;  5BRT A;  1J08 A;  3UBK A;  3C1R A;  2P31 A;  3EWL A;  1OC8 A;  2WRT A;  3HCZ A;  2JSY A;  1ERT A;  2H19 A;  2RUF A;  4NXI A;  1ZYN A;  4PQH A;  1VF2 A;  5IOX A;  4IP1 A;  3CTF A;  2O8V B;  3OR5 A;  1FB0 A;  2FLS A;  1TJD A;  3LSZ A;  4F82 A;  2HI7 A;  1O7U A;  2JZT A;  1U3A A;  5KN3 A;  4V1A g;  3A2W A;  5IMF A;  1XW6 A;  5DCH A;  2WCI A;  4ZL7 A;  1FVK A;  2X8H A;  2M46 A;  2IMK A;  5ELG A;  2TRX A;  1YKA A;  1TW9 A;  5A4V A;  1E6B A;  2YJ7 A;  5AN1 A;  3ZTL A;  2CAI A;  1XWG A;  3TDG A;  3DEX A;  1UVZ A;  4I6X A;  1XWB A;  4DSQ A;  4GST A;  1Y6E A;  4POL A;  2LJA A;  2H1D A;  3GNJ A;  1XWC A;  1B9X C;  4NHW A;  2PWJ A;  3GTU A;  2FGX A;  1X9S B;  1A0F A;  1QK8 A;  2R2J A;  2PMT A;  2V32 A;  4MMM A;  3CXG A;  5IPH A;  3UIW A;  3G7Y A;  5D9V A;  3MIX A;  2WJU A;  1YEP A;  3M9J A;  2GVP A;  3D4T A;  2HNL A;  3GX8 A;  5B8B A;  3FK8 A;  2HYX A;  4CY8 A;  4PX1 A;  2B6M A;  3VK9 A;  5JCG A;  1JZO A;  2X99 A;  4WET A;  2H71 A;  3IK9 A;  2OAC A;  3ZZX A;  1F3B A;  4HEA 2;  3O6T A;  3LGC A;  4O92 A;  4K9Z A;  4GRF A;  3VLN A;  1XW9 A;  2VUP A;  2I9H A;  3IHQ A;  2M72 A;  3AY8 A;  4K7N A;  2DC5 A;  2DKI A;  4PNF A;  2R4V A;  3ISO A;  3RPP A;  1EV4 A;  2N5F A;  3IAS 2;  4GCI A;  4O5U A;  4NHZ A;  2C8U A;  2KP2 A;  2VL3 A;  4V2M A;  2NBS A;  1PQN A;  4XHM A;  3FW2 A;  2ES7 A;  2AAW A;  2PGT A;  4ZL9 A;  4G19 A;  4TR1 A;  5LNK e;  5LCZ A;  4Z2T A;  3P7X A;  3D5J A;  3TUE A;  1TK8 B;  3E3E A;  1Z9H A;  1GSE A;  3M0F A;  1MTC A;  4OFM A;  5DJM A;  1AQV A;  1C72 A;  5ECO B;  1MDI A;  2KUC A;  5DQS A;  2OKA A;  3F3R A;  2DLX A;  4QQ7 A;  2YAN A;  3DRN A;  1VGL A;  3C71 A;  2FWE A;  3EU4 A;  4GSN A;  5F07 A;  4TN8 A;  4HQZ A;  3ME7 A;  3QAV A;  5ECI B;  2LS5 A;  3L9S A;  3VWW A;  5ELA A;  2PER A;  4EO3 A;  3FR9 A;  1O8X A;  2IMI A;  4FIW A;  3VWV A;  4TXV A;  3HA9 A;  2C3T A;  5G5F A;  2XBQ A;  2LV3 A;  5LD0 A;  2GT5 A;  20GS A;  5DJL A;  17GS A;  2VLU A;  1SD8 A;  5EL8 A;  1U6T A;  3KP8 A;  1XCC A;  4K2X A;  2L6C A;  2CX4 A;  1T3B A;  2C3Q A;  3CTG A;  3TKS C;  1ZCP A;  3ZIT A;  1TRU A;  4ULX A;  4XIH A;  4XTS A;  4POB A;  1YF0 A;  2TRC P;  5H5R A;  2E0Q A;  2QKE A;  5EY6 A;  6GSW A;  1YQ1 A;  1M99 A;  4WF5 A;  4OO4 A;  3LOR A;  2YPM A;  4X1U A;  2B5X A;  3SWL A;  3IPZ A;  2IMF A;  2CVK A;  4MF7 A;  1V40 A;  2RUE A;  2JZR A;  3UBL A;  5KOW A;  3MNG A;  4BWS A;  1URM A;  2YNX A;  5G2Z A;  1SJZ A;  5DAK B;  5H5Q A;  1R5A A;  2IFQ A;  5ECN B;  1GSS A;  4MJE A;  1KNG A;  5HR0 A;  1OC9 B;  2QC7 A;  4GF0 A;  2PU9 C;  1I5G A;  1V9W A;  3DXB A;  1XVQ A;  4IS0 A;  3TKQ A;  3ZMK A;  3QD9 A;  3H93 A;  3IC4 A;  1F6M C;  1ERW A;  2EIO A;  2JAD A;  1HNA A;  2B1K A;  3QCP A;  1G7O A;  1PRX A;  2H74 A;  3QFA C;  2LQQ A;  4HI7 A;  3FZ5 A;  1U87 A;  3M3M A;  3TKS E;  2NDO A;  2X8C A;  2M80 A;  4QL7 A;  1RW1 A;  3KJY A;  4DSS A;  4DEJ A;  3KMN A;  1M9A A;  2J23 A;  2X4A A;  5H5S A;  4Q5N A;  5G5E A;  4K8M A;  3F4R A;  4RUV A;  3HDC A;  2IMD A;  2IWT A;  6GST A;  5J9C A;  2K8S A;  2I4A A;  3KTB A;  5IIZ A;  2YJH A;  3FYG A;  6GSX A;  4BVY A;  1OAZ A;  1X5C A;  2YWI A;  3DGQ A;  1JLV A;  2R37 A;  1FG4 A;  2ON7 A;  3CRU A;  2HE3 A;  2VO4 A;  5ECL B;  3GYK A;  3BD2 A;  3GL3 A;  2HZE B;  1TI1 A;  1OE7 A;  1FAA A;  1NHO A;  4J57 E;  3LQ7 A;  3A3T A;  1ZYE A;  5GST A;  2YV9 A;  2AHE A;  1TRW A;  2MYG A;  3IR4 A;  2FA8 A;  1ERU A;  4KGI A;  5G31 A;  2IIY A;  2FWF A;  5AIX A;  4HJ2 A;  4ZB9 A;  1EOG A;  3Q18 A;  2NVL A;  4GSS A;  1SL1 B;  3J7Y k;  3EE2 A;  2JZS A;  2VD1 A;  3WYW A;  5C00 A;  4BPY A;  2O89 A;  1ZL9 A;  2XHF A;  4Z7X A;  1Y25 A;  2G0F A;  5EVO A;  4HDE A;  5D9T A;  2LNS A;  2VCZ A;  1DUG A;  3D6I A;  2CV4 A;  2I3Y A;  2PBJ A;  2H6X A;  4AGS A;  3UEM A;  1JFU A;  2L57 A;  3G9B A;  5KN1 A;  4Q5R A;  3QR6 A;  5JWR B;  4MNN A;  1G6Y A;  1K0N A;  4KAE A;  4RI6 A;  3GV1 A;  3F4S A;  1ZOF A;  1LU4 A;  4EUY A;  4OD7 A;  1LBK A;  1ACV A;  5JCU A;  2IL3 A;  3H1N A;  1O85 A;  4ZXG A;  2WDU A;  4G0L A;  2A4H A;  4ECI A;  1SKS B;  4HU7 A;  4F0B A;  5CAX A;  4QL9 A;  3RBT A;  3ZIJ A;  6GSS A;  1WMJ A;  2YN1 A;  1KBN A;  4NPB A;  5FHI A;  3VUR A;  1K0O A;  3RAZ A;  3KGK A;  4XRD A;  3UVH A;  4CY6 A;  3VI5 A;  4POK A;  1SYX A;  4PNG A;  1X9W B;  4HOJ A;  1G7E A;  2IN3 A;  9GSS A;  1QGV A;  4G0I A;  5CRW A;  2H0H A;  4JBB A;  3P8W A;  2FNO A;  3WT1 A;  4V2N A;  3TJG A;  4IVF A;  2X64 A;  1T4Z A;  2I81 A;  2B7K A;  3GIX A;  4GLT A;  4HQS A;  1V58 A;  3ERG A;  3QMX A;  2H30 A;  3QOU A;  1K0A A;  4LL4 B;  4TR3 A;  4IJ3 A;  1O73 A;  4PUA A;  1X9M B;  1GSQ A;  5A4U A;  3TRX A;  3N5O A;  3ZFL A;  1WOU A;  3A2X A;  2XBI A;  4MZW A;  1ERV A;  4FYC A;  5DAL A;  3GA4 A;  4MP4 A;  5HR2 A;  3QFB C;  4PQI A;  4KDY A;  2YWO A;  3LG6 A;  4O32 A;  2YP6 A;  4KA0 A;  1PX6 A;  3KMO A;  1FB6 A;  1A8L A;  3N9J A;  2R0G A;  4PGT A;  5COH A;  4O7H A;  3C1S A;  1BYE A;  3FR6 A;  1XFL A;  1PGT A;  5GZZ B;  1QUW A;  2BJX A;  2VCV A;  4WBR D;  3A5I A;  3IA1 A;  3TKP A;  3Q6O A;  4KDU A;  2WFC A;  2V41 A;  1K0C A;  1X0R A;  5A4W A;  1DBY A;  2C0F A;  1AIU A;  1HYU A;  4FYB A;  4HUA A;  5BMU A;  2QA2 A;  2V1M A;  2H66 A;  1PD2 1;  4KB3 A;  2V6O A;  5ABR A;  3GUS A;  1YF1 A;  5ID2 A;  11GS A;  4X0X A;  1PKZ A;  5HFK A;  1Z3E A;  1IYI A;  2KP1 A;  2CX3 A;  2R6K A;  5IOW A;  3WGX A;  1CQH A;  1GSF A;  1DSB A;  2G2Q A;  4DVC A;  3G7I A;  1XOB A;  3GKX A;  1VF3 A;  1SK1 A;  1TTZ A;  2DIZ A;  1PL2 A;  5CRG A;  5AIS A;  1JLW A;  5IMV A;  1DE1 A;  3R2Q A;  2YCD A;  4ILF A;  3W8J A;  1S3D A;  3LYK A;  1GTA A;  4JR6 A;  2HT9 A;  5GSS A;  2CZ3 A;  3GH9 A;  3R3E A;  1EWX A;  2FWG A;  4MCU A;  4YQM A;  2B3S A;  2WZ9 A;  1M2B A;  4F0C A;  4Q5Q A;  1F37 A;  3QPM A;  3PPU A;  1V2A A;  2E7P A;  4KH7 A;  2MBS A;  1B9Y C;  4N11 A;  2H1B A;  2Z9S A;  5JCW A;  2X8G A;  4L0W A;  3GKM A;  2WUL A;  5J5N A;  4K7I A;  2DBC A;  5IMD A;  3APO A;  5IMZ A;  3HJM A;  3QAG A;  3KZQ A;  19GS A;  3LFL A;  4KSO A;  1S3C A;  3HY2 A;  4FQU A;  3IC8 A;  2GS3 A;  3LEF A;  3MSZ A;  3CMI A;  1U88 A;  1WRY A;  3WD6 A;  4POM A;  2PVO C;  4MPG A;  4YAV A;  3K8N A;  4XRA A;  3E0U A;  2EIQ A;  3EU3 A;  1K0M A;  3KH7 A;  5IO2 A;  10GS A;  1XVW A;  8GSS A;  2C0E A;  3RHB A;  1GLQ A;  2OBK A;  2P5Q A;  4IHU A;  3GTU B;  4MJA A;  4TRX A;  1AC1 A;  4V2L A;  4TXO A;  4BL7 A;  1TU8 A;  1FW1 A;  4XCS A;  2GGT A;  4EC0 A;  1CQG A;  2CT6 A;  2VLT A;  4IN0 A;  1T1V A;  2RLI A;  4MF5 A;  2X49 A;  1K3Y A;  3VWX A;  4OCF A;  2OE0 A;  2FA4 A;  3ERW A;  4BVX A;  4WR5 A;  4P3Y B;  2IJY A;  2LTK A;  1WJK A;  2AV4 A;  3TRP A;  1TK5 B;  1GTI A;  4GWR A;  2OJL A;  4MPF A;  5DCG A;  5ECM B;  3F6F A;  3BBY A;  4IJI A;  1R26 A;  3G7J A;  5ECS A;  1TK0 B;  4IEL A;  1O8W A;  1SJ6 A;  1OC3 A;  3FZ9 A;  1B4P A;  5J41 A;  4YAP A;  1WIK A;  1F2E A;  3GSS A;  1SK0 A;  4KE3 A;  3EMX A;  4TR1 B;  1GSY A;  1BED A;  2YOI A;  3FZA A;  5AGY A;  1ZGN A;  4NMU A;  1X5D A;  4ML6 A;  3ZVJ D;  4G0K A;  1OVN A;  3P2A A;  5DQY A;  3C7M A;  2K18 A;  2K8V A;  1AXD A;  2GDR A;  1QQ2 A;  4O5R A;  4USS A;  1PN0 A;  1NM3 A;  3WGE A;  5HQP A;  1M9B A;  3KTL A;  1TRV A;  3M9K A;  3PH9 A;  3FHK A;  3UVT A;  3LWA A;  1HNB A;  3UAP A;  4XS1 A;  4EDZ A;  2B5E A;  4TOP A;  4IW9 A;  7GSS A;  2VL9 A;  2IME A;  2KLX A;  1PX7 A;  5INY A;  1PMT A;  2VM1 A;  2L4Q A;  4GXZ A;  2F8A A;  3NOF A;  1XXU A;  1SJI A;  1BG5 A;  1XZO A;  1JZD A;  3DVW A;  3V1W A;  1Q98 A;  4D73 B;  3I43 A;  2ZCT A;  5FT3 A;  1QFN A;  4MDC A;  4RQR A;  4HU9 A;  1F3A A;  2CZ2 A;  4LMW A;  2F3M A;  1Z6N A;  4X4J A;  5ECP B;  1S3A A;  4OFT A;  3L9V A;  5E59 A;  4YQU A;  1U3I A;  4BA7 A;  2N5B A;  4PUF C;  2YZU A;  5HFG A;  4K5R A;  4WBJ A;  3GRX A;  4MH3 A;  2HZE A;  1GSD A;  2WGR A;  2IFQ B;  3TKR A;  1J9B A;  3CYN A;  1K0D A;  2H72 A;  4WF4 A;  1OKD A;  4JRR A;  3HZ8 A;  1R7H A;  1KEB A;  4KUN A;  1SK2 A;  5IO0 A;  1T8E B;  1GTU A;  2FUG 2;  4HS1 A;  1OE8 A;  5IPG A;  5J4U A;  1M7T A;  1E2Y A;  1W4V A;  1SYR A;  4ZBB A;  2H6Z A;  4YQV A;  5GAN D;  4IBP A;  2L5L A;  1WPI A;  1F9M A;  3BCK A;  3GST A;  4I2U A;  4YKF A;  2A4V A;  4DSS B;  3W8S A;  3FY7 A;  2RM6 A;  2K9F A;  4WR4 A;  4L0U A;  3F0I A;  3MDK A;  5J9B A;  3DKS A;  3D22 A;  2P0G A;  3H79 A;  2HSY A;  3HVX A;  3BCI A;  5IMC A;  1MDK A;  2QA1 A;  2J9H A;  1A23 A;  2OE3 A;  1AUC A;  3IBH A;  2PN8 A;  4BVY B;  1PKW A;  1EP8 A;  1EGR A;  5B6N A;  5KOX A;  3DML A;  1YEX A;  1O6J A;  2IPA A;  4ZB8 A;  1VF1 A;  2EC4 A;  4O5Q A;  3SBC A;  1J0F A;  2DJJ A;  3GL5 A;  4DSR A;  5ECR B;  1HQO A;  2DKH A;  2VIM A;  2GQL A;  5DDL A;  3DYR A;  5CRE A;  4G2E A;  2K6V A;  1THO A;  5IM9 A;  2H01 A;  2OAD A;  3GFK A;  2LEG A;  2VCX A;  4H86 A;  2XC2 A;  4KSM A;  3L78 A;  2MMZ A;  2VCW A;  1AQW A;  22GS A;  4K2D A;  1XOA A;  2I1U A;  3PR8 A;  1SL2 B;  2LQO A;  1SU9 A;  2VCT A;  2FCH A;  1R4W A;  1SKR B;  3GKK A;  5DBQ A;  3ME8 A;  1GWC A;  4NWY A;  5KN0 A;  3DVX A;  5DVB A;  3QDN A;  1XWK A;  2LUS A;  3FMW A;  1A0R P;  4OMV A;  1Z7P A;  2H1G A;  3BJ5 A;  3EPT A;  4CDO A;  1GRX A;  2VCQ A;  6GSV A;  1UC7 A;  4XS4 A;  1TRS A;  1USB A;  3TRQ A;  1YY7 A;  5F0G A;  3ZML A;  1T7P B;  4JE1 A;  3FRC A;  2L5O A;  3O3T A;  4LMV A;  4MZC A;  3WT2 A;  4MJC A;  3P90 A;  2LRT A;  3A5W A;  4ECJ A;  1SL0 B;  2E2G A;  1EGO A;  2R0P A;  4OCE A;  4WXT A;  4KND A;  1YZX A;  4IP6 A;  2LRC A;  4A5P A;  1MEK A;  1EEJ A;  3E9J B;  5CO3 A;  3D21 A;  1ILO A;  2B7J A;  3RDW A;  3IHG A;  2JAC A;  2V2G A;  2BMX A;  1Z5Y E;  1SKW B;  3CSI A;  4WEY A;  1TDI A;  5ECH B;  3TGZ A;  4KX4 A;  3VPT A;  4ZIJ A;  4MA9 A;  2VAF A;  4EE0 A;  2BTO T;  3GN3 A;  3KM6 A;  4RI7 A;  3TOU A;  2P5R A;  1GNE A;  4N30 A;  5CRH A;  1TI3 A;  2H73 A;  1EOH A;  3HHV A;  5G1K A;  1GSU A;  2C1Y A;  3LJR A;  5D9X A;  3HVV A;  3NIV A;  1TXX A;  1SD9 A;  1GUH A;  2MBT A;  1NW2 A;  3H8Q A;  2PUK C;  3S9F A;  1XPV A;  2JSZ A;  1NHY A;  4HZ2 A;  2HSM A;  2DJ0 A;  4EF0 A;  2GST A;  3M1G A;  2TIR A;  1SEN A;  2UZ8 A;  6GSU A;  1GTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...