1X5EA

The solution structure of the thioredoxin-like domain of human thioredoxin-related transmembrane protein
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
126
structure length
126
Chain Sequence
GSSGSSGNVRVITDENWRELLEGDWMIEFYAPWCPACQNLQPEWESFAEWGEDLEVNIAKVDVTEQPGLSGRFIINALPTIYHCKDGEFRRYQGPRTKKDFINFISDKEWKSIEPVSSWFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Thioredoxin domain containing protein 1
publication title The solution structure of the thioredoxin-like domain of human Thioredoxin-related transmembrane protein
rcsb
source organism Homo sapiens
total genus 21
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2005-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1x5eA01
3QR6A 4NAXA 1GSQA 1U3IA 1M99A 1GSUA 2CX3A 3FR6A 1XIYA 3F8UA 1SK1A 2WCIA 4XHMA 2GQMA 3C71A 5D9TA 2IN3A 2N5FA 5B6NA 3FW2A 2WRTA 1F3AA 2XBIA 2VCWA 1FAAA 1GTUA 5H5QA 3ZFLA 4OD7A 6GSYA 2GS3A 5JCGA 4K7NA 5JWQB 2HXKA 3FKFA 1A2MA 2PVOC 4RQRA 4L5OA 3IRAA 1NM3A 4F2IA 1XOBA 1JFUA 1S3DA 5ID2B 2VAFA 2JZTA 2YP6A 5G1KA 4EUYA 1ZYEA 1GLPA 3FK8A 3HJOA 3F9UA 1QQ2A 4D73B 4HJMA 1PA3A 1Z6MA 2FA4A 5ECKB 2YWOA 2OJLA 3GKNA 1G7EA 1Q98A 4JBBA 1X9WB 4O32A 1V58A 1PGTA 3P2AA 5ECNB 3KP8A 4MP4A 3DIEA 5IOXA 3HZ4A 2HZEB 1C72A 4BL7A 3R2QA 4CHSA 4GXZA 3IE3A 2DIYA 1DBYA 4TXVA 4LL4B 4RI7A 3GV1A 1SJ6A 3RDWA 4FYBA 4ECIA 2I81A 1WJKA 3SWLA 3A2VA 2FWHA 3APSA 3O76A 5CAXA 3VWVA 4N0ZA 3VWWA 2GLRA 3WYWA 1B48A 3LWAA 1BYEA 4DVCA 5EL8A 2WDUA 1GWCA 1TU8A 5ELAA 1MD4A 5GSTA 3GN3A 2LQQA 4IQ1A 4WF4A 4MZCA 1PD21 19GSA 5KN3A 4TR0A 5IOWA 5J4UA 1YF0A 2VL2A 3D6IA 4DSSA 1V98A 5G30A 4MPGA 3QOUA 3ZIJA 5KN0A 1SD9A 2C8UA 2IMKA 3CTGA 1EWXA 3IOSA 2L4CA 4TRXA 5DVBA 4MK3A 2YWMA 4XS6A 3PGTA 2JZSA 5J41A 17GSA 2HFDA 4EDZA 5ABRA 1V9WA 4HUAA 2YV7A 1IYHA 4G2EA 1Q4JA 2D2ZA 1TI1A 2FD3A 1GL8A 1GUKA 3N9JA 1VF1A 1G7OA 4RI6A 2R3XA 1PKWA 1FVKA 4F0BA 1ZL9A 2LS5A 4POBA 4HI7A 2LV3A 5KN2A 4I8BA 3HDCA 2ON7A 2IJYA 3EWLA 5CO3A 3ZITA 2RUFA 1SL1B 3IC4A 3G9BA 2EIRA 5IMAA 2HLSA 2RUEA 3RHCA 8GSSA 4BA7A 1YKAA 3PINA 1T1VA 4HU9A 1K3YA 2K6VA 2B5YA 4DSSB 3GTUB 2H75A 1O8XA 2AHEA 4KDYA 5CRGA 4IN0A 1VF3A 3O6TA 3C73A 1FHEA 1JZDA 3TKSE 2E0QA 1AIUA 1TK0B 1K0BA 1W89A 4GSSA 3K8NA 1GLQA 1Z7PA 3VPTA 3G7YA 2GT5A 2IL3A 4G10A 5IMFA 2C80A 3TOTA 2RM6A 3VI5A 4ZBDA 5A4WA 2WJUA 4AJ6A 4OWYA 1OC3A 2YZUA 3D4TA 5DCHA 3ZREA 1E6BA 2WULA 3ZRDA 4ACSA 2NPBA 5CRWA 1WPIA 5FT3A 4FYCA 4ZIJA 1H4OA 3TJGA 2VM1A 4WETA 1VF4A 4DEJA 3CSHA 3TKPA 5G31A 1TJDA 5DBQA 2CZ2A 4QL9A 4I6XA 4AJ7A 3UBLA 3WGDA 2FUG2 3MWHA 2C0DA 3QMXA 2B6MA 1QK8A 4Q5NA 3BOAA 4O92A 2YZHA 3FRCA 2BMXA 2LNSA 1YEPA 1EOGA 1EOHA 4MF7A 2ZUPA 5JCUA 3ZIVA 2E2GA 4IJIA 5F8BA 1GSEA 2YCDA 4BVXA 1Z3EA 4GWRA 2CA8A 1V2AA 2F3MA 3DD3A 3HY2A 3NZNA 5DJLA 2OA7A 4PQ1A 4ZB6A 2V6OA 1M0UA 3GKXA 2HT9A 4GTUA 3VWXA 2H6YA 2NTOA 5DQYA 1HNAA 3FZ5A 1SYRA 1OE8A 5HR0A 2PMTA 1GP1A 2X8HA 1YZXA 1CQHA 3C8EA 2JACA 1TKDB 3L9UA 3UMAA 5ECSA 1FG4A 2VLVA 2CVDA 1B8XA 4X1UA 3UEMA 3LXZA 1G0TA 3H4KA 2AAWA 1SKSB 1ON4A 3MSZA 2C1YA 4IW9A 2AB6A 4ZXGA 2H1DA 5AIVA 2RLIA 1ZCPA 2XBQA 1F6MC 3U5RE 3HCZA 3UBKA 4JRRA 2WFCA 4PXOA 1FB0A 2MMNA 3M0FA 2JU5A 2H73A 1K0MA 1PRXA 2VL2C 4POKA 5ECOB 3RPNA 1TP9A 1PL1A 4IP1A 1QMVA 1A0RP 4MH2A 1ST9A 2B5EA 4GQCA 5IIZA 4NV2A 4ZBAA 4NV5A 1OVNA 5D9XA 4KE3A 1VF2A 1ZGNA 3TKQA 4F9ZA 2WGRA 5ECQB 4Z7XA 3LXTA 3VFIA 1PL2A 2VLUA 3C1SA 4EVMA 2A2SA 2HYXA 1Z9HA 1RW1A 2H6ZA 2KUCA 1AXDA 3LYKA 1Y6EA 4ECJA 3E0UA 3IK9A 3GFKA 2GSRA 2PERA 1HNBA 1FB6A 4IGJA 2X8CA 3KH9A 1X0RA 1GUHA 2H74A 1MD3A 4HDEA 1XW6A 4OO4A 2V2GA 2OE3A 1BEDA 3HXSA 2DJ1A 1JLWA 3HA9A 3NOFA 3I9V2 3ZZXA 4AGSA 2AUVA 2K18A 2DJ3A 2C4JA 2NBSA 3M9KA 2CT6A 4IVFA 1WRYA 1ACVA 3KXOA 3UOMA 4KW6A 3ZLPA 4GF0A 4IQAA 4KAEA 2P5RA 3GX8A 16GSA 2IFQA 3RBTA 3FR9A 4GSTA 3BBYA 3PR8A 5GSSA 2PN8A 1TXXA 4OFMA 1X5CA 2GQLA 1THOA 3FZ9A 3UIWA 2DJ2A 3F4SA 4L5LA 4ZB8A 1WE0A 1TRSA 5INYA 4Q5QA 1OKDA 2VCTA 2JSZA 3MDKA 3QAVA 2C0FA 3TRXA 4TXOA 3GSSA 1YKCA 1FVJA 1TW9A 2YN1A 2ALBA 2X64A 1GNEA 2R2JA 4PGTA 3M1GA 1J0FA 4WKWA 3TOUA 4KCAA 1H75A 3H79A 5IPHA 5GZZB 2YJ7A 1K0DA 2ZNMA 3DXBA 1UC7A 2H19A 1EP7A 2HSYA 2WZ9A 2P5QA 1ABAA 4NHZA 1A2JA 3L0HA 1GTBA 2MMZA 4MCUA 2VM2A 3QFAC 4K2DA 3TCOA 1XZOA 1F37A 3IAM2 4KDUA 1NSWA 4EO3A 1EEJA 1HNCA 1A8YA 4FYUA 3Q6OA 3GKMA 3BCIA 4KCEA 1K3OA 4IS0A 1I9DA 3CMIA 4J2FA 3F6DA 1GH2A 1BJXA 5IMVA 1BX9A 1GSDA 2DIZA 3EU3A 5HR2A 3IK7A 5HFIA 1SKWB 1PSQA 2M46A 3P8WA 2K8VA 4L0WA 1KBNA 3GL5A 1GUMA 1WMJA 4ISDA 5G2ZA 4QQ7A 5IO0A 1YJ6A 4PNGA 3GH6A 2B1KA 4TXOB 2X8GA 4YQVA 4YH2A 3KJYA 2C3TA 1SL0B 6GSVA 2VO4A 3HYPA 3TDGA 2YANA 2KLXA 1AQWA 5CYYA 5ECMB 1OC9A 1WP0A 4K7OA 4MJEA 2YV9A 4YQMA 1XVQA 2DBCA 4ZL7A 1O7UA 4XS1A 1HD2A 5DAKA 3F4RA 2YPMA 4O7HA 2VCZA 2L5LA 2AJQB 3LYPA 2V41A 1ILOA 3C7MA 5F0GA 2PUKC 1NW2A 1Z7RA 2RM5A 2OACA 2ZCTA 3JCML 1Z5YE 1R5PA 3F0IA 4IBPA 2V6KA 3H1NA 1M7TA 1XPVA 3IXRA 2B3SA 3FY7A 3KGKA 5ECRB 2MMOA 3A2WA 3E3EA 4TR4A 1T3BA 3UL3A 1X9MB 3UAPA 3H8QA 2YOIA 4LMVA 2LEGA 2L4QA 5JWRB 3J7Yb 4KSOA 1T4ZA 3IBHA 1JLVA 2O89A 2OBKA 2GSSA 1J9BA 2WB9A 1JZWA 1ML6A 4N10A 5ENUA 4EXJA 3F6FA 2O7KA 3APQA 1BQ7A 3PH9A 3IAS2 3F4TA 2L59A 1QGVA 3VURA 3GYKA 3LQ7A 3DRNA 1USBA 4HS1A 2TRXA 4JE1A 1XCCA 4TR1A 14GSA 5DAKB 1M2DA 4HEA2 2GZYA 3HD5A 3CXGA 1U6TA 1YQ1A 3ZYWA 3GH9A 2LJAA 4K9ZA 1F2EA 5J9BA 1E2YA 2VCQA 5B8BA 5CREA 2R5GA 5A4VA 4EKZA 2CVKA 4V2LA 1EP8A 4KNDA 4NPBA 1FO5A 4H86A 1K0OA 4GLTA 3HZ8A 4WBRD 1M2AA 1QFNA 5HFKA 5IO2A 2LUSA 1B9YC 2I9HA 1TK8B 4LL1B 1CQGA 3HHVA 1T4YA 2FA8A 3HVXA 5KEJA 3EINA 2F9SA 1TDIA 4XTSA 1F9MA 2HSHA 5EY6A 3S9FA 5B7CA 2EIOA 4HU7A 3ERGA 2DMLA 9GSSA 2YNXA 3EE2A 1XVWA 1G6WA 3UVTA 3BCKA 5DCGA 1O6JA 3L4NA 1M9BA 4F0CA 3ZFBA 4IHUA 1BAYA 2GTUA 4RQXA 2REMA 1B4PA 3L9SA 5LCZA 1OE7A 3FHKA 4N0VA 2HZFA 2H8LA 5J5NA 2LJKA 5D73A 1DSBA 4G19A 4F03A 2IPAA 1O73A 4E8EA 5GAPD 3TKRA 1O8WA 2H70A 2EC4A 2IWTA 2KOKA 2FGXA 4ECCA 4ZL9A 4MDCA 3KMOA 10GSA 1GRXA 2I4AA 5EPFA 3TUEA 1AQXA 2O85A 1J08A 3W8JA 2EIQA 2GZZA 5A5KA 5F06A 4OFTA 3W8SA 3GMFA 5E4WA 2PU9C 2H0GA 1GULA 1GSSA 4WR5A 6GSTA 4V1Ag 3GIXA 3ZL5A 1T7PB 4XS4A 1SU9A 4JZQA 3DYRA 4TKYA 3EYTA 4ID0A 2IIYA 7GSSA 3CSIA 5DDLA 2R6KA 1U87A 3EU4A 4MJBA 2R37A 4MA9A 4KB3A 2E7PA 3ME7A 4HQZA 2XPEA 1SENA 4ULXA 5LD0A 4IP6A 2PGTA 3GA4A 3DVXA 1T8EB 1V40A 1N8JA 3M9JA 2Z9SA 1QXHA 3IA1A 3OR5A 3ZTLA 2H01A 3BJ5A 4K8MA 1ERUA 5B8AA 5CRDA 3TGZA 2LQOA 1S3AA 4P3YB 2DJJA 2LKUA 3US3A 4ECBA 4EC0A 2CX4A 6GSSA 3KD0A 4TN8A 2HRNA 3TRQA 1UN2A 1N2AA 2GQKA 1AUCA 3TRPA 4ZB9A 4GCIA 2VCVA 2L5OA 5HR1A 3FR3A 1R26A 3UVHA 3HJMA 2K9FA 3KMNA 1EZKA 2VLTA 4NXIA 3CRUA 1A24A 3F3RA 4KGIA 2H30A 4WEYA 5D96A 1MDIA 3VWUA 1OKTA 3A5WA 4FH8A 1Y25A 1SJZA 4KSMA 3RHBA 5DALA 1AAZA 2J9HA 4XS4B 5HFGA 2C3NA 2KP1A 4TR3A 4AJ8A 2F8FA 3LGCA 4K0GA 1U3AA 4MJCA 2BJXA 4NWYA 5G5FA 4I97A 4FO5A 13GSA 1O81A 5IMCA 3DKSA 5J9CA 4L8EA 1WOUA 4POMA 1A2LA 3APOA 5AGYA 2BTOT 3ED3A 4OCEA 4ZL8A 4KX4A 2H66A 5FWGA 3BD2A 2FY6A 3I6AA 1SK2A 1OYJA 1SJIA 3D4MA 3EVIA 4JU5A 2L6CA 4IKHA 4HZ2A 5ID2A 3A2XA 1MTCA 2B7KA 1A0FA 4OFNA 1TI3A 2FHEA 4D73A 2H71A 3LSZA 1B4QA 1G6YA 2YWIA 3IPZA 3VK9A 5G1LA 5ECHB 5FHIA 2CVBA 4TVEA 1EGRA 3FZAA 1XW5A 3VLNA 2GVPA 1SKRB 2HZEA 5F07A 5AIXA 2FNOA 2IMIA 1ZYQB 2P31A 2WS2A 5DALB 1X5DA 5JWOB 2LSTA 2A4VA 1LBKA 5GAND 3CYNA 1ERWA 2VUPA 3D21A 2HE3A 4WBJA 4HJ2A 3LORA 2HRFA 2X99A 3KP9A 4I2UA 4E8HA 5JCWA 5C04A 3VPQA 1RQMA 2GSQA 2P0GA 2G2QA 3TB2A 3MAKA 4MF6A 2QSIA 3TJBA 3EC3A 2L6DA 2LRNA 4HOJA 11GSA 1JHBA 4GRFA 2VCXA 1TRVA 2NVLA 3CSJA 2VOCA 2O8VB 2VL3A 3G7JA 2NDOA 2KHPA 3KTBA 3LEFA 4HQSA 4F82A 3KEBA 2IFQB 4MPFA 2FLSA 4KDXA 2I1UA 1K0AA 2J23A 2F51A 2B5XA 2OBIA 1EEMA 1PX6A 2AYTA 20GSA 12GSA 2N5BA 4BWQA 2KP2A 5CRHA 3DWVA 2PBJA 2DC5A 2H6XA 3A3TA 3IHQA 1GSFA 2I3YA 1X5EA 1TOFA 2V1MA 1XWAA 3QDNA 3GURA 3DVWA 4K0NA 4MJAA 3TJKA 2IMEA 3EMXA 1XOAA 4ML1A 5DQSA 3DMLA 1YDKA 1S3CA 2H1GA 1K3LA 1QUWA 1R7HA 5HQPA 4N30A 3QFBC 4I2TA 4RUVA 3E9JB 3KH7A 4YAPA 2GZPA 3KZQA 1EGOA 4PQIA 2QKEA 2VD1A 2M80A 3GL3A 4EF0A 4PQHA 2XHFA 2V32A 5AN1A 3W6GA 3GTUA 2JADA 5ECPB 5COHA 2VL9A 5E59A 4LMWA 3TKSA 2QGVA 1VRSD 4J57E 3Q74A 3GKKA 4LA1A 4X43A 2MYGA 2O87A 2CV4A 2FCHA 5B6MA 1GNWA 4OCFA 2JL4A 3D5JA 3G7IA 4I5QA 4MABA 1MEKA 2DJKA 2HNLA 3IDVA 1PN9A 3FZ4A 3KCMA 2TRCP 3J7Yk 3I43A 2YWNA 4MF5A 2IMDA 3N5OA 1R5AA 2L57A 4XRDA 4XRAA 2H1BA 1AC1A 1OC9B 1SYXA 4G9HA 2C3QA 5IM9A 1RK4A 3GSTA 1AQVA 1K0NA 1U88A 4Q5FA 1OC8A 4EDYA 4KH7A 1GSYA 5G5EA 4GQFA 4ILFA 3QAWA 1M9AA 1ZMAA 4BPYA 2PPTA 1TTZA 1URMA 1YF1A 4V1Ap 4QL7A 1V57A 1GTIA 3L78A 2H0HA 1EV9A 3V1WA 2A2RA 1PMTA 4IJ3A 3GUSA 2GDRA 2CAQA 2DMMA 6GSWA 4PURA 1A8LA 3GNJA 3FYGA 1PKZA 22GSA 3DEXA 4ZILA 2JSYA 1KNGA 4V2NA 2CZ3A 2XPDA 2LJRA 3WT1A 4MH3A 1W4VA 2PWJA 2PVQA 5F05A 4PX1A 2JZRA 4OMVA 4KUNA 1X9SB 1I5GA 2H76A 2N5AA 1PQNA 5ECIB 5ELGA 4FIWA 5IMZA 4PUAA 5LNKe 3IR4A 4BVYA 2OE0A 4X0XA 2ON5A 4MLYA 1THXA 3QAGA 5D8IA 2XC2A 3HJPA 1NHYA 2B7JA 4EE0A 1YY7A 3D0ZA 1VGLA 2OKAA 1LU4A 2YJHA 2VIMA 3RAZA 4TW5A 1A23A 4TR1B 2H0IA 1YEXA 3ZMLA 6GSXA 4POLA 1XWCA 5AISA 3HVVA 2F8AA 6GSUA 1TK5B 4AF2A 3WT2A 1DE1A 3M3MA 4JR6A 2C0EA 2GSTA 4WF5A 1GTAA 2HI7A 3Q18A 2FWFA 2DJ0A 3O3TA 4J56E 4PUFC 3D22A 3AY8A 2LRCA 3GRXA 1HYUA 3ME8A 1KEBA 3WD6A 3FEUA 3WGXA 3QPMA 5L71A 4CW9A 4MZWA 2C0GA 1F3BA 1SL2B 3ZVJA 3QD9A 4MZBA 4JR4A 2MBTA 2MZCA 1SK0A 4KA0A 1NHOA 2H1AA 2QC7A 3KM6A 5D9WA 3ZMKA 1ERVA 1DE2A 3DGQA 4XCSA 1R4WA 5A4UA 2LTKA 4ML6A 1M2BA 3TJFA 2DSAA 3P90A 2OADA 4PNFA 5C00A 4V2MA 2MBSA 5KN1A 2LRTA 4TOPA 4NMUA 4DSRA 4GSNA 3UJ1A 4O5RA 3C1RA 4IELA 5D93A 3I69A 1ZOFA 5H5RA 4EL1A 3IV4A 1LJRA 3EURA 3LJRA 1O85A 2CQ9A 2MMAA 4K1FA 2VD0A 5CP1A 1WIKA 3QCPA 3GHAA 1ERTA 2E2MA 18GSA 3KTLA 3TJJA 4DSQA 2M72A 4K7IA 2ES7A 1SD8A 3H93A 1TRUA 1OAZA 2GT6A 3HVSA 5H5SA 2GGTA 1JZOA 1XWBA 1ZZYA 4YQUA 3ZVJD 1IYIA 1UA5A 1BG5A 4BWSA 5J3RA 2K8SA 3GX0A 5EVOA 2FWEA 5IMDA 2LNTA 3CTFA 1AW9A 1XBSA 1B9XC 3LFLA 3NIVA 2RIIA 3TKSC 4Q5RA 1WWJA 3WGEA 3M8NA 1Z6NA 1T00A 3F63A 3LG6A 1JZRA 3HKRA 2FWGA 1PX7A 4CDOA 4YAVA 3VI7A 1DUGA 3ERFA 1MDKA 4OO5A 1XWKA 4XIHA 2IMFA 3MNGA 4K6XA 1FW1A 3UARA 5IQYA 1K0CA 3CBUA 3U6VA 2TIRA 3RPPA 4NHWA 1EV4A 5HR3A 2R4VA 1HQOA 3EMPA 3Q19A 2B1LA 1XWGA 5CNWA 3CRTA 3ISOA 4MMMA 1XW9A 2OE1A 5IPGA 4WR4A 2H72A 1UVZA 4HZ4A 4JEDA 3KIJA 3SBCA 2G0FA 3P7XA 4L0UA 5ECLB 1MDJA 2DLXA 3L9VA 4LLRA 3ERWA 2AV4A 2CAIA 1XXUA 5DJMA 4N11A 1KTEA 3F3QA 1TRWA 4WXTA 1XFLA 1FOVA 5D9VA 4ZBBA 1TU7A
chains in the Genus database with same CATH superfamily
3QR6A 4NAXA 1GSQA 1U3IA 1M99A 1GSUA 2CX3A 3FR6A 1XIYA 3F8UA 1SK1A 2WCIA 4XHMA 2GQMA 3C71A 5D9TA 2IN3A 2N5FA 5B6NA 3FW2A 2WRTA 1F3AA 2XBIA 2VCWA 1FAAA 1GTUA 5H5QA 3ZFLA 4OD7A 1PFOA 6GSYA 2GS3A 5JCGA 4K7NA 5JWQB 2HXKA 3FKFA 1A2MA 2PVOC 4RQRA 4L5OA 3IRAA 1NM3A 4F2IA 1XOBA 1JFUA 1S3DA 1ZYNA 5ID2B 2VAFA 2JZTA 2YP6A 5G1KA 4EUYA 1ZYEA 1GLPA 3FK8A 3HJOA 3F9UA 1QQ2A 4D73B 4HJMA 1PA3A 1Z6MA 2FA4A 5ECKB 2YWOA 2OJLA 3GKNA 1G7EA 1Q98A 4JBBA 1X9WB 4O32A 1V58A 1PGTA 3P2AA 5ECNB 3KP8A 4MP4A 3DIEA 5IOXA 3HZ4A 2HZEB 3CQFA 1C72A 4BL7A 3R2QA 4CHSA 4GXZA 3IE3A 2DIYA 1DBYA 4TXVA 4PTSA 4LL4B 4RI7A 3GV1A 1SJ6A 3RDWA 4FYBA 4G0IA 4ECIA 2I81A 1WJKA 3SWLA 3A2VA 2FWHA 3APSA 3O76A 5CAXA 3VWVA 4N0ZA 3VWWA 2GLRA 3WYWA 1B48A 3LWAA 1BYEA 4DVCA 5EL8A 2WDUA 1GWCA 1TU8A 5ELAA 1MD4A 5GSTA 1PN0A 3GN3A 2LQQA 4IQ1A 4WF4A 4MZCA 2DKHA 1PD21 19GSA 5KN3A 4TR0A 5IOWA 5J4UA 1YF0A 2VL2A 3D6IA 4DSSA 1V98A 5G30A 4MPGA 3QOUA 2QA1A 3ZIJA 5KN0A 4Z2UA 1SD9A 2C8UA 4O5QA 2IMKA 3CTGA 1EWXA 3IOSA 2L4CA 4TRXA 5DVBA 4MK3A 2YWMA 4XS6A 3PGTA 2JZSA 5J41A 17GSA 2HFDA 4EDZA 5ABRA 1V9WA 4HUAA 2YV7A 4KF9A 1IYHA 4G2EA 1Q4JA 4BL7B 2D2ZA 1TI1A 2FD3A 1GL8A 1GUKA 3N9JA 1VF1A 1G7OA 4RI6A 2R3XA 1PKWA 1FVKA 4F0BA 1ZL9A 2LS5A 4POBA 4HI7A 2LV3A 5KN2A 4I8BA 3HDCA 2ON7A 2IJYA 3EWLA 5CO3A 3ZITA 2RUFA 1SL1B 3IC4A 3G9BA 2EIRA 5IMAA 2HLSA 2RUEA 3RHCA 8GSSA 4BA7A 1YKAA 3PINA 1T1VA 4HU9A 1K3YA 2K6VA 2B5YA 4DSSB 3GTUB 4HSCX 2H75A 1M3JA 1O8XA 2AHEA 4KDYA 5CRGA 4IN0A 1VF3A 4ICYA 3O6TA 3C73A 1FHEA 1JZDA 3TKSE 2E0QA 1AIUA 1TK0B 1K0BA 1W89A 4GSSA 3K8NA 2A2PA 1GLQA 1Z7PA 3VPTA 3G7YA 2GT5A 2IL3A 4G10A 5IMFA 2C80A 3TOTA 2RM6A 3VI5A 4ZBDA 5A4WA 2WJUA 4AJ6A 4OWYA 1OC3A 2YZUA 3D4TA 5DCHA 3ZREA 1E6BA 2WULA 3ZRDA 4ACSA 2NPBA 5CRWA 1WPIA 5FT3A 4FYCA 4ZIJA 1H4OA 3TJGA 2VM1A 4WETA 1VF4A 4DEJA 3CSHA 3TKPA 5G31A 1TJDA 5DBQA 2CZ2A 4QL9A 4I6XA 4AJ7A 3UBLA 3WGDA 2FUG2 3MWHA 2C0DA 3QMXA 2B6MA 1QK8A 4Q5NA 3BOAA 4O92A 2YZHA 3FRCA 2BMXA 2LNSA 1YEPA 1EOGA 1EOHA 4MF7A 2ZUPA 5JCUA 3ZIVA 2E2GA 4IJIA 5F8BA 1GSEA 2YCDA 4BVXA 1Z3EA 4GWRA 2CA8A 1V2AA 2F3MA 3DD3A 3HY2A 3NZNA 5DJLA 2OA7A 4PQ1A 4ZB6A 2V6OA 1M0UA 3GKXA 2HT9A 4GTUA 3VWXA 2H6YA 2NTOA 5DQYA 1HNAA 3FZ5A 1SYRA 1OE8A 5HR0A 2PMTA 1GP1A 2X8HA 1YZXA 1CQHA 3C8EA 2JACA 1TKDB 3L9UA 3UMAA 5ECSA 1FG4A 2VLVA 2CVDA 1B8XA 4X1UA 3UEMA 3LXZA 1G0TA 3H4KA 2AAWA 1SKSB 1ON4A 3MSZA 2C1YA 4IW9A 2AB6A 4ZXGA 2H1DA 5AIVA 2RLIA 1ZCPA 2XBQA 1F6MC 3U5RE 3HCZA 3UBKA 4JRRA 2WFCA 4PXOA 1FB0A 2MMNA 3M0FA 2JU5A 2H73A 1K0MA 2HRKA 1PRXA 2VL2C 4POKA 5ECOB 3RPNA 1TP9A 1PL1A 4IP1A 1QMVA 5BRTA 1A0RP 4MH2A 1ST9A 2B5EA 4GQCA 5IIZA 3HVNA 4NV2A 4ZBAA 4NV5A 1OVNA 5D9XA 2X49A 4KE3A 1VF2A 1ZGNA 3TKQA 4F9ZA 2WGRA 5ECQB 4Z7XA 3LXTA 3VFIA 1PL2A 2VLUA 3C1SA 4EVMA 2A2SA 2HYXA 1Z9HA 1RW1A 2H6ZA 2KUCA 1AXDA 3LYKA 1Y6EA 4ECJA 3E0UA 3IK9A 3GFKA 2GSRA 2PERA 3IC8A 1HNBA 1FB6A 4IGJA 2X8CA 3KH9A 1X0RA 3MYDA 1GUHA 2H74A 1MD3A 4HDEA 1XW6A 4OO4A 2V2GA 2OE3A 1BEDA 3HXSA 2DJ1A 1JLWA 3HA9A 3NOFA 3I9V2 3ZZXA 4AGSA 2AUVA 2K18A 5BMUA 2DJ3A 2C4JA 2NBSA 3M9KA 3MIXA 2CT6A 4IVFA 1WRYA 1ACVA 3KXOA 3UOMA 4KW6A 3ZLPA 4GF0A 4IQAA 4KAEA 4A5PA 2P5RA 3GX8A 16GSA 2IFQA 3RBTA 3FR9A 4GSTA 3BBYA 3PR8A 5GSSA 2PN8A 1TXXA 4OFMA 1X5CA 2GQLA 1THOA 3FZ9A 3UIWA 2DJ2A 3F4SA 4L5LA 4ZB8A 1WE0A 1TRSA 5INYA 4Q5QA 1OKDA 2VCTA 2JSZA 3MDKA 3QAVA 2C0FA 3TRXA 4TXOA 3GSSA 1YKCA 1FVJA 1TW9A 2YN1A 2ALBA 2X64A 1GNEA 2R2JA 4PGTA 3M1GA 1J0FA 4WKWA 3TOUA 4KCAA 1H75A 3H79A 5IPHA 5GZZB 2YJ7A 1K0DA 2ZNMA 3DXBA 1UC7A 2H19A 1EP7A 2HSYA 2WZ9A 2P5QA 1ABAA 4NHZA 1A2JA 4YKGA 3L0HA 1GTBA 2MMZA 4MCUA 2VM2A 3QFAC 4K2DA 3TCOA 1XZOA 1F37A 3IAM2 4KDUA 1NSWA 4EO3A 1EEJA 1HNCA 1A8YA 4FYUA 3Q6OA 3GKMA 3BCIA 4KCEA 1K3OA 4IS0A 1I9DA 3CMIA 4J2FA 3F6DA 1GH2A 1BJXA 5IMVA 1BX9A 1GSDA 2DIZA 3EU3A 5HR2A 3IK7A 5HFIA 1SKWB 1PSQA 2M46A 3P8WA 2K8VA 4L0WA 1KBNA 3GL5A 1GUMA 1WMJA 4ISDA 5G2ZA 4QQ7A 5IO0A 1YJ6A 4PNGA 3GH6A 2B1KA 4TXOB 2X8GA 4YQVA 4YH2A 3KJYA 2C3TA 3R3EA 1SL0B 6GSVA 2VO4A 3HYPA 3TDGA 2YANA 2KLXA 1AQWA 5CYYA 5ECMB 1OC9A 1WP0A 4K7OA 4MJEA 2YV9A 4YQMA 1XVQA 2DBCA 4ZL7A 1O7UA 4XS1A 1HD2A 5DAKA 3F4RA 2YPMA 4O7HA 2VCZA 2L5LA 2AJQB 3LYPA 2V41A 1ILOA 3C7MA 5F0GA 3A5IA 2PUKC 1NW2A 1Z7RA 2RM5A 4K2XA 2OACA 2ZCTA 3JCML 1Z5YE 1R5PA 3F0IA 3IHGA 4IBPA 2V6KA 3H1NA 1M7TA 1ZYPA 1XPVA 3IXRA 2B3SA 3FY7A 3KGKA 5ECRB 2MMOA 3A2WA 3E3EA 4TR4A 1T3BA 3UL3A 1X9MB 3UAPA 3H8QA 2YOIA 4LMVA 2LEGA 2L4QA 5JWRB 3J7Yb 4KSOA 1T4ZA 3IBHA 1JLVA 2O89A 2OBKA 2GSSA 1J9BA 2WB9A 2R0CA 1JZWA 1ML6A 4N10A 5ENUA 4EXJA 3F6FA 4K5RA 2O7KA 4CY6A 3APQA 4EIPA 1BQ7A 3PH9A 3IAS2 3F4TA 2L59A 1QGVA 3VURA 3GYKA 3LQ7A 3DRNA 1USBA 4HS1A 2TRXA 4JE1A 1XCCA 4TR1A 14GSA 5DAKB 1M2DA 4HEA2 2GZYA 3HD5A 3CXGA 1U6TA 1YQ1A 3ZYWA 3GH9A 2LJAA 4K9ZA 1F2EA 5J9BA 1E2YA 2VCQA 5B8BA 5CREA 2R5GA 5A4VA 4EKZA 2CVKA 4V2LA 1EP8A 4KNDA 4NPBA 1FO5A 4H86A 1K0OA 4GLTA 3HZ8A 4WBRD 1M2AA 1QFNA 5HFKA 5IO2A 2LUSA 1B9YC 2I9HA 1TK8B 4LL1B 1CQGA 3HHVA 1T4YA 2FA8A 3HVXA 4X4JA 5KEJA 3EINA 2F9SA 1TDIA 4XTSA 1F9MA 2HSHA 5EY6A 1M3IA 3S9FA 5B7CA 2EIOA 4HU7A 3ERGA 2DMLA 9GSSA 2YNXA 3EE2A 1XVWA 1G6WA 3UVTA 3BCKA 5DCGA 1O6JA 3L4NA 1M9BA 4F0CA 3ZFBA 4IHUA 1BAYA 2GTUA 4RQXA 2REMA 1B4PA 3L9SA 5LCZA 1OE7A 3FHKA 2DKIA 4N0VA 2HZFA 2H8LA 5J5NA 2LJKA 5D73A 1DSBA 4G19A 4F03A 2IPAA 1O73A 4E8EA 5GAPD 3TKRA 1O8WA 2H70A 2EC4A 2IWTA 2KOKA 2FGXA 4ECCA 4ZL9A 4MDCA 3KMOA 10GSA 1GRXA 2I4AA 5EPFA 3TUEA 1AQXA 2QA2A 2O85A 1J08A 3W8JA 2EIQA 2GZZA 5A5KA 5F06A 4OFTA 3W8SA 3GMFA 5E4WA 2PU9C 2H0GA 1GULA 1GSSA 4WR5A 6GSTA 4V1Ag 3GIXA 3ZL5A 1T7PB 4XS4A 1SU9A 4JZQA 3DYRA 4TKYA 3EYTA 1XG8A 4ID0A 2IIYA 7GSSA 3CSIA 5DDLA 2R6KA 1U87A 3EU4A 4MJBA 2R37A 4MA9A 1S3RA 4KB3A 2E7PA 3ME7A 4HQZA 2XPEA 1SENA 4ULXA 5LD0A 4IP6A 2PGTA 3GA4A 3DVXA 1T8EB 1V40A 1N8JA 3M9JA 2Z9SA 1QXHA 4YKFA 3IA1A 3OR5A 3ZTLA 2H01A 3BJ5A 4K8MA 1ERUA 5B8AA 5CRDA 3TGZA 2LQOA 1S3AA 2UZ8A 4P3YB 2DJJA 2LKUA 3US3A 4ECBA 4EC0A 2CX4A 6GSSA 3KD0A 4TN8A 2HRNA 3TRQA 1UN2A 1N2AA 2GQKA 1AUCA 3TRPA 4ZB9A 4GCIA 2VCVA 2L5OA 5HR1A 3FR3A 1R26A 3UVHA 3HJMA 2K9FA 3KMNA 1EZKA 4BVXB 2VLTA 4NXIA 3CRUA 1A24A 3F3RA 4KGIA 2H30A 4WEYA 5D96A 1MDIA 3VWUA 1OKTA 3A5WA 4FH8A 1Y25A 1SJZA 4KSMA 4USSA 3RHBA 5DALA 1AAZA 2J9HA 4XS4B 5HFGA 2C3NA 2KP1A 4TR3A 4AJ8A 2F8FA 3LGCA 4K0GA 1U3AA 4MJCA 2BJXA 4NWYA 5G5FA 4I97A 4FO5A 13GSA 1O81A 5IMCA 3DKSA 5J9CA 4L8EA 1WOUA 4POMA 1A2LA 3APOA 5AGYA 2BTOT 3ED3A 4OCEA 4ZL8A 4KX4A 2H66A 5FWGA 3BD2A 2FY6A 3I6AA 1SK2A 1OYJA 1SJIA 3D4MA 3EVIA 4JU5A 2L6CA 4IKHA 4HZ2A 5ID2A 3A2XA 1MTCA 4Z2TA 2B7KA 1A0FA 4OFNA 1TI3A 2FHEA 4D73A 2H71A 3LSZA 1B4QA 1G6YA 2YWIA 3IPZA 3VK9A 2X4AA 5G1LA 5ECHB 3LW9A 5FHIA 2CVBA 4TVEA 1EGRA 3FZAA 1XW5A 3VLNA 2GVPA 1SKRB 2HZEA 5F07A 5AIXA 2FNOA 2IMIA 1ZYQB 2P31A 2WS2A 2HSMA 5DALB 1X5DA 5JWOB 2LSTA 2A4VA 1LBKA 5GAND 3CYNA 1ERWA 4Z2RA 2VUPA 3D21A 2HE3A 4WBJA 4HJ2A 3LORA 2HRFA 2X99A 3KP9A 4I2UA 4E8HA 5JCWA 5C04A 3VPQA 1RQMA 2GSQA 2P0GA 2G2QA 3TB2A 3MAKA 4MF6A 2QSIA 3TJBA 3EC3A 2L6DA 2LRNA 4HOJA 11GSA 1JHBA 4GRFA 2VCXA 1TRVA 2NVLA 3CSJA 2VOCA 2O8VB 2VL3A 3G7JA 2NDOA 2KHPA 3KTBA 3LEFA 4HQSA 4F82A 3KEBA 2IFQB 4MPFA 2FLSA 4KDXA 2I1UA 1K0AA 2J23A 2F51A 2B5XA 2OBIA 1EEMA 1PX6A 3FMWA 2AYTA 20GSA 12GSA 2N5BA 4BWQA 2KP2A 5CRHA 3DWVA 2PBJA 2DC5A 2H6XA 3A3TA 3IHQA 1GSFA 2I3YA 1X5EA 1TOFA 2V1MA 1XWAA 3QDNA 3GURA 3DVWA 4K0NA 4MJAA 3TJKA 2IMEA 2R0GA 3EMXA 1XOAA 4ML1A 5DQSA 3DMLA 1YDKA 1S3CA 2H1GA 1K3LA 1QUWA 1R7HA 5HQPA 4N30A 3QFBC 4I2TA 4K5SA 4RUVA 3E9JB 3KH7A 4YAPA 2GZPA 3KZQA 1EGOA 4PQIA 4FQUA 2QKEA 2VD1A 2M80A 3GL3A 4EF0A 4PQHA 2XHFA 2V32A 5AN1A 3W6GA 3GTUA 2JADA 5ECPB 5COHA 2VL9A 5E59A 4LMWA 3TKSA 2QGVA 1VRSD 4J57E 3Q74A 3GKKA 4LA1A 4X43A 2MYGA 2O87A 2CV4A 2FCHA 5B6MA 4MNNA 1GNWA 4OCFA 2JL4A 3D5JA 3G7IA 4I5QA 4MABA 1MEKA 2DJKA 2HNLA 3IDVA 1PN9A 3FZ4A 3KCMA 2TRCP 3J7Yk 3I43A 2YWNA 4MF5A 2IMDA 3N5OA 1R5AA 2L57A 4XRDA 4XRAA 2H1BA 1AC1A 1OC9B 1SYXA 4G9HA 2C3QA 5IM9A 1RK4A 3GSTA 1AQVA 1K0NA 1U88A 4Q5FA 1OC8A 4EDYA 4KH7A 4G0LA 3EPTA 1GSYA 5G5EA 4GQFA 5KOXA 4ILFA 3QAWA 1M9AA 1ZMAA 4BPYA 2PPTA 1TTZA 1URMA 1YF1A 4V1Ap 4QL7A 1V57A 1GTIA 3L78A 1FOHA 2H0HA 1EV9A 3V1WA 2A2RA 1PMTA 4IJ3A 3GUSA 2GDRA 2CAQA 2DMMA 4O5UA 6GSWA 4PURA 1A8LA 3GNJA 3FYGA 1PKZA 22GSA 3DEXA 4ZILA 2JSYA 1KNGA 4V2NA 2CZ3A 2XPDA 2LJRA 3WT1A 4MH3A 1W4VA 2PWJA 2PVQA 5F05A 4PX1A 2JZRA 4OMVA 4KUNA 1X9SB 1I5GA 2H76A 2N5AA 1PQNA 5ECIB 5ELGA 4FIWA 5IMZA 4PUAA 5LNKe 3IR4A 4BVYA 2OE0A 4X0XA 2ON5A 4MLYA 1THXA 3QAGA 5D8IA 2XC2A 3HJPA 1NHYA 2B7JA 4EE0A 1YY7A 3D0ZA 1VGLA 2OKAA 1LU4A 2YJHA 2VIMA 3RAZA 4TW5A 4EIQA 1A23A 4TR1B 2H0IA 1YEXA 3ZMLA 6GSXA 4POLA 1XWCA 5AISA 3HVVA 2F8AA 6GSUA 1TK5B 4AF2A 3WT2A 1DE1A 3M3MA 4JR6A 2C0EA 2GSTA 4WF5A 1GTAA 2HI7A 3Q18A 2FWFA 2DJ0A 3O3TA 4J56E 4PUFC 3D22A 3AY8A 2LRCA 3GRXA 1HYUA 3ME8A 1KEBA 3WD6A 3FEUA 3WGXA 3QPMA 5L71A 4CW9A 4MZWA 2C0GA 1F3BA 1SL2B 3ZVJA 2HRAA 3QD9A 4MZBA 4JR4A 2MBTA 2MZCA 1SK0A 4KA0A 1NHOA 2H1AA 2QC7A 3KM6A 5D9WA 3ZMKA 1ERVA 1DE2A 3DGQA 4G0KA 4XCSA 1R4WA 5A4UA 2LTKA 4ML6A 1M2BA 3TJFA 2DSAA 3P90A 2OADA 4PNFA 5C00A 4V2MA 2MBSA 5KN1A 2LRTA 4TOPA 2A4HA 4NMUA 4DSRA 4GSNA 3UJ1A 4O5RA 3C1RA 4IELA 5D93A 3I69A 1ZOFA 5H5RA 4BVYB 4EL1A 3IV4A 1LJRA 3EURA 3LJRA 1O85A 2CQ9A 2MMAA 4K1FA 2VD0A 5CP1A 1WIKA 3QCPA 3GHAA 1ERTA 2E2MA 18GSA 2R0PA 3KTLA 3TJJA 4DSQA 2M72A 4K7IA 2ES7A 1SD8A 3H93A 1TRUA 1OAZA 2GT6A 3HVSA 5H5SA 2GGTA 1JZOA 1XWBA 1ZZYA 4YQUA 3ZVJD 1IYIA 1UA5A 1BG5A 4BWSA 5J3RA 2K8SA 3GX0A 5EVOA 2FWEA 5IMDA 2LNTA 3CTFA 1AW9A 1XBSA 1B9XC 3LFLA 3NIVA 2RIIA 3TKSC 4Q5RA 1WWJA 3WGEA 3M8NA 1Z6NA 1T00A 3F63A 3LG6A 1JZRA 3HKRA 2FWGA 1PX7A 4CDOA 4YAVA 3VI7A 1DUGA 3ERFA 1MDKA 4OO5A 1XWKA 4XIHA 3PPUA 2IMFA 3MNGA 4K6XA 1FW1A 3UARA 5IQYA 1K0CA 3CBUA 3U6VA 4BIKA 2TIRA 3RPPA 4NHWA 1EV4A 5HR3A 2R4VA 1HQOA 3EMPA 3Q19A 2B1LA 1XWGA 5CNWA 3CRTA 3ISOA 4MMMA 1XW9A 2OE1A 5IPGA 4WR4A 2H72A 1UVZA 4HZ4A 4JEDA 3KIJA 3SBCA 2G0FA 3P7XA 4L0UA 5ECLB 5KOWA 1MDJA 2DLXA 3L9VA 4LLRA 3ERWA 2AV4A 2CAIA 1XXUA 5DJMA 4N11A 1KTEA 3F3QA 1TRWA 4WXTA 1XFLA 1FOVA 5D9VA 4ZBBA 1TU7A 4CY8A
chains in the Genus database with same CATH topology
3QR6A 4NAXA 1GSQA 1U3IA 1M99A 1GSUA 2CX3A 3FR6A 1XIYA 3F8UA 1SK1A 2WCIA 4XHMA 2GQMA 3C71A 5D9TA 2IN3A 2N5FA 5B6NA 3FW2A 2WRTA 1F3AA 2XBIA 2VCWA 1FAAA 1GTUA 5H5QA 3ZFLA 4OD7A 6GSYA 2GS3A 5JCGA 4K7NA 5JWQB 2HXKA 3FKFA 1A2MA 2PVOC 4RQRA 4L5OA 3IRAA 1NM3A 4F2IA 1XOBA 1JFUA 1S3DA 1ZYNA 5ID2B 2VAFA 2JZTA 2YP6A 5G1KA 4EUYA 1ZYEA 1GLPA 3FK8A 3HJOA 3F9UA 1QQ2A 4D73B 4HJMA 1PA3A 1Z6MA 2FA4A 5ECKB 2YWOA 2OJLA 3GKNA 1G7EA 1Q98A 4JBBA 1X9WB 4O32A 1V58A 1PGTA 3P2AA 5ECNB 3KP8A 4MP4A 3DIEA 5IOXA 3HZ4A 2HZEB 1C72A 4BL7A 3R2QA 4CHSA 4GXZA 3IE3A 2DIYA 1DBYA 4TXVA 4PTSA 4LL4B 4RI7A 3GV1A 1SJ6A 3RDWA 4FYBA 4G0IA 4ECIA 2I81A 1WJKA 3SWLA 3A2VA 2FWHA 3APSA 3O76A 5CAXA 3VWVA 4N0ZA 3VWWA 2GLRA 3WYWA 1B48A 3LWAA 1BYEA 4DVCA 5EL8A 2WDUA 1GWCA 1TU8A 5ELAA 1MD4A 5GSTA 1PN0A 3GN3A 2LQQA 4IQ1A 4WF4A 4MZCA 2DKHA 1PD21 19GSA 5KN3A 4TR0A 5IOWA 5J4UA 1YF0A 2VL2A 3D6IA 4DSSA 1V98A 5G30A 4MPGA 3QOUA 2QA1A 3ZIJA 5KN0A 4Z2UA 1SD9A 2C8UA 4O5QA 2IMKA 3CTGA 1EWXA 3IOSA 2L4CA 4TRXA 5DVBA 4MK3A 2YWMA 4XS6A 3PGTA 2JZSA 5J41A 17GSA 2HFDA 4EDZA 5ABRA 1V9WA 4HUAA 2YV7A 4KF9A 1IYHA 4G2EA 1Q4JA 4BL7B 2D2ZA 1TI1A 2FD3A 1GL8A 1GUKA 3N9JA 1VF1A 1G7OA 4RI6A 2R3XA 1PKWA 1FVKA 4F0BA 1ZL9A 2LS5A 4POBA 4HI7A 2LV3A 5KN2A 4I8BA 3HDCA 2ON7A 2IJYA 3EWLA 5CO3A 3ZITA 2RUFA 1SL1B 3IC4A 3G9BA 2EIRA 5IMAA 2HLSA 2RUEA 3RHCA 8GSSA 4BA7A 1YKAA 3PINA 1T1VA 4HU9A 1K3YA 2K6VA 2B5YA 4DSSB 3GTUB 2H75A 1O8XA 2AHEA 4KDYA 5CRGA 4IN0A 1VF3A 4ICYA 3O6TA 3C73A 1FHEA 1JZDA 3TKSE 2E0QA 1AIUA 1TK0B 1K0BA 1W89A 4GSSA 3K8NA 2A2PA 1GLQA 1Z7PA 3VPTA 3G7YA 2GT5A 2IL3A 4G10A 5IMFA 2C80A 3TOTA 2RM6A 3VI5A 4ZBDA 5A4WA 2WJUA 4AJ6A 4OWYA 1OC3A 2YZUA 3D4TA 5DCHA 3ZREA 1E6BA 2WULA 3ZRDA 4ACSA 2NPBA 5CRWA 1WPIA 5FT3A 4FYCA 4ZIJA 1H4OA 3TJGA 2VM1A 4WETA 1VF4A 4DEJA 3CSHA 3TKPA 5G31A 1TJDA 5DBQA 2CZ2A 4QL9A 4I6XA 4AJ7A 3UBLA 3WGDA 2FUG2 3MWHA 2C0DA 3QMXA 2B6MA 1QK8A 4Q5NA 3BOAA 4O92A 2YZHA 3FRCA 2BMXA 2LNSA 1YEPA 1EOGA 1EOHA 4MF7A 2ZUPA 5JCUA 3ZIVA 2E2GA 4IJIA 5F8BA 1GSEA 2YCDA 4BVXA 1Z3EA 4GWRA 2CA8A 1V2AA 2F3MA 3DD3A 3HY2A 3NZNA 5DJLA 2OA7A 4PQ1A 4ZB6A 2V6OA 1M0UA 3GKXA 2HT9A 4GTUA 3VWXA 2H6YA 2NTOA 5DQYA 1HNAA 3FZ5A 1SYRA 1OE8A 5HR0A 2PMTA 1GP1A 2X8HA 1YZXA 1CQHA 3C8EA 2JACA 1TKDB 3L9UA 3UMAA 5ECSA 1FG4A 2VLVA 2CVDA 1B8XA 4X1UA 3UEMA 3LXZA 1G0TA 3H4KA 2AAWA 1SKSB 1ON4A 3MSZA 2C1YA 4IW9A 2AB6A 4ZXGA 2H1DA 5AIVA 2RLIA 1ZCPA 2XBQA 1F6MC 3U5RE 3HCZA 3UBKA 4JRRA 2WFCA 4PXOA 1FB0A 2MMNA 3M0FA 2JU5A 2H73A 1K0MA 2HRKA 1PRXA 2VL2C 4POKA 5ECOB 3RPNA 1TP9A 1PL1A 4IP1A 1QMVA 5BRTA 1A0RP 4MH2A 1ST9A 2B5EA 4GQCA 5IIZA 4NV2A 4ZBAA 4NV5A 1OVNA 5D9XA 2X49A 4KE3A 1VF2A 1ZGNA 3TKQA 4F9ZA 2WGRA 5ECQB 4Z7XA 3LXTA 3VFIA 1PL2A 2VLUA 3C1SA 4EVMA 2A2SA 2HYXA 1Z9HA 1RW1A 2H6ZA 2KUCA 1AXDA 3LYKA 1Y6EA 4ECJA 3E0UA 3IK9A 3GFKA 2GSRA 2PERA 3IC8A 1HNBA 1FB6A 4IGJA 2X8CA 3KH9A 1X0RA 3MYDA 1GUHA 2H74A 1MD3A 4HDEA 1XW6A 4OO4A 2V2GA 2OE3A 1BEDA 3HXSA 2DJ1A 1JLWA 3HA9A 3NOFA 3I9V2 3ZZXA 4AGSA 2AUVA 2K18A 5BMUA 2DJ3A 2C4JA 2NBSA 3M9KA 3MIXA 2CT6A 4IVFA 1WRYA 1ACVA 3KXOA 3UOMA 4KW6A 3ZLPA 4GF0A 4IQAA 4KAEA 4A5PA 2P5RA 3GX8A 16GSA 2IFQA 3RBTA 3FR9A 4GSTA 3BBYA 3PR8A 5GSSA 2PN8A 1TXXA 4OFMA 1X5CA 2GQLA 1THOA 3FZ9A 3UIWA 2DJ2A 3F4SA 4L5LA 4ZB8A 1WE0A 1TRSA 5INYA 4Q5QA 1OKDA 2VCTA 2JSZA 3MDKA 3QAVA 2C0FA 3TRXA 4TXOA 3GSSA 1YKCA 1FVJA 1TW9A 2YN1A 2ALBA 2X64A 1GNEA 2R2JA 4PGTA 3M1GA 1J0FA 4WKWA 3TOUA 4KCAA 1H75A 3H79A 5IPHA 5GZZB 2YJ7A 1K0DA 2ZNMA 3DXBA 1UC7A 2H19A 1EP7A 2HSYA 2WZ9A 2P5QA 1ABAA 4NHZA 1A2JA 4YKGA 3L0HA 1GTBA 2MMZA 4MCUA 2VM2A 3QFAC 4K2DA 3TCOA 1XZOA 1F37A 3IAM2 4KDUA 1NSWA 4EO3A 1EEJA 1HNCA 1A8YA 4FYUA 3Q6OA 3GKMA 3BCIA 4KCEA 1K3OA 4IS0A 1I9DA 3CMIA 4J2FA 3F6DA 1GH2A 1BJXA 5IMVA 1BX9A 1GSDA 2DIZA 3EU3A 5HR2A 3IK7A 5HFIA 1SKWB 1PSQA 2M46A 3P8WA 2K8VA 4L0WA 1KBNA 3GL5A 1GUMA 1WMJA 4ISDA 5G2ZA 4QQ7A 5IO0A 1YJ6A 4PNGA 3GH6A 2B1KA 4TXOB 2X8GA 4YQVA 4YH2A 3KJYA 2C3TA 3R3EA 1SL0B 6GSVA 2VO4A 3HYPA 3TDGA 2YANA 2KLXA 1AQWA 5CYYA 5ECMB 1OC9A 1WP0A 4K7OA 4MJEA 2YV9A 4YQMA 1XVQA 2DBCA 4ZL7A 1O7UA 4XS1A 1HD2A 5DAKA 3F4RA 2YPMA 4O7HA 2VCZA 2L5LA 2AJQB 3LYPA 2V41A 1ILOA 3C7MA 5F0GA 3A5IA 2PUKC 1NW2A 1Z7RA 2RM5A 4K2XA 2OACA 2ZCTA 3JCML 1Z5YE 1R5PA 3F0IA 3IHGA 4IBPA 2V6KA 3H1NA 1M7TA 1ZYPA 1XPVA 3IXRA 2B3SA 3FY7A 3KGKA 5ECRB 2MMOA 3A2WA 3E3EA 4TR4A 1T3BA 3UL3A 1X9MB 3UAPA 3H8QA 2YOIA 4LMVA 2LEGA 2L4QA 5JWRB 3J7Yb 4KSOA 1T4ZA 3IBHA 1JLVA 2O89A 2OBKA 2GSSA 1J9BA 2WB9A 2R0CA 1JZWA 1ML6A 4N10A 5ENUA 4EXJA 3F6FA 4K5RA 2O7KA 4CY6A 3APQA 4EIPA 1BQ7A 3PH9A 3IAS2 3F4TA 2L59A 1QGVA 3VURA 3GYKA 3LQ7A 3DRNA 1USBA 4HS1A 2TRXA 4JE1A 1XCCA 4TR1A 14GSA 5DAKB 1M2DA 4HEA2 2GZYA 3HD5A 3CXGA 1U6TA 1YQ1A 3ZYWA 3GH9A 2LJAA 4K9ZA 1F2EA 5J9BA 1E2YA 2VCQA 5B8BA 5CREA 2R5GA 5A4VA 4EKZA 2CVKA 4V2LA 1EP8A 4KNDA 4NPBA 1FO5A 4H86A 1K0OA 4GLTA 3HZ8A 4WBRD 1M2AA 1QFNA 5HFKA 5IO2A 2LUSA 1B9YC 2I9HA 1TK8B 4LL1B 1CQGA 3HHVA 1T4YA 2FA8A 3HVXA 4X4JA 5KEJA 3EINA 2F9SA 1TDIA 4XTSA 1F9MA 2HSHA 5EY6A 3S9FA 5B7CA 2EIOA 4HU7A 3ERGA 2DMLA 9GSSA 2YNXA 3EE2A 1XVWA 1G6WA 3UVTA 3BCKA 5DCGA 1O6JA 3L4NA 1M9BA 4F0CA 3ZFBA 4IHUA 1BAYA 2GTUA 4RQXA 2REMA 1B4PA 3L9SA 5LCZA 1OE7A 3FHKA 2DKIA 4N0VA 2HZFA 2H8LA 5J5NA 2LJKA 5D73A 1DSBA 4G19A 4F03A 2IPAA 1O73A 4E8EA 5GAPD 3TKRA 1O8WA 2H70A 2EC4A 2IWTA 2KOKA 2FGXA 4ECCA 4ZL9A 4MDCA 3KMOA 10GSA 1GRXA 2I4AA 5EPFA 3TUEA 1AQXA 2QA2A 2O85A 1J08A 3W8JA 2EIQA 2GZZA 5A5KA 5F06A 4OFTA 3W8SA 3GMFA 5E4WA 2PU9C 2H0GA 1GULA 1GSSA 4WR5A 6GSTA 4V1Ag 3GIXA 3ZL5A 1T7PB 4XS4A 1SU9A 4JZQA 3DYRA 4TKYA 3EYTA 4ID0A 2IIYA 7GSSA 3CSIA 5DDLA 2R6KA 1U87A 3EU4A 4MJBA 2R37A 4MA9A 4KB3A 2E7PA 3ME7A 4HQZA 2XPEA 1SENA 4ULXA 5LD0A 4IP6A 2PGTA 3GA4A 3DVXA 1T8EB 1V40A 1N8JA 3M9JA 2Z9SA 1QXHA 4YKFA 3IA1A 3OR5A 3ZTLA 2H01A 3BJ5A 4K8MA 1ERUA 5B8AA 5CRDA 3TGZA 2LQOA 1S3AA 2UZ8A 4P3YB 2DJJA 2LKUA 3US3A 4ECBA 4EC0A 2CX4A 6GSSA 3KD0A 4TN8A 2HRNA 3TRQA 1UN2A 1N2AA 2GQKA 1AUCA 3TRPA 4ZB9A 4GCIA 2VCVA 2L5OA 5HR1A 3FR3A 1R26A 3UVHA 3HJMA 2K9FA 3KMNA 1EZKA 4BVXB 2VLTA 4NXIA 3CRUA 1A24A 3F3RA 4KGIA 2H30A 4WEYA 5D96A 1MDIA 3VWUA 1OKTA 3A5WA 4FH8A 1Y25A 1SJZA 4KSMA 4USSA 3RHBA 5DALA 1AAZA 2J9HA 4XS4B 5HFGA 2C3NA 2KP1A 4TR3A 4AJ8A 2F8FA 3LGCA 4K0GA 1U3AA 4MJCA 2BJXA 4NWYA 5G5FA 4I97A 4FO5A 13GSA 1O81A 5IMCA 3DKSA 5J9CA 4L8EA 1WOUA 4POMA 1A2LA 3APOA 5AGYA 2BTOT 3ED3A 4OCEA 4ZL8A 4KX4A 2H66A 5FWGA 3BD2A 2FY6A 3I6AA 1SK2A 1OYJA 1SJIA 3D4MA 3EVIA 4JU5A 2L6CA 4IKHA 4HZ2A 5ID2A 3A2XA 1MTCA 4Z2TA 2B7KA 1A0FA 4OFNA 1TI3A 2FHEA 4D73A 2H71A 3LSZA 1B4QA 1G6YA 2YWIA 3IPZA 3VK9A 2X4AA 5G1LA 5ECHB 3LW9A 5FHIA 2CVBA 4TVEA 1EGRA 3FZAA 1XW5A 3VLNA 2GVPA 1SKRB 2HZEA 5F07A 5AIXA 2FNOA 2IMIA 1ZYQB 2P31A 2WS2A 2HSMA 5DALB 1X5DA 5JWOB 2LSTA 2A4VA 1LBKA 5GAND 3CYNA 1ERWA 4Z2RA 2VUPA 3D21A 2HE3A 4WBJA 4HJ2A 3LORA 2HRFA 2X99A 3KP9A 4I2UA 4E8HA 5JCWA 5C04A 3VPQA 1RQMA 2GSQA 2P0GA 2G2QA 3TB2A 3MAKA 4MF6A 2QSIA 3TJBA 3EC3A 2L6DA 2LRNA 4HOJA 11GSA 1JHBA 4GRFA 2VCXA 1TRVA 2NVLA 3CSJA 2VOCA 2O8VB 2VL3A 3G7JA 2NDOA 2KHPA 3KTBA 3LEFA 4HQSA 4F82A 3KEBA 2IFQB 4MPFA 2FLSA 4KDXA 2I1UA 1K0AA 2J23A 2F51A 2B5XA 2OBIA 1EEMA 1PX6A 3FMWA 2AYTA 20GSA 12GSA 2N5BA 4BWQA 2KP2A 5CRHA 3DWVA 2PBJA 2DC5A 2H6XA 3A3TA 3IHQA 1GSFA 2I3YA 1X5EA 1TOFA 2V1MA 1XWAA 3QDNA 3GURA 3DVWA 4K0NA 4MJAA 3TJKA 2IMEA 2R0GA 3EMXA 1XOAA 4ML1A 5DQSA 3DMLA 1YDKA 1S3CA 2H1GA 1K3LA 1QUWA 1R7HA 5HQPA 4N30A 3QFBC 4I2TA 4K5SA 4RUVA 3E9JB 3KH7A 4YAPA 2GZPA 3KZQA 1EGOA 4PQIA 4FQUA 2QKEA 2VD1A 2M80A 3GL3A 4EF0A 4PQHA 2XHFA 2V32A 5AN1A 3W6GA 3GTUA 2JADA 5ECPB 5COHA 2VL9A 5E59A 4LMWA 3TKSA 2QGVA 1VRSD 4J57E 3Q74A 3GKKA 4LA1A 4X43A 2MYGA 2O87A 2CV4A 2FCHA 5B6MA 4MNNA 1GNWA 4OCFA 2JL4A 3D5JA 3G7IA 4I5QA 4MABA 1MEKA 2DJKA 2HNLA 3IDVA 1PN9A 3FZ4A 3KCMA 2TRCP 3J7Yk 3I43A 2YWNA 4MF5A 2IMDA 3N5OA 1R5AA 2L57A 4XRDA 4XRAA 2H1BA 1AC1A 1OC9B 1SYXA 4G9HA 2C3QA 5IM9A 1RK4A 3GSTA 1AQVA 1K0NA 1U88A 4Q5FA 1OC8A 4EDYA 4KH7A 4G0LA 3EPTA 1GSYA 5G5EA 4GQFA 5KOXA 4ILFA 3QAWA 1M9AA 1ZMAA 4BPYA 2PPTA 1TTZA 1URMA 1YF1A 4V1Ap 4QL7A 1V57A 1GTIA 3L78A 1FOHA 2H0HA 1EV9A 3V1WA 2A2RA 1PMTA 4IJ3A 3GUSA 2GDRA 2CAQA 2DMMA 4O5UA 6GSWA 4PURA 1A8LA 3GNJA 3FYGA 1PKZA 22GSA 3DEXA 4ZILA 2JSYA 1KNGA 4V2NA 2CZ3A 2XPDA 2LJRA 3WT1A 4MH3A 1W4VA 2PWJA 2PVQA 5F05A 4PX1A 2JZRA 4OMVA 4KUNA 1X9SB 1I5GA 2H76A 2N5AA 1PQNA 5ECIB 5ELGA 4FIWA 5IMZA 4PUAA 5LNKe 3IR4A 4BVYA 2OE0A 4X0XA 2ON5A 4MLYA 1THXA 3QAGA 5D8IA 2XC2A 3HJPA 1NHYA 2B7JA 4EE0A 1YY7A 3D0ZA 1VGLA 2OKAA 1LU4A 2YJHA 2VIMA 3RAZA 4TW5A 4EIQA 1A23A 4TR1B 2H0IA 1YEXA 3ZMLA 6GSXA 4POLA 1XWCA 5AISA 3HVVA 2F8AA 6GSUA 1TK5B 4AF2A 3WT2A 1DE1A 3M3MA 4JR6A 2C0EA 2GSTA 4WF5A 1GTAA 2HI7A 3Q18A 2FWFA 2DJ0A 3O3TA 4J56E 4PUFC 3D22A 3AY8A 2LRCA 3GRXA 1HYUA 3ME8A 1KEBA 3WD6A 3FEUA 3WGXA 3QPMA 5L71A 4CW9A 4MZWA 2C0GA 1F3BA 1SL2B 3ZVJA 2HRAA 3QD9A 4MZBA 4JR4A 2MBTA 2MZCA 1SK0A 4KA0A 1NHOA 2H1AA 2QC7A 3KM6A 5D9WA 3ZMKA 1ERVA 1DE2A 3DGQA 4G0KA 4XCSA 1R4WA 5A4UA 2LTKA 4ML6A 1M2BA 3TJFA 2DSAA 3P90A 2OADA 4PNFA 5C00A 4V2MA 2MBSA 5KN1A 2LRTA 4TOPA 2A4HA 4NMUA 4DSRA 4GSNA 3UJ1A 4O5RA 3C1RA 4IELA 5D93A 3I69A 1ZOFA 5H5RA 4BVYB 4EL1A 3IV4A 1LJRA 3EURA 3LJRA 1O85A 2CQ9A 2MMAA 4K1FA 2VD0A 5CP1A 1WIKA 3QCPA 3GHAA 1ERTA 2E2MA 18GSA 2R0PA 3KTLA 3TJJA 4DSQA 2M72A 4K7IA 2ES7A 1SD8A 3H93A 1TRUA 1OAZA 2GT6A 3HVSA 5H5SA 2GGTA 1JZOA 1XWBA 1ZZYA 4YQUA 3ZVJD 1IYIA 1UA5A 1BG5A 4BWSA 5J3RA 2K8SA 3GX0A 5EVOA 2FWEA 5IMDA 2LNTA 3CTFA 1AW9A 1XBSA 1B9XC 3LFLA 3NIVA 2RIIA 3TKSC 4Q5RA 1WWJA 3WGEA 3M8NA 1Z6NA 1T00A 3F63A 3LG6A 1JZRA 3HKRA 2FWGA 1PX7A 4CDOA 4YAVA 3VI7A 1DUGA 3ERFA 1MDKA 4OO5A 1XWKA 4XIHA 3PPUA 2IMFA 3MNGA 4K6XA 1FW1A 3UARA 5IQYA 1K0CA 3CBUA 3U6VA 2TIRA 3RPPA 4NHWA 1EV4A 5HR3A 2R4VA 1HQOA 3EMPA 3Q19A 2B1LA 1XWGA 5CNWA 3CRTA 3ISOA 4MMMA 1XW9A 2OE1A 5IPGA 4WR4A 2H72A 1UVZA 4HZ4A 4JEDA 3KIJA 3SBCA 2G0FA 3P7XA 4L0UA 5ECLB 5KOWA 1MDJA 2DLXA 3L9VA 4LLRA 3ERWA 2AV4A 2CAIA 1XXUA 5DJMA 4N11A 1KTEA 3F3QA 1TRWA 4WXTA 1XFLA 1FOVA 5D9VA 4ZBBA 1TU7A 4CY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QR6 A;  4NAX A;  1GSQ A;  1U3I A;  1M99 A;  1GSU A;  2CX3 A;  3FR6 A;  1XIY A;  3F8U A;  1SK1 A;  2WCI A;  4XHM A;  2GQM A;  3C71 A;  5D9T A;  2IN3 A;  2N5F A;  5B6N A;  3FW2 A;  2WRT A;  1F3A A;  2XBI A;  2VCW A;  1FAA A;  1GTU A;  5H5Q A;  3ZFL A;  4OD7 A;  6GSY A;  2GS3 A;  5JCG A;  4K7N A;  5JWQ B;  2HXK A;  3FKF A;  1A2M A;  2PVO C;  4RQR A;  4L5O A;  3IRA A;  1NM3 A;  4F2I A;  1XOB A;  1JFU A;  1S3D A;  5ID2 B;  2VAF A;  2JZT A;  2YP6 A;  5G1K A;  4EUY A;  1ZYE A;  1GLP A;  3FK8 A;  3HJO A;  3F9U A;  1QQ2 A;  4D73 B;  4HJM A;  1PA3 A;  1Z6M A;  2FA4 A;  5ECK B;  2YWO A;  2OJL A;  3GKN A;  1G7E A;  1Q98 A;  4JBB A;  1X9W B;  4O32 A;  1V58 A;  1PGT A;  3P2A A;  5ECN B;  3KP8 A;  4MP4 A;  3DIE A;  5IOX A;  3HZ4 A;  2HZE B;  1C72 A;  4BL7 A;  3R2Q A;  4CHS A;  4GXZ A;  3IE3 A;  2DIY A;  1DBY A;  4TXV A;  4LL4 B;  4RI7 A;  3GV1 A;  1SJ6 A;  3RDW A;  4FYB A;  4ECI A;  2I81 A;  1WJK A;  3SWL A;  3A2V A;  2FWH A;  3APS A;  3O76 A;  5CAX A;  3VWV A;  4N0Z A;  3VWW A;  2GLR A;  3WYW A;  1B48 A;  3LWA A;  1BYE A;  4DVC A;  5EL8 A;  2WDU A;  1GWC A;  1TU8 A;  5ELA A;  1MD4 A;  5GST A;  3GN3 A;  2LQQ A;  4IQ1 A;  4WF4 A;  4MZC A;  1PD2 1;  19GS A;  5KN3 A;  4TR0 A;  5IOW A;  5J4U A;  1YF0 A;  2VL2 A;  3D6I A;  4DSS A;  1V98 A;  5G30 A;  4MPG A;  3QOU A;  3ZIJ A;  5KN0 A;  1SD9 A;  2C8U A;  2IMK A;  3CTG A;  1EWX A;  3IOS A;  2L4C A;  4TRX A;  5DVB A;  4MK3 A;  2YWM A;  4XS6 A;  3PGT A;  2JZS A;  5J41 A;  17GS A;  2HFD A;  4EDZ A;  5ABR A;  1V9W A;  4HUA A;  2YV7 A;  1IYH A;  4G2E A;  1Q4J A;  2D2Z A;  1TI1 A;  2FD3 A;  1GL8 A;  1GUK A;  3N9J A;  1VF1 A;  1G7O A;  4RI6 A;  2R3X A;  1PKW A;  1FVK A;  4F0B A;  1ZL9 A;  2LS5 A;  4POB A;  4HI7 A;  2LV3 A;  5KN2 A;  4I8B A;  3HDC A;  2ON7 A;  2IJY A;  3EWL A;  5CO3 A;  3ZIT A;  2RUF A;  1SL1 B;  3IC4 A;  3G9B A;  2EIR A;  5IMA A;  2HLS A;  2RUE A;  3RHC A;  8GSS A;  4BA7 A;  1YKA A;  3PIN A;  1T1V A;  4HU9 A;  1K3Y A;  2K6V A;  2B5Y A;  4DSS B;  3GTU B;  2H75 A;  1O8X A;  2AHE A;  4KDY A;  5CRG A;  4IN0 A;  1VF3 A;  3O6T A;  3C73 A;  1FHE A;  1JZD A;  3TKS E;  2E0Q A;  1AIU A;  1TK0 B;  1K0B A;  1W89 A;  4GSS A;  3K8N A;  1GLQ A;  1Z7P A;  3VPT A;  3G7Y A;  2GT5 A;  2IL3 A;  4G10 A;  5IMF A;  2C80 A;  3TOT A;  2RM6 A;  3VI5 A;  4ZBD A;  5A4W A;  2WJU A;  4AJ6 A;  4OWY A;  1OC3 A;  2YZU A;  3D4T A;  5DCH A;  3ZRE A;  1E6B A;  2WUL A;  3ZRD A;  4ACS A;  2NPB A;  5CRW A;  1WPI A;  5FT3 A;  4FYC A;  4ZIJ A;  1H4O A;  3TJG A;  2VM1 A;  4WET A;  1VF4 A;  4DEJ A;  3CSH A;  3TKP A;  5G31 A;  1TJD A;  5DBQ A;  2CZ2 A;  4QL9 A;  4I6X A;  4AJ7 A;  3UBL A;  3WGD A;  2FUG 2;  3MWH A;  2C0D A;  3QMX A;  2B6M A;  1QK8 A;  4Q5N A;  3BOA A;  4O92 A;  2YZH A;  3FRC A;  2BMX A;  2LNS A;  1YEP A;  1EOG A;  1EOH A;  4MF7 A;  2ZUP A;  5JCU A;  3ZIV A;  2E2G A;  4IJI A;  5F8B A;  1GSE A;  2YCD A;  4BVX A;  1Z3E A;  4GWR A;  2CA8 A;  1V2A A;  2F3M A;  3DD3 A;  3HY2 A;  3NZN A;  5DJL A;  2OA7 A;  4PQ1 A;  4ZB6 A;  2V6O A;  1M0U A;  3GKX A;  2HT9 A;  4GTU A;  3VWX A;  2H6Y A;  2NTO A;  5DQY A;  1HNA A;  3FZ5 A;  1SYR A;  1OE8 A;  5HR0 A;  2PMT A;  1GP1 A;  2X8H A;  1YZX A;  1CQH A;  3C8E A;  2JAC A;  1TKD B;  3L9U A;  3UMA A;  5ECS A;  1FG4 A;  2VLV A;  2CVD A;  1B8X A;  4X1U A;  3UEM A;  3LXZ A;  1G0T A;  3H4K A;  2AAW A;  1SKS B;  1ON4 A;  3MSZ A;  2C1Y A;  4IW9 A;  2AB6 A;  4ZXG A;  2H1D A;  5AIV A;  2RLI A;  1ZCP A;  2XBQ A;  1F6M C;  3U5R E;  3HCZ A;  3UBK A;  4JRR A;  2WFC A;  4PXO A;  1FB0 A;  2MMN A;  3M0F A;  2JU5 A;  2H73 A;  1K0M A;  1PRX A;  2VL2 C;  4POK A;  5ECO B;  3RPN A;  1TP9 A;  1PL1 A;  4IP1 A;  1QMV A;  1A0R P;  4MH2 A;  1ST9 A;  2B5E A;  4GQC A;  5IIZ A;  4NV2 A;  4ZBA A;  4NV5 A;  1OVN A;  5D9X A;  4KE3 A;  1VF2 A;  1ZGN A;  3TKQ A;  4F9Z A;  2WGR A;  5ECQ B;  4Z7X A;  3LXT A;  3VFI A;  1PL2 A;  2VLU A;  3C1S A;  4EVM A;  2A2S A;  2HYX A;  1Z9H A;  1RW1 A;  2H6Z A;  2KUC A;  1AXD A;  3LYK A;  1Y6E A;  4ECJ A;  3E0U A;  3IK9 A;  3GFK A;  2GSR A;  2PER A;  1HNB A;  1FB6 A;  4IGJ A;  2X8C A;  3KH9 A;  1X0R A;  1GUH A;  2H74 A;  1MD3 A;  4HDE A;  1XW6 A;  4OO4 A;  2V2G A;  2OE3 A;  1BED A;  3HXS A;  2DJ1 A;  1JLW A;  3HA9 A;  3NOF A;  3I9V 2;  3ZZX A;  4AGS A;  2AUV A;  2K18 A;  2DJ3 A;  2C4J A;  2NBS A;  3M9K A;  2CT6 A;  4IVF A;  1WRY A;  1ACV A;  3KXO A;  3UOM A;  4KW6 A;  3ZLP A;  4GF0 A;  4IQA A;  4KAE A;  2P5R A;  3GX8 A;  16GS A;  2IFQ A;  3RBT A;  3FR9 A;  4GST A;  3BBY A;  3PR8 A;  5GSS A;  2PN8 A;  1TXX A;  4OFM A;  1X5C A;  2GQL A;  1THO A;  3FZ9 A;  3UIW A;  2DJ2 A;  3F4S A;  4L5L A;  4ZB8 A;  1WE0 A;  1TRS A;  5INY A;  4Q5Q A;  1OKD A;  2VCT A;  2JSZ A;  3MDK A;  3QAV A;  2C0F A;  3TRX A;  4TXO A;  3GSS A;  1YKC A;  1FVJ A;  1TW9 A;  2YN1 A;  2ALB A;  2X64 A;  1GNE A;  2R2J A;  4PGT A;  3M1G A;  1J0F A;  4WKW A;  3TOU A;  4KCA A;  1H75 A;  3H79 A;  5IPH A;  5GZZ B;  2YJ7 A;  1K0D A;  2ZNM A;  3DXB A;  1UC7 A;  2H19 A;  1EP7 A;  2HSY A;  2WZ9 A;  2P5Q A;  1ABA A;  4NHZ A;  1A2J A;  3L0H A;  1GTB A;  2MMZ A;  4MCU A;  2VM2 A;  3QFA C;  4K2D A;  3TCO A;  1XZO A;  1F37 A;  3IAM 2;  4KDU A;  1NSW A;  4EO3 A;  1EEJ A;  1HNC A;  1A8Y A;  4FYU A;  3Q6O A;  3GKM A;  3BCI A;  4KCE A;  1K3O A;  4IS0 A;  1I9D A;  3CMI A;  4J2F A;  3F6D A;  1GH2 A;  1BJX A;  5IMV A;  1BX9 A;  1GSD A;  2DIZ A;  3EU3 A;  5HR2 A;  3IK7 A;  5HFI A;  1SKW B;  1PSQ A;  2M46 A;  3P8W A;  2K8V A;  4L0W A;  1KBN A;  3GL5 A;  1GUM A;  1WMJ A;  4ISD A;  5G2Z A;  4QQ7 A;  5IO0 A;  1YJ6 A;  4PNG A;  3GH6 A;  2B1K A;  4TXO B;  2X8G A;  4YQV A;  4YH2 A;  3KJY A;  2C3T A;  1SL0 B;  6GSV A;  2VO4 A;  3HYP A;  3TDG A;  2YAN A;  2KLX A;  1AQW A;  5CYY A;  5ECM B;  1OC9 A;  1WP0 A;  4K7O A;  4MJE A;  2YV9 A;  4YQM A;  1XVQ A;  2DBC A;  4ZL7 A;  1O7U A;  4XS1 A;  1HD2 A;  5DAK A;  3F4R A;  2YPM A;  4O7H A;  2VCZ A;  2L5L A;  2AJQ B;  3LYP A;  2V41 A;  1ILO A;  3C7M A;  5F0G A;  2PUK C;  1NW2 A;  1Z7R A;  2RM5 A;  2OAC A;  2ZCT A;  3JCM L;  1Z5Y E;  1R5P A;  3F0I A;  4IBP A;  2V6K A;  3H1N A;  1M7T A;  1XPV A;  3IXR A;  2B3S A;  3FY7 A;  3KGK A;  5ECR B;  2MMO A;  3A2W A;  3E3E A;  4TR4 A;  1T3B A;  3UL3 A;  1X9M B;  3UAP A;  3H8Q A;  2YOI A;  4LMV A;  2LEG A;  2L4Q A;  5JWR B;  3J7Y b;  4KSO A;  1T4Z A;  3IBH A;  1JLV A;  2O89 A;  2OBK A;  2GSS A;  1J9B A;  2WB9 A;  1JZW A;  1ML6 A;  4N10 A;  5ENU A;  4EXJ A;  3F6F A;  2O7K A;  3APQ A;  1BQ7 A;  3PH9 A;  3IAS 2;  3F4T A;  2L59 A;  1QGV A;  3VUR A;  3GYK A;  3LQ7 A;  3DRN A;  1USB A;  4HS1 A;  2TRX A;  4JE1 A;  1XCC A;  4TR1 A;  14GS A;  5DAK B;  1M2D A;  4HEA 2;  2GZY A;  3HD5 A;  3CXG A;  1U6T A;  1YQ1 A;  3ZYW A;  3GH9 A;  2LJA A;  4K9Z A;  1F2E A;  5J9B A;  1E2Y A;  2VCQ A;  5B8B A;  5CRE A;  2R5G A;  5A4V A;  4EKZ A;  2CVK A;  4V2L A;  1EP8 A;  4KND A;  4NPB A;  1FO5 A;  4H86 A;  1K0O A;  4GLT A;  3HZ8 A;  4WBR D;  1M2A A;  1QFN A;  5HFK A;  5IO2 A;  2LUS A;  1B9Y C;  2I9H A;  1TK8 B;  4LL1 B;  1CQG A;  3HHV A;  1T4Y A;  2FA8 A;  3HVX A;  5KEJ A;  3EIN A;  2F9S A;  1TDI A;  4XTS A;  1F9M A;  2HSH A;  5EY6 A;  3S9F A;  5B7C A;  2EIO A;  4HU7 A;  3ERG A;  2DML A;  9GSS A;  2YNX A;  3EE2 A;  1XVW A;  1G6W A;  3UVT A;  3BCK A;  5DCG A;  1O6J A;  3L4N A;  1M9B A;  4F0C A;  3ZFB A;  4IHU A;  1BAY A;  2GTU A;  4RQX A;  2REM A;  1B4P A;  3L9S A;  5LCZ A;  1OE7 A;  3FHK A;  4N0V A;  2HZF A;  2H8L A;  5J5N A;  2LJK A;  5D73 A;  1DSB A;  4G19 A;  4F03 A;  2IPA A;  1O73 A;  4E8E A;  5GAP D;  3TKR A;  1O8W A;  2H70 A;  2EC4 A;  2IWT A;  2KOK A;  2FGX A;  4ECC A;  4ZL9 A;  4MDC A;  3KMO A;  10GS A;  1GRX A;  2I4A A;  5EPF A;  3TUE A;  1AQX A;  2O85 A;  1J08 A;  3W8J A;  2EIQ A;  2GZZ A;  5A5K A;  5F06 A;  4OFT A;  3W8S A;  3GMF A;  5E4W A;  2PU9 C;  2H0G A;  1GUL A;  1GSS A;  4WR5 A;  6GST A;  4V1A g;  3GIX A;  3ZL5 A;  1T7P B;  4XS4 A;  1SU9 A;  4JZQ A;  3DYR A;  4TKY A;  3EYT A;  4ID0 A;  2IIY A;  7GSS A;  3CSI A;  5DDL A;  2R6K A;  1U87 A;  3EU4 A;  4MJB A;  2R37 A;  4MA9 A;  4KB3 A;  2E7P A;  3ME7 A;  4HQZ A;  2XPE A;  1SEN A;  4ULX A;  5LD0 A;  4IP6 A;  2PGT A;  3GA4 A;  3DVX A;  1T8E B;  1V40 A;  1N8J A;  3M9J A;  2Z9S A;  1QXH A;  3IA1 A;  3OR5 A;  3ZTL A;  2H01 A;  3BJ5 A;  4K8M A;  1ERU A;  5B8A A;  5CRD A;  3TGZ A;  2LQO A;  1S3A A;  4P3Y B;  2DJJ A;  2LKU A;  3US3 A;  4ECB A;  4EC0 A;  2CX4 A;  6GSS A;  3KD0 A;  4TN8 A;  2HRN A;  3TRQ A;  1UN2 A;  1N2A A;  2GQK A;  1AUC A;  3TRP A;  4ZB9 A;  4GCI A;  2VCV A;  2L5O A;  5HR1 A;  3FR3 A;  1R26 A;  3UVH A;  3HJM A;  2K9F A;  3KMN A;  1EZK A;  2VLT A;  4NXI A;  3CRU A;  1A24 A;  3F3R A;  4KGI A;  2H30 A;  4WEY A;  5D96 A;  1MDI A;  3VWU A;  1OKT A;  3A5W A;  4FH8 A;  1Y25 A;  1SJZ A;  4KSM A;  3RHB A;  5DAL A;  1AAZ A;  2J9H A;  4XS4 B;  5HFG A;  2C3N A;  2KP1 A;  4TR3 A;  4AJ8 A;  2F8F A;  3LGC A;  4K0G A;  1U3A A;  4MJC A;  2BJX A;  4NWY A;  5G5F A;  4I97 A;  4FO5 A;  13GS A;  1O81 A;  5IMC A;  3DKS A;  5J9C A;  4L8E A;  1WOU A;  4POM A;  1A2L A;  3APO A;  5AGY A;  2BTO T;  3ED3 A;  4OCE A;  4ZL8 A;  4KX4 A;  2H66 A;  5FWG A;  3BD2 A;  2FY6 A;  3I6A A;  1SK2 A;  1OYJ A;  1SJI A;  3D4M A;  3EVI A;  4JU5 A;  2L6C A;  4IKH A;  4HZ2 A;  5ID2 A;  3A2X A;  1MTC A;  2B7K A;  1A0F A;  4OFN A;  1TI3 A;  2FHE A;  4D73 A;  2H71 A;  3LSZ A;  1B4Q A;  1G6Y A;  2YWI A;  3IPZ A;  3VK9 A;  5G1L A;  5ECH B;  5FHI A;  2CVB A;  4TVE A;  1EGR A;  3FZA A;  1XW5 A;  3VLN A;  2GVP A;  1SKR B;  2HZE A;  5F07 A;  5AIX A;  2FNO A;  2IMI A;  1ZYQ B;  2P31 A;  2WS2 A;  5DAL B;  1X5D A;  5JWO B;  2LST A;  2A4V A;  1LBK A;  5GAN D;  3CYN A;  1ERW A;  2VUP A;  3D21 A;  2HE3 A;  4WBJ A;  4HJ2 A;  3LOR A;  2HRF A;  2X99 A;  3KP9 A;  4I2U A;  4E8H A;  5JCW A;  5C04 A;  3VPQ A;  1RQM A;  2GSQ A;  2P0G A;  2G2Q A;  3TB2 A;  3MAK A;  4MF6 A;  2QSI A;  3TJB A;  3EC3 A;  2L6D A;  2LRN A;  4HOJ A;  11GS A;  1JHB A;  4GRF A;  2VCX A;  1TRV A;  2NVL A;  3CSJ A;  2VOC A;  2O8V B;  2VL3 A;  3G7J A;  2NDO A;  2KHP A;  3KTB A;  3LEF A;  4HQS A;  4F82 A;  3KEB A;  2IFQ B;  4MPF A;  2FLS A;  4KDX A;  2I1U A;  1K0A A;  2J23 A;  2F51 A;  2B5X A;  2OBI A;  1EEM A;  1PX6 A;  2AYT A;  20GS A;  12GS A;  2N5B A;  4BWQ A;  2KP2 A;  5CRH A;  3DWV A;  2PBJ A;  2DC5 A;  2H6X A;  3A3T A;  3IHQ A;  1GSF A;  2I3Y A;  1X5E A;  1TOF A;  2V1M A;  1XWA A;  3QDN A;  3GUR A;  3DVW A;  4K0N A;  4MJA A;  3TJK A;  2IME A;  3EMX A;  1XOA A;  4ML1 A;  5DQS A;  3DML A;  1YDK A;  1S3C A;  2H1G A;  1K3L A;  1QUW A;  1R7H A;  5HQP A;  4N30 A;  3QFB C;  4I2T A;  4RUV A;  3E9J B;  3KH7 A;  4YAP A;  2GZP A;  3KZQ A;  1EGO A;  4PQI A;  2QKE A;  2VD1 A;  2M80 A;  3GL3 A;  4EF0 A;  4PQH A;  2XHF A;  2V32 A;  5AN1 A;  3W6G A;  3GTU A;  2JAD A;  5ECP B;  5COH A;  2VL9 A;  5E59 A;  4LMW A;  3TKS A;  2QGV A;  1VRS D;  4J57 E;  3Q74 A;  3GKK A;  4LA1 A;  4X43 A;  2MYG A;  2O87 A;  2CV4 A;  2FCH A;  5B6M A;  1GNW A;  4OCF A;  2JL4 A;  3D5J A;  3G7I A;  4I5Q A;  4MAB A;  1MEK A;  2DJK A;  2HNL A;  3IDV A;  1PN9 A;  3FZ4 A;  3KCM A;  2TRC P;  3J7Y k;  3I43 A;  2YWN A;  4MF5 A;  2IMD A;  3N5O A;  1R5A A;  2L57 A;  4XRD A;  4XRA A;  2H1B A;  1AC1 A;  1OC9 B;  1SYX A;  4G9H A;  2C3Q A;  5IM9 A;  1RK4 A;  3GST A;  1AQV A;  1K0N A;  1U88 A;  4Q5F A;  1OC8 A;  4EDY A;  4KH7 A;  1GSY A;  5G5E A;  4GQF A;  4ILF A;  3QAW A;  1M9A A;  1ZMA A;  4BPY A;  2PPT A;  1TTZ A;  1URM A;  1YF1 A;  4V1A p;  4QL7 A;  1V57 A;  1GTI A;  3L78 A;  2H0H A;  1EV9 A;  3V1W A;  2A2R A;  1PMT A;  4IJ3 A;  3GUS A;  2GDR A;  2CAQ A;  2DMM A;  6GSW A;  4PUR A;  1A8L A;  3GNJ A;  3FYG A;  1PKZ A;  22GS A;  3DEX A;  4ZIL A;  2JSY A;  1KNG A;  4V2N A;  2CZ3 A;  2XPD A;  2LJR A;  3WT1 A;  4MH3 A;  1W4V A;  2PWJ A;  2PVQ A;  5F05 A;  4PX1 A;  2JZR A;  4OMV A;  4KUN A;  1X9S B;  1I5G A;  2H76 A;  2N5A A;  1PQN A;  5ECI B;  5ELG A;  4FIW A;  5IMZ A;  4PUA A;  5LNK e;  3IR4 A;  4BVY A;  2OE0 A;  4X0X A;  2ON5 A;  4MLY A;  1THX A;  3QAG A;  5D8I A;  2XC2 A;  3HJP A;  1NHY A;  2B7J A;  4EE0 A;  1YY7 A;  3D0Z A;  1VGL A;  2OKA A;  1LU4 A;  2YJH A;  2VIM A;  3RAZ A;  4TW5 A;  1A23 A;  4TR1 B;  2H0I A;  1YEX A;  3ZML A;  6GSX A;  4POL A;  1XWC A;  5AIS A;  3HVV A;  2F8A A;  6GSU A;  1TK5 B;  4AF2 A;  3WT2 A;  1DE1 A;  3M3M A;  4JR6 A;  2C0E A;  2GST A;  4WF5 A;  1GTA A;  2HI7 A;  3Q18 A;  2FWF A;  2DJ0 A;  3O3T A;  4J56 E;  4PUF C;  3D22 A;  3AY8 A;  2LRC A;  3GRX A;  1HYU A;  3ME8 A;  1KEB A;  3WD6 A;  3FEU A;  3WGX A;  3QPM A;  5L71 A;  4CW9 A;  4MZW A;  2C0G A;  1F3B A;  1SL2 B;  3ZVJ A;  3QD9 A;  4MZB A;  4JR4 A;  2MBT A;  2MZC A;  1SK0 A;  4KA0 A;  1NHO A;  2H1A A;  2QC7 A;  3KM6 A;  5D9W A;  3ZMK A;  1ERV A;  1DE2 A;  3DGQ A;  4XCS A;  1R4W A;  5A4U A;  2LTK A;  4ML6 A;  1M2B A;  3TJF A;  2DSA A;  3P90 A;  2OAD A;  4PNF A;  5C00 A;  4V2M A;  2MBS A;  5KN1 A;  2LRT A;  4TOP A;  4NMU A;  4DSR A;  4GSN A;  3UJ1 A;  4O5R A;  3C1R A;  4IEL A;  5D93 A;  3I69 A;  1ZOF A;  5H5R A;  4EL1 A;  3IV4 A;  1LJR A;  3EUR A;  3LJR A;  1O85 A;  2CQ9 A;  2MMA A;  4K1F A;  2VD0 A;  5CP1 A;  1WIK A;  3QCP A;  3GHA A;  1ERT A;  2E2M A;  18GS A;  3KTL A;  3TJJ A;  4DSQ A;  2M72 A;  4K7I A;  2ES7 A;  1SD8 A;  3H93 A;  1TRU A;  1OAZ A;  2GT6 A;  3HVS A;  5H5S A;  2GGT A;  1JZO A;  1XWB A;  1ZZY A;  4YQU A;  3ZVJ D;  1IYI A;  1UA5 A;  1BG5 A;  4BWS A;  5J3R A;  2K8S A;  3GX0 A;  5EVO A;  2FWE A;  5IMD A;  2LNT A;  3CTF A;  1AW9 A;  1XBS A;  1B9X C;  3LFL A;  3NIV A;  2RII A;  3TKS C;  4Q5R A;  1WWJ A;  3WGE A;  3M8N A;  1Z6N A;  1T00 A;  3F63 A;  3LG6 A;  1JZR A;  3HKR A;  2FWG A;  1PX7 A;  4CDO A;  4YAV A;  3VI7 A;  1DUG A;  3ERF A;  1MDK A;  4OO5 A;  1XWK A;  4XIH A;  2IMF A;  3MNG A;  4K6X A;  1FW1 A;  3UAR A;  5IQY A;  1K0C A;  3CBU A;  3U6V A;  2TIR A;  3RPP A;  4NHW A;  1EV4 A;  5HR3 A;  2R4V A;  1HQO A;  3EMP A;  3Q19 A;  2B1L A;  1XWG A;  5CNW A;  3CRT A;  3ISO A;  4MMM A;  1XW9 A;  2OE1 A;  5IPG A;  4WR4 A;  2H72 A;  1UVZ A;  4HZ4 A;  4JED A;  3KIJ A;  3SBC A;  2G0F A;  3P7X A;  4L0U A;  5ECL B;  1MDJ A;  2DLX A;  3L9V A;  4LLR A;  3ERW A;  2AV4 A;  2CAI A;  1XXU A;  5DJM A;  4N11 A;  1KTE A;  3F3Q A;  1TRW A;  4WXT A;  1XFL A;  1FOV A;  5D9V A;  4ZBB A;  1TU7 A; 
#chains in the Genus database with same CATH topology
 3QR6 A;  4NAX A;  1GSQ A;  1U3I A;  1M99 A;  1GSU A;  2CX3 A;  3FR6 A;  1XIY A;  3F8U A;  1SK1 A;  2WCI A;  4XHM A;  2GQM A;  3C71 A;  5D9T A;  2IN3 A;  2N5F A;  5B6N A;  3FW2 A;  2WRT A;  1F3A A;  2XBI A;  2VCW A;  1FAA A;  1GTU A;  5H5Q A;  3ZFL A;  4OD7 A;  1PFO A;  6GSY A;  2GS3 A;  5JCG A;  4K7N A;  5JWQ B;  2HXK A;  3FKF A;  1A2M A;  2PVO C;  4RQR A;  4L5O A;  3IRA A;  1NM3 A;  4F2I A;  1XOB A;  1JFU A;  1S3D A;  1ZYN A;  5ID2 B;  2VAF A;  2JZT A;  2YP6 A;  5G1K A;  4EUY A;  1ZYE A;  1GLP A;  3FK8 A;  3HJO A;  3F9U A;  1QQ2 A;  4D73 B;  4HJM A;  1PA3 A;  1Z6M A;  2FA4 A;  5ECK B;  2YWO A;  2OJL A;  3GKN A;  1G7E A;  1Q98 A;  4JBB A;  1X9W B;  4O32 A;  1V58 A;  1PGT A;  3P2A A;  5ECN B;  3KP8 A;  4MP4 A;  3DIE A;  5IOX A;  3HZ4 A;  2HZE B;  3CQF A;  1C72 A;  4BL7 A;  3R2Q A;  4CHS A;  4GXZ A;  3IE3 A;  2DIY A;  1DBY A;  4TXV A;  4PTS A;  4LL4 B;  4RI7 A;  3GV1 A;  1SJ6 A;  3RDW A;  4FYB A;  4G0I A;  4ECI A;  2I81 A;  1WJK A;  3SWL A;  3A2V A;  2FWH A;  3APS A;  3O76 A;  5CAX A;  3VWV A;  4N0Z A;  3VWW A;  2GLR A;  3WYW A;  1B48 A;  3LWA A;  1BYE A;  4DVC A;  5EL8 A;  2WDU A;  1GWC A;  1TU8 A;  5ELA A;  1MD4 A;  5GST A;  1PN0 A;  3GN3 A;  2LQQ A;  4IQ1 A;  4WF4 A;  4MZC A;  2DKH A;  1PD2 1;  19GS A;  5KN3 A;  4TR0 A;  5IOW A;  5J4U A;  1YF0 A;  2VL2 A;  3D6I A;  4DSS A;  1V98 A;  5G30 A;  4MPG A;  3QOU A;  2QA1 A;  3ZIJ A;  5KN0 A;  4Z2U A;  1SD9 A;  2C8U A;  4O5Q A;  2IMK A;  3CTG A;  1EWX A;  3IOS A;  2L4C A;  4TRX A;  5DVB A;  4MK3 A;  2YWM A;  4XS6 A;  3PGT A;  2JZS A;  5J41 A;  17GS A;  2HFD A;  4EDZ A;  5ABR A;  1V9W A;  4HUA A;  2YV7 A;  4KF9 A;  1IYH A;  4G2E A;  1Q4J A;  4BL7 B;  2D2Z A;  1TI1 A;  2FD3 A;  1GL8 A;  1GUK A;  3N9J A;  1VF1 A;  1G7O A;  4RI6 A;  2R3X A;  1PKW A;  1FVK A;  4F0B A;  1ZL9 A;  2LS5 A;  4POB A;  4HI7 A;  2LV3 A;  5KN2 A;  4I8B A;  3HDC A;  2ON7 A;  2IJY A;  3EWL A;  5CO3 A;  3ZIT A;  2RUF A;  1SL1 B;  3IC4 A;  3G9B A;  2EIR A;  5IMA A;  2HLS A;  2RUE A;  3RHC A;  8GSS A;  4BA7 A;  1YKA A;  3PIN A;  1T1V A;  4HU9 A;  1K3Y A;  2K6V A;  2B5Y A;  4DSS B;  3GTU B;  4HSC X;  2H75 A;  1M3J A;  1O8X A;  2AHE A;  4KDY A;  5CRG A;  4IN0 A;  1VF3 A;  4ICY A;  3O6T A;  3C73 A;  1FHE A;  1JZD A;  3TKS E;  2E0Q A;  1AIU A;  1TK0 B;  1K0B A;  1W89 A;  4GSS A;  3K8N A;  2A2P A;  1GLQ A;  1Z7P A;  3VPT A;  3G7Y A;  2GT5 A;  2IL3 A;  4G10 A;  5IMF A;  2C80 A;  3TOT A;  2RM6 A;  3VI5 A;  4ZBD A;  5A4W A;  2WJU A;  4AJ6 A;  4OWY A;  1OC3 A;  2YZU A;  3D4T A;  5DCH A;  3ZRE A;  1E6B A;  2WUL A;  3ZRD A;  4ACS A;  2NPB A;  5CRW A;  1WPI A;  5FT3 A;  4FYC A;  4ZIJ A;  1H4O A;  3TJG A;  2VM1 A;  4WET A;  1VF4 A;  4DEJ A;  3CSH A;  3TKP A;  5G31 A;  1TJD A;  5DBQ A;  2CZ2 A;  4QL9 A;  4I6X A;  4AJ7 A;  3UBL A;  3WGD A;  2FUG 2;  3MWH A;  2C0D A;  3QMX A;  2B6M A;  1QK8 A;  4Q5N A;  3BOA A;  4O92 A;  2YZH A;  3FRC A;  2BMX A;  2LNS A;  1YEP A;  1EOG A;  1EOH A;  4MF7 A;  2ZUP A;  5JCU A;  3ZIV A;  2E2G A;  4IJI A;  5F8B A;  1GSE A;  2YCD A;  4BVX A;  1Z3E A;  4GWR A;  2CA8 A;  1V2A A;  2F3M A;  3DD3 A;  3HY2 A;  3NZN A;  5DJL A;  2OA7 A;  4PQ1 A;  4ZB6 A;  2V6O A;  1M0U A;  3GKX A;  2HT9 A;  4GTU A;  3VWX A;  2H6Y A;  2NTO A;  5DQY A;  1HNA A;  3FZ5 A;  1SYR A;  1OE8 A;  5HR0 A;  2PMT A;  1GP1 A;  2X8H A;  1YZX A;  1CQH A;  3C8E A;  2JAC A;  1TKD B;  3L9U A;  3UMA A;  5ECS A;  1FG4 A;  2VLV A;  2CVD A;  1B8X A;  4X1U A;  3UEM A;  3LXZ A;  1G0T A;  3H4K A;  2AAW A;  1SKS B;  1ON4 A;  3MSZ A;  2C1Y A;  4IW9 A;  2AB6 A;  4ZXG A;  2H1D A;  5AIV A;  2RLI A;  1ZCP A;  2XBQ A;  1F6M C;  3U5R E;  3HCZ A;  3UBK A;  4JRR A;  2WFC A;  4PXO A;  1FB0 A;  2MMN A;  3M0F A;  2JU5 A;  2H73 A;  1K0M A;  2HRK A;  1PRX A;  2VL2 C;  4POK A;  5ECO B;  3RPN A;  1TP9 A;  1PL1 A;  4IP1 A;  1QMV A;  5BRT A;  1A0R P;  4MH2 A;  1ST9 A;  2B5E A;  4GQC A;  5IIZ A;  3HVN A;  4NV2 A;  4ZBA A;  4NV5 A;  1OVN A;  5D9X A;  2X49 A;  4KE3 A;  1VF2 A;  1ZGN A;  3TKQ A;  4F9Z A;  2WGR A;  5ECQ B;  4Z7X A;  3LXT A;  3VFI A;  1PL2 A;  2VLU A;  3C1S A;  4EVM A;  2A2S A;  2HYX A;  1Z9H A;  1RW1 A;  2H6Z A;  2KUC A;  1AXD A;  3LYK A;  1Y6E A;  4ECJ A;  3E0U A;  3IK9 A;  3GFK A;  2GSR A;  2PER A;  3IC8 A;  1HNB A;  1FB6 A;  4IGJ A;  2X8C A;  3KH9 A;  1X0R A;  3MYD A;  1GUH A;  2H74 A;  1MD3 A;  4HDE A;  1XW6 A;  4OO4 A;  2V2G A;  2OE3 A;  1BED A;  3HXS A;  2DJ1 A;  1JLW A;  3HA9 A;  3NOF A;  3I9V 2;  3ZZX A;  4AGS A;  2AUV A;  2K18 A;  5BMU A;  2DJ3 A;  2C4J A;  2NBS A;  3M9K A;  3MIX A;  2CT6 A;  4IVF A;  1WRY A;  1ACV A;  3KXO A;  3UOM A;  4KW6 A;  3ZLP A;  4GF0 A;  4IQA A;  4KAE A;  4A5P A;  2P5R A;  3GX8 A;  16GS A;  2IFQ A;  3RBT A;  3FR9 A;  4GST A;  3BBY A;  3PR8 A;  5GSS A;  2PN8 A;  1TXX A;  4OFM A;  1X5C A;  2GQL A;  1THO A;  3FZ9 A;  3UIW A;  2DJ2 A;  3F4S A;  4L5L A;  4ZB8 A;  1WE0 A;  1TRS A;  5INY A;  4Q5Q A;  1OKD A;  2VCT A;  2JSZ A;  3MDK A;  3QAV A;  2C0F A;  3TRX A;  4TXO A;  3GSS A;  1YKC A;  1FVJ A;  1TW9 A;  2YN1 A;  2ALB A;  2X64 A;  1GNE A;  2R2J A;  4PGT A;  3M1G A;  1J0F A;  4WKW A;  3TOU A;  4KCA A;  1H75 A;  3H79 A;  5IPH A;  5GZZ B;  2YJ7 A;  1K0D A;  2ZNM A;  3DXB A;  1UC7 A;  2H19 A;  1EP7 A;  2HSY A;  2WZ9 A;  2P5Q A;  1ABA A;  4NHZ A;  1A2J A;  4YKG A;  3L0H A;  1GTB A;  2MMZ A;  4MCU A;  2VM2 A;  3QFA C;  4K2D A;  3TCO A;  1XZO A;  1F37 A;  3IAM 2;  4KDU A;  1NSW A;  4EO3 A;  1EEJ A;  1HNC A;  1A8Y A;  4FYU A;  3Q6O A;  3GKM A;  3BCI A;  4KCE A;  1K3O A;  4IS0 A;  1I9D A;  3CMI A;  4J2F A;  3F6D A;  1GH2 A;  1BJX A;  5IMV A;  1BX9 A;  1GSD A;  2DIZ A;  3EU3 A;  5HR2 A;  3IK7 A;  5HFI A;  1SKW B;  1PSQ A;  2M46 A;  3P8W A;  2K8V A;  4L0W A;  1KBN A;  3GL5 A;  1GUM A;  1WMJ A;  4ISD A;  5G2Z A;  4QQ7 A;  5IO0 A;  1YJ6 A;  4PNG A;  3GH6 A;  2B1K A;  4TXO B;  2X8G A;  4YQV A;  4YH2 A;  3KJY A;  2C3T A;  3R3E A;  1SL0 B;  6GSV A;  2VO4 A;  3HYP A;  3TDG A;  2YAN A;  2KLX A;  1AQW A;  5CYY A;  5ECM B;  1OC9 A;  1WP0 A;  4K7O A;  4MJE A;  2YV9 A;  4YQM A;  1XVQ A;  2DBC A;  4ZL7 A;  1O7U A;  4XS1 A;  1HD2 A;  5DAK A;  3F4R A;  2YPM A;  4O7H A;  2VCZ A;  2L5L A;  2AJQ B;  3LYP A;  2V41 A;  1ILO A;  3C7M A;  5F0G A;  3A5I A;  2PUK C;  1NW2 A;  1Z7R A;  2RM5 A;  4K2X A;  2OAC A;  2ZCT A;  3JCM L;  1Z5Y E;  1R5P A;  3F0I A;  3IHG A;  4IBP A;  2V6K A;  3H1N A;  1M7T A;  1ZYP A;  1XPV A;  3IXR A;  2B3S A;  3FY7 A;  3KGK A;  5ECR B;  2MMO A;  3A2W A;  3E3E A;  4TR4 A;  1T3B A;  3UL3 A;  1X9M B;  3UAP A;  3H8Q A;  2YOI A;  4LMV A;  2LEG A;  2L4Q A;  5JWR B;  3J7Y b;  4KSO A;  1T4Z A;  3IBH A;  1JLV A;  2O89 A;  2OBK A;  2GSS A;  1J9B A;  2WB9 A;  2R0C A;  1JZW A;  1ML6 A;  4N10 A;  5ENU A;  4EXJ A;  3F6F A;  4K5R A;  2O7K A;  4CY6 A;  3APQ A;  4EIP A;  1BQ7 A;  3PH9 A;  3IAS 2;  3F4T A;  2L59 A;  1QGV A;  3VUR A;  3GYK A;  3LQ7 A;  3DRN A;  1USB A;  4HS1 A;  2TRX A;  4JE1 A;  1XCC A;  4TR1 A;  14GS A;  5DAK B;  1M2D A;  4HEA 2;  2GZY A;  3HD5 A;  3CXG A;  1U6T A;  1YQ1 A;  3ZYW A;  3GH9 A;  2LJA A;  4K9Z A;  1F2E A;  5J9B A;  1E2Y A;  2VCQ A;  5B8B A;  5CRE A;  2R5G A;  5A4V A;  4EKZ A;  2CVK A;  4V2L A;  1EP8 A;  4KND A;  4NPB A;  1FO5 A;  4H86 A;  1K0O A;  4GLT A;  3HZ8 A;  4WBR D;  1M2A A;  1QFN A;  5HFK A;  5IO2 A;  2LUS A;  1B9Y C;  2I9H A;  1TK8 B;  4LL1 B;  1CQG A;  3HHV A;  1T4Y A;  2FA8 A;  3HVX A;  4X4J A;  5KEJ A;  3EIN A;  2F9S A;  1TDI A;  4XTS A;  1F9M A;  2HSH A;  5EY6 A;  1M3I A;  3S9F A;  5B7C A;  2EIO A;  4HU7 A;  3ERG A;  2DML A;  9GSS A;  2YNX A;  3EE2 A;  1XVW A;  1G6W A;  3UVT A;  3BCK A;  5DCG A;  1O6J A;  3L4N A;  1M9B A;  4F0C A;  3ZFB A;  4IHU A;  1BAY A;  2GTU A;  4RQX A;  2REM A;  1B4P A;  3L9S A;  5LCZ A;  1OE7 A;  3FHK A;  2DKI A;  4N0V A;  2HZF A;  2H8L A;  5J5N A;  2LJK A;  5D73 A;  1DSB A;  4G19 A;  4F03 A;  2IPA A;  1O73 A;  4E8E A;  5GAP D;  3TKR A;  1O8W A;  2H70 A;  2EC4 A;  2IWT A;  2KOK A;  2FGX A;  4ECC A;  4ZL9 A;  4MDC A;  3KMO A;  10GS A;  1GRX A;  2I4A A;  5EPF A;  3TUE A;  1AQX A;  2QA2 A;  2O85 A;  1J08 A;  3W8J A;  2EIQ A;  2GZZ A;  5A5K A;  5F06 A;  4OFT A;  3W8S A;  3GMF A;  5E4W A;  2PU9 C;  2H0G A;  1GUL A;  1GSS A;  4WR5 A;  6GST A;  4V1A g;  3GIX A;  3ZL5 A;  1T7P B;  4XS4 A;  1SU9 A;  4JZQ A;  3DYR A;  4TKY A;  3EYT A;  1XG8 A;  4ID0 A;  2IIY A;  7GSS A;  3CSI A;  5DDL A;  2R6K A;  1U87 A;  3EU4 A;  4MJB A;  2R37 A;  4MA9 A;  1S3R A;  4KB3 A;  2E7P A;  3ME7 A;  4HQZ A;  2XPE A;  1SEN A;  4ULX A;  5LD0 A;  4IP6 A;  2PGT A;  3GA4 A;  3DVX A;  1T8E B;  1V40 A;  1N8J A;  3M9J A;  2Z9S A;  1QXH A;  4YKF A;  3IA1 A;  3OR5 A;  3ZTL A;  2H01 A;  3BJ5 A;  4K8M A;  1ERU A;  5B8A A;  5CRD A;  3TGZ A;  2LQO A;  1S3A A;  2UZ8 A;  4P3Y B;  2DJJ A;  2LKU A;  3US3 A;  4ECB A;  4EC0 A;  2CX4 A;  6GSS A;  3KD0 A;  4TN8 A;  2HRN A;  3TRQ A;  1UN2 A;  1N2A A;  2GQK A;  1AUC A;  3TRP A;  4ZB9 A;  4GCI A;  2VCV A;  2L5O A;  5HR1 A;  3FR3 A;  1R26 A;  3UVH A;  3HJM A;  2K9F A;  3KMN A;  1EZK A;  4BVX B;  2VLT A;  4NXI A;  3CRU A;  1A24 A;  3F3R A;  4KGI A;  2H30 A;  4WEY A;  5D96 A;  1MDI A;  3VWU A;  1OKT A;  3A5W A;  4FH8 A;  1Y25 A;  1SJZ A;  4KSM A;  4USS A;  3RHB A;  5DAL A;  1AAZ A;  2J9H A;  4XS4 B;  5HFG A;  2C3N A;  2KP1 A;  4TR3 A;  4AJ8 A;  2F8F A;  3LGC A;  4K0G A;  1U3A A;  4MJC A;  2BJX A;  4NWY A;  5G5F A;  4I97 A;  4FO5 A;  13GS A;  1O81 A;  5IMC A;  3DKS A;  5J9C A;  4L8E A;  1WOU A;  4POM A;  1A2L A;  3APO A;  5AGY A;  2BTO T;  3ED3 A;  4OCE A;  4ZL8 A;  4KX4 A;  2H66 A;  5FWG A;  3BD2 A;  2FY6 A;  3I6A A;  1SK2 A;  1OYJ A;  1SJI A;  3D4M A;  3EVI A;  4JU5 A;  2L6C A;  4IKH A;  4HZ2 A;  5ID2 A;  3A2X A;  1MTC A;  4Z2T A;  2B7K A;  1A0F A;  4OFN A;  1TI3 A;  2FHE A;  4D73 A;  2H71 A;  3LSZ A;  1B4Q A;  1G6Y A;  2YWI A;  3IPZ A;  3VK9 A;  2X4A A;  5G1L A;  5ECH B;  3LW9 A;  5FHI A;  2CVB A;  4TVE A;  1EGR A;  3FZA A;  1XW5 A;  3VLN A;  2GVP A;  1SKR B;  2HZE A;  5F07 A;  5AIX A;  2FNO A;  2IMI A;  1ZYQ B;  2P31 A;  2WS2 A;  2HSM A;  5DAL B;  1X5D A;  5JWO B;  2LST A;  2A4V A;  1LBK A;  5GAN D;  3CYN A;  1ERW A;  4Z2R A;  2VUP A;  3D21 A;  2HE3 A;  4WBJ A;  4HJ2 A;  3LOR A;  2HRF A;  2X99 A;  3KP9 A;  4I2U A;  4E8H A;  5JCW A;  5C04 A;  3VPQ A;  1RQM A;  2GSQ A;  2P0G A;  2G2Q A;  3TB2 A;  3MAK A;  4MF6 A;  2QSI A;  3TJB A;  3EC3 A;  2L6D A;  2LRN A;  4HOJ A;  11GS A;  1JHB A;  4GRF A;  2VCX A;  1TRV A;  2NVL A;  3CSJ A;  2VOC A;  2O8V B;  2VL3 A;  3G7J A;  2NDO A;  2KHP A;  3KTB A;  3LEF A;  4HQS A;  4F82 A;  3KEB A;  2IFQ B;  4MPF A;  2FLS A;  4KDX A;  2I1U A;  1K0A A;  2J23 A;  2F51 A;  2B5X A;  2OBI A;  1EEM A;  1PX6 A;  3FMW A;  2AYT A;  20GS A;  12GS A;  2N5B A;  4BWQ A;  2KP2 A;  5CRH A;  3DWV A;  2PBJ A;  2DC5 A;  2H6X A;  3A3T A;  3IHQ A;  1GSF A;  2I3Y A;  1X5E A;  1TOF A;  2V1M A;  1XWA A;  3QDN A;  3GUR A;  3DVW A;  4K0N A;  4MJA A;  3TJK A;  2IME A;  2R0G A;  3EMX A;  1XOA A;  4ML1 A;  5DQS A;  3DML A;  1YDK A;  1S3C A;  2H1G A;  1K3L A;  1QUW A;  1R7H A;  5HQP A;  4N30 A;  3QFB C;  4I2T A;  4K5S A;  4RUV A;  3E9J B;  3KH7 A;  4YAP A;  2GZP A;  3KZQ A;  1EGO A;  4PQI A;  4FQU A;  2QKE A;  2VD1 A;  2M80 A;  3GL3 A;  4EF0 A;  4PQH A;  2XHF A;  2V32 A;  5AN1 A;  3W6G A;  3GTU A;  2JAD A;  5ECP B;  5COH A;  2VL9 A;  5E59 A;  4LMW A;  3TKS A;  2QGV A;  1VRS D;  4J57 E;  3Q74 A;  3GKK A;  4LA1 A;  4X43 A;  2MYG A;  2O87 A;  2CV4 A;  2FCH A;  5B6M A;  4MNN A;  1GNW A;  4OCF A;  2JL4 A;  3D5J A;  3G7I A;  4I5Q A;  4MAB A;  1MEK A;  2DJK A;  2HNL A;  3IDV A;  1PN9 A;  3FZ4 A;  3KCM A;  2TRC P;  3J7Y k;  3I43 A;  2YWN A;  4MF5 A;  2IMD A;  3N5O A;  1R5A A;  2L57 A;  4XRD A;  4XRA A;  2H1B A;  1AC1 A;  1OC9 B;  1SYX A;  4G9H A;  2C3Q A;  5IM9 A;  1RK4 A;  3GST A;  1AQV A;  1K0N A;  1U88 A;  4Q5F A;  1OC8 A;  4EDY A;  4KH7 A;  4G0L A;  3EPT A;  1GSY A;  5G5E A;  4GQF A;  5KOX A;  4ILF A;  3QAW A;  1M9A A;  1ZMA A;  4BPY A;  2PPT A;  1TTZ A;  1URM A;  1YF1 A;  4V1A p;  4QL7 A;  1V57 A;  1GTI A;  3L78 A;  1FOH A;  2H0H A;  1EV9 A;  3V1W A;  2A2R A;  1PMT A;  4IJ3 A;  3GUS A;  2GDR A;  2CAQ A;  2DMM A;  4O5U A;  6GSW A;  4PUR A;  1A8L A;  3GNJ A;  3FYG A;  1PKZ A;  22GS A;  3DEX A;  4ZIL A;  2JSY A;  1KNG A;  4V2N A;  2CZ3 A;  2XPD A;  2LJR A;  3WT1 A;  4MH3 A;  1W4V A;  2PWJ A;  2PVQ A;  5F05 A;  4PX1 A;  2JZR A;  4OMV A;  4KUN A;  1X9S B;  1I5G A;  2H76 A;  2N5A A;  1PQN A;  5ECI B;  5ELG A;  4FIW A;  5IMZ A;  4PUA A;  5LNK e;  3IR4 A;  4BVY A;  2OE0 A;  4X0X A;  2ON5 A;  4MLY A;  1THX A;  3QAG A;  5D8I A;  2XC2 A;  3HJP A;  1NHY A;  2B7J A;  4EE0 A;  1YY7 A;  3D0Z A;  1VGL A;  2OKA A;  1LU4 A;  2YJH A;  2VIM A;  3RAZ A;  4TW5 A;  4EIQ A;  1A23 A;  4TR1 B;  2H0I A;  1YEX A;  3ZML A;  6GSX A;  4POL A;  1XWC A;  5AIS A;  3HVV A;  2F8A A;  6GSU A;  1TK5 B;  4AF2 A;  3WT2 A;  1DE1 A;  3M3M A;  4JR6 A;  2C0E A;  2GST A;  4WF5 A;  1GTA A;  2HI7 A;  3Q18 A;  2FWF A;  2DJ0 A;  3O3T A;  4J56 E;  4PUF C;  3D22 A;  3AY8 A;  2LRC A;  3GRX A;  1HYU A;  3ME8 A;  1KEB A;  3WD6 A;  3FEU A;  3WGX A;  3QPM A;  5L71 A;  4CW9 A;  4MZW A;  2C0G A;  1F3B A;  1SL2 B;  3ZVJ A;  2HRA A;  3QD9 A;  4MZB A;  4JR4 A;  2MBT A;  2MZC A;  1SK0 A;  4KA0 A;  1NHO A;  2H1A A;  2QC7 A;  3KM6 A;  5D9W A;  3ZMK A;  1ERV A;  1DE2 A;  3DGQ A;  4G0K A;  4XCS A;  1R4W A;  5A4U A;  2LTK A;  4ML6 A;  1M2B A;  3TJF A;  2DSA A;  3P90 A;  2OAD A;  4PNF A;  5C00 A;  4V2M A;  2MBS A;  5KN1 A;  2LRT A;  4TOP A;  2A4H A;  4NMU A;  4DSR A;  4GSN A;  3UJ1 A;  4O5R A;  3C1R A;  4IEL A;  5D93 A;  3I69 A;  1ZOF A;  5H5R A;  4BVY B;  4EL1 A;  3IV4 A;  1LJR A;  3EUR A;  3LJR A;  1O85 A;  2CQ9 A;  2MMA A;  4K1F A;  2VD0 A;  5CP1 A;  1WIK A;  3QCP A;  3GHA A;  1ERT A;  2E2M A;  18GS A;  2R0P A;  3KTL A;  3TJJ A;  4DSQ A;  2M72 A;  4K7I A;  2ES7 A;  1SD8 A;  3H93 A;  1TRU A;  1OAZ A;  2GT6 A;  3HVS A;  5H5S A;  2GGT A;  1JZO A;  1XWB A;  1ZZY A;  4YQU A;  3ZVJ D;  1IYI A;  1UA5 A;  1BG5 A;  4BWS A;  5J3R A;  2K8S A;  3GX0 A;  5EVO A;  2FWE A;  5IMD A;  2LNT A;  3CTF A;  1AW9 A;  1XBS A;  1B9X C;  3LFL A;  3NIV A;  2RII A;  3TKS C;  4Q5R A;  1WWJ A;  3WGE A;  3M8N A;  1Z6N A;  1T00 A;  3F63 A;  3LG6 A;  1JZR A;  3HKR A;  2FWG A;  1PX7 A;  4CDO A;  4YAV A;  3VI7 A;  1DUG A;  3ERF A;  1MDK A;  4OO5 A;  1XWK A;  4XIH A;  3PPU A;  2IMF A;  3MNG A;  4K6X A;  1FW1 A;  3UAR A;  5IQY A;  1K0C A;  3CBU A;  3U6V A;  4BIK A;  2TIR A;  3RPP A;  4NHW A;  1EV4 A;  5HR3 A;  2R4V A;  1HQO A;  3EMP A;  3Q19 A;  2B1L A;  1XWG A;  5CNW A;  3CRT A;  3ISO A;  4MMM A;  1XW9 A;  2OE1 A;  5IPG A;  4WR4 A;  2H72 A;  1UVZ A;  4HZ4 A;  4JED A;  3KIJ A;  3SBC A;  2G0F A;  3P7X A;  4L0U A;  5ECL B;  5KOW A;  1MDJ A;  2DLX A;  3L9V A;  4LLR A;  3ERW A;  2AV4 A;  2CAI A;  1XXU A;  5DJM A;  4N11 A;  1KTE A;  3F3Q A;  1TRW A;  4WXT A;  1XFL A;  1FOV A;  5D9V A;  4ZBB A;  1TU7 A;  4CY8 A; 
#chains in the Genus database with same CATH homology
 3QR6 A;  4NAX A;  1GSQ A;  1U3I A;  1M99 A;  1GSU A;  2CX3 A;  3FR6 A;  1XIY A;  3F8U A;  1SK1 A;  2WCI A;  4XHM A;  2GQM A;  3C71 A;  5D9T A;  2IN3 A;  2N5F A;  5B6N A;  3FW2 A;  2WRT A;  1F3A A;  2XBI A;  2VCW A;  1FAA A;  1GTU A;  5H5Q A;  3ZFL A;  4OD7 A;  6GSY A;  2GS3 A;  5JCG A;  4K7N A;  5JWQ B;  2HXK A;  3FKF A;  1A2M A;  2PVO C;  4RQR A;  4L5O A;  3IRA A;  1NM3 A;  4F2I A;  1XOB A;  1JFU A;  1S3D A;  1ZYN A;  5ID2 B;  2VAF A;  2JZT A;  2YP6 A;  5G1K A;  4EUY A;  1ZYE A;  1GLP A;  3FK8 A;  3HJO A;  3F9U A;  1QQ2 A;  4D73 B;  4HJM A;  1PA3 A;  1Z6M A;  2FA4 A;  5ECK B;  2YWO A;  2OJL A;  3GKN A;  1G7E A;  1Q98 A;  4JBB A;  1X9W B;  4O32 A;  1V58 A;  1PGT A;  3P2A A;  5ECN B;  3KP8 A;  4MP4 A;  3DIE A;  5IOX A;  3HZ4 A;  2HZE B;  1C72 A;  4BL7 A;  3R2Q A;  4CHS A;  4GXZ A;  3IE3 A;  2DIY A;  1DBY A;  4TXV A;  4PTS A;  4LL4 B;  4RI7 A;  3GV1 A;  1SJ6 A;  3RDW A;  4FYB A;  4G0I A;  4ECI A;  2I81 A;  1WJK A;  3SWL A;  3A2V A;  2FWH A;  3APS A;  3O76 A;  5CAX A;  3VWV A;  4N0Z A;  3VWW A;  2GLR A;  3WYW A;  1B48 A;  3LWA A;  1BYE A;  4DVC A;  5EL8 A;  2WDU A;  1GWC A;  1TU8 A;  5ELA A;  1MD4 A;  5GST A;  1PN0 A;  3GN3 A;  2LQQ A;  4IQ1 A;  4WF4 A;  4MZC A;  2DKH A;  1PD2 1;  19GS A;  5KN3 A;  4TR0 A;  5IOW A;  5J4U A;  1YF0 A;  2VL2 A;  3D6I A;  4DSS A;  1V98 A;  5G30 A;  4MPG A;  3QOU A;  2QA1 A;  3ZIJ A;  5KN0 A;  4Z2U A;  1SD9 A;  2C8U A;  4O5Q A;  2IMK A;  3CTG A;  1EWX A;  3IOS A;  2L4C A;  4TRX A;  5DVB A;  4MK3 A;  2YWM A;  4XS6 A;  3PGT A;  2JZS A;  5J41 A;  17GS A;  2HFD A;  4EDZ A;  5ABR A;  1V9W A;  4HUA A;  2YV7 A;  4KF9 A;  1IYH A;  4G2E A;  1Q4J A;  4BL7 B;  2D2Z A;  1TI1 A;  2FD3 A;  1GL8 A;  1GUK A;  3N9J A;  1VF1 A;  1G7O A;  4RI6 A;  2R3X A;  1PKW A;  1FVK A;  4F0B A;  1ZL9 A;  2LS5 A;  4POB A;  4HI7 A;  2LV3 A;  5KN2 A;  4I8B A;  3HDC A;  2ON7 A;  2IJY A;  3EWL A;  5CO3 A;  3ZIT A;  2RUF A;  1SL1 B;  3IC4 A;  3G9B A;  2EIR A;  5IMA A;  2HLS A;  2RUE A;  3RHC A;  8GSS A;  4BA7 A;  1YKA A;  3PIN A;  1T1V A;  4HU9 A;  1K3Y A;  2K6V A;  2B5Y A;  4DSS B;  3GTU B;  2H75 A;  1O8X A;  2AHE A;  4KDY A;  5CRG A;  4IN0 A;  1VF3 A;  4ICY A;  3O6T A;  3C73 A;  1FHE A;  1JZD A;  3TKS E;  2E0Q A;  1AIU A;  1TK0 B;  1K0B A;  1W89 A;  4GSS A;  3K8N A;  2A2P A;  1GLQ A;  1Z7P A;  3VPT A;  3G7Y A;  2GT5 A;  2IL3 A;  4G10 A;  5IMF A;  2C80 A;  3TOT A;  2RM6 A;  3VI5 A;  4ZBD A;  5A4W A;  2WJU A;  4AJ6 A;  4OWY A;  1OC3 A;  2YZU A;  3D4T A;  5DCH A;  3ZRE A;  1E6B A;  2WUL A;  3ZRD A;  4ACS A;  2NPB A;  5CRW A;  1WPI A;  5FT3 A;  4FYC A;  4ZIJ A;  1H4O A;  3TJG A;  2VM1 A;  4WET A;  1VF4 A;  4DEJ A;  3CSH A;  3TKP A;  5G31 A;  1TJD A;  5DBQ A;  2CZ2 A;  4QL9 A;  4I6X A;  4AJ7 A;  3UBL A;  3WGD A;  2FUG 2;  3MWH A;  2C0D A;  3QMX A;  2B6M A;  1QK8 A;  4Q5N A;  3BOA A;  4O92 A;  2YZH A;  3FRC A;  2BMX A;  2LNS A;  1YEP A;  1EOG A;  1EOH A;  4MF7 A;  2ZUP A;  5JCU A;  3ZIV A;  2E2G A;  4IJI A;  5F8B A;  1GSE A;  2YCD A;  4BVX A;  1Z3E A;  4GWR A;  2CA8 A;  1V2A A;  2F3M A;  3DD3 A;  3HY2 A;  3NZN A;  5DJL A;  2OA7 A;  4PQ1 A;  4ZB6 A;  2V6O A;  1M0U A;  3GKX A;  2HT9 A;  4GTU A;  3VWX A;  2H6Y A;  2NTO A;  5DQY A;  1HNA A;  3FZ5 A;  1SYR A;  1OE8 A;  5HR0 A;  2PMT A;  1GP1 A;  2X8H A;  1YZX A;  1CQH A;  3C8E A;  2JAC A;  1TKD B;  3L9U A;  3UMA A;  5ECS A;  1FG4 A;  2VLV A;  2CVD A;  1B8X A;  4X1U A;  3UEM A;  3LXZ A;  1G0T A;  3H4K A;  2AAW A;  1SKS B;  1ON4 A;  3MSZ A;  2C1Y A;  4IW9 A;  2AB6 A;  4ZXG A;  2H1D A;  5AIV A;  2RLI A;  1ZCP A;  2XBQ A;  1F6M C;  3U5R E;  3HCZ A;  3UBK A;  4JRR A;  2WFC A;  4PXO A;  1FB0 A;  2MMN A;  3M0F A;  2JU5 A;  2H73 A;  1K0M A;  2HRK A;  1PRX A;  2VL2 C;  4POK A;  5ECO B;  3RPN A;  1TP9 A;  1PL1 A;  4IP1 A;  1QMV A;  5BRT A;  1A0R P;  4MH2 A;  1ST9 A;  2B5E A;  4GQC A;  5IIZ A;  4NV2 A;  4ZBA A;  4NV5 A;  1OVN A;  5D9X A;  2X49 A;  4KE3 A;  1VF2 A;  1ZGN A;  3TKQ A;  4F9Z A;  2WGR A;  5ECQ B;  4Z7X A;  3LXT A;  3VFI A;  1PL2 A;  2VLU A;  3C1S A;  4EVM A;  2A2S A;  2HYX A;  1Z9H A;  1RW1 A;  2H6Z A;  2KUC A;  1AXD A;  3LYK A;  1Y6E A;  4ECJ A;  3E0U A;  3IK9 A;  3GFK A;  2GSR A;  2PER A;  3IC8 A;  1HNB A;  1FB6 A;  4IGJ A;  2X8C A;  3KH9 A;  1X0R A;  3MYD A;  1GUH A;  2H74 A;  1MD3 A;  4HDE A;  1XW6 A;  4OO4 A;  2V2G A;  2OE3 A;  1BED A;  3HXS A;  2DJ1 A;  1JLW A;  3HA9 A;  3NOF A;  3I9V 2;  3ZZX A;  4AGS A;  2AUV A;  2K18 A;  5BMU A;  2DJ3 A;  2C4J A;  2NBS A;  3M9K A;  3MIX A;  2CT6 A;  4IVF A;  1WRY A;  1ACV A;  3KXO A;  3UOM A;  4KW6 A;  3ZLP A;  4GF0 A;  4IQA A;  4KAE A;  4A5P A;  2P5R A;  3GX8 A;  16GS A;  2IFQ A;  3RBT A;  3FR9 A;  4GST A;  3BBY A;  3PR8 A;  5GSS A;  2PN8 A;  1TXX A;  4OFM A;  1X5C A;  2GQL A;  1THO A;  3FZ9 A;  3UIW A;  2DJ2 A;  3F4S A;  4L5L A;  4ZB8 A;  1WE0 A;  1TRS A;  5INY A;  4Q5Q A;  1OKD A;  2VCT A;  2JSZ A;  3MDK A;  3QAV A;  2C0F A;  3TRX A;  4TXO A;  3GSS A;  1YKC A;  1FVJ A;  1TW9 A;  2YN1 A;  2ALB A;  2X64 A;  1GNE A;  2R2J A;  4PGT A;  3M1G A;  1J0F A;  4WKW A;  3TOU A;  4KCA A;  1H75 A;  3H79 A;  5IPH A;  5GZZ B;  2YJ7 A;  1K0D A;  2ZNM A;  3DXB A;  1UC7 A;  2H19 A;  1EP7 A;  2HSY A;  2WZ9 A;  2P5Q A;  1ABA A;  4NHZ A;  1A2J A;  4YKG A;  3L0H A;  1GTB A;  2MMZ A;  4MCU A;  2VM2 A;  3QFA C;  4K2D A;  3TCO A;  1XZO A;  1F37 A;  3IAM 2;  4KDU A;  1NSW A;  4EO3 A;  1EEJ A;  1HNC A;  1A8Y A;  4FYU A;  3Q6O A;  3GKM A;  3BCI A;  4KCE A;  1K3O A;  4IS0 A;  1I9D A;  3CMI A;  4J2F A;  3F6D A;  1GH2 A;  1BJX A;  5IMV A;  1BX9 A;  1GSD A;  2DIZ A;  3EU3 A;  5HR2 A;  3IK7 A;  5HFI A;  1SKW B;  1PSQ A;  2M46 A;  3P8W A;  2K8V A;  4L0W A;  1KBN A;  3GL5 A;  1GUM A;  1WMJ A;  4ISD A;  5G2Z A;  4QQ7 A;  5IO0 A;  1YJ6 A;  4PNG A;  3GH6 A;  2B1K A;  4TXO B;  2X8G A;  4YQV A;  4YH2 A;  3KJY A;  2C3T A;  3R3E A;  1SL0 B;  6GSV A;  2VO4 A;  3HYP A;  3TDG A;  2YAN A;  2KLX A;  1AQW A;  5CYY A;  5ECM B;  1OC9 A;  1WP0 A;  4K7O A;  4MJE A;  2YV9 A;  4YQM A;  1XVQ A;  2DBC A;  4ZL7 A;  1O7U A;  4XS1 A;  1HD2 A;  5DAK A;  3F4R A;  2YPM A;  4O7H A;  2VCZ A;  2L5L A;  2AJQ B;  3LYP A;  2V41 A;  1ILO A;  3C7M A;  5F0G A;  3A5I A;  2PUK C;  1NW2 A;  1Z7R A;  2RM5 A;  4K2X A;  2OAC A;  2ZCT A;  3JCM L;  1Z5Y E;  1R5P A;  3F0I A;  3IHG A;  4IBP A;  2V6K A;  3H1N A;  1M7T A;  1ZYP A;  1XPV A;  3IXR A;  2B3S A;  3FY7 A;  3KGK A;  5ECR B;  2MMO A;  3A2W A;  3E3E A;  4TR4 A;  1T3B A;  3UL3 A;  1X9M B;  3UAP A;  3H8Q A;  2YOI A;  4LMV A;  2LEG A;  2L4Q A;  5JWR B;  3J7Y b;  4KSO A;  1T4Z A;  3IBH A;  1JLV A;  2O89 A;  2OBK A;  2GSS A;  1J9B A;  2WB9 A;  2R0C A;  1JZW A;  1ML6 A;  4N10 A;  5ENU A;  4EXJ A;  3F6F A;  4K5R A;  2O7K A;  4CY6 A;  3APQ A;  4EIP A;  1BQ7 A;  3PH9 A;  3IAS 2;  3F4T A;  2L59 A;  1QGV A;  3VUR A;  3GYK A;  3LQ7 A;  3DRN A;  1USB A;  4HS1 A;  2TRX A;  4JE1 A;  1XCC A;  4TR1 A;  14GS A;  5DAK B;  1M2D A;  4HEA 2;  2GZY A;  3HD5 A;  3CXG A;  1U6T A;  1YQ1 A;  3ZYW A;  3GH9 A;  2LJA A;  4K9Z A;  1F2E A;  5J9B A;  1E2Y A;  2VCQ A;  5B8B A;  5CRE A;  2R5G A;  5A4V A;  4EKZ A;  2CVK A;  4V2L A;  1EP8 A;  4KND A;  4NPB A;  1FO5 A;  4H86 A;  1K0O A;  4GLT A;  3HZ8 A;  4WBR D;  1M2A A;  1QFN A;  5HFK A;  5IO2 A;  2LUS A;  1B9Y C;  2I9H A;  1TK8 B;  4LL1 B;  1CQG A;  3HHV A;  1T4Y A;  2FA8 A;  3HVX A;  4X4J A;  5KEJ A;  3EIN A;  2F9S A;  1TDI A;  4XTS A;  1F9M A;  2HSH A;  5EY6 A;  3S9F A;  5B7C A;  2EIO A;  4HU7 A;  3ERG A;  2DML A;  9GSS A;  2YNX A;  3EE2 A;  1XVW A;  1G6W A;  3UVT A;  3BCK A;  5DCG A;  1O6J A;  3L4N A;  1M9B A;  4F0C A;  3ZFB A;  4IHU A;  1BAY A;  2GTU A;  4RQX A;  2REM A;  1B4P A;  3L9S A;  5LCZ A;  1OE7 A;  3FHK A;  2DKI A;  4N0V A;  2HZF A;  2H8L A;  5J5N A;  2LJK A;  5D73 A;  1DSB A;  4G19 A;  4F03 A;  2IPA A;  1O73 A;  4E8E A;  5GAP D;  3TKR A;  1O8W A;  2H70 A;  2EC4 A;  2IWT A;  2KOK A;  2FGX A;  4ECC A;  4ZL9 A;  4MDC A;  3KMO A;  10GS A;  1GRX A;  2I4A A;  5EPF A;  3TUE A;  1AQX A;  2QA2 A;  2O85 A;  1J08 A;  3W8J A;  2EIQ A;  2GZZ A;  5A5K A;  5F06 A;  4OFT A;  3W8S A;  3GMF A;  5E4W A;  2PU9 C;  2H0G A;  1GUL A;  1GSS A;  4WR5 A;  6GST A;  4V1A g;  3GIX A;  3ZL5 A;  1T7P B;  4XS4 A;  1SU9 A;  4JZQ A;  3DYR A;  4TKY A;  3EYT A;  4ID0 A;  2IIY A;  7GSS A;  3CSI A;  5DDL A;  2R6K A;  1U87 A;  3EU4 A;  4MJB A;  2R37 A;  4MA9 A;  4KB3 A;  2E7P A;  3ME7 A;  4HQZ A;  2XPE A;  1SEN A;  4ULX A;  5LD0 A;  4IP6 A;  2PGT A;  3GA4 A;  3DVX A;  1T8E B;  1V40 A;  1N8J A;  3M9J A;  2Z9S A;  1QXH A;  4YKF A;  3IA1 A;  3OR5 A;  3ZTL A;  2H01 A;  3BJ5 A;  4K8M A;  1ERU A;  5B8A A;  5CRD A;  3TGZ A;  2LQO A;  1S3A A;  2UZ8 A;  4P3Y B;  2DJJ A;  2LKU A;  3US3 A;  4ECB A;  4EC0 A;  2CX4 A;  6GSS A;  3KD0 A;  4TN8 A;  2HRN A;  3TRQ A;  1UN2 A;  1N2A A;  2GQK A;  1AUC A;  3TRP A;  4ZB9 A;  4GCI A;  2VCV A;  2L5O A;  5HR1 A;  3FR3 A;  1R26 A;  3UVH A;  3HJM A;  2K9F A;  3KMN A;  1EZK A;  4BVX B;  2VLT A;  4NXI A;  3CRU A;  1A24 A;  3F3R A;  4KGI A;  2H30 A;  4WEY A;  5D96 A;  1MDI A;  3VWU A;  1OKT A;  3A5W A;  4FH8 A;  1Y25 A;  1SJZ A;  4KSM A;  4USS A;  3RHB A;  5DAL A;  1AAZ A;  2J9H A;  4XS4 B;  5HFG A;  2C3N A;  2KP1 A;  4TR3 A;  4AJ8 A;  2F8F A;  3LGC A;  4K0G A;  1U3A A;  4MJC A;  2BJX A;  4NWY A;  5G5F A;  4I97 A;  4FO5 A;  13GS A;  1O81 A;  5IMC A;  3DKS A;  5J9C A;  4L8E A;  1WOU A;  4POM A;  1A2L A;  3APO A;  5AGY A;  2BTO T;  3ED3 A;  4OCE A;  4ZL8 A;  4KX4 A;  2H66 A;  5FWG A;  3BD2 A;  2FY6 A;  3I6A A;  1SK2 A;  1OYJ A;  1SJI A;  3D4M A;  3EVI A;  4JU5 A;  2L6C A;  4IKH A;  4HZ2 A;  5ID2 A;  3A2X A;  1MTC A;  4Z2T A;  2B7K A;  1A0F A;  4OFN A;  1TI3 A;  2FHE A;  4D73 A;  2H71 A;  3LSZ A;  1B4Q A;  1G6Y A;  2YWI A;  3IPZ A;  3VK9 A;  2X4A A;  5G1L A;  5ECH B;  3LW9 A;  5FHI A;  2CVB A;  4TVE A;  1EGR A;  3FZA A;  1XW5 A;  3VLN A;  2GVP A;  1SKR B;  2HZE A;  5F07 A;  5AIX A;  2FNO A;  2IMI A;  1ZYQ B;  2P31 A;  2WS2 A;  2HSM A;  5DAL B;  1X5D A;  5JWO B;  2LST A;  2A4V A;  1LBK A;  5GAN D;  3CYN A;  1ERW A;  4Z2R A;  2VUP A;  3D21 A;  2HE3 A;  4WBJ A;  4HJ2 A;  3LOR A;  2HRF A;  2X99 A;  3KP9 A;  4I2U A;  4E8H A;  5JCW A;  5C04 A;  3VPQ A;  1RQM A;  2GSQ A;  2P0G A;  2G2Q A;  3TB2 A;  3MAK A;  4MF6 A;  2QSI A;  3TJB A;  3EC3 A;  2L6D A;  2LRN A;  4HOJ A;  11GS A;  1JHB A;  4GRF A;  2VCX A;  1TRV A;  2NVL A;  3CSJ A;  2VOC A;  2O8V B;  2VL3 A;  3G7J A;  2NDO A;  2KHP A;  3KTB A;  3LEF A;  4HQS A;  4F82 A;  3KEB A;  2IFQ B;  4MPF A;  2FLS A;  4KDX A;  2I1U A;  1K0A A;  2J23 A;  2F51 A;  2B5X A;  2OBI A;  1EEM A;  1PX6 A;  3FMW A;  2AYT A;  20GS A;  12GS A;  2N5B A;  4BWQ A;  2KP2 A;  5CRH A;  3DWV A;  2PBJ A;  2DC5 A;  2H6X A;  3A3T A;  3IHQ A;  1GSF A;  2I3Y A;  1X5E A;  1TOF A;  2V1M A;  1XWA A;  3QDN A;  3GUR A;  3DVW A;  4K0N A;  4MJA A;  3TJK A;  2IME A;  2R0G A;  3EMX A;  1XOA A;  4ML1 A;  5DQS A;  3DML A;  1YDK A;  1S3C A;  2H1G A;  1K3L A;  1QUW A;  1R7H A;  5HQP A;  4N30 A;  3QFB C;  4I2T A;  4K5S A;  4RUV A;  3E9J B;  3KH7 A;  4YAP A;  2GZP A;  3KZQ A;  1EGO A;  4PQI A;  4FQU A;  2QKE A;  2VD1 A;  2M80 A;  3GL3 A;  4EF0 A;  4PQH A;  2XHF A;  2V32 A;  5AN1 A;  3W6G A;  3GTU A;  2JAD A;  5ECP B;  5COH A;  2VL9 A;  5E59 A;  4LMW A;  3TKS A;  2QGV A;  1VRS D;  4J57 E;  3Q74 A;  3GKK A;  4LA1 A;  4X43 A;  2MYG A;  2O87 A;  2CV4 A;  2FCH A;  5B6M A;  4MNN A;  1GNW A;  4OCF A;  2JL4 A;  3D5J A;  3G7I A;  4I5Q A;  4MAB A;  1MEK A;  2DJK A;  2HNL A;  3IDV A;  1PN9 A;  3FZ4 A;  3KCM A;  2TRC P;  3J7Y k;  3I43 A;  2YWN A;  4MF5 A;  2IMD A;  3N5O A;  1R5A A;  2L57 A;  4XRD A;  4XRA A;  2H1B A;  1AC1 A;  1OC9 B;  1SYX A;  4G9H A;  2C3Q A;  5IM9 A;  1RK4 A;  3GST A;  1AQV A;  1K0N A;  1U88 A;  4Q5F A;  1OC8 A;  4EDY A;  4KH7 A;  4G0L A;  3EPT A;  1GSY A;  5G5E A;  4GQF A;  5KOX A;  4ILF A;  3QAW A;  1M9A A;  1ZMA A;  4BPY A;  2PPT A;  1TTZ A;  1URM A;  1YF1 A;  4V1A p;  4QL7 A;  1V57 A;  1GTI A;  3L78 A;  1FOH A;  2H0H A;  1EV9 A;  3V1W A;  2A2R A;  1PMT A;  4IJ3 A;  3GUS A;  2GDR A;  2CAQ A;  2DMM A;  4O5U A;  6GSW A;  4PUR A;  1A8L A;  3GNJ A;  3FYG A;  1PKZ A;  22GS A;  3DEX A;  4ZIL A;  2JSY A;  1KNG A;  4V2N A;  2CZ3 A;  2XPD A;  2LJR A;  3WT1 A;  4MH3 A;  1W4V A;  2PWJ A;  2PVQ A;  5F05 A;  4PX1 A;  2JZR A;  4OMV A;  4KUN A;  1X9S B;  1I5G A;  2H76 A;  2N5A A;  1PQN A;  5ECI B;  5ELG A;  4FIW A;  5IMZ A;  4PUA A;  5LNK e;  3IR4 A;  4BVY A;  2OE0 A;  4X0X A;  2ON5 A;  4MLY A;  1THX A;  3QAG A;  5D8I A;  2XC2 A;  3HJP A;  1NHY A;  2B7J A;  4EE0 A;  1YY7 A;  3D0Z A;  1VGL A;  2OKA A;  1LU4 A;  2YJH A;  2VIM A;  3RAZ A;  4TW5 A;  4EIQ A;  1A23 A;  4TR1 B;  2H0I A;  1YEX A;  3ZML A;  6GSX A;  4POL A;  1XWC A;  5AIS A;  3HVV A;  2F8A A;  6GSU A;  1TK5 B;  4AF2 A;  3WT2 A;  1DE1 A;  3M3M A;  4JR6 A;  2C0E A;  2GST A;  4WF5 A;  1GTA A;  2HI7 A;  3Q18 A;  2FWF A;  2DJ0 A;  3O3T A;  4J56 E;  4PUF C;  3D22 A;  3AY8 A;  2LRC A;  3GRX A;  1HYU A;  3ME8 A;  1KEB A;  3WD6 A;  3FEU A;  3WGX A;  3QPM A;  5L71 A;  4CW9 A;  4MZW A;  2C0G A;  1F3B A;  1SL2 B;  3ZVJ A;  2HRA A;  3QD9 A;  4MZB A;  4JR4 A;  2MBT A;  2MZC A;  1SK0 A;  4KA0 A;  1NHO A;  2H1A A;  2QC7 A;  3KM6 A;  5D9W A;  3ZMK A;  1ERV A;  1DE2 A;  3DGQ A;  4G0K A;  4XCS A;  1R4W A;  5A4U A;  2LTK A;  4ML6 A;  1M2B A;  3TJF A;  2DSA A;  3P90 A;  2OAD A;  4PNF A;  5C00 A;  4V2M A;  2MBS A;  5KN1 A;  2LRT A;  4TOP A;  2A4H A;  4NMU A;  4DSR A;  4GSN A;  3UJ1 A;  4O5R A;  3C1R A;  4IEL A;  5D93 A;  3I69 A;  1ZOF A;  5H5R A;  4BVY B;  4EL1 A;  3IV4 A;  1LJR A;  3EUR A;  3LJR A;  1O85 A;  2CQ9 A;  2MMA A;  4K1F A;  2VD0 A;  5CP1 A;  1WIK A;  3QCP A;  3GHA A;  1ERT A;  2E2M A;  18GS A;  2R0P A;  3KTL A;  3TJJ A;  4DSQ A;  2M72 A;  4K7I A;  2ES7 A;  1SD8 A;  3H93 A;  1TRU A;  1OAZ A;  2GT6 A;  3HVS A;  5H5S A;  2GGT A;  1JZO A;  1XWB A;  1ZZY A;  4YQU A;  3ZVJ D;  1IYI A;  1UA5 A;  1BG5 A;  4BWS A;  5J3R A;  2K8S A;  3GX0 A;  5EVO A;  2FWE A;  5IMD A;  2LNT A;  3CTF A;  1AW9 A;  1XBS A;  1B9X C;  3LFL A;  3NIV A;  2RII A;  3TKS C;  4Q5R A;  1WWJ A;  3WGE A;  3M8N A;  1Z6N A;  1T00 A;  3F63 A;  3LG6 A;  1JZR A;  3HKR A;  2FWG A;  1PX7 A;  4CDO A;  4YAV A;  3VI7 A;  1DUG A;  3ERF A;  1MDK A;  4OO5 A;  1XWK A;  4XIH A;  3PPU A;  2IMF A;  3MNG A;  4K6X A;  1FW1 A;  3UAR A;  5IQY A;  1K0C A;  3CBU A;  3U6V A;  2TIR A;  3RPP A;  4NHW A;  1EV4 A;  5HR3 A;  2R4V A;  1HQO A;  3EMP A;  3Q19 A;  2B1L A;  1XWG A;  5CNW A;  3CRT A;  3ISO A;  4MMM A;  1XW9 A;  2OE1 A;  5IPG A;  4WR4 A;  2H72 A;  1UVZ A;  4HZ4 A;  4JED A;  3KIJ A;  3SBC A;  2G0F A;  3P7X A;  4L0U A;  5ECL B;  5KOW A;  1MDJ A;  2DLX A;  3L9V A;  4LLR A;  3ERW A;  2AV4 A;  2CAI A;  1XXU A;  5DJM A;  4N11 A;  1KTE A;  3F3Q A;  1TRW A;  4WXT A;  1XFL A;  1FOV A;  5D9V A;  4ZBB A;  1TU7 A;  4CY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...