2FA8A

Crystal structure of the putative selenoprotein w-related family protein from agrobacterium tumefaciens
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
86
structure length
86
Chain Sequence
TKPRIAIRYCTQCNWLLRAGWMAQEILQTFASDIGEVSLIPSTGGLFEITVDGTIIWERKRDGGFPGPKELKQRIRDLIDPERDLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein Atu0228
publication title Crystal Structure of the Putative Selenoprotein W-related family Protein from Agrobacterium tumefaciens
rcsb
source organism Agrobacterium tumefaciens str.
total genus 22
structure length 86
sequence length 86
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10262 Rdx Rdx family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2fa8A00
4K7OA 2EIRA 4CHSA 18GSA 1K0NA 4DVCA 1O8XA 4ZBAA 4KDXA 1OAZA 3IK9A 2H76A 4K7NA 3WGEA 1J08A 4IELA 2ZNMA 1UVZA 1PD21 1DUGA 4K7IA 3TRXA 4ZILA 2DJ1A 3H8QA 5ECKB 1A8YA 1JZRA 3W8JA 4Q5QA 4XS4B 4FO5A 2P5RA 1N8JA 3LSZA 5ECOB 1R7HA 5ECHB 3HXSA 2G2QA 4PUAA 4BPYA 1SD8A 1MDJA 1Z7RA 4JE1A 4Q5NA 5HFKA 3EINA 1S3AA 1BX9A 1GSQA 2IIYA 4ZBBA 3E0UA 4LA1A 2L59A 4YQUA 2PGTA 3ZLPA 5LNKe 3RHCA 3LYPA 5E4WA 3DWVA 5ELGA 2GSRA 1FW1A 5FT3A 3ZFLA 1X5DA 1KTEA 3A2XA 3QDNA 1CQHA 5DCGA 2FCHA 4ID0A 3P2AA 2H0IA 2AHEA 1A24A 4GLTA 4K6XA 2PWJA 2RM5A 2VCXA 1SK1A 4MABA 1XWBA 4WBRD 3CRUA 1X5CA 5A4WA 4IS0A 3GFKA 3GNJA 4POLA 3D21A 4TR0A 5CRHA 3IPZA 1SKWB 5LD0A 4WETA 2FHEA 1PRXA 2C3TA 4BL7A 4MPFA 5J4UA 5IPHA 1GRXA 11GSA 4BVXA 1R4WA 3VLNA 1B4PA 5INYA 4P3YB 4NV2A 5CRGA 5D8IA 3APOA 5D9TA 3FZ9A 1XW6A 3F63A 3BCKA 1U6TA 3LORA 4OO4A 4PUFC 5ABRA 1WWJA 3LWAA 3F3RA 3GX0A 3I6AA 2FA4A 2FLSA 3KM6A 4OFMA 1J9BA 20GSA 2N5FA 4TXVA 2LKUA 1IYHA 3G9BA 1JZOA 2WDUA 1KBNA 4I8BA 2RIIA 2F8AA 4TOPA 5G1LA 5L71A 1OVNA 3C1SA 1GTAA 2PVQA 2L5LA 3FHKA 1GULA 3ZL5A 8GSSA 3CTFA 4XHMA 2BMXA 3PINA 3HHVA 1HD2A 3WD6A 2L5OA 1TXXA 2GTUA 4OCEA 1IYIA 2LJRA 4DSRA 2LUSA 1B9XC 4XRAA 4BWSA 5ECRB 4EC0A 4HDEA 1B9YC 1ERUA 4QL7A 3A3TA 4ECJA 2OE0A 2V1MA 2FUG2 2EIQA 1U88A 1HYUA 3FKFA 1QK8A 4OFTA 3US3A 2PMTA 4HJMA 1HQOA 2E0QA 3F9UA 5IOXA 4TR1B 1T4ZA 1SYXA 4TRXA 1O8WA 1LU4A 3IK7A 1SJIA 2CVBA 1H4OA 2K6VA 5H5SA 1EZKA 1XW5A 6GSXA 2QGVA 4F2IA 1HNAA 19GSA 1M2AA 1AQXA 5E59A 3DD3A 4MJBA 4XS6A 1ZYEA 2IL3A 1EEJA 2V2GA 5J9CA 1GSFA 1JHBA 3U6VA 2CX4A 5D9XA 3DIEA 5A4UA 4IN0A 4N11A 4GSSA 3V1WA 2KLXA 4KX4A 1ON4A 10GSA 4EF0A 5ECMB 2DJ3A 4CDOA 2GVPA 1SENA 1MD3A 4HZ4A 3IHQA 4RUVA 3IC4A 5KN1A 2OBIA 3BCIA 2HNLA 3TGZA 4F03A 5DCHA 2H74A 2VL2A 2YPMA 2IMDA 2X99A 5KN2A 3ZFBA 2HSHA 5C04A 5IM9A 5DDLA 3EMPA 3UAPA 2NPBA 2PU9C 4WF5A 1RQMA 2FWEA 3QFBC 4ML6A 2BJXA 1I9DA 1F6MC 3GRXA 16GSA 4NAXA 2VL2C 4I2UA 1PQNA 3HYPA 3M8NA 2LNTA 2GT5A 2V6OA 1T8EB 1XOAA 3TB2A 4O5RA 3RAZA 2F51A 4KUNA 2HRNA 4MP4A 3VK9A 1EP8A 2H75A 2GSQA 5IIZA 2D2ZA 2VL9A 5CAXA 2LQOA 3KXOA 3CMIA 2GZYA 3DKSA 1TRSA 2LSTA 1RK4A 4BVYA 1ILOA 3D4MA 2REMA 5DALB 3EU4A 4KE3A 4LL1B 4K8MA 1MD4A 2VM2A 4N30A 1THXA 1XOBA 3EC3A 4IQAA 2H8LA 4XS1A 2K18A 2NTOA 12GSA 4IJ3A 2PPTA 2CQ9A 5CREA 3RBTA 2MMAA 1SKRB 1JZWA 1VF3A 5EL8A 1X5EA 2MMOA 3D5JA 3GIXA 3Q19A 2L4CA 3VFIA 3KCMA 1SYRA 2H6YA 4QL9A 1Z9HA 5GSTA 1TJDA 1TDIA 2FWFA 1FVJA 1DSBA 4GRFA 2E7PA 3FRCA 1Z7PA 3OR5A 3UBLA 5GZZB 3CYNA 1QUWA 2VOCA 3R2QA 5ECQB 3L9UA 5F05A 2GQLA 1YEXA 2DBCA 2DMLA 4E8EA 3Q18A 2B1LA 2XBQA 2R2JA 3HY2A 3ZIJA 2VD0A 1QFNA 4N0ZA 3M9JA 3TOTA 1VRSD 1ZOFA 1S3DA 2VM1A 2QKEA 2GZZA 2F3MA 4IW9A 4KW6A 1DBYA 2CZ3A 2AJQB 2HZEB 3MDKA 4V2LA 2OBKA 1NSWA 1XCCA 4J2FA 4IBPA 2LRTA 1F2EA 1UN2A 4KGIA 2R3XA 3F4TA 4GQFA 4G2EA 1DE2A 1O73A 1VF4A 4JRRA 2MZCA 1MTCA 2RLIA 2FWGA 3L9VA 1M7TA 3GX8A 4POMA 1R5PA 1X9WB 2YJHA 3SBCA 4YAVA 2RUFA 5G2ZA 2A2SA 3H1NA 1XW9A 1T7PB 2NDOA 3EMXA 3ZIVA 5DVBA 3KP9A 1OC8A 2R6KA 2JZSA 3TKQA 2JSYA 5IQYA 1EV9A 2B5YA 1GSYA 4E8HA 2YWMA 2IMKA 4Q5RA 4K1FA 5ID2B 1XVQA 3FR9A 2K8SA 2ZUPA 1ML6A 3MAKA 2FA8A 4N10A 2VCQA 5FHIA 5IOWA 1W4VA 5GAPD 1Y25A 3M9KA 4KA0A 1M2DA 2AYTA 2M72A 2GLRA 2VUPA 3L4NA 5DQYA 2P5QA 2EIOA 1Q98A 2YJ7A 1B4QA 1ZCPA 3ZRDA 3TKRA 1Z5YE 5DJMA 1AC1A 14GSA 4PQHA 1QMVA 2C1YA 2HT9A 1QQ2A 1RW1A 4NMUA 5IMZA 4MH3A 1NW2A 2HRFA 1Z6NA 2B5EA 5ECLB 4ZBDA 4YQVA 1YQ1A 3H4KA 5EY6A 2H0GA 4Q5FA 1EOHA 1K0DA 4O32A 5F8BA 1G6WA 3HVVA 2FGXA 2DMMA 1HNCA 4KSOA 4AJ6A 4EUYA 3O6TA 1JLVA 3A2WA 3FR3A 2CVDA 4X43A 1XVWA 2C3QA 3QAVA 4CW9A 1GH2A 3K8NA 2YNXA 3RHBA 2CA8A 1K0AA 5DAKB 4NPBA 2XPDA 1GNWA 4JU5A 4D73B 1BAYA 1WJKA 2GQMA 1AQWA 3TJBA 3TDGA 1YF0A 1GL8A 3KD0A 1OKTA 3ZYWA 1O85A 1PGTA 4YQMA 2MMZA 3HZ4A 4HS1A 2VCTA 2R4VA 3CSIA 1XZOA 1Y6EA 4HJ2A 2VCVA 1TU8A 3F0IA 3LXTA 3DYRA 4LLRA 2TRCP 3S9FA 4WKWA 3MSZA 1A23A 1XIYA 1QGVA 2CX3A 2LRNA 1B8XA 2H6ZA 3CRTA 3WT2A 4G10A 1FAAA 4ZL7A 1URMA 5HFGA 1FO5A 5JCWA 1THOA 5CRWA 5B8BA 4ISDA 4EKZA 4ZIJA 2X64A 3H93A 1E6BA 3HCZA 2LEGA 2A4VA 2DC5A 3SWLA 1TKDB 2VD1A 2OADA 3GV1A 2DJJA 3LEFA 3TJJA 4GWRA 1W89A 3G7YA 1OYJA 2ES7A 5ECPB 2WFCA 2HXKA 1XWCA 4MZWA 3CSJA 3FZ4A 4MPGA 2H01A 2F8FA 2AV4A 3LXZA 3DGQA 4JR6A 1MEKA 2C4JA 2MYGA 4TR1A 4KDYA 3TJGA 2J23A 4PX1A 2C0GA 2LNSA 4MH2A 5H5QA 5CYYA 1SL1B 2XBIA 3GUSA 1XWAA 1GUMA 1TK0B 2B6MA 1WPIA 4ECCA 1TK8B 1M9BA 3ERGA 1ERTA 2X8HA 1TOFA 1U87A 4X1UA 2K9FA 2JADA 2CV4A 1M0UA 2E2MA 1GSDA 1OE7A 1VF1A 3G7IA 3HJMA 2PERA 1O7UA 4TN8A 1HNBA 4K9ZA 1A8LA 4OO5A 1GSUA 4POKA 1DE1A 1K0BA 1UC7A 6GSVA 4Z7XA 3ZREA 3P8WA 5G30A 3HVXA 1WMJA 1C72A 2M46A 4ZB9A 1EOGA 1PA3A 1YY7A 4WR4A 2QC7A 1V40A 5AIVA 2JL4A 4IGJA 2OA7A 4TXOB 3J7Yb 2HE3A 1YDKA 1TI1A 2MBTA 1BYEA 4GQCA 5GAND 2IJYA 3C1RA 2IMIA 3C7MA 1AW9A 1AUCA 4MF7A 5IPGA 5CRDA 5DBQA 4ECIA 1ERWA 2JZTA 5HR0A 2VO4A 4MDCA 3LYKA 4NV5A 1XXUA 3IBHA 3TKSC 3D22A 4OCFA 4NHWA 3GKKA 2H1GA 2X8GA 1NM3A 2H72A 3UOMA 2ZCTA 3EE2A 3I43A 2GQKA 3GYKA 5B7CA 3CXGA 2LQQA 2HYXA 4EDYA 3DMLA 4V2MA 1TRWA 3BOAA 3ERFA 4K0NA 1OC9B 1YJ6A 3GMFA 4EO3A 1ZYQB 5D96A 3EWLA 2LV3A 3DRNA 2H70A 1PL1A 3APQA 4DSSB 3LJRA 4OWYA 3LQ7A 3IV4A 1JZDA 4LMVA 1TW9A 4F0CA 4EVMA 3KEBA 2B5XA 2DJKA 2L6CA 1XPVA 2YV9A 2XC2A 1XWKA 3QD9A 1GTUA 4FH8A 2GT6A 5JWOB 3F6DA 4ZB6A 1OE8A 3ERWA 4EL1A 4HQSA 5AN1A 3G7JA 4WF4A 4AGSA 1AQVA 5IMVA 1TRVA 4OMVA 3TRPA 1YKCA 2VCWA 1A2LA 2OJLA 2YOIA 4FYUA 3VURA 3QFAC 1PX6A 4TR4A 1WP0A 2KP2A 3ME7A 4JEDA 2TRXA 1SK2A 3IR4A 2LS5A 3KTLA 3LG6A 5AISA 2X8CA 1MDIA 2IFQB 1PSQA 3IOSA 4MLYA 2MMNA 1FG4A 1WOUA 4LL4B 2HZEA 1O81A 1ABAA 2R5GA 2WZ9A 3IXRA 4GTUA 4FIWA 1EV4A 3PR8A 3LFLA 5D9WA 4YAPA 3UEMA 3KMNA 3FZ5A 1PN9A 2HSYA 2PN8A 4KH7A 3H79A 4MK3A 5F07A 2IPAA 1FHEA 1EGOA 4KCEA 3UL3A 1R26A 4DSQA 5HFIA 4HU9A 4IP6A 4L5OA 2PVOC 3QCPA 5KEJA 2OKAA 3P90A 1WIKA 1SJ6A 1VGLA 2YWIA 1GP1A 3TOUA 1UA5A 3C8EA 5ENUA 3GH9A 1ERVA 5G5EA 2FWHA 2H73A 3MNGA 3DEXA 3UMAA 2HZFA 1M2BA 2L57A 3GKMA 1JLWA 2OE1A 2ON5A 2KOKA 4PURA 4HQZA 3L9SA 2YANA 5ECNB 5ID2A 3IAS2 2XHFA 3I69A 4MMMA 1USBA 1TP9A 2B7KA 2H66A 2LJKA 3TCOA 3C71A 2N5AA 4XIHA 3NZNA 1GSEA 2B3SA 1I5GA 3ED3A 3TUEA 5J9BA 1X0RA 1ZMAA 2K8VA 2O89A 3JCML 1G7OA 1XBSA 2I4AA 4HEA2 2GGTA 3GTUB 4KDUA 3N5OA 5CP1A 4XS4A 5AIXA 4MJCA 1YEPA 1GLPA 3F4RA 1SL2B 1BJXA 1V9WA 5KN3A 1YZXA 1NHYA 4WBJA 1GLQA 1PX7A 1GUHA 2OE3A 3D4TA 4GSTA 2H1DA 4ML1A 3FR6A 4PQIA 2CZ2A 1TI3A 4RQXA 2Z9SA 1GTBA 1A2MA 4KAEA 4EE0A 1BG5A 1Q4JA 4NHZA 6GSSA 2GZPA 4JZQA 2AUVA 4ZXGA 2CAQA 5HR1A 2J9HA 1K0MA 3CTGA 5GSSA 1U3AA 4KSMA 4NXIA 3FZAA 1G0TA 3UARA 7GSSA 3A5WA 2IN3A 1ZZYA 3UJ1A 5DAKA 3DXBA 2H1BA 3GL5A 4D73A 4MA9A 4IP1A 2C8UA 2PUKC 1FVKA 3ISOA 2YP6A 3EYTA 4PQ1A 1TU7A 3VI5A 3VWUA 1G6YA 1JFUA 1AIUA 3W6GA 2YCDA 4WR5A 5FWGA 4ACSA 5JCGA 3KH9A 1TRUA 3ZZXA 3FEUA 3IDVA 5IMAA 5B6NA 3EVIA 5G31A 4J56E 3ZMLA 5EVOA 5IO0A 2XPEA 4YH2A 3Q6OA 2M80A 2CVKA 4TR3A 4L8EA 2YWOA 4ULXA 2DIYA 2O8VB 3QPMA 3TJFA 2NVLA 4KNDA 3IAM2 1SJZA 4K0GA 1LBKA 1ZL9A 4MJEA 13GSA 1GWCA 1XFLA 2IMFA 5CO3A 3KGKA 4RI7A 3GURA 3KIJA 1OC3A 2O85A 4EDZA 3VWWA 5G5FA 4V2NA 4BA7A 3D0ZA 1F3AA 5JWQB 2CT6A 3A2VA 2GSSA 2VAFA 3NIVA 2YN1A 4AJ7A 1H75A 2DIZA 2DSAA 1E2YA 3VWXA 4ZL8A 4NWYA 5HR3A 3ZVJA 5A5KA 3M1GA 4RI6A 3IA1A 4TVEA 1ACVA 1N2AA 2HFDA 3DVXA 4EXJA 2N5BA 4POBA 1TTZA 3FY7A 4ZB8A 3AY8A 1A2JA 1FB0A 5ELAA 2V32A 4HZ2A 3EU3A 3P7XA 2TIRA 4L0UA 3F3QA 3HJPA 4GSNA 5A4VA 2QSIA 4KB3A 3HD5A 2PBJA 2WULA 1EGRA 3HKRA 1M99A 4MJAA 4ZL9A 1EP7A 2B7JA 3EURA 1GUKA 2KP1A 5HQPA 3WT1A 3E9JB 3UIWA 4PNGA 2WCIA 3ZMKA 1YF1A 4I2TA 3O76A 3WGDA 2WGRA 2L6DA 1SD9A 2O7KA 3Q74A 2DLXA 1KEBA 2IWTA 5IO2A 2H6XA 4IKHA 3FYGA 5EPFA 2VCZA 4G9HA 2C80A 1Z3EA 1SU9A 1K0CA 4TXOA 1K3YA 1Z6MA 4HU7A 4V1Ag 3TRQA 3GA4A 1T4YA 3L78A 4L0WA 4DEJA 3QAGA 4IHUA 3BBYA 2H30A 1BQ7A 2CAIA 2WB9A 3QR6A 4I5QA 5G1KA 2LRCA 4L5LA 5B8AA 5D9VA 2YWNA 3RPNA 2I9HA 2ON7A 4F82A 1K0OA 4IQ1A 3F4SA 4WXTA 2HI7A 4K2DA 2NBSA 2C0EA 3N9JA 3TKSA 4ILFA 3KZQA 2H19A 4O92A 4MCUA 5IMCA 3LGCA 3VPQA 3W8SA 1VF2A 4I6XA 1T00A 4OD7A 3TKSE 4HOJA 1EWXA 1T3BA 2GDRA 3PGTA 3GL3A 3GHAA 1OC9A 4HUAA 4XTSA 3GSTA 4IJIA 4GXZA 5DQSA 2C3NA 6GSYA 3QOUA 3I9V2 4DSSA 2VIMA 2MBSA 2WS2A 2EC4A 2GSTA 3F6FA 2R37A 2C0FA 1R5AA 3J7Yk 3HZ8A 4IVFA 5AGYA 3ZTLA 2JACA 3TJKA 1PMTA 2JZRA 2YZUA 2F9SA 2P0GA 3IE3A 1PL2A 2V6KA 1QXHA 4X0XA 6GSWA 6GSUA 2I81A 2H0HA 5B6MA 5J41A 5C00A 3U5RE 2E2GA 1T1VA 3RPPA 5DALA 4FYBA 5HR2A 4AJ8A 3NOFA 3BJ5A 4H86A 2AB6A 2O87A 1V2AA 3GH6A 3RDWA 3VWVA 1ZGNA 5KN0A 1LJRA 1B48A 5IMFA 2VLUA 3ME8A 1U3IA 4GF0A 5D93A 5F0GA 2DJ0A 5ECSA 1GTIA 3KMOA 1NHOA 1O6JA 2IFQA 1V58A 1X9MB 4J57E 1PKWA 1A0FA 2C0DA 4AF2A 4F0BA 2H71A 4TW5A 1SL0B 3GKXA 3UVTA 1ST9A 4F9ZA 2KHPA 3ZITA 4KCAA 2AAWA 3UVHA 4HI7A 6GSTA 5J3RA 2JU5A 2VL3A 2YV7A 1EEMA 3VPTA 4N0VA 3HDCA 2ALBA 2VLVA 3GN3A 1K3LA 1AXDA 1SK0A 3WGXA 2LJAA 2HLSA 3M0FA 3ZVJD 5JCUA 1MDKA 1F3BA 1V57A 4I97A 2FNOA 4WEYA 3HA9A 2WJUA 1X9SB 22GSA 2V41A 2WRTA 3KJYA 3DVWA 4OFNA 5J5NA 4PXOA 5CNWA 2H1AA 2BTOT 4XRDA 4PGTA 2L4QA 4LMWA 2G0FA 1SKSB 5ECIB 3HVSA 3VI7A 1K3OA 3KP8A 1F37A 1CQGA 3CSHA 4PNFA 1M9AA 1KNGA 4JR4A 1WRYA 3F8UA 3FW2A 3QAWA 3GKNA 1FB6A 3C73A 1F9MA 3E3EA 3UBKA 17GSA 1S3CA 1A0RP 4MZBA 3APSA 3O3TA 4ECBA 3GTUA 4MZCA 4RQRA 5F06A 1GNEA 3BD2A 1BEDA 5IMDA 4V1Ap 4XCSA 2FY6A 1YKAA 3MWHA 4QQ7A 2RUEA 2JSZA 5LCZA 2I3YA 2I1UA 1TK5B 2YZHA 2A2RA 5JWRB 4FYCA 1OKDA 2LTKA 3CBUA 1FOVA 3M3MA 2FD3A 2P31A 4MF5A 2VLTA 5D73A 3TKPA 3FK8A 2DJ2A 3WYWA 1GSSA 4BWQA 9GSSA 3L0HA 3IRAA 1AAZA 1WE0A 1PKZA 2RM6A 1V98A 5DJLA 3GSSA 2B1KA 3D6IA 3KH7A 5COHA 4TKYA 2GS3A 1XWGA 2KUCA 2IMEA 4MF6A 4O7HA 4G19A 4JBBA 1J0FA 3PH9A 3QMXA 1G7EA 5H5RA 4GCIA 2OACA 3HJOA 3KTBA
chains in the Genus database with same CATH superfamily
4K7OA 2EIRA 4CHSA 18GSA 1K0NA 4DVCA 1O8XA 2QA2A 4ZBAA 4KDXA 1OAZA 3IK9A 2H76A 2X49A 4K7NA 3WGEA 1J08A 4IELA 2ZNMA 1UVZA 1PD21 1DUGA 4K7IA 3TRXA 4ZILA 2DJ1A 3H8QA 5ECKB 1A8YA 1JZRA 3W8JA 4Q5QA 4XS4B 4FO5A 2P5RA 1N8JA 3LSZA 5ECOB 1R7HA 3PPUA 5ECHB 3HXSA 2G2QA 4PUAA 4BPYA 1SD8A 1MDJA 1Z7RA 4JE1A 4Q5NA 5HFKA 3EINA 1S3AA 1BX9A 1GSQA 2IIYA 4ZBBA 3E0UA 4LA1A 2L59A 4YQUA 2PGTA 3ZLPA 5LNKe 3RHCA 3LYPA 5E4WA 3DWVA 5ELGA 2GSRA 1FW1A 5FT3A 3ZFLA 1X5DA 1KTEA 3A2XA 3QDNA 1CQHA 5DCGA 2FCHA 4ID0A 3P2AA 2H0IA 2AHEA 1A24A 1PFOA 4GLTA 4K6XA 2PWJA 2RM5A 2VCXA 1SK1A 4MABA 1XWBA 4WBRD 3CRUA 1X5CA 5A4WA 4IS0A 3GFKA 3GNJA 4POLA 3D21A 4TR0A 5CRHA 3IPZA 1SKWB 5LD0A 4WETA 2FHEA 1PRXA 2C3TA 4BL7A 4O5QA 4MPFA 5J4UA 5IPHA 1GRXA 11GSA 4BVXA 1R4WA 3VLNA 1B4PA 4HSCX 5INYA 4P3YB 4NV2A 5CRGA 5D8IA 3APOA 5D9TA 3FZ9A 1XW6A 3F63A 3BCKA 1U6TA 3LORA 4OO4A 4PUFC 5ABRA 1WWJA 3LWAA 3F3RA 3GX0A 3I6AA 2FA4A 2FLSA 3KM6A 4OFMA 1J9BA 20GSA 2N5FA 4TXVA 2LKUA 1IYHA 3G9BA 1JZOA 2WDUA 1KBNA 4I8BA 2RIIA 2F8AA 4TOPA 5G1LA 5L71A 1OVNA 3C1SA 1GTAA 2PVQA 2L5LA 3FHKA 1GULA 3ZL5A 8GSSA 3CTFA 4XHMA 2BMXA 3PINA 3HHVA 1HD2A 3WD6A 2L5OA 1TXXA 2A4HA 2GTUA 4OCEA 1IYIA 2LJRA 4DSRA 2LUSA 1B9XC 4XRAA 4BWSA 5ECRB 4EC0A 4HDEA 1B9YC 1ERUA 4QL7A 2HRKA 3A3TA 4ECJA 2OE0A 2V1MA 2FUG2 2EIQA 1U88A 1HYUA 3FKFA 1QK8A 4OFTA 3US3A 2PMTA 4HJMA 1HQOA 2E0QA 3F9UA 5IOXA 4TR1B 1T4ZA 1SYXA 4TRXA 1O8WA 4G0LA 1LU4A 3IK7A 1SJIA 2CVBA 3CQFA 1H4OA 2K6VA 5H5SA 4K2XA 1EZKA 1XW5A 6GSXA 2QGVA 4F2IA 1HNAA 19GSA 1M2AA 1AQXA 5E59A 3DD3A 4MJBA 4XS6A 1ZYEA 2IL3A 1EEJA 2V2GA 5J9CA 1GSFA 1JHBA 3U6VA 2CX4A 5D9XA 3DIEA 5A4UA 4IN0A 4N11A 4GSSA 3V1WA 2KLXA 4KX4A 1ON4A 10GSA 4EF0A 5ECMB 2DJ3A 4CDOA 2GVPA 1SENA 1MD3A 4HZ4A 3IHQA 4RUVA 4EIPA 3IC4A 5KN1A 2OBIA 2X4AA 3BCIA 4Z2TA 2HNLA 3TGZA 4F03A 5DCHA 2H74A 2VL2A 2YPMA 2IMDA 2X99A 5KN2A 3ZFBA 2HSHA 5C04A 5IM9A 5DDLA 3EMPA 3UAPA 2NPBA 2PU9C 4WF5A 1RQMA 2FWEA 3QFBC 4ML6A 2BJXA 1I9DA 1F6MC 3GRXA 16GSA 4NAXA 2VL2C 4I2UA 1PQNA 3HYPA 3M8NA 2LNTA 2GT5A 2V6OA 1T8EB 4USSA 1XOAA 3TB2A 4O5RA 3RAZA 2F51A 4KUNA 2HRNA 4MP4A 3VK9A 1EP8A 2H75A 2GSQA 5IIZA 2D2ZA 2VL9A 5CAXA 2LQOA 3KXOA 3CMIA 2GZYA 3DKSA 3A5IA 1TRSA 2LSTA 1RK4A 4BVYA 1ILOA 3D4MA 5KOXA 2REMA 5DALB 3EU4A 4KE3A 2QA1A 4LL1B 4K8MA 1MD4A 2VM2A 4N30A 1THXA 1XOBA 3EC3A 4IQAA 3EPTA 2H8LA 4XS1A 2K18A 2NTOA 12GSA 4IJ3A 2PPTA 2CQ9A 4KF9A 5CREA 3RBTA 2MMAA 1SKRB 1JZWA 1VF3A 5EL8A 1X5EA 2MMOA 3D5JA 3GIXA 3Q19A 2L4CA 3VFIA 3KCMA 1SYRA 2H6YA 4QL9A 1Z9HA 5GSTA 1TJDA 1TDIA 2FWFA 1FVJA 1DSBA 4GRFA 2E7PA 3FRCA 1Z7PA 3OR5A 3UBLA 5GZZB 3CYNA 1QUWA 2VOCA 3R2QA 5ECQB 3L9UA 5F05A 2GQLA 1YEXA 2DBCA 2DMLA 4E8EA 3Q18A 2B1LA 3LW9A 2XBQA 2R2JA 3HY2A 3ZIJA 2VD0A 1QFNA 4N0ZA 3M9JA 3TOTA 1VRSD 1ZOFA 1S3DA 2VM1A 2QKEA 2GZZA 2F3MA 4IW9A 4KW6A 1DBYA 2CZ3A 2AJQB 2HZEB 3MDKA 4V2LA 2OBKA 1NSWA 1XCCA 4J2FA 4IBPA 2LRTA 1F2EA 1UN2A 4KGIA 2R3XA 3F4TA 4GQFA 4G2EA 1DE2A 1O73A 1VF4A 4JRRA 2MZCA 1MTCA 2RLIA 2FWGA 3L9VA 1M7TA 3GX8A 4POMA 2DKHA 1R5PA 1X9WB 2YJHA 3SBCA 4YAVA 2RUFA 5G2ZA 2A2SA 3H1NA 2HSMA 1XW9A 1T7PB 2NDOA 3EMXA 3ZIVA 5DVBA 3KP9A 1OC8A 2R6KA 2JZSA 3TKQA 2JSYA 5IQYA 1EV9A 2B5YA 1GSYA 4E8HA 2YWMA 2IMKA 4Q5RA 4K1FA 5ID2B 1XVQA 3FR9A 4Z2UA 2K8SA 2ZUPA 1ML6A 3MAKA 2FA8A 4N10A 2VCQA 5FHIA 5IOWA 1W4VA 5GAPD 1Y25A 3M9KA 4KA0A 1M2DA 2AYTA 2M72A 2GLRA 2VUPA 3L4NA 5DQYA 2P5QA 2EIOA 1Q98A 2YJ7A 1B4QA 1ZCPA 3ZRDA 3TKRA 1Z5YE 5DJMA 1AC1A 14GSA 4PQHA 1QMVA 2C1YA 2HT9A 1QQ2A 1RW1A 1M3IA 4NMUA 5IMZA 4MH3A 1NW2A 2HRFA 3FMWA 1Z6NA 2B5EA 5ECLB 4ZBDA 4YQVA 1YQ1A 3H4KA 5EY6A 5BRTA 2H0GA 4Q5FA 1EOHA 1K0DA 4O32A 5F8BA 1G6WA 3HVVA 2FGXA 2DMMA 1HNCA 4KSOA 4AJ6A 4EUYA 3O6TA 1JLVA 3A2WA 3FR3A 2CVDA 4X43A 1XVWA 2C3QA 3QAVA 4CW9A 1GH2A 3K8NA 4FQUA 2YNXA 3RHBA 2CA8A 1K0AA 5DAKB 4NPBA 2XPDA 1GNWA 4JU5A 4D73B 1BAYA 1WJKA 2GQMA 1AQWA 3TJBA 3TDGA 1YF0A 1GL8A 3KD0A 1OKTA 3ZYWA 1O85A 1PGTA 4YQMA 4X4JA 2MMZA 3HZ4A 4HS1A 2VCTA 1FOHA 2R4VA 3CSIA 1XZOA 1Y6EA 4HJ2A 2VCVA 1TU8A 3F0IA 3LXTA 3DYRA 4LLRA 2TRCP 3S9FA 4WKWA 3MSZA 1A23A 1XIYA 1QGVA 2CX3A 2LRNA 1B8XA 2H6ZA 3CRTA 3WT2A 4EIQA 4G10A 1FAAA 4ZL7A 1URMA 5HFGA 1FO5A 5JCWA 1THOA 5CRWA 5B8BA 4ISDA 4EKZA 4ZIJA 2X64A 3H93A 1E6BA 3R3EA 3HCZA 2LEGA 2A4VA 2DC5A 3SWLA 1TKDB 2VD1A 2OADA 2DKIA 3GV1A 2DJJA 3LEFA 3TJJA 4GWRA 1W89A 3G7YA 1OYJA 2ES7A 5ECPB 2WFCA 2HXKA 1XWCA 4MZWA 3CSJA 3FZ4A 4BL7B 4MPGA 2H01A 2F8FA 2AV4A 3LXZA 3DGQA 4JR6A 1MEKA 2C4JA 2MYGA 4TR1A 4KDYA 3TJGA 2J23A 4PX1A 2C0GA 2LNSA 4MH2A 5H5QA 1ZYPA 5CYYA 1SL1B 2XBIA 3GUSA 1XWAA 1GUMA 1TK0B 2B6MA 1WPIA 4ECCA 1TK8B 1M9BA 3ERGA 1ERTA 2X8HA 1TOFA 1U87A 4X1UA 2K9FA 2JADA 2CV4A 1M0UA 2E2MA 1GSDA 1OE7A 1VF1A 3G7IA 3HJMA 2PERA 1O7UA 4TN8A 1HNBA 4K9ZA 1A8LA 4OO5A 1GSUA 4POKA 1DE1A 1K0BA 1UC7A 6GSVA 4Z7XA 3ZREA 3P8WA 5G30A 3HVXA 1WMJA 1C72A 2M46A 4CY8A 4ZB9A 1EOGA 1PA3A 4ICYA 1YY7A 4WR4A 2QC7A 1V40A 5AIVA 2JL4A 4IGJA 2OA7A 4TXOB 3J7Yb 2HE3A 1YDKA 1TI1A 2MBTA 1BYEA 4GQCA 5GAND 2IJYA 3C1RA 2IMIA 3C7MA 1AW9A 1AUCA 4MF7A 5IPGA 5CRDA 5DBQA 4ECIA 4Z2RA 1ERWA 2JZTA 5HR0A 2VO4A 4MDCA 3LYKA 4NV5A 1XXUA 3IBHA 3TKSC 3D22A 4PTSA 2R0GA 4OCFA 4NHWA 3GKKA 2H1GA 2X8GA 1NM3A 2H72A 3UOMA 2ZCTA 3EE2A 3I43A 4O5UA 2GQKA 3GYKA 5B7CA 3CXGA 2LQQA 2HYXA 4EDYA 3DMLA 4V2MA 1TRWA 3BOAA 3ERFA 4K0NA 1OC9B 1YJ6A 3GMFA 4EO3A 1ZYQB 5D96A 3EWLA 2LV3A 3DRNA 2H70A 1PL1A 3APQA 4DSSB 3LJRA 4OWYA 3LQ7A 3IV4A 1JZDA 4LMVA 1TW9A 4F0CA 4EVMA 3KEBA 1S3RA 2B5XA 2DJKA 2L6CA 1XPVA 2YV9A 2XC2A 1XWKA 3QD9A 1GTUA 4FH8A 2GT6A 5JWOB 3F6DA 4ZB6A 1OE8A 3ERWA 4EL1A 4HQSA 5AN1A 3G7JA 4WF4A 4AGSA 1AQVA 5IMVA 1TRVA 4OMVA 3TRPA 4CY6A 1YKCA 2VCWA 3MYDA 1A2LA 2OJLA 2YOIA 4FYUA 3VURA 3QFAC 1PX6A 4TR4A 1WP0A 2KP2A 3ME7A 4JEDA 2TRXA 1SK2A 3IR4A 2LS5A 3KTLA 3LG6A 5AISA 2X8CA 1MDIA 2IFQB 1PSQA 3IOSA 4MLYA 2MMNA 1FG4A 1WOUA 4LL4B 2HZEA 1O81A 1ABAA 2R5GA 2WZ9A 3IXRA 4GTUA 4FIWA 1EV4A 3PR8A 3LFLA 5D9WA 4YAPA 3UEMA 3KMNA 3FZ5A 1PN9A 2HSYA 2PN8A 4KH7A 3H79A 4MK3A 5F07A 2IPAA 4BVYB 1FHEA 1EGOA 4KCEA 2UZ8A 3UL3A 1R26A 4DSQA 5HFIA 4HU9A 4IP6A 4L5OA 2PVOC 3QCPA 5KEJA 2OKAA 3P90A 1WIKA 1SJ6A 1VGLA 2YWIA 1GP1A 3TOUA 1UA5A 3C8EA 5ENUA 3GH9A 1ERVA 5G5EA 2FWHA 2H73A 3MNGA 3DEXA 3UMAA 2HZFA 1M2BA 2L57A 3GKMA 1JLWA 2OE1A 2ON5A 2KOKA 4PURA 4HQZA 3L9SA 2YANA 5ECNB 5ID2A 3IAS2 2XHFA 3I69A 4MMMA 1USBA 1TP9A 2B7KA 2H66A 2LJKA 3TCOA 3C71A 2N5AA 4XIHA 3NZNA 1GSEA 2B3SA 1I5GA 1PN0A 3ED3A 3TUEA 5J9BA 1X0RA 1ZMAA 2K8VA 2O89A 3JCML 1G7OA 1XBSA 2I4AA 4HEA2 2GGTA 3GTUB 4KDUA 3N5OA 5CP1A 4XS4A 5AIXA 4MJCA 1ZYNA 1YEPA 1GLPA 3F4RA 1SL2B 1BJXA 1V9WA 5KN3A 1YZXA 1NHYA 4WBJA 1GLQA 1PX7A 1GUHA 2OE3A 3D4TA 4GSTA 2H1DA 4ML1A 3FR6A 4PQIA 2CZ2A 1TI3A 4RQXA 2Z9SA 1GTBA 1A2MA 4KAEA 4EE0A 1BG5A 2R0PA 1Q4JA 4NHZA 6GSSA 2GZPA 4JZQA 2AUVA 4ZXGA 2CAQA 5HR1A 2J9HA 5KOWA 1K0MA 3CTGA 5GSSA 1U3AA 4KSMA 4NXIA 3FZAA 1G0TA 3UARA 7GSSA 3A5WA 2IN3A 1ZZYA 4YKFA 3UJ1A 5DAKA 3DXBA 2H1BA 3GL5A 4D73A 4MA9A 4IP1A 2C8UA 2PUKC 4YKGA 1FVKA 3ISOA 2YP6A 3EYTA 4PQ1A 1TU7A 3VI5A 3VWUA 1G6YA 1JFUA 1AIUA 3W6GA 2YCDA 4WR5A 5FWGA 4ACSA 5JCGA 3KH9A 1TRUA 3ZZXA 3FEUA 3IDVA 5IMAA 5B6NA 3EVIA 5G31A 4J56E 3ZMLA 5EVOA 5IO0A 2XPEA 4YH2A 3Q6OA 2M80A 2CVKA 4TR3A 4L8EA 2YWOA 4ULXA 2DIYA 2O8VB 3QPMA 3TJFA 2NVLA 4KNDA 3IAM2 1SJZA 4K0GA 1LBKA 1ZL9A 4MJEA 13GSA 1GWCA 1XFLA 2IMFA 5CO3A 3KGKA 4RI7A 3GURA 3KIJA 1OC3A 2O85A 4EDZA 3VWWA 5G5FA 4V2NA 4BA7A 3D0ZA 1F3AA 5JWQB 2CT6A 3A2VA 2GSSA 2VAFA 3NIVA 2YN1A 4AJ7A 3IC8A 1H75A 2DIZA 2DSAA 1E2YA 3VWXA 4ZL8A 4NWYA 5HR3A 3ZVJA 5A5KA 3M1GA 4RI6A 3IA1A 4TVEA 1ACVA 1N2AA 2HFDA 3DVXA 4BIKA 4EXJA 2N5BA 4POBA 1TTZA 3FY7A 4ZB8A 3AY8A 1A2JA 1FB0A 5ELAA 2V32A 4HZ2A 3EU3A 3P7XA 3MIXA 2TIRA 4L0UA 3F3QA 3HJPA 4GSNA 5A4VA 2QSIA 4KB3A 3HD5A 2PBJA 2WULA 1EGRA 3HKRA 1M99A 4MJAA 4ZL9A 1EP7A 2B7JA 4BVXB 3EURA 1GUKA 2KP1A 5HQPA 4G0KA 3WT1A 4K5SA 3E9JB 3UIWA 4PNGA 2WCIA 2HRAA 3ZMKA 1YF1A 4I2TA 3O76A 3WGDA 2WGRA 2L6DA 1SD9A 2O7KA 3Q74A 2DLXA 1KEBA 2IWTA 5IO2A 3IHGA 2H6XA 4IKHA 3FYGA 5EPFA 2VCZA 4G9HA 2C80A 1Z3EA 1SU9A 1K0CA 4TXOA 1K3YA 1Z6MA 4HU7A 4V1Ag 3TRQA 3GA4A 1T4YA 3L78A 4L0WA 4DEJA 3QAGA 4IHUA 3BBYA 2H30A 1BQ7A 2CAIA 2WB9A 3QR6A 4I5QA 5G1KA 2LRCA 4L5LA 5B8AA 5D9VA 2YWNA 3RPNA 2I9HA 2ON7A 4F82A 1K0OA 4IQ1A 3F4SA 4WXTA 2HI7A 4K2DA 2NBSA 2C0EA 3N9JA 3TKSA 4ILFA 3KZQA 2H19A 4O92A 4K5RA 4MCUA 5IMCA 3LGCA 3VPQA 3W8SA 1VF2A 4I6XA 1T00A 4OD7A 3TKSE 4HOJA 1EWXA 1T3BA 2GDRA 3PGTA 3GL3A 3GHAA 1OC9A 4HUAA 4XTSA 3GSTA 4IJIA 4GXZA 5DQSA 2C3NA 6GSYA 3QOUA 3I9V2 4DSSA 2VIMA 2MBSA 2WS2A 2EC4A 1XG8A 2GSTA 3F6FA 2R37A 2C0FA 1R5AA 3J7Yk 3HZ8A 4IVFA 5AGYA 3ZTLA 2JACA 3TJKA 1PMTA 2JZRA 2YZUA 2F9SA 2P0GA 3IE3A 1PL2A 2V6KA 1QXHA 4X0XA 6GSWA 6GSUA 2I81A 2H0HA 5B6MA 5J41A 5C00A 3U5RE 2E2GA 1T1VA 3RPPA 5DALA 4A5PA 4FYBA 5HR2A 4AJ8A 3NOFA 3BJ5A 4H86A 2AB6A 2O87A 1V2AA 3GH6A 3RDWA 3VWVA 2R0CA 1ZGNA 5KN0A 1LJRA 1B48A 5IMFA 2VLUA 3ME8A 1U3IA 4GF0A 5D93A 5F0GA 2DJ0A 5ECSA 1GTIA 3KMOA 1NHOA 1O6JA 2IFQA 1V58A 1X9MB 4J57E 1PKWA 1A0FA 2C0DA 4AF2A 4F0BA 2H71A 4TW5A 1SL0B 3GKXA 3UVTA 1ST9A 4F9ZA 2KHPA 3ZITA 4KCAA 2AAWA 3UVHA 4HI7A 6GSTA 5J3RA 2JU5A 2VL3A 2YV7A 1EEMA 3VPTA 4N0VA 4MNNA 3HDCA 2ALBA 2VLVA 3GN3A 1K3LA 1AXDA 1SK0A 3WGXA 2LJAA 2HLSA 3M0FA 3ZVJD 5JCUA 1MDKA 1F3BA 1V57A 4I97A 2FNOA 4WEYA 3HA9A 2WJUA 1X9SB 22GSA 2V41A 2WRTA 3KJYA 3DVWA 4OFNA 5J5NA 4PXOA 5CNWA 2H1AA 2BTOT 4XRDA 4PGTA 2L4QA 4LMWA 2G0FA 1SKSB 5ECIB 3HVSA 3VI7A 1K3OA 3KP8A 1F37A 1CQGA 3CSHA 4PNFA 1M9AA 1KNGA 4JR4A 1WRYA 3F8UA 3FW2A 3QAWA 3GKNA 5BMUA 1FB6A 3C73A 1F9MA 3E3EA 3UBKA 3HVNA 17GSA 1S3CA 1A0RP 4MZBA 3APSA 3O3TA 4ECBA 3GTUA 4MZCA 4RQRA 5F06A 1GNEA 3BD2A 1BEDA 5IMDA 4V1Ap 4XCSA 2FY6A 1YKAA 3MWHA 4QQ7A 2RUEA 2JSZA 5LCZA 2A2PA 2I3YA 4G0IA 2I1UA 1TK5B 2YZHA 2A2RA 5JWRB 4FYCA 1OKDA 2LTKA 3CBUA 1FOVA 3M3MA 2FD3A 2P31A 4MF5A 2VLTA 5D73A 3TKPA 3FK8A 2DJ2A 3WYWA 1GSSA 4BWQA 9GSSA 3L0HA 3IRAA 1AAZA 1WE0A 1PKZA 2RM6A 1V98A 5DJLA 3GSSA 2B1KA 3D6IA 3KH7A 5COHA 4TKYA 2GS3A 1XWGA 2KUCA 2IMEA 4MF6A 4O7HA 4G19A 4JBBA 1J0FA 3PH9A 3QMXA 1G7EA 1M3JA 5H5RA 4GCIA 2OACA 3HJOA 3KTBA
chains in the Genus database with same CATH topology
4K7OA 2EIRA 4CHSA 18GSA 1K0NA 4DVCA 1O8XA 2QA2A 4ZBAA 4KDXA 1OAZA 3IK9A 2H76A 2X49A 4K7NA 3WGEA 1J08A 4IELA 2ZNMA 1UVZA 1PD21 1DUGA 4K7IA 3TRXA 4ZILA 2DJ1A 3H8QA 5ECKB 1A8YA 1JZRA 3W8JA 4Q5QA 4XS4B 4FO5A 2P5RA 1N8JA 3LSZA 5ECOB 1R7HA 3PPUA 5ECHB 3HXSA 2G2QA 4PUAA 4BPYA 1SD8A 1MDJA 1Z7RA 4JE1A 4Q5NA 5HFKA 3EINA 1S3AA 1BX9A 1GSQA 2IIYA 4ZBBA 3E0UA 4LA1A 2L59A 4YQUA 2PGTA 3ZLPA 5LNKe 3RHCA 3LYPA 5E4WA 3DWVA 5ELGA 2GSRA 1FW1A 5FT3A 3ZFLA 1X5DA 1KTEA 3A2XA 3QDNA 1CQHA 5DCGA 2FCHA 4ID0A 3P2AA 2H0IA 2AHEA 1A24A 4GLTA 4K6XA 2PWJA 2RM5A 2VCXA 1SK1A 4MABA 1XWBA 4WBRD 3CRUA 1X5CA 5A4WA 4IS0A 3GFKA 3GNJA 4POLA 3D21A 4TR0A 5CRHA 3IPZA 1SKWB 5LD0A 4WETA 2FHEA 1PRXA 2C3TA 4BL7A 4O5QA 4MPFA 5J4UA 5IPHA 1GRXA 11GSA 4BVXA 1R4WA 3VLNA 1B4PA 5INYA 4P3YB 4NV2A 5CRGA 5D8IA 3APOA 5D9TA 3FZ9A 1XW6A 3F63A 3BCKA 1U6TA 3LORA 4OO4A 4PUFC 5ABRA 1WWJA 3LWAA 3F3RA 3GX0A 3I6AA 2FA4A 2FLSA 3KM6A 4OFMA 1J9BA 20GSA 2N5FA 4TXVA 2LKUA 1IYHA 3G9BA 1JZOA 2WDUA 1KBNA 4I8BA 2RIIA 2F8AA 4TOPA 5G1LA 5L71A 1OVNA 3C1SA 1GTAA 2PVQA 2L5LA 3FHKA 1GULA 3ZL5A 8GSSA 3CTFA 4XHMA 2BMXA 3PINA 3HHVA 1HD2A 3WD6A 2L5OA 1TXXA 2A4HA 2GTUA 4OCEA 1IYIA 2LJRA 4DSRA 2LUSA 1B9XC 4XRAA 4BWSA 5ECRB 4EC0A 4HDEA 1B9YC 1ERUA 4QL7A 2HRKA 3A3TA 4ECJA 2OE0A 2V1MA 2FUG2 2EIQA 1U88A 1HYUA 3FKFA 1QK8A 4OFTA 3US3A 2PMTA 4HJMA 1HQOA 2E0QA 3F9UA 5IOXA 4TR1B 1T4ZA 1SYXA 4TRXA 1O8WA 4G0LA 1LU4A 3IK7A 1SJIA 2CVBA 1H4OA 2K6VA 5H5SA 4K2XA 1EZKA 1XW5A 6GSXA 2QGVA 4F2IA 1HNAA 19GSA 1M2AA 1AQXA 5E59A 3DD3A 4MJBA 4XS6A 1ZYEA 2IL3A 1EEJA 2V2GA 5J9CA 1GSFA 1JHBA 3U6VA 2CX4A 5D9XA 3DIEA 5A4UA 4IN0A 4N11A 4GSSA 3V1WA 2KLXA 4KX4A 1ON4A 10GSA 4EF0A 5ECMB 2DJ3A 4CDOA 2GVPA 1SENA 1MD3A 4HZ4A 3IHQA 4RUVA 4EIPA 3IC4A 5KN1A 2OBIA 2X4AA 3BCIA 4Z2TA 2HNLA 3TGZA 4F03A 5DCHA 2H74A 2VL2A 2YPMA 2IMDA 2X99A 5KN2A 3ZFBA 2HSHA 5C04A 5IM9A 5DDLA 3EMPA 3UAPA 2NPBA 2PU9C 4WF5A 1RQMA 2FWEA 3QFBC 4ML6A 2BJXA 1I9DA 1F6MC 3GRXA 16GSA 4NAXA 2VL2C 4I2UA 1PQNA 3HYPA 3M8NA 2LNTA 2GT5A 2V6OA 1T8EB 4USSA 1XOAA 3TB2A 4O5RA 3RAZA 2F51A 4KUNA 2HRNA 4MP4A 3VK9A 1EP8A 2H75A 2GSQA 5IIZA 2D2ZA 2VL9A 5CAXA 2LQOA 3KXOA 3CMIA 2GZYA 3DKSA 3A5IA 1TRSA 2LSTA 1RK4A 4BVYA 1ILOA 3D4MA 5KOXA 2REMA 5DALB 3EU4A 4KE3A 2QA1A 4LL1B 4K8MA 1MD4A 2VM2A 4N30A 1THXA 1XOBA 3EC3A 4IQAA 3EPTA 2H8LA 4XS1A 2K18A 2NTOA 12GSA 4IJ3A 2PPTA 2CQ9A 4KF9A 5CREA 3RBTA 2MMAA 1SKRB 1JZWA 1VF3A 5EL8A 1X5EA 2MMOA 3D5JA 3GIXA 3Q19A 2L4CA 3VFIA 3KCMA 1SYRA 2H6YA 4QL9A 1Z9HA 5GSTA 1TJDA 1TDIA 2FWFA 1FVJA 1DSBA 4GRFA 2E7PA 3FRCA 1Z7PA 3OR5A 3UBLA 5GZZB 3CYNA 1QUWA 2VOCA 3R2QA 5ECQB 3L9UA 5F05A 2GQLA 1YEXA 2DBCA 2DMLA 4E8EA 3Q18A 2B1LA 3LW9A 2XBQA 2R2JA 3HY2A 3ZIJA 2VD0A 1QFNA 4N0ZA 3M9JA 3TOTA 1VRSD 1ZOFA 1S3DA 2VM1A 2QKEA 2GZZA 2F3MA 4IW9A 4KW6A 1DBYA 2CZ3A 2AJQB 2HZEB 3MDKA 4V2LA 2OBKA 1NSWA 1XCCA 4J2FA 4IBPA 2LRTA 1F2EA 1UN2A 4KGIA 2R3XA 3F4TA 4GQFA 4G2EA 1DE2A 1O73A 1VF4A 4JRRA 2MZCA 1MTCA 2RLIA 2FWGA 3L9VA 1M7TA 3GX8A 4POMA 2DKHA 1R5PA 1X9WB 2YJHA 3SBCA 4YAVA 2RUFA 5G2ZA 2A2SA 3H1NA 2HSMA 1XW9A 1T7PB 2NDOA 3EMXA 3ZIVA 5DVBA 3KP9A 1OC8A 2R6KA 2JZSA 3TKQA 2JSYA 5IQYA 1EV9A 2B5YA 1GSYA 4E8HA 2YWMA 2IMKA 4Q5RA 4K1FA 5ID2B 1XVQA 3FR9A 4Z2UA 2K8SA 2ZUPA 1ML6A 3MAKA 2FA8A 4N10A 2VCQA 5FHIA 5IOWA 1W4VA 5GAPD 1Y25A 3M9KA 4KA0A 1M2DA 2AYTA 2M72A 2GLRA 2VUPA 3L4NA 5DQYA 2P5QA 2EIOA 1Q98A 2YJ7A 1B4QA 1ZCPA 3ZRDA 3TKRA 1Z5YE 5DJMA 1AC1A 14GSA 4PQHA 1QMVA 2C1YA 2HT9A 1QQ2A 1RW1A 4NMUA 5IMZA 4MH3A 1NW2A 2HRFA 3FMWA 1Z6NA 2B5EA 5ECLB 4ZBDA 4YQVA 1YQ1A 3H4KA 5EY6A 5BRTA 2H0GA 4Q5FA 1EOHA 1K0DA 4O32A 5F8BA 1G6WA 3HVVA 2FGXA 2DMMA 1HNCA 4KSOA 4AJ6A 4EUYA 3O6TA 1JLVA 3A2WA 3FR3A 2CVDA 4X43A 1XVWA 2C3QA 3QAVA 4CW9A 1GH2A 3K8NA 4FQUA 2YNXA 3RHBA 2CA8A 1K0AA 5DAKB 4NPBA 2XPDA 1GNWA 4JU5A 4D73B 1BAYA 1WJKA 2GQMA 1AQWA 3TJBA 3TDGA 1YF0A 1GL8A 3KD0A 1OKTA 3ZYWA 1O85A 1PGTA 4YQMA 4X4JA 2MMZA 3HZ4A 4HS1A 2VCTA 1FOHA 2R4VA 3CSIA 1XZOA 1Y6EA 4HJ2A 2VCVA 1TU8A 3F0IA 3LXTA 3DYRA 4LLRA 2TRCP 3S9FA 4WKWA 3MSZA 1A23A 1XIYA 1QGVA 2CX3A 2LRNA 1B8XA 2H6ZA 3CRTA 3WT2A 4EIQA 4G10A 1FAAA 4ZL7A 1URMA 5HFGA 1FO5A 5JCWA 1THOA 5CRWA 5B8BA 4ISDA 4EKZA 4ZIJA 2X64A 3H93A 1E6BA 3R3EA 3HCZA 2LEGA 2A4VA 2DC5A 3SWLA 1TKDB 2VD1A 2OADA 2DKIA 3GV1A 2DJJA 3LEFA 3TJJA 4GWRA 1W89A 3G7YA 1OYJA 2ES7A 5ECPB 2WFCA 2HXKA 1XWCA 4MZWA 3CSJA 3FZ4A 4BL7B 4MPGA 2H01A 2F8FA 2AV4A 3LXZA 3DGQA 4JR6A 1MEKA 2C4JA 2MYGA 4TR1A 4KDYA 3TJGA 2J23A 4PX1A 2C0GA 2LNSA 4MH2A 5H5QA 1ZYPA 5CYYA 1SL1B 2XBIA 3GUSA 1XWAA 1GUMA 1TK0B 2B6MA 1WPIA 4ECCA 1TK8B 1M9BA 3ERGA 1ERTA 2X8HA 1TOFA 1U87A 4X1UA 2K9FA 2JADA 2CV4A 1M0UA 2E2MA 1GSDA 1OE7A 1VF1A 3G7IA 3HJMA 2PERA 1O7UA 4TN8A 1HNBA 4K9ZA 1A8LA 4OO5A 1GSUA 4POKA 1DE1A 1K0BA 1UC7A 6GSVA 4Z7XA 3ZREA 3P8WA 5G30A 3HVXA 1WMJA 1C72A 2M46A 4CY8A 4ZB9A 1EOGA 1PA3A 4ICYA 1YY7A 4WR4A 2QC7A 1V40A 5AIVA 2JL4A 4IGJA 2OA7A 4TXOB 3J7Yb 2HE3A 1YDKA 1TI1A 2MBTA 1BYEA 4GQCA 5GAND 2IJYA 3C1RA 2IMIA 3C7MA 1AW9A 1AUCA 4MF7A 5IPGA 5CRDA 5DBQA 4ECIA 4Z2RA 1ERWA 2JZTA 5HR0A 2VO4A 4MDCA 3LYKA 4NV5A 1XXUA 3IBHA 3TKSC 3D22A 4PTSA 2R0GA 4OCFA 4NHWA 3GKKA 2H1GA 2X8GA 1NM3A 2H72A 3UOMA 2ZCTA 3EE2A 3I43A 4O5UA 2GQKA 3GYKA 5B7CA 3CXGA 2LQQA 2HYXA 4EDYA 3DMLA 4V2MA 1TRWA 3BOAA 3ERFA 4K0NA 1OC9B 1YJ6A 3GMFA 4EO3A 1ZYQB 5D96A 3EWLA 2LV3A 3DRNA 2H70A 1PL1A 3APQA 4DSSB 3LJRA 4OWYA 3LQ7A 3IV4A 1JZDA 4LMVA 1TW9A 4F0CA 4EVMA 3KEBA 2B5XA 2DJKA 2L6CA 1XPVA 2YV9A 2XC2A 1XWKA 3QD9A 1GTUA 4FH8A 2GT6A 5JWOB 3F6DA 4ZB6A 1OE8A 3ERWA 4EL1A 4HQSA 5AN1A 3G7JA 4WF4A 4AGSA 1AQVA 5IMVA 1TRVA 4OMVA 3TRPA 4CY6A 1YKCA 2VCWA 3MYDA 1A2LA 2OJLA 2YOIA 4FYUA 3VURA 3QFAC 1PX6A 4TR4A 1WP0A 2KP2A 3ME7A 4JEDA 2TRXA 1SK2A 3IR4A 2LS5A 3KTLA 3LG6A 5AISA 2X8CA 1MDIA 2IFQB 1PSQA 3IOSA 4MLYA 2MMNA 1FG4A 1WOUA 4LL4B 2HZEA 1O81A 1ABAA 2R5GA 2WZ9A 3IXRA 4GTUA 4FIWA 1EV4A 3PR8A 3LFLA 5D9WA 4YAPA 3UEMA 3KMNA 3FZ5A 1PN9A 2HSYA 2PN8A 4KH7A 3H79A 4MK3A 5F07A 2IPAA 4BVYB 1FHEA 1EGOA 4KCEA 2UZ8A 3UL3A 1R26A 4DSQA 5HFIA 4HU9A 4IP6A 4L5OA 2PVOC 3QCPA 5KEJA 2OKAA 3P90A 1WIKA 1SJ6A 1VGLA 2YWIA 1GP1A 3TOUA 1UA5A 3C8EA 5ENUA 3GH9A 1ERVA 5G5EA 2FWHA 2H73A 3MNGA 3DEXA 3UMAA 2HZFA 1M2BA 2L57A 3GKMA 1JLWA 2OE1A 2ON5A 2KOKA 4PURA 4HQZA 3L9SA 2YANA 5ECNB 5ID2A 3IAS2 2XHFA 3I69A 4MMMA 1USBA 1TP9A 2B7KA 2H66A 2LJKA 3TCOA 3C71A 2N5AA 4XIHA 3NZNA 1GSEA 2B3SA 1I5GA 1PN0A 3ED3A 3TUEA 5J9BA 1X0RA 1ZMAA 2K8VA 2O89A 3JCML 1G7OA 1XBSA 2I4AA 4HEA2 2GGTA 3GTUB 4KDUA 3N5OA 5CP1A 4XS4A 5AIXA 4MJCA 1ZYNA 1YEPA 1GLPA 3F4RA 1SL2B 1BJXA 1V9WA 5KN3A 1YZXA 1NHYA 4WBJA 1GLQA 1PX7A 1GUHA 2OE3A 3D4TA 4GSTA 2H1DA 4ML1A 3FR6A 4PQIA 2CZ2A 1TI3A 4RQXA 2Z9SA 1GTBA 1A2MA 4KAEA 4EE0A 1BG5A 2R0PA 1Q4JA 4NHZA 6GSSA 2GZPA 4JZQA 2AUVA 4ZXGA 2CAQA 5HR1A 2J9HA 5KOWA 1K0MA 3CTGA 5GSSA 1U3AA 4KSMA 4NXIA 3FZAA 1G0TA 3UARA 7GSSA 3A5WA 2IN3A 1ZZYA 4YKFA 3UJ1A 5DAKA 3DXBA 2H1BA 3GL5A 4D73A 4MA9A 4IP1A 2C8UA 2PUKC 4YKGA 1FVKA 3ISOA 2YP6A 3EYTA 4PQ1A 1TU7A 3VI5A 3VWUA 1G6YA 1JFUA 1AIUA 3W6GA 2YCDA 4WR5A 5FWGA 4ACSA 5JCGA 3KH9A 1TRUA 3ZZXA 3FEUA 3IDVA 5IMAA 5B6NA 3EVIA 5G31A 4J56E 3ZMLA 5EVOA 5IO0A 2XPEA 4YH2A 3Q6OA 2M80A 2CVKA 4TR3A 4L8EA 2YWOA 4ULXA 2DIYA 2O8VB 3QPMA 3TJFA 2NVLA 4KNDA 3IAM2 1SJZA 4K0GA 1LBKA 1ZL9A 4MJEA 13GSA 1GWCA 1XFLA 2IMFA 5CO3A 3KGKA 4RI7A 3GURA 3KIJA 1OC3A 2O85A 4EDZA 3VWWA 5G5FA 4V2NA 4BA7A 3D0ZA 1F3AA 5JWQB 2CT6A 3A2VA 2GSSA 2VAFA 3NIVA 2YN1A 4AJ7A 3IC8A 1H75A 2DIZA 2DSAA 1E2YA 3VWXA 4ZL8A 4NWYA 5HR3A 3ZVJA 5A5KA 3M1GA 4RI6A 3IA1A 4TVEA 1ACVA 1N2AA 2HFDA 3DVXA 4EXJA 2N5BA 4POBA 1TTZA 3FY7A 4ZB8A 3AY8A 1A2JA 1FB0A 5ELAA 2V32A 4HZ2A 3EU3A 3P7XA 3MIXA 2TIRA 4L0UA 3F3QA 3HJPA 4GSNA 5A4VA 2QSIA 4KB3A 3HD5A 2PBJA 2WULA 1EGRA 3HKRA 1M99A 4MJAA 4ZL9A 1EP7A 2B7JA 4BVXB 3EURA 1GUKA 2KP1A 5HQPA 4G0KA 3WT1A 4K5SA 3E9JB 3UIWA 4PNGA 2WCIA 2HRAA 3ZMKA 1YF1A 4I2TA 3O76A 3WGDA 2WGRA 2L6DA 1SD9A 2O7KA 3Q74A 2DLXA 1KEBA 2IWTA 5IO2A 3IHGA 2H6XA 4IKHA 3FYGA 5EPFA 2VCZA 4G9HA 2C80A 1Z3EA 1SU9A 1K0CA 4TXOA 1K3YA 1Z6MA 4HU7A 4V1Ag 3TRQA 3GA4A 1T4YA 3L78A 4L0WA 4DEJA 3QAGA 4IHUA 3BBYA 2H30A 1BQ7A 2CAIA 2WB9A 3QR6A 4I5QA 5G1KA 2LRCA 4L5LA 5B8AA 5D9VA 2YWNA 3RPNA 2I9HA 2ON7A 4F82A 1K0OA 4IQ1A 3F4SA 4WXTA 2HI7A 4K2DA 2NBSA 2C0EA 3N9JA 3TKSA 4ILFA 3KZQA 2H19A 4O92A 4K5RA 4MCUA 5IMCA 3LGCA 3VPQA 3W8SA 1VF2A 4I6XA 1T00A 4OD7A 3TKSE 4HOJA 1EWXA 1T3BA 2GDRA 3PGTA 3GL3A 3GHAA 1OC9A 4HUAA 4XTSA 3GSTA 4IJIA 4GXZA 5DQSA 2C3NA 6GSYA 3QOUA 3I9V2 4DSSA 2VIMA 2MBSA 2WS2A 2EC4A 2GSTA 3F6FA 2R37A 2C0FA 1R5AA 3J7Yk 3HZ8A 4IVFA 5AGYA 3ZTLA 2JACA 3TJKA 1PMTA 2JZRA 2YZUA 2F9SA 2P0GA 3IE3A 1PL2A 2V6KA 1QXHA 4X0XA 6GSWA 6GSUA 2I81A 2H0HA 5B6MA 5J41A 5C00A 3U5RE 2E2GA 1T1VA 3RPPA 5DALA 4A5PA 4FYBA 5HR2A 4AJ8A 3NOFA 3BJ5A 4H86A 2AB6A 2O87A 1V2AA 3GH6A 3RDWA 3VWVA 2R0CA 1ZGNA 5KN0A 1LJRA 1B48A 5IMFA 2VLUA 3ME8A 1U3IA 4GF0A 5D93A 5F0GA 2DJ0A 5ECSA 1GTIA 3KMOA 1NHOA 1O6JA 2IFQA 1V58A 1X9MB 4J57E 1PKWA 1A0FA 2C0DA 4AF2A 4F0BA 2H71A 4TW5A 1SL0B 3GKXA 3UVTA 1ST9A 4F9ZA 2KHPA 3ZITA 4KCAA 2AAWA 3UVHA 4HI7A 6GSTA 5J3RA 2JU5A 2VL3A 2YV7A 1EEMA 3VPTA 4N0VA 4MNNA 3HDCA 2ALBA 2VLVA 3GN3A 1K3LA 1AXDA 1SK0A 3WGXA 2LJAA 2HLSA 3M0FA 3ZVJD 5JCUA 1MDKA 1F3BA 1V57A 4I97A 2FNOA 4WEYA 3HA9A 2WJUA 1X9SB 22GSA 2V41A 2WRTA 3KJYA 3DVWA 4OFNA 5J5NA 4PXOA 5CNWA 2H1AA 2BTOT 4XRDA 4PGTA 2L4QA 4LMWA 2G0FA 1SKSB 5ECIB 3HVSA 3VI7A 1K3OA 3KP8A 1F37A 1CQGA 3CSHA 4PNFA 1M9AA 1KNGA 4JR4A 1WRYA 3F8UA 3FW2A 3QAWA 3GKNA 5BMUA 1FB6A 3C73A 1F9MA 3E3EA 3UBKA 17GSA 1S3CA 1A0RP 4MZBA 3APSA 3O3TA 4ECBA 3GTUA 4MZCA 4RQRA 5F06A 1GNEA 3BD2A 1BEDA 5IMDA 4V1Ap 4XCSA 2FY6A 1YKAA 3MWHA 4QQ7A 2RUEA 2JSZA 5LCZA 2A2PA 2I3YA 4G0IA 2I1UA 1TK5B 2YZHA 2A2RA 5JWRB 4FYCA 1OKDA 2LTKA 3CBUA 1FOVA 3M3MA 2FD3A 2P31A 4MF5A 2VLTA 5D73A 3TKPA 3FK8A 2DJ2A 3WYWA 1GSSA 4BWQA 9GSSA 3L0HA 3IRAA 1AAZA 1WE0A 1PKZA 2RM6A 1V98A 5DJLA 3GSSA 2B1KA 3D6IA 3KH7A 5COHA 4TKYA 2GS3A 1XWGA 2KUCA 2IMEA 4MF6A 4O7HA 4G19A 4JBBA 1J0FA 3PH9A 3QMXA 1G7EA 5H5RA 4GCIA 2OACA 3HJOA 3KTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K7O A;  2EIR A;  4CHS A;  18GS A;  1K0N A;  4DVC A;  1O8X A;  4ZBA A;  4KDX A;  1OAZ A;  3IK9 A;  2H76 A;  4K7N A;  3WGE A;  1J08 A;  4IEL A;  2ZNM A;  1UVZ A;  1PD2 1;  1DUG A;  4K7I A;  3TRX A;  4ZIL A;  2DJ1 A;  3H8Q A;  5ECK B;  1A8Y A;  1JZR A;  3W8J A;  4Q5Q A;  4XS4 B;  4FO5 A;  2P5R A;  1N8J A;  3LSZ A;  5ECO B;  1R7H A;  5ECH B;  3HXS A;  2G2Q A;  4PUA A;  4BPY A;  1SD8 A;  1MDJ A;  1Z7R A;  4JE1 A;  4Q5N A;  5HFK A;  3EIN A;  1S3A A;  1BX9 A;  1GSQ A;  2IIY A;  4ZBB A;  3E0U A;  4LA1 A;  2L59 A;  4YQU A;  2PGT A;  3ZLP A;  5LNK e;  3RHC A;  3LYP A;  5E4W A;  3DWV A;  5ELG A;  2GSR A;  1FW1 A;  5FT3 A;  3ZFL A;  1X5D A;  1KTE A;  3A2X A;  3QDN A;  1CQH A;  5DCG A;  2FCH A;  4ID0 A;  3P2A A;  2H0I A;  2AHE A;  1A24 A;  4GLT A;  4K6X A;  2PWJ A;  2RM5 A;  2VCX A;  1SK1 A;  4MAB A;  1XWB A;  4WBR D;  3CRU A;  1X5C A;  5A4W A;  4IS0 A;  3GFK A;  3GNJ A;  4POL A;  3D21 A;  4TR0 A;  5CRH A;  3IPZ A;  1SKW B;  5LD0 A;  4WET A;  2FHE A;  1PRX A;  2C3T A;  4BL7 A;  4MPF A;  5J4U A;  5IPH A;  1GRX A;  11GS A;  4BVX A;  1R4W A;  3VLN A;  1B4P A;  5INY A;  4P3Y B;  4NV2 A;  5CRG A;  5D8I A;  3APO A;  5D9T A;  3FZ9 A;  1XW6 A;  3F63 A;  3BCK A;  1U6T A;  3LOR A;  4OO4 A;  4PUF C;  5ABR A;  1WWJ A;  3LWA A;  3F3R A;  3GX0 A;  3I6A A;  2FA4 A;  2FLS A;  3KM6 A;  4OFM A;  1J9B A;  20GS A;  2N5F A;  4TXV A;  2LKU A;  1IYH A;  3G9B A;  1JZO A;  2WDU A;  1KBN A;  4I8B A;  2RII A;  2F8A A;  4TOP A;  5G1L A;  5L71 A;  1OVN A;  3C1S A;  1GTA A;  2PVQ A;  2L5L A;  3FHK A;  1GUL A;  3ZL5 A;  8GSS A;  3CTF A;  4XHM A;  2BMX A;  3PIN A;  3HHV A;  1HD2 A;  3WD6 A;  2L5O A;  1TXX A;  2GTU A;  4OCE A;  1IYI A;  2LJR A;  4DSR A;  2LUS A;  1B9X C;  4XRA A;  4BWS A;  5ECR B;  4EC0 A;  4HDE A;  1B9Y C;  1ERU A;  4QL7 A;  3A3T A;  4ECJ A;  2OE0 A;  2V1M A;  2FUG 2;  2EIQ A;  1U88 A;  1HYU A;  3FKF A;  1QK8 A;  4OFT A;  3US3 A;  2PMT A;  4HJM A;  1HQO A;  2E0Q A;  3F9U A;  5IOX A;  4TR1 B;  1T4Z A;  1SYX A;  4TRX A;  1O8W A;  1LU4 A;  3IK7 A;  1SJI A;  2CVB A;  1H4O A;  2K6V A;  5H5S A;  1EZK A;  1XW5 A;  6GSX A;  2QGV A;  4F2I A;  1HNA A;  19GS A;  1M2A A;  1AQX A;  5E59 A;  3DD3 A;  4MJB A;  4XS6 A;  1ZYE A;  2IL3 A;  1EEJ A;  2V2G A;  5J9C A;  1GSF A;  1JHB A;  3U6V A;  2CX4 A;  5D9X A;  3DIE A;  5A4U A;  4IN0 A;  4N11 A;  4GSS A;  3V1W A;  2KLX A;  4KX4 A;  1ON4 A;  10GS A;  4EF0 A;  5ECM B;  2DJ3 A;  4CDO A;  2GVP A;  1SEN A;  1MD3 A;  4HZ4 A;  3IHQ A;  4RUV A;  3IC4 A;  5KN1 A;  2OBI A;  3BCI A;  2HNL A;  3TGZ A;  4F03 A;  5DCH A;  2H74 A;  2VL2 A;  2YPM A;  2IMD A;  2X99 A;  5KN2 A;  3ZFB A;  2HSH A;  5C04 A;  5IM9 A;  5DDL A;  3EMP A;  3UAP A;  2NPB A;  2PU9 C;  4WF5 A;  1RQM A;  2FWE A;  3QFB C;  4ML6 A;  2BJX A;  1I9D A;  1F6M C;  3GRX A;  16GS A;  4NAX A;  2VL2 C;  4I2U A;  1PQN A;  3HYP A;  3M8N A;  2LNT A;  2GT5 A;  2V6O A;  1T8E B;  1XOA A;  3TB2 A;  4O5R A;  3RAZ A;  2F51 A;  4KUN A;  2HRN A;  4MP4 A;  3VK9 A;  1EP8 A;  2H75 A;  2GSQ A;  5IIZ A;  2D2Z A;  2VL9 A;  5CAX A;  2LQO A;  3KXO A;  3CMI A;  2GZY A;  3DKS A;  1TRS A;  2LST A;  1RK4 A;  4BVY A;  1ILO A;  3D4M A;  2REM A;  5DAL B;  3EU4 A;  4KE3 A;  4LL1 B;  4K8M A;  1MD4 A;  2VM2 A;  4N30 A;  1THX A;  1XOB A;  3EC3 A;  4IQA A;  2H8L A;  4XS1 A;  2K18 A;  2NTO A;  12GS A;  4IJ3 A;  2PPT A;  2CQ9 A;  5CRE A;  3RBT A;  2MMA A;  1SKR B;  1JZW A;  1VF3 A;  5EL8 A;  1X5E A;  2MMO A;  3D5J A;  3GIX A;  3Q19 A;  2L4C A;  3VFI A;  3KCM A;  1SYR A;  2H6Y A;  4QL9 A;  1Z9H A;  5GST A;  1TJD A;  1TDI A;  2FWF A;  1FVJ A;  1DSB A;  4GRF A;  2E7P A;  3FRC A;  1Z7P A;  3OR5 A;  3UBL A;  5GZZ B;  3CYN A;  1QUW A;  2VOC A;  3R2Q A;  5ECQ B;  3L9U A;  5F05 A;  2GQL A;  1YEX A;  2DBC A;  2DML A;  4E8E A;  3Q18 A;  2B1L A;  2XBQ A;  2R2J A;  3HY2 A;  3ZIJ A;  2VD0 A;  1QFN A;  4N0Z A;  3M9J A;  3TOT A;  1VRS D;  1ZOF A;  1S3D A;  2VM1 A;  2QKE A;  2GZZ A;  2F3M A;  4IW9 A;  4KW6 A;  1DBY A;  2CZ3 A;  2AJQ B;  2HZE B;  3MDK A;  4V2L A;  2OBK A;  1NSW A;  1XCC A;  4J2F A;  4IBP A;  2LRT A;  1F2E A;  1UN2 A;  4KGI A;  2R3X A;  3F4T A;  4GQF A;  4G2E A;  1DE2 A;  1O73 A;  1VF4 A;  4JRR A;  2MZC A;  1MTC A;  2RLI A;  2FWG A;  3L9V A;  1M7T A;  3GX8 A;  4POM A;  1R5P A;  1X9W B;  2YJH A;  3SBC A;  4YAV A;  2RUF A;  5G2Z A;  2A2S A;  3H1N A;  1XW9 A;  1T7P B;  2NDO A;  3EMX A;  3ZIV A;  5DVB A;  3KP9 A;  1OC8 A;  2R6K A;  2JZS A;  3TKQ A;  2JSY A;  5IQY A;  1EV9 A;  2B5Y A;  1GSY A;  4E8H A;  2YWM A;  2IMK A;  4Q5R A;  4K1F A;  5ID2 B;  1XVQ A;  3FR9 A;  2K8S A;  2ZUP A;  1ML6 A;  3MAK A;  2FA8 A;  4N10 A;  2VCQ A;  5FHI A;  5IOW A;  1W4V A;  5GAP D;  1Y25 A;  3M9K A;  4KA0 A;  1M2D A;  2AYT A;  2M72 A;  2GLR A;  2VUP A;  3L4N A;  5DQY A;  2P5Q A;  2EIO A;  1Q98 A;  2YJ7 A;  1B4Q A;  1ZCP A;  3ZRD A;  3TKR A;  1Z5Y E;  5DJM A;  1AC1 A;  14GS A;  4PQH A;  1QMV A;  2C1Y A;  2HT9 A;  1QQ2 A;  1RW1 A;  4NMU A;  5IMZ A;  4MH3 A;  1NW2 A;  2HRF A;  1Z6N A;  2B5E A;  5ECL B;  4ZBD A;  4YQV A;  1YQ1 A;  3H4K A;  5EY6 A;  2H0G A;  4Q5F A;  1EOH A;  1K0D A;  4O32 A;  5F8B A;  1G6W A;  3HVV A;  2FGX A;  2DMM A;  1HNC A;  4KSO A;  4AJ6 A;  4EUY A;  3O6T A;  1JLV A;  3A2W A;  3FR3 A;  2CVD A;  4X43 A;  1XVW A;  2C3Q A;  3QAV A;  4CW9 A;  1GH2 A;  3K8N A;  2YNX A;  3RHB A;  2CA8 A;  1K0A A;  5DAK B;  4NPB A;  2XPD A;  1GNW A;  4JU5 A;  4D73 B;  1BAY A;  1WJK A;  2GQM A;  1AQW A;  3TJB A;  3TDG A;  1YF0 A;  1GL8 A;  3KD0 A;  1OKT A;  3ZYW A;  1O85 A;  1PGT A;  4YQM A;  2MMZ A;  3HZ4 A;  4HS1 A;  2VCT A;  2R4V A;  3CSI A;  1XZO A;  1Y6E A;  4HJ2 A;  2VCV A;  1TU8 A;  3F0I A;  3LXT A;  3DYR A;  4LLR A;  2TRC P;  3S9F A;  4WKW A;  3MSZ A;  1A23 A;  1XIY A;  1QGV A;  2CX3 A;  2LRN A;  1B8X A;  2H6Z A;  3CRT A;  3WT2 A;  4G10 A;  1FAA A;  4ZL7 A;  1URM A;  5HFG A;  1FO5 A;  5JCW A;  1THO A;  5CRW A;  5B8B A;  4ISD A;  4EKZ A;  4ZIJ A;  2X64 A;  3H93 A;  1E6B A;  3HCZ A;  2LEG A;  2A4V A;  2DC5 A;  3SWL A;  1TKD B;  2VD1 A;  2OAD A;  3GV1 A;  2DJJ A;  3LEF A;  3TJJ A;  4GWR A;  1W89 A;  3G7Y A;  1OYJ A;  2ES7 A;  5ECP B;  2WFC A;  2HXK A;  1XWC A;  4MZW A;  3CSJ A;  3FZ4 A;  4MPG A;  2H01 A;  2F8F A;  2AV4 A;  3LXZ A;  3DGQ A;  4JR6 A;  1MEK A;  2C4J A;  2MYG A;  4TR1 A;  4KDY A;  3TJG A;  2J23 A;  4PX1 A;  2C0G A;  2LNS A;  4MH2 A;  5H5Q A;  5CYY A;  1SL1 B;  2XBI A;  3GUS A;  1XWA A;  1GUM A;  1TK0 B;  2B6M A;  1WPI A;  4ECC A;  1TK8 B;  1M9B A;  3ERG A;  1ERT A;  2X8H A;  1TOF A;  1U87 A;  4X1U A;  2K9F A;  2JAD A;  2CV4 A;  1M0U A;  2E2M A;  1GSD A;  1OE7 A;  1VF1 A;  3G7I A;  3HJM A;  2PER A;  1O7U A;  4TN8 A;  1HNB A;  4K9Z A;  1A8L A;  4OO5 A;  1GSU A;  4POK A;  1DE1 A;  1K0B A;  1UC7 A;  6GSV A;  4Z7X A;  3ZRE A;  3P8W A;  5G30 A;  3HVX A;  1WMJ A;  1C72 A;  2M46 A;  4ZB9 A;  1EOG A;  1PA3 A;  1YY7 A;  4WR4 A;  2QC7 A;  1V40 A;  5AIV A;  2JL4 A;  4IGJ A;  2OA7 A;  4TXO B;  3J7Y b;  2HE3 A;  1YDK A;  1TI1 A;  2MBT A;  1BYE A;  4GQC A;  5GAN D;  2IJY A;  3C1R A;  2IMI A;  3C7M A;  1AW9 A;  1AUC A;  4MF7 A;  5IPG A;  5CRD A;  5DBQ A;  4ECI A;  1ERW A;  2JZT A;  5HR0 A;  2VO4 A;  4MDC A;  3LYK A;  4NV5 A;  1XXU A;  3IBH A;  3TKS C;  3D22 A;  4OCF A;  4NHW A;  3GKK A;  2H1G A;  2X8G A;  1NM3 A;  2H72 A;  3UOM A;  2ZCT A;  3EE2 A;  3I43 A;  2GQK A;  3GYK A;  5B7C A;  3CXG A;  2LQQ A;  2HYX A;  4EDY A;  3DML A;  4V2M A;  1TRW A;  3BOA A;  3ERF A;  4K0N A;  1OC9 B;  1YJ6 A;  3GMF A;  4EO3 A;  1ZYQ B;  5D96 A;  3EWL A;  2LV3 A;  3DRN A;  2H70 A;  1PL1 A;  3APQ A;  4DSS B;  3LJR A;  4OWY A;  3LQ7 A;  3IV4 A;  1JZD A;  4LMV A;  1TW9 A;  4F0C A;  4EVM A;  3KEB A;  2B5X A;  2DJK A;  2L6C A;  1XPV A;  2YV9 A;  2XC2 A;  1XWK A;  3QD9 A;  1GTU A;  4FH8 A;  2GT6 A;  5JWO B;  3F6D A;  4ZB6 A;  1OE8 A;  3ERW A;  4EL1 A;  4HQS A;  5AN1 A;  3G7J A;  4WF4 A;  4AGS A;  1AQV A;  5IMV A;  1TRV A;  4OMV A;  3TRP A;  1YKC A;  2VCW A;  1A2L A;  2OJL A;  2YOI A;  4FYU A;  3VUR A;  3QFA C;  1PX6 A;  4TR4 A;  1WP0 A;  2KP2 A;  3ME7 A;  4JED A;  2TRX A;  1SK2 A;  3IR4 A;  2LS5 A;  3KTL A;  3LG6 A;  5AIS A;  2X8C A;  1MDI A;  2IFQ B;  1PSQ A;  3IOS A;  4MLY A;  2MMN A;  1FG4 A;  1WOU A;  4LL4 B;  2HZE A;  1O81 A;  1ABA A;  2R5G A;  2WZ9 A;  3IXR A;  4GTU A;  4FIW A;  1EV4 A;  3PR8 A;  3LFL A;  5D9W A;  4YAP A;  3UEM A;  3KMN A;  3FZ5 A;  1PN9 A;  2HSY A;  2PN8 A;  4KH7 A;  3H79 A;  4MK3 A;  5F07 A;  2IPA A;  1FHE A;  1EGO A;  4KCE A;  3UL3 A;  1R26 A;  4DSQ A;  5HFI A;  4HU9 A;  4IP6 A;  4L5O A;  2PVO C;  3QCP A;  5KEJ A;  2OKA A;  3P90 A;  1WIK A;  1SJ6 A;  1VGL A;  2YWI A;  1GP1 A;  3TOU A;  1UA5 A;  3C8E A;  5ENU A;  3GH9 A;  1ERV A;  5G5E A;  2FWH A;  2H73 A;  3MNG A;  3DEX A;  3UMA A;  2HZF A;  1M2B A;  2L57 A;  3GKM A;  1JLW A;  2OE1 A;  2ON5 A;  2KOK A;  4PUR A;  4HQZ A;  3L9S A;  2YAN A;  5ECN B;  5ID2 A;  3IAS 2;  2XHF A;  3I69 A;  4MMM A;  1USB A;  1TP9 A;  2B7K A;  2H66 A;  2LJK A;  3TCO A;  3C71 A;  2N5A A;  4XIH A;  3NZN A;  1GSE A;  2B3S A;  1I5G A;  3ED3 A;  3TUE A;  5J9B A;  1X0R A;  1ZMA A;  2K8V A;  2O89 A;  3JCM L;  1G7O A;  1XBS A;  2I4A A;  4HEA 2;  2GGT A;  3GTU B;  4KDU A;  3N5O A;  5CP1 A;  4XS4 A;  5AIX A;  4MJC A;  1YEP A;  1GLP A;  3F4R A;  1SL2 B;  1BJX A;  1V9W A;  5KN3 A;  1YZX A;  1NHY A;  4WBJ A;  1GLQ A;  1PX7 A;  1GUH A;  2OE3 A;  3D4T A;  4GST A;  2H1D A;  4ML1 A;  3FR6 A;  4PQI A;  2CZ2 A;  1TI3 A;  4RQX A;  2Z9S A;  1GTB A;  1A2M A;  4KAE A;  4EE0 A;  1BG5 A;  1Q4J A;  4NHZ A;  6GSS A;  2GZP A;  4JZQ A;  2AUV A;  4ZXG A;  2CAQ A;  5HR1 A;  2J9H A;  1K0M A;  3CTG A;  5GSS A;  1U3A A;  4KSM A;  4NXI A;  3FZA A;  1G0T A;  3UAR A;  7GSS A;  3A5W A;  2IN3 A;  1ZZY A;  3UJ1 A;  5DAK A;  3DXB A;  2H1B A;  3GL5 A;  4D73 A;  4MA9 A;  4IP1 A;  2C8U A;  2PUK C;  1FVK A;  3ISO A;  2YP6 A;  3EYT A;  4PQ1 A;  1TU7 A;  3VI5 A;  3VWU A;  1G6Y A;  1JFU A;  1AIU A;  3W6G A;  2YCD A;  4WR5 A;  5FWG A;  4ACS A;  5JCG A;  3KH9 A;  1TRU A;  3ZZX A;  3FEU A;  3IDV A;  5IMA A;  5B6N A;  3EVI A;  5G31 A;  4J56 E;  3ZML A;  5EVO A;  5IO0 A;  2XPE A;  4YH2 A;  3Q6O A;  2M80 A;  2CVK A;  4TR3 A;  4L8E A;  2YWO A;  4ULX A;  2DIY A;  2O8V B;  3QPM A;  3TJF A;  2NVL A;  4KND A;  3IAM 2;  1SJZ A;  4K0G A;  1LBK A;  1ZL9 A;  4MJE A;  13GS A;  1GWC A;  1XFL A;  2IMF A;  5CO3 A;  3KGK A;  4RI7 A;  3GUR A;  3KIJ A;  1OC3 A;  2O85 A;  4EDZ A;  3VWW A;  5G5F A;  4V2N A;  4BA7 A;  3D0Z A;  1F3A A;  5JWQ B;  2CT6 A;  3A2V A;  2GSS A;  2VAF A;  3NIV A;  2YN1 A;  4AJ7 A;  1H75 A;  2DIZ A;  2DSA A;  1E2Y A;  3VWX A;  4ZL8 A;  4NWY A;  5HR3 A;  3ZVJ A;  5A5K A;  3M1G A;  4RI6 A;  3IA1 A;  4TVE A;  1ACV A;  1N2A A;  2HFD A;  3DVX A;  4EXJ A;  2N5B A;  4POB A;  1TTZ A;  3FY7 A;  4ZB8 A;  3AY8 A;  1A2J A;  1FB0 A;  5ELA A;  2V32 A;  4HZ2 A;  3EU3 A;  3P7X A;  2TIR A;  4L0U A;  3F3Q A;  3HJP A;  4GSN A;  5A4V A;  2QSI A;  4KB3 A;  3HD5 A;  2PBJ A;  2WUL A;  1EGR A;  3HKR A;  1M99 A;  4MJA A;  4ZL9 A;  1EP7 A;  2B7J A;  3EUR A;  1GUK A;  2KP1 A;  5HQP A;  3WT1 A;  3E9J B;  3UIW A;  4PNG A;  2WCI A;  3ZMK A;  1YF1 A;  4I2T A;  3O76 A;  3WGD A;  2WGR A;  2L6D A;  1SD9 A;  2O7K A;  3Q74 A;  2DLX A;  1KEB A;  2IWT A;  5IO2 A;  2H6X A;  4IKH A;  3FYG A;  5EPF A;  2VCZ A;  4G9H A;  2C80 A;  1Z3E A;  1SU9 A;  1K0C A;  4TXO A;  1K3Y A;  1Z6M A;  4HU7 A;  4V1A g;  3TRQ A;  3GA4 A;  1T4Y A;  3L78 A;  4L0W A;  4DEJ A;  3QAG A;  4IHU A;  3BBY A;  2H30 A;  1BQ7 A;  2CAI A;  2WB9 A;  3QR6 A;  4I5Q A;  5G1K A;  2LRC A;  4L5L A;  5B8A A;  5D9V A;  2YWN A;  3RPN A;  2I9H A;  2ON7 A;  4F82 A;  1K0O A;  4IQ1 A;  3F4S A;  4WXT A;  2HI7 A;  4K2D A;  2NBS A;  2C0E A;  3N9J A;  3TKS A;  4ILF A;  3KZQ A;  2H19 A;  4O92 A;  4MCU A;  5IMC A;  3LGC A;  3VPQ A;  3W8S A;  1VF2 A;  4I6X A;  1T00 A;  4OD7 A;  3TKS E;  4HOJ A;  1EWX A;  1T3B A;  2GDR A;  3PGT A;  3GL3 A;  3GHA A;  1OC9 A;  4HUA A;  4XTS A;  3GST A;  4IJI A;  4GXZ A;  5DQS A;  2C3N A;  6GSY A;  3QOU A;  3I9V 2;  4DSS A;  2VIM A;  2MBS A;  2WS2 A;  2EC4 A;  2GST A;  3F6F A;  2R37 A;  2C0F A;  1R5A A;  3J7Y k;  3HZ8 A;  4IVF A;  5AGY A;  3ZTL A;  2JAC A;  3TJK A;  1PMT A;  2JZR A;  2YZU A;  2F9S A;  2P0G A;  3IE3 A;  1PL2 A;  2V6K A;  1QXH A;  4X0X A;  6GSW A;  6GSU A;  2I81 A;  2H0H A;  5B6M A;  5J41 A;  5C00 A;  3U5R E;  2E2G A;  1T1V A;  3RPP A;  5DAL A;  4FYB A;  5HR2 A;  4AJ8 A;  3NOF A;  3BJ5 A;  4H86 A;  2AB6 A;  2O87 A;  1V2A A;  3GH6 A;  3RDW A;  3VWV A;  1ZGN A;  5KN0 A;  1LJR A;  1B48 A;  5IMF A;  2VLU A;  3ME8 A;  1U3I A;  4GF0 A;  5D93 A;  5F0G A;  2DJ0 A;  5ECS A;  1GTI A;  3KMO A;  1NHO A;  1O6J A;  2IFQ A;  1V58 A;  1X9M B;  4J57 E;  1PKW A;  1A0F A;  2C0D A;  4AF2 A;  4F0B A;  2H71 A;  4TW5 A;  1SL0 B;  3GKX A;  3UVT A;  1ST9 A;  4F9Z A;  2KHP A;  3ZIT A;  4KCA A;  2AAW A;  3UVH A;  4HI7 A;  6GST A;  5J3R A;  2JU5 A;  2VL3 A;  2YV7 A;  1EEM A;  3VPT A;  4N0V A;  3HDC A;  2ALB A;  2VLV A;  3GN3 A;  1K3L A;  1AXD A;  1SK0 A;  3WGX A;  2LJA A;  2HLS A;  3M0F A;  3ZVJ D;  5JCU A;  1MDK A;  1F3B A;  1V57 A;  4I97 A;  2FNO A;  4WEY A;  3HA9 A;  2WJU A;  1X9S B;  22GS A;  2V41 A;  2WRT A;  3KJY A;  3DVW A;  4OFN A;  5J5N A;  4PXO A;  5CNW A;  2H1A A;  2BTO T;  4XRD A;  4PGT A;  2L4Q A;  4LMW A;  2G0F A;  1SKS B;  5ECI B;  3HVS A;  3VI7 A;  1K3O A;  3KP8 A;  1F37 A;  1CQG A;  3CSH A;  4PNF A;  1M9A A;  1KNG A;  4JR4 A;  1WRY A;  3F8U A;  3FW2 A;  3QAW A;  3GKN A;  1FB6 A;  3C73 A;  1F9M A;  3E3E A;  3UBK A;  17GS A;  1S3C A;  1A0R P;  4MZB A;  3APS A;  3O3T A;  4ECB A;  3GTU A;  4MZC A;  4RQR A;  5F06 A;  1GNE A;  3BD2 A;  1BED A;  5IMD A;  4V1A p;  4XCS A;  2FY6 A;  1YKA A;  3MWH A;  4QQ7 A;  2RUE A;  2JSZ A;  5LCZ A;  2I3Y A;  2I1U A;  1TK5 B;  2YZH A;  2A2R A;  5JWR B;  4FYC A;  1OKD A;  2LTK A;  3CBU A;  1FOV A;  3M3M A;  2FD3 A;  2P31 A;  4MF5 A;  2VLT A;  5D73 A;  3TKP A;  3FK8 A;  2DJ2 A;  3WYW A;  1GSS A;  4BWQ A;  9GSS A;  3L0H A;  3IRA A;  1AAZ A;  1WE0 A;  1PKZ A;  2RM6 A;  1V98 A;  5DJL A;  3GSS A;  2B1K A;  3D6I A;  3KH7 A;  5COH A;  4TKY A;  2GS3 A;  1XWG A;  2KUC A;  2IME A;  4MF6 A;  4O7H A;  4G19 A;  4JBB A;  1J0F A;  3PH9 A;  3QMX A;  1G7E A;  5H5R A;  4GCI A;  2OAC A;  3HJO A;  3KTB A; 
#chains in the Genus database with same CATH topology
 4K7O A;  2EIR A;  4CHS A;  18GS A;  1K0N A;  4DVC A;  1O8X A;  2QA2 A;  4ZBA A;  4KDX A;  1OAZ A;  3IK9 A;  2H76 A;  2X49 A;  4K7N A;  3WGE A;  1J08 A;  4IEL A;  2ZNM A;  1UVZ A;  1PD2 1;  1DUG A;  4K7I A;  3TRX A;  4ZIL A;  2DJ1 A;  3H8Q A;  5ECK B;  1A8Y A;  1JZR A;  3W8J A;  4Q5Q A;  4XS4 B;  4FO5 A;  2P5R A;  1N8J A;  3LSZ A;  5ECO B;  1R7H A;  3PPU A;  5ECH B;  3HXS A;  2G2Q A;  4PUA A;  4BPY A;  1SD8 A;  1MDJ A;  1Z7R A;  4JE1 A;  4Q5N A;  5HFK A;  3EIN A;  1S3A A;  1BX9 A;  1GSQ A;  2IIY A;  4ZBB A;  3E0U A;  4LA1 A;  2L59 A;  4YQU A;  2PGT A;  3ZLP A;  5LNK e;  3RHC A;  3LYP A;  5E4W A;  3DWV A;  5ELG A;  2GSR A;  1FW1 A;  5FT3 A;  3ZFL A;  1X5D A;  1KTE A;  3A2X A;  3QDN A;  1CQH A;  5DCG A;  2FCH A;  4ID0 A;  3P2A A;  2H0I A;  2AHE A;  1A24 A;  1PFO A;  4GLT A;  4K6X A;  2PWJ A;  2RM5 A;  2VCX A;  1SK1 A;  4MAB A;  1XWB A;  4WBR D;  3CRU A;  1X5C A;  5A4W A;  4IS0 A;  3GFK A;  3GNJ A;  4POL A;  3D21 A;  4TR0 A;  5CRH A;  3IPZ A;  1SKW B;  5LD0 A;  4WET A;  2FHE A;  1PRX A;  2C3T A;  4BL7 A;  4O5Q A;  4MPF A;  5J4U A;  5IPH A;  1GRX A;  11GS A;  4BVX A;  1R4W A;  3VLN A;  1B4P A;  4HSC X;  5INY A;  4P3Y B;  4NV2 A;  5CRG A;  5D8I A;  3APO A;  5D9T A;  3FZ9 A;  1XW6 A;  3F63 A;  3BCK A;  1U6T A;  3LOR A;  4OO4 A;  4PUF C;  5ABR A;  1WWJ A;  3LWA A;  3F3R A;  3GX0 A;  3I6A A;  2FA4 A;  2FLS A;  3KM6 A;  4OFM A;  1J9B A;  20GS A;  2N5F A;  4TXV A;  2LKU A;  1IYH A;  3G9B A;  1JZO A;  2WDU A;  1KBN A;  4I8B A;  2RII A;  2F8A A;  4TOP A;  5G1L A;  5L71 A;  1OVN A;  3C1S A;  1GTA A;  2PVQ A;  2L5L A;  3FHK A;  1GUL A;  3ZL5 A;  8GSS A;  3CTF A;  4XHM A;  2BMX A;  3PIN A;  3HHV A;  1HD2 A;  3WD6 A;  2L5O A;  1TXX A;  2A4H A;  2GTU A;  4OCE A;  1IYI A;  2LJR A;  4DSR A;  2LUS A;  1B9X C;  4XRA A;  4BWS A;  5ECR B;  4EC0 A;  4HDE A;  1B9Y C;  1ERU A;  4QL7 A;  2HRK A;  3A3T A;  4ECJ A;  2OE0 A;  2V1M A;  2FUG 2;  2EIQ A;  1U88 A;  1HYU A;  3FKF A;  1QK8 A;  4OFT A;  3US3 A;  2PMT A;  4HJM A;  1HQO A;  2E0Q A;  3F9U A;  5IOX A;  4TR1 B;  1T4Z A;  1SYX A;  4TRX A;  1O8W A;  4G0L A;  1LU4 A;  3IK7 A;  1SJI A;  2CVB A;  3CQF A;  1H4O A;  2K6V A;  5H5S A;  4K2X A;  1EZK A;  1XW5 A;  6GSX A;  2QGV A;  4F2I A;  1HNA A;  19GS A;  1M2A A;  1AQX A;  5E59 A;  3DD3 A;  4MJB A;  4XS6 A;  1ZYE A;  2IL3 A;  1EEJ A;  2V2G A;  5J9C A;  1GSF A;  1JHB A;  3U6V A;  2CX4 A;  5D9X A;  3DIE A;  5A4U A;  4IN0 A;  4N11 A;  4GSS A;  3V1W A;  2KLX A;  4KX4 A;  1ON4 A;  10GS A;  4EF0 A;  5ECM B;  2DJ3 A;  4CDO A;  2GVP A;  1SEN A;  1MD3 A;  4HZ4 A;  3IHQ A;  4RUV A;  4EIP A;  3IC4 A;  5KN1 A;  2OBI A;  2X4A A;  3BCI A;  4Z2T A;  2HNL A;  3TGZ A;  4F03 A;  5DCH A;  2H74 A;  2VL2 A;  2YPM A;  2IMD A;  2X99 A;  5KN2 A;  3ZFB A;  2HSH A;  5C04 A;  5IM9 A;  5DDL A;  3EMP A;  3UAP A;  2NPB A;  2PU9 C;  4WF5 A;  1RQM A;  2FWE A;  3QFB C;  4ML6 A;  2BJX A;  1I9D A;  1F6M C;  3GRX A;  16GS A;  4NAX A;  2VL2 C;  4I2U A;  1PQN A;  3HYP A;  3M8N A;  2LNT A;  2GT5 A;  2V6O A;  1T8E B;  4USS A;  1XOA A;  3TB2 A;  4O5R A;  3RAZ A;  2F51 A;  4KUN A;  2HRN A;  4MP4 A;  3VK9 A;  1EP8 A;  2H75 A;  2GSQ A;  5IIZ A;  2D2Z A;  2VL9 A;  5CAX A;  2LQO A;  3KXO A;  3CMI A;  2GZY A;  3DKS A;  3A5I A;  1TRS A;  2LST A;  1RK4 A;  4BVY A;  1ILO A;  3D4M A;  5KOX A;  2REM A;  5DAL B;  3EU4 A;  4KE3 A;  2QA1 A;  4LL1 B;  4K8M A;  1MD4 A;  2VM2 A;  4N30 A;  1THX A;  1XOB A;  3EC3 A;  4IQA A;  3EPT A;  2H8L A;  4XS1 A;  2K18 A;  2NTO A;  12GS A;  4IJ3 A;  2PPT A;  2CQ9 A;  4KF9 A;  5CRE A;  3RBT A;  2MMA A;  1SKR B;  1JZW A;  1VF3 A;  5EL8 A;  1X5E A;  2MMO A;  3D5J A;  3GIX A;  3Q19 A;  2L4C A;  3VFI A;  3KCM A;  1SYR A;  2H6Y A;  4QL9 A;  1Z9H A;  5GST A;  1TJD A;  1TDI A;  2FWF A;  1FVJ A;  1DSB A;  4GRF A;  2E7P A;  3FRC A;  1Z7P A;  3OR5 A;  3UBL A;  5GZZ B;  3CYN A;  1QUW A;  2VOC A;  3R2Q A;  5ECQ B;  3L9U A;  5F05 A;  2GQL A;  1YEX A;  2DBC A;  2DML A;  4E8E A;  3Q18 A;  2B1L A;  3LW9 A;  2XBQ A;  2R2J A;  3HY2 A;  3ZIJ A;  2VD0 A;  1QFN A;  4N0Z A;  3M9J A;  3TOT A;  1VRS D;  1ZOF A;  1S3D A;  2VM1 A;  2QKE A;  2GZZ A;  2F3M A;  4IW9 A;  4KW6 A;  1DBY A;  2CZ3 A;  2AJQ B;  2HZE B;  3MDK A;  4V2L A;  2OBK A;  1NSW A;  1XCC A;  4J2F A;  4IBP A;  2LRT A;  1F2E A;  1UN2 A;  4KGI A;  2R3X A;  3F4T A;  4GQF A;  4G2E A;  1DE2 A;  1O73 A;  1VF4 A;  4JRR A;  2MZC A;  1MTC A;  2RLI A;  2FWG A;  3L9V A;  1M7T A;  3GX8 A;  4POM A;  2DKH A;  1R5P A;  1X9W B;  2YJH A;  3SBC A;  4YAV A;  2RUF A;  5G2Z A;  2A2S A;  3H1N A;  2HSM A;  1XW9 A;  1T7P B;  2NDO A;  3EMX A;  3ZIV A;  5DVB A;  3KP9 A;  1OC8 A;  2R6K A;  2JZS A;  3TKQ A;  2JSY A;  5IQY A;  1EV9 A;  2B5Y A;  1GSY A;  4E8H A;  2YWM A;  2IMK A;  4Q5R A;  4K1F A;  5ID2 B;  1XVQ A;  3FR9 A;  4Z2U A;  2K8S A;  2ZUP A;  1ML6 A;  3MAK A;  2FA8 A;  4N10 A;  2VCQ A;  5FHI A;  5IOW A;  1W4V A;  5GAP D;  1Y25 A;  3M9K A;  4KA0 A;  1M2D A;  2AYT A;  2M72 A;  2GLR A;  2VUP A;  3L4N A;  5DQY A;  2P5Q A;  2EIO A;  1Q98 A;  2YJ7 A;  1B4Q A;  1ZCP A;  3ZRD A;  3TKR A;  1Z5Y E;  5DJM A;  1AC1 A;  14GS A;  4PQH A;  1QMV A;  2C1Y A;  2HT9 A;  1QQ2 A;  1RW1 A;  1M3I A;  4NMU A;  5IMZ A;  4MH3 A;  1NW2 A;  2HRF A;  3FMW A;  1Z6N A;  2B5E A;  5ECL B;  4ZBD A;  4YQV A;  1YQ1 A;  3H4K A;  5EY6 A;  5BRT A;  2H0G A;  4Q5F A;  1EOH A;  1K0D A;  4O32 A;  5F8B A;  1G6W A;  3HVV A;  2FGX A;  2DMM A;  1HNC A;  4KSO A;  4AJ6 A;  4EUY A;  3O6T A;  1JLV A;  3A2W A;  3FR3 A;  2CVD A;  4X43 A;  1XVW A;  2C3Q A;  3QAV A;  4CW9 A;  1GH2 A;  3K8N A;  4FQU A;  2YNX A;  3RHB A;  2CA8 A;  1K0A A;  5DAK B;  4NPB A;  2XPD A;  1GNW A;  4JU5 A;  4D73 B;  1BAY A;  1WJK A;  2GQM A;  1AQW A;  3TJB A;  3TDG A;  1YF0 A;  1GL8 A;  3KD0 A;  1OKT A;  3ZYW A;  1O85 A;  1PGT A;  4YQM A;  4X4J A;  2MMZ A;  3HZ4 A;  4HS1 A;  2VCT A;  1FOH A;  2R4V A;  3CSI A;  1XZO A;  1Y6E A;  4HJ2 A;  2VCV A;  1TU8 A;  3F0I A;  3LXT A;  3DYR A;  4LLR A;  2TRC P;  3S9F A;  4WKW A;  3MSZ A;  1A23 A;  1XIY A;  1QGV A;  2CX3 A;  2LRN A;  1B8X A;  2H6Z A;  3CRT A;  3WT2 A;  4EIQ A;  4G10 A;  1FAA A;  4ZL7 A;  1URM A;  5HFG A;  1FO5 A;  5JCW A;  1THO A;  5CRW A;  5B8B A;  4ISD A;  4EKZ A;  4ZIJ A;  2X64 A;  3H93 A;  1E6B A;  3R3E A;  3HCZ A;  2LEG A;  2A4V A;  2DC5 A;  3SWL A;  1TKD B;  2VD1 A;  2OAD A;  2DKI A;  3GV1 A;  2DJJ A;  3LEF A;  3TJJ A;  4GWR A;  1W89 A;  3G7Y A;  1OYJ A;  2ES7 A;  5ECP B;  2WFC A;  2HXK A;  1XWC A;  4MZW A;  3CSJ A;  3FZ4 A;  4BL7 B;  4MPG A;  2H01 A;  2F8F A;  2AV4 A;  3LXZ A;  3DGQ A;  4JR6 A;  1MEK A;  2C4J A;  2MYG A;  4TR1 A;  4KDY A;  3TJG A;  2J23 A;  4PX1 A;  2C0G A;  2LNS A;  4MH2 A;  5H5Q A;  1ZYP A;  5CYY A;  1SL1 B;  2XBI A;  3GUS A;  1XWA A;  1GUM A;  1TK0 B;  2B6M A;  1WPI A;  4ECC A;  1TK8 B;  1M9B A;  3ERG A;  1ERT A;  2X8H A;  1TOF A;  1U87 A;  4X1U A;  2K9F A;  2JAD A;  2CV4 A;  1M0U A;  2E2M A;  1GSD A;  1OE7 A;  1VF1 A;  3G7I A;  3HJM A;  2PER A;  1O7U A;  4TN8 A;  1HNB A;  4K9Z A;  1A8L A;  4OO5 A;  1GSU A;  4POK A;  1DE1 A;  1K0B A;  1UC7 A;  6GSV A;  4Z7X A;  3ZRE A;  3P8W A;  5G30 A;  3HVX A;  1WMJ A;  1C72 A;  2M46 A;  4CY8 A;  4ZB9 A;  1EOG A;  1PA3 A;  4ICY A;  1YY7 A;  4WR4 A;  2QC7 A;  1V40 A;  5AIV A;  2JL4 A;  4IGJ A;  2OA7 A;  4TXO B;  3J7Y b;  2HE3 A;  1YDK A;  1TI1 A;  2MBT A;  1BYE A;  4GQC A;  5GAN D;  2IJY A;  3C1R A;  2IMI A;  3C7M A;  1AW9 A;  1AUC A;  4MF7 A;  5IPG A;  5CRD A;  5DBQ A;  4ECI A;  4Z2R A;  1ERW A;  2JZT A;  5HR0 A;  2VO4 A;  4MDC A;  3LYK A;  4NV5 A;  1XXU A;  3IBH A;  3TKS C;  3D22 A;  4PTS A;  2R0G A;  4OCF A;  4NHW A;  3GKK A;  2H1G A;  2X8G A;  1NM3 A;  2H72 A;  3UOM A;  2ZCT A;  3EE2 A;  3I43 A;  4O5U A;  2GQK A;  3GYK A;  5B7C A;  3CXG A;  2LQQ A;  2HYX A;  4EDY A;  3DML A;  4V2M A;  1TRW A;  3BOA A;  3ERF A;  4K0N A;  1OC9 B;  1YJ6 A;  3GMF A;  4EO3 A;  1ZYQ B;  5D96 A;  3EWL A;  2LV3 A;  3DRN A;  2H70 A;  1PL1 A;  3APQ A;  4DSS B;  3LJR A;  4OWY A;  3LQ7 A;  3IV4 A;  1JZD A;  4LMV A;  1TW9 A;  4F0C A;  4EVM A;  3KEB A;  1S3R A;  2B5X A;  2DJK A;  2L6C A;  1XPV A;  2YV9 A;  2XC2 A;  1XWK A;  3QD9 A;  1GTU A;  4FH8 A;  2GT6 A;  5JWO B;  3F6D A;  4ZB6 A;  1OE8 A;  3ERW A;  4EL1 A;  4HQS A;  5AN1 A;  3G7J A;  4WF4 A;  4AGS A;  1AQV A;  5IMV A;  1TRV A;  4OMV A;  3TRP A;  4CY6 A;  1YKC A;  2VCW A;  3MYD A;  1A2L A;  2OJL A;  2YOI A;  4FYU A;  3VUR A;  3QFA C;  1PX6 A;  4TR4 A;  1WP0 A;  2KP2 A;  3ME7 A;  4JED A;  2TRX A;  1SK2 A;  3IR4 A;  2LS5 A;  3KTL A;  3LG6 A;  5AIS A;  2X8C A;  1MDI A;  2IFQ B;  1PSQ A;  3IOS A;  4MLY A;  2MMN A;  1FG4 A;  1WOU A;  4LL4 B;  2HZE A;  1O81 A;  1ABA A;  2R5G A;  2WZ9 A;  3IXR A;  4GTU A;  4FIW A;  1EV4 A;  3PR8 A;  3LFL A;  5D9W A;  4YAP A;  3UEM A;  3KMN A;  3FZ5 A;  1PN9 A;  2HSY A;  2PN8 A;  4KH7 A;  3H79 A;  4MK3 A;  5F07 A;  2IPA A;  4BVY B;  1FHE A;  1EGO A;  4KCE A;  2UZ8 A;  3UL3 A;  1R26 A;  4DSQ A;  5HFI A;  4HU9 A;  4IP6 A;  4L5O A;  2PVO C;  3QCP A;  5KEJ A;  2OKA A;  3P90 A;  1WIK A;  1SJ6 A;  1VGL A;  2YWI A;  1GP1 A;  3TOU A;  1UA5 A;  3C8E A;  5ENU A;  3GH9 A;  1ERV A;  5G5E A;  2FWH A;  2H73 A;  3MNG A;  3DEX A;  3UMA A;  2HZF A;  1M2B A;  2L57 A;  3GKM A;  1JLW A;  2OE1 A;  2ON5 A;  2KOK A;  4PUR A;  4HQZ A;  3L9S A;  2YAN A;  5ECN B;  5ID2 A;  3IAS 2;  2XHF A;  3I69 A;  4MMM A;  1USB A;  1TP9 A;  2B7K A;  2H66 A;  2LJK A;  3TCO A;  3C71 A;  2N5A A;  4XIH A;  3NZN A;  1GSE A;  2B3S A;  1I5G A;  1PN0 A;  3ED3 A;  3TUE A;  5J9B A;  1X0R A;  1ZMA A;  2K8V A;  2O89 A;  3JCM L;  1G7O A;  1XBS A;  2I4A A;  4HEA 2;  2GGT A;  3GTU B;  4KDU A;  3N5O A;  5CP1 A;  4XS4 A;  5AIX A;  4MJC A;  1ZYN A;  1YEP A;  1GLP A;  3F4R A;  1SL2 B;  1BJX A;  1V9W A;  5KN3 A;  1YZX A;  1NHY A;  4WBJ A;  1GLQ A;  1PX7 A;  1GUH A;  2OE3 A;  3D4T A;  4GST A;  2H1D A;  4ML1 A;  3FR6 A;  4PQI A;  2CZ2 A;  1TI3 A;  4RQX A;  2Z9S A;  1GTB A;  1A2M A;  4KAE A;  4EE0 A;  1BG5 A;  2R0P A;  1Q4J A;  4NHZ A;  6GSS A;  2GZP A;  4JZQ A;  2AUV A;  4ZXG A;  2CAQ A;  5HR1 A;  2J9H A;  5KOW A;  1K0M A;  3CTG A;  5GSS A;  1U3A A;  4KSM A;  4NXI A;  3FZA A;  1G0T A;  3UAR A;  7GSS A;  3A5W A;  2IN3 A;  1ZZY A;  4YKF A;  3UJ1 A;  5DAK A;  3DXB A;  2H1B A;  3GL5 A;  4D73 A;  4MA9 A;  4IP1 A;  2C8U A;  2PUK C;  4YKG A;  1FVK A;  3ISO A;  2YP6 A;  3EYT A;  4PQ1 A;  1TU7 A;  3VI5 A;  3VWU A;  1G6Y A;  1JFU A;  1AIU A;  3W6G A;  2YCD A;  4WR5 A;  5FWG A;  4ACS A;  5JCG A;  3KH9 A;  1TRU A;  3ZZX A;  3FEU A;  3IDV A;  5IMA A;  5B6N A;  3EVI A;  5G31 A;  4J56 E;  3ZML A;  5EVO A;  5IO0 A;  2XPE A;  4YH2 A;  3Q6O A;  2M80 A;  2CVK A;  4TR3 A;  4L8E A;  2YWO A;  4ULX A;  2DIY A;  2O8V B;  3QPM A;  3TJF A;  2NVL A;  4KND A;  3IAM 2;  1SJZ A;  4K0G A;  1LBK A;  1ZL9 A;  4MJE A;  13GS A;  1GWC A;  1XFL A;  2IMF A;  5CO3 A;  3KGK A;  4RI7 A;  3GUR A;  3KIJ A;  1OC3 A;  2O85 A;  4EDZ A;  3VWW A;  5G5F A;  4V2N A;  4BA7 A;  3D0Z A;  1F3A A;  5JWQ B;  2CT6 A;  3A2V A;  2GSS A;  2VAF A;  3NIV A;  2YN1 A;  4AJ7 A;  3IC8 A;  1H75 A;  2DIZ A;  2DSA A;  1E2Y A;  3VWX A;  4ZL8 A;  4NWY A;  5HR3 A;  3ZVJ A;  5A5K A;  3M1G A;  4RI6 A;  3IA1 A;  4TVE A;  1ACV A;  1N2A A;  2HFD A;  3DVX A;  4BIK A;  4EXJ A;  2N5B A;  4POB A;  1TTZ A;  3FY7 A;  4ZB8 A;  3AY8 A;  1A2J A;  1FB0 A;  5ELA A;  2V32 A;  4HZ2 A;  3EU3 A;  3P7X A;  3MIX A;  2TIR A;  4L0U A;  3F3Q A;  3HJP A;  4GSN A;  5A4V A;  2QSI A;  4KB3 A;  3HD5 A;  2PBJ A;  2WUL A;  1EGR A;  3HKR A;  1M99 A;  4MJA A;  4ZL9 A;  1EP7 A;  2B7J A;  4BVX B;  3EUR A;  1GUK A;  2KP1 A;  5HQP A;  4G0K A;  3WT1 A;  4K5S A;  3E9J B;  3UIW A;  4PNG A;  2WCI A;  2HRA A;  3ZMK A;  1YF1 A;  4I2T A;  3O76 A;  3WGD A;  2WGR A;  2L6D A;  1SD9 A;  2O7K A;  3Q74 A;  2DLX A;  1KEB A;  2IWT A;  5IO2 A;  3IHG A;  2H6X A;  4IKH A;  3FYG A;  5EPF A;  2VCZ A;  4G9H A;  2C80 A;  1Z3E A;  1SU9 A;  1K0C A;  4TXO A;  1K3Y A;  1Z6M A;  4HU7 A;  4V1A g;  3TRQ A;  3GA4 A;  1T4Y A;  3L78 A;  4L0W A;  4DEJ A;  3QAG A;  4IHU A;  3BBY A;  2H30 A;  1BQ7 A;  2CAI A;  2WB9 A;  3QR6 A;  4I5Q A;  5G1K A;  2LRC A;  4L5L A;  5B8A A;  5D9V A;  2YWN A;  3RPN A;  2I9H A;  2ON7 A;  4F82 A;  1K0O A;  4IQ1 A;  3F4S A;  4WXT A;  2HI7 A;  4K2D A;  2NBS A;  2C0E A;  3N9J A;  3TKS A;  4ILF A;  3KZQ A;  2H19 A;  4O92 A;  4K5R A;  4MCU A;  5IMC A;  3LGC A;  3VPQ A;  3W8S A;  1VF2 A;  4I6X A;  1T00 A;  4OD7 A;  3TKS E;  4HOJ A;  1EWX A;  1T3B A;  2GDR A;  3PGT A;  3GL3 A;  3GHA A;  1OC9 A;  4HUA A;  4XTS A;  3GST A;  4IJI A;  4GXZ A;  5DQS A;  2C3N A;  6GSY A;  3QOU A;  3I9V 2;  4DSS A;  2VIM A;  2MBS A;  2WS2 A;  2EC4 A;  1XG8 A;  2GST A;  3F6F A;  2R37 A;  2C0F A;  1R5A A;  3J7Y k;  3HZ8 A;  4IVF A;  5AGY A;  3ZTL A;  2JAC A;  3TJK A;  1PMT A;  2JZR A;  2YZU A;  2F9S A;  2P0G A;  3IE3 A;  1PL2 A;  2V6K A;  1QXH A;  4X0X A;  6GSW A;  6GSU A;  2I81 A;  2H0H A;  5B6M A;  5J41 A;  5C00 A;  3U5R E;  2E2G A;  1T1V A;  3RPP A;  5DAL A;  4A5P A;  4FYB A;  5HR2 A;  4AJ8 A;  3NOF A;  3BJ5 A;  4H86 A;  2AB6 A;  2O87 A;  1V2A A;  3GH6 A;  3RDW A;  3VWV A;  2R0C A;  1ZGN A;  5KN0 A;  1LJR A;  1B48 A;  5IMF A;  2VLU A;  3ME8 A;  1U3I A;  4GF0 A;  5D93 A;  5F0G A;  2DJ0 A;  5ECS A;  1GTI A;  3KMO A;  1NHO A;  1O6J A;  2IFQ A;  1V58 A;  1X9M B;  4J57 E;  1PKW A;  1A0F A;  2C0D A;  4AF2 A;  4F0B A;  2H71 A;  4TW5 A;  1SL0 B;  3GKX A;  3UVT A;  1ST9 A;  4F9Z A;  2KHP A;  3ZIT A;  4KCA A;  2AAW A;  3UVH A;  4HI7 A;  6GST A;  5J3R A;  2JU5 A;  2VL3 A;  2YV7 A;  1EEM A;  3VPT A;  4N0V A;  4MNN A;  3HDC A;  2ALB A;  2VLV A;  3GN3 A;  1K3L A;  1AXD A;  1SK0 A;  3WGX A;  2LJA A;  2HLS A;  3M0F A;  3ZVJ D;  5JCU A;  1MDK A;  1F3B A;  1V57 A;  4I97 A;  2FNO A;  4WEY A;  3HA9 A;  2WJU A;  1X9S B;  22GS A;  2V41 A;  2WRT A;  3KJY A;  3DVW A;  4OFN A;  5J5N A;  4PXO A;  5CNW A;  2H1A A;  2BTO T;  4XRD A;  4PGT A;  2L4Q A;  4LMW A;  2G0F A;  1SKS B;  5ECI B;  3HVS A;  3VI7 A;  1K3O A;  3KP8 A;  1F37 A;  1CQG A;  3CSH A;  4PNF A;  1M9A A;  1KNG A;  4JR4 A;  1WRY A;  3F8U A;  3FW2 A;  3QAW A;  3GKN A;  5BMU A;  1FB6 A;  3C73 A;  1F9M A;  3E3E A;  3UBK A;  3HVN A;  17GS A;  1S3C A;  1A0R P;  4MZB A;  3APS A;  3O3T A;  4ECB A;  3GTU A;  4MZC A;  4RQR A;  5F06 A;  1GNE A;  3BD2 A;  1BED A;  5IMD A;  4V1A p;  4XCS A;  2FY6 A;  1YKA A;  3MWH A;  4QQ7 A;  2RUE A;  2JSZ A;  5LCZ A;  2A2P A;  2I3Y A;  4G0I A;  2I1U A;  1TK5 B;  2YZH A;  2A2R A;  5JWR B;  4FYC A;  1OKD A;  2LTK A;  3CBU A;  1FOV A;  3M3M A;  2FD3 A;  2P31 A;  4MF5 A;  2VLT A;  5D73 A;  3TKP A;  3FK8 A;  2DJ2 A;  3WYW A;  1GSS A;  4BWQ A;  9GSS A;  3L0H A;  3IRA A;  1AAZ A;  1WE0 A;  1PKZ A;  2RM6 A;  1V98 A;  5DJL A;  3GSS A;  2B1K A;  3D6I A;  3KH7 A;  5COH A;  4TKY A;  2GS3 A;  1XWG A;  2KUC A;  2IME A;  4MF6 A;  4O7H A;  4G19 A;  4JBB A;  1J0F A;  3PH9 A;  3QMX A;  1G7E A;  1M3J A;  5H5R A;  4GCI A;  2OAC A;  3HJO A;  3KTB A; 
#chains in the Genus database with same CATH homology
 4K7O A;  2EIR A;  4CHS A;  18GS A;  1K0N A;  4DVC A;  1O8X A;  2QA2 A;  4ZBA A;  4KDX A;  1OAZ A;  3IK9 A;  2H76 A;  2X49 A;  4K7N A;  3WGE A;  1J08 A;  4IEL A;  2ZNM A;  1UVZ A;  1PD2 1;  1DUG A;  4K7I A;  3TRX A;  4ZIL A;  2DJ1 A;  3H8Q A;  5ECK B;  1A8Y A;  1JZR A;  3W8J A;  4Q5Q A;  4XS4 B;  4FO5 A;  2P5R A;  1N8J A;  3LSZ A;  5ECO B;  1R7H A;  3PPU A;  5ECH B;  3HXS A;  2G2Q A;  4PUA A;  4BPY A;  1SD8 A;  1MDJ A;  1Z7R A;  4JE1 A;  4Q5N A;  5HFK A;  3EIN A;  1S3A A;  1BX9 A;  1GSQ A;  2IIY A;  4ZBB A;  3E0U A;  4LA1 A;  2L59 A;  4YQU A;  2PGT A;  3ZLP A;  5LNK e;  3RHC A;  3LYP A;  5E4W A;  3DWV A;  5ELG A;  2GSR A;  1FW1 A;  5FT3 A;  3ZFL A;  1X5D A;  1KTE A;  3A2X A;  3QDN A;  1CQH A;  5DCG A;  2FCH A;  4ID0 A;  3P2A A;  2H0I A;  2AHE A;  1A24 A;  4GLT A;  4K6X A;  2PWJ A;  2RM5 A;  2VCX A;  1SK1 A;  4MAB A;  1XWB A;  4WBR D;  3CRU A;  1X5C A;  5A4W A;  4IS0 A;  3GFK A;  3GNJ A;  4POL A;  3D21 A;  4TR0 A;  5CRH A;  3IPZ A;  1SKW B;  5LD0 A;  4WET A;  2FHE A;  1PRX A;  2C3T A;  4BL7 A;  4O5Q A;  4MPF A;  5J4U A;  5IPH A;  1GRX A;  11GS A;  4BVX A;  1R4W A;  3VLN A;  1B4P A;  5INY A;  4P3Y B;  4NV2 A;  5CRG A;  5D8I A;  3APO A;  5D9T A;  3FZ9 A;  1XW6 A;  3F63 A;  3BCK A;  1U6T A;  3LOR A;  4OO4 A;  4PUF C;  5ABR A;  1WWJ A;  3LWA A;  3F3R A;  3GX0 A;  3I6A A;  2FA4 A;  2FLS A;  3KM6 A;  4OFM A;  1J9B A;  20GS A;  2N5F A;  4TXV A;  2LKU A;  1IYH A;  3G9B A;  1JZO A;  2WDU A;  1KBN A;  4I8B A;  2RII A;  2F8A A;  4TOP A;  5G1L A;  5L71 A;  1OVN A;  3C1S A;  1GTA A;  2PVQ A;  2L5L A;  3FHK A;  1GUL A;  3ZL5 A;  8GSS A;  3CTF A;  4XHM A;  2BMX A;  3PIN A;  3HHV A;  1HD2 A;  3WD6 A;  2L5O A;  1TXX A;  2A4H A;  2GTU A;  4OCE A;  1IYI A;  2LJR A;  4DSR A;  2LUS A;  1B9X C;  4XRA A;  4BWS A;  5ECR B;  4EC0 A;  4HDE A;  1B9Y C;  1ERU A;  4QL7 A;  2HRK A;  3A3T A;  4ECJ A;  2OE0 A;  2V1M A;  2FUG 2;  2EIQ A;  1U88 A;  1HYU A;  3FKF A;  1QK8 A;  4OFT A;  3US3 A;  2PMT A;  4HJM A;  1HQO A;  2E0Q A;  3F9U A;  5IOX A;  4TR1 B;  1T4Z A;  1SYX A;  4TRX A;  1O8W A;  4G0L A;  1LU4 A;  3IK7 A;  1SJI A;  2CVB A;  1H4O A;  2K6V A;  5H5S A;  4K2X A;  1EZK A;  1XW5 A;  6GSX A;  2QGV A;  4F2I A;  1HNA A;  19GS A;  1M2A A;  1AQX A;  5E59 A;  3DD3 A;  4MJB A;  4XS6 A;  1ZYE A;  2IL3 A;  1EEJ A;  2V2G A;  5J9C A;  1GSF A;  1JHB A;  3U6V A;  2CX4 A;  5D9X A;  3DIE A;  5A4U A;  4IN0 A;  4N11 A;  4GSS A;  3V1W A;  2KLX A;  4KX4 A;  1ON4 A;  10GS A;  4EF0 A;  5ECM B;  2DJ3 A;  4CDO A;  2GVP A;  1SEN A;  1MD3 A;  4HZ4 A;  3IHQ A;  4RUV A;  4EIP A;  3IC4 A;  5KN1 A;  2OBI A;  2X4A A;  3BCI A;  4Z2T A;  2HNL A;  3TGZ A;  4F03 A;  5DCH A;  2H74 A;  2VL2 A;  2YPM A;  2IMD A;  2X99 A;  5KN2 A;  3ZFB A;  2HSH A;  5C04 A;  5IM9 A;  5DDL A;  3EMP A;  3UAP A;  2NPB A;  2PU9 C;  4WF5 A;  1RQM A;  2FWE A;  3QFB C;  4ML6 A;  2BJX A;  1I9D A;  1F6M C;  3GRX A;  16GS A;  4NAX A;  2VL2 C;  4I2U A;  1PQN A;  3HYP A;  3M8N A;  2LNT A;  2GT5 A;  2V6O A;  1T8E B;  4USS A;  1XOA A;  3TB2 A;  4O5R A;  3RAZ A;  2F51 A;  4KUN A;  2HRN A;  4MP4 A;  3VK9 A;  1EP8 A;  2H75 A;  2GSQ A;  5IIZ A;  2D2Z A;  2VL9 A;  5CAX A;  2LQO A;  3KXO A;  3CMI A;  2GZY A;  3DKS A;  3A5I A;  1TRS A;  2LST A;  1RK4 A;  4BVY A;  1ILO A;  3D4M A;  5KOX A;  2REM A;  5DAL B;  3EU4 A;  4KE3 A;  2QA1 A;  4LL1 B;  4K8M A;  1MD4 A;  2VM2 A;  4N30 A;  1THX A;  1XOB A;  3EC3 A;  4IQA A;  3EPT A;  2H8L A;  4XS1 A;  2K18 A;  2NTO A;  12GS A;  4IJ3 A;  2PPT A;  2CQ9 A;  4KF9 A;  5CRE A;  3RBT A;  2MMA A;  1SKR B;  1JZW A;  1VF3 A;  5EL8 A;  1X5E A;  2MMO A;  3D5J A;  3GIX A;  3Q19 A;  2L4C A;  3VFI A;  3KCM A;  1SYR A;  2H6Y A;  4QL9 A;  1Z9H A;  5GST A;  1TJD A;  1TDI A;  2FWF A;  1FVJ A;  1DSB A;  4GRF A;  2E7P A;  3FRC A;  1Z7P A;  3OR5 A;  3UBL A;  5GZZ B;  3CYN A;  1QUW A;  2VOC A;  3R2Q A;  5ECQ B;  3L9U A;  5F05 A;  2GQL A;  1YEX A;  2DBC A;  2DML A;  4E8E A;  3Q18 A;  2B1L A;  3LW9 A;  2XBQ A;  2R2J A;  3HY2 A;  3ZIJ A;  2VD0 A;  1QFN A;  4N0Z A;  3M9J A;  3TOT A;  1VRS D;  1ZOF A;  1S3D A;  2VM1 A;  2QKE A;  2GZZ A;  2F3M A;  4IW9 A;  4KW6 A;  1DBY A;  2CZ3 A;  2AJQ B;  2HZE B;  3MDK A;  4V2L A;  2OBK A;  1NSW A;  1XCC A;  4J2F A;  4IBP A;  2LRT A;  1F2E A;  1UN2 A;  4KGI A;  2R3X A;  3F4T A;  4GQF A;  4G2E A;  1DE2 A;  1O73 A;  1VF4 A;  4JRR A;  2MZC A;  1MTC A;  2RLI A;  2FWG A;  3L9V A;  1M7T A;  3GX8 A;  4POM A;  2DKH A;  1R5P A;  1X9W B;  2YJH A;  3SBC A;  4YAV A;  2RUF A;  5G2Z A;  2A2S A;  3H1N A;  2HSM A;  1XW9 A;  1T7P B;  2NDO A;  3EMX A;  3ZIV A;  5DVB A;  3KP9 A;  1OC8 A;  2R6K A;  2JZS A;  3TKQ A;  2JSY A;  5IQY A;  1EV9 A;  2B5Y A;  1GSY A;  4E8H A;  2YWM A;  2IMK A;  4Q5R A;  4K1F A;  5ID2 B;  1XVQ A;  3FR9 A;  4Z2U A;  2K8S A;  2ZUP A;  1ML6 A;  3MAK A;  2FA8 A;  4N10 A;  2VCQ A;  5FHI A;  5IOW A;  1W4V A;  5GAP D;  1Y25 A;  3M9K A;  4KA0 A;  1M2D A;  2AYT A;  2M72 A;  2GLR A;  2VUP A;  3L4N A;  5DQY A;  2P5Q A;  2EIO A;  1Q98 A;  2YJ7 A;  1B4Q A;  1ZCP A;  3ZRD A;  3TKR A;  1Z5Y E;  5DJM A;  1AC1 A;  14GS A;  4PQH A;  1QMV A;  2C1Y A;  2HT9 A;  1QQ2 A;  1RW1 A;  4NMU A;  5IMZ A;  4MH3 A;  1NW2 A;  2HRF A;  3FMW A;  1Z6N A;  2B5E A;  5ECL B;  4ZBD A;  4YQV A;  1YQ1 A;  3H4K A;  5EY6 A;  5BRT A;  2H0G A;  4Q5F A;  1EOH A;  1K0D A;  4O32 A;  5F8B A;  1G6W A;  3HVV A;  2FGX A;  2DMM A;  1HNC A;  4KSO A;  4AJ6 A;  4EUY A;  3O6T A;  1JLV A;  3A2W A;  3FR3 A;  2CVD A;  4X43 A;  1XVW A;  2C3Q A;  3QAV A;  4CW9 A;  1GH2 A;  3K8N A;  4FQU A;  2YNX A;  3RHB A;  2CA8 A;  1K0A A;  5DAK B;  4NPB A;  2XPD A;  1GNW A;  4JU5 A;  4D73 B;  1BAY A;  1WJK A;  2GQM A;  1AQW A;  3TJB A;  3TDG A;  1YF0 A;  1GL8 A;  3KD0 A;  1OKT A;  3ZYW A;  1O85 A;  1PGT A;  4YQM A;  4X4J A;  2MMZ A;  3HZ4 A;  4HS1 A;  2VCT A;  1FOH A;  2R4V A;  3CSI A;  1XZO A;  1Y6E A;  4HJ2 A;  2VCV A;  1TU8 A;  3F0I A;  3LXT A;  3DYR A;  4LLR A;  2TRC P;  3S9F A;  4WKW A;  3MSZ A;  1A23 A;  1XIY A;  1QGV A;  2CX3 A;  2LRN A;  1B8X A;  2H6Z A;  3CRT A;  3WT2 A;  4EIQ A;  4G10 A;  1FAA A;  4ZL7 A;  1URM A;  5HFG A;  1FO5 A;  5JCW A;  1THO A;  5CRW A;  5B8B A;  4ISD A;  4EKZ A;  4ZIJ A;  2X64 A;  3H93 A;  1E6B A;  3R3E A;  3HCZ A;  2LEG A;  2A4V A;  2DC5 A;  3SWL A;  1TKD B;  2VD1 A;  2OAD A;  2DKI A;  3GV1 A;  2DJJ A;  3LEF A;  3TJJ A;  4GWR A;  1W89 A;  3G7Y A;  1OYJ A;  2ES7 A;  5ECP B;  2WFC A;  2HXK A;  1XWC A;  4MZW A;  3CSJ A;  3FZ4 A;  4BL7 B;  4MPG A;  2H01 A;  2F8F A;  2AV4 A;  3LXZ A;  3DGQ A;  4JR6 A;  1MEK A;  2C4J A;  2MYG A;  4TR1 A;  4KDY A;  3TJG A;  2J23 A;  4PX1 A;  2C0G A;  2LNS A;  4MH2 A;  5H5Q A;  1ZYP A;  5CYY A;  1SL1 B;  2XBI A;  3GUS A;  1XWA A;  1GUM A;  1TK0 B;  2B6M A;  1WPI A;  4ECC A;  1TK8 B;  1M9B A;  3ERG A;  1ERT A;  2X8H A;  1TOF A;  1U87 A;  4X1U A;  2K9F A;  2JAD A;  2CV4 A;  1M0U A;  2E2M A;  1GSD A;  1OE7 A;  1VF1 A;  3G7I A;  3HJM A;  2PER A;  1O7U A;  4TN8 A;  1HNB A;  4K9Z A;  1A8L A;  4OO5 A;  1GSU A;  4POK A;  1DE1 A;  1K0B A;  1UC7 A;  6GSV A;  4Z7X A;  3ZRE A;  3P8W A;  5G30 A;  3HVX A;  1WMJ A;  1C72 A;  2M46 A;  4CY8 A;  4ZB9 A;  1EOG A;  1PA3 A;  4ICY A;  1YY7 A;  4WR4 A;  2QC7 A;  1V40 A;  5AIV A;  2JL4 A;  4IGJ A;  2OA7 A;  4TXO B;  3J7Y b;  2HE3 A;  1YDK A;  1TI1 A;  2MBT A;  1BYE A;  4GQC A;  5GAN D;  2IJY A;  3C1R A;  2IMI A;  3C7M A;  1AW9 A;  1AUC A;  4MF7 A;  5IPG A;  5CRD A;  5DBQ A;  4ECI A;  4Z2R A;  1ERW A;  2JZT A;  5HR0 A;  2VO4 A;  4MDC A;  3LYK A;  4NV5 A;  1XXU A;  3IBH A;  3TKS C;  3D22 A;  4PTS A;  2R0G A;  4OCF A;  4NHW A;  3GKK A;  2H1G A;  2X8G A;  1NM3 A;  2H72 A;  3UOM A;  2ZCT A;  3EE2 A;  3I43 A;  4O5U A;  2GQK A;  3GYK A;  5B7C A;  3CXG A;  2LQQ A;  2HYX A;  4EDY A;  3DML A;  4V2M A;  1TRW A;  3BOA A;  3ERF A;  4K0N A;  1OC9 B;  1YJ6 A;  3GMF A;  4EO3 A;  1ZYQ B;  5D96 A;  3EWL A;  2LV3 A;  3DRN A;  2H70 A;  1PL1 A;  3APQ A;  4DSS B;  3LJR A;  4OWY A;  3LQ7 A;  3IV4 A;  1JZD A;  4LMV A;  1TW9 A;  4F0C A;  4EVM A;  3KEB A;  2B5X A;  2DJK A;  2L6C A;  1XPV A;  2YV9 A;  2XC2 A;  1XWK A;  3QD9 A;  1GTU A;  4FH8 A;  2GT6 A;  5JWO B;  3F6D A;  4ZB6 A;  1OE8 A;  3ERW A;  4EL1 A;  4HQS A;  5AN1 A;  3G7J A;  4WF4 A;  4AGS A;  1AQV A;  5IMV A;  1TRV A;  4OMV A;  3TRP A;  4CY6 A;  1YKC A;  2VCW A;  3MYD A;  1A2L A;  2OJL A;  2YOI A;  4FYU A;  3VUR A;  3QFA C;  1PX6 A;  4TR4 A;  1WP0 A;  2KP2 A;  3ME7 A;  4JED A;  2TRX A;  1SK2 A;  3IR4 A;  2LS5 A;  3KTL A;  3LG6 A;  5AIS A;  2X8C A;  1MDI A;  2IFQ B;  1PSQ A;  3IOS A;  4MLY A;  2MMN A;  1FG4 A;  1WOU A;  4LL4 B;  2HZE A;  1O81 A;  1ABA A;  2R5G A;  2WZ9 A;  3IXR A;  4GTU A;  4FIW A;  1EV4 A;  3PR8 A;  3LFL A;  5D9W A;  4YAP A;  3UEM A;  3KMN A;  3FZ5 A;  1PN9 A;  2HSY A;  2PN8 A;  4KH7 A;  3H79 A;  4MK3 A;  5F07 A;  2IPA A;  4BVY B;  1FHE A;  1EGO A;  4KCE A;  2UZ8 A;  3UL3 A;  1R26 A;  4DSQ A;  5HFI A;  4HU9 A;  4IP6 A;  4L5O A;  2PVO C;  3QCP A;  5KEJ A;  2OKA A;  3P90 A;  1WIK A;  1SJ6 A;  1VGL A;  2YWI A;  1GP1 A;  3TOU A;  1UA5 A;  3C8E A;  5ENU A;  3GH9 A;  1ERV A;  5G5E A;  2FWH A;  2H73 A;  3MNG A;  3DEX A;  3UMA A;  2HZF A;  1M2B A;  2L57 A;  3GKM A;  1JLW A;  2OE1 A;  2ON5 A;  2KOK A;  4PUR A;  4HQZ A;  3L9S A;  2YAN A;  5ECN B;  5ID2 A;  3IAS 2;  2XHF A;  3I69 A;  4MMM A;  1USB A;  1TP9 A;  2B7K A;  2H66 A;  2LJK A;  3TCO A;  3C71 A;  2N5A A;  4XIH A;  3NZN A;  1GSE A;  2B3S A;  1I5G A;  1PN0 A;  3ED3 A;  3TUE A;  5J9B A;  1X0R A;  1ZMA A;  2K8V A;  2O89 A;  3JCM L;  1G7O A;  1XBS A;  2I4A A;  4HEA 2;  2GGT A;  3GTU B;  4KDU A;  3N5O A;  5CP1 A;  4XS4 A;  5AIX A;  4MJC A;  1ZYN A;  1YEP A;  1GLP A;  3F4R A;  1SL2 B;  1BJX A;  1V9W A;  5KN3 A;  1YZX A;  1NHY A;  4WBJ A;  1GLQ A;  1PX7 A;  1GUH A;  2OE3 A;  3D4T A;  4GST A;  2H1D A;  4ML1 A;  3FR6 A;  4PQI A;  2CZ2 A;  1TI3 A;  4RQX A;  2Z9S A;  1GTB A;  1A2M A;  4KAE A;  4EE0 A;  1BG5 A;  2R0P A;  1Q4J A;  4NHZ A;  6GSS A;  2GZP A;  4JZQ A;  2AUV A;  4ZXG A;  2CAQ A;  5HR1 A;  2J9H A;  5KOW A;  1K0M A;  3CTG A;  5GSS A;  1U3A A;  4KSM A;  4NXI A;  3FZA A;  1G0T A;  3UAR A;  7GSS A;  3A5W A;  2IN3 A;  1ZZY A;  4YKF A;  3UJ1 A;  5DAK A;  3DXB A;  2H1B A;  3GL5 A;  4D73 A;  4MA9 A;  4IP1 A;  2C8U A;  2PUK C;  4YKG A;  1FVK A;  3ISO A;  2YP6 A;  3EYT A;  4PQ1 A;  1TU7 A;  3VI5 A;  3VWU A;  1G6Y A;  1JFU A;  1AIU A;  3W6G A;  2YCD A;  4WR5 A;  5FWG A;  4ACS A;  5JCG A;  3KH9 A;  1TRU A;  3ZZX A;  3FEU A;  3IDV A;  5IMA A;  5B6N A;  3EVI A;  5G31 A;  4J56 E;  3ZML A;  5EVO A;  5IO0 A;  2XPE A;  4YH2 A;  3Q6O A;  2M80 A;  2CVK A;  4TR3 A;  4L8E A;  2YWO A;  4ULX A;  2DIY A;  2O8V B;  3QPM A;  3TJF A;  2NVL A;  4KND A;  3IAM 2;  1SJZ A;  4K0G A;  1LBK A;  1ZL9 A;  4MJE A;  13GS A;  1GWC A;  1XFL A;  2IMF A;  5CO3 A;  3KGK A;  4RI7 A;  3GUR A;  3KIJ A;  1OC3 A;  2O85 A;  4EDZ A;  3VWW A;  5G5F A;  4V2N A;  4BA7 A;  3D0Z A;  1F3A A;  5JWQ B;  2CT6 A;  3A2V A;  2GSS A;  2VAF A;  3NIV A;  2YN1 A;  4AJ7 A;  3IC8 A;  1H75 A;  2DIZ A;  2DSA A;  1E2Y A;  3VWX A;  4ZL8 A;  4NWY A;  5HR3 A;  3ZVJ A;  5A5K A;  3M1G A;  4RI6 A;  3IA1 A;  4TVE A;  1ACV A;  1N2A A;  2HFD A;  3DVX A;  4EXJ A;  2N5B A;  4POB A;  1TTZ A;  3FY7 A;  4ZB8 A;  3AY8 A;  1A2J A;  1FB0 A;  5ELA A;  2V32 A;  4HZ2 A;  3EU3 A;  3P7X A;  3MIX A;  2TIR A;  4L0U A;  3F3Q A;  3HJP A;  4GSN A;  5A4V A;  2QSI A;  4KB3 A;  3HD5 A;  2PBJ A;  2WUL A;  1EGR A;  3HKR A;  1M99 A;  4MJA A;  4ZL9 A;  1EP7 A;  2B7J A;  4BVX B;  3EUR A;  1GUK A;  2KP1 A;  5HQP A;  4G0K A;  3WT1 A;  4K5S A;  3E9J B;  3UIW A;  4PNG A;  2WCI A;  2HRA A;  3ZMK A;  1YF1 A;  4I2T A;  3O76 A;  3WGD A;  2WGR A;  2L6D A;  1SD9 A;  2O7K A;  3Q74 A;  2DLX A;  1KEB A;  2IWT A;  5IO2 A;  3IHG A;  2H6X A;  4IKH A;  3FYG A;  5EPF A;  2VCZ A;  4G9H A;  2C80 A;  1Z3E A;  1SU9 A;  1K0C A;  4TXO A;  1K3Y A;  1Z6M A;  4HU7 A;  4V1A g;  3TRQ A;  3GA4 A;  1T4Y A;  3L78 A;  4L0W A;  4DEJ A;  3QAG A;  4IHU A;  3BBY A;  2H30 A;  1BQ7 A;  2CAI A;  2WB9 A;  3QR6 A;  4I5Q A;  5G1K A;  2LRC A;  4L5L A;  5B8A A;  5D9V A;  2YWN A;  3RPN A;  2I9H A;  2ON7 A;  4F82 A;  1K0O A;  4IQ1 A;  3F4S A;  4WXT A;  2HI7 A;  4K2D A;  2NBS A;  2C0E A;  3N9J A;  3TKS A;  4ILF A;  3KZQ A;  2H19 A;  4O92 A;  4K5R A;  4MCU A;  5IMC A;  3LGC A;  3VPQ A;  3W8S A;  1VF2 A;  4I6X A;  1T00 A;  4OD7 A;  3TKS E;  4HOJ A;  1EWX A;  1T3B A;  2GDR A;  3PGT A;  3GL3 A;  3GHA A;  1OC9 A;  4HUA A;  4XTS A;  3GST A;  4IJI A;  4GXZ A;  5DQS A;  2C3N A;  6GSY A;  3QOU A;  3I9V 2;  4DSS A;  2VIM A;  2MBS A;  2WS2 A;  2EC4 A;  2GST A;  3F6F A;  2R37 A;  2C0F A;  1R5A A;  3J7Y k;  3HZ8 A;  4IVF A;  5AGY A;  3ZTL A;  2JAC A;  3TJK A;  1PMT A;  2JZR A;  2YZU A;  2F9S A;  2P0G A;  3IE3 A;  1PL2 A;  2V6K A;  1QXH A;  4X0X A;  6GSW A;  6GSU A;  2I81 A;  2H0H A;  5B6M A;  5J41 A;  5C00 A;  3U5R E;  2E2G A;  1T1V A;  3RPP A;  5DAL A;  4A5P A;  4FYB A;  5HR2 A;  4AJ8 A;  3NOF A;  3BJ5 A;  4H86 A;  2AB6 A;  2O87 A;  1V2A A;  3GH6 A;  3RDW A;  3VWV A;  2R0C A;  1ZGN A;  5KN0 A;  1LJR A;  1B48 A;  5IMF A;  2VLU A;  3ME8 A;  1U3I A;  4GF0 A;  5D93 A;  5F0G A;  2DJ0 A;  5ECS A;  1GTI A;  3KMO A;  1NHO A;  1O6J A;  2IFQ A;  1V58 A;  1X9M B;  4J57 E;  1PKW A;  1A0F A;  2C0D A;  4AF2 A;  4F0B A;  2H71 A;  4TW5 A;  1SL0 B;  3GKX A;  3UVT A;  1ST9 A;  4F9Z A;  2KHP A;  3ZIT A;  4KCA A;  2AAW A;  3UVH A;  4HI7 A;  6GST A;  5J3R A;  2JU5 A;  2VL3 A;  2YV7 A;  1EEM A;  3VPT A;  4N0V A;  4MNN A;  3HDC A;  2ALB A;  2VLV A;  3GN3 A;  1K3L A;  1AXD A;  1SK0 A;  3WGX A;  2LJA A;  2HLS A;  3M0F A;  3ZVJ D;  5JCU A;  1MDK A;  1F3B A;  1V57 A;  4I97 A;  2FNO A;  4WEY A;  3HA9 A;  2WJU A;  1X9S B;  22GS A;  2V41 A;  2WRT A;  3KJY A;  3DVW A;  4OFN A;  5J5N A;  4PXO A;  5CNW A;  2H1A A;  2BTO T;  4XRD A;  4PGT A;  2L4Q A;  4LMW A;  2G0F A;  1SKS B;  5ECI B;  3HVS A;  3VI7 A;  1K3O A;  3KP8 A;  1F37 A;  1CQG A;  3CSH A;  4PNF A;  1M9A A;  1KNG A;  4JR4 A;  1WRY A;  3F8U A;  3FW2 A;  3QAW A;  3GKN A;  5BMU A;  1FB6 A;  3C73 A;  1F9M A;  3E3E A;  3UBK A;  17GS A;  1S3C A;  1A0R P;  4MZB A;  3APS A;  3O3T A;  4ECB A;  3GTU A;  4MZC A;  4RQR A;  5F06 A;  1GNE A;  3BD2 A;  1BED A;  5IMD A;  4V1A p;  4XCS A;  2FY6 A;  1YKA A;  3MWH A;  4QQ7 A;  2RUE A;  2JSZ A;  5LCZ A;  2A2P A;  2I3Y A;  4G0I A;  2I1U A;  1TK5 B;  2YZH A;  2A2R A;  5JWR B;  4FYC A;  1OKD A;  2LTK A;  3CBU A;  1FOV A;  3M3M A;  2FD3 A;  2P31 A;  4MF5 A;  2VLT A;  5D73 A;  3TKP A;  3FK8 A;  2DJ2 A;  3WYW A;  1GSS A;  4BWQ A;  9GSS A;  3L0H A;  3IRA A;  1AAZ A;  1WE0 A;  1PKZ A;  2RM6 A;  1V98 A;  5DJL A;  3GSS A;  2B1K A;  3D6I A;  3KH7 A;  5COH A;  4TKY A;  2GS3 A;  1XWG A;  2KUC A;  2IME A;  4MF6 A;  4O7H A;  4G19 A;  4JBB A;  1J0F A;  3PH9 A;  3QMX A;  1G7E A;  5H5R A;  4GCI A;  2OAC A;  3HJO A;  3KTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...