1O6JA

Tryparedoxin ii from c.fasciculata solved by sulphur phasing
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
149
Chain Sequence
MSGLKKFFPYSTNVLKGAAADIALPSLAGKTVFFYFSASWCPPCRAFTPQLIDFYKAHAEKKNFEVMLISWDESAEDFKDYYAKMPWLALPFEDRKGMEFLTTGFDVKSIPTLVGVEADSGNIITTQARTMVVKDPEAKDFPWPNVEAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords TRYPAREDOXIN II
publication title De Novo Phasing of Two Crystal Forms of Tryparedoxin II Using the Anomalous Scattering from S Atoms: A Combination of Small Signal and Medium Resolution Reveals This to be a General Tool for Solving Protein Crystal Structures
pubmed doi rcsb
source organism Crithidia fasciculata
total genus 46
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1o6jA00
1AIUA 1O85A 4NV5A 1K3YA 1JLWA 1XWKA 3FEUA 5ECHB 4X0XA 2WGRA 1E6BA 4CHSA 2X8HA 3FHKA 4KB3A 2RLIA 1XWAA 4ZB8A 2N5BA 3HY2A 4ZXGA 3M3MA 3IA1A 2GQMA 4AGSA 4TN8A 2HXKA 1R7HA 1XOBA 1TI3A 2H70A 4MCUA 1GSQA 4YQUA 1T7PB 5F8BA 4GQCA 1XCCA 1XBSA 3GFKA 3HHVA 1XOAA 2CV4A 2VL3A 5ID2B 4EE0A 2JZRA 1GH2A 1ILOA 2IMEA 3HJMA 1V57A 4TR1A 2A2RA 5INYA 4E8EA 1JZOA 2MMZA 2YZUA 2EIQA 5DALA 3ZIJA 1VF4A 4D73B 2C0DA 2KUCA 1QFNA 4BPYA 2GT6A 4OFMA 2VL9A 4TOPA 3LEFA 2YPMA 2LRCA 4ML1A 4HJ2A 4PQHA 3HVXA 2VCWA 3DD3A 2M72A 4HU9A 3P8WA 4EKZA 1U3AA 4HI7A 3ZFBA 5KN1A 4K6XA 2F8AA 5IPGA 5IIZA 5A4VA 1K0BA 1LU4A 4EXJA 1ZCPA 2YNXA 5KN2A 4GRFA 4KGIA 3D4MA 3LXZA 4HQZA 3A5WA 5IO0A 3UMAA 1SU9A 1OVNA 2V32A 4WEYA 4F2IA 1EV4A 5L71A 2LRTA 3GX8A 1Z6NA 2PVQA 2R6KA 3LGCA 4MJBA 1PN9A 2XPDA 3CBUA 1SJZA 2OACA 5DCHA 4KSMA 2H75A 4N0ZA 1RW1A 2BJXA 2R3XA 3F4TA 4MZBA 2L6CA 1BQ7A 5IOWA 4OCFA 1X9SB 4NHWA 4MP4A 3LWAA 1X9WB 5D9XA 2RM6A 1G6WA 5J5NA 2ON5A 3KH9A 2QGVA 2XBIA 1Z7PA 2CX3A 3HJPA 6GSYA 1BEDA 5IMFA 4MK3A 1T8EB 5ELAA 1ERUA 3A3TA 2HFDA 2Z9SA 18GSA 3C71A 3GL5A 5GAPD 3D6IA 3L4NA 3NOFA 2IPAA 4Q5NA 4P3YB 3J7Yk 3F4RA 2IIYA 1BX9A 1JZRA 2BTOT 4N11A 4ISDA 3EYTA 1PGTA 5DAKA 5JCGA 2FY6A 5FT3A 1PKZA 2V41A 4G19A 2F9SA 1T3BA 4KAEA 3K8NA 3KTBA 5D8IA 2IWTA 2YWOA 3FZ4A 4FIWA 4POBA 1PX7A 3IV4A 1GSEA 4KDUA 5IPHA 4IQAA 2O87A 1A2JA 1WMJA 1J9BA 1WWJA 1R5AA 4XS6A 2CVBA 2LJKA 4K8MA 2HZEB 1XW9A 3DYRA 1X9MB 2HZFA 1YEPA 16GSA 1J08A 4POMA 3IHQA 4MZCA 3QPMA 2J23A 3ZZXA 3RPNA 4HJMA 2DMMA 4CW9A 3KH7A 4DSSB 1AAZA 1PKWA 1IYHA 4MPGA 5FHIA 3PH9A 2VAFA 3TJKA 4V1Ap 5IMZA 5CAXA 1URMA 1O8WA 1ERWA 1FG4A 4OO5A 2H1DA 1GUKA 3F0IA 4JE1A 3SBCA 3ZITA 2RM5A 3IAS2 4IJ3A 3CSHA 2EIOA 2N5AA 2TIRA 4HEA2 2H1GA 2JZTA 2EIRA 5LCZA 4HS1A 4FYCA 1FO5A 3GUSA 1YF0A 1WE0A 2TRCP 5GAND 3CMIA 1A0RP 3ZREA 5D93A 5KEJA 5F0GA 3HJOA 5IO2A 4GTUA 1AQXA 1F2EA 4PXOA 2MMNA 1R26A 3EMPA 2VD1A 3GL3A 1A23A 1QGVA 1HNBA 3F4SA 2VCTA 4GLTA 3VWWA 1XWBA 5HFIA 4PQIA 5LD0A 3MAKA 5E59A 2FWEA 2GTUA 1TJDA 2X64A 5ECSA 5GZZB 1K3OA 17GSA 4IW9A 3APSA 1Z3EA 4HQSA 4IS0A 2B5XA 2H66A 2HSYA 4QL9A 5IQYA 2G2QA 4TVEA 2IMKA 3L9SA 1T00A 3TKRA 1SL2B 2H6XA 3GYKA 1ZYEA 3ERFA 5CO3A 3Q74A 4K7NA 2VCQA 4ULXA 5IOXA 2C0FA 4TXOA 3F6DA 14GSA 2DJKA 4JR4A 2B5YA 3EMXA 3GSTA 1YKCA 3GIXA 2FA4A 1SYRA 5EPFA 1PQNA 2CAQA 4TR0A 4I97A 5JCUA 2NDOA 4BVYA 1LBKA 4MJAA 2E7PA 5CRWA 4ML6A 3VFIA 2OE3A 4WBJA 1O81A 1TP9A 3UOMA 3HZ8A 1EP8A 2LNSA 4MH2A 1XWCA 1Y6EA 2PWJA 1K0DA 5G31A 6GSTA 2OE0A 4G2EA 1A24A 5J4UA 3PGTA 3VWUA 4XRAA 5B6NA 1FHEA 3HCZA 2WFCA 5J41A 2ON7A 1EGRA 3ZIVA 4FYUA 2E2MA 3QAVA 4OCEA 3G9BA 2V6OA 13GSA 1XZOA 8GSSA 5G5EA 2X8CA 2VLVA 3I43A 3LYPA 3HZ4A 3M0FA 5G30A 4XHMA 1Z5YE 6GSWA 4IQ1A 1SENA 2XHFA 1UC7A 1AUCA 4KNDA 3GURA 5GSTA 5DALB 2LQQA 1VF3A 4POKA 1ZYQB 1ERTA 5HFGA 1THXA 1M2BA 5GSSA 3UEMA 3O76A 4PUFC 4ECJA 4F82A 3MWHA 3C1SA 2VCZA 4TKYA 2L59A 1AXDA 2B6MA 1DBYA 1XW6A 3ZLPA 2NBSA 4AJ8A 2IMFA 1SYXA 4L8EA 2A2SA 2YP6A 1FOVA 4TW5A 3L9UA 2VM2A 3L0HA 3A2VA 1SK2A 4ZL7A 5HR0A 3WYWA 4MDCA 5CRDA 2AYTA 3O3TA 1ON4A 1GULA 1QK8A 4I8BA 3UBKA 1Q98A 1SL0B 2PERA 3D0ZA 2HRNA 4K1FA 4XRDA 3TCOA 3DGQA 3G7JA 3CTFA 1SD8A 3F8UA 3H8QA 3A2WA 4WXTA 2CZ3A 3VI5A 3VK9A 2IFQB 4OFNA 4CDOA 3CYNA 3TRXA 1TK8B 2LRNA 3CTGA 4JR6A 2FWGA 4J2FA 3TKQA 4N30A 4ZL8A 2GSTA 1NHOA 3IOSA 1XWGA 4XTSA 1U87A 1S3CA 4WKWA 1KEBA 1GSFA 1G6YA 2KP1A 5H5SA 1MD4A 5F07A 3F9UA 5AGYA 1S3DA 3I9V2 3DWVA 1GP1A 2DJJA 3M9KA 1GSSA 5ECOB 12GSA 2H0IA 4L5OA 3DMLA 2N5FA 3HDCA 5IMCA 2MZCA 3BD2A 2WRTA 3E0UA 2I1UA 5CP1A 3TB2A 1TK0B 4I5QA 3H93A 3RBTA 2GSSA 1GNWA 4X43A 2WDUA 1GSYA 2H1BA 5COHA 1ZGNA 2YV7A 1QXHA 2L5OA 1N8JA 5D96A 1J0FA 3EVIA 3ZMLA 2MBTA 5CRHA 2O89A 5DVBA 3J7Yb 4KSOA 5J3RA 2LUSA 3JCML 2LEGA 3G7YA 5IMVA 3KP8A 4HZ2A 3IK7A 1HNCA 3W8JA 4OFTA 4DVCA 2I9HA 5ECNB 2ES7A 2P5QA 3GKNA 2FWHA 1OE8A 5KN0A 2VM1A 1HNAA 1OKDA 1K0MA 2FHEA 1VRSD 1EEJA 1XXUA 1OE7A 3LYKA 3F6FA 2FNOA 1Z9HA 3KIJA 1HD2A 5ENUA 3ZYWA 1C72A 2YN1A 4NPBA 2L5LA 4ZB6A 3TJGA 2KLXA 2K18A 4BA7A 5H5QA 3U6VA 2HRFA 5DQSA 2IMDA 4WF4A 19GSA 2REMA 1S3AA 2P31A 2C3QA 1OC9B 4IP6A 1TDIA 1X5EA 1V9WA 4RQXA 3ERWA 4GSNA 3D5JA 2YJ7A 1EWXA 2BMXA 2VUPA 4EDYA 3Q6OA 3ISOA 2K9FA 4OO4A 1XVQA 3TUEA 6GSVA 4GSSA 3C73A 1O8XA 1SK1A 2MMAA 4KA0A 3L9VA 5G1KA 1TRSA 5B6MA 1V40A 4EL1A 2MBSA 1RQMA 3VURA 2ZCTA 3GN3A 3MSZA 1K0AA 4KE3A 4LLRA 2H6YA 4NWYA 5ECQB 2I4AA 1JLVA 4ID0A 3ZVJD 5EVOA 4FO5A 2V2GA 2B7KA 1Q4JA 3TJBA 1M99A 4IHUA 2K8VA 1YDKA 4MF7A 3EWLA 2DJ1A 3CXGA 3TOUA 2FUG2 2H01A 5ID2A 2B1LA 1X5DA 2PU9C 5IM9A 2JADA 3DVWA 4MMMA 4MPFA 4L0UA 3HD5A 3DIEA 2YJHA 1KNGA 4O92A 3APQA 3F3RA 5DJMA 4TRXA 1X5CA 5J9CA 1A8LA 3GKKA 1JHBA 1E2YA 4FYBA 2F3MA 3E3EA 3QFBC 4LL4B 2G0FA 2JSYA 4ECIA 1PX6A 3BBYA 3UJ1A 1B4QA 3CRTA 1PD21 5AIXA 5B8BA 2X8GA 2PBJA 2PN8A 3CSIA 3C7MA 1GTUA 1O7UA 2YWIA 4K7OA 3S9FA 1AQWA 3I6AA 5D9WA 1GTBA 2GQLA 4ZILA 2I81A 3UIWA 4G9HA 3ZL5A 2C0EA 1EOHA 4XS4B 4JZQA 1I5GA 1YY7A 3QCPA 2H19A 2VIMA 2YCDA 22GSA 3GTUB 1PRXA 3FY7A 4I2UA 1M9AA 3FR6A 5ECPB 4IBPA 1GSDA 1ML6A 4N0VA 1EP7A 2GSRA 1KBNA 4K9ZA 1B8XA 3IBHA 1EEMA 1R4WA 3GH9A 2HI7A 4V1Ag 1SD9A 4ECCA 4KX4A 2YV9A 3TGZA 3LFLA 3BJ5A 4KUNA 3ED3A 4RI6A 4O5RA 2VOCA 3GRXA 2KOKA 2GZZA 2GT5A 3KM6A 2XC2A 3D21A 4O32A 3APOA 3ZRDA 1TU7A 1Z7RA 2E2GA 3HA9A 2E0QA 4OMVA 1ABAA 1NSWA 2O7KA 2GGTA 2MMOA 5DQYA 1YZXA 1XVWA 1YF1A 3GNJA 3HYPA 3W6GA 1USBA 3VLNA 1MD3A 3UARA 4PQ1A 5G1LA 4Q5QA 1I9DA 5IMDA 5HFKA 3D4TA 3DRNA 3R2QA 3KMNA 3KTLA 4YQMA 3Q19A 5JWRB 2DJ2A 3FK8A 4XCSA 3HXSA 4MF6A 3GHAA 1TXXA 2DLXA 2JACA 4MABA 2H74A 3RHCA 4PURA 3SWLA 6GSUA 2H30A 3FW2A 1X0RA 4WF5A 1SJIA 2GLRA 5KN3A 5H5RA 4HZ4A 4ZIJA 2KHPA 1DSBA 1ERVA 1OYJA 2A4VA 3P90A 3H79A 2L4CA 3EE2A 4WETA 3PINA 1TI1A 3TKSC 1BYEA 2H71A 2HZEA 2IN3A 5HR3A 2YWNA 2FGXA 2WJUA 4WBRD 2C4JA 4DEJA 4F0CA 1AW9A 3AY8A 5F05A 4DSSA 1T1VA 1OAZA 5EY6A 2WCIA 1VF2A 3N5OA 3QR6A 1FVJA 4TR1B 2AV4A 2AB6A 3F63A 1W89A 4Q5RA 1O6JA 4IGJA 2F8FA 3QFAC 1GRXA 4K0NA 2LJAA 4RUVA 5CREA 2CVKA 1B9YC 3C8EA 1YJ6A 4MZWA 3KEBA 3TKSA 3ZTLA 1YEXA 3E9JB 1ZOFA 2I3YA 2RIIA 4K0GA 5AISA 4IVFA 1OC3A 4V2NA 4YQVA 2JZSA 4LL1B 1GL8A 2JSZA 1M2AA 2B7JA 4ZBBA 3G7IA 4MH3A 4N10A 1V58A 2TRXA 4IJIA 1XIYA 4JEDA 3WT2A 5D73A 3N9JA 2GQKA 5JWOB 3IPZA 3IRAA 2VL2C 2CX4A 3M1GA 5ELGA 2C80A 3QAWA 4JRRA 1SKRB 3TDGA 4EC0A 5DDLA 2VCVA 1RK4A 3GSSA 3P7XA 4GXZA 1G7OA 3FZ5A 2DIZA 1B48A 1ZZYA 2P5RA 4F03A 4O7HA 2L57A 1LJRA 1SJ6A 2K6VA 2WS2A 1IYIA 2OADA 2LJRA 2B5EA 1PL1A 4DSQA 4IKHA 2VLTA 4XS1A 4K7IA 2GSQA 2PPTA 4H86A 1WJKA 4IN0A 2DJ0A 5J9BA 2H1AA 2R37A 2H73A 3PR8A 1M0UA 4MJCA 2AUVA 2OA7A 1JZDA 1FVKA 1F6MC 2VL2A 4Z7XA 1TRWA 4PUAA 4KCAA 5ABRA 2HT9A 1BAYA 11GSA 2GDRA 4PGTA 2GVPA 5DAKB 3BOAA 4V2LA 1A0FA 4ACSA 1F3AA 9GSSA 20GSA 3ZMKA 1JZWA 2H0GA 3FR3A 2F51A 1JFUA 3GKMA 1FAAA 2FWFA 3QAGA 3DXBA 1TOFA 1BJXA 3IR4A 2HNLA 2QKEA 3H4KA 1KTEA 4ZBDA 4ZBAA 1TRUA 2OBIA 3HKRA 5HR1A 3TOTA 1THOA 5B7CA 3TKSE 5F06A 2VO4A 3IK9A 1PA3A 2QSIA 4AJ6A 1GWCA 1B9XC 1WP0A 4RQRA 1XPVA 4Q5FA 5C04A 3FZAA 3WT1A 3LG6A 3VWXA 2DMLA 3L78A 5ECLB 5CYYA 5ECIB 1DUGA 1V2AA 3V1WA 1GUMA 3KD0A 1AQVA 1MDJA 4HOJA 2B1KA 1WRYA 4LMWA 1DE2A 3DEXA 2CT6A 2FLSA 1OKTA 5EL8A 2D2ZA 3MNGA 2YOIA 3TJFA 4AJ7A 1ST9A 2ZNMA 1XW5A 2C8UA 2J9HA 3LXTA 2IFQA 1U88A 2DIYA 2LTKA 1ACVA 2H76A 1AC1A 4BVXA 2ALBA 2M80A 4G10A 4GWRA 4MF5A 6GSSA 2B3SA 3WD6A 2FD3A 4J57E 3OR5A 1NHYA 5A5KA 1FB6A 2CZ2A 2PGTA 3BCKA 4MLYA 3GA4A 4GQFA 1MEKA 4KDYA 1WPIA 3KZQA 2HSHA 4WR5A 4FH8A 2L6DA 3VPQA 2KP2A 2NPBA 3QOUA 5A4WA 4LA1A 2X99A 1WIKA 3LJRA 2C1YA 1GUHA 2WZ9A 2QC7A 1SL1B 4YAPA 2CA8A 1EV9A 5G5FA 4NHZA 3HVSA 1GSUA 4BWSA 1TTZA 1M7TA 1GTAA 1K0NA 4OWYA 3IAM2 2K8SA 4KDXA 4MA9A 3CRUA 3EINA 2LV3A 3IC4A 2LNTA 1O73A 1T4YA 3FKFA 3IE3A 4D73A 2H0HA 4I6XA 4EF0A 1K0CA 1EZKA 3ME7A 2LQOA 1HYUA 1R5PA 2LKUA 5CNWA 4QQ7A 2HE3A 2RUEA 4IP1A 3HVVA 4ZL9A 2C3TA 4TXOB 2GZYA 1UA5A 4HUAA 1MDKA 3FZ9A 2OJLA 1QMVA 4HU7A 5A4UA 1U3IA 3KXOA 4GCIA 5DJLA 3GH6A 2V6KA 3QMXA 3WGDA 5AN1A 2DC5A 3UAPA 3EURA 2LS5A 1CQHA 3TRQA 2WULA 3TKPA 5LNKe 3EC3A 3ZFLA 1H4OA 1TKDB 1PL2A 3KP9A 3EU4A 3TJJA 1N2AA 1M9BA 2M46A 4L5LA 5FWGA 2HYXA 4F9ZA 1OC9A 5ECMB 1DE1A 1VGLA 4NMUA 5G2ZA 2OE1A 3CSJA 3DVXA 3MDKA 2C3NA 4J56E 4V2MA 2C0GA 4I2TA 2JL4A 1A8YA 1MDIA 4X1UA 3VPTA 3M9JA 2NTOA 3FYGA 1Z6MA 3QD9A 4ILFA 4NV2A 3FRCA 4KW6A 2VCXA 2AJQB 1V98A 3RDWA 1TRVA 4NAXA 2ZUPA 1ZMAA 3GMFA 7GSSA 5CRGA 3UVHA 5ECRB 2HLSA 4PNFA 2NVLA 3A2XA 1A2LA 1G7EA 4LMVA 1TK5B 5AIVA 4PNGA 4MJEA 3F3QA 3VI7A 3FR9A 3KCMA 2PUKC 6GSXA 1EOGA 1SK0A 1TW9A 2R5GA 1EGOA 4KCEA 2VLUA 2JU5A 4TXVA 4GF0A 3O6TA 1GLPA 3GKXA 4KH7A 1NM3A 4TR3A 1SKWB 2CVDA 2DJ3A 2O8VB 2PVOC 5B8AA 1PSQA 5HR2A 1HQOA 5C00A 5HQPA 3DKSA 1MTCA 2H6ZA 4POLA 2VD0A 4WR4A 5ECKB 2IJYA 3RAZA 1F9MA 3UBLA 3GX0A 5DCGA 5E4WA 1G0TA 3IXRA 4GSTA 4EUYA 3C1RA 1OC8A 1VF1A 3US3A 1CQGA 1F37A 3LORA 2AAWA 2AHEA 4BWQA 5D9TA 3UL3A 2DBCA 4EDZA 2YANA 4YH2A 1NW2A 3IDVA 1UN2A 4HDEA 4PX1A 2FCHA 1K3LA 4EO3A 2CQ9A 4QL7A 4EVMA 2IMIA 2H72A 1W4VA 1B4PA 3ERGA 4XS4A 1Y25A 3ME8A 4IELA 2MYGA 1M2DA 3LQ7A 4AF2A 2GS3A 4DSRA 2R2JA 3RHBA 4TR4A 1GTIA 3H1NA 3ZVJA 2OKAA 1PMTA 1XFLA 3GTUA 3KJYA 4K2DA 1H75A 3KMOA 3Q18A 2FA8A 4ZB9A 3WGXA 3QDNA 1K0OA 3NIVA 4F0BA 1GNEA 4RI7A 1ZL9A 2V1MA 4JU5A 2YWMA 1YKAA 1T4ZA 2O85A 2CAIA 4BL7A 3WGEA 2PMTA 3P2AA 1FB0A 1FW1A 4ECBA 3I69A 2DSAA 2GZPA 3NZNA 2XPEA 1U6TA 3LSZA 3U5RE 3KGKA 2OBKA 3VWVA 1TU8A 2IL3A 2LSTA 10GSA 3W8SA 4XIHA 5JCWA 3TRPA 2L4QA 2P0GA 3M8NA 5D9VA 5IMAA 3GV1A 3RPPA 3D22A 4YAVA 2WB9A 1BG5A 1F3BA 2EC4A 3UVTA 4JBBA 4E8HA 1GLQA 2XBQA 2R4VA 1QUWA 1UVZA 5JWQB 1QQ2A 1SKSB 2RUFA 2YZHA 3BCIA 4L0WA 3EU3A 5DBQA 4OD7A 1A2MA 1WOUA 4NXIA 2H8LA 1YQ1A
chains in the Genus database with same CATH superfamily
1AIUA 1O85A 4NV5A 1K3YA 1JLWA 1XWKA 4G0LA 3FEUA 5ECHB 4X0XA 2WGRA 1E6BA 4CHSA 2X8HA 3FHKA 4KB3A 2RLIA 1XWAA 4ZB8A 2N5BA 3HY2A 4ZXGA 3M3MA 3IA1A 2GQMA 4AGSA 4TN8A 2HXKA 1R7HA 1XOBA 1TI3A 2H70A 4MCUA 1GSQA 4MNNA 4YQUA 1T7PB 5F8BA 4GQCA 1XCCA 1XBSA 3GFKA 3HHVA 1XOAA 2CV4A 2VL3A 5ID2B 4EE0A 2JZRA 1GH2A 1ILOA 2IMEA 3HJMA 1V57A 4TR1A 2A2RA 5INYA 4E8EA 1JZOA 2MMZA 2YZUA 2EIQA 5DALA 3ZIJA 1VF4A 4D73B 4K5RA 2C0DA 2KUCA 1QFNA 4BPYA 2GT6A 4OFMA 2VL9A 4TOPA 3LEFA 2YPMA 2LRCA 4ML1A 4HJ2A 4PQHA 4KF9A 3HVXA 2VCWA 3DD3A 2M72A 4HU9A 4K2XA 3P8WA 4EKZA 1U3AA 4HI7A 3ZFBA 5KN1A 4K6XA 2F8AA 4EIQA 5IPGA 5IIZA 5A4VA 1K0BA 1LU4A 4EXJA 1ZCPA 3LW9A 3PPUA 2YNXA 5KN2A 4GRFA 4KGIA 3D4MA 3LXZA 4HQZA 3A5WA 5IO0A 3UMAA 1SU9A 1OVNA 2V32A 4WEYA 4F2IA 1EV4A 5L71A 2LRTA 3GX8A 1Z6NA 2PVQA 2R6KA 3LGCA 4MJBA 1PN9A 2XPDA 3CBUA 1SJZA 3HVNA 2OACA 5DCHA 4KSMA 2H75A 4N0ZA 1RW1A 2BJXA 2R3XA 3F4TA 4MZBA 5KOWA 2L6CA 1BQ7A 5IOWA 4OCFA 1X9SB 4NHWA 4MP4A 3LWAA 1X9WB 5D9XA 2RM6A 1G6WA 5J5NA 2ON5A 3KH9A 2QGVA 2XBIA 1Z7PA 2CX3A 3HJPA 6GSYA 1BEDA 5IMFA 4MK3A 1T8EB 5ELAA 1ERUA 3A3TA 2HFDA 2Z9SA 18GSA 5KOXA 3C71A 3GL5A 5GAPD 3D6IA 3L4NA 3NOFA 2IPAA 4Q5NA 4P3YB 4USSA 3J7Yk 3F4RA 2IIYA 1BX9A 1JZRA 2BTOT 4N11A 4ISDA 3EYTA 1PGTA 5DAKA 5JCGA 4O5UA 2FY6A 5FT3A 1PKZA 2V41A 4G19A 2F9SA 1T3BA 4KAEA 3K8NA 3KTBA 5D8IA 2IWTA 2YWOA 3FZ4A 4FIWA 4POBA 1PX7A 3IV4A 1GSEA 4KDUA 5IPHA 4IQAA 2O87A 1A2JA 1WMJA 1J9BA 4O5QA 1WWJA 1ZYPA 1R5AA 4XS6A 2CVBA 2LJKA 4K8MA 2HZEB 1XW9A 3DYRA 1X9MB 2HZFA 1YEPA 16GSA 1J08A 4POMA 3IHQA 4MZCA 3QPMA 2J23A 3ZZXA 3RPNA 4HJMA 2DMMA 4CW9A 3KH7A 4DSSB 1AAZA 1PKWA 1IYHA 4MPGA 5FHIA 3PH9A 2VAFA 3TJKA 4V1Ap 5IMZA 5CAXA 1URMA 1O8WA 1ERWA 1FG4A 4OO5A 2H1DA 1GUKA 3F0IA 4JE1A 3SBCA 3ZITA 2RM5A 3IAS2 4IJ3A 3CSHA 2EIOA 2N5AA 2TIRA 4HEA2 2H1GA 2JZTA 2EIRA 5LCZA 4HS1A 4FYCA 1FO5A 3GUSA 1YF0A 1WE0A 2TRCP 5GAND 3CMIA 1A0RP 3ZREA 5D93A 5KEJA 5F0GA 3HJOA 5IO2A 4GTUA 1AQXA 1F2EA 4PXOA 4CY6A 2MMNA 1R26A 3EMPA 2VD1A 3GL3A 1A23A 1QGVA 1HNBA 3F4SA 2VCTA 4GLTA 3VWWA 1XWBA 5HFIA 4PQIA 5LD0A 3MAKA 5E59A 2FWEA 2GTUA 1TJDA 2X64A 5ECSA 5GZZB 1K3OA 17GSA 4IW9A 3APSA 1Z3EA 4HQSA 4IS0A 2B5XA 2H66A 2HSYA 4QL9A 5IQYA 2G2QA 4TVEA 2IMKA 3L9SA 1T00A 3TKRA 1SL2B 4FQUA 2H6XA 3GYKA 1ZYEA 3ERFA 5CO3A 3Q74A 4K7NA 2VCQA 4ULXA 5IOXA 2C0FA 4TXOA 3F6DA 14GSA 2DJKA 4G0KA 2B5YA 4JR4A 3EMXA 3GSTA 1YKCA 3GIXA 2FA4A 1SYRA 5EPFA 1PQNA 2CAQA 4TR0A 4I97A 5JCUA 2NDOA 4BVYA 1LBKA 4MJAA 2E7PA 5CRWA 4ML6A 3VFIA 2OE3A 4WBJA 1O81A 1TP9A 3UOMA 3HZ8A 1EP8A 2LNSA 4MH2A 1XWCA 1Y6EA 2PWJA 1K0DA 5G31A 6GSTA 2OE0A 4G2EA 1A24A 5J4UA 3PGTA 3VWUA 4XRAA 5B6NA 1FHEA 3HCZA 2WFCA 5J41A 2ON7A 1EGRA 3ZIVA 4FYUA 2E2MA 3QAVA 4OCEA 3G9BA 2HSMA 13GSA 2V6OA 1XZOA 8GSSA 5G5EA 2X8CA 2VLVA 3I43A 3LYPA 3HZ4A 3M0FA 5G30A 4XHMA 1Z5YE 6GSWA 4IQ1A 1SENA 2XHFA 1UC7A 1AUCA 4KNDA 3GURA 5GSTA 5DALB 2LQQA 1VF3A 4POKA 1ZYQB 1ERTA 5HFGA 1THXA 1M2BA 5GSSA 3UEMA 3O76A 4PUFC 4ECJA 4F82A 3MWHA 3C1SA 2VCZA 4TKYA 2L59A 1AXDA 2B6MA 1DBYA 1XW6A 3ZLPA 2NBSA 4AJ8A 2IMFA 1SYXA 4L8EA 2A2SA 2YP6A 1FOVA 4TW5A 3L9UA 2VM2A 3L0HA 3A2VA 3MYDA 1SK2A 4ZL7A 5HR0A 3WYWA 4MDCA 5CRDA 2AYTA 3O3TA 1ON4A 1GULA 1QK8A 4I8BA 3IHGA 3UBKA 1Q98A 1SL0B 2PERA 3D0ZA 2HRNA 4K1FA 4XRDA 3TCOA 3DGQA 3G7JA 3CTFA 1SD8A 3F8UA 3H8QA 3A2WA 4WXTA 2CZ3A 3VI5A 3VK9A 2IFQB 4OFNA 4CDOA 3CYNA 3TRXA 1TK8B 4CY8A 2LRNA 3CTGA 4JR6A 2FWGA 4J2FA 3TKQA 4N30A 4ZL8A 2GSTA 1NHOA 3IOSA 1XWGA 4XTSA 1U87A 1S3CA 4WKWA 1KEBA 1GSFA 1G6YA 2KP1A 5H5SA 1MD4A 5F07A 3F9UA 5AGYA 1S3DA 3I9V2 3DWVA 1GP1A 2DJJA 3M9KA 1GSSA 5ECOB 12GSA 2H0IA 4L5OA 3DMLA 2N5FA 3HDCA 5IMCA 2MZCA 3BD2A 2WRTA 3E0UA 2I1UA 5CP1A 3TB2A 1TK0B 4I5QA 2R0GA 3H93A 3RBTA 2GSSA 1GNWA 4X43A 2WDUA 1GSYA 2H1BA 5COHA 1ZGNA 2YV7A 1QXHA 2L5OA 1N8JA 5D96A 1J0FA 3EVIA 3ZMLA 2MBTA 5CRHA 2O89A 5DVBA 3J7Yb 4KSOA 5J3RA 2LUSA 3JCML 2LEGA 3G7YA 5IMVA 3EPTA 3KP8A 4HZ2A 3IK7A 1HNCA 1PN0A 3W8JA 4OFTA 4DVCA 2I9HA 5ECNB 2ES7A 2P5QA 3GKNA 2FWHA 4ICYA 1OE8A 5KN0A 2VM1A 1HNAA 1PFOA 1OKDA 1K0MA 2FHEA 1VRSD 1EEJA 1XXUA 1OE7A 3LYKA 3F6FA 2FNOA 1Z9HA 3KIJA 1HD2A 5ENUA 3ZYWA 2A4HA 1C72A 2YN1A 4NPBA 2L5LA 4ZB6A 3TJGA 2KLXA 2K18A 4BA7A 5H5QA 3U6VA 2HRFA 5DQSA 2IMDA 4WF4A 4YKFA 19GSA 2REMA 1XG8A 1S3AA 2P31A 2C3QA 1OC9B 4IP6A 1TDIA 1X5EA 1V9WA 4RQXA 3ERWA 4GSNA 3D5JA 2YJ7A 1EWXA 2BMXA 2VUPA 4EDYA 3Q6OA 3ISOA 2K9FA 4OO4A 1XVQA 3TUEA 6GSVA 4GSSA 3C73A 1O8XA 1SK1A 2MMAA 4KA0A 3L9VA 5G1KA 1TRSA 5B6MA 1V40A 4EL1A 2HRKA 2MBSA 1RQMA 3VURA 2ZCTA 3GN3A 3MSZA 1K0AA 4KE3A 4LLRA 2H6YA 4NWYA 5ECQB 2I4AA 1JLVA 4ID0A 3ZVJD 5EVOA 4FO5A 2V2GA 2UZ8A 2B7KA 1Q4JA 3TJBA 1M99A 4IHUA 2K8VA 1YDKA 4MF7A 3EWLA 2DJ1A 3CXGA 3TOUA 2FUG2 2H01A 5ID2A 2B1LA 1X5DA 2PU9C 5IM9A 4Z2TA 2JADA 3DVWA 4MMMA 4MPFA 4L0UA 3HD5A 3DIEA 2YJHA 1KNGA 4O92A 1M3JA 3APQA 3F3RA 5DJMA 4TRXA 1X5CA 5J9CA 1A8LA 3GKKA 1JHBA 1E2YA 4FYBA 2F3MA 3E3EA 3QFBC 4LL4B 2G0FA 5BMUA 2JSYA 4ECIA 1PX6A 3BBYA 3UJ1A 1B4QA 3CRTA 1PD21 5AIXA 5B8BA 2X8GA 2PBJA 4Z2RA 2PN8A 3CSIA 3C7MA 1GTUA 1O7UA 2YWIA 4K7OA 3S9FA 1AQWA 3I6AA 5D9WA 1GTBA 2GQLA 4ZILA 2I81A 3UIWA 4G9HA 3ZL5A 2C0EA 1EOHA 4XS4B 4JZQA 2R0PA 1I5GA 1YY7A 3QCPA 4A5PA 2H19A 2VIMA 2YCDA 22GSA 3GTUB 1PRXA 3FY7A 4I2UA 1M9AA 3FR6A 5ECPB 4IBPA 1GSDA 1ML6A 4N0VA 1EP7A 2GSRA 1KBNA 4K9ZA 1B8XA 3IBHA 1EEMA 1R4WA 3GH9A 2HI7A 4V1Ag 1SD9A 4ECCA 4KX4A 2YV9A 3TGZA 3LFLA 4BL7B 3BJ5A 4KUNA 4Z2UA 3ED3A 4RI6A 4O5RA 2VOCA 3GRXA 2KOKA 2GZZA 2GT5A 3KM6A 2XC2A 3D21A 4O32A 3APOA 3ZRDA 1TU7A 1Z7RA 2E2GA 3HA9A 2E0QA 4OMVA 2R0CA 1ABAA 1NSWA 2O7KA 2GGTA 2MMOA 5DQYA 1YZXA 1XVWA 1YF1A 3GNJA 3HYPA 3W6GA 1USBA 3VLNA 1MD3A 3UARA 4PQ1A 5G1LA 4Q5QA 1I9DA 5IMDA 5HFKA 3D4TA 3DRNA 3R2QA 3KMNA 3KTLA 4YQMA 3Q19A 5JWRB 2DJ2A 3FK8A 4XCSA 3HXSA 4MF6A 3GHAA 1TXXA 2DLXA 2JACA 4MABA 2H74A 3RHCA 4PURA 3SWLA 6GSUA 2H30A 2HRAA 4G0IA 3FW2A 1X0RA 4WF5A 1SJIA 2GLRA 5KN3A 5H5RA 4HZ4A 4ZIJA 2KHPA 1DSBA 1ERVA 1OYJA 2A4VA 3P90A 3H79A 2L4CA 3EE2A 4WETA 3PINA 1TI1A 3TKSC 1BYEA 2H71A 2HZEA 2IN3A 5HR3A 2YWNA 2FGXA 2WJUA 4WBRD 2C4JA 4DEJA 4F0CA 1AW9A 3AY8A 5F05A 4DSSA 4HSCX 1T1VA 1OAZA 5EY6A 2WCIA 1VF2A 3N5OA 3QR6A 1FVJA 3MIXA 4TR1B 2AV4A 2AB6A 3F63A 1W89A 4Q5RA 1O6JA 4IGJA 2F8FA 3QFAC 1GRXA 4K0NA 2LJAA 4RUVA 5CREA 2CVKA 1B9YC 3C8EA 1YJ6A 4MZWA 3KEBA 3TKSA 3ZTLA 1YEXA 3E9JB 1ZOFA 2I3YA 2RIIA 4K0GA 5AISA 4IVFA 1OC3A 4V2NA 4YQVA 2JZSA 4LL1B 1GL8A 2JSZA 1M2AA 2B7JA 4ZBBA 3G7IA 1S3RA 4MH3A 4K5SA 4N10A 1V58A 2TRXA 3R3EA 4IJIA 1XIYA 4JEDA 3WT2A 5D73A 3N9JA 2GQKA 5JWOB 3IPZA 3IRAA 2VL2C 2CX4A 3M1GA 5ELGA 2X4AA 2C80A 3QAWA 4JRRA 1SKRB 3TDGA 4EC0A 5DDLA 2VCVA 1RK4A 3GSSA 3P7XA 4GXZA 1G7OA 3FZ5A 2DIZA 1B48A 1ZZYA 2P5RA 4F03A 4O7HA 2L57A 1LJRA 1SJ6A 2K6VA 2WS2A 1IYIA 2OADA 2LJRA 2B5EA 1PL1A 4DSQA 4IKHA 2VLTA 4XS1A 4K7IA 2GSQA 2PPTA 4H86A 1WJKA 4IN0A 2DJ0A 5J9BA 2H1AA 4BIKA 2R37A 2H73A 3PR8A 1M0UA 4MJCA 2AUVA 2OA7A 1JZDA 1FVKA 1F6MC 2VL2A 4Z7XA 1TRWA 4PUAA 4KCAA 5ABRA 2HT9A 1BAYA 11GSA 2GDRA 4PGTA 2GVPA 5DAKB 3BOAA 4V2LA 1A0FA 4ACSA 1F3AA 9GSSA 20GSA 3ZMKA 1JZWA 2H0GA 3FR3A 2F51A 1JFUA 3GKMA 1FAAA 2FWFA 3QAGA 3DXBA 1TOFA 1BJXA 2QA1A 3IR4A 2HNLA 2QKEA 3H4KA 1KTEA 4ZBDA 4ZBAA 1TRUA 2OBIA 3HKRA 5HR1A 3TOTA 2DKIA 1THOA 5B7CA 3TKSE 5F06A 2VO4A 3IK9A 1PA3A 2QSIA 4AJ6A 1GWCA 1B9XC 1WP0A 4RQRA 1XPVA 4Q5FA 5C04A 3FZAA 3WT1A 3LG6A 3VWXA 2DMLA 3L78A 5ECLB 5CYYA 5ECIB 1DUGA 1V2AA 3V1WA 1GUMA 3KD0A 1AQVA 1MDJA 4HOJA 2B1KA 1WRYA 4LMWA 1DE2A 3DEXA 2CT6A 2FLSA 1OKTA 5EL8A 2D2ZA 3MNGA 2YOIA 3TJFA 4AJ7A 1ST9A 2ZNMA 1XW5A 2C8UA 2DKHA 2J9HA 3LXTA 2IFQA 1U88A 2DIYA 2LTKA 1ACVA 2H76A 1AC1A 4BVXA 2ALBA 2M80A 4G10A 4GWRA 4MF5A 6GSSA 2B3SA 1M3IA 3WD6A 2FD3A 4J57E 3OR5A 1NHYA 5A5KA 1FB6A 2CZ2A 2PGTA 3BCKA 4MLYA 3GA4A 4GQFA 1MEKA 4KDYA 1WPIA 3KZQA 2HSHA 4WR5A 4FH8A 2L6DA 3VPQA 2KP2A 2NPBA 3QOUA 5A4WA 4LA1A 2X99A 1WIKA 3LJRA 2C1YA 1GUHA 2WZ9A 2QC7A 1SL1B 4YAPA 2CA8A 1EV9A 5G5FA 4NHZA 3HVSA 1GSUA 4BWSA 4YKGA 1TTZA 1M7TA 1GTAA 1K0NA 4OWYA 3IAM2 2K8SA 4KDXA 4MA9A 3CRUA 3EINA 2LV3A 3IC4A 2LNTA 1O73A 1T4YA 3FKFA 4EIPA 3IE3A 4D73A 2H0HA 4I6XA 4EF0A 1K0CA 1EZKA 3ME7A 2LQOA 1HYUA 1R5PA 2LKUA 5CNWA 4QQ7A 2HE3A 2RUEA 4IP1A 1ZYNA 3HVVA 4ZL9A 2C3TA 4TXOB 2GZYA 1UA5A 4HUAA 1MDKA 3FZ9A 2OJLA 1QMVA 4HU7A 5A4UA 1U3IA 3KXOA 3CQFA 4GCIA 5DJLA 3GH6A 2V6KA 3QMXA 4BVYB 3WGDA 5AN1A 2DC5A 3UAPA 3EURA 2LS5A 1CQHA 3TRQA 2WULA 3TKPA 5LNKe 3EC3A 3ZFLA 1H4OA 3A5IA 1TKDB 1PL2A 3KP9A 3EU4A 3TJJA 1N2AA 1M9BA 2M46A 4L5LA 5FWGA 2HYXA 4F9ZA 1OC9A 5ECMB 1DE1A 1VGLA 4NMUA 5G2ZA 2OE1A 3CSJA 3DVXA 3MDKA 2C3NA 4J56E 4V2MA 2C0GA 4I2TA 2JL4A 1A8YA 1MDIA 4X1UA 3VPTA 3M9JA 3IC8A 2NTOA 3FYGA 1Z6MA 3QD9A 4ILFA 4NV2A 3FRCA 4KW6A 2VCXA 2AJQB 1V98A 3RDWA 1TRVA 4NAXA 2ZUPA 1ZMAA 3GMFA 7GSSA 5CRGA 3UVHA 5ECRB 2HLSA 4PNFA 2NVLA 3A2XA 1A2LA 1G7EA 4LMVA 1TK5B 5AIVA 4PNGA 4MJEA 3F3QA 3VI7A 3FR9A 3KCMA 2PUKC 6GSXA 1EOGA 1SK0A 1TW9A 2R5GA 1EGOA 4KCEA 2VLUA 2JU5A 4TXVA 4GF0A 3O6TA 1GLPA 3GKXA 4KH7A 1NM3A 2A2PA 4TR3A 1SKWB 2CVDA 2DJ3A 2O8VB 2PVOC 5B8AA 1PSQA 5HR2A 1HQOA 5C00A 5HQPA 3DKSA 1MTCA 2H6ZA 4POLA 2VD0A 4WR4A 5ECKB 2IJYA 3RAZA 1F9MA 3UBLA 3GX0A 5DCGA 5E4WA 1G0TA 3IXRA 4GSTA 4EUYA 3C1RA 1OC8A 1VF1A 3US3A 1CQGA 1F37A 3LORA 2AAWA 2AHEA 4BWQA 5D9TA 3UL3A 2DBCA 4EDZA 2YANA 4YH2A 1NW2A 3IDVA 1UN2A 2X49A 4HDEA 4PX1A 2FCHA 1K3LA 4EO3A 2CQ9A 4QL7A 4EVMA 2IMIA 2H72A 1W4VA 1B4PA 3ERGA 4XS4A 1Y25A 3ME8A 4IELA 2MYGA 1M2DA 4X4JA 3LQ7A 4AF2A 2GS3A 4DSRA 2R2JA 3RHBA 4TR4A 1GTIA 3H1NA 3ZVJA 5BRTA 2OKAA 1PMTA 1XFLA 3GTUA 3KJYA 4K2DA 1H75A 3FMWA 3KMOA 3Q18A 2QA2A 2FA8A 4ZB9A 3WGXA 3QDNA 1K0OA 3NIVA 4F0BA 1GNEA 4RI7A 1ZL9A 2V1MA 4JU5A 2YWMA 1YKAA 1T4ZA 2O85A 2CAIA 4BL7A 3WGEA 2PMTA 3P2AA 1FB0A 1FW1A 4ECBA 3I69A 2DSAA 2GZPA 3NZNA 2XPEA 1U6TA 3LSZA 3U5RE 3KGKA 2OBKA 3VWVA 1TU8A 2IL3A 2LSTA 10GSA 3W8SA 4XIHA 5JCWA 3TRPA 2L4QA 2P0GA 3M8NA 5D9VA 5IMAA 3GV1A 3RPPA 3D22A 4YAVA 2WB9A 1BG5A 1F3BA 2EC4A 3UVTA 4JBBA 4E8HA 1GLQA 2XBQA 2R4VA 1QUWA 1UVZA 5JWQB 1QQ2A 4PTSA 1SKSB 2RUFA 2YZHA 3BCIA 4L0WA 3EU3A 5DBQA 4OD7A 4BVXB 1FOHA 1A2MA 1WOUA 4NXIA 2H8LA 1YQ1A
chains in the Genus database with same CATH topology
1AIUA 1O85A 4NV5A 1K3YA 1JLWA 1XWKA 4G0LA 3FEUA 5ECHB 4X0XA 2WGRA 1E6BA 4CHSA 2X8HA 3FHKA 4KB3A 2RLIA 1XWAA 4ZB8A 2N5BA 3HY2A 4ZXGA 3M3MA 3IA1A 2GQMA 4AGSA 4TN8A 2HXKA 1R7HA 1XOBA 1TI3A 2H70A 4MCUA 1GSQA 4MNNA 4YQUA 1T7PB 5F8BA 4GQCA 1XCCA 1XBSA 3GFKA 3HHVA 1XOAA 2CV4A 2VL3A 5ID2B 4EE0A 2JZRA 1GH2A 1ILOA 2IMEA 3HJMA 1V57A 4TR1A 2A2RA 5INYA 4E8EA 1JZOA 2MMZA 2YZUA 2EIQA 5DALA 3ZIJA 1VF4A 4D73B 4K5RA 2C0DA 2KUCA 1QFNA 4BPYA 2GT6A 4OFMA 2VL9A 4TOPA 3LEFA 2YPMA 2LRCA 4ML1A 4HJ2A 4PQHA 4KF9A 3HVXA 2VCWA 3DD3A 2M72A 4HU9A 4K2XA 3P8WA 4EKZA 1U3AA 4HI7A 3ZFBA 5KN1A 4K6XA 2F8AA 4EIQA 5IPGA 5IIZA 5A4VA 1K0BA 1LU4A 4EXJA 1ZCPA 3LW9A 3PPUA 2YNXA 5KN2A 4GRFA 4KGIA 3D4MA 3LXZA 4HQZA 3A5WA 5IO0A 3UMAA 1SU9A 1OVNA 2V32A 4WEYA 4F2IA 1EV4A 5L71A 2LRTA 3GX8A 1Z6NA 2PVQA 2R6KA 3LGCA 4MJBA 1PN9A 2XPDA 3CBUA 1SJZA 2OACA 5DCHA 4KSMA 2H75A 4N0ZA 1RW1A 2BJXA 2R3XA 3F4TA 4MZBA 5KOWA 2L6CA 1BQ7A 5IOWA 4OCFA 1X9SB 4NHWA 4MP4A 3LWAA 1X9WB 5D9XA 2RM6A 1G6WA 5J5NA 2ON5A 3KH9A 2QGVA 2XBIA 1Z7PA 2CX3A 3HJPA 6GSYA 1BEDA 5IMFA 4MK3A 1T8EB 5ELAA 1ERUA 3A3TA 2HFDA 2Z9SA 18GSA 5KOXA 3C71A 3GL5A 5GAPD 3D6IA 3L4NA 3NOFA 2IPAA 4Q5NA 4P3YB 4USSA 3J7Yk 3F4RA 2IIYA 1BX9A 1JZRA 2BTOT 4N11A 4ISDA 3EYTA 1PGTA 5DAKA 5JCGA 4O5UA 2FY6A 5FT3A 1PKZA 2V41A 4G19A 2F9SA 1T3BA 4KAEA 3K8NA 3KTBA 5D8IA 2IWTA 2YWOA 3FZ4A 4FIWA 4POBA 1PX7A 3IV4A 1GSEA 4KDUA 5IPHA 4IQAA 2O87A 1A2JA 1WMJA 1J9BA 4O5QA 1WWJA 1ZYPA 1R5AA 4XS6A 2CVBA 2LJKA 4K8MA 2HZEB 1XW9A 3DYRA 1X9MB 2HZFA 1YEPA 16GSA 1J08A 4POMA 3IHQA 4MZCA 3QPMA 2J23A 3ZZXA 3RPNA 4HJMA 2DMMA 4CW9A 3KH7A 4DSSB 1AAZA 1PKWA 1IYHA 4MPGA 5FHIA 3PH9A 2VAFA 3TJKA 4V1Ap 5IMZA 5CAXA 1URMA 1O8WA 1ERWA 1FG4A 4OO5A 2H1DA 1GUKA 3F0IA 4JE1A 3SBCA 3ZITA 2RM5A 3IAS2 4IJ3A 3CSHA 2EIOA 2N5AA 2TIRA 4HEA2 2H1GA 2JZTA 2EIRA 5LCZA 4HS1A 4FYCA 1FO5A 3GUSA 1YF0A 1WE0A 2TRCP 5GAND 3CMIA 1A0RP 3ZREA 5D93A 5KEJA 5F0GA 3HJOA 5IO2A 4GTUA 1AQXA 1F2EA 4PXOA 4CY6A 2MMNA 1R26A 3EMPA 2VD1A 3GL3A 1A23A 1QGVA 1HNBA 3F4SA 2VCTA 4GLTA 3VWWA 1XWBA 5HFIA 4PQIA 5LD0A 3MAKA 5E59A 2FWEA 2GTUA 1TJDA 2X64A 5ECSA 5GZZB 1K3OA 17GSA 4IW9A 3APSA 1Z3EA 4HQSA 4IS0A 2B5XA 2H66A 2HSYA 4QL9A 5IQYA 2G2QA 4TVEA 2IMKA 3L9SA 1T00A 3TKRA 1SL2B 4FQUA 2H6XA 3GYKA 1ZYEA 3ERFA 5CO3A 3Q74A 4K7NA 2VCQA 4ULXA 5IOXA 2C0FA 4TXOA 3F6DA 14GSA 2DJKA 4G0KA 2B5YA 4JR4A 3EMXA 3GSTA 1YKCA 3GIXA 2FA4A 1SYRA 5EPFA 1PQNA 2CAQA 4TR0A 4I97A 5JCUA 2NDOA 4BVYA 1LBKA 4MJAA 2E7PA 5CRWA 4ML6A 3VFIA 2OE3A 4WBJA 1O81A 1TP9A 3UOMA 3HZ8A 1EP8A 2LNSA 4MH2A 1XWCA 1Y6EA 2PWJA 1K0DA 5G31A 6GSTA 2OE0A 4G2EA 1A24A 5J4UA 3PGTA 3VWUA 4XRAA 5B6NA 1FHEA 3HCZA 2WFCA 5J41A 2ON7A 1EGRA 3ZIVA 4FYUA 2E2MA 3QAVA 4OCEA 3G9BA 2HSMA 13GSA 2V6OA 1XZOA 8GSSA 5G5EA 2X8CA 2VLVA 3I43A 3LYPA 3HZ4A 3M0FA 5G30A 4XHMA 1Z5YE 6GSWA 4IQ1A 1SENA 2XHFA 1UC7A 1AUCA 4KNDA 3GURA 5GSTA 5DALB 2LQQA 1VF3A 4POKA 1ZYQB 1ERTA 5HFGA 1THXA 1M2BA 5GSSA 3UEMA 3O76A 4PUFC 4ECJA 4F82A 3MWHA 3C1SA 2VCZA 4TKYA 2L59A 1AXDA 2B6MA 1DBYA 1XW6A 3ZLPA 2NBSA 4AJ8A 2IMFA 1SYXA 4L8EA 2A2SA 2YP6A 1FOVA 4TW5A 3L9UA 2VM2A 3L0HA 3A2VA 3MYDA 1SK2A 4ZL7A 5HR0A 3WYWA 4MDCA 5CRDA 2AYTA 3O3TA 1ON4A 1GULA 1QK8A 4I8BA 3IHGA 3UBKA 1Q98A 1SL0B 2PERA 3D0ZA 2HRNA 4K1FA 4XRDA 3TCOA 3DGQA 3G7JA 3CTFA 1SD8A 3F8UA 3H8QA 3A2WA 4WXTA 2CZ3A 3VI5A 3VK9A 2IFQB 4OFNA 4CDOA 3CYNA 3TRXA 1TK8B 4CY8A 2LRNA 3CTGA 4JR6A 2FWGA 4J2FA 3TKQA 4N30A 4ZL8A 2GSTA 1NHOA 3IOSA 1XWGA 4XTSA 1U87A 1S3CA 4WKWA 1KEBA 1GSFA 1G6YA 2KP1A 5H5SA 1MD4A 5F07A 3F9UA 5AGYA 1S3DA 3I9V2 3DWVA 1GP1A 2DJJA 3M9KA 1GSSA 5ECOB 12GSA 2H0IA 4L5OA 3DMLA 2N5FA 3HDCA 5IMCA 2MZCA 3BD2A 2WRTA 3E0UA 2I1UA 5CP1A 3TB2A 1TK0B 4I5QA 2R0GA 3H93A 3RBTA 2GSSA 1GNWA 4X43A 2WDUA 1GSYA 2H1BA 5COHA 1ZGNA 2YV7A 1QXHA 2L5OA 1N8JA 5D96A 1J0FA 3EVIA 3ZMLA 2MBTA 5CRHA 2O89A 5DVBA 3J7Yb 4KSOA 5J3RA 2LUSA 3JCML 2LEGA 3G7YA 5IMVA 3EPTA 3KP8A 4HZ2A 3IK7A 1HNCA 1PN0A 3W8JA 4OFTA 4DVCA 2I9HA 5ECNB 2ES7A 2P5QA 3GKNA 2FWHA 4ICYA 1OE8A 5KN0A 2VM1A 1HNAA 1OKDA 1K0MA 2FHEA 1VRSD 1EEJA 1XXUA 1OE7A 3LYKA 3F6FA 2FNOA 1Z9HA 3KIJA 1HD2A 5ENUA 3ZYWA 2A4HA 1C72A 2YN1A 4NPBA 2L5LA 4ZB6A 3TJGA 2KLXA 2K18A 4BA7A 5H5QA 3U6VA 2HRFA 5DQSA 2IMDA 4WF4A 4YKFA 19GSA 2REMA 1S3AA 2P31A 2C3QA 1OC9B 4IP6A 1TDIA 1X5EA 1V9WA 4RQXA 3ERWA 4GSNA 3D5JA 2YJ7A 1EWXA 2BMXA 2VUPA 4EDYA 3Q6OA 3ISOA 2K9FA 4OO4A 1XVQA 3TUEA 6GSVA 4GSSA 3C73A 1O8XA 1SK1A 2MMAA 4KA0A 3L9VA 5G1KA 1TRSA 5B6MA 1V40A 4EL1A 2HRKA 2MBSA 1RQMA 3VURA 2ZCTA 3GN3A 3MSZA 1K0AA 4KE3A 4LLRA 2H6YA 4NWYA 5ECQB 2I4AA 1JLVA 4ID0A 3ZVJD 5EVOA 4FO5A 2V2GA 2UZ8A 2B7KA 1Q4JA 3TJBA 1M99A 4IHUA 2K8VA 1YDKA 4MF7A 3EWLA 2DJ1A 3CXGA 3TOUA 2FUG2 2H01A 5ID2A 2B1LA 1X5DA 2PU9C 5IM9A 4Z2TA 2JADA 3DVWA 4MMMA 4MPFA 4L0UA 3HD5A 3DIEA 2YJHA 1KNGA 4O92A 3APQA 3F3RA 5DJMA 4TRXA 1X5CA 5J9CA 1A8LA 3GKKA 1JHBA 1E2YA 4FYBA 2F3MA 3E3EA 3QFBC 4LL4B 2G0FA 5BMUA 2JSYA 4ECIA 1PX6A 3BBYA 3UJ1A 1B4QA 3CRTA 1PD21 5AIXA 5B8BA 2X8GA 2PBJA 4Z2RA 2PN8A 3CSIA 3C7MA 1GTUA 1O7UA 2YWIA 4K7OA 3S9FA 1AQWA 3I6AA 5D9WA 1GTBA 2GQLA 4ZILA 2I81A 3UIWA 4G9HA 3ZL5A 2C0EA 1EOHA 4XS4B 4JZQA 2R0PA 1I5GA 1YY7A 3QCPA 4A5PA 2H19A 2VIMA 2YCDA 22GSA 3GTUB 1PRXA 3FY7A 4I2UA 1M9AA 3FR6A 5ECPB 4IBPA 1GSDA 1ML6A 4N0VA 1EP7A 2GSRA 1KBNA 4K9ZA 1B8XA 3IBHA 1EEMA 1R4WA 3GH9A 2HI7A 4V1Ag 1SD9A 4ECCA 4KX4A 2YV9A 3TGZA 3LFLA 4BL7B 3BJ5A 4KUNA 4Z2UA 3ED3A 4RI6A 4O5RA 2VOCA 3GRXA 2KOKA 2GZZA 2GT5A 3KM6A 2XC2A 3D21A 4O32A 3APOA 3ZRDA 1TU7A 1Z7RA 2E2GA 3HA9A 2E0QA 4OMVA 2R0CA 1ABAA 1NSWA 2O7KA 2GGTA 2MMOA 5DQYA 1YZXA 1XVWA 1YF1A 3GNJA 3HYPA 3W6GA 1USBA 3VLNA 1MD3A 3UARA 4PQ1A 5G1LA 4Q5QA 1I9DA 5IMDA 5HFKA 3D4TA 3DRNA 3R2QA 3KMNA 3KTLA 4YQMA 3Q19A 5JWRB 2DJ2A 3FK8A 4XCSA 3HXSA 4MF6A 3GHAA 1TXXA 2DLXA 2JACA 4MABA 2H74A 3RHCA 4PURA 3SWLA 6GSUA 2H30A 2HRAA 4G0IA 3FW2A 1X0RA 4WF5A 1SJIA 2GLRA 5KN3A 5H5RA 4HZ4A 4ZIJA 2KHPA 1DSBA 1ERVA 1OYJA 2A4VA 3P90A 3H79A 2L4CA 3EE2A 4WETA 3PINA 1TI1A 3TKSC 1BYEA 2H71A 2HZEA 2IN3A 5HR3A 2YWNA 2FGXA 2WJUA 4WBRD 2C4JA 4DEJA 4F0CA 1AW9A 3AY8A 5F05A 4DSSA 1T1VA 1OAZA 5EY6A 2WCIA 1VF2A 3N5OA 3QR6A 1FVJA 3MIXA 4TR1B 2AV4A 2AB6A 3F63A 1W89A 4Q5RA 1O6JA 4IGJA 2F8FA 3QFAC 1GRXA 4K0NA 2LJAA 4RUVA 5CREA 2CVKA 1B9YC 3C8EA 1YJ6A 4MZWA 3KEBA 3TKSA 3ZTLA 1YEXA 3E9JB 1ZOFA 2I3YA 2RIIA 4K0GA 5AISA 4IVFA 1OC3A 4V2NA 4YQVA 2JZSA 4LL1B 1GL8A 2JSZA 1M2AA 2B7JA 4ZBBA 3G7IA 4MH3A 4K5SA 4N10A 1V58A 2TRXA 3R3EA 4IJIA 1XIYA 4JEDA 3WT2A 5D73A 3N9JA 2GQKA 5JWOB 3IPZA 3IRAA 2VL2C 2CX4A 3M1GA 5ELGA 2X4AA 2C80A 3QAWA 4JRRA 1SKRB 3TDGA 4EC0A 5DDLA 2VCVA 1RK4A 3GSSA 3P7XA 4GXZA 1G7OA 3FZ5A 2DIZA 1B48A 1ZZYA 2P5RA 4F03A 4O7HA 2L57A 1LJRA 1SJ6A 2K6VA 2WS2A 1IYIA 2OADA 2LJRA 2B5EA 1PL1A 4DSQA 4IKHA 2VLTA 4XS1A 4K7IA 2GSQA 2PPTA 4H86A 1WJKA 4IN0A 2DJ0A 5J9BA 2H1AA 2R37A 2H73A 3PR8A 1M0UA 4MJCA 2AUVA 2OA7A 1JZDA 1FVKA 1F6MC 2VL2A 4Z7XA 1TRWA 4PUAA 4KCAA 5ABRA 2HT9A 1BAYA 11GSA 2GDRA 4PGTA 2GVPA 5DAKB 3BOAA 4V2LA 1A0FA 4ACSA 1F3AA 9GSSA 20GSA 3ZMKA 1JZWA 2H0GA 3FR3A 2F51A 1JFUA 3GKMA 1FAAA 2FWFA 3QAGA 3DXBA 1TOFA 1BJXA 2QA1A 3IR4A 2HNLA 2QKEA 3H4KA 1KTEA 4ZBDA 4ZBAA 1TRUA 2OBIA 3HKRA 5HR1A 3TOTA 2DKIA 1THOA 5B7CA 3TKSE 5F06A 2VO4A 3IK9A 1PA3A 2QSIA 4AJ6A 1GWCA 1B9XC 1WP0A 4RQRA 1XPVA 4Q5FA 5C04A 3FZAA 3WT1A 3LG6A 3VWXA 2DMLA 3L78A 5ECLB 5CYYA 5ECIB 1DUGA 1V2AA 3V1WA 1GUMA 3KD0A 1AQVA 1MDJA 4HOJA 2B1KA 1WRYA 4LMWA 1DE2A 3DEXA 2CT6A 2FLSA 1OKTA 5EL8A 2D2ZA 3MNGA 2YOIA 3TJFA 4AJ7A 1ST9A 2ZNMA 1XW5A 2C8UA 2DKHA 2J9HA 3LXTA 2IFQA 1U88A 2DIYA 2LTKA 1ACVA 2H76A 1AC1A 4BVXA 2ALBA 2M80A 4G10A 4GWRA 4MF5A 6GSSA 2B3SA 3WD6A 2FD3A 4J57E 3OR5A 1NHYA 5A5KA 1FB6A 2CZ2A 2PGTA 3BCKA 4MLYA 3GA4A 4GQFA 1MEKA 4KDYA 1WPIA 3KZQA 2HSHA 4WR5A 4FH8A 2L6DA 3VPQA 2KP2A 2NPBA 3QOUA 5A4WA 4LA1A 2X99A 1WIKA 3LJRA 2C1YA 1GUHA 2WZ9A 2QC7A 1SL1B 4YAPA 2CA8A 1EV9A 5G5FA 4NHZA 3HVSA 1GSUA 4BWSA 4YKGA 1TTZA 1M7TA 1GTAA 1K0NA 4OWYA 3IAM2 2K8SA 4KDXA 4MA9A 3CRUA 3EINA 2LV3A 3IC4A 2LNTA 1O73A 1T4YA 3FKFA 4EIPA 3IE3A 4D73A 2H0HA 4I6XA 4EF0A 1K0CA 1EZKA 3ME7A 2LQOA 1HYUA 1R5PA 2LKUA 5CNWA 4QQ7A 2HE3A 2RUEA 4IP1A 1ZYNA 3HVVA 4ZL9A 2C3TA 4TXOB 2GZYA 1UA5A 4HUAA 1MDKA 3FZ9A 2OJLA 1QMVA 4HU7A 5A4UA 1U3IA 3KXOA 4GCIA 5DJLA 3GH6A 2V6KA 3QMXA 4BVYB 3WGDA 5AN1A 2DC5A 3UAPA 3EURA 2LS5A 1CQHA 3TRQA 2WULA 3TKPA 5LNKe 3EC3A 3ZFLA 1H4OA 3A5IA 1TKDB 1PL2A 3KP9A 3EU4A 3TJJA 1N2AA 1M9BA 2M46A 4L5LA 5FWGA 2HYXA 4F9ZA 1OC9A 5ECMB 1DE1A 1VGLA 4NMUA 5G2ZA 2OE1A 3CSJA 3DVXA 3MDKA 2C3NA 4J56E 4V2MA 2C0GA 4I2TA 2JL4A 1A8YA 1MDIA 4X1UA 3VPTA 3M9JA 3IC8A 2NTOA 3FYGA 1Z6MA 3QD9A 4ILFA 4NV2A 3FRCA 4KW6A 2VCXA 2AJQB 1V98A 3RDWA 1TRVA 4NAXA 2ZUPA 1ZMAA 3GMFA 7GSSA 5CRGA 3UVHA 5ECRB 2HLSA 4PNFA 2NVLA 3A2XA 1A2LA 1G7EA 4LMVA 1TK5B 5AIVA 4PNGA 4MJEA 3F3QA 3VI7A 3FR9A 3KCMA 2PUKC 6GSXA 1EOGA 1SK0A 1TW9A 2R5GA 1EGOA 4KCEA 2VLUA 2JU5A 4TXVA 4GF0A 3O6TA 1GLPA 3GKXA 4KH7A 1NM3A 2A2PA 4TR3A 1SKWB 2CVDA 2DJ3A 2O8VB 2PVOC 5B8AA 1PSQA 5HR2A 1HQOA 5C00A 5HQPA 3DKSA 1MTCA 2H6ZA 4POLA 2VD0A 4WR4A 5ECKB 2IJYA 3RAZA 1F9MA 3UBLA 3GX0A 5DCGA 5E4WA 1G0TA 3IXRA 4GSTA 4EUYA 3C1RA 1OC8A 1VF1A 3US3A 1CQGA 1F37A 3LORA 2AAWA 2AHEA 4BWQA 5D9TA 3UL3A 2DBCA 4EDZA 2YANA 4YH2A 1NW2A 3IDVA 1UN2A 2X49A 4HDEA 4PX1A 2FCHA 1K3LA 4EO3A 2CQ9A 4QL7A 4EVMA 2IMIA 2H72A 1W4VA 1B4PA 3ERGA 4XS4A 1Y25A 3ME8A 4IELA 2MYGA 1M2DA 4X4JA 3LQ7A 4AF2A 2GS3A 4DSRA 2R2JA 3RHBA 4TR4A 1GTIA 3H1NA 3ZVJA 5BRTA 2OKAA 1PMTA 1XFLA 3GTUA 3KJYA 4K2DA 1H75A 3FMWA 3KMOA 3Q18A 2QA2A 2FA8A 4ZB9A 3WGXA 3QDNA 1K0OA 3NIVA 4F0BA 1GNEA 4RI7A 1ZL9A 2V1MA 4JU5A 2YWMA 1YKAA 1T4ZA 2O85A 2CAIA 4BL7A 3WGEA 2PMTA 3P2AA 1FB0A 1FW1A 4ECBA 3I69A 2DSAA 2GZPA 3NZNA 2XPEA 1U6TA 3LSZA 3U5RE 3KGKA 2OBKA 3VWVA 1TU8A 2IL3A 2LSTA 10GSA 3W8SA 4XIHA 5JCWA 3TRPA 2L4QA 2P0GA 3M8NA 5D9VA 5IMAA 3GV1A 3RPPA 3D22A 4YAVA 2WB9A 1BG5A 1F3BA 2EC4A 3UVTA 4JBBA 4E8HA 1GLQA 2XBQA 2R4VA 1QUWA 1UVZA 5JWQB 1QQ2A 4PTSA 1SKSB 2RUFA 2YZHA 3BCIA 4L0WA 3EU3A 5DBQA 4OD7A 4BVXB 1FOHA 1A2MA 1WOUA 4NXIA 2H8LA 1YQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AIU A;  1O85 A;  4NV5 A;  1K3Y A;  1JLW A;  1XWK A;  3FEU A;  5ECH B;  4X0X A;  2WGR A;  1E6B A;  4CHS A;  2X8H A;  3FHK A;  4KB3 A;  2RLI A;  1XWA A;  4ZB8 A;  2N5B A;  3HY2 A;  4ZXG A;  3M3M A;  3IA1 A;  2GQM A;  4AGS A;  4TN8 A;  2HXK A;  1R7H A;  1XOB A;  1TI3 A;  2H70 A;  4MCU A;  1GSQ A;  4YQU A;  1T7P B;  5F8B A;  4GQC A;  1XCC A;  1XBS A;  3GFK A;  3HHV A;  1XOA A;  2CV4 A;  2VL3 A;  5ID2 B;  4EE0 A;  2JZR A;  1GH2 A;  1ILO A;  2IME A;  3HJM A;  1V57 A;  4TR1 A;  2A2R A;  5INY A;  4E8E A;  1JZO A;  2MMZ A;  2YZU A;  2EIQ A;  5DAL A;  3ZIJ A;  1VF4 A;  4D73 B;  2C0D A;  2KUC A;  1QFN A;  4BPY A;  2GT6 A;  4OFM A;  2VL9 A;  4TOP A;  3LEF A;  2YPM A;  2LRC A;  4ML1 A;  4HJ2 A;  4PQH A;  3HVX A;  2VCW A;  3DD3 A;  2M72 A;  4HU9 A;  3P8W A;  4EKZ A;  1U3A A;  4HI7 A;  3ZFB A;  5KN1 A;  4K6X A;  2F8A A;  5IPG A;  5IIZ A;  5A4V A;  1K0B A;  1LU4 A;  4EXJ A;  1ZCP A;  2YNX A;  5KN2 A;  4GRF A;  4KGI A;  3D4M A;  3LXZ A;  4HQZ A;  3A5W A;  5IO0 A;  3UMA A;  1SU9 A;  1OVN A;  2V32 A;  4WEY A;  4F2I A;  1EV4 A;  5L71 A;  2LRT A;  3GX8 A;  1Z6N A;  2PVQ A;  2R6K A;  3LGC A;  4MJB A;  1PN9 A;  2XPD A;  3CBU A;  1SJZ A;  2OAC A;  5DCH A;  4KSM A;  2H75 A;  4N0Z A;  1RW1 A;  2BJX A;  2R3X A;  3F4T A;  4MZB A;  2L6C A;  1BQ7 A;  5IOW A;  4OCF A;  1X9S B;  4NHW A;  4MP4 A;  3LWA A;  1X9W B;  5D9X A;  2RM6 A;  1G6W A;  5J5N A;  2ON5 A;  3KH9 A;  2QGV A;  2XBI A;  1Z7P A;  2CX3 A;  3HJP A;  6GSY A;  1BED A;  5IMF A;  4MK3 A;  1T8E B;  5ELA A;  1ERU A;  3A3T A;  2HFD A;  2Z9S A;  18GS A;  3C71 A;  3GL5 A;  5GAP D;  3D6I A;  3L4N A;  3NOF A;  2IPA A;  4Q5N A;  4P3Y B;  3J7Y k;  3F4R A;  2IIY A;  1BX9 A;  1JZR A;  2BTO T;  4N11 A;  4ISD A;  3EYT A;  1PGT A;  5DAK A;  5JCG A;  2FY6 A;  5FT3 A;  1PKZ A;  2V41 A;  4G19 A;  2F9S A;  1T3B A;  4KAE A;  3K8N A;  3KTB A;  5D8I A;  2IWT A;  2YWO A;  3FZ4 A;  4FIW A;  4POB A;  1PX7 A;  3IV4 A;  1GSE A;  4KDU A;  5IPH A;  4IQA A;  2O87 A;  1A2J A;  1WMJ A;  1J9B A;  1WWJ A;  1R5A A;  4XS6 A;  2CVB A;  2LJK A;  4K8M A;  2HZE B;  1XW9 A;  3DYR A;  1X9M B;  2HZF A;  1YEP A;  16GS A;  1J08 A;  4POM A;  3IHQ A;  4MZC A;  3QPM A;  2J23 A;  3ZZX A;  3RPN A;  4HJM A;  2DMM A;  4CW9 A;  3KH7 A;  4DSS B;  1AAZ A;  1PKW A;  1IYH A;  4MPG A;  5FHI A;  3PH9 A;  2VAF A;  3TJK A;  4V1A p;  5IMZ A;  5CAX A;  1URM A;  1O8W A;  1ERW A;  1FG4 A;  4OO5 A;  2H1D A;  1GUK A;  3F0I A;  4JE1 A;  3SBC A;  3ZIT A;  2RM5 A;  3IAS 2;  4IJ3 A;  3CSH A;  2EIO A;  2N5A A;  2TIR A;  4HEA 2;  2H1G A;  2JZT A;  2EIR A;  5LCZ A;  4HS1 A;  4FYC A;  1FO5 A;  3GUS A;  1YF0 A;  1WE0 A;  2TRC P;  5GAN D;  3CMI A;  1A0R P;  3ZRE A;  5D93 A;  5KEJ A;  5F0G A;  3HJO A;  5IO2 A;  4GTU A;  1AQX A;  1F2E A;  4PXO A;  2MMN A;  1R26 A;  3EMP A;  2VD1 A;  3GL3 A;  1A23 A;  1QGV A;  1HNB A;  3F4S A;  2VCT A;  4GLT A;  3VWW A;  1XWB A;  5HFI A;  4PQI A;  5LD0 A;  3MAK A;  5E59 A;  2FWE A;  2GTU A;  1TJD A;  2X64 A;  5ECS A;  5GZZ B;  1K3O A;  17GS A;  4IW9 A;  3APS A;  1Z3E A;  4HQS A;  4IS0 A;  2B5X A;  2H66 A;  2HSY A;  4QL9 A;  5IQY A;  2G2Q A;  4TVE A;  2IMK A;  3L9S A;  1T00 A;  3TKR A;  1SL2 B;  2H6X A;  3GYK A;  1ZYE A;  3ERF A;  5CO3 A;  3Q74 A;  4K7N A;  2VCQ A;  4ULX A;  5IOX A;  2C0F A;  4TXO A;  3F6D A;  14GS A;  2DJK A;  4JR4 A;  2B5Y A;  3EMX A;  3GST A;  1YKC A;  3GIX A;  2FA4 A;  1SYR A;  5EPF A;  1PQN A;  2CAQ A;  4TR0 A;  4I97 A;  5JCU A;  2NDO A;  4BVY A;  1LBK A;  4MJA A;  2E7P A;  5CRW A;  4ML6 A;  3VFI A;  2OE3 A;  4WBJ A;  1O81 A;  1TP9 A;  3UOM A;  3HZ8 A;  1EP8 A;  2LNS A;  4MH2 A;  1XWC A;  1Y6E A;  2PWJ A;  1K0D A;  5G31 A;  6GST A;  2OE0 A;  4G2E A;  1A24 A;  5J4U A;  3PGT A;  3VWU A;  4XRA A;  5B6N A;  1FHE A;  3HCZ A;  2WFC A;  5J41 A;  2ON7 A;  1EGR A;  3ZIV A;  4FYU A;  2E2M A;  3QAV A;  4OCE A;  3G9B A;  2V6O A;  13GS A;  1XZO A;  8GSS A;  5G5E A;  2X8C A;  2VLV A;  3I43 A;  3LYP A;  3HZ4 A;  3M0F A;  5G30 A;  4XHM A;  1Z5Y E;  6GSW A;  4IQ1 A;  1SEN A;  2XHF A;  1UC7 A;  1AUC A;  4KND A;  3GUR A;  5GST A;  5DAL B;  2LQQ A;  1VF3 A;  4POK A;  1ZYQ B;  1ERT A;  5HFG A;  1THX A;  1M2B A;  5GSS A;  3UEM A;  3O76 A;  4PUF C;  4ECJ A;  4F82 A;  3MWH A;  3C1S A;  2VCZ A;  4TKY A;  2L59 A;  1AXD A;  2B6M A;  1DBY A;  1XW6 A;  3ZLP A;  2NBS A;  4AJ8 A;  2IMF A;  1SYX A;  4L8E A;  2A2S A;  2YP6 A;  1FOV A;  4TW5 A;  3L9U A;  2VM2 A;  3L0H A;  3A2V A;  1SK2 A;  4ZL7 A;  5HR0 A;  3WYW A;  4MDC A;  5CRD A;  2AYT A;  3O3T A;  1ON4 A;  1GUL A;  1QK8 A;  4I8B A;  3UBK A;  1Q98 A;  1SL0 B;  2PER A;  3D0Z A;  2HRN A;  4K1F A;  4XRD A;  3TCO A;  3DGQ A;  3G7J A;  3CTF A;  1SD8 A;  3F8U A;  3H8Q A;  3A2W A;  4WXT A;  2CZ3 A;  3VI5 A;  3VK9 A;  2IFQ B;  4OFN A;  4CDO A;  3CYN A;  3TRX A;  1TK8 B;  2LRN A;  3CTG A;  4JR6 A;  2FWG A;  4J2F A;  3TKQ A;  4N30 A;  4ZL8 A;  2GST A;  1NHO A;  3IOS A;  1XWG A;  4XTS A;  1U87 A;  1S3C A;  4WKW A;  1KEB A;  1GSF A;  1G6Y A;  2KP1 A;  5H5S A;  1MD4 A;  5F07 A;  3F9U A;  5AGY A;  1S3D A;  3I9V 2;  3DWV A;  1GP1 A;  2DJJ A;  3M9K A;  1GSS A;  5ECO B;  12GS A;  2H0I A;  4L5O A;  3DML A;  2N5F A;  3HDC A;  5IMC A;  2MZC A;  3BD2 A;  2WRT A;  3E0U A;  2I1U A;  5CP1 A;  3TB2 A;  1TK0 B;  4I5Q A;  3H93 A;  3RBT A;  2GSS A;  1GNW A;  4X43 A;  2WDU A;  1GSY A;  2H1B A;  5COH A;  1ZGN A;  2YV7 A;  1QXH A;  2L5O A;  1N8J A;  5D96 A;  1J0F A;  3EVI A;  3ZML A;  2MBT A;  5CRH A;  2O89 A;  5DVB A;  3J7Y b;  4KSO A;  5J3R A;  2LUS A;  3JCM L;  2LEG A;  3G7Y A;  5IMV A;  3KP8 A;  4HZ2 A;  3IK7 A;  1HNC A;  3W8J A;  4OFT A;  4DVC A;  2I9H A;  5ECN B;  2ES7 A;  2P5Q A;  3GKN A;  2FWH A;  1OE8 A;  5KN0 A;  2VM1 A;  1HNA A;  1OKD A;  1K0M A;  2FHE A;  1VRS D;  1EEJ A;  1XXU A;  1OE7 A;  3LYK A;  3F6F A;  2FNO A;  1Z9H A;  3KIJ A;  1HD2 A;  5ENU A;  3ZYW A;  1C72 A;  2YN1 A;  4NPB A;  2L5L A;  4ZB6 A;  3TJG A;  2KLX A;  2K18 A;  4BA7 A;  5H5Q A;  3U6V A;  2HRF A;  5DQS A;  2IMD A;  4WF4 A;  19GS A;  2REM A;  1S3A A;  2P31 A;  2C3Q A;  1OC9 B;  4IP6 A;  1TDI A;  1X5E A;  1V9W A;  4RQX A;  3ERW A;  4GSN A;  3D5J A;  2YJ7 A;  1EWX A;  2BMX A;  2VUP A;  4EDY A;  3Q6O A;  3ISO A;  2K9F A;  4OO4 A;  1XVQ A;  3TUE A;  6GSV A;  4GSS A;  3C73 A;  1O8X A;  1SK1 A;  2MMA A;  4KA0 A;  3L9V A;  5G1K A;  1TRS A;  5B6M A;  1V40 A;  4EL1 A;  2MBS A;  1RQM A;  3VUR A;  2ZCT A;  3GN3 A;  3MSZ A;  1K0A A;  4KE3 A;  4LLR A;  2H6Y A;  4NWY A;  5ECQ B;  2I4A A;  1JLV A;  4ID0 A;  3ZVJ D;  5EVO A;  4FO5 A;  2V2G A;  2B7K A;  1Q4J A;  3TJB A;  1M99 A;  4IHU A;  2K8V A;  1YDK A;  4MF7 A;  3EWL A;  2DJ1 A;  3CXG A;  3TOU A;  2FUG 2;  2H01 A;  5ID2 A;  2B1L A;  1X5D A;  2PU9 C;  5IM9 A;  2JAD A;  3DVW A;  4MMM A;  4MPF A;  4L0U A;  3HD5 A;  3DIE A;  2YJH A;  1KNG A;  4O92 A;  3APQ A;  3F3R A;  5DJM A;  4TRX A;  1X5C A;  5J9C A;  1A8L A;  3GKK A;  1JHB A;  1E2Y A;  4FYB A;  2F3M A;  3E3E A;  3QFB C;  4LL4 B;  2G0F A;  2JSY A;  4ECI A;  1PX6 A;  3BBY A;  3UJ1 A;  1B4Q A;  3CRT A;  1PD2 1;  5AIX A;  5B8B A;  2X8G A;  2PBJ A;  2PN8 A;  3CSI A;  3C7M A;  1GTU A;  1O7U A;  2YWI A;  4K7O A;  3S9F A;  1AQW A;  3I6A A;  5D9W A;  1GTB A;  2GQL A;  4ZIL A;  2I81 A;  3UIW A;  4G9H A;  3ZL5 A;  2C0E A;  1EOH A;  4XS4 B;  4JZQ A;  1I5G A;  1YY7 A;  3QCP A;  2H19 A;  2VIM A;  2YCD A;  22GS A;  3GTU B;  1PRX A;  3FY7 A;  4I2U A;  1M9A A;  3FR6 A;  5ECP B;  4IBP A;  1GSD A;  1ML6 A;  4N0V A;  1EP7 A;  2GSR A;  1KBN A;  4K9Z A;  1B8X A;  3IBH A;  1EEM A;  1R4W A;  3GH9 A;  2HI7 A;  4V1A g;  1SD9 A;  4ECC A;  4KX4 A;  2YV9 A;  3TGZ A;  3LFL A;  3BJ5 A;  4KUN A;  3ED3 A;  4RI6 A;  4O5R A;  2VOC A;  3GRX A;  2KOK A;  2GZZ A;  2GT5 A;  3KM6 A;  2XC2 A;  3D21 A;  4O32 A;  3APO A;  3ZRD A;  1TU7 A;  1Z7R A;  2E2G A;  3HA9 A;  2E0Q A;  4OMV A;  1ABA A;  1NSW A;  2O7K A;  2GGT A;  2MMO A;  5DQY A;  1YZX A;  1XVW A;  1YF1 A;  3GNJ A;  3HYP A;  3W6G A;  1USB A;  3VLN A;  1MD3 A;  3UAR A;  4PQ1 A;  5G1L A;  4Q5Q A;  1I9D A;  5IMD A;  5HFK A;  3D4T A;  3DRN A;  3R2Q A;  3KMN A;  3KTL A;  4YQM A;  3Q19 A;  5JWR B;  2DJ2 A;  3FK8 A;  4XCS A;  3HXS A;  4MF6 A;  3GHA A;  1TXX A;  2DLX A;  2JAC A;  4MAB A;  2H74 A;  3RHC A;  4PUR A;  3SWL A;  6GSU A;  2H30 A;  3FW2 A;  1X0R A;  4WF5 A;  1SJI A;  2GLR A;  5KN3 A;  5H5R A;  4HZ4 A;  4ZIJ A;  2KHP A;  1DSB A;  1ERV A;  1OYJ A;  2A4V A;  3P90 A;  3H79 A;  2L4C A;  3EE2 A;  4WET A;  3PIN A;  1TI1 A;  3TKS C;  1BYE A;  2H71 A;  2HZE A;  2IN3 A;  5HR3 A;  2YWN A;  2FGX A;  2WJU A;  4WBR D;  2C4J A;  4DEJ A;  4F0C A;  1AW9 A;  3AY8 A;  5F05 A;  4DSS A;  1T1V A;  1OAZ A;  5EY6 A;  2WCI A;  1VF2 A;  3N5O A;  3QR6 A;  1FVJ A;  4TR1 B;  2AV4 A;  2AB6 A;  3F63 A;  1W89 A;  4Q5R A;  1O6J A;  4IGJ A;  2F8F A;  3QFA C;  1GRX A;  4K0N A;  2LJA A;  4RUV A;  5CRE A;  2CVK A;  1B9Y C;  3C8E A;  1YJ6 A;  4MZW A;  3KEB A;  3TKS A;  3ZTL A;  1YEX A;  3E9J B;  1ZOF A;  2I3Y A;  2RII A;  4K0G A;  5AIS A;  4IVF A;  1OC3 A;  4V2N A;  4YQV A;  2JZS A;  4LL1 B;  1GL8 A;  2JSZ A;  1M2A A;  2B7J A;  4ZBB A;  3G7I A;  4MH3 A;  4N10 A;  1V58 A;  2TRX A;  4IJI A;  1XIY A;  4JED A;  3WT2 A;  5D73 A;  3N9J A;  2GQK A;  5JWO B;  3IPZ A;  3IRA A;  2VL2 C;  2CX4 A;  3M1G A;  5ELG A;  2C80 A;  3QAW A;  4JRR A;  1SKR B;  3TDG A;  4EC0 A;  5DDL A;  2VCV A;  1RK4 A;  3GSS A;  3P7X A;  4GXZ A;  1G7O A;  3FZ5 A;  2DIZ A;  1B48 A;  1ZZY A;  2P5R A;  4F03 A;  4O7H A;  2L57 A;  1LJR A;  1SJ6 A;  2K6V A;  2WS2 A;  1IYI A;  2OAD A;  2LJR A;  2B5E A;  1PL1 A;  4DSQ A;  4IKH A;  2VLT A;  4XS1 A;  4K7I A;  2GSQ A;  2PPT A;  4H86 A;  1WJK A;  4IN0 A;  2DJ0 A;  5J9B A;  2H1A A;  2R37 A;  2H73 A;  3PR8 A;  1M0U A;  4MJC A;  2AUV A;  2OA7 A;  1JZD A;  1FVK A;  1F6M C;  2VL2 A;  4Z7X A;  1TRW A;  4PUA A;  4KCA A;  5ABR A;  2HT9 A;  1BAY A;  11GS A;  2GDR A;  4PGT A;  2GVP A;  5DAK B;  3BOA A;  4V2L A;  1A0F A;  4ACS A;  1F3A A;  9GSS A;  20GS A;  3ZMK A;  1JZW A;  2H0G A;  3FR3 A;  2F51 A;  1JFU A;  3GKM A;  1FAA A;  2FWF A;  3QAG A;  3DXB A;  1TOF A;  1BJX A;  3IR4 A;  2HNL A;  2QKE A;  3H4K A;  1KTE A;  4ZBD A;  4ZBA A;  1TRU A;  2OBI A;  3HKR A;  5HR1 A;  3TOT A;  1THO A;  5B7C A;  3TKS E;  5F06 A;  2VO4 A;  3IK9 A;  1PA3 A;  2QSI A;  4AJ6 A;  1GWC A;  1B9X C;  1WP0 A;  4RQR A;  1XPV A;  4Q5F A;  5C04 A;  3FZA A;  3WT1 A;  3LG6 A;  3VWX A;  2DML A;  3L78 A;  5ECL B;  5CYY A;  5ECI B;  1DUG A;  1V2A A;  3V1W A;  1GUM A;  3KD0 A;  1AQV A;  1MDJ A;  4HOJ A;  2B1K A;  1WRY A;  4LMW A;  1DE2 A;  3DEX A;  2CT6 A;  2FLS A;  1OKT A;  5EL8 A;  2D2Z A;  3MNG A;  2YOI A;  3TJF A;  4AJ7 A;  1ST9 A;  2ZNM A;  1XW5 A;  2C8U A;  2J9H A;  3LXT A;  2IFQ A;  1U88 A;  2DIY A;  2LTK A;  1ACV A;  2H76 A;  1AC1 A;  4BVX A;  2ALB A;  2M80 A;  4G10 A;  4GWR A;  4MF5 A;  6GSS A;  2B3S A;  3WD6 A;  2FD3 A;  4J57 E;  3OR5 A;  1NHY A;  5A5K A;  1FB6 A;  2CZ2 A;  2PGT A;  3BCK A;  4MLY A;  3GA4 A;  4GQF A;  1MEK A;  4KDY A;  1WPI A;  3KZQ A;  2HSH A;  4WR5 A;  4FH8 A;  2L6D A;  3VPQ A;  2KP2 A;  2NPB A;  3QOU A;  5A4W A;  4LA1 A;  2X99 A;  1WIK A;  3LJR A;  2C1Y A;  1GUH A;  2WZ9 A;  2QC7 A;  1SL1 B;  4YAP A;  2CA8 A;  1EV9 A;  5G5F A;  4NHZ A;  3HVS A;  1GSU A;  4BWS A;  1TTZ A;  1M7T A;  1GTA A;  1K0N A;  4OWY A;  3IAM 2;  2K8S A;  4KDX A;  4MA9 A;  3CRU A;  3EIN A;  2LV3 A;  3IC4 A;  2LNT A;  1O73 A;  1T4Y A;  3FKF A;  3IE3 A;  4D73 A;  2H0H A;  4I6X A;  4EF0 A;  1K0C A;  1EZK A;  3ME7 A;  2LQO A;  1HYU A;  1R5P A;  2LKU A;  5CNW A;  4QQ7 A;  2HE3 A;  2RUE A;  4IP1 A;  3HVV A;  4ZL9 A;  2C3T A;  4TXO B;  2GZY A;  1UA5 A;  4HUA A;  1MDK A;  3FZ9 A;  2OJL A;  1QMV A;  4HU7 A;  5A4U A;  1U3I A;  3KXO A;  4GCI A;  5DJL A;  3GH6 A;  2V6K A;  3QMX A;  3WGD A;  5AN1 A;  2DC5 A;  3UAP A;  3EUR A;  2LS5 A;  1CQH A;  3TRQ A;  2WUL A;  3TKP A;  5LNK e;  3EC3 A;  3ZFL A;  1H4O A;  1TKD B;  1PL2 A;  3KP9 A;  3EU4 A;  3TJJ A;  1N2A A;  1M9B A;  2M46 A;  4L5L A;  5FWG A;  2HYX A;  4F9Z A;  1OC9 A;  5ECM B;  1DE1 A;  1VGL A;  4NMU A;  5G2Z A;  2OE1 A;  3CSJ A;  3DVX A;  3MDK A;  2C3N A;  4J56 E;  4V2M A;  2C0G A;  4I2T A;  2JL4 A;  1A8Y A;  1MDI A;  4X1U A;  3VPT A;  3M9J A;  2NTO A;  3FYG A;  1Z6M A;  3QD9 A;  4ILF A;  4NV2 A;  3FRC A;  4KW6 A;  2VCX A;  2AJQ B;  1V98 A;  3RDW A;  1TRV A;  4NAX A;  2ZUP A;  1ZMA A;  3GMF A;  7GSS A;  5CRG A;  3UVH A;  5ECR B;  2HLS A;  4PNF A;  2NVL A;  3A2X A;  1A2L A;  1G7E A;  4LMV A;  1TK5 B;  5AIV A;  4PNG A;  4MJE A;  3F3Q A;  3VI7 A;  3FR9 A;  3KCM A;  2PUK C;  6GSX A;  1EOG A;  1SK0 A;  1TW9 A;  2R5G A;  1EGO A;  4KCE A;  2VLU A;  2JU5 A;  4TXV A;  4GF0 A;  3O6T A;  1GLP A;  3GKX A;  4KH7 A;  1NM3 A;  4TR3 A;  1SKW B;  2CVD A;  2DJ3 A;  2O8V B;  2PVO C;  5B8A A;  1PSQ A;  5HR2 A;  1HQO A;  5C00 A;  5HQP A;  3DKS A;  1MTC A;  2H6Z A;  4POL A;  2VD0 A;  4WR4 A;  5ECK B;  2IJY A;  3RAZ A;  1F9M A;  3UBL A;  3GX0 A;  5DCG A;  5E4W A;  1G0T A;  3IXR A;  4GST A;  4EUY A;  3C1R A;  1OC8 A;  1VF1 A;  3US3 A;  1CQG A;  1F37 A;  3LOR A;  2AAW A;  2AHE A;  4BWQ A;  5D9T A;  3UL3 A;  2DBC A;  4EDZ A;  2YAN A;  4YH2 A;  1NW2 A;  3IDV A;  1UN2 A;  4HDE A;  4PX1 A;  2FCH A;  1K3L A;  4EO3 A;  2CQ9 A;  4QL7 A;  4EVM A;  2IMI A;  2H72 A;  1W4V A;  1B4P A;  3ERG A;  4XS4 A;  1Y25 A;  3ME8 A;  4IEL A;  2MYG A;  1M2D A;  3LQ7 A;  4AF2 A;  2GS3 A;  4DSR A;  2R2J A;  3RHB A;  4TR4 A;  1GTI A;  3H1N A;  3ZVJ A;  2OKA A;  1PMT A;  1XFL A;  3GTU A;  3KJY A;  4K2D A;  1H75 A;  3KMO A;  3Q18 A;  2FA8 A;  4ZB9 A;  3WGX A;  3QDN A;  1K0O A;  3NIV A;  4F0B A;  1GNE A;  4RI7 A;  1ZL9 A;  2V1M A;  4JU5 A;  2YWM A;  1YKA A;  1T4Z A;  2O85 A;  2CAI A;  4BL7 A;  3WGE A;  2PMT A;  3P2A A;  1FB0 A;  1FW1 A;  4ECB A;  3I69 A;  2DSA A;  2GZP A;  3NZN A;  2XPE A;  1U6T A;  3LSZ A;  3U5R E;  3KGK A;  2OBK A;  3VWV A;  1TU8 A;  2IL3 A;  2LST A;  10GS A;  3W8S A;  4XIH A;  5JCW A;  3TRP A;  2L4Q A;  2P0G A;  3M8N A;  5D9V A;  5IMA A;  3GV1 A;  3RPP A;  3D22 A;  4YAV A;  2WB9 A;  1BG5 A;  1F3B A;  2EC4 A;  3UVT A;  4JBB A;  4E8H A;  1GLQ A;  2XBQ A;  2R4V A;  1QUW A;  1UVZ A;  5JWQ B;  1QQ2 A;  1SKS B;  2RUF A;  2YZH A;  3BCI A;  4L0W A;  3EU3 A;  5DBQ A;  4OD7 A;  1A2M A;  1WOU A;  4NXI A;  2H8L A;  1YQ1 A; 
#chains in the Genus database with same CATH topology
 1AIU A;  1O85 A;  4NV5 A;  1K3Y A;  1JLW A;  1XWK A;  4G0L A;  3FEU A;  5ECH B;  4X0X A;  2WGR A;  1E6B A;  4CHS A;  2X8H A;  3FHK A;  4KB3 A;  2RLI A;  1XWA A;  4ZB8 A;  2N5B A;  3HY2 A;  4ZXG A;  3M3M A;  3IA1 A;  2GQM A;  4AGS A;  4TN8 A;  2HXK A;  1R7H A;  1XOB A;  1TI3 A;  2H70 A;  4MCU A;  1GSQ A;  4MNN A;  4YQU A;  1T7P B;  5F8B A;  4GQC A;  1XCC A;  1XBS A;  3GFK A;  3HHV A;  1XOA A;  2CV4 A;  2VL3 A;  5ID2 B;  4EE0 A;  2JZR A;  1GH2 A;  1ILO A;  2IME A;  3HJM A;  1V57 A;  4TR1 A;  2A2R A;  5INY A;  4E8E A;  1JZO A;  2MMZ A;  2YZU A;  2EIQ A;  5DAL A;  3ZIJ A;  1VF4 A;  4D73 B;  4K5R A;  2C0D A;  2KUC A;  1QFN A;  4BPY A;  2GT6 A;  4OFM A;  2VL9 A;  4TOP A;  3LEF A;  2YPM A;  2LRC A;  4ML1 A;  4HJ2 A;  4PQH A;  4KF9 A;  3HVX A;  2VCW A;  3DD3 A;  2M72 A;  4HU9 A;  4K2X A;  3P8W A;  4EKZ A;  1U3A A;  4HI7 A;  3ZFB A;  5KN1 A;  4K6X A;  2F8A A;  4EIQ A;  5IPG A;  5IIZ A;  5A4V A;  1K0B A;  1LU4 A;  4EXJ A;  1ZCP A;  3LW9 A;  3PPU A;  2YNX A;  5KN2 A;  4GRF A;  4KGI A;  3D4M A;  3LXZ A;  4HQZ A;  3A5W A;  5IO0 A;  3UMA A;  1SU9 A;  1OVN A;  2V32 A;  4WEY A;  4F2I A;  1EV4 A;  5L71 A;  2LRT A;  3GX8 A;  1Z6N A;  2PVQ A;  2R6K A;  3LGC A;  4MJB A;  1PN9 A;  2XPD A;  3CBU A;  1SJZ A;  3HVN A;  2OAC A;  5DCH A;  4KSM A;  2H75 A;  4N0Z A;  1RW1 A;  2BJX A;  2R3X A;  3F4T A;  4MZB A;  5KOW A;  2L6C A;  1BQ7 A;  5IOW A;  4OCF A;  1X9S B;  4NHW A;  4MP4 A;  3LWA A;  1X9W B;  5D9X A;  2RM6 A;  1G6W A;  5J5N A;  2ON5 A;  3KH9 A;  2QGV A;  2XBI A;  1Z7P A;  2CX3 A;  3HJP A;  6GSY A;  1BED A;  5IMF A;  4MK3 A;  1T8E B;  5ELA A;  1ERU A;  3A3T A;  2HFD A;  2Z9S A;  18GS A;  5KOX A;  3C71 A;  3GL5 A;  5GAP D;  3D6I A;  3L4N A;  3NOF A;  2IPA A;  4Q5N A;  4P3Y B;  4USS A;  3J7Y k;  3F4R A;  2IIY A;  1BX9 A;  1JZR A;  2BTO T;  4N11 A;  4ISD A;  3EYT A;  1PGT A;  5DAK A;  5JCG A;  4O5U A;  2FY6 A;  5FT3 A;  1PKZ A;  2V41 A;  4G19 A;  2F9S A;  1T3B A;  4KAE A;  3K8N A;  3KTB A;  5D8I A;  2IWT A;  2YWO A;  3FZ4 A;  4FIW A;  4POB A;  1PX7 A;  3IV4 A;  1GSE A;  4KDU A;  5IPH A;  4IQA A;  2O87 A;  1A2J A;  1WMJ A;  1J9B A;  4O5Q A;  1WWJ A;  1ZYP A;  1R5A A;  4XS6 A;  2CVB A;  2LJK A;  4K8M A;  2HZE B;  1XW9 A;  3DYR A;  1X9M B;  2HZF A;  1YEP A;  16GS A;  1J08 A;  4POM A;  3IHQ A;  4MZC A;  3QPM A;  2J23 A;  3ZZX A;  3RPN A;  4HJM A;  2DMM A;  4CW9 A;  3KH7 A;  4DSS B;  1AAZ A;  1PKW A;  1IYH A;  4MPG A;  5FHI A;  3PH9 A;  2VAF A;  3TJK A;  4V1A p;  5IMZ A;  5CAX A;  1URM A;  1O8W A;  1ERW A;  1FG4 A;  4OO5 A;  2H1D A;  1GUK A;  3F0I A;  4JE1 A;  3SBC A;  3ZIT A;  2RM5 A;  3IAS 2;  4IJ3 A;  3CSH A;  2EIO A;  2N5A A;  2TIR A;  4HEA 2;  2H1G A;  2JZT A;  2EIR A;  5LCZ A;  4HS1 A;  4FYC A;  1FO5 A;  3GUS A;  1YF0 A;  1WE0 A;  2TRC P;  5GAN D;  3CMI A;  1A0R P;  3ZRE A;  5D93 A;  5KEJ A;  5F0G A;  3HJO A;  5IO2 A;  4GTU A;  1AQX A;  1F2E A;  4PXO A;  4CY6 A;  2MMN A;  1R26 A;  3EMP A;  2VD1 A;  3GL3 A;  1A23 A;  1QGV A;  1HNB A;  3F4S A;  2VCT A;  4GLT A;  3VWW A;  1XWB A;  5HFI A;  4PQI A;  5LD0 A;  3MAK A;  5E59 A;  2FWE A;  2GTU A;  1TJD A;  2X64 A;  5ECS A;  5GZZ B;  1K3O A;  17GS A;  4IW9 A;  3APS A;  1Z3E A;  4HQS A;  4IS0 A;  2B5X A;  2H66 A;  2HSY A;  4QL9 A;  5IQY A;  2G2Q A;  4TVE A;  2IMK A;  3L9S A;  1T00 A;  3TKR A;  1SL2 B;  4FQU A;  2H6X A;  3GYK A;  1ZYE A;  3ERF A;  5CO3 A;  3Q74 A;  4K7N A;  2VCQ A;  4ULX A;  5IOX A;  2C0F A;  4TXO A;  3F6D A;  14GS A;  2DJK A;  4G0K A;  2B5Y A;  4JR4 A;  3EMX A;  3GST A;  1YKC A;  3GIX A;  2FA4 A;  1SYR A;  5EPF A;  1PQN A;  2CAQ A;  4TR0 A;  4I97 A;  5JCU A;  2NDO A;  4BVY A;  1LBK A;  4MJA A;  2E7P A;  5CRW A;  4ML6 A;  3VFI A;  2OE3 A;  4WBJ A;  1O81 A;  1TP9 A;  3UOM A;  3HZ8 A;  1EP8 A;  2LNS A;  4MH2 A;  1XWC A;  1Y6E A;  2PWJ A;  1K0D A;  5G31 A;  6GST A;  2OE0 A;  4G2E A;  1A24 A;  5J4U A;  3PGT A;  3VWU A;  4XRA A;  5B6N A;  1FHE A;  3HCZ A;  2WFC A;  5J41 A;  2ON7 A;  1EGR A;  3ZIV A;  4FYU A;  2E2M A;  3QAV A;  4OCE A;  3G9B A;  2HSM A;  13GS A;  2V6O A;  1XZO A;  8GSS A;  5G5E A;  2X8C A;  2VLV A;  3I43 A;  3LYP A;  3HZ4 A;  3M0F A;  5G30 A;  4XHM A;  1Z5Y E;  6GSW A;  4IQ1 A;  1SEN A;  2XHF A;  1UC7 A;  1AUC A;  4KND A;  3GUR A;  5GST A;  5DAL B;  2LQQ A;  1VF3 A;  4POK A;  1ZYQ B;  1ERT A;  5HFG A;  1THX A;  1M2B A;  5GSS A;  3UEM A;  3O76 A;  4PUF C;  4ECJ A;  4F82 A;  3MWH A;  3C1S A;  2VCZ A;  4TKY A;  2L59 A;  1AXD A;  2B6M A;  1DBY A;  1XW6 A;  3ZLP A;  2NBS A;  4AJ8 A;  2IMF A;  1SYX A;  4L8E A;  2A2S A;  2YP6 A;  1FOV A;  4TW5 A;  3L9U A;  2VM2 A;  3L0H A;  3A2V A;  3MYD A;  1SK2 A;  4ZL7 A;  5HR0 A;  3WYW A;  4MDC A;  5CRD A;  2AYT A;  3O3T A;  1ON4 A;  1GUL A;  1QK8 A;  4I8B A;  3IHG A;  3UBK A;  1Q98 A;  1SL0 B;  2PER A;  3D0Z A;  2HRN A;  4K1F A;  4XRD A;  3TCO A;  3DGQ A;  3G7J A;  3CTF A;  1SD8 A;  3F8U A;  3H8Q A;  3A2W A;  4WXT A;  2CZ3 A;  3VI5 A;  3VK9 A;  2IFQ B;  4OFN A;  4CDO A;  3CYN A;  3TRX A;  1TK8 B;  4CY8 A;  2LRN A;  3CTG A;  4JR6 A;  2FWG A;  4J2F A;  3TKQ A;  4N30 A;  4ZL8 A;  2GST A;  1NHO A;  3IOS A;  1XWG A;  4XTS A;  1U87 A;  1S3C A;  4WKW A;  1KEB A;  1GSF A;  1G6Y A;  2KP1 A;  5H5S A;  1MD4 A;  5F07 A;  3F9U A;  5AGY A;  1S3D A;  3I9V 2;  3DWV A;  1GP1 A;  2DJJ A;  3M9K A;  1GSS A;  5ECO B;  12GS A;  2H0I A;  4L5O A;  3DML A;  2N5F A;  3HDC A;  5IMC A;  2MZC A;  3BD2 A;  2WRT A;  3E0U A;  2I1U A;  5CP1 A;  3TB2 A;  1TK0 B;  4I5Q A;  2R0G A;  3H93 A;  3RBT A;  2GSS A;  1GNW A;  4X43 A;  2WDU A;  1GSY A;  2H1B A;  5COH A;  1ZGN A;  2YV7 A;  1QXH A;  2L5O A;  1N8J A;  5D96 A;  1J0F A;  3EVI A;  3ZML A;  2MBT A;  5CRH A;  2O89 A;  5DVB A;  3J7Y b;  4KSO A;  5J3R A;  2LUS A;  3JCM L;  2LEG A;  3G7Y A;  5IMV A;  3EPT A;  3KP8 A;  4HZ2 A;  3IK7 A;  1HNC A;  1PN0 A;  3W8J A;  4OFT A;  4DVC A;  2I9H A;  5ECN B;  2ES7 A;  2P5Q A;  3GKN A;  2FWH A;  4ICY A;  1OE8 A;  5KN0 A;  2VM1 A;  1HNA A;  1PFO A;  1OKD A;  1K0M A;  2FHE A;  1VRS D;  1EEJ A;  1XXU A;  1OE7 A;  3LYK A;  3F6F A;  2FNO A;  1Z9H A;  3KIJ A;  1HD2 A;  5ENU A;  3ZYW A;  2A4H A;  1C72 A;  2YN1 A;  4NPB A;  2L5L A;  4ZB6 A;  3TJG A;  2KLX A;  2K18 A;  4BA7 A;  5H5Q A;  3U6V A;  2HRF A;  5DQS A;  2IMD A;  4WF4 A;  4YKF A;  19GS A;  2REM A;  1XG8 A;  1S3A A;  2P31 A;  2C3Q A;  1OC9 B;  4IP6 A;  1TDI A;  1X5E A;  1V9W A;  4RQX A;  3ERW A;  4GSN A;  3D5J A;  2YJ7 A;  1EWX A;  2BMX A;  2VUP A;  4EDY A;  3Q6O A;  3ISO A;  2K9F A;  4OO4 A;  1XVQ A;  3TUE A;  6GSV A;  4GSS A;  3C73 A;  1O8X A;  1SK1 A;  2MMA A;  4KA0 A;  3L9V A;  5G1K A;  1TRS A;  5B6M A;  1V40 A;  4EL1 A;  2HRK A;  2MBS A;  1RQM A;  3VUR A;  2ZCT A;  3GN3 A;  3MSZ A;  1K0A A;  4KE3 A;  4LLR A;  2H6Y A;  4NWY A;  5ECQ B;  2I4A A;  1JLV A;  4ID0 A;  3ZVJ D;  5EVO A;  4FO5 A;  2V2G A;  2UZ8 A;  2B7K A;  1Q4J A;  3TJB A;  1M99 A;  4IHU A;  2K8V A;  1YDK A;  4MF7 A;  3EWL A;  2DJ1 A;  3CXG A;  3TOU A;  2FUG 2;  2H01 A;  5ID2 A;  2B1L A;  1X5D A;  2PU9 C;  5IM9 A;  4Z2T A;  2JAD A;  3DVW A;  4MMM A;  4MPF A;  4L0U A;  3HD5 A;  3DIE A;  2YJH A;  1KNG A;  4O92 A;  1M3J A;  3APQ A;  3F3R A;  5DJM A;  4TRX A;  1X5C A;  5J9C A;  1A8L A;  3GKK A;  1JHB A;  1E2Y A;  4FYB A;  2F3M A;  3E3E A;  3QFB C;  4LL4 B;  2G0F A;  5BMU A;  2JSY A;  4ECI A;  1PX6 A;  3BBY A;  3UJ1 A;  1B4Q A;  3CRT A;  1PD2 1;  5AIX A;  5B8B A;  2X8G A;  2PBJ A;  4Z2R A;  2PN8 A;  3CSI A;  3C7M A;  1GTU A;  1O7U A;  2YWI A;  4K7O A;  3S9F A;  1AQW A;  3I6A A;  5D9W A;  1GTB A;  2GQL A;  4ZIL A;  2I81 A;  3UIW A;  4G9H A;  3ZL5 A;  2C0E A;  1EOH A;  4XS4 B;  4JZQ A;  2R0P A;  1I5G A;  1YY7 A;  3QCP A;  4A5P A;  2H19 A;  2VIM A;  2YCD A;  22GS A;  3GTU B;  1PRX A;  3FY7 A;  4I2U A;  1M9A A;  3FR6 A;  5ECP B;  4IBP A;  1GSD A;  1ML6 A;  4N0V A;  1EP7 A;  2GSR A;  1KBN A;  4K9Z A;  1B8X A;  3IBH A;  1EEM A;  1R4W A;  3GH9 A;  2HI7 A;  4V1A g;  1SD9 A;  4ECC A;  4KX4 A;  2YV9 A;  3TGZ A;  3LFL A;  4BL7 B;  3BJ5 A;  4KUN A;  4Z2U A;  3ED3 A;  4RI6 A;  4O5R A;  2VOC A;  3GRX A;  2KOK A;  2GZZ A;  2GT5 A;  3KM6 A;  2XC2 A;  3D21 A;  4O32 A;  3APO A;  3ZRD A;  1TU7 A;  1Z7R A;  2E2G A;  3HA9 A;  2E0Q A;  4OMV A;  2R0C A;  1ABA A;  1NSW A;  2O7K A;  2GGT A;  2MMO A;  5DQY A;  1YZX A;  1XVW A;  1YF1 A;  3GNJ A;  3HYP A;  3W6G A;  1USB A;  3VLN A;  1MD3 A;  3UAR A;  4PQ1 A;  5G1L A;  4Q5Q A;  1I9D A;  5IMD A;  5HFK A;  3D4T A;  3DRN A;  3R2Q A;  3KMN A;  3KTL A;  4YQM A;  3Q19 A;  5JWR B;  2DJ2 A;  3FK8 A;  4XCS A;  3HXS A;  4MF6 A;  3GHA A;  1TXX A;  2DLX A;  2JAC A;  4MAB A;  2H74 A;  3RHC A;  4PUR A;  3SWL A;  6GSU A;  2H30 A;  2HRA A;  4G0I A;  3FW2 A;  1X0R A;  4WF5 A;  1SJI A;  2GLR A;  5KN3 A;  5H5R A;  4HZ4 A;  4ZIJ A;  2KHP A;  1DSB A;  1ERV A;  1OYJ A;  2A4V A;  3P90 A;  3H79 A;  2L4C A;  3EE2 A;  4WET A;  3PIN A;  1TI1 A;  3TKS C;  1BYE A;  2H71 A;  2HZE A;  2IN3 A;  5HR3 A;  2YWN A;  2FGX A;  2WJU A;  4WBR D;  2C4J A;  4DEJ A;  4F0C A;  1AW9 A;  3AY8 A;  5F05 A;  4DSS A;  4HSC X;  1T1V A;  1OAZ A;  5EY6 A;  2WCI A;  1VF2 A;  3N5O A;  3QR6 A;  1FVJ A;  3MIX A;  4TR1 B;  2AV4 A;  2AB6 A;  3F63 A;  1W89 A;  4Q5R A;  1O6J A;  4IGJ A;  2F8F A;  3QFA C;  1GRX A;  4K0N A;  2LJA A;  4RUV A;  5CRE A;  2CVK A;  1B9Y C;  3C8E A;  1YJ6 A;  4MZW A;  3KEB A;  3TKS A;  3ZTL A;  1YEX A;  3E9J B;  1ZOF A;  2I3Y A;  2RII A;  4K0G A;  5AIS A;  4IVF A;  1OC3 A;  4V2N A;  4YQV A;  2JZS A;  4LL1 B;  1GL8 A;  2JSZ A;  1M2A A;  2B7J A;  4ZBB A;  3G7I A;  1S3R A;  4MH3 A;  4K5S A;  4N10 A;  1V58 A;  2TRX A;  3R3E A;  4IJI A;  1XIY A;  4JED A;  3WT2 A;  5D73 A;  3N9J A;  2GQK A;  5JWO B;  3IPZ A;  3IRA A;  2VL2 C;  2CX4 A;  3M1G A;  5ELG A;  2X4A A;  2C80 A;  3QAW A;  4JRR A;  1SKR B;  3TDG A;  4EC0 A;  5DDL A;  2VCV A;  1RK4 A;  3GSS A;  3P7X A;  4GXZ A;  1G7O A;  3FZ5 A;  2DIZ A;  1B48 A;  1ZZY A;  2P5R A;  4F03 A;  4O7H A;  2L57 A;  1LJR A;  1SJ6 A;  2K6V A;  2WS2 A;  1IYI A;  2OAD A;  2LJR A;  2B5E A;  1PL1 A;  4DSQ A;  4IKH A;  2VLT A;  4XS1 A;  4K7I A;  2GSQ A;  2PPT A;  4H86 A;  1WJK A;  4IN0 A;  2DJ0 A;  5J9B A;  2H1A A;  4BIK A;  2R37 A;  2H73 A;  3PR8 A;  1M0U A;  4MJC A;  2AUV A;  2OA7 A;  1JZD A;  1FVK A;  1F6M C;  2VL2 A;  4Z7X A;  1TRW A;  4PUA A;  4KCA A;  5ABR A;  2HT9 A;  1BAY A;  11GS A;  2GDR A;  4PGT A;  2GVP A;  5DAK B;  3BOA A;  4V2L A;  1A0F A;  4ACS A;  1F3A A;  9GSS A;  20GS A;  3ZMK A;  1JZW A;  2H0G A;  3FR3 A;  2F51 A;  1JFU A;  3GKM A;  1FAA A;  2FWF A;  3QAG A;  3DXB A;  1TOF A;  1BJX A;  2QA1 A;  3IR4 A;  2HNL A;  2QKE A;  3H4K A;  1KTE A;  4ZBD A;  4ZBA A;  1TRU A;  2OBI A;  3HKR A;  5HR1 A;  3TOT A;  2DKI A;  1THO A;  5B7C A;  3TKS E;  5F06 A;  2VO4 A;  3IK9 A;  1PA3 A;  2QSI A;  4AJ6 A;  1GWC A;  1B9X C;  1WP0 A;  4RQR A;  1XPV A;  4Q5F A;  5C04 A;  3FZA A;  3WT1 A;  3LG6 A;  3VWX A;  2DML A;  3L78 A;  5ECL B;  5CYY A;  5ECI B;  1DUG A;  1V2A A;  3V1W A;  1GUM A;  3KD0 A;  1AQV A;  1MDJ A;  4HOJ A;  2B1K A;  1WRY A;  4LMW A;  1DE2 A;  3DEX A;  2CT6 A;  2FLS A;  1OKT A;  5EL8 A;  2D2Z A;  3MNG A;  2YOI A;  3TJF A;  4AJ7 A;  1ST9 A;  2ZNM A;  1XW5 A;  2C8U A;  2DKH A;  2J9H A;  3LXT A;  2IFQ A;  1U88 A;  2DIY A;  2LTK A;  1ACV A;  2H76 A;  1AC1 A;  4BVX A;  2ALB A;  2M80 A;  4G10 A;  4GWR A;  4MF5 A;  6GSS A;  2B3S A;  1M3I A;  3WD6 A;  2FD3 A;  4J57 E;  3OR5 A;  1NHY A;  5A5K A;  1FB6 A;  2CZ2 A;  2PGT A;  3BCK A;  4MLY A;  3GA4 A;  4GQF A;  1MEK A;  4KDY A;  1WPI A;  3KZQ A;  2HSH A;  4WR5 A;  4FH8 A;  2L6D A;  3VPQ A;  2KP2 A;  2NPB A;  3QOU A;  5A4W A;  4LA1 A;  2X99 A;  1WIK A;  3LJR A;  2C1Y A;  1GUH A;  2WZ9 A;  2QC7 A;  1SL1 B;  4YAP A;  2CA8 A;  1EV9 A;  5G5F A;  4NHZ A;  3HVS A;  1GSU A;  4BWS A;  4YKG A;  1TTZ A;  1M7T A;  1GTA A;  1K0N A;  4OWY A;  3IAM 2;  2K8S A;  4KDX A;  4MA9 A;  3CRU A;  3EIN A;  2LV3 A;  3IC4 A;  2LNT A;  1O73 A;  1T4Y A;  3FKF A;  4EIP A;  3IE3 A;  4D73 A;  2H0H A;  4I6X A;  4EF0 A;  1K0C A;  1EZK A;  3ME7 A;  2LQO A;  1HYU A;  1R5P A;  2LKU A;  5CNW A;  4QQ7 A;  2HE3 A;  2RUE A;  4IP1 A;  1ZYN A;  3HVV A;  4ZL9 A;  2C3T A;  4TXO B;  2GZY A;  1UA5 A;  4HUA A;  1MDK A;  3FZ9 A;  2OJL A;  1QMV A;  4HU7 A;  5A4U A;  1U3I A;  3KXO A;  3CQF A;  4GCI A;  5DJL A;  3GH6 A;  2V6K A;  3QMX A;  4BVY B;  3WGD A;  5AN1 A;  2DC5 A;  3UAP A;  3EUR A;  2LS5 A;  1CQH A;  3TRQ A;  2WUL A;  3TKP A;  5LNK e;  3EC3 A;  3ZFL A;  1H4O A;  3A5I A;  1TKD B;  1PL2 A;  3KP9 A;  3EU4 A;  3TJJ A;  1N2A A;  1M9B A;  2M46 A;  4L5L A;  5FWG A;  2HYX A;  4F9Z A;  1OC9 A;  5ECM B;  1DE1 A;  1VGL A;  4NMU A;  5G2Z A;  2OE1 A;  3CSJ A;  3DVX A;  3MDK A;  2C3N A;  4J56 E;  4V2M A;  2C0G A;  4I2T A;  2JL4 A;  1A8Y A;  1MDI A;  4X1U A;  3VPT A;  3M9J A;  3IC8 A;  2NTO A;  3FYG A;  1Z6M A;  3QD9 A;  4ILF A;  4NV2 A;  3FRC A;  4KW6 A;  2VCX A;  2AJQ B;  1V98 A;  3RDW A;  1TRV A;  4NAX A;  2ZUP A;  1ZMA A;  3GMF A;  7GSS A;  5CRG A;  3UVH A;  5ECR B;  2HLS A;  4PNF A;  2NVL A;  3A2X A;  1A2L A;  1G7E A;  4LMV A;  1TK5 B;  5AIV A;  4PNG A;  4MJE A;  3F3Q A;  3VI7 A;  3FR9 A;  3KCM A;  2PUK C;  6GSX A;  1EOG A;  1SK0 A;  1TW9 A;  2R5G A;  1EGO A;  4KCE A;  2VLU A;  2JU5 A;  4TXV A;  4GF0 A;  3O6T A;  1GLP A;  3GKX A;  4KH7 A;  1NM3 A;  2A2P A;  4TR3 A;  1SKW B;  2CVD A;  2DJ3 A;  2O8V B;  2PVO C;  5B8A A;  1PSQ A;  5HR2 A;  1HQO A;  5C00 A;  5HQP A;  3DKS A;  1MTC A;  2H6Z A;  4POL A;  2VD0 A;  4WR4 A;  5ECK B;  2IJY A;  3RAZ A;  1F9M A;  3UBL A;  3GX0 A;  5DCG A;  5E4W A;  1G0T A;  3IXR A;  4GST A;  4EUY A;  3C1R A;  1OC8 A;  1VF1 A;  3US3 A;  1CQG A;  1F37 A;  3LOR A;  2AAW A;  2AHE A;  4BWQ A;  5D9T A;  3UL3 A;  2DBC A;  4EDZ A;  2YAN A;  4YH2 A;  1NW2 A;  3IDV A;  1UN2 A;  2X49 A;  4HDE A;  4PX1 A;  2FCH A;  1K3L A;  4EO3 A;  2CQ9 A;  4QL7 A;  4EVM A;  2IMI A;  2H72 A;  1W4V A;  1B4P A;  3ERG A;  4XS4 A;  1Y25 A;  3ME8 A;  4IEL A;  2MYG A;  1M2D A;  4X4J A;  3LQ7 A;  4AF2 A;  2GS3 A;  4DSR A;  2R2J A;  3RHB A;  4TR4 A;  1GTI A;  3H1N A;  3ZVJ A;  5BRT A;  2OKA A;  1PMT A;  1XFL A;  3GTU A;  3KJY A;  4K2D A;  1H75 A;  3FMW A;  3KMO A;  3Q18 A;  2QA2 A;  2FA8 A;  4ZB9 A;  3WGX A;  3QDN A;  1K0O A;  3NIV A;  4F0B A;  1GNE A;  4RI7 A;  1ZL9 A;  2V1M A;  4JU5 A;  2YWM A;  1YKA A;  1T4Z A;  2O85 A;  2CAI A;  4BL7 A;  3WGE A;  2PMT A;  3P2A A;  1FB0 A;  1FW1 A;  4ECB A;  3I69 A;  2DSA A;  2GZP A;  3NZN A;  2XPE A;  1U6T A;  3LSZ A;  3U5R E;  3KGK A;  2OBK A;  3VWV A;  1TU8 A;  2IL3 A;  2LST A;  10GS A;  3W8S A;  4XIH A;  5JCW A;  3TRP A;  2L4Q A;  2P0G A;  3M8N A;  5D9V A;  5IMA A;  3GV1 A;  3RPP A;  3D22 A;  4YAV A;  2WB9 A;  1BG5 A;  1F3B A;  2EC4 A;  3UVT A;  4JBB A;  4E8H A;  1GLQ A;  2XBQ A;  2R4V A;  1QUW A;  1UVZ A;  5JWQ B;  1QQ2 A;  4PTS A;  1SKS B;  2RUF A;  2YZH A;  3BCI A;  4L0W A;  3EU3 A;  5DBQ A;  4OD7 A;  4BVX B;  1FOH A;  1A2M A;  1WOU A;  4NXI A;  2H8L A;  1YQ1 A; 
#chains in the Genus database with same CATH homology
 1AIU A;  1O85 A;  4NV5 A;  1K3Y A;  1JLW A;  1XWK A;  4G0L A;  3FEU A;  5ECH B;  4X0X A;  2WGR A;  1E6B A;  4CHS A;  2X8H A;  3FHK A;  4KB3 A;  2RLI A;  1XWA A;  4ZB8 A;  2N5B A;  3HY2 A;  4ZXG A;  3M3M A;  3IA1 A;  2GQM A;  4AGS A;  4TN8 A;  2HXK A;  1R7H A;  1XOB A;  1TI3 A;  2H70 A;  4MCU A;  1GSQ A;  4MNN A;  4YQU A;  1T7P B;  5F8B A;  4GQC A;  1XCC A;  1XBS A;  3GFK A;  3HHV A;  1XOA A;  2CV4 A;  2VL3 A;  5ID2 B;  4EE0 A;  2JZR A;  1GH2 A;  1ILO A;  2IME A;  3HJM A;  1V57 A;  4TR1 A;  2A2R A;  5INY A;  4E8E A;  1JZO A;  2MMZ A;  2YZU A;  2EIQ A;  5DAL A;  3ZIJ A;  1VF4 A;  4D73 B;  4K5R A;  2C0D A;  2KUC A;  1QFN A;  4BPY A;  2GT6 A;  4OFM A;  2VL9 A;  4TOP A;  3LEF A;  2YPM A;  2LRC A;  4ML1 A;  4HJ2 A;  4PQH A;  4KF9 A;  3HVX A;  2VCW A;  3DD3 A;  2M72 A;  4HU9 A;  4K2X A;  3P8W A;  4EKZ A;  1U3A A;  4HI7 A;  3ZFB A;  5KN1 A;  4K6X A;  2F8A A;  4EIQ A;  5IPG A;  5IIZ A;  5A4V A;  1K0B A;  1LU4 A;  4EXJ A;  1ZCP A;  3LW9 A;  3PPU A;  2YNX A;  5KN2 A;  4GRF A;  4KGI A;  3D4M A;  3LXZ A;  4HQZ A;  3A5W A;  5IO0 A;  3UMA A;  1SU9 A;  1OVN A;  2V32 A;  4WEY A;  4F2I A;  1EV4 A;  5L71 A;  2LRT A;  3GX8 A;  1Z6N A;  2PVQ A;  2R6K A;  3LGC A;  4MJB A;  1PN9 A;  2XPD A;  3CBU A;  1SJZ A;  2OAC A;  5DCH A;  4KSM A;  2H75 A;  4N0Z A;  1RW1 A;  2BJX A;  2R3X A;  3F4T A;  4MZB A;  5KOW A;  2L6C A;  1BQ7 A;  5IOW A;  4OCF A;  1X9S B;  4NHW A;  4MP4 A;  3LWA A;  1X9W B;  5D9X A;  2RM6 A;  1G6W A;  5J5N A;  2ON5 A;  3KH9 A;  2QGV A;  2XBI A;  1Z7P A;  2CX3 A;  3HJP A;  6GSY A;  1BED A;  5IMF A;  4MK3 A;  1T8E B;  5ELA A;  1ERU A;  3A3T A;  2HFD A;  2Z9S A;  18GS A;  5KOX A;  3C71 A;  3GL5 A;  5GAP D;  3D6I A;  3L4N A;  3NOF A;  2IPA A;  4Q5N A;  4P3Y B;  4USS A;  3J7Y k;  3F4R A;  2IIY A;  1BX9 A;  1JZR A;  2BTO T;  4N11 A;  4ISD A;  3EYT A;  1PGT A;  5DAK A;  5JCG A;  4O5U A;  2FY6 A;  5FT3 A;  1PKZ A;  2V41 A;  4G19 A;  2F9S A;  1T3B A;  4KAE A;  3K8N A;  3KTB A;  5D8I A;  2IWT A;  2YWO A;  3FZ4 A;  4FIW A;  4POB A;  1PX7 A;  3IV4 A;  1GSE A;  4KDU A;  5IPH A;  4IQA A;  2O87 A;  1A2J A;  1WMJ A;  1J9B A;  4O5Q A;  1WWJ A;  1ZYP A;  1R5A A;  4XS6 A;  2CVB A;  2LJK A;  4K8M A;  2HZE B;  1XW9 A;  3DYR A;  1X9M B;  2HZF A;  1YEP A;  16GS A;  1J08 A;  4POM A;  3IHQ A;  4MZC A;  3QPM A;  2J23 A;  3ZZX A;  3RPN A;  4HJM A;  2DMM A;  4CW9 A;  3KH7 A;  4DSS B;  1AAZ A;  1PKW A;  1IYH A;  4MPG A;  5FHI A;  3PH9 A;  2VAF A;  3TJK A;  4V1A p;  5IMZ A;  5CAX A;  1URM A;  1O8W A;  1ERW A;  1FG4 A;  4OO5 A;  2H1D A;  1GUK A;  3F0I A;  4JE1 A;  3SBC A;  3ZIT A;  2RM5 A;  3IAS 2;  4IJ3 A;  3CSH A;  2EIO A;  2N5A A;  2TIR A;  4HEA 2;  2H1G A;  2JZT A;  2EIR A;  5LCZ A;  4HS1 A;  4FYC A;  1FO5 A;  3GUS A;  1YF0 A;  1WE0 A;  2TRC P;  5GAN D;  3CMI A;  1A0R P;  3ZRE A;  5D93 A;  5KEJ A;  5F0G A;  3HJO A;  5IO2 A;  4GTU A;  1AQX A;  1F2E A;  4PXO A;  4CY6 A;  2MMN A;  1R26 A;  3EMP A;  2VD1 A;  3GL3 A;  1A23 A;  1QGV A;  1HNB A;  3F4S A;  2VCT A;  4GLT A;  3VWW A;  1XWB A;  5HFI A;  4PQI A;  5LD0 A;  3MAK A;  5E59 A;  2FWE A;  2GTU A;  1TJD A;  2X64 A;  5ECS A;  5GZZ B;  1K3O A;  17GS A;  4IW9 A;  3APS A;  1Z3E A;  4HQS A;  4IS0 A;  2B5X A;  2H66 A;  2HSY A;  4QL9 A;  5IQY A;  2G2Q A;  4TVE A;  2IMK A;  3L9S A;  1T00 A;  3TKR A;  1SL2 B;  4FQU A;  2H6X A;  3GYK A;  1ZYE A;  3ERF A;  5CO3 A;  3Q74 A;  4K7N A;  2VCQ A;  4ULX A;  5IOX A;  2C0F A;  4TXO A;  3F6D A;  14GS A;  2DJK A;  4G0K A;  2B5Y A;  4JR4 A;  3EMX A;  3GST A;  1YKC A;  3GIX A;  2FA4 A;  1SYR A;  5EPF A;  1PQN A;  2CAQ A;  4TR0 A;  4I97 A;  5JCU A;  2NDO A;  4BVY A;  1LBK A;  4MJA A;  2E7P A;  5CRW A;  4ML6 A;  3VFI A;  2OE3 A;  4WBJ A;  1O81 A;  1TP9 A;  3UOM A;  3HZ8 A;  1EP8 A;  2LNS A;  4MH2 A;  1XWC A;  1Y6E A;  2PWJ A;  1K0D A;  5G31 A;  6GST A;  2OE0 A;  4G2E A;  1A24 A;  5J4U A;  3PGT A;  3VWU A;  4XRA A;  5B6N A;  1FHE A;  3HCZ A;  2WFC A;  5J41 A;  2ON7 A;  1EGR A;  3ZIV A;  4FYU A;  2E2M A;  3QAV A;  4OCE A;  3G9B A;  2HSM A;  13GS A;  2V6O A;  1XZO A;  8GSS A;  5G5E A;  2X8C A;  2VLV A;  3I43 A;  3LYP A;  3HZ4 A;  3M0F A;  5G30 A;  4XHM A;  1Z5Y E;  6GSW A;  4IQ1 A;  1SEN A;  2XHF A;  1UC7 A;  1AUC A;  4KND A;  3GUR A;  5GST A;  5DAL B;  2LQQ A;  1VF3 A;  4POK A;  1ZYQ B;  1ERT A;  5HFG A;  1THX A;  1M2B A;  5GSS A;  3UEM A;  3O76 A;  4PUF C;  4ECJ A;  4F82 A;  3MWH A;  3C1S A;  2VCZ A;  4TKY A;  2L59 A;  1AXD A;  2B6M A;  1DBY A;  1XW6 A;  3ZLP A;  2NBS A;  4AJ8 A;  2IMF A;  1SYX A;  4L8E A;  2A2S A;  2YP6 A;  1FOV A;  4TW5 A;  3L9U A;  2VM2 A;  3L0H A;  3A2V A;  3MYD A;  1SK2 A;  4ZL7 A;  5HR0 A;  3WYW A;  4MDC A;  5CRD A;  2AYT A;  3O3T A;  1ON4 A;  1GUL A;  1QK8 A;  4I8B A;  3IHG A;  3UBK A;  1Q98 A;  1SL0 B;  2PER A;  3D0Z A;  2HRN A;  4K1F A;  4XRD A;  3TCO A;  3DGQ A;  3G7J A;  3CTF A;  1SD8 A;  3F8U A;  3H8Q A;  3A2W A;  4WXT A;  2CZ3 A;  3VI5 A;  3VK9 A;  2IFQ B;  4OFN A;  4CDO A;  3CYN A;  3TRX A;  1TK8 B;  4CY8 A;  2LRN A;  3CTG A;  4JR6 A;  2FWG A;  4J2F A;  3TKQ A;  4N30 A;  4ZL8 A;  2GST A;  1NHO A;  3IOS A;  1XWG A;  4XTS A;  1U87 A;  1S3C A;  4WKW A;  1KEB A;  1GSF A;  1G6Y A;  2KP1 A;  5H5S A;  1MD4 A;  5F07 A;  3F9U A;  5AGY A;  1S3D A;  3I9V 2;  3DWV A;  1GP1 A;  2DJJ A;  3M9K A;  1GSS A;  5ECO B;  12GS A;  2H0I A;  4L5O A;  3DML A;  2N5F A;  3HDC A;  5IMC A;  2MZC A;  3BD2 A;  2WRT A;  3E0U A;  2I1U A;  5CP1 A;  3TB2 A;  1TK0 B;  4I5Q A;  2R0G A;  3H93 A;  3RBT A;  2GSS A;  1GNW A;  4X43 A;  2WDU A;  1GSY A;  2H1B A;  5COH A;  1ZGN A;  2YV7 A;  1QXH A;  2L5O A;  1N8J A;  5D96 A;  1J0F A;  3EVI A;  3ZML A;  2MBT A;  5CRH A;  2O89 A;  5DVB A;  3J7Y b;  4KSO A;  5J3R A;  2LUS A;  3JCM L;  2LEG A;  3G7Y A;  5IMV A;  3EPT A;  3KP8 A;  4HZ2 A;  3IK7 A;  1HNC A;  1PN0 A;  3W8J A;  4OFT A;  4DVC A;  2I9H A;  5ECN B;  2ES7 A;  2P5Q A;  3GKN A;  2FWH A;  4ICY A;  1OE8 A;  5KN0 A;  2VM1 A;  1HNA A;  1OKD A;  1K0M A;  2FHE A;  1VRS D;  1EEJ A;  1XXU A;  1OE7 A;  3LYK A;  3F6F A;  2FNO A;  1Z9H A;  3KIJ A;  1HD2 A;  5ENU A;  3ZYW A;  2A4H A;  1C72 A;  2YN1 A;  4NPB A;  2L5L A;  4ZB6 A;  3TJG A;  2KLX A;  2K18 A;  4BA7 A;  5H5Q A;  3U6V A;  2HRF A;  5DQS A;  2IMD A;  4WF4 A;  4YKF A;  19GS A;  2REM A;  1S3A A;  2P31 A;  2C3Q A;  1OC9 B;  4IP6 A;  1TDI A;  1X5E A;  1V9W A;  4RQX A;  3ERW A;  4GSN A;  3D5J A;  2YJ7 A;  1EWX A;  2BMX A;  2VUP A;  4EDY A;  3Q6O A;  3ISO A;  2K9F A;  4OO4 A;  1XVQ A;  3TUE A;  6GSV A;  4GSS A;  3C73 A;  1O8X A;  1SK1 A;  2MMA A;  4KA0 A;  3L9V A;  5G1K A;  1TRS A;  5B6M A;  1V40 A;  4EL1 A;  2HRK A;  2MBS A;  1RQM A;  3VUR A;  2ZCT A;  3GN3 A;  3MSZ A;  1K0A A;  4KE3 A;  4LLR A;  2H6Y A;  4NWY A;  5ECQ B;  2I4A A;  1JLV A;  4ID0 A;  3ZVJ D;  5EVO A;  4FO5 A;  2V2G A;  2UZ8 A;  2B7K A;  1Q4J A;  3TJB A;  1M99 A;  4IHU A;  2K8V A;  1YDK A;  4MF7 A;  3EWL A;  2DJ1 A;  3CXG A;  3TOU A;  2FUG 2;  2H01 A;  5ID2 A;  2B1L A;  1X5D A;  2PU9 C;  5IM9 A;  4Z2T A;  2JAD A;  3DVW A;  4MMM A;  4MPF A;  4L0U A;  3HD5 A;  3DIE A;  2YJH A;  1KNG A;  4O92 A;  3APQ A;  3F3R A;  5DJM A;  4TRX A;  1X5C A;  5J9C A;  1A8L A;  3GKK A;  1JHB A;  1E2Y A;  4FYB A;  2F3M A;  3E3E A;  3QFB C;  4LL4 B;  2G0F A;  5BMU A;  2JSY A;  4ECI A;  1PX6 A;  3BBY A;  3UJ1 A;  1B4Q A;  3CRT A;  1PD2 1;  5AIX A;  5B8B A;  2X8G A;  2PBJ A;  4Z2R A;  2PN8 A;  3CSI A;  3C7M A;  1GTU A;  1O7U A;  2YWI A;  4K7O A;  3S9F A;  1AQW A;  3I6A A;  5D9W A;  1GTB A;  2GQL A;  4ZIL A;  2I81 A;  3UIW A;  4G9H A;  3ZL5 A;  2C0E A;  1EOH A;  4XS4 B;  4JZQ A;  2R0P A;  1I5G A;  1YY7 A;  3QCP A;  4A5P A;  2H19 A;  2VIM A;  2YCD A;  22GS A;  3GTU B;  1PRX A;  3FY7 A;  4I2U A;  1M9A A;  3FR6 A;  5ECP B;  4IBP A;  1GSD A;  1ML6 A;  4N0V A;  1EP7 A;  2GSR A;  1KBN A;  4K9Z A;  1B8X A;  3IBH A;  1EEM A;  1R4W A;  3GH9 A;  2HI7 A;  4V1A g;  1SD9 A;  4ECC A;  4KX4 A;  2YV9 A;  3TGZ A;  3LFL A;  4BL7 B;  3BJ5 A;  4KUN A;  4Z2U A;  3ED3 A;  4RI6 A;  4O5R A;  2VOC A;  3GRX A;  2KOK A;  2GZZ A;  2GT5 A;  3KM6 A;  2XC2 A;  3D21 A;  4O32 A;  3APO A;  3ZRD A;  1TU7 A;  1Z7R A;  2E2G A;  3HA9 A;  2E0Q A;  4OMV A;  2R0C A;  1ABA A;  1NSW A;  2O7K A;  2GGT A;  2MMO A;  5DQY A;  1YZX A;  1XVW A;  1YF1 A;  3GNJ A;  3HYP A;  3W6G A;  1USB A;  3VLN A;  1MD3 A;  3UAR A;  4PQ1 A;  5G1L A;  4Q5Q A;  1I9D A;  5IMD A;  5HFK A;  3D4T A;  3DRN A;  3R2Q A;  3KMN A;  3KTL A;  4YQM A;  3Q19 A;  5JWR B;  2DJ2 A;  3FK8 A;  4XCS A;  3HXS A;  4MF6 A;  3GHA A;  1TXX A;  2DLX A;  2JAC A;  4MAB A;  2H74 A;  3RHC A;  4PUR A;  3SWL A;  6GSU A;  2H30 A;  2HRA A;  4G0I A;  3FW2 A;  1X0R A;  4WF5 A;  1SJI A;  2GLR A;  5KN3 A;  5H5R A;  4HZ4 A;  4ZIJ A;  2KHP A;  1DSB A;  1ERV A;  1OYJ A;  2A4V A;  3P90 A;  3H79 A;  2L4C A;  3EE2 A;  4WET A;  3PIN A;  1TI1 A;  3TKS C;  1BYE A;  2H71 A;  2HZE A;  2IN3 A;  5HR3 A;  2YWN A;  2FGX A;  2WJU A;  4WBR D;  2C4J A;  4DEJ A;  4F0C A;  1AW9 A;  3AY8 A;  5F05 A;  4DSS A;  1T1V A;  1OAZ A;  5EY6 A;  2WCI A;  1VF2 A;  3N5O A;  3QR6 A;  1FVJ A;  3MIX A;  4TR1 B;  2AV4 A;  2AB6 A;  3F63 A;  1W89 A;  4Q5R A;  1O6J A;  4IGJ A;  2F8F A;  3QFA C;  1GRX A;  4K0N A;  2LJA A;  4RUV A;  5CRE A;  2CVK A;  1B9Y C;  3C8E A;  1YJ6 A;  4MZW A;  3KEB A;  3TKS A;  3ZTL A;  1YEX A;  3E9J B;  1ZOF A;  2I3Y A;  2RII A;  4K0G A;  5AIS A;  4IVF A;  1OC3 A;  4V2N A;  4YQV A;  2JZS A;  4LL1 B;  1GL8 A;  2JSZ A;  1M2A A;  2B7J A;  4ZBB A;  3G7I A;  4MH3 A;  4K5S A;  4N10 A;  1V58 A;  2TRX A;  3R3E A;  4IJI A;  1XIY A;  4JED A;  3WT2 A;  5D73 A;  3N9J A;  2GQK A;  5JWO B;  3IPZ A;  3IRA A;  2VL2 C;  2CX4 A;  3M1G A;  5ELG A;  2X4A A;  2C80 A;  3QAW A;  4JRR A;  1SKR B;  3TDG A;  4EC0 A;  5DDL A;  2VCV A;  1RK4 A;  3GSS A;  3P7X A;  4GXZ A;  1G7O A;  3FZ5 A;  2DIZ A;  1B48 A;  1ZZY A;  2P5R A;  4F03 A;  4O7H A;  2L57 A;  1LJR A;  1SJ6 A;  2K6V A;  2WS2 A;  1IYI A;  2OAD A;  2LJR A;  2B5E A;  1PL1 A;  4DSQ A;  4IKH A;  2VLT A;  4XS1 A;  4K7I A;  2GSQ A;  2PPT A;  4H86 A;  1WJK A;  4IN0 A;  2DJ0 A;  5J9B A;  2H1A A;  2R37 A;  2H73 A;  3PR8 A;  1M0U A;  4MJC A;  2AUV A;  2OA7 A;  1JZD A;  1FVK A;  1F6M C;  2VL2 A;  4Z7X A;  1TRW A;  4PUA A;  4KCA A;  5ABR A;  2HT9 A;  1BAY A;  11GS A;  2GDR A;  4PGT A;  2GVP A;  5DAK B;  3BOA A;  4V2L A;  1A0F A;  4ACS A;  1F3A A;  9GSS A;  20GS A;  3ZMK A;  1JZW A;  2H0G A;  3FR3 A;  2F51 A;  1JFU A;  3GKM A;  1FAA A;  2FWF A;  3QAG A;  3DXB A;  1TOF A;  1BJX A;  2QA1 A;  3IR4 A;  2HNL A;  2QKE A;  3H4K A;  1KTE A;  4ZBD A;  4ZBA A;  1TRU A;  2OBI A;  3HKR A;  5HR1 A;  3TOT A;  2DKI A;  1THO A;  5B7C A;  3TKS E;  5F06 A;  2VO4 A;  3IK9 A;  1PA3 A;  2QSI A;  4AJ6 A;  1GWC A;  1B9X C;  1WP0 A;  4RQR A;  1XPV A;  4Q5F A;  5C04 A;  3FZA A;  3WT1 A;  3LG6 A;  3VWX A;  2DML A;  3L78 A;  5ECL B;  5CYY A;  5ECI B;  1DUG A;  1V2A A;  3V1W A;  1GUM A;  3KD0 A;  1AQV A;  1MDJ A;  4HOJ A;  2B1K A;  1WRY A;  4LMW A;  1DE2 A;  3DEX A;  2CT6 A;  2FLS A;  1OKT A;  5EL8 A;  2D2Z A;  3MNG A;  2YOI A;  3TJF A;  4AJ7 A;  1ST9 A;  2ZNM A;  1XW5 A;  2C8U A;  2DKH A;  2J9H A;  3LXT A;  2IFQ A;  1U88 A;  2DIY A;  2LTK A;  1ACV A;  2H76 A;  1AC1 A;  4BVX A;  2ALB A;  2M80 A;  4G10 A;  4GWR A;  4MF5 A;  6GSS A;  2B3S A;  3WD6 A;  2FD3 A;  4J57 E;  3OR5 A;  1NHY A;  5A5K A;  1FB6 A;  2CZ2 A;  2PGT A;  3BCK A;  4MLY A;  3GA4 A;  4GQF A;  1MEK A;  4KDY A;  1WPI A;  3KZQ A;  2HSH A;  4WR5 A;  4FH8 A;  2L6D A;  3VPQ A;  2KP2 A;  2NPB A;  3QOU A;  5A4W A;  4LA1 A;  2X99 A;  1WIK A;  3LJR A;  2C1Y A;  1GUH A;  2WZ9 A;  2QC7 A;  1SL1 B;  4YAP A;  2CA8 A;  1EV9 A;  5G5F A;  4NHZ A;  3HVS A;  1GSU A;  4BWS A;  4YKG A;  1TTZ A;  1M7T A;  1GTA A;  1K0N A;  4OWY A;  3IAM 2;  2K8S A;  4KDX A;  4MA9 A;  3CRU A;  3EIN A;  2LV3 A;  3IC4 A;  2LNT A;  1O73 A;  1T4Y A;  3FKF A;  4EIP A;  3IE3 A;  4D73 A;  2H0H A;  4I6X A;  4EF0 A;  1K0C A;  1EZK A;  3ME7 A;  2LQO A;  1HYU A;  1R5P A;  2LKU A;  5CNW A;  4QQ7 A;  2HE3 A;  2RUE A;  4IP1 A;  1ZYN A;  3HVV A;  4ZL9 A;  2C3T A;  4TXO B;  2GZY A;  1UA5 A;  4HUA A;  1MDK A;  3FZ9 A;  2OJL A;  1QMV A;  4HU7 A;  5A4U A;  1U3I A;  3KXO A;  4GCI A;  5DJL A;  3GH6 A;  2V6K A;  3QMX A;  4BVY B;  3WGD A;  5AN1 A;  2DC5 A;  3UAP A;  3EUR A;  2LS5 A;  1CQH A;  3TRQ A;  2WUL A;  3TKP A;  5LNK e;  3EC3 A;  3ZFL A;  1H4O A;  3A5I A;  1TKD B;  1PL2 A;  3KP9 A;  3EU4 A;  3TJJ A;  1N2A A;  1M9B A;  2M46 A;  4L5L A;  5FWG A;  2HYX A;  4F9Z A;  1OC9 A;  5ECM B;  1DE1 A;  1VGL A;  4NMU A;  5G2Z A;  2OE1 A;  3CSJ A;  3DVX A;  3MDK A;  2C3N A;  4J56 E;  4V2M A;  2C0G A;  4I2T A;  2JL4 A;  1A8Y A;  1MDI A;  4X1U A;  3VPT A;  3M9J A;  3IC8 A;  2NTO A;  3FYG A;  1Z6M A;  3QD9 A;  4ILF A;  4NV2 A;  3FRC A;  4KW6 A;  2VCX A;  2AJQ B;  1V98 A;  3RDW A;  1TRV A;  4NAX A;  2ZUP A;  1ZMA A;  3GMF A;  7GSS A;  5CRG A;  3UVH A;  5ECR B;  2HLS A;  4PNF A;  2NVL A;  3A2X A;  1A2L A;  1G7E A;  4LMV A;  1TK5 B;  5AIV A;  4PNG A;  4MJE A;  3F3Q A;  3VI7 A;  3FR9 A;  3KCM A;  2PUK C;  6GSX A;  1EOG A;  1SK0 A;  1TW9 A;  2R5G A;  1EGO A;  4KCE A;  2VLU A;  2JU5 A;  4TXV A;  4GF0 A;  3O6T A;  1GLP A;  3GKX A;  4KH7 A;  1NM3 A;  2A2P A;  4TR3 A;  1SKW B;  2CVD A;  2DJ3 A;  2O8V B;  2PVO C;  5B8A A;  1PSQ A;  5HR2 A;  1HQO A;  5C00 A;  5HQP A;  3DKS A;  1MTC A;  2H6Z A;  4POL A;  2VD0 A;  4WR4 A;  5ECK B;  2IJY A;  3RAZ A;  1F9M A;  3UBL A;  3GX0 A;  5DCG A;  5E4W A;  1G0T A;  3IXR A;  4GST A;  4EUY A;  3C1R A;  1OC8 A;  1VF1 A;  3US3 A;  1CQG A;  1F37 A;  3LOR A;  2AAW A;  2AHE A;  4BWQ A;  5D9T A;  3UL3 A;  2DBC A;  4EDZ A;  2YAN A;  4YH2 A;  1NW2 A;  3IDV A;  1UN2 A;  2X49 A;  4HDE A;  4PX1 A;  2FCH A;  1K3L A;  4EO3 A;  2CQ9 A;  4QL7 A;  4EVM A;  2IMI A;  2H72 A;  1W4V A;  1B4P A;  3ERG A;  4XS4 A;  1Y25 A;  3ME8 A;  4IEL A;  2MYG A;  1M2D A;  4X4J A;  3LQ7 A;  4AF2 A;  2GS3 A;  4DSR A;  2R2J A;  3RHB A;  4TR4 A;  1GTI A;  3H1N A;  3ZVJ A;  5BRT A;  2OKA A;  1PMT A;  1XFL A;  3GTU A;  3KJY A;  4K2D A;  1H75 A;  3FMW A;  3KMO A;  3Q18 A;  2QA2 A;  2FA8 A;  4ZB9 A;  3WGX A;  3QDN A;  1K0O A;  3NIV A;  4F0B A;  1GNE A;  4RI7 A;  1ZL9 A;  2V1M A;  4JU5 A;  2YWM A;  1YKA A;  1T4Z A;  2O85 A;  2CAI A;  4BL7 A;  3WGE A;  2PMT A;  3P2A A;  1FB0 A;  1FW1 A;  4ECB A;  3I69 A;  2DSA A;  2GZP A;  3NZN A;  2XPE A;  1U6T A;  3LSZ A;  3U5R E;  3KGK A;  2OBK A;  3VWV A;  1TU8 A;  2IL3 A;  2LST A;  10GS A;  3W8S A;  4XIH A;  5JCW A;  3TRP A;  2L4Q A;  2P0G A;  3M8N A;  5D9V A;  5IMA A;  3GV1 A;  3RPP A;  3D22 A;  4YAV A;  2WB9 A;  1BG5 A;  1F3B A;  2EC4 A;  3UVT A;  4JBB A;  4E8H A;  1GLQ A;  2XBQ A;  2R4V A;  1QUW A;  1UVZ A;  5JWQ B;  1QQ2 A;  4PTS A;  1SKS B;  2RUF A;  2YZH A;  3BCI A;  4L0W A;  3EU3 A;  5DBQ A;  4OD7 A;  4BVX B;  1FOH A;  1A2M A;  1WOU A;  4NXI A;  2H8L A;  1YQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...