1O6JA

Tryparedoxin ii from c.fasciculata solved by sulphur phasing
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
149
structure length
149
Chain Sequence
MSGLKKFFPYSTNVLKGAAADIALPSLAGKTVFFYFSASWCPPCRAFTPQLIDFYKAHAEKKNFEVMLISWDESAEDFKDYYAKMPWLALPFEDRKGMEFLTTGFDVKSIPTLVGVEADSGNIITTQARTMVVKDPEAKDFPWPNVEAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPAREDOXIN II
publication title De Novo Phasing of Two Crystal Forms of Tryparedoxin II Using the Anomalous Scattering from S Atoms: A Combination of Small Signal and Medium Resolution Reveals This to be a General Tool for Solving Protein Crystal Structures
pubmed doi rcsb
source organism Crithidia fasciculata
molecule tags Electron transport
total genus 46
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1o6jA00
2HRNA 2R6KA 4ZILA 4ZL9A 3ZFLA 1YKCA 1Z6MA 4XS4A 3VPTA 1GSQA 1GP1A 2X64A 2AB6A 4OCFA 1TKDB 1OC3A 1M2BA 2YWOA 2H1DA 3FRCA 4LL4B 3ERFA 4MH2A 3GNJA 4IVFA 1EV4A 1XZOA 4HZ4A 3ED3A 4L8EA 3WD6A 1TRVA 3P7XA 2O7KA 4IQ1A 1VF1A 4HUAA 2C0FA 3FW2A 1GUKA 3P90A 1PQNA 1DSBA 2HSHA 1XFLA 2FWEA 1GWCA 2GQKA 1SYXA 4TR1A 3FZ5A 3ZFBA 2RM5A 2VD1A 3KP9A 1Y6EA 1B9YC 2B1KA 3U5RE 4GXZA 1YJ6A 4G9HA 2WJUA 1BYEA 1UN2A 1K3YA 2OE1A 1WWJA 1X0RA 5ID2A 4WF4A 1XW9A 3D6IA 4IJIA 4GQCA 3KGKA 4XRAA 1HNAA 5DDLA 1M2AA 1ZMAA 16GSA 3TKPA 5IOXA 4BWQA 3GFKA 1LJRA 2NBSA 3GSTA 5J9BA 1F9MA 3IR4A 3TKQA 4EE0A 5GSSA 2AV4A 3C73A 2VCWA 2YNXA 1RK4A 1TRSA 2CX3A 3FKFA 3GH9A 2JACA 3Q74A 4KSOA 2GSRA 3L9SA 4JR6A 4MF7A 1A23A 3GHAA 1YF0A 2PVQA 1SK1A 4XS1A 4ZL8A 5EVOA 2YV9A 3IPZA 4MPGA 2CVBA 2LUSA 2C4JA 4MLYA 18GSA 5IM9A 1TK5B 3TJJA 6GSSA 2GZYA 4ECBA 2I3YA 2WRTA 3H4KA 2XPEA 3L9VA 3I69A 1SL2B 5JCWA 5FWGA 1JLVA 5FHIA 5GZZB 5G2ZA 1XW6A 4V1Ag 1PX6A 5IMDA 5CRWA 1Z9HA 3FR3A 2JZSA 4GSSA 3UEMA 3HYPA 2R4VA 3CSJA 1PX7A 3QMXA 4Z7XA 5KN0A 1V57A 2H8LA 1PL2A 2GZZA 7GSSA 5DBQA 3APOA 2B1LA 3HVXA 5DVBA 4K7NA 4BA7A 3QCPA 3HA9A 3SWLA 3F6DA 5EPFA 1FAAA 3KM6A 1UC7A 3ZVJD 2FWGA 2CQ9A 2IMEA 2M80A 3IAS2 1URMA 2B7KA 1DBYA 4LA1A 1LBKA 4IW9A 2VO4A 2LQQA 1Z7PA 1W89A 1ZYEA 3G7YA 2CVKA 1ILOA 3LFLA 2VCTA 1O6JA 2FHEA 1XOAA 5B7CA 3VWWA 4HDEA 4YQVA 3FR6A 2LEGA 1TI3A 4IP1A 2GT6A 5ECRB 1SK2A 2PU9C 3ERWA 2PMTA 3O6TA 2L59A 3WGXA 4JE1A 1AQWA 1AAZA 5KN1A 4JR4A 4ULXA 1RW1A 2YWNA 1MD3A 2GDRA 1Y25A 3DXBA 2V32A 4TOPA 3BD2A 4KDYA 2TRCP 2FA8A 2QSIA 1WJKA 1HQOA 4HU7A 4KW6A 4KCAA 2H1GA 5H5RA 2K6VA 3PR8A 4KB3A 1UA5A 3GKXA 3DWVA 3VI7A 1GSFA 1X9MB 3BOAA 5E59A 5ELAA 4DSSB 3UAPA 2V1MA 4GLTA 1J9BA 4HOJA 4PURA 2HNLA 2DIYA 2KHPA 2FCHA 2PUKC 1BJXA 2XPDA 2EC4A 3LYPA 4K6XA 3EURA 5AISA 3EE2A 1YEPA 3MAKA 1FB0A 2KLXA 4XIHA 3V1WA 1M2DA 3TOTA 2I9HA 1IYHA 2L5LA 4ZBDA 1SD9A 3TGZA 4EO3A 3LGCA 2QKEA 3QFAC 4MMMA 3BCKA 4ZXGA 4EDYA 2O87A 2VD0A 3CTGA 3UOMA 2H01A 3VLNA 2A2RA 3KXOA 1FVKA 2PGTA 5E4WA 1M9BA 4F9ZA 2L57A 3IC4A 6GSXA 2DJ2A 1WMJA 2LKUA 4JU5A 2VL2A 2EIQA 3RHBA 3GKMA 4PUFC 2C0GA 5H5SA 3D0ZA 4JRRA 1ZZYA 3J7Yk 5DJMA 3CSIA 4N30A 2LJAA 4FIWA 3RAZA 4MF5A 3RHCA 1KTEA 2H75A 4YAPA 4JEDA 1U87A 2B5YA 2HYXA 1O8XA 2VCXA 2MMAA 1TP9A 4XCSA 2HLSA 2C80A 2IFQB 3QAWA 1U6TA 2REMA 3IXRA 3WYWA 1O81A 1AUCA 4PNGA 5IMZA 2H66A 4K7OA 3GURA 5J41A 4MK3A 1R26A 2E2GA 1ERUA 3HXSA 3L4NA 3NZNA 3LJRA 2CZ3A 2XBQA 6GSYA 5IO2A 1BQ7A 1BAYA 1EGOA 2DJ0A 3EINA 3DEXA 2VL3A 1A2JA 4GSTA 1E6BA 6GSVA 2HZFA 1GRXA 2CA8A 3IA1A 1U3AA 1AQXA 1SL0B 3QDNA 5ECOB 1THOA 2JADA 1Z6NA 4I97A 4N0VA 4IBPA 5GSTA 4TR3A 4X43A 1G7OA 4LMVA 5CRDA 2JSYA 2LNSA 4YQMA 1F3BA 2VL9A 5HR3A 2NVLA 1MDJA 1EP7A 3WT2A 2IN3A 5IMAA 3HJPA 3F63A 3H1NA 20GSA 5ECHB 2TRXA 4RI7A 22GSA 2HE3A 1TK8B 2YOIA 1OVNA 2H6YA 3K8NA 1THXA 4MCUA 4H86A 3RPPA 3ZITA 10GSA 2YV7A 4MF6A 1JZDA 5IQYA 4MJEA 1ZL9A 1SJZA 3MDKA 1WOUA 3I9V2 1QXHA 1X5DA 1R5PA 1OC9B 2PVOC 1T4YA 3KD0A 3GUSA 2FLSA 4O92A 3GV1A 4XS4B 4ZB6A 1G6YA 2AYTA 2VLVA 3GH6A 3GKNA 1GH2A 4L0UA 5IMVA 1S3DA 1FG4A 1PKWA 4KDUA 1O73A 1K0OA 3W8JA 1Z5YE 4X1UA 4HQSA 1SKSB 2AAWA 6GSUA 5D8IA 2ZNMA 1X9WB 3TUEA 4KE3A 1K0NA 2P0GA 3FR9A 1KNGA 4TW5A 1K0BA 4KDXA 1T1VA 1VF4A 2N5AA 2MBSA 4IGJA 5L71A 1O85A 1N8JA 1PSQA 3TRPA 2GQLA 2F8AA 5DQYA 3DVWA 3QFBC 1ACVA 3ISOA 3US3A 4TR1B 3A5WA 4PUAA 3GKKA 1TOFA 4YH2A 2LS5A 3CRUA 2JZTA 2P31A 2YWMA 3C71A 2PPTA 1WRYA 4NPBA 2K8SA 4ILFA 4EL1A 4F03A 1KEBA 1G0TA 2J9HA 5J3RA 1XIYA 3EC3A 5ID2B 3TKSE 11GSA 4DSQA 2E0QA 2E7PA 4MJBA 2H70A 2DMLA 1K0AA 1RQMA 4O7HA 4K2DA 2LJKA 2DSAA 1YEXA 2CT6A 4D73A 4IN0A 3KIJA 1SD8A 1Z7RA 5D73A 2X8HA 2I1UA 1MEKA 2HZEA 2DC5A 3KZQA 1EGRA 2YWIA 1A2MA 2O89A 1B4PA 5CRHA 1U3IA 4BPYA 2V41A 4MJAA 2YP6A 3DYRA 2L4QA 1YF1A 3A3TA 1V98A 2OA7A 1DE2A 2XBIA 2OKAA 3QD9A 2PBJA 2GSQA 4WKWA 5FT3A 3RPNA 4ID0A 3VWUA 3D4TA 2AJQB 2C8UA 5IMCA 1HNBA 2QGVA 4HU9A 1JHBA 3TKSA 1GTIA 3M0FA 2ON7A 2RUEA 5D9WA 3F4RA 5HQPA 3A2XA 5KEJA 1NSWA 2VLTA 3L78A 2L5OA 4V1Ap 4EF0A 4MZCA 4MDCA 2OJLA 1AW9A 2FWHA 1T7PB 1ZGNA 2MMNA 4I2TA 3GTUA 1R4WA 1B48A 2GVPA 3DVXA 4IS0A 19GSA 4OFMA 1QGVA 4KSMA 1SU9A 3N5OA 2H74A 1BX9A 5LD0A 4NV2A 1EZKA 3D5JA 1GSYA 3OR5A 3KTBA 3CBUA 4FYBA 2LNTA 5DCHA 3C8EA 4TVEA 1FO5A 4KA0A 1XWAA 2VL2C 4LL1B 1HD2A 5J5NA 2CAQA 2J23A 2ES7A 1V2AA 3D21A 3JCML 2IJYA 5CNWA 3ZLPA 1MDIA 5JWRB 1GSSA 4MABA 2JZRA 2M46A 3QAVA 4Q5QA 3NIVA 2CX4A 2LSTA 1OE8A 4V2MA 2O8VB 1SJ6A 1WE0A 2YZHA 5F0GA 1QQ2A 1G6WA 3UBKA 2DJ3A 3IAM2 4IQAA 4J56E 1ZOFA 4P3YB 4WXTA 3DIEA 2AUVA 4OMVA 1TXXA 1TW9A 3W8SA 4E8EA 1OAZA 1Q4JA 5C00A 1TI1A 3HCZA 1JZWA 4N11A 2CVDA 3G7JA 2XHFA 3U6VA 4HZ2A 1CQGA 1V9WA 2GSSA 4WEYA 4F0BA 2GZPA 3GN3A 1M7TA 4MPFA 2VCZA 4PQIA 1R5AA 3F6FA 2L6CA 3KCMA 1A24A 3LXTA 3A2VA 3TDGA 1PD21 3QAGA 3Q18A 1PN9A 1NW2A 1HYUA 2P5RA 5G1LA 4OO5A 1X5EA 3M8NA 4CHSA 1GL8A 2FWFA 1SL1B 1B4QA 4PXOA 4NMUA 4I6XA 6GSWA 3DRNA 4WBRD 4HI7A 3LXZA 4F0CA 1EV9A 2DMMA 1E2YA 2VIMA 4X0XA 1G7EA 1NHYA 1GTBA 3MWHA 4OFTA 5ELGA 2X8CA 1Q98A 5B6MA 1YDKA 2R5GA 3F8UA 3F9UA 2N5FA 4TKYA 1VRSD 5ECKB 5F06A 5J4UA 4ZIJA 2GQMA 4YQUA 2IWTA 3I43A 2QC7A 1A8LA 5JWOB 2WS2A 4G2EA 4V2NA 1ERTA 1TU8A 4QQ7A 2H72A 2IPAA 3S9FA 1GLQA 3LWAA 2GSTA 2VOCA 5ECMB 4MH3A 3F0IA 1FW1A 3H8QA 3TJBA 4GCIA 4WBJA 5D93A 3RDWA 4KAEA 3O76A 4Q5FA 3CMIA 1WIKA 3VFIA 4WF5A 4OD7A 1K3OA 3PH9A 3GL5A 2OACA 3GIXA 5AIVA 2IMKA 3CYNA 3F3QA 1XW5A 4MP4A 3HZ4A 2G0FA 5IPHA 2C0EA 1F37A 3ZIJA 1GSEA 2L4CA 3EVIA 2F51A 2EIRA 2H71A 1FHEA 3IDVA 4K9ZA 3HVSA 1V40A 5D9TA 3M3MA 1CQHA 1O8WA 5ECSA 2NDOA 4DVCA 4NV5A 2B7JA 4LMWA 4XRDA 2K18A 2IL3A 2KUCA 3FHKA 4KGIA 4DEJA 2F3MA 1ERVA 1B9XC 2F9SA 2GT5A 4MZWA 5ECNB 4RQRA 3EU4A 17GSA 5ECLB 4KH7A 4EXJA 2IMFA 2H0IA 3QOUA 4XS6A 1K0CA 1PRXA 4FH8A 5G5FA 5D96A 5EY6A 4GF0A 1V58A 2C3NA 5ENUA 2H6XA 5DAKA 1WP0A 2PERA 3FK8A 1R7HA 3QPMA 4K0GA 1W4VA 5J9CA 3G7IA 2H6ZA 2JSZA 2RIIA 1M99A 2CAIA 3IK7A 3ZVJA 4OO4A 4FYCA 2RM6A 3L0HA 2A4VA 3BJ5A 1FVJA 3UL3A 1AC1A 2IIYA 3C1RA 2CV4A 4ML6A 4TRXA 4K1FA 5CRGA 1J0FA 1FB6A 2YPMA 4N10A 2B3SA 3GYKA 4EDZA 3EMXA 4FYUA 3EWLA 2HRFA 2LRNA 2OBIA 5ECQB 2YANA 4MJCA 1XVQA 3GX0A 1USBA 2WFCA 4IHUA 4PNFA 3KJYA 3TKSC 1OKTA 4Q5NA 1YKAA 3ME8A 4PGTA 13GSA 4ZB8A 2G2QA 3J7Yb 1GTUA 2DBCA 3QR6A 2YZUA 2H0HA 5KN3A 1T4ZA 1T00A 3VURA 3UIWA 3UVTA 1M9AA 3APQA 3EYTA 1JLWA 1PL1A 2OADA 4LLRA 4EC0A 3TJFA 2X99A 4TN8A 4EUYA 2F8FA 3ERGA 1GLPA 3HHVA 1XXUA 3HD5A 1XBSA 3UMAA 4ML1A 5A5KA 2KOKA 5LNKe 4BL7A 3UVHA 2LTKA 5IMFA 4ZB9A 2C0DA 1IYIA 2LRTA 4I2UA 4ACSA 2V6OA 6GSTA 2A2SA 2OE3A 5AIXA 2RLIA 3VWXA 1PKZA 1YY7A 5A4WA 1A0FA 3LORA 2P5QA 2BTOT 4AJ8A 4K0NA 3E0UA 2K9FA 2FUG2 1T3BA 4QL9A 4TR0A 2R2JA 1MTCA 5DJLA 3KMOA 1NM3A 2WZ9A 4D73B 3DGQA 3IHQA 3LYKA 4BVXA 4CW9A 1A8YA 1J08A 3IRAA 1PGTA 2HZEB 4I8BA 2M72A 1BG5A 5CREA 5CYYA 4K8MA 4KX4A 2VLUA 3VI5A 4NHZA 5DALA 2FGXA 1SJIA 2VAFA 4TXOB 2H0GA 1UVZA 3C1SA 2DIZA 2YJHA 5F05A 2DJKA 2BJXA 2MZCA 1SYRA 2VCVA 3P8WA 3SBCA 3FZ9A 4NHWA 2LV3A 3ZMLA 8GSSA 4ECJA 2KP1A 5G1KA 3H79A 4NXIA 4TXOA 5F8BA 1WPIA 2OBKA 2WCIA 5ABRA 2D2ZA 2WULA 2WDUA 1I9DA 4I5QA 2V6KA 2R37A 1VF3A 2I4AA 3GTUB 2YCDA 3HZ8A 2H1BA 3FZAA 3IV4A 5JCUA 4L5OA 5B8BA 1GUHA 2XC2A 1NHOA 3O3TA 2GGTA 4KNDA 5H5QA 2ZCTA 2H73A 3VK9A 1EWXA 1MD4A 2H19A 4OWYA 5A4VA 1TK0B 4Q5RA 4YAVA 4OFNA 1JZOA 3R2QA 1ST9A 3AY8A 1QMVA 2MMZA 3LSZA 3UBLA 4BVYA 3M9JA 2HI7A 3CRTA 9GSSA 4RQXA 5GAPD 3PGTA 3EU3A 1XCCA 2NTOA 4WETA 3C7MA 1F6MC 1QFNA 3ZYWA 3TCOA 3GSSA 3TJGA 1XOBA 1OC8A 4DSRA 2ZUPA 4GRFA 5LCZA 3ZMKA 3FZ4A 4PX1A 1T8EB 3UJ1A 4ZBAA 2X8GA 4EKZA 4OCEA 2ON5A 1PMTA 5HFKA 4KUNA 3APSA 1QK8A 2C1YA 3NOFA 5DCGA 4IKHA 2GS3A 1H75A 1LU4A 3KH7A 4E8HA 3DKSA 4RI6A 5G5EA 3MSZA 1GUMA 2YJ7A 1K3LA 3ZRDA 1U88A 2WGRA 4HQZA 4O5RA 3DMLA 4POBA 3TRXA 2LRCA 2VUPA 1SKWB 3G9BA 1EEJA 4ECIA 1F2EA 2WB9A 4J2FA 2E2MA 4JZQA 3HKRA 1EEMA 3L9UA 5GAND 1TRUA 3P2AA 2FD3A 1GTAA 4O32A 1BEDA 3ZTLA 1XWGA 5CAXA 5G31A 4ECCA 3HJMA 3F4TA 4XHMA 4TXVA 1M0UA 3MNGA 1ZYQB 2C3QA 3Q19A 1X9SB 4GWRA 1XWKA 2FNOA 3VPQA 3IE3A 3F3RA 3EMPA 1DUGA 5KN2A 1GULA 4ZL7A 5IOWA 4TR4A 3I6AA 2I81A 3FYGA 2PN8A 1TRWA 3VWVA 4V2LA 2HSYA 2MBTA 2NPBA 4F82A 2OE0A 3LG6A 4AJ6A 3M9KA 5A4UA 2H1AA 3ZREA 5B6NA 3BBYA 1N2AA 5JCGA 1PA3A 4G19A 1K0DA 3ZZXA 5CO3A 1S3AA 3WGEA 1HNCA 4MZBA 4QL7A 2GLRA 4WR5A 4ISDA 2AHEA 1GNWA 1YQ1A 3GX8A 4DSSA 5HR1A 4GTUA 1MDKA 3E3EA 4MA9A 4ZBBA 3TRQA 1ABAA 4HS1A 5HFIA 1ML6A 1O7UA 5EL8A 1QUWA 3HJOA 1AIUA 2Z9SA 1A0RP 2VM1A 2CZ2A 5ECPB 3HY2A 1AQVA 4WR4A 4HEA2 2N5BA 5AN1A 5DAKB 5ECIB 12GSA 3F4SA 4K7IA 1XPVA 3LEFA 4AF2A 2HXKA 14GSA 4XTSA 3ZIVA 3WGDA 4RUVA 3GL3A 2C3TA 4N0ZA 3D22A 1TDIA 3UARA 1OKDA 5IPGA 3W6GA 1JZRA 3KP8A 2H76A 3TOUA 3IK9A 1A2LA 1KBNA 3HDCA 4HJ2A 2DJJA 3KTLA 1DE1A 2IMIA 3KEBA 3GRXA 1X5CA 2B5XA 5HFGA 2VCQA 4L5LA 1K0MA 3TJKA 4EVMA 4F2IA 4PQHA 4CDOA 3H93A 2VM2A 1OE7A 3BCIA 3ZL5A 5G30A 5F07A 4NWYA 3PINA 3LQ7A 2MYGA 2JU5A 4BWSA 1GSDA 1TU7A 5HR0A 2DJ1A 2GTUA 4POLA 2B6MA 1VGLA 2O85A 3DD3A 1TJDA 3GMFA 1OYJA 4NAXA 2IFQA 2HFDA 1SENA 3ME7A 2MMOA 5COHA 4GSNA 1GNEA 4JBBA 1EOHA 1FOVA 2LQOA 3D4MA 2HT9A 1Z3EA 5DQSA 3A2WA 1B8XA 1XWCA 3GA4A 1JFUA 3RBTA 4KCEA 1EP8A 1SK0A 5INYA 3WT1A 5IIZA 3M1GA 3FEUA 3TKRA 4IP6A 1GSUA 2TIRA 1ERWA 3N9JA 3KMNA 2L6DA 5B8AA 4GQFA 4PQ1A 4G10A 2BMXA 3HVVA 1YZXA 2V2GA 5AGYA 2R3XA 1SKRB 2JL4A 5D9VA 2FA4A 4FO5A 1F3AA 4IJ3A 5D9XA 4L0WA 4AJ7A 4AGSA 3Q6OA 2ALBA 5JWQB 1ON4A 2PWJA 5CP1A 4J57E 3IOSA 3E9JB 3IBHA 2YN1A 1XWBA 1EOGA 3CSHA 5HR2A 2DLXA 2LJRA 5C04A 1TTZA 2H30A 1VF2A 2B5EA 2IMDA 2K8VA 3TB2A 4HJMA 1S3CA 2EIOA 4POMA 1H4OA 2RUFA 1XVWA 1AXDA 3CXGA 5IO0A 1ZCPA 4POKA 1C72A 2FY6A 4IELA 5DALB 3FY7A 3CTFA 3KH9A 1OC9A 1I5GA 2KP2A
chains in the Genus database with same CATH superfamily
2HRNA 2R6KA 4ZILA 4ZL9A 3ZFLA 1YKCA 1Z6MA 4XS4A 3VPTA 1GSQA 1GP1A 2X64A 2AB6A 4OCFA 1TKDB 1OC3A 1M2BA 2YWOA 2H1DA 3FRCA 4LL4B 3ERFA 4MH2A 3GNJA 4IVFA 1EV4A 1XZOA 4HZ4A 3ED3A 4L8EA 3WD6A 1TRVA 3P7XA 2O7KA 4IQ1A 1VF1A 4HUAA 4KF9A 2C0FA 3FW2A 1GUKA 3P90A 1PQNA 1DSBA 2HSHA 1XFLA 2FWEA 1GWCA 2GQKA 1SYXA 4TR1A 3FZ5A 3ZFBA 2RM5A 2VD1A 3KP9A 1Y6EA 1B9YC 2B1KA 3U5RE 4GXZA 1YJ6A 4G9HA 2WJUA 1BYEA 1UN2A 1K3YA 2OE1A 2QA2A 1WWJA 1X0RA 5ID2A 4WF4A 1XW9A 3D6IA 4IJIA 4GQCA 5KOXA 3KGKA 4XRAA 1HNAA 5DDLA 1M2AA 1ZMAA 16GSA 3TKPA 5IOXA 4BWQA 3GFKA 1LJRA 4BVYB 2NBSA 3GSTA 5J9BA 1F9MA 3IR4A 3TKQA 4EE0A 5GSSA 2AV4A 3C73A 2VCWA 2YNXA 1RK4A 1TRSA 2CX3A 3FKFA 3GH9A 2JACA 3Q74A 4KSOA 2GSRA 3L9SA 4JR6A 4MF7A 1A23A 3GHAA 1YF0A 2PVQA 1SK1A 4XS1A 4ZL8A 5EVOA 2YV9A 3IPZA 4MPGA 2CVBA 2LUSA 2C4JA 4MLYA 18GSA 5IM9A 4BIKA 1TK5B 3TJJA 6GSSA 2GZYA 4ECBA 2I3YA 2WRTA 3H4KA 2XPEA 3L9VA 4G0LA 3I69A 1SL2B 5JCWA 5FWGA 1JLVA 5FHIA 5GZZB 5G2ZA 1XW6A 4V1Ag 1PX6A 5IMDA 5CRWA 1Z9HA 3FR3A 2JZSA 4GSSA 3UEMA 3HYPA 2R4VA 3CSJA 1PX7A 3QMXA 4Z7XA 5KN0A 1V57A 2H8LA 4K5SA 1PL2A 2GZZA 7GSSA 5DBQA 3APOA 2B1LA 3HVXA 5DVBA 4K7NA 4BA7A 3QCPA 3HA9A 3SWLA 3F6DA 5EPFA 1FAAA 3KM6A 1UC7A 3ZVJD 2FWGA 2CQ9A 2IMEA 2M80A 3IAS2 1URMA 2B7KA 1DBYA 4LA1A 1LBKA 4IW9A 2VO4A 2LQQA 1Z7PA 1W89A 1ZYEA 3G7YA 2CVKA 1ILOA 3LFLA 2VCTA 1O6JA 2FHEA 1XOAA 5B7CA 3VWWA 4HDEA 4YQVA 3FR6A 2LEGA 1TI3A 4IP1A 2GT6A 5ECRB 1SK2A 2PU9C 3ERWA 2PMTA 2QA1A 3O6TA 2L59A 3WGXA 4JE1A 1AQWA 1AAZA 5KN1A 4JR4A 4ULXA 1RW1A 2YWNA 1MD3A 2GDRA 1Y25A 3DXBA 2V32A 4TOPA 3BD2A 4KDYA 2TRCP 2FA8A 2QSIA 1WJKA 1HQOA 4HU7A 4KW6A 4KCAA 2H1GA 5H5RA 3CQFA 2K6VA 3PR8A 4KB3A 1UA5A 3GKXA 3DWVA 3VI7A 1GSFA 1X9MB 3BOAA 5E59A 5ELAA 4DSSB 3UAPA 2V1MA 3FMWA 4GLTA 1J9BA 4HOJA 4PURA 2HNLA 2DIYA 2KHPA 2FCHA 2PUKC 1BJXA 2XPDA 2EC4A 3LYPA 4K6XA 3EURA 5AISA 3EE2A 1YEPA 3MAKA 3HVNA 1FB0A 2KLXA 4XIHA 3V1WA 1M2DA 3TOTA 2I9HA 1IYHA 2L5LA 4ZBDA 1SD9A 3TGZA 4EO3A 3LGCA 2QKEA 3QFAC 4MMMA 3BCKA 4ZXGA 4EDYA 2O87A 2VD0A 3CTGA 3UOMA 2H01A 3VLNA 2A2RA 3KXOA 1FVKA 2PGTA 5E4WA 1M9BA 4F9ZA 2L57A 3IC4A 6GSXA 2DJ2A 1WMJA 2LKUA 4JU5A 2VL2A 2EIQA 3RHBA 3GKMA 4PUFC 2C0GA 5H5SA 3D0ZA 4JRRA 1ZZYA 3J7Yk 5DJMA 3CSIA 5BRTA 4N30A 2LJAA 4FIWA 3RAZA 4MF5A 3RHCA 1KTEA 2H75A 4YAPA 4JEDA 1U87A 2B5YA 2HYXA 2R0GA 1O8XA 2VCXA 2MMAA 1TP9A 4XCSA 2HLSA 2C80A 2IFQB 3QAWA 1U6TA 2REMA 3IXRA 3WYWA 1O81A 1AUCA 4PNGA 5IMZA 2H66A 4K7OA 3GURA 5J41A 4MK3A 1R26A 1FOHA 2E2GA 1ERUA 3HXSA 3L4NA 3NZNA 3LJRA 2CZ3A 2XBQA 6GSYA 5IO2A 1BQ7A 1BAYA 4Z2TA 1EGOA 2DJ0A 3EINA 3DEXA 2VL3A 1A2JA 4GSTA 1E6BA 6GSVA 2HZFA 1GRXA 2CA8A 3IA1A 1U3AA 1AQXA 1SL0B 3QDNA 5ECOB 1THOA 2JADA 1Z6NA 4I97A 4N0VA 4IBPA 1PFOA 3MYDA 5GSTA 4TR3A 4X43A 1G7OA 4LMVA 5CRDA 2JSYA 2LNSA 4YQMA 1F3BA 2VL9A 5HR3A 2NVLA 1MDJA 1EP7A 3WT2A 2IN3A 5IMAA 3HJPA 3F63A 3H1NA 20GSA 5ECHB 4FQUA 2TRXA 4RI7A 22GSA 2HE3A 1TK8B 2YOIA 1OVNA 2H6YA 3K8NA 1THXA 4MCUA 4H86A 3RPPA 3ZITA 10GSA 2YV7A 4MF6A 1JZDA 5IQYA 4MJEA 1ZL9A 1SJZA 3MDKA 1WOUA 3I9V2 1QXHA 1X5DA 1R5PA 1OC9B 2PVOC 1T4YA 3KD0A 3GUSA 2FLSA 4O92A 4YKGA 3GV1A 4XS4B 4ZB6A 1G6YA 4G0KA 2AYTA 2VLVA 3GH6A 3GKNA 1GH2A 4L0UA 5IMVA 1S3DA 1FG4A 1PKWA 4KDUA 1O73A 1K0OA 4EIPA 1M3JA 3W8JA 1Z5YE 4X1UA 4HQSA 1SKSB 2AAWA 6GSUA 5D8IA 2ZNMA 1X9WB 3TUEA 4KE3A 1K0NA 2P0GA 3FR9A 4A5PA 1KNGA 4TW5A 1K0BA 4KDXA 1T1VA 1VF4A 2N5AA 2MBSA 4IGJA 5L71A 1O85A 1N8JA 1PSQA 3TRPA 2GQLA 2F8AA 5DQYA 3DVWA 3QFBC 1ACVA 4O5QA 3ISOA 3US3A 4TR1B 3A5WA 4PUAA 3GKKA 1TOFA 4YH2A 2LS5A 3CRUA 2JZTA 2P31A 2R0PA 2YWMA 3C71A 2PPTA 1WRYA 4NPBA 2K8SA 4ILFA 4EL1A 4F03A 1KEBA 1G0TA 2J9HA 5J3RA 1XIYA 1M3IA 3EC3A 5ID2B 3TKSE 11GSA 4DSQA 2E0QA 2E7PA 4MJBA 2H70A 2DMLA 1K0AA 1RQMA 4O7HA 4K2DA 2LJKA 2DSAA 1YEXA 2CT6A 4D73A 4IN0A 3KIJA 1SD8A 1Z7RA 2DKIA 5D73A 2X8HA 2I1UA 1MEKA 2HZEA 2DC5A 3KZQA 1EGRA 2YWIA 1A2MA 2O89A 1B4PA 5CRHA 1U3IA 4BPYA 2V41A 4MJAA 2YP6A 3DYRA 2L4QA 1YF1A 3A3TA 1V98A 2OA7A 1DE2A 2XBIA 2OKAA 3QD9A 2PBJA 2GSQA 4WKWA 5FT3A 3RPNA 3LW9A 4ID0A 3VWUA 3D4TA 2AJQB 2C8UA 5IMCA 1HNBA 2QGVA 4HU9A 1JHBA 3TKSA 1GTIA 3M0FA 2ON7A 2RUEA 2HRAA 4YKFA 5D9WA 3F4RA 5HQPA 3A2XA 5KEJA 1NSWA 2VLTA 3L78A 2L5OA 4V1Ap 4EF0A 4MZCA 4MDCA 2OJLA 1AW9A 2FWHA 1T7PB 1ZGNA 2MMNA 4I2TA 3GTUA 1R4WA 1B48A 2GVPA 3DVXA 4IS0A 19GSA 4OFMA 1QGVA 4KSMA 1SU9A 3N5OA 2H74A 1BX9A 5LD0A 4NV2A 1EZKA 3D5JA 1GSYA 3OR5A 3KTBA 3CBUA 4FYBA 2LNTA 5DCHA 3C8EA 4TVEA 1FO5A 4KA0A 1XWAA 2VL2C 2X49A 4LL1B 1HD2A 5J5NA 2CAQA 2J23A 2ES7A 1V2AA 3D21A 3JCML 2IJYA 5CNWA 3ZLPA 1MDIA 5JWRB 1GSSA 4MABA 2JZRA 2M46A 3QAVA 4Q5QA 3NIVA 2CX4A 2LSTA 1OE8A 4V2MA 2O8VB 1SJ6A 1WE0A 2YZHA 5F0GA 1QQ2A 1G6WA 3UBKA 2DJ3A 3IAM2 4IQAA 4J56E 1ZOFA 4P3YB 4WXTA 3DIEA 2AUVA 4OMVA 1TXXA 1TW9A 3W8SA 4E8EA 1OAZA 1Q4JA 5C00A 1TI1A 3HCZA 1JZWA 4N11A 2CVDA 2HSMA 3G7JA 2XHFA 3U6VA 4HZ2A 1CQGA 1V9WA 2GSSA 4WEYA 4F0BA 2GZPA 3GN3A 1M7TA 4MPFA 2VCZA 4PQIA 1R5AA 3F6FA 2L6CA 3KCMA 1A24A 3LXTA 3A2VA 3TDGA 1PD21 3QAGA 3Q18A 1PN9A 1NW2A 1HYUA 2P5RA 5G1LA 4OO5A 1X5EA 3M8NA 4CHSA 1GL8A 2FWFA 1SL1B 1B4QA 4PXOA 4NMUA 4I6XA 6GSWA 3DRNA 4WBRD 4HI7A 3LXZA 4F0CA 2HRKA 1EV9A 2DMMA 1E2YA 2VIMA 4X0XA 1G7EA 1NHYA 1GTBA 3MWHA 4OFTA 5ELGA 2X8CA 1Q98A 5B6MA 1YDKA 2R5GA 3F8UA 3F9UA 2N5FA 4TKYA 1VRSD 5ECKB 5F06A 5J4UA 4ZIJA 2GQMA 4YQUA 2IWTA 3I43A 2QC7A 1A8LA 5JWOB 2WS2A 4G0IA 4G2EA 4V2NA 1ERTA 1TU8A 4QQ7A 1ZYNA 2H72A 2IPAA 3S9FA 1GLQA 3LWAA 3R3EA 2GSTA 2VOCA 5ECMB 4MH3A 3F0IA 1FW1A 3H8QA 3TJBA 4GCIA 4WBJA 5D93A 3RDWA 4KAEA 3O76A 4Q5FA 3CMIA 1WIKA 3VFIA 4WF5A 4OD7A 1K3OA 3PH9A 3GL5A 2OACA 3GIXA 5AIVA 2IMKA 3CYNA 3F3QA 1XW5A 4MP4A 3HZ4A 2G0FA 5IPHA 2C0EA 1F37A 3ZIJA 1GSEA 2L4CA 3EVIA 2F51A 2EIRA 1PN0A 1FHEA 2H71A 3IDVA 4K9ZA 3HVSA 1V40A 5D9TA 3M3MA 1CQHA 1O8WA 5ECSA 2NDOA 4DVCA 4NV5A 2B7JA 4LMWA 4XRDA 2K18A 2IL3A 2KUCA 3FHKA 4KGIA 4DEJA 2F3MA 1ERVA 1B9XC 2F9SA 2GT5A 4MZWA 5ECNB 4ICYA 4RQRA 3EU4A 17GSA 5ECLB 4KH7A 4EXJA 2IMFA 2H0IA 3QOUA 4XS6A 1K0CA 1PRXA 4FH8A 5G5FA 5D96A 5EY6A 4GF0A 1V58A 2C3NA 5ENUA 2H6XA 5DAKA 1WP0A 2PERA 3FK8A 1R7HA 3QPMA 4K0GA 1W4VA 5J9CA 2X4AA 3G7IA 4K2XA 2H6ZA 2JSZA 4EIQA 2RIIA 1M99A 2CAIA 3IK7A 3ZVJA 4OO4A 4FYCA 2RM6A 3L0HA 2A4VA 3BJ5A 1FVJA 3UL3A 4K5RA 1AC1A 2IIYA 3C1RA 2CV4A 4ML6A 4TRXA 4K1FA 5CRGA 3EPTA 1J0FA 1FB6A 2YPMA 4MNNA 4N10A 2B3SA 3GYKA 4EDZA 3EMXA 4FYUA 3EWLA 2HRFA 2LRNA 2OBIA 5ECQB 2YANA 4MJCA 1XVQA 3GX0A 1USBA 2WFCA 4IHUA 4PNFA 3KJYA 3TKSC 1OKTA 4Q5NA 1YKAA 3ME8A 4PGTA 13GSA 4ZB8A 2G2QA 3J7Yb 1GTUA 2DBCA 3QR6A 2YZUA 2H0HA 5KN3A 5KOWA 1T4ZA 1T00A 3VURA 1S3RA 3UIWA 3UVTA 1M9AA 3APQA 3EYTA 1JLWA 1PL1A 2OADA 4LLRA 4EC0A 3TJFA 2X99A 4TN8A 4EUYA 3IC8A 2F8FA 3ERGA 1GLPA 3HHVA 1XXUA 3HD5A 1XBSA 3UMAA 4ML1A 5A5KA 2KOKA 4Z2RA 5LNKe 4BL7A 3UVHA 2LTKA 5IMFA 4ZB9A 2C0DA 1IYIA 2LRTA 2UZ8A 4I2UA 4ACSA 2V6OA 6GSTA 2A2SA 2OE3A 5AIXA 2RLIA 3VWXA 1PKZA 1YY7A 5A4WA 1A0FA 3LORA 2P5QA 2BTOT 4AJ8A 4K0NA 3E0UA 2K9FA 2FUG2 1T3BA 4QL9A 4TR0A 2R2JA 1MTCA 5DJLA 3KMOA 1NM3A 2WZ9A 4D73B 3DGQA 3IHQA 3LYKA 4BVXA 4CW9A 1A8YA 1J08A 3IRAA 1PGTA 2HZEB 4I8BA 2M72A 1BG5A 5CREA 5CYYA 4K8MA 4KX4A 2VLUA 3VI5A 4NHZA 5DALA 2FGXA 1SJIA 2VAFA 4TXOB 2H0GA 1UVZA 3C1SA 2DIZA 2YJHA 5F05A 2DJKA 2BJXA 2MZCA 1SYRA 2VCVA 3P8WA 3SBCA 3FZ9A 4NHWA 2LV3A 3ZMLA 8GSSA 4ECJA 2KP1A 5G1KA 3H79A 4NXIA 4TXOA 5F8BA 1WPIA 2OBKA 2WCIA 5ABRA 2D2ZA 2WULA 4USSA 2WDUA 1I9DA 4I5QA 2V6KA 2R37A 1VF3A 2I4AA 3GTUB 2YCDA 3HZ8A 2H1BA 3FZAA 3IV4A 5JCUA 4L5OA 5B8BA 1GUHA 2XC2A 1NHOA 4HSCX 3O3TA 2GGTA 4KNDA 5H5QA 2ZCTA 2H73A 3VK9A 1EWXA 1MD4A 2H19A 4OWYA 5A4VA 1TK0B 4Q5RA 4YAVA 4OFNA 1JZOA 3R2QA 1ST9A 3A5IA 3AY8A 1QMVA 2MMZA 3LSZA 3UBLA 4BVYA 3M9JA 2HI7A 3CRTA 9GSSA 4RQXA 5GAPD 3PGTA 3EU3A 1XCCA 2NTOA 4WETA 3C7MA 1F6MC 1QFNA 3ZYWA 3TCOA 3GSSA 4O5UA 3TJGA 1XOBA 1OC8A 4DSRA 2ZUPA 4GRFA 5LCZA 3ZMKA 3FZ4A 4PX1A 1T8EB 3UJ1A 4ZBAA 2X8GA 4EKZA 2A4HA 4OCEA 2ON5A 1PMTA 5HFKA 4KUNA 3APSA 1QK8A 2C1YA 3NOFA 5DCGA 4IKHA 2GS3A 4CY8A 1H75A 1LU4A 3KH7A 4E8HA 1ZYPA 3DKSA 4RI6A 5G5EA 3MSZA 1GUMA 2A2PA 2YJ7A 1K3LA 3ZRDA 1U88A 2WGRA 4HQZA 4O5RA 3DMLA 4POBA 3TRXA 2LRCA 2VUPA 1SKWB 3G9BA 1EEJA 4ECIA 1F2EA 2WB9A 4J2FA 2E2MA 4JZQA 3HKRA 1EEMA 3L9UA 5GAND 1TRUA 3P2AA 2FD3A 1GTAA 4O32A 1BEDA 3ZTLA 1XWGA 5CAXA 5G31A 4Z2UA 4PTSA 4ECCA 3HJMA 3F4TA 4XHMA 4TXVA 1M0UA 3MNGA 1ZYQB 2C3QA 3Q19A 1X9SB 4GWRA 1XWKA 2FNOA 3VPQA 3IE3A 3F3RA 3EMPA 1DUGA 5KN2A 1GULA 4ZL7A 5IOWA 4TR4A 3I6AA 3PPUA 2I81A 3FYGA 2PN8A 1TRWA 3VWVA 4V2LA 2HSYA 2MBTA 2NPBA 4F82A 2OE0A 3LG6A 4AJ6A 3M9KA 5A4UA 2H1AA 3ZREA 5B6NA 3BBYA 1N2AA 5JCGA 1PA3A 4G19A 1K0DA 3ZZXA 5CO3A 1S3AA 3WGEA 1HNCA 4MZBA 4QL7A 2GLRA 4WR5A 4ISDA 2AHEA 1GNWA 1YQ1A 3GX8A 4DSSA 5HR1A 4GTUA 1MDKA 3E3EA 4MA9A 4ZBBA 3TRQA 1ABAA 4HS1A 5HFIA 1ML6A 1O7UA 5EL8A 4X4JA 1QUWA 3HJOA 1AIUA 2Z9SA 1A0RP 2VM1A 2CZ2A 5ECPB 3HY2A 1AQVA 4WR4A 4HEA2 2N5BA 5BMUA 5AN1A 5DAKB 5ECIB 12GSA 3F4SA 4K7IA 1XPVA 3LEFA 4AF2A 2HXKA 14GSA 4XTSA 3ZIVA 3WGDA 4RUVA 3GL3A 2C3TA 4N0ZA 3D22A 1TDIA 3UARA 1OKDA 5IPGA 3W6GA 1JZRA 3KP8A 2H76A 3TOUA 3IK9A 1A2LA 1KBNA 1XG8A 3HDCA 4HJ2A 2DJJA 3KTLA 1DE1A 2IMIA 3KEBA 3GRXA 1X5CA 2B5XA 5HFGA 2VCQA 4L5LA 1K0MA 3TJKA 4EVMA 4F2IA 4PQHA 4CDOA 3H93A 2VM2A 1OE7A 3BCIA 3ZL5A 5G30A 5F07A 4NWYA 3PINA 3LQ7A 2MYGA 2JU5A 4BWSA 1GSDA 1TU7A 5HR0A 2DJ1A 2GTUA 4POLA 2B6MA 1VGLA 2O85A 3DD3A 1TJDA 3GMFA 1OYJA 4NAXA 2IFQA 2HFDA 1SENA 3ME7A 2MMOA 5COHA 4GSNA 1GNEA 4JBBA 1EOHA 1FOVA 2LQOA 3D4MA 2HT9A 1Z3EA 5DQSA 3A2WA 2R0CA 1B8XA 1XWCA 3GA4A 1JFUA 3RBTA 4KCEA 1EP8A 1SK0A 5INYA 3WT1A 5IIZA 3M1GA 3FEUA 3TKRA 4IP6A 1GSUA 2TIRA 1ERWA 3N9JA 3KMNA 2L6DA 5B8AA 4GQFA 4PQ1A 2DKHA 4G10A 4BL7B 2BMXA 3HVVA 1YZXA 2V2GA 5AGYA 3MIXA 2R3XA 1SKRB 2JL4A 5D9VA 2FA4A 4FO5A 1F3AA 4IJ3A 5D9XA 4L0WA 4AJ7A 4AGSA 3Q6OA 2ALBA 5JWQB 1ON4A 2PWJA 5CP1A 4J57E 3IOSA 3IHGA 3E9JB 3IBHA 2YN1A 1XWBA 1EOGA 3CSHA 5HR2A 2DLXA 2LJRA 5C04A 4CY6A 1TTZA 2H30A 1VF2A 2B5EA 2IMDA 2K8VA 4BVXB 3TB2A 4HJMA 1S3CA 2EIOA 4POMA 1H4OA 2RUFA 1XVWA 1AXDA 3CXGA 5IO0A 4POKA 1ZCPA 1C72A 2FY6A 4IELA 5DALB 3FY7A 3CTFA 3KH9A 1OC9A 1I5GA 2KP2A
chains in the Genus database with same CATH topology
2HRNA 2R6KA 4ZILA 4ZL9A 3ZFLA 1YKCA 1Z6MA 4XS4A 3VPTA 1GSQA 1GP1A 2X64A 2AB6A 4OCFA 1TKDB 1OC3A 1M2BA 2YWOA 2H1DA 3FRCA 4LL4B 3ERFA 4MH2A 3GNJA 4IVFA 1EV4A 1XZOA 4HZ4A 3ED3A 4L8EA 3WD6A 1TRVA 3P7XA 2O7KA 4IQ1A 1VF1A 4HUAA 4KF9A 2C0FA 3FW2A 1GUKA 3P90A 1PQNA 1DSBA 2HSHA 1XFLA 2FWEA 1GWCA 2GQKA 1SYXA 4TR1A 3FZ5A 3ZFBA 2RM5A 2VD1A 3KP9A 1Y6EA 1B9YC 2B1KA 3U5RE 4GXZA 1YJ6A 4G9HA 2WJUA 1BYEA 1UN2A 1K3YA 2OE1A 2QA2A 1WWJA 1X0RA 5ID2A 4WF4A 1XW9A 3D6IA 4IJIA 4GQCA 5KOXA 3KGKA 4XRAA 1HNAA 5DDLA 1M2AA 1ZMAA 16GSA 3TKPA 5IOXA 4BWQA 3GFKA 1LJRA 4BVYB 2NBSA 3GSTA 5J9BA 1F9MA 3IR4A 3TKQA 4EE0A 5GSSA 2AV4A 3C73A 2VCWA 2YNXA 1RK4A 1TRSA 2CX3A 3FKFA 3GH9A 2JACA 3Q74A 4KSOA 2GSRA 3L9SA 4JR6A 4MF7A 1A23A 3GHAA 1YF0A 2PVQA 1SK1A 4XS1A 4ZL8A 5EVOA 2YV9A 3IPZA 4MPGA 2CVBA 2LUSA 2C4JA 4MLYA 18GSA 5IM9A 1TK5B 3TJJA 6GSSA 2GZYA 4ECBA 2I3YA 2WRTA 3H4KA 2XPEA 3L9VA 4G0LA 3I69A 1SL2B 5JCWA 5FWGA 1JLVA 5FHIA 5GZZB 5G2ZA 1XW6A 4V1Ag 1PX6A 5IMDA 5CRWA 1Z9HA 3FR3A 2JZSA 4GSSA 3UEMA 3HYPA 2R4VA 3CSJA 1PX7A 3QMXA 4Z7XA 5KN0A 1V57A 2H8LA 4K5SA 1PL2A 2GZZA 7GSSA 5DBQA 3APOA 2B1LA 3HVXA 5DVBA 4K7NA 4BA7A 3QCPA 3HA9A 3SWLA 3F6DA 5EPFA 1FAAA 3KM6A 1UC7A 3ZVJD 2FWGA 2CQ9A 2IMEA 2M80A 3IAS2 1URMA 2B7KA 1DBYA 4LA1A 1LBKA 4IW9A 2VO4A 2LQQA 1Z7PA 1W89A 1ZYEA 3G7YA 2CVKA 1ILOA 3LFLA 2VCTA 1O6JA 2FHEA 1XOAA 5B7CA 3VWWA 4HDEA 4YQVA 3FR6A 2LEGA 1TI3A 4IP1A 2GT6A 5ECRB 1SK2A 2PU9C 3ERWA 2PMTA 2QA1A 3O6TA 2L59A 3WGXA 4JE1A 1AQWA 1AAZA 5KN1A 4JR4A 4ULXA 1RW1A 2YWNA 1MD3A 2GDRA 1Y25A 3DXBA 2V32A 4TOPA 3BD2A 4KDYA 2TRCP 2FA8A 2QSIA 1WJKA 1HQOA 4HU7A 4KW6A 4KCAA 2H1GA 5H5RA 2K6VA 3PR8A 4KB3A 1UA5A 3GKXA 3DWVA 3VI7A 1GSFA 1X9MB 3BOAA 5E59A 5ELAA 4DSSB 3UAPA 2V1MA 3FMWA 4GLTA 1J9BA 4HOJA 4PURA 2HNLA 2DIYA 2KHPA 2FCHA 2PUKC 1BJXA 2XPDA 2EC4A 3LYPA 4K6XA 3EURA 5AISA 3EE2A 1YEPA 3MAKA 1FB0A 2KLXA 4XIHA 3V1WA 1M2DA 3TOTA 2I9HA 1IYHA 2L5LA 4ZBDA 1SD9A 3TGZA 4EO3A 3LGCA 2QKEA 3QFAC 4MMMA 3BCKA 4ZXGA 4EDYA 2O87A 2VD0A 3CTGA 3UOMA 2H01A 3VLNA 2A2RA 3KXOA 1FVKA 2PGTA 5E4WA 1M9BA 4F9ZA 2L57A 3IC4A 6GSXA 2DJ2A 1WMJA 2LKUA 4JU5A 2VL2A 2EIQA 3RHBA 3GKMA 4PUFC 2C0GA 5H5SA 3D0ZA 4JRRA 1ZZYA 3J7Yk 5DJMA 3CSIA 5BRTA 4N30A 2LJAA 4FIWA 3RAZA 4MF5A 3RHCA 1KTEA 2H75A 4YAPA 4JEDA 1U87A 2B5YA 2HYXA 2R0GA 1O8XA 2VCXA 2MMAA 1TP9A 4XCSA 2HLSA 2C80A 2IFQB 3QAWA 1U6TA 2REMA 3IXRA 3WYWA 1O81A 1AUCA 4PNGA 5IMZA 2H66A 4K7OA 3GURA 5J41A 4MK3A 1R26A 1FOHA 2E2GA 1ERUA 3HXSA 3L4NA 3NZNA 3LJRA 2CZ3A 2XBQA 6GSYA 5IO2A 1BQ7A 1BAYA 4Z2TA 1EGOA 2DJ0A 3EINA 3DEXA 2VL3A 1A2JA 4GSTA 1E6BA 6GSVA 2HZFA 1GRXA 2CA8A 3IA1A 1U3AA 1AQXA 1SL0B 3QDNA 5ECOB 1THOA 2JADA 1Z6NA 4I97A 4N0VA 4IBPA 3MYDA 5GSTA 4TR3A 4X43A 1G7OA 4LMVA 5CRDA 2JSYA 2LNSA 4YQMA 1F3BA 2VL9A 5HR3A 2NVLA 1MDJA 1EP7A 3WT2A 2IN3A 5IMAA 3HJPA 3F63A 3H1NA 20GSA 5ECHB 4FQUA 2TRXA 4RI7A 22GSA 2HE3A 1TK8B 2YOIA 1OVNA 2H6YA 3K8NA 1THXA 4MCUA 4H86A 3RPPA 3ZITA 10GSA 2YV7A 4MF6A 1JZDA 5IQYA 4MJEA 1ZL9A 1SJZA 3MDKA 1WOUA 3I9V2 1QXHA 1X5DA 1R5PA 1OC9B 2PVOC 1T4YA 3KD0A 3GUSA 2FLSA 4O92A 4YKGA 3GV1A 4XS4B 4ZB6A 1G6YA 4G0KA 2AYTA 2VLVA 3GH6A 3GKNA 1GH2A 4L0UA 5IMVA 1S3DA 1FG4A 1PKWA 4KDUA 1O73A 1K0OA 4EIPA 3W8JA 1Z5YE 4X1UA 4HQSA 1SKSB 2AAWA 6GSUA 5D8IA 2ZNMA 1X9WB 3TUEA 4KE3A 1K0NA 2P0GA 3FR9A 4A5PA 1KNGA 4TW5A 1K0BA 4KDXA 1T1VA 1VF4A 2N5AA 2MBSA 4IGJA 5L71A 1O85A 1N8JA 1PSQA 3TRPA 2GQLA 2F8AA 5DQYA 3DVWA 3QFBC 1ACVA 4O5QA 3ISOA 3US3A 4TR1B 3A5WA 4PUAA 3GKKA 1TOFA 4YH2A 2LS5A 3CRUA 2JZTA 2P31A 2R0PA 2YWMA 3C71A 2PPTA 1WRYA 4NPBA 2K8SA 4ILFA 4EL1A 4F03A 1KEBA 1G0TA 2J9HA 5J3RA 1XIYA 3EC3A 5ID2B 3TKSE 11GSA 4DSQA 2E0QA 2E7PA 4MJBA 2H70A 2DMLA 1K0AA 1RQMA 4O7HA 4K2DA 2LJKA 2DSAA 1YEXA 2CT6A 4D73A 4IN0A 3KIJA 1SD8A 1Z7RA 2DKIA 5D73A 2X8HA 2I1UA 1MEKA 2HZEA 2DC5A 3KZQA 1EGRA 2YWIA 1A2MA 2O89A 1B4PA 5CRHA 1U3IA 4BPYA 2V41A 4MJAA 2YP6A 3DYRA 2L4QA 1YF1A 3A3TA 1V98A 2OA7A 1DE2A 2XBIA 2OKAA 3QD9A 2PBJA 2GSQA 4WKWA 5FT3A 3RPNA 3LW9A 4ID0A 3VWUA 3D4TA 2AJQB 2C8UA 5IMCA 1HNBA 2QGVA 4HU9A 1JHBA 3TKSA 1GTIA 3M0FA 2ON7A 2RUEA 2HRAA 4YKFA 5D9WA 3F4RA 5HQPA 3A2XA 5KEJA 1NSWA 2VLTA 3L78A 2L5OA 4V1Ap 4EF0A 4MZCA 4MDCA 2OJLA 1AW9A 2FWHA 1T7PB 1ZGNA 2MMNA 4I2TA 3GTUA 1R4WA 1B48A 2GVPA 3DVXA 4IS0A 19GSA 4OFMA 1QGVA 4KSMA 1SU9A 3N5OA 2H74A 1BX9A 5LD0A 4NV2A 1EZKA 3D5JA 1GSYA 3OR5A 3KTBA 3CBUA 4FYBA 2LNTA 5DCHA 3C8EA 4TVEA 1FO5A 4KA0A 1XWAA 2VL2C 2X49A 4LL1B 1HD2A 5J5NA 2CAQA 2J23A 2ES7A 1V2AA 3D21A 3JCML 2IJYA 5CNWA 3ZLPA 1MDIA 5JWRB 1GSSA 4MABA 2JZRA 2M46A 3QAVA 4Q5QA 3NIVA 2CX4A 2LSTA 1OE8A 4V2MA 2O8VB 1SJ6A 1WE0A 2YZHA 5F0GA 1QQ2A 1G6WA 3UBKA 2DJ3A 3IAM2 4IQAA 4J56E 1ZOFA 4P3YB 4WXTA 3DIEA 2AUVA 4OMVA 1TXXA 1TW9A 3W8SA 4E8EA 1OAZA 1Q4JA 5C00A 1TI1A 3HCZA 1JZWA 4N11A 2CVDA 2HSMA 3G7JA 2XHFA 3U6VA 4HZ2A 1CQGA 1V9WA 2GSSA 4WEYA 4F0BA 2GZPA 3GN3A 1M7TA 4MPFA 2VCZA 4PQIA 1R5AA 3F6FA 2L6CA 3KCMA 1A24A 3LXTA 3A2VA 3TDGA 1PD21 3QAGA 3Q18A 1PN9A 1NW2A 1HYUA 2P5RA 5G1LA 4OO5A 1X5EA 3M8NA 4CHSA 1GL8A 2FWFA 1SL1B 1B4QA 4PXOA 4NMUA 4I6XA 6GSWA 3DRNA 4WBRD 4HI7A 3LXZA 4F0CA 2HRKA 1EV9A 2DMMA 1E2YA 2VIMA 4X0XA 1G7EA 1NHYA 1GTBA 3MWHA 4OFTA 5ELGA 2X8CA 1Q98A 5B6MA 1YDKA 2R5GA 3F8UA 3F9UA 2N5FA 4TKYA 1VRSD 5ECKB 5F06A 5J4UA 4ZIJA 2GQMA 4YQUA 2IWTA 3I43A 2QC7A 1A8LA 5JWOB 2WS2A 4G0IA 4G2EA 4V2NA 1ERTA 1TU8A 4QQ7A 1ZYNA 2H72A 2IPAA 3S9FA 1GLQA 3LWAA 3R3EA 2GSTA 2VOCA 5ECMB 4MH3A 3F0IA 1FW1A 3H8QA 3TJBA 4GCIA 4WBJA 5D93A 3RDWA 4KAEA 3O76A 4Q5FA 3CMIA 1WIKA 3VFIA 4WF5A 4OD7A 1K3OA 3PH9A 3GL5A 2OACA 3GIXA 5AIVA 2IMKA 3CYNA 3F3QA 1XW5A 4MP4A 3HZ4A 2G0FA 5IPHA 2C0EA 1F37A 3ZIJA 1GSEA 2L4CA 3EVIA 2F51A 2EIRA 1PN0A 1FHEA 2H71A 3IDVA 4K9ZA 3HVSA 1V40A 5D9TA 3M3MA 1CQHA 1O8WA 5ECSA 2NDOA 4DVCA 4NV5A 2B7JA 4LMWA 4XRDA 2K18A 2IL3A 2KUCA 3FHKA 4KGIA 4DEJA 2F3MA 1ERVA 1B9XC 2F9SA 2GT5A 4MZWA 5ECNB 4ICYA 4RQRA 3EU4A 17GSA 5ECLB 4KH7A 4EXJA 2IMFA 2H0IA 3QOUA 4XS6A 1K0CA 1PRXA 4FH8A 5G5FA 5D96A 5EY6A 4GF0A 1V58A 2C3NA 5ENUA 2H6XA 5DAKA 1WP0A 2PERA 3FK8A 1R7HA 3QPMA 4K0GA 1W4VA 5J9CA 2X4AA 3G7IA 4K2XA 2H6ZA 2JSZA 4EIQA 2RIIA 1M99A 2CAIA 3IK7A 3ZVJA 4OO4A 4FYCA 2RM6A 3L0HA 2A4VA 3BJ5A 1FVJA 3UL3A 4K5RA 1AC1A 2IIYA 3C1RA 2CV4A 4ML6A 4TRXA 4K1FA 5CRGA 3EPTA 1J0FA 1FB6A 2YPMA 4MNNA 4N10A 2B3SA 3GYKA 4EDZA 3EMXA 4FYUA 3EWLA 2HRFA 2LRNA 2OBIA 5ECQB 2YANA 4MJCA 1XVQA 3GX0A 1USBA 2WFCA 4IHUA 4PNFA 3KJYA 3TKSC 1OKTA 4Q5NA 1YKAA 3ME8A 4PGTA 13GSA 4ZB8A 2G2QA 3J7Yb 1GTUA 2DBCA 3QR6A 2YZUA 2H0HA 5KN3A 5KOWA 1T4ZA 1T00A 3VURA 3UIWA 3UVTA 1M9AA 3APQA 3EYTA 1JLWA 1PL1A 2OADA 4LLRA 4EC0A 3TJFA 2X99A 4TN8A 4EUYA 3IC8A 2F8FA 3ERGA 1GLPA 3HHVA 1XXUA 3HD5A 1XBSA 3UMAA 4ML1A 5A5KA 2KOKA 4Z2RA 5LNKe 4BL7A 3UVHA 2LTKA 5IMFA 4ZB9A 2C0DA 1IYIA 2LRTA 2UZ8A 4I2UA 4ACSA 2V6OA 6GSTA 2A2SA 2OE3A 5AIXA 2RLIA 3VWXA 1PKZA 1YY7A 5A4WA 1A0FA 3LORA 2P5QA 2BTOT 4AJ8A 4K0NA 3E0UA 2K9FA 2FUG2 1T3BA 4QL9A 4TR0A 2R2JA 1MTCA 5DJLA 3KMOA 1NM3A 2WZ9A 4D73B 3DGQA 3IHQA 3LYKA 4BVXA 4CW9A 1A8YA 1J08A 3IRAA 1PGTA 2HZEB 4I8BA 2M72A 1BG5A 5CREA 5CYYA 4K8MA 4KX4A 2VLUA 3VI5A 4NHZA 5DALA 2FGXA 1SJIA 2VAFA 4TXOB 2H0GA 1UVZA 3C1SA 2DIZA 2YJHA 5F05A 2DJKA 2BJXA 2MZCA 1SYRA 2VCVA 3P8WA 3SBCA 3FZ9A 4NHWA 2LV3A 3ZMLA 8GSSA 4ECJA 2KP1A 5G1KA 3H79A 4NXIA 4TXOA 5F8BA 1WPIA 2OBKA 2WCIA 5ABRA 2D2ZA 2WULA 4USSA 2WDUA 1I9DA 4I5QA 2V6KA 2R37A 1VF3A 2I4AA 3GTUB 2YCDA 3HZ8A 2H1BA 3FZAA 3IV4A 5JCUA 4L5OA 5B8BA 1GUHA 2XC2A 1NHOA 3O3TA 2GGTA 4KNDA 5H5QA 2ZCTA 2H73A 3VK9A 1EWXA 1MD4A 2H19A 4OWYA 5A4VA 1TK0B 4Q5RA 4YAVA 4OFNA 1JZOA 3R2QA 1ST9A 3A5IA 3AY8A 1QMVA 2MMZA 3LSZA 3UBLA 4BVYA 3M9JA 2HI7A 3CRTA 9GSSA 4RQXA 5GAPD 3PGTA 3EU3A 1XCCA 2NTOA 4WETA 3C7MA 1F6MC 1QFNA 3ZYWA 3TCOA 3GSSA 4O5UA 3TJGA 1XOBA 1OC8A 4DSRA 2ZUPA 4GRFA 5LCZA 3ZMKA 3FZ4A 4PX1A 1T8EB 3UJ1A 4ZBAA 2X8GA 4EKZA 2A4HA 4OCEA 2ON5A 1PMTA 5HFKA 4KUNA 3APSA 1QK8A 2C1YA 3NOFA 5DCGA 4IKHA 2GS3A 4CY8A 1H75A 1LU4A 3KH7A 4E8HA 1ZYPA 3DKSA 4RI6A 5G5EA 3MSZA 1GUMA 2A2PA 2YJ7A 1K3LA 3ZRDA 1U88A 2WGRA 4HQZA 4O5RA 3DMLA 4POBA 3TRXA 2LRCA 2VUPA 1SKWB 3G9BA 1EEJA 4ECIA 1F2EA 2WB9A 4J2FA 2E2MA 4JZQA 3HKRA 1EEMA 3L9UA 5GAND 1TRUA 3P2AA 2FD3A 1GTAA 4O32A 1BEDA 3ZTLA 1XWGA 5CAXA 5G31A 4Z2UA 4PTSA 4ECCA 3HJMA 3F4TA 4XHMA 4TXVA 1M0UA 3MNGA 1ZYQB 2C3QA 3Q19A 1X9SB 4GWRA 1XWKA 2FNOA 3VPQA 3IE3A 3F3RA 3EMPA 1DUGA 5KN2A 1GULA 4ZL7A 5IOWA 4TR4A 3I6AA 3PPUA 2I81A 3FYGA 2PN8A 1TRWA 3VWVA 4V2LA 2HSYA 2MBTA 2NPBA 4F82A 2OE0A 3LG6A 4AJ6A 3M9KA 5A4UA 2H1AA 3ZREA 5B6NA 3BBYA 1N2AA 5JCGA 1PA3A 4G19A 1K0DA 3ZZXA 5CO3A 1S3AA 3WGEA 1HNCA 4MZBA 4QL7A 2GLRA 4WR5A 4ISDA 2AHEA 1GNWA 1YQ1A 3GX8A 4DSSA 5HR1A 4GTUA 1MDKA 3E3EA 4MA9A 4ZBBA 3TRQA 1ABAA 4HS1A 5HFIA 1ML6A 1O7UA 5EL8A 4X4JA 1QUWA 3HJOA 1AIUA 2Z9SA 1A0RP 2VM1A 2CZ2A 5ECPB 3HY2A 1AQVA 4WR4A 4HEA2 2N5BA 5BMUA 5AN1A 5DAKB 5ECIB 12GSA 3F4SA 4K7IA 1XPVA 3LEFA 4AF2A 2HXKA 14GSA 4XTSA 3ZIVA 3WGDA 4RUVA 3GL3A 2C3TA 4N0ZA 3D22A 1TDIA 3UARA 1OKDA 5IPGA 3W6GA 1JZRA 3KP8A 2H76A 3TOUA 3IK9A 1A2LA 1KBNA 3HDCA 4HJ2A 2DJJA 3KTLA 1DE1A 2IMIA 3KEBA 3GRXA 1X5CA 2B5XA 5HFGA 2VCQA 4L5LA 1K0MA 3TJKA 4EVMA 4F2IA 4PQHA 4CDOA 3H93A 2VM2A 1OE7A 3BCIA 3ZL5A 5G30A 5F07A 4NWYA 3PINA 3LQ7A 2MYGA 2JU5A 4BWSA 1GSDA 1TU7A 5HR0A 2DJ1A 2GTUA 4POLA 2B6MA 1VGLA 2O85A 3DD3A 1TJDA 3GMFA 1OYJA 4NAXA 2IFQA 2HFDA 1SENA 3ME7A 2MMOA 5COHA 4GSNA 1GNEA 4JBBA 1EOHA 1FOVA 2LQOA 3D4MA 2HT9A 1Z3EA 5DQSA 3A2WA 2R0CA 1B8XA 1XWCA 3GA4A 1JFUA 3RBTA 4KCEA 1EP8A 1SK0A 5INYA 3WT1A 5IIZA 3M1GA 3FEUA 3TKRA 4IP6A 1GSUA 2TIRA 1ERWA 3N9JA 3KMNA 2L6DA 5B8AA 4GQFA 4PQ1A 2DKHA 4G10A 4BL7B 2BMXA 3HVVA 1YZXA 2V2GA 5AGYA 3MIXA 2R3XA 1SKRB 2JL4A 5D9VA 2FA4A 4FO5A 1F3AA 4IJ3A 5D9XA 4L0WA 4AJ7A 4AGSA 3Q6OA 2ALBA 5JWQB 1ON4A 2PWJA 5CP1A 4J57E 3IOSA 3IHGA 3E9JB 3IBHA 2YN1A 1XWBA 1EOGA 3CSHA 5HR2A 2DLXA 2LJRA 5C04A 4CY6A 1TTZA 2H30A 1VF2A 2B5EA 2IMDA 2K8VA 4BVXB 3TB2A 4HJMA 1S3CA 2EIOA 4POMA 1H4OA 2RUFA 1XVWA 1AXDA 3CXGA 5IO0A 4POKA 1ZCPA 1C72A 2FY6A 4IELA 5DALB 3FY7A 3CTFA 3KH9A 1OC9A 1I5GA 2KP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HRN A;  2R6K A;  4ZIL A;  4ZL9 A;  3ZFL A;  1YKC A;  1Z6M A;  4XS4 A;  3VPT A;  1GSQ A;  1GP1 A;  2X64 A;  2AB6 A;  4OCF A;  1TKD B;  1OC3 A;  1M2B A;  2YWO A;  2H1D A;  3FRC A;  4LL4 B;  3ERF A;  4MH2 A;  3GNJ A;  4IVF A;  1EV4 A;  1XZO A;  4HZ4 A;  3ED3 A;  4L8E A;  3WD6 A;  1TRV A;  3P7X A;  2O7K A;  4IQ1 A;  1VF1 A;  4HUA A;  2C0F A;  3FW2 A;  1GUK A;  3P90 A;  1PQN A;  1DSB A;  2HSH A;  1XFL A;  2FWE A;  1GWC A;  2GQK A;  1SYX A;  4TR1 A;  3FZ5 A;  3ZFB A;  2RM5 A;  2VD1 A;  3KP9 A;  1Y6E A;  1B9Y C;  2B1K A;  3U5R E;  4GXZ A;  1YJ6 A;  4G9H A;  2WJU A;  1BYE A;  1UN2 A;  1K3Y A;  2OE1 A;  1WWJ A;  1X0R A;  5ID2 A;  4WF4 A;  1XW9 A;  3D6I A;  4IJI A;  4GQC A;  3KGK A;  4XRA A;  1HNA A;  5DDL A;  1M2A A;  1ZMA A;  16GS A;  3TKP A;  5IOX A;  4BWQ A;  3GFK A;  1LJR A;  2NBS A;  3GST A;  5J9B A;  1F9M A;  3IR4 A;  3TKQ A;  4EE0 A;  5GSS A;  2AV4 A;  3C73 A;  2VCW A;  2YNX A;  1RK4 A;  1TRS A;  2CX3 A;  3FKF A;  3GH9 A;  2JAC A;  3Q74 A;  4KSO A;  2GSR A;  3L9S A;  4JR6 A;  4MF7 A;  1A23 A;  3GHA A;  1YF0 A;  2PVQ A;  1SK1 A;  4XS1 A;  4ZL8 A;  5EVO A;  2YV9 A;  3IPZ A;  4MPG A;  2CVB A;  2LUS A;  2C4J A;  4MLY A;  18GS A;  5IM9 A;  1TK5 B;  3TJJ A;  6GSS A;  2GZY A;  4ECB A;  2I3Y A;  2WRT A;  3H4K A;  2XPE A;  3L9V A;  3I69 A;  1SL2 B;  5JCW A;  5FWG A;  1JLV A;  5FHI A;  5GZZ B;  5G2Z A;  1XW6 A;  4V1A g;  1PX6 A;  5IMD A;  5CRW A;  1Z9H A;  3FR3 A;  2JZS A;  4GSS A;  3UEM A;  3HYP A;  2R4V A;  3CSJ A;  1PX7 A;  3QMX A;  4Z7X A;  5KN0 A;  1V57 A;  2H8L A;  1PL2 A;  2GZZ A;  7GSS A;  5DBQ A;  3APO A;  2B1L A;  3HVX A;  5DVB A;  4K7N A;  4BA7 A;  3QCP A;  3HA9 A;  3SWL A;  3F6D A;  5EPF A;  1FAA A;  3KM6 A;  1UC7 A;  3ZVJ D;  2FWG A;  2CQ9 A;  2IME A;  2M80 A;  3IAS 2;  1URM A;  2B7K A;  1DBY A;  4LA1 A;  1LBK A;  4IW9 A;  2VO4 A;  2LQQ A;  1Z7P A;  1W89 A;  1ZYE A;  3G7Y A;  2CVK A;  1ILO A;  3LFL A;  2VCT A;  1O6J A;  2FHE A;  1XOA A;  5B7C A;  3VWW A;  4HDE A;  4YQV A;  3FR6 A;  2LEG A;  1TI3 A;  4IP1 A;  2GT6 A;  5ECR B;  1SK2 A;  2PU9 C;  3ERW A;  2PMT A;  3O6T A;  2L59 A;  3WGX A;  4JE1 A;  1AQW A;  1AAZ A;  5KN1 A;  4JR4 A;  4ULX A;  1RW1 A;  2YWN A;  1MD3 A;  2GDR A;  1Y25 A;  3DXB A;  2V32 A;  4TOP A;  3BD2 A;  4KDY A;  2TRC P;  2FA8 A;  2QSI A;  1WJK A;  1HQO A;  4HU7 A;  4KW6 A;  4KCA A;  2H1G A;  5H5R A;  2K6V A;  3PR8 A;  4KB3 A;  1UA5 A;  3GKX A;  3DWV A;  3VI7 A;  1GSF A;  1X9M B;  3BOA A;  5E59 A;  5ELA A;  4DSS B;  3UAP A;  2V1M A;  4GLT A;  1J9B A;  4HOJ A;  4PUR A;  2HNL A;  2DIY A;  2KHP A;  2FCH A;  2PUK C;  1BJX A;  2XPD A;  2EC4 A;  3LYP A;  4K6X A;  3EUR A;  5AIS A;  3EE2 A;  1YEP A;  3MAK A;  1FB0 A;  2KLX A;  4XIH A;  3V1W A;  1M2D A;  3TOT A;  2I9H A;  1IYH A;  2L5L A;  4ZBD A;  1SD9 A;  3TGZ A;  4EO3 A;  3LGC A;  2QKE A;  3QFA C;  4MMM A;  3BCK A;  4ZXG A;  4EDY A;  2O87 A;  2VD0 A;  3CTG A;  3UOM A;  2H01 A;  3VLN A;  2A2R A;  3KXO A;  1FVK A;  2PGT A;  5E4W A;  1M9B A;  4F9Z A;  2L57 A;  3IC4 A;  6GSX A;  2DJ2 A;  1WMJ A;  2LKU A;  4JU5 A;  2VL2 A;  2EIQ A;  3RHB A;  3GKM A;  4PUF C;  2C0G A;  5H5S A;  3D0Z A;  4JRR A;  1ZZY A;  3J7Y k;  5DJM A;  3CSI A;  4N30 A;  2LJA A;  4FIW A;  3RAZ A;  4MF5 A;  3RHC A;  1KTE A;  2H75 A;  4YAP A;  4JED A;  1U87 A;  2B5Y A;  2HYX A;  1O8X A;  2VCX A;  2MMA A;  1TP9 A;  4XCS A;  2HLS A;  2C80 A;  2IFQ B;  3QAW A;  1U6T A;  2REM A;  3IXR A;  3WYW A;  1O81 A;  1AUC A;  4PNG A;  5IMZ A;  2H66 A;  4K7O A;  3GUR A;  5J41 A;  4MK3 A;  1R26 A;  2E2G A;  1ERU A;  3HXS A;  3L4N A;  3NZN A;  3LJR A;  2CZ3 A;  2XBQ A;  6GSY A;  5IO2 A;  1BQ7 A;  1BAY A;  1EGO A;  2DJ0 A;  3EIN A;  3DEX A;  2VL3 A;  1A2J A;  4GST A;  1E6B A;  6GSV A;  2HZF A;  1GRX A;  2CA8 A;  3IA1 A;  1U3A A;  1AQX A;  1SL0 B;  3QDN A;  5ECO B;  1THO A;  2JAD A;  1Z6N A;  4I97 A;  4N0V A;  4IBP A;  5GST A;  4TR3 A;  4X43 A;  1G7O A;  4LMV A;  5CRD A;  2JSY A;  2LNS A;  4YQM A;  1F3B A;  2VL9 A;  5HR3 A;  2NVL A;  1MDJ A;  1EP7 A;  3WT2 A;  2IN3 A;  5IMA A;  3HJP A;  3F63 A;  3H1N A;  20GS A;  5ECH B;  2TRX A;  4RI7 A;  22GS A;  2HE3 A;  1TK8 B;  2YOI A;  1OVN A;  2H6Y A;  3K8N A;  1THX A;  4MCU A;  4H86 A;  3RPP A;  3ZIT A;  10GS A;  2YV7 A;  4MF6 A;  1JZD A;  5IQY A;  4MJE A;  1ZL9 A;  1SJZ A;  3MDK A;  1WOU A;  3I9V 2;  1QXH A;  1X5D A;  1R5P A;  1OC9 B;  2PVO C;  1T4Y A;  3KD0 A;  3GUS A;  2FLS A;  4O92 A;  3GV1 A;  4XS4 B;  4ZB6 A;  1G6Y A;  2AYT A;  2VLV A;  3GH6 A;  3GKN A;  1GH2 A;  4L0U A;  5IMV A;  1S3D A;  1FG4 A;  1PKW A;  4KDU A;  1O73 A;  1K0O A;  3W8J A;  1Z5Y E;  4X1U A;  4HQS A;  1SKS B;  2AAW A;  6GSU A;  5D8I A;  2ZNM A;  1X9W B;  3TUE A;  4KE3 A;  1K0N A;  2P0G A;  3FR9 A;  1KNG A;  4TW5 A;  1K0B A;  4KDX A;  1T1V A;  1VF4 A;  2N5A A;  2MBS A;  4IGJ A;  5L71 A;  1O85 A;  1N8J A;  1PSQ A;  3TRP A;  2GQL A;  2F8A A;  5DQY A;  3DVW A;  3QFB C;  1ACV A;  3ISO A;  3US3 A;  4TR1 B;  3A5W A;  4PUA A;  3GKK A;  1TOF A;  4YH2 A;  2LS5 A;  3CRU A;  2JZT A;  2P31 A;  2YWM A;  3C71 A;  2PPT A;  1WRY A;  4NPB A;  2K8S A;  4ILF A;  4EL1 A;  4F03 A;  1KEB A;  1G0T A;  2J9H A;  5J3R A;  1XIY A;  3EC3 A;  5ID2 B;  3TKS E;  11GS A;  4DSQ A;  2E0Q A;  2E7P A;  4MJB A;  2H70 A;  2DML A;  1K0A A;  1RQM A;  4O7H A;  4K2D A;  2LJK A;  2DSA A;  1YEX A;  2CT6 A;  4D73 A;  4IN0 A;  3KIJ A;  1SD8 A;  1Z7R A;  5D73 A;  2X8H A;  2I1U A;  1MEK A;  2HZE A;  2DC5 A;  3KZQ A;  1EGR A;  2YWI A;  1A2M A;  2O89 A;  1B4P A;  5CRH A;  1U3I A;  4BPY A;  2V41 A;  4MJA A;  2YP6 A;  3DYR A;  2L4Q A;  1YF1 A;  3A3T A;  1V98 A;  2OA7 A;  1DE2 A;  2XBI A;  2OKA A;  3QD9 A;  2PBJ A;  2GSQ A;  4WKW A;  5FT3 A;  3RPN A;  4ID0 A;  3VWU A;  3D4T A;  2AJQ B;  2C8U A;  5IMC A;  1HNB A;  2QGV A;  4HU9 A;  1JHB A;  3TKS A;  1GTI A;  3M0F A;  2ON7 A;  2RUE A;  5D9W A;  3F4R A;  5HQP A;  3A2X A;  5KEJ A;  1NSW A;  2VLT A;  3L78 A;  2L5O A;  4V1A p;  4EF0 A;  4MZC A;  4MDC A;  2OJL A;  1AW9 A;  2FWH A;  1T7P B;  1ZGN A;  2MMN A;  4I2T A;  3GTU A;  1R4W A;  1B48 A;  2GVP A;  3DVX A;  4IS0 A;  19GS A;  4OFM A;  1QGV A;  4KSM A;  1SU9 A;  3N5O A;  2H74 A;  1BX9 A;  5LD0 A;  4NV2 A;  1EZK A;  3D5J A;  1GSY A;  3OR5 A;  3KTB A;  3CBU A;  4FYB A;  2LNT A;  5DCH A;  3C8E A;  4TVE A;  1FO5 A;  4KA0 A;  1XWA A;  2VL2 C;  4LL1 B;  1HD2 A;  5J5N A;  2CAQ A;  2J23 A;  2ES7 A;  1V2A A;  3D21 A;  3JCM L;  2IJY A;  5CNW A;  3ZLP A;  1MDI A;  5JWR B;  1GSS A;  4MAB A;  2JZR A;  2M46 A;  3QAV A;  4Q5Q A;  3NIV A;  2CX4 A;  2LST A;  1OE8 A;  4V2M A;  2O8V B;  1SJ6 A;  1WE0 A;  2YZH A;  5F0G A;  1QQ2 A;  1G6W A;  3UBK A;  2DJ3 A;  3IAM 2;  4IQA A;  4J56 E;  1ZOF A;  4P3Y B;  4WXT A;  3DIE A;  2AUV A;  4OMV A;  1TXX A;  1TW9 A;  3W8S A;  4E8E A;  1OAZ A;  1Q4J A;  5C00 A;  1TI1 A;  3HCZ A;  1JZW A;  4N11 A;  2CVD A;  3G7J A;  2XHF A;  3U6V A;  4HZ2 A;  1CQG A;  1V9W A;  2GSS A;  4WEY A;  4F0B A;  2GZP A;  3GN3 A;  1M7T A;  4MPF A;  2VCZ A;  4PQI A;  1R5A A;  3F6F A;  2L6C A;  3KCM A;  1A24 A;  3LXT A;  3A2V A;  3TDG A;  1PD2 1;  3QAG A;  3Q18 A;  1PN9 A;  1NW2 A;  1HYU A;  2P5R A;  5G1L A;  4OO5 A;  1X5E A;  3M8N A;  4CHS A;  1GL8 A;  2FWF A;  1SL1 B;  1B4Q A;  4PXO A;  4NMU A;  4I6X A;  6GSW A;  3DRN A;  4WBR D;  4HI7 A;  3LXZ A;  4F0C A;  1EV9 A;  2DMM A;  1E2Y A;  2VIM A;  4X0X A;  1G7E A;  1NHY A;  1GTB A;  3MWH A;  4OFT A;  5ELG A;  2X8C A;  1Q98 A;  5B6M A;  1YDK A;  2R5G A;  3F8U A;  3F9U A;  2N5F A;  4TKY A;  1VRS D;  5ECK B;  5F06 A;  5J4U A;  4ZIJ A;  2GQM A;  4YQU A;  2IWT A;  3I43 A;  2QC7 A;  1A8L A;  5JWO B;  2WS2 A;  4G2E A;  4V2N A;  1ERT A;  1TU8 A;  4QQ7 A;  2H72 A;  2IPA A;  3S9F A;  1GLQ A;  3LWA A;  2GST A;  2VOC A;  5ECM B;  4MH3 A;  3F0I A;  1FW1 A;  3H8Q A;  3TJB A;  4GCI A;  4WBJ A;  5D93 A;  3RDW A;  4KAE A;  3O76 A;  4Q5F A;  3CMI A;  1WIK A;  3VFI A;  4WF5 A;  4OD7 A;  1K3O A;  3PH9 A;  3GL5 A;  2OAC A;  3GIX A;  5AIV A;  2IMK A;  3CYN A;  3F3Q A;  1XW5 A;  4MP4 A;  3HZ4 A;  2G0F A;  5IPH A;  2C0E A;  1F37 A;  3ZIJ A;  1GSE A;  2L4C A;  3EVI A;  2F51 A;  2EIR A;  2H71 A;  1FHE A;  3IDV A;  4K9Z A;  3HVS A;  1V40 A;  5D9T A;  3M3M A;  1CQH A;  1O8W A;  5ECS A;  2NDO A;  4DVC A;  4NV5 A;  2B7J A;  4LMW A;  4XRD A;  2K18 A;  2IL3 A;  2KUC A;  3FHK A;  4KGI A;  4DEJ A;  2F3M A;  1ERV A;  1B9X C;  2F9S A;  2GT5 A;  4MZW A;  5ECN B;  4RQR A;  3EU4 A;  17GS A;  5ECL B;  4KH7 A;  4EXJ A;  2IMF A;  2H0I A;  3QOU A;  4XS6 A;  1K0C A;  1PRX A;  4FH8 A;  5G5F A;  5D96 A;  5EY6 A;  4GF0 A;  1V58 A;  2C3N A;  5ENU A;  2H6X A;  5DAK A;  1WP0 A;  2PER A;  3FK8 A;  1R7H A;  3QPM A;  4K0G A;  1W4V A;  5J9C A;  3G7I A;  2H6Z A;  2JSZ A;  2RII A;  1M99 A;  2CAI A;  3IK7 A;  3ZVJ A;  4OO4 A;  4FYC A;  2RM6 A;  3L0H A;  2A4V A;  3BJ5 A;  1FVJ A;  3UL3 A;  1AC1 A;  2IIY A;  3C1R A;  2CV4 A;  4ML6 A;  4TRX A;  4K1F A;  5CRG A;  1J0F A;  1FB6 A;  2YPM A;  4N10 A;  2B3S A;  3GYK A;  4EDZ A;  3EMX A;  4FYU A;  3EWL A;  2HRF A;  2LRN A;  2OBI A;  5ECQ B;  2YAN A;  4MJC A;  1XVQ A;  3GX0 A;  1USB A;  2WFC A;  4IHU A;  4PNF A;  3KJY A;  3TKS C;  1OKT A;  4Q5N A;  1YKA A;  3ME8 A;  4PGT A;  13GS A;  4ZB8 A;  2G2Q A;  3J7Y b;  1GTU A;  2DBC A;  3QR6 A;  2YZU A;  2H0H A;  5KN3 A;  1T4Z A;  1T00 A;  3VUR A;  3UIW A;  3UVT A;  1M9A A;  3APQ A;  3EYT A;  1JLW A;  1PL1 A;  2OAD A;  4LLR A;  4EC0 A;  3TJF A;  2X99 A;  4TN8 A;  4EUY A;  2F8F A;  3ERG A;  1GLP A;  3HHV A;  1XXU A;  3HD5 A;  1XBS A;  3UMA A;  4ML1 A;  5A5K A;  2KOK A;  5LNK e;  4BL7 A;  3UVH A;  2LTK A;  5IMF A;  4ZB9 A;  2C0D A;  1IYI A;  2LRT A;  4I2U A;  4ACS A;  2V6O A;  6GST A;  2A2S A;  2OE3 A;  5AIX A;  2RLI A;  3VWX A;  1PKZ A;  1YY7 A;  5A4W A;  1A0F A;  3LOR A;  2P5Q A;  2BTO T;  4AJ8 A;  4K0N A;  3E0U A;  2K9F A;  2FUG 2;  1T3B A;  4QL9 A;  4TR0 A;  2R2J A;  1MTC A;  5DJL A;  3KMO A;  1NM3 A;  2WZ9 A;  4D73 B;  3DGQ A;  3IHQ A;  3LYK A;  4BVX A;  4CW9 A;  1A8Y A;  1J08 A;  3IRA A;  1PGT A;  2HZE B;  4I8B A;  2M72 A;  1BG5 A;  5CRE A;  5CYY A;  4K8M A;  4KX4 A;  2VLU A;  3VI5 A;  4NHZ A;  5DAL A;  2FGX A;  1SJI A;  2VAF A;  4TXO B;  2H0G A;  1UVZ A;  3C1S A;  2DIZ A;  2YJH A;  5F05 A;  2DJK A;  2BJX A;  2MZC A;  1SYR A;  2VCV A;  3P8W A;  3SBC A;  3FZ9 A;  4NHW A;  2LV3 A;  3ZML A;  8GSS A;  4ECJ A;  2KP1 A;  5G1K A;  3H79 A;  4NXI A;  4TXO A;  5F8B A;  1WPI A;  2OBK A;  2WCI A;  5ABR A;  2D2Z A;  2WUL A;  2WDU A;  1I9D A;  4I5Q A;  2V6K A;  2R37 A;  1VF3 A;  2I4A A;  3GTU B;  2YCD A;  3HZ8 A;  2H1B A;  3FZA A;  3IV4 A;  5JCU A;  4L5O A;  5B8B A;  1GUH A;  2XC2 A;  1NHO A;  3O3T A;  2GGT A;  4KND A;  5H5Q A;  2ZCT A;  2H73 A;  3VK9 A;  1EWX A;  1MD4 A;  2H19 A;  4OWY A;  5A4V A;  1TK0 B;  4Q5R A;  4YAV A;  4OFN A;  1JZO A;  3R2Q A;  1ST9 A;  3AY8 A;  1QMV A;  2MMZ A;  3LSZ A;  3UBL A;  4BVY A;  3M9J A;  2HI7 A;  3CRT A;  9GSS A;  4RQX A;  5GAP D;  3PGT A;  3EU3 A;  1XCC A;  2NTO A;  4WET A;  3C7M A;  1F6M C;  1QFN A;  3ZYW A;  3TCO A;  3GSS A;  3TJG A;  1XOB A;  1OC8 A;  4DSR A;  2ZUP A;  4GRF A;  5LCZ A;  3ZMK A;  3FZ4 A;  4PX1 A;  1T8E B;  3UJ1 A;  4ZBA A;  2X8G A;  4EKZ A;  4OCE A;  2ON5 A;  1PMT A;  5HFK A;  4KUN A;  3APS A;  1QK8 A;  2C1Y A;  3NOF A;  5DCG A;  4IKH A;  2GS3 A;  1H75 A;  1LU4 A;  3KH7 A;  4E8H A;  3DKS A;  4RI6 A;  5G5E A;  3MSZ A;  1GUM A;  2YJ7 A;  1K3L A;  3ZRD A;  1U88 A;  2WGR A;  4HQZ A;  4O5R A;  3DML A;  4POB A;  3TRX A;  2LRC A;  2VUP A;  1SKW B;  3G9B A;  1EEJ A;  4ECI A;  1F2E A;  2WB9 A;  4J2F A;  2E2M A;  4JZQ A;  3HKR A;  1EEM A;  3L9U A;  5GAN D;  1TRU A;  3P2A A;  2FD3 A;  1GTA A;  4O32 A;  1BED A;  3ZTL A;  1XWG A;  5CAX A;  5G31 A;  4ECC A;  3HJM A;  3F4T A;  4XHM A;  4TXV A;  1M0U A;  3MNG A;  1ZYQ B;  2C3Q A;  3Q19 A;  1X9S B;  4GWR A;  1XWK A;  2FNO A;  3VPQ A;  3IE3 A;  3F3R A;  3EMP A;  1DUG A;  5KN2 A;  1GUL A;  4ZL7 A;  5IOW A;  4TR4 A;  3I6A A;  2I81 A;  3FYG A;  2PN8 A;  1TRW A;  3VWV A;  4V2L A;  2HSY A;  2MBT A;  2NPB A;  4F82 A;  2OE0 A;  3LG6 A;  4AJ6 A;  3M9K A;  5A4U A;  2H1A A;  3ZRE A;  5B6N A;  3BBY A;  1N2A A;  5JCG A;  1PA3 A;  4G19 A;  1K0D A;  3ZZX A;  5CO3 A;  1S3A A;  3WGE A;  1HNC A;  4MZB A;  4QL7 A;  2GLR A;  4WR5 A;  4ISD A;  2AHE A;  1GNW A;  1YQ1 A;  3GX8 A;  4DSS A;  5HR1 A;  4GTU A;  1MDK A;  3E3E A;  4MA9 A;  4ZBB A;  3TRQ A;  1ABA A;  4HS1 A;  5HFI A;  1ML6 A;  1O7U A;  5EL8 A;  1QUW A;  3HJO A;  1AIU A;  2Z9S A;  1A0R P;  2VM1 A;  2CZ2 A;  5ECP B;  3HY2 A;  1AQV A;  4WR4 A;  4HEA 2;  2N5B A;  5AN1 A;  5DAK B;  5ECI B;  12GS A;  3F4S A;  4K7I A;  1XPV A;  3LEF A;  4AF2 A;  2HXK A;  14GS A;  4XTS A;  3ZIV A;  3WGD A;  4RUV A;  3GL3 A;  2C3T A;  4N0Z A;  3D22 A;  1TDI A;  3UAR A;  1OKD A;  5IPG A;  3W6G A;  1JZR A;  3KP8 A;  2H76 A;  3TOU A;  3IK9 A;  1A2L A;  1KBN A;  3HDC A;  4HJ2 A;  2DJJ A;  3KTL A;  1DE1 A;  2IMI A;  3KEB A;  3GRX A;  1X5C A;  2B5X A;  5HFG A;  2VCQ A;  4L5L A;  1K0M A;  3TJK A;  4EVM A;  4F2I A;  4PQH A;  4CDO A;  3H93 A;  2VM2 A;  1OE7 A;  3BCI A;  3ZL5 A;  5G30 A;  5F07 A;  4NWY A;  3PIN A;  3LQ7 A;  2MYG A;  2JU5 A;  4BWS A;  1GSD A;  1TU7 A;  5HR0 A;  2DJ1 A;  2GTU A;  4POL A;  2B6M A;  1VGL A;  2O85 A;  3DD3 A;  1TJD A;  3GMF A;  1OYJ A;  4NAX A;  2IFQ A;  2HFD A;  1SEN A;  3ME7 A;  2MMO A;  5COH A;  4GSN A;  1GNE A;  4JBB A;  1EOH A;  1FOV A;  2LQO A;  3D4M A;  2HT9 A;  1Z3E A;  5DQS A;  3A2W A;  1B8X A;  1XWC A;  3GA4 A;  1JFU A;  3RBT A;  4KCE A;  1EP8 A;  1SK0 A;  5INY A;  3WT1 A;  5IIZ A;  3M1G A;  3FEU A;  3TKR A;  4IP6 A;  1GSU A;  2TIR A;  1ERW A;  3N9J A;  3KMN A;  2L6D A;  5B8A A;  4GQF A;  4PQ1 A;  4G10 A;  2BMX A;  3HVV A;  1YZX A;  2V2G A;  5AGY A;  2R3X A;  1SKR B;  2JL4 A;  5D9V A;  2FA4 A;  4FO5 A;  1F3A A;  4IJ3 A;  5D9X A;  4L0W A;  4AJ7 A;  4AGS A;  3Q6O A;  2ALB A;  5JWQ B;  1ON4 A;  2PWJ A;  5CP1 A;  4J57 E;  3IOS A;  3E9J B;  3IBH A;  2YN1 A;  1XWB A;  1EOG A;  3CSH A;  5HR2 A;  2DLX A;  2LJR A;  5C04 A;  1TTZ A;  2H30 A;  1VF2 A;  2B5E A;  2IMD A;  2K8V A;  3TB2 A;  4HJM A;  1S3C A;  2EIO A;  4POM A;  1H4O A;  2RUF A;  1XVW A;  1AXD A;  3CXG A;  5IO0 A;  1ZCP A;  4POK A;  1C72 A;  2FY6 A;  4IEL A;  5DAL B;  3FY7 A;  3CTF A;  3KH9 A;  1OC9 A;  1I5G A;  2KP2 A; 
#chains in the Genus database with same CATH topology
 2HRN A;  2R6K A;  4ZIL A;  4ZL9 A;  3ZFL A;  1YKC A;  1Z6M A;  4XS4 A;  3VPT A;  1GSQ A;  1GP1 A;  2X64 A;  2AB6 A;  4OCF A;  1TKD B;  1OC3 A;  1M2B A;  2YWO A;  2H1D A;  3FRC A;  4LL4 B;  3ERF A;  4MH2 A;  3GNJ A;  4IVF A;  1EV4 A;  1XZO A;  4HZ4 A;  3ED3 A;  4L8E A;  3WD6 A;  1TRV A;  3P7X A;  2O7K A;  4IQ1 A;  1VF1 A;  4HUA A;  4KF9 A;  2C0F A;  3FW2 A;  1GUK A;  3P90 A;  1PQN A;  1DSB A;  2HSH A;  1XFL A;  2FWE A;  1GWC A;  2GQK A;  1SYX A;  4TR1 A;  3FZ5 A;  3ZFB A;  2RM5 A;  2VD1 A;  3KP9 A;  1Y6E A;  1B9Y C;  2B1K A;  3U5R E;  4GXZ A;  1YJ6 A;  4G9H A;  2WJU A;  1BYE A;  1UN2 A;  1K3Y A;  2OE1 A;  2QA2 A;  1WWJ A;  1X0R A;  5ID2 A;  4WF4 A;  1XW9 A;  3D6I A;  4IJI A;  4GQC A;  5KOX A;  3KGK A;  4XRA A;  1HNA A;  5DDL A;  1M2A A;  1ZMA A;  16GS A;  3TKP A;  5IOX A;  4BWQ A;  3GFK A;  1LJR A;  4BVY B;  2NBS A;  3GST A;  5J9B A;  1F9M A;  3IR4 A;  3TKQ A;  4EE0 A;  5GSS A;  2AV4 A;  3C73 A;  2VCW A;  2YNX A;  1RK4 A;  1TRS A;  2CX3 A;  3FKF A;  3GH9 A;  2JAC A;  3Q74 A;  4KSO A;  2GSR A;  3L9S A;  4JR6 A;  4MF7 A;  1A23 A;  3GHA A;  1YF0 A;  2PVQ A;  1SK1 A;  4XS1 A;  4ZL8 A;  5EVO A;  2YV9 A;  3IPZ A;  4MPG A;  2CVB A;  2LUS A;  2C4J A;  4MLY A;  18GS A;  5IM9 A;  4BIK A;  1TK5 B;  3TJJ A;  6GSS A;  2GZY A;  4ECB A;  2I3Y A;  2WRT A;  3H4K A;  2XPE A;  3L9V A;  4G0L A;  3I69 A;  1SL2 B;  5JCW A;  5FWG A;  1JLV A;  5FHI A;  5GZZ B;  5G2Z A;  1XW6 A;  4V1A g;  1PX6 A;  5IMD A;  5CRW A;  1Z9H A;  3FR3 A;  2JZS A;  4GSS A;  3UEM A;  3HYP A;  2R4V A;  3CSJ A;  1PX7 A;  3QMX A;  4Z7X A;  5KN0 A;  1V57 A;  2H8L A;  4K5S A;  1PL2 A;  2GZZ A;  7GSS A;  5DBQ A;  3APO A;  2B1L A;  3HVX A;  5DVB A;  4K7N A;  4BA7 A;  3QCP A;  3HA9 A;  3SWL A;  3F6D A;  5EPF A;  1FAA A;  3KM6 A;  1UC7 A;  3ZVJ D;  2FWG A;  2CQ9 A;  2IME A;  2M80 A;  3IAS 2;  1URM A;  2B7K A;  1DBY A;  4LA1 A;  1LBK A;  4IW9 A;  2VO4 A;  2LQQ A;  1Z7P A;  1W89 A;  1ZYE A;  3G7Y A;  2CVK A;  1ILO A;  3LFL A;  2VCT A;  1O6J A;  2FHE A;  1XOA A;  5B7C A;  3VWW A;  4HDE A;  4YQV A;  3FR6 A;  2LEG A;  1TI3 A;  4IP1 A;  2GT6 A;  5ECR B;  1SK2 A;  2PU9 C;  3ERW A;  2PMT A;  2QA1 A;  3O6T A;  2L59 A;  3WGX A;  4JE1 A;  1AQW A;  1AAZ A;  5KN1 A;  4JR4 A;  4ULX A;  1RW1 A;  2YWN A;  1MD3 A;  2GDR A;  1Y25 A;  3DXB A;  2V32 A;  4TOP A;  3BD2 A;  4KDY A;  2TRC P;  2FA8 A;  2QSI A;  1WJK A;  1HQO A;  4HU7 A;  4KW6 A;  4KCA A;  2H1G A;  5H5R A;  3CQF A;  2K6V A;  3PR8 A;  4KB3 A;  1UA5 A;  3GKX A;  3DWV A;  3VI7 A;  1GSF A;  1X9M B;  3BOA A;  5E59 A;  5ELA A;  4DSS B;  3UAP A;  2V1M A;  3FMW A;  4GLT A;  1J9B A;  4HOJ A;  4PUR A;  2HNL A;  2DIY A;  2KHP A;  2FCH A;  2PUK C;  1BJX A;  2XPD A;  2EC4 A;  3LYP A;  4K6X A;  3EUR A;  5AIS A;  3EE2 A;  1YEP A;  3MAK A;  3HVN A;  1FB0 A;  2KLX A;  4XIH A;  3V1W A;  1M2D A;  3TOT A;  2I9H A;  1IYH A;  2L5L A;  4ZBD A;  1SD9 A;  3TGZ A;  4EO3 A;  3LGC A;  2QKE A;  3QFA C;  4MMM A;  3BCK A;  4ZXG A;  4EDY A;  2O87 A;  2VD0 A;  3CTG A;  3UOM A;  2H01 A;  3VLN A;  2A2R A;  3KXO A;  1FVK A;  2PGT A;  5E4W A;  1M9B A;  4F9Z A;  2L57 A;  3IC4 A;  6GSX A;  2DJ2 A;  1WMJ A;  2LKU A;  4JU5 A;  2VL2 A;  2EIQ A;  3RHB A;  3GKM A;  4PUF C;  2C0G A;  5H5S A;  3D0Z A;  4JRR A;  1ZZY A;  3J7Y k;  5DJM A;  3CSI A;  5BRT A;  4N30 A;  2LJA A;  4FIW A;  3RAZ A;  4MF5 A;  3RHC A;  1KTE A;  2H75 A;  4YAP A;  4JED A;  1U87 A;  2B5Y A;  2HYX A;  2R0G A;  1O8X A;  2VCX A;  2MMA A;  1TP9 A;  4XCS A;  2HLS A;  2C80 A;  2IFQ B;  3QAW A;  1U6T A;  2REM A;  3IXR A;  3WYW A;  1O81 A;  1AUC A;  4PNG A;  5IMZ A;  2H66 A;  4K7O A;  3GUR A;  5J41 A;  4MK3 A;  1R26 A;  1FOH A;  2E2G A;  1ERU A;  3HXS A;  3L4N A;  3NZN A;  3LJR A;  2CZ3 A;  2XBQ A;  6GSY A;  5IO2 A;  1BQ7 A;  1BAY A;  4Z2T A;  1EGO A;  2DJ0 A;  3EIN A;  3DEX A;  2VL3 A;  1A2J A;  4GST A;  1E6B A;  6GSV A;  2HZF A;  1GRX A;  2CA8 A;  3IA1 A;  1U3A A;  1AQX A;  1SL0 B;  3QDN A;  5ECO B;  1THO A;  2JAD A;  1Z6N A;  4I97 A;  4N0V A;  4IBP A;  1PFO A;  3MYD A;  5GST A;  4TR3 A;  4X43 A;  1G7O A;  4LMV A;  5CRD A;  2JSY A;  2LNS A;  4YQM A;  1F3B A;  2VL9 A;  5HR3 A;  2NVL A;  1MDJ A;  1EP7 A;  3WT2 A;  2IN3 A;  5IMA A;  3HJP A;  3F63 A;  3H1N A;  20GS A;  5ECH B;  4FQU A;  2TRX A;  4RI7 A;  22GS A;  2HE3 A;  1TK8 B;  2YOI A;  1OVN A;  2H6Y A;  3K8N A;  1THX A;  4MCU A;  4H86 A;  3RPP A;  3ZIT A;  10GS A;  2YV7 A;  4MF6 A;  1JZD A;  5IQY A;  4MJE A;  1ZL9 A;  1SJZ A;  3MDK A;  1WOU A;  3I9V 2;  1QXH A;  1X5D A;  1R5P A;  1OC9 B;  2PVO C;  1T4Y A;  3KD0 A;  3GUS A;  2FLS A;  4O92 A;  4YKG A;  3GV1 A;  4XS4 B;  4ZB6 A;  1G6Y A;  4G0K A;  2AYT A;  2VLV A;  3GH6 A;  3GKN A;  1GH2 A;  4L0U A;  5IMV A;  1S3D A;  1FG4 A;  1PKW A;  4KDU A;  1O73 A;  1K0O A;  4EIP A;  1M3J A;  3W8J A;  1Z5Y E;  4X1U A;  4HQS A;  1SKS B;  2AAW A;  6GSU A;  5D8I A;  2ZNM A;  1X9W B;  3TUE A;  4KE3 A;  1K0N A;  2P0G A;  3FR9 A;  4A5P A;  1KNG A;  4TW5 A;  1K0B A;  4KDX A;  1T1V A;  1VF4 A;  2N5A A;  2MBS A;  4IGJ A;  5L71 A;  1O85 A;  1N8J A;  1PSQ A;  3TRP A;  2GQL A;  2F8A A;  5DQY A;  3DVW A;  3QFB C;  1ACV A;  4O5Q A;  3ISO A;  3US3 A;  4TR1 B;  3A5W A;  4PUA A;  3GKK A;  1TOF A;  4YH2 A;  2LS5 A;  3CRU A;  2JZT A;  2P31 A;  2R0P A;  2YWM A;  3C71 A;  2PPT A;  1WRY A;  4NPB A;  2K8S A;  4ILF A;  4EL1 A;  4F03 A;  1KEB A;  1G0T A;  2J9H A;  5J3R A;  1XIY A;  1M3I A;  3EC3 A;  5ID2 B;  3TKS E;  11GS A;  4DSQ A;  2E0Q A;  2E7P A;  4MJB A;  2H70 A;  2DML A;  1K0A A;  1RQM A;  4O7H A;  4K2D A;  2LJK A;  2DSA A;  1YEX A;  2CT6 A;  4D73 A;  4IN0 A;  3KIJ A;  1SD8 A;  1Z7R A;  2DKI A;  5D73 A;  2X8H A;  2I1U A;  1MEK A;  2HZE A;  2DC5 A;  3KZQ A;  1EGR A;  2YWI A;  1A2M A;  2O89 A;  1B4P A;  5CRH A;  1U3I A;  4BPY A;  2V41 A;  4MJA A;  2YP6 A;  3DYR A;  2L4Q A;  1YF1 A;  3A3T A;  1V98 A;  2OA7 A;  1DE2 A;  2XBI A;  2OKA A;  3QD9 A;  2PBJ A;  2GSQ A;  4WKW A;  5FT3 A;  3RPN A;  3LW9 A;  4ID0 A;  3VWU A;  3D4T A;  2AJQ B;  2C8U A;  5IMC A;  1HNB A;  2QGV A;  4HU9 A;  1JHB A;  3TKS A;  1GTI A;  3M0F A;  2ON7 A;  2RUE A;  2HRA A;  4YKF A;  5D9W A;  3F4R A;  5HQP A;  3A2X A;  5KEJ A;  1NSW A;  2VLT A;  3L78 A;  2L5O A;  4V1A p;  4EF0 A;  4MZC A;  4MDC A;  2OJL A;  1AW9 A;  2FWH A;  1T7P B;  1ZGN A;  2MMN A;  4I2T A;  3GTU A;  1R4W A;  1B48 A;  2GVP A;  3DVX A;  4IS0 A;  19GS A;  4OFM A;  1QGV A;  4KSM A;  1SU9 A;  3N5O A;  2H74 A;  1BX9 A;  5LD0 A;  4NV2 A;  1EZK A;  3D5J A;  1GSY A;  3OR5 A;  3KTB A;  3CBU A;  4FYB A;  2LNT A;  5DCH A;  3C8E A;  4TVE A;  1FO5 A;  4KA0 A;  1XWA A;  2VL2 C;  2X49 A;  4LL1 B;  1HD2 A;  5J5N A;  2CAQ A;  2J23 A;  2ES7 A;  1V2A A;  3D21 A;  3JCM L;  2IJY A;  5CNW A;  3ZLP A;  1MDI A;  5JWR B;  1GSS A;  4MAB A;  2JZR A;  2M46 A;  3QAV A;  4Q5Q A;  3NIV A;  2CX4 A;  2LST A;  1OE8 A;  4V2M A;  2O8V B;  1SJ6 A;  1WE0 A;  2YZH A;  5F0G A;  1QQ2 A;  1G6W A;  3UBK A;  2DJ3 A;  3IAM 2;  4IQA A;  4J56 E;  1ZOF A;  4P3Y B;  4WXT A;  3DIE A;  2AUV A;  4OMV A;  1TXX A;  1TW9 A;  3W8S A;  4E8E A;  1OAZ A;  1Q4J A;  5C00 A;  1TI1 A;  3HCZ A;  1JZW A;  4N11 A;  2CVD A;  2HSM A;  3G7J A;  2XHF A;  3U6V A;  4HZ2 A;  1CQG A;  1V9W A;  2GSS A;  4WEY A;  4F0B A;  2GZP A;  3GN3 A;  1M7T A;  4MPF A;  2VCZ A;  4PQI A;  1R5A A;  3F6F A;  2L6C A;  3KCM A;  1A24 A;  3LXT A;  3A2V A;  3TDG A;  1PD2 1;  3QAG A;  3Q18 A;  1PN9 A;  1NW2 A;  1HYU A;  2P5R A;  5G1L A;  4OO5 A;  1X5E A;  3M8N A;  4CHS A;  1GL8 A;  2FWF A;  1SL1 B;  1B4Q A;  4PXO A;  4NMU A;  4I6X A;  6GSW A;  3DRN A;  4WBR D;  4HI7 A;  3LXZ A;  4F0C A;  2HRK A;  1EV9 A;  2DMM A;  1E2Y A;  2VIM A;  4X0X A;  1G7E A;  1NHY A;  1GTB A;  3MWH A;  4OFT A;  5ELG A;  2X8C A;  1Q98 A;  5B6M A;  1YDK A;  2R5G A;  3F8U A;  3F9U A;  2N5F A;  4TKY A;  1VRS D;  5ECK B;  5F06 A;  5J4U A;  4ZIJ A;  2GQM A;  4YQU A;  2IWT A;  3I43 A;  2QC7 A;  1A8L A;  5JWO B;  2WS2 A;  4G0I A;  4G2E A;  4V2N A;  1ERT A;  1TU8 A;  4QQ7 A;  1ZYN A;  2H72 A;  2IPA A;  3S9F A;  1GLQ A;  3LWA A;  3R3E A;  2GST A;  2VOC A;  5ECM B;  4MH3 A;  3F0I A;  1FW1 A;  3H8Q A;  3TJB A;  4GCI A;  4WBJ A;  5D93 A;  3RDW A;  4KAE A;  3O76 A;  4Q5F A;  3CMI A;  1WIK A;  3VFI A;  4WF5 A;  4OD7 A;  1K3O A;  3PH9 A;  3GL5 A;  2OAC A;  3GIX A;  5AIV A;  2IMK A;  3CYN A;  3F3Q A;  1XW5 A;  4MP4 A;  3HZ4 A;  2G0F A;  5IPH A;  2C0E A;  1F37 A;  3ZIJ A;  1GSE A;  2L4C A;  3EVI A;  2F51 A;  2EIR A;  1PN0 A;  1FHE A;  2H71 A;  3IDV A;  4K9Z A;  3HVS A;  1V40 A;  5D9T A;  3M3M A;  1CQH A;  1O8W A;  5ECS A;  2NDO A;  4DVC A;  4NV5 A;  2B7J A;  4LMW A;  4XRD A;  2K18 A;  2IL3 A;  2KUC A;  3FHK A;  4KGI A;  4DEJ A;  2F3M A;  1ERV A;  1B9X C;  2F9S A;  2GT5 A;  4MZW A;  5ECN B;  4ICY A;  4RQR A;  3EU4 A;  17GS A;  5ECL B;  4KH7 A;  4EXJ A;  2IMF A;  2H0I A;  3QOU A;  4XS6 A;  1K0C A;  1PRX A;  4FH8 A;  5G5F A;  5D96 A;  5EY6 A;  4GF0 A;  1V58 A;  2C3N A;  5ENU A;  2H6X A;  5DAK A;  1WP0 A;  2PER A;  3FK8 A;  1R7H A;  3QPM A;  4K0G A;  1W4V A;  5J9C A;  2X4A A;  3G7I A;  4K2X A;  2H6Z A;  2JSZ A;  4EIQ A;  2RII A;  1M99 A;  2CAI A;  3IK7 A;  3ZVJ A;  4OO4 A;  4FYC A;  2RM6 A;  3L0H A;  2A4V A;  3BJ5 A;  1FVJ A;  3UL3 A;  4K5R A;  1AC1 A;  2IIY A;  3C1R A;  2CV4 A;  4ML6 A;  4TRX A;  4K1F A;  5CRG A;  3EPT A;  1J0F A;  1FB6 A;  2YPM A;  4MNN A;  4N10 A;  2B3S A;  3GYK A;  4EDZ A;  3EMX A;  4FYU A;  3EWL A;  2HRF A;  2LRN A;  2OBI A;  5ECQ B;  2YAN A;  4MJC A;  1XVQ A;  3GX0 A;  1USB A;  2WFC A;  4IHU A;  4PNF A;  3KJY A;  3TKS C;  1OKT A;  4Q5N A;  1YKA A;  3ME8 A;  4PGT A;  13GS A;  4ZB8 A;  2G2Q A;  3J7Y b;  1GTU A;  2DBC A;  3QR6 A;  2YZU A;  2H0H A;  5KN3 A;  5KOW A;  1T4Z A;  1T00 A;  3VUR A;  1S3R A;  3UIW A;  3UVT A;  1M9A A;  3APQ A;  3EYT A;  1JLW A;  1PL1 A;  2OAD A;  4LLR A;  4EC0 A;  3TJF A;  2X99 A;  4TN8 A;  4EUY A;  3IC8 A;  2F8F A;  3ERG A;  1GLP A;  3HHV A;  1XXU A;  3HD5 A;  1XBS A;  3UMA A;  4ML1 A;  5A5K A;  2KOK A;  4Z2R A;  5LNK e;  4BL7 A;  3UVH A;  2LTK A;  5IMF A;  4ZB9 A;  2C0D A;  1IYI A;  2LRT A;  2UZ8 A;  4I2U A;  4ACS A;  2V6O A;  6GST A;  2A2S A;  2OE3 A;  5AIX A;  2RLI A;  3VWX A;  1PKZ A;  1YY7 A;  5A4W A;  1A0F A;  3LOR A;  2P5Q A;  2BTO T;  4AJ8 A;  4K0N A;  3E0U A;  2K9F A;  2FUG 2;  1T3B A;  4QL9 A;  4TR0 A;  2R2J A;  1MTC A;  5DJL A;  3KMO A;  1NM3 A;  2WZ9 A;  4D73 B;  3DGQ A;  3IHQ A;  3LYK A;  4BVX A;  4CW9 A;  1A8Y A;  1J08 A;  3IRA A;  1PGT A;  2HZE B;  4I8B A;  2M72 A;  1BG5 A;  5CRE A;  5CYY A;  4K8M A;  4KX4 A;  2VLU A;  3VI5 A;  4NHZ A;  5DAL A;  2FGX A;  1SJI A;  2VAF A;  4TXO B;  2H0G A;  1UVZ A;  3C1S A;  2DIZ A;  2YJH A;  5F05 A;  2DJK A;  2BJX A;  2MZC A;  1SYR A;  2VCV A;  3P8W A;  3SBC A;  3FZ9 A;  4NHW A;  2LV3 A;  3ZML A;  8GSS A;  4ECJ A;  2KP1 A;  5G1K A;  3H79 A;  4NXI A;  4TXO A;  5F8B A;  1WPI A;  2OBK A;  2WCI A;  5ABR A;  2D2Z A;  2WUL A;  4USS A;  2WDU A;  1I9D A;  4I5Q A;  2V6K A;  2R37 A;  1VF3 A;  2I4A A;  3GTU B;  2YCD A;  3HZ8 A;  2H1B A;  3FZA A;  3IV4 A;  5JCU A;  4L5O A;  5B8B A;  1GUH A;  2XC2 A;  1NHO A;  4HSC X;  3O3T A;  2GGT A;  4KND A;  5H5Q A;  2ZCT A;  2H73 A;  3VK9 A;  1EWX A;  1MD4 A;  2H19 A;  4OWY A;  5A4V A;  1TK0 B;  4Q5R A;  4YAV A;  4OFN A;  1JZO A;  3R2Q A;  1ST9 A;  3A5I A;  3AY8 A;  1QMV A;  2MMZ A;  3LSZ A;  3UBL A;  4BVY A;  3M9J A;  2HI7 A;  3CRT A;  9GSS A;  4RQX A;  5GAP D;  3PGT A;  3EU3 A;  1XCC A;  2NTO A;  4WET A;  3C7M A;  1F6M C;  1QFN A;  3ZYW A;  3TCO A;  3GSS A;  4O5U A;  3TJG A;  1XOB A;  1OC8 A;  4DSR A;  2ZUP A;  4GRF A;  5LCZ A;  3ZMK A;  3FZ4 A;  4PX1 A;  1T8E B;  3UJ1 A;  4ZBA A;  2X8G A;  4EKZ A;  2A4H A;  4OCE A;  2ON5 A;  1PMT A;  5HFK A;  4KUN A;  3APS A;  1QK8 A;  2C1Y A;  3NOF A;  5DCG A;  4IKH A;  2GS3 A;  4CY8 A;  1H75 A;  1LU4 A;  3KH7 A;  4E8H A;  1ZYP A;  3DKS A;  4RI6 A;  5G5E A;  3MSZ A;  1GUM A;  2A2P A;  2YJ7 A;  1K3L A;  3ZRD A;  1U88 A;  2WGR A;  4HQZ A;  4O5R A;  3DML A;  4POB A;  3TRX A;  2LRC A;  2VUP A;  1SKW B;  3G9B A;  1EEJ A;  4ECI A;  1F2E A;  2WB9 A;  4J2F A;  2E2M A;  4JZQ A;  3HKR A;  1EEM A;  3L9U A;  5GAN D;  1TRU A;  3P2A A;  2FD3 A;  1GTA A;  4O32 A;  1BED A;  3ZTL A;  1XWG A;  5CAX A;  5G31 A;  4Z2U A;  4PTS A;  4ECC A;  3HJM A;  3F4T A;  4XHM A;  4TXV A;  1M0U A;  3MNG A;  1ZYQ B;  2C3Q A;  3Q19 A;  1X9S B;  4GWR A;  1XWK A;  2FNO A;  3VPQ A;  3IE3 A;  3F3R A;  3EMP A;  1DUG A;  5KN2 A;  1GUL A;  4ZL7 A;  5IOW A;  4TR4 A;  3I6A A;  3PPU A;  2I81 A;  3FYG A;  2PN8 A;  1TRW A;  3VWV A;  4V2L A;  2HSY A;  2MBT A;  2NPB A;  4F82 A;  2OE0 A;  3LG6 A;  4AJ6 A;  3M9K A;  5A4U A;  2H1A A;  3ZRE A;  5B6N A;  3BBY A;  1N2A A;  5JCG A;  1PA3 A;  4G19 A;  1K0D A;  3ZZX A;  5CO3 A;  1S3A A;  3WGE A;  1HNC A;  4MZB A;  4QL7 A;  2GLR A;  4WR5 A;  4ISD A;  2AHE A;  1GNW A;  1YQ1 A;  3GX8 A;  4DSS A;  5HR1 A;  4GTU A;  1MDK A;  3E3E A;  4MA9 A;  4ZBB A;  3TRQ A;  1ABA A;  4HS1 A;  5HFI A;  1ML6 A;  1O7U A;  5EL8 A;  4X4J A;  1QUW A;  3HJO A;  1AIU A;  2Z9S A;  1A0R P;  2VM1 A;  2CZ2 A;  5ECP B;  3HY2 A;  1AQV A;  4WR4 A;  4HEA 2;  2N5B A;  5BMU A;  5AN1 A;  5DAK B;  5ECI B;  12GS A;  3F4S A;  4K7I A;  1XPV A;  3LEF A;  4AF2 A;  2HXK A;  14GS A;  4XTS A;  3ZIV A;  3WGD A;  4RUV A;  3GL3 A;  2C3T A;  4N0Z A;  3D22 A;  1TDI A;  3UAR A;  1OKD A;  5IPG A;  3W6G A;  1JZR A;  3KP8 A;  2H76 A;  3TOU A;  3IK9 A;  1A2L A;  1KBN A;  1XG8 A;  3HDC A;  4HJ2 A;  2DJJ A;  3KTL A;  1DE1 A;  2IMI A;  3KEB A;  3GRX A;  1X5C A;  2B5X A;  5HFG A;  2VCQ A;  4L5L A;  1K0M A;  3TJK A;  4EVM A;  4F2I A;  4PQH A;  4CDO A;  3H93 A;  2VM2 A;  1OE7 A;  3BCI A;  3ZL5 A;  5G30 A;  5F07 A;  4NWY A;  3PIN A;  3LQ7 A;  2MYG A;  2JU5 A;  4BWS A;  1GSD A;  1TU7 A;  5HR0 A;  2DJ1 A;  2GTU A;  4POL A;  2B6M A;  1VGL A;  2O85 A;  3DD3 A;  1TJD A;  3GMF A;  1OYJ A;  4NAX A;  2IFQ A;  2HFD A;  1SEN A;  3ME7 A;  2MMO A;  5COH A;  4GSN A;  1GNE A;  4JBB A;  1EOH A;  1FOV A;  2LQO A;  3D4M A;  2HT9 A;  1Z3E A;  5DQS A;  3A2W A;  2R0C A;  1B8X A;  1XWC A;  3GA4 A;  1JFU A;  3RBT A;  4KCE A;  1EP8 A;  1SK0 A;  5INY A;  3WT1 A;  5IIZ A;  3M1G A;  3FEU A;  3TKR A;  4IP6 A;  1GSU A;  2TIR A;  1ERW A;  3N9J A;  3KMN A;  2L6D A;  5B8A A;  4GQF A;  4PQ1 A;  2DKH A;  4G10 A;  4BL7 B;  2BMX A;  3HVV A;  1YZX A;  2V2G A;  5AGY A;  3MIX A;  2R3X A;  1SKR B;  2JL4 A;  5D9V A;  2FA4 A;  4FO5 A;  1F3A A;  4IJ3 A;  5D9X A;  4L0W A;  4AJ7 A;  4AGS A;  3Q6O A;  2ALB A;  5JWQ B;  1ON4 A;  2PWJ A;  5CP1 A;  4J57 E;  3IOS A;  3IHG A;  3E9J B;  3IBH A;  2YN1 A;  1XWB A;  1EOG A;  3CSH A;  5HR2 A;  2DLX A;  2LJR A;  5C04 A;  4CY6 A;  1TTZ A;  2H30 A;  1VF2 A;  2B5E A;  2IMD A;  2K8V A;  4BVX B;  3TB2 A;  4HJM A;  1S3C A;  2EIO A;  4POM A;  1H4O A;  2RUF A;  1XVW A;  1AXD A;  3CXG A;  5IO0 A;  4POK A;  1ZCP A;  1C72 A;  2FY6 A;  4IEL A;  5DAL B;  3FY7 A;  3CTF A;  3KH9 A;  1OC9 A;  1I5G A;  2KP2 A; 
#chains in the Genus database with same CATH homology
 2HRN A;  2R6K A;  4ZIL A;  4ZL9 A;  3ZFL A;  1YKC A;  1Z6M A;  4XS4 A;  3VPT A;  1GSQ A;  1GP1 A;  2X64 A;  2AB6 A;  4OCF A;  1TKD B;  1OC3 A;  1M2B A;  2YWO A;  2H1D A;  3FRC A;  4LL4 B;  3ERF A;  4MH2 A;  3GNJ A;  4IVF A;  1EV4 A;  1XZO A;  4HZ4 A;  3ED3 A;  4L8E A;  3WD6 A;  1TRV A;  3P7X A;  2O7K A;  4IQ1 A;  1VF1 A;  4HUA A;  4KF9 A;  2C0F A;  3FW2 A;  1GUK A;  3P90 A;  1PQN A;  1DSB A;  2HSH A;  1XFL A;  2FWE A;  1GWC A;  2GQK A;  1SYX A;  4TR1 A;  3FZ5 A;  3ZFB A;  2RM5 A;  2VD1 A;  3KP9 A;  1Y6E A;  1B9Y C;  2B1K A;  3U5R E;  4GXZ A;  1YJ6 A;  4G9H A;  2WJU A;  1BYE A;  1UN2 A;  1K3Y A;  2OE1 A;  2QA2 A;  1WWJ A;  1X0R A;  5ID2 A;  4WF4 A;  1XW9 A;  3D6I A;  4IJI A;  4GQC A;  5KOX A;  3KGK A;  4XRA A;  1HNA A;  5DDL A;  1M2A A;  1ZMA A;  16GS A;  3TKP A;  5IOX A;  4BWQ A;  3GFK A;  1LJR A;  4BVY B;  2NBS A;  3GST A;  5J9B A;  1F9M A;  3IR4 A;  3TKQ A;  4EE0 A;  5GSS A;  2AV4 A;  3C73 A;  2VCW A;  2YNX A;  1RK4 A;  1TRS A;  2CX3 A;  3FKF A;  3GH9 A;  2JAC A;  3Q74 A;  4KSO A;  2GSR A;  3L9S A;  4JR6 A;  4MF7 A;  1A23 A;  3GHA A;  1YF0 A;  2PVQ A;  1SK1 A;  4XS1 A;  4ZL8 A;  5EVO A;  2YV9 A;  3IPZ A;  4MPG A;  2CVB A;  2LUS A;  2C4J A;  4MLY A;  18GS A;  5IM9 A;  1TK5 B;  3TJJ A;  6GSS A;  2GZY A;  4ECB A;  2I3Y A;  2WRT A;  3H4K A;  2XPE A;  3L9V A;  4G0L A;  3I69 A;  1SL2 B;  5JCW A;  5FWG A;  1JLV A;  5FHI A;  5GZZ B;  5G2Z A;  1XW6 A;  4V1A g;  1PX6 A;  5IMD A;  5CRW A;  1Z9H A;  3FR3 A;  2JZS A;  4GSS A;  3UEM A;  3HYP A;  2R4V A;  3CSJ A;  1PX7 A;  3QMX A;  4Z7X A;  5KN0 A;  1V57 A;  2H8L A;  4K5S A;  1PL2 A;  2GZZ A;  7GSS A;  5DBQ A;  3APO A;  2B1L A;  3HVX A;  5DVB A;  4K7N A;  4BA7 A;  3QCP A;  3HA9 A;  3SWL A;  3F6D A;  5EPF A;  1FAA A;  3KM6 A;  1UC7 A;  3ZVJ D;  2FWG A;  2CQ9 A;  2IME A;  2M80 A;  3IAS 2;  1URM A;  2B7K A;  1DBY A;  4LA1 A;  1LBK A;  4IW9 A;  2VO4 A;  2LQQ A;  1Z7P A;  1W89 A;  1ZYE A;  3G7Y A;  2CVK A;  1ILO A;  3LFL A;  2VCT A;  1O6J A;  2FHE A;  1XOA A;  5B7C A;  3VWW A;  4HDE A;  4YQV A;  3FR6 A;  2LEG A;  1TI3 A;  4IP1 A;  2GT6 A;  5ECR B;  1SK2 A;  2PU9 C;  3ERW A;  2PMT A;  2QA1 A;  3O6T A;  2L59 A;  3WGX A;  4JE1 A;  1AQW A;  1AAZ A;  5KN1 A;  4JR4 A;  4ULX A;  1RW1 A;  2YWN A;  1MD3 A;  2GDR A;  1Y25 A;  3DXB A;  2V32 A;  4TOP A;  3BD2 A;  4KDY A;  2TRC P;  2FA8 A;  2QSI A;  1WJK A;  1HQO A;  4HU7 A;  4KW6 A;  4KCA A;  2H1G A;  5H5R A;  2K6V A;  3PR8 A;  4KB3 A;  1UA5 A;  3GKX A;  3DWV A;  3VI7 A;  1GSF A;  1X9M B;  3BOA A;  5E59 A;  5ELA A;  4DSS B;  3UAP A;  2V1M A;  3FMW A;  4GLT A;  1J9B A;  4HOJ A;  4PUR A;  2HNL A;  2DIY A;  2KHP A;  2FCH A;  2PUK C;  1BJX A;  2XPD A;  2EC4 A;  3LYP A;  4K6X A;  3EUR A;  5AIS A;  3EE2 A;  1YEP A;  3MAK A;  1FB0 A;  2KLX A;  4XIH A;  3V1W A;  1M2D A;  3TOT A;  2I9H A;  1IYH A;  2L5L A;  4ZBD A;  1SD9 A;  3TGZ A;  4EO3 A;  3LGC A;  2QKE A;  3QFA C;  4MMM A;  3BCK A;  4ZXG A;  4EDY A;  2O87 A;  2VD0 A;  3CTG A;  3UOM A;  2H01 A;  3VLN A;  2A2R A;  3KXO A;  1FVK A;  2PGT A;  5E4W A;  1M9B A;  4F9Z A;  2L57 A;  3IC4 A;  6GSX A;  2DJ2 A;  1WMJ A;  2LKU A;  4JU5 A;  2VL2 A;  2EIQ A;  3RHB A;  3GKM A;  4PUF C;  2C0G A;  5H5S A;  3D0Z A;  4JRR A;  1ZZY A;  3J7Y k;  5DJM A;  3CSI A;  5BRT A;  4N30 A;  2LJA A;  4FIW A;  3RAZ A;  4MF5 A;  3RHC A;  1KTE A;  2H75 A;  4YAP A;  4JED A;  1U87 A;  2B5Y A;  2HYX A;  2R0G A;  1O8X A;  2VCX A;  2MMA A;  1TP9 A;  4XCS A;  2HLS A;  2C80 A;  2IFQ B;  3QAW A;  1U6T A;  2REM A;  3IXR A;  3WYW A;  1O81 A;  1AUC A;  4PNG A;  5IMZ A;  2H66 A;  4K7O A;  3GUR A;  5J41 A;  4MK3 A;  1R26 A;  1FOH A;  2E2G A;  1ERU A;  3HXS A;  3L4N A;  3NZN A;  3LJR A;  2CZ3 A;  2XBQ A;  6GSY A;  5IO2 A;  1BQ7 A;  1BAY A;  4Z2T A;  1EGO A;  2DJ0 A;  3EIN A;  3DEX A;  2VL3 A;  1A2J A;  4GST A;  1E6B A;  6GSV A;  2HZF A;  1GRX A;  2CA8 A;  3IA1 A;  1U3A A;  1AQX A;  1SL0 B;  3QDN A;  5ECO B;  1THO A;  2JAD A;  1Z6N A;  4I97 A;  4N0V A;  4IBP A;  3MYD A;  5GST A;  4TR3 A;  4X43 A;  1G7O A;  4LMV A;  5CRD A;  2JSY A;  2LNS A;  4YQM A;  1F3B A;  2VL9 A;  5HR3 A;  2NVL A;  1MDJ A;  1EP7 A;  3WT2 A;  2IN3 A;  5IMA A;  3HJP A;  3F63 A;  3H1N A;  20GS A;  5ECH B;  4FQU A;  2TRX A;  4RI7 A;  22GS A;  2HE3 A;  1TK8 B;  2YOI A;  1OVN A;  2H6Y A;  3K8N A;  1THX A;  4MCU A;  4H86 A;  3RPP A;  3ZIT A;  10GS A;  2YV7 A;  4MF6 A;  1JZD A;  5IQY A;  4MJE A;  1ZL9 A;  1SJZ A;  3MDK A;  1WOU A;  3I9V 2;  1QXH A;  1X5D A;  1R5P A;  1OC9 B;  2PVO C;  1T4Y A;  3KD0 A;  3GUS A;  2FLS A;  4O92 A;  4YKG A;  3GV1 A;  4XS4 B;  4ZB6 A;  1G6Y A;  4G0K A;  2AYT A;  2VLV A;  3GH6 A;  3GKN A;  1GH2 A;  4L0U A;  5IMV A;  1S3D A;  1FG4 A;  1PKW A;  4KDU A;  1O73 A;  1K0O A;  4EIP A;  3W8J A;  1Z5Y E;  4X1U A;  4HQS A;  1SKS B;  2AAW A;  6GSU A;  5D8I A;  2ZNM A;  1X9W B;  3TUE A;  4KE3 A;  1K0N A;  2P0G A;  3FR9 A;  4A5P A;  1KNG A;  4TW5 A;  1K0B A;  4KDX A;  1T1V A;  1VF4 A;  2N5A A;  2MBS A;  4IGJ A;  5L71 A;  1O85 A;  1N8J A;  1PSQ A;  3TRP A;  2GQL A;  2F8A A;  5DQY A;  3DVW A;  3QFB C;  1ACV A;  4O5Q A;  3ISO A;  3US3 A;  4TR1 B;  3A5W A;  4PUA A;  3GKK A;  1TOF A;  4YH2 A;  2LS5 A;  3CRU A;  2JZT A;  2P31 A;  2R0P A;  2YWM A;  3C71 A;  2PPT A;  1WRY A;  4NPB A;  2K8S A;  4ILF A;  4EL1 A;  4F03 A;  1KEB A;  1G0T A;  2J9H A;  5J3R A;  1XIY A;  3EC3 A;  5ID2 B;  3TKS E;  11GS A;  4DSQ A;  2E0Q A;  2E7P A;  4MJB A;  2H70 A;  2DML A;  1K0A A;  1RQM A;  4O7H A;  4K2D A;  2LJK A;  2DSA A;  1YEX A;  2CT6 A;  4D73 A;  4IN0 A;  3KIJ A;  1SD8 A;  1Z7R A;  2DKI A;  5D73 A;  2X8H A;  2I1U A;  1MEK A;  2HZE A;  2DC5 A;  3KZQ A;  1EGR A;  2YWI A;  1A2M A;  2O89 A;  1B4P A;  5CRH A;  1U3I A;  4BPY A;  2V41 A;  4MJA A;  2YP6 A;  3DYR A;  2L4Q A;  1YF1 A;  3A3T A;  1V98 A;  2OA7 A;  1DE2 A;  2XBI A;  2OKA A;  3QD9 A;  2PBJ A;  2GSQ A;  4WKW A;  5FT3 A;  3RPN A;  3LW9 A;  4ID0 A;  3VWU A;  3D4T A;  2AJQ B;  2C8U A;  5IMC A;  1HNB A;  2QGV A;  4HU9 A;  1JHB A;  3TKS A;  1GTI A;  3M0F A;  2ON7 A;  2RUE A;  2HRA A;  4YKF A;  5D9W A;  3F4R A;  5HQP A;  3A2X A;  5KEJ A;  1NSW A;  2VLT A;  3L78 A;  2L5O A;  4V1A p;  4EF0 A;  4MZC A;  4MDC A;  2OJL A;  1AW9 A;  2FWH A;  1T7P B;  1ZGN A;  2MMN A;  4I2T A;  3GTU A;  1R4W A;  1B48 A;  2GVP A;  3DVX A;  4IS0 A;  19GS A;  4OFM A;  1QGV A;  4KSM A;  1SU9 A;  3N5O A;  2H74 A;  1BX9 A;  5LD0 A;  4NV2 A;  1EZK A;  3D5J A;  1GSY A;  3OR5 A;  3KTB A;  3CBU A;  4FYB A;  2LNT A;  5DCH A;  3C8E A;  4TVE A;  1FO5 A;  4KA0 A;  1XWA A;  2VL2 C;  2X49 A;  4LL1 B;  1HD2 A;  5J5N A;  2CAQ A;  2J23 A;  2ES7 A;  1V2A A;  3D21 A;  3JCM L;  2IJY A;  5CNW A;  3ZLP A;  1MDI A;  5JWR B;  1GSS A;  4MAB A;  2JZR A;  2M46 A;  3QAV A;  4Q5Q A;  3NIV A;  2CX4 A;  2LST A;  1OE8 A;  4V2M A;  2O8V B;  1SJ6 A;  1WE0 A;  2YZH A;  5F0G A;  1QQ2 A;  1G6W A;  3UBK A;  2DJ3 A;  3IAM 2;  4IQA A;  4J56 E;  1ZOF A;  4P3Y B;  4WXT A;  3DIE A;  2AUV A;  4OMV A;  1TXX A;  1TW9 A;  3W8S A;  4E8E A;  1OAZ A;  1Q4J A;  5C00 A;  1TI1 A;  3HCZ A;  1JZW A;  4N11 A;  2CVD A;  2HSM A;  3G7J A;  2XHF A;  3U6V A;  4HZ2 A;  1CQG A;  1V9W A;  2GSS A;  4WEY A;  4F0B A;  2GZP A;  3GN3 A;  1M7T A;  4MPF A;  2VCZ A;  4PQI A;  1R5A A;  3F6F A;  2L6C A;  3KCM A;  1A24 A;  3LXT A;  3A2V A;  3TDG A;  1PD2 1;  3QAG A;  3Q18 A;  1PN9 A;  1NW2 A;  1HYU A;  2P5R A;  5G1L A;  4OO5 A;  1X5E A;  3M8N A;  4CHS A;  1GL8 A;  2FWF A;  1SL1 B;  1B4Q A;  4PXO A;  4NMU A;  4I6X A;  6GSW A;  3DRN A;  4WBR D;  4HI7 A;  3LXZ A;  4F0C A;  2HRK A;  1EV9 A;  2DMM A;  1E2Y A;  2VIM A;  4X0X A;  1G7E A;  1NHY A;  1GTB A;  3MWH A;  4OFT A;  5ELG A;  2X8C A;  1Q98 A;  5B6M A;  1YDK A;  2R5G A;  3F8U A;  3F9U A;  2N5F A;  4TKY A;  1VRS D;  5ECK B;  5F06 A;  5J4U A;  4ZIJ A;  2GQM A;  4YQU A;  2IWT A;  3I43 A;  2QC7 A;  1A8L A;  5JWO B;  2WS2 A;  4G0I A;  4G2E A;  4V2N A;  1ERT A;  1TU8 A;  4QQ7 A;  1ZYN A;  2H72 A;  2IPA A;  3S9F A;  1GLQ A;  3LWA A;  3R3E A;  2GST A;  2VOC A;  5ECM B;  4MH3 A;  3F0I A;  1FW1 A;  3H8Q A;  3TJB A;  4GCI A;  4WBJ A;  5D93 A;  3RDW A;  4KAE A;  3O76 A;  4Q5F A;  3CMI A;  1WIK A;  3VFI A;  4WF5 A;  4OD7 A;  1K3O A;  3PH9 A;  3GL5 A;  2OAC A;  3GIX A;  5AIV A;  2IMK A;  3CYN A;  3F3Q A;  1XW5 A;  4MP4 A;  3HZ4 A;  2G0F A;  5IPH A;  2C0E A;  1F37 A;  3ZIJ A;  1GSE A;  2L4C A;  3EVI A;  2F51 A;  2EIR A;  1PN0 A;  1FHE A;  2H71 A;  3IDV A;  4K9Z A;  3HVS A;  1V40 A;  5D9T A;  3M3M A;  1CQH A;  1O8W A;  5ECS A;  2NDO A;  4DVC A;  4NV5 A;  2B7J A;  4LMW A;  4XRD A;  2K18 A;  2IL3 A;  2KUC A;  3FHK A;  4KGI A;  4DEJ A;  2F3M A;  1ERV A;  1B9X C;  2F9S A;  2GT5 A;  4MZW A;  5ECN B;  4ICY A;  4RQR A;  3EU4 A;  17GS A;  5ECL B;  4KH7 A;  4EXJ A;  2IMF A;  2H0I A;  3QOU A;  4XS6 A;  1K0C A;  1PRX A;  4FH8 A;  5G5F A;  5D96 A;  5EY6 A;  4GF0 A;  1V58 A;  2C3N A;  5ENU A;  2H6X A;  5DAK A;  1WP0 A;  2PER A;  3FK8 A;  1R7H A;  3QPM A;  4K0G A;  1W4V A;  5J9C A;  2X4A A;  3G7I A;  4K2X A;  2H6Z A;  2JSZ A;  4EIQ A;  2RII A;  1M99 A;  2CAI A;  3IK7 A;  3ZVJ A;  4OO4 A;  4FYC A;  2RM6 A;  3L0H A;  2A4V A;  3BJ5 A;  1FVJ A;  3UL3 A;  4K5R A;  1AC1 A;  2IIY A;  3C1R A;  2CV4 A;  4ML6 A;  4TRX A;  4K1F A;  5CRG A;  3EPT A;  1J0F A;  1FB6 A;  2YPM A;  4MNN A;  4N10 A;  2B3S A;  3GYK A;  4EDZ A;  3EMX A;  4FYU A;  3EWL A;  2HRF A;  2LRN A;  2OBI A;  5ECQ B;  2YAN A;  4MJC A;  1XVQ A;  3GX0 A;  1USB A;  2WFC A;  4IHU A;  4PNF A;  3KJY A;  3TKS C;  1OKT A;  4Q5N A;  1YKA A;  3ME8 A;  4PGT A;  13GS A;  4ZB8 A;  2G2Q A;  3J7Y b;  1GTU A;  2DBC A;  3QR6 A;  2YZU A;  2H0H A;  5KN3 A;  5KOW A;  1T4Z A;  1T00 A;  3VUR A;  3UIW A;  3UVT A;  1M9A A;  3APQ A;  3EYT A;  1JLW A;  1PL1 A;  2OAD A;  4LLR A;  4EC0 A;  3TJF A;  2X99 A;  4TN8 A;  4EUY A;  3IC8 A;  2F8F A;  3ERG A;  1GLP A;  3HHV A;  1XXU A;  3HD5 A;  1XBS A;  3UMA A;  4ML1 A;  5A5K A;  2KOK A;  4Z2R A;  5LNK e;  4BL7 A;  3UVH A;  2LTK A;  5IMF A;  4ZB9 A;  2C0D A;  1IYI A;  2LRT A;  2UZ8 A;  4I2U A;  4ACS A;  2V6O A;  6GST A;  2A2S A;  2OE3 A;  5AIX A;  2RLI A;  3VWX A;  1PKZ A;  1YY7 A;  5A4W A;  1A0F A;  3LOR A;  2P5Q A;  2BTO T;  4AJ8 A;  4K0N A;  3E0U A;  2K9F A;  2FUG 2;  1T3B A;  4QL9 A;  4TR0 A;  2R2J A;  1MTC A;  5DJL A;  3KMO A;  1NM3 A;  2WZ9 A;  4D73 B;  3DGQ A;  3IHQ A;  3LYK A;  4BVX A;  4CW9 A;  1A8Y A;  1J08 A;  3IRA A;  1PGT A;  2HZE B;  4I8B A;  2M72 A;  1BG5 A;  5CRE A;  5CYY A;  4K8M A;  4KX4 A;  2VLU A;  3VI5 A;  4NHZ A;  5DAL A;  2FGX A;  1SJI A;  2VAF A;  4TXO B;  2H0G A;  1UVZ A;  3C1S A;  2DIZ A;  2YJH A;  5F05 A;  2DJK A;  2BJX A;  2MZC A;  1SYR A;  2VCV A;  3P8W A;  3SBC A;  3FZ9 A;  4NHW A;  2LV3 A;  3ZML A;  8GSS A;  4ECJ A;  2KP1 A;  5G1K A;  3H79 A;  4NXI A;  4TXO A;  5F8B A;  1WPI A;  2OBK A;  2WCI A;  5ABR A;  2D2Z A;  2WUL A;  4USS A;  2WDU A;  1I9D A;  4I5Q A;  2V6K A;  2R37 A;  1VF3 A;  2I4A A;  3GTU B;  2YCD A;  3HZ8 A;  2H1B A;  3FZA A;  3IV4 A;  5JCU A;  4L5O A;  5B8B A;  1GUH A;  2XC2 A;  1NHO A;  3O3T A;  2GGT A;  4KND A;  5H5Q A;  2ZCT A;  2H73 A;  3VK9 A;  1EWX A;  1MD4 A;  2H19 A;  4OWY A;  5A4V A;  1TK0 B;  4Q5R A;  4YAV A;  4OFN A;  1JZO A;  3R2Q A;  1ST9 A;  3A5I A;  3AY8 A;  1QMV A;  2MMZ A;  3LSZ A;  3UBL A;  4BVY A;  3M9J A;  2HI7 A;  3CRT A;  9GSS A;  4RQX A;  5GAP D;  3PGT A;  3EU3 A;  1XCC A;  2NTO A;  4WET A;  3C7M A;  1F6M C;  1QFN A;  3ZYW A;  3TCO A;  3GSS A;  4O5U A;  3TJG A;  1XOB A;  1OC8 A;  4DSR A;  2ZUP A;  4GRF A;  5LCZ A;  3ZMK A;  3FZ4 A;  4PX1 A;  1T8E B;  3UJ1 A;  4ZBA A;  2X8G A;  4EKZ A;  2A4H A;  4OCE A;  2ON5 A;  1PMT A;  5HFK A;  4KUN A;  3APS A;  1QK8 A;  2C1Y A;  3NOF A;  5DCG A;  4IKH A;  2GS3 A;  4CY8 A;  1H75 A;  1LU4 A;  3KH7 A;  4E8H A;  1ZYP A;  3DKS A;  4RI6 A;  5G5E A;  3MSZ A;  1GUM A;  2A2P A;  2YJ7 A;  1K3L A;  3ZRD A;  1U88 A;  2WGR A;  4HQZ A;  4O5R A;  3DML A;  4POB A;  3TRX A;  2LRC A;  2VUP A;  1SKW B;  3G9B A;  1EEJ A;  4ECI A;  1F2E A;  2WB9 A;  4J2F A;  2E2M A;  4JZQ A;  3HKR A;  1EEM A;  3L9U A;  5GAN D;  1TRU A;  3P2A A;  2FD3 A;  1GTA A;  4O32 A;  1BED A;  3ZTL A;  1XWG A;  5CAX A;  5G31 A;  4Z2U A;  4PTS A;  4ECC A;  3HJM A;  3F4T A;  4XHM A;  4TXV A;  1M0U A;  3MNG A;  1ZYQ B;  2C3Q A;  3Q19 A;  1X9S B;  4GWR A;  1XWK A;  2FNO A;  3VPQ A;  3IE3 A;  3F3R A;  3EMP A;  1DUG A;  5KN2 A;  1GUL A;  4ZL7 A;  5IOW A;  4TR4 A;  3I6A A;  3PPU A;  2I81 A;  3FYG A;  2PN8 A;  1TRW A;  3VWV A;  4V2L A;  2HSY A;  2MBT A;  2NPB A;  4F82 A;  2OE0 A;  3LG6 A;  4AJ6 A;  3M9K A;  5A4U A;  2H1A A;  3ZRE A;  5B6N A;  3BBY A;  1N2A A;  5JCG A;  1PA3 A;  4G19 A;  1K0D A;  3ZZX A;  5CO3 A;  1S3A A;  3WGE A;  1HNC A;  4MZB A;  4QL7 A;  2GLR A;  4WR5 A;  4ISD A;  2AHE A;  1GNW A;  1YQ1 A;  3GX8 A;  4DSS A;  5HR1 A;  4GTU A;  1MDK A;  3E3E A;  4MA9 A;  4ZBB A;  3TRQ A;  1ABA A;  4HS1 A;  5HFI A;  1ML6 A;  1O7U A;  5EL8 A;  4X4J A;  1QUW A;  3HJO A;  1AIU A;  2Z9S A;  1A0R P;  2VM1 A;  2CZ2 A;  5ECP B;  3HY2 A;  1AQV A;  4WR4 A;  4HEA 2;  2N5B A;  5BMU A;  5AN1 A;  5DAK B;  5ECI B;  12GS A;  3F4S A;  4K7I A;  1XPV A;  3LEF A;  4AF2 A;  2HXK A;  14GS A;  4XTS A;  3ZIV A;  3WGD A;  4RUV A;  3GL3 A;  2C3T A;  4N0Z A;  3D22 A;  1TDI A;  3UAR A;  1OKD A;  5IPG A;  3W6G A;  1JZR A;  3KP8 A;  2H76 A;  3TOU A;  3IK9 A;  1A2L A;  1KBN A;  3HDC A;  4HJ2 A;  2DJJ A;  3KTL A;  1DE1 A;  2IMI A;  3KEB A;  3GRX A;  1X5C A;  2B5X A;  5HFG A;  2VCQ A;  4L5L A;  1K0M A;  3TJK A;  4EVM A;  4F2I A;  4PQH A;  4CDO A;  3H93 A;  2VM2 A;  1OE7 A;  3BCI A;  3ZL5 A;  5G30 A;  5F07 A;  4NWY A;  3PIN A;  3LQ7 A;  2MYG A;  2JU5 A;  4BWS A;  1GSD A;  1TU7 A;  5HR0 A;  2DJ1 A;  2GTU A;  4POL A;  2B6M A;  1VGL A;  2O85 A;  3DD3 A;  1TJD A;  3GMF A;  1OYJ A;  4NAX A;  2IFQ A;  2HFD A;  1SEN A;  3ME7 A;  2MMO A;  5COH A;  4GSN A;  1GNE A;  4JBB A;  1EOH A;  1FOV A;  2LQO A;  3D4M A;  2HT9 A;  1Z3E A;  5DQS A;  3A2W A;  2R0C A;  1B8X A;  1XWC A;  3GA4 A;  1JFU A;  3RBT A;  4KCE A;  1EP8 A;  1SK0 A;  5INY A;  3WT1 A;  5IIZ A;  3M1G A;  3FEU A;  3TKR A;  4IP6 A;  1GSU A;  2TIR A;  1ERW A;  3N9J A;  3KMN A;  2L6D A;  5B8A A;  4GQF A;  4PQ1 A;  2DKH A;  4G10 A;  4BL7 B;  2BMX A;  3HVV A;  1YZX A;  2V2G A;  5AGY A;  3MIX A;  2R3X A;  1SKR B;  2JL4 A;  5D9V A;  2FA4 A;  4FO5 A;  1F3A A;  4IJ3 A;  5D9X A;  4L0W A;  4AJ7 A;  4AGS A;  3Q6O A;  2ALB A;  5JWQ B;  1ON4 A;  2PWJ A;  5CP1 A;  4J57 E;  3IOS A;  3IHG A;  3E9J B;  3IBH A;  2YN1 A;  1XWB A;  1EOG A;  3CSH A;  5HR2 A;  2DLX A;  2LJR A;  5C04 A;  4CY6 A;  1TTZ A;  2H30 A;  1VF2 A;  2B5E A;  2IMD A;  2K8V A;  4BVX B;  3TB2 A;  4HJM A;  1S3C A;  2EIO A;  4POM A;  1H4O A;  2RUF A;  1XVW A;  1AXD A;  3CXG A;  5IO0 A;  4POK A;  1ZCP A;  1C72 A;  2FY6 A;  4IEL A;  5DAL B;  3FY7 A;  3CTF A;  3KH9 A;  1OC9 A;  1I5G A;  2KP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...