1HD2A

Human peroxiredoxin 5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
161
structure length
161
Chain Sequence
APIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antioxidant enzyme
molecule keywords PEROXIREDOXIN 5 RESIDUES 54-214
publication title Crystal Structure of Human Peroxiredoxin 5, a Novel Type of Mammalian Peroxiredoxin at 1.5 A Resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 161
sequence length 161
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2000-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1hd2A00
4WF4A 2NDOA 3GSSA 1J9BA 2GLRA 4EL1A 4MH3A 5C00A 2C0DA 1B8XA 2M72A 4KB3A 1TI3A 3C71A 1XWGA 1M2BA 4ZB6A 5ECSA 1TXXA 1BYEA 2CX4A 4XCSA 1KEBA 3KXOA 4TR0A 2KLXA 3BCIA 4YAPA 16GSA 1BJXA 1I5GA 2TIRA 2GT6A 1J08A 2GS3A 2C8UA 2R3XA 4EF0A 2CAIA 2N5AA 2QKEA 1HNBA 2IFQA 3ZREA 1UN2A 5J3RA 2H19A 1JZDA 5IMVA 18GSA 1Y25A 5CP1A 1V58A 2EIQA 2AB6A 2B5XA 2LJKA 4MABA 3DD3A 5EVOA 2XPEA 2QGVA 3DKSA 3CBUA 3WT2A 3APOA 1SD9A 3UMAA 2LNTA 3ZVJA 3KZQA 1SL1B 4I8BA 4GRFA 6GSWA 3KP8A 5F05A 2DJKA 2LJRA 2YOIA 2H8LA 1V2AA 3HJOA 2V6KA 5DBQA 2R6KA 5A4UA 1AIUA 2H6XA 3QOUA 4N10A 2B5YA 5DQSA 5ECHB 4EKZA 4MZWA 4HU9A 5GZZB 2EC4A 1OKDA 2QSIA 5DALA 4KH7A 2B3SA 4OCEA 4ECCA 2C0GA 5ELAA 4ZILA 2LS5A 4NHZA 1M0UA 3WGDA 2MMAA 1ACVA 2VIMA 2HSHA 3APQA 3P2AA 3GUSA 4BWQA 4N11A 2V1MA 1EOHA 3QDNA 2E2MA 4RI6A 4IVFA 7GSSA 3QFBC 2B6MA 1K3YA 5LNKe 3A2VA 3CSHA 1XW6A 2K9FA 3IAS2 3ZRDA 5DJLA 2YZUA 4EXJA 3HVSA 1WOUA 4PURA 1K3LA 1EV9A 3DVXA 3G7YA 1HQOA 1T8EB 1XWCA 1XWKA 1TU8A 4MA9A 2JADA 2M46A 5IMZA 4LMWA 2PUKC 2H6YA 4MPFA 2VCZA 3GV1A 1EZKA 3P7XA 2H76A 3VK9A 2DJJA 5HR0A 4XHMA 3RHCA 3TOUA 1T4YA 4H86A 3VWXA 4E8HA 3G7IA 5D9VA 3FKFA 1JZRA 3FR6A 1M7TA 1H4OA 2GGTA 1ZGNA 1OC9B 4JE1A 4CHSA 3GL3A 2AYTA 4XTSA 4IW9A 3I6AA 1KTEA 1ERUA 3KTBA 4PX1A 1F37A 1Z3EA 1A2JA 3DRNA 4DSQA 5D9TA 5HFGA 3ZZXA 1PD21 3TKRA 3DYRA 4GQFA 4TRXA 1K0AA 3GHAA 4G10A 1SKWB 2H1DA 5IQYA 1VF4A 1DUGA 1M9BA 4IKHA 1NW2A 2CQ9A 4PUFC 2HFDA 4YH2A 4NHWA 2HI7A 1MD3A 3U6VA 1Y6EA 4BVXA 1RQMA 1X9WB 4KW6A 1ERTA 3LWAA 1SYXA 3HA9A 4F0BA 4FYBA 2CAQA 2X8HA 2JZTA 2FA8A 4RQRA 1G0TA 3IAM2 3VWWA 3D22A 3TJKA 1XCCA 1AUCA 1A23A 4ML1A 3HZ4A 3IDVA 4PQ1A 2JSYA 2C0FA 5G2ZA 5JWQB 3SWLA 2G2QA 4L0UA 3TRPA 4OFNA 4QL9A 3P8WA 3IRAA 4OCFA 1EWXA 2JSZA 2ZUPA 2I81A 4ZIJA 4EDZA 4FO5A 2X8GA 2B5EA 4N0ZA 1GWCA 2PN8A 2H73A 4X43A 1GSQA 4WR4A 1SL2B 3HXSA 4GF0A 2PBJA 2VCTA 4AJ7A 2EIRA 3VFIA 2JU5A 1THXA 1PN9A 2VAFA 2DIZA 1BEDA 3RBTA 4BA7A 1B9YC 2DLXA 2F8FA 6GSYA 4D73A 2ON7A 2B1KA 2OACA 3RAZA 5KN2A 1Z7PA 1Q4JA 1QQ2A 3TB2A 3CRUA 4TKYA 2VLVA 2DBCA 1MEKA 2H0GA 5G30A 4YQVA 1YDKA 1HD2A 1HYUA 2E0QA 2H30A 5HQPA 5E59A 5ECNB 2WJUA 1YEXA 5JWRB 3BBYA 4V2NA 2LV3A 1MTCA 4WF5A 1VGLA 3BD2A 4ISDA 1BQ7A 2L6DA 5A5KA 2VCQA 2L4CA 1ZYEA 1MD4A 4KDYA 3LYPA 1U3AA 1UC7A 1GLQA 1URMA 4JU5A 2L59A 4QQ7A 2N5FA 4NV5A 3LGCA 2CT6A 2DIYA 2TRCP 1T4ZA 2HZFA 1M2AA 4ZBAA 2DJ3A 5ECRB 2ZCTA 3D21A 4PNGA 4OD7A 5CRWA 3EYTA 3KMNA 2D2ZA 5J9BA 4I2UA 4L8EA 1X9SB 5ECIB 4MZCA 2ON5A 3GIXA 3N5OA 1FVJA 1S3AA 2YWMA 11GSA 3HHVA 1R5AA 1PKWA 2G0FA 4HEA2 4K8MA 1F2EA 3QMXA 2PU9C 3FW2A 2V2GA 4I2TA 1GNWA 4IHUA 2WRTA 1SJIA 4XRAA 4QL7A 1SK0A 2YJHA 1T3BA 1GP1A 3CTGA 4N0VA 3TKSC 1PX6A 2IMIA 3KEBA 4LL1B 3UJ1A 1F9MA 2CVKA 1T00A 2NVLA 1X9MB 1YF0A 6GSVA 3KGKA 4O5RA 5FT3A 1GTAA 5J5NA 4GLTA 4HI7A 4TOPA 4IJ3A 5HFIA 1GTBA 5IPHA 5H5SA 2RUEA 2MZCA 3UOMA 3IPZA 3C8EA 3GX0A 2FWFA 5LD0A 3RPPA 5GAND 5CAXA 4PQHA 4HOJA 3GURA 5IPGA 2NBSA 2R2JA 3KTLA 4MK3A 2A2RA 1OC8A 1BG5A 2HSYA 4NAXA 3C1RA 4I97A 1SENA 12GSA 1VF3A 2C3QA 4IN0A 3O3TA 1DE2A 3ZL5A 1GTIA 5B6NA 1F3BA 3ZVJD 1TOFA 1A2LA 1ERVA 3ED3A 2IWTA 3GKXA 1WWJA 1ON4A 1IYHA 1O8XA 1YY7A 1GSEA 6GSUA 4KUNA 1CQGA 4E8EA 2OJLA 3VLNA 4AF2A 2N5BA 5G1KA 1B4PA 4ZB9A 2WGRA 2F8AA 1H75A 1GSFA 4MJEA 2FD3A 1R5PA 4V1Ag 4WBJA 4POBA 1PL2A 1K0MA 2ES7A 3GFKA 1OVNA 2LKUA 5CRGA 1O73A 3EMPA 1F3AA 4KGIA 4IGJA 4LLRA 4ECBA 3MNGA 2AHEA 1XIYA 1WMJA 2RIIA 5DCHA 3H4KA 1V9WA 1SJ6A 4MJBA 4IP1A 2LUSA 2XPDA 2P31A 3Q19A 4F2IA 2VD1A 2OA7A 1V40A 2KUCA 1G7EA 1FB0A 5IO2A 5CO3A 5GAPD 4GSTA 2DSAA 5JWOB 4X0XA 5IOWA 3EMXA 2PMTA 4MJAA 5A4VA 1PSQA 2R37A 2WB9A 1LJRA 2YNXA 5F0GA 1A0RP 3TRQA 2OADA 2X8CA 4WEYA 3IBHA 1JLVA 2VOCA 3F9UA 2HRNA 2BTOT 2XBQA 3QPMA 4LA1A 3J7Yb 1E2YA 1OKTA 1PRXA 1W4VA 3IC4A 4IBPA 3MAKA 3FZAA 2CVBA 2REMA 2PWJA 4XS6A 3D4MA 1SU9A 4N30A 3L4NA 3EE2A 1B9XC 2H01A 4BWSA 4G2EA 2FLSA 1K0CA 4EUYA 4GCIA 3IA1A 3TKSA 2YWOA 5HR2A 4WXTA 3ERFA 3KMOA 2NTOA 4Q5QA 3Q18A 1TI1A 5AIVA 3GRXA 4HZ4A 3F4RA 3GKKA 4P3YB 2O7KA 4TR4A 2VM1A 5DVBA 1W89A 1YKCA 1NM3A 2AV4A 3QAWA 3KCMA 4JR4A 1UVZA 2LTKA 3GH6A 4F9ZA 4K2DA 4V2MA 1PA3A 4WKWA 3GKMA 2H75A 5AGYA 1OE7A 4GXZA 1XXUA 3GKNA 2YN1A 3GSTA 3W6GA 2FGXA 2WFCA 3FZ5A 1DBYA 2JZRA 1R7HA 1A0FA 5IMDA 4YQUA 1FB6A 3H79A 5B8AA 4K7IA 4ECIA 1Z6NA 4MP4A 2IPAA 1EP8A 1U6TA 4IQ1A 4JZQA 4GQCA 5ID2A 1B48A 2ALBA 1TRSA 1X5CA 4MCUA 3HD5A 2GQKA 5G31A 1XBSA 4KE3A 2AAWA 3SBCA 3UBLA 4KDUA 2OBKA 3QAGA 5ID2B 2NPBA 3UARA 4ACSA 3J7Yk 2L5OA 1SKRB 3DIEA 2CA8A 1OC9A 2MMZA 4HS1A 4OFMA 4Z7XA 3ZITA 1GUKA 2OBIA 5D9XA 5D8IA 4V2LA 3UL3A 4HDEA 5D93A 2GZYA 3HJMA 1XFLA 4MDCA 3F4TA 4KAEA 3G9BA 3LXTA 2F3MA 1FAAA 5LCZA 5IMCA 2LRNA 1WPIA 3FHKA 5GSTA 4MJCA 1IYIA 4PUAA 3CYNA 3ZMLA 1TKDB 4TN8A 4ZL9A 4OO4A 3PGTA 2I4AA 2YWNA 3NZNA 1TK8B 3GX8A 1E6BA 5AISA 1TW9A 3M9JA 1J0FA 5D9WA 3G7JA 2V32A 2RLIA 4WBRD 5L71A 2HYXA 4L5OA 1SK1A 1M2DA 1O8WA 1XOBA 3H93A 1K0NA 2VCWA 3CSJA 5IOXA 1T7PB 2AJQB 2QC7A 6GSXA 3V1WA 3GH9A 20GSA 1AQVA 3TGZA 1TP9A 5B8BA 2H72A 1A2MA 1GSSA 3BJ5A 3I43A 3TJFA 2K6VA 1PL1A 5C04A 2OE3A 3QD9A 4J2FA 4J56E 3TDGA 5G5FA 1X5DA 1JFUA 1O85A 2GZZA 5HR3A 2PVQA 4PXOA 1BAYA 3M0FA 3S9FA 1XVWA 2WS2A 1QK8A 5KN1A 3ZIVA 4EVMA 2FY6A 1NHOA 3CSIA 2RM6A 3CMIA 3D6IA 3H1NA 1Z7RA 2WZ9A 1MDJA 2FUG2 2A2SA 3F3QA 4TXOA 2H1AA 1G7OA 4JR6A 3GN3A 5JCWA 4PNFA 2GDRA 1MDKA 2IL3A 3FR9A 4ECJA 2E2GA 1RW1A 2YJ7A 3IE3A 1S3CA 2MBSA 2BJXA 2J23A 3FR3A 4TXOB 4PQIA 1MDIA 4LL4B 3VPQA 1TU7A 4MZBA 2M80A 1O81A 4J57E 4POKA 3IHQA 3TRXA 2PVOC 1OYJA 4HUAA 5ECLB 2FA4A 2H6ZA 3DGQA 2CX3A 3ZMKA 1AW9A 4AJ6A 2H66A 3IV4A 3FEUA 5CRHA 1XVQA 4TVEA 4LMVA 2XC2A 3L9SA 4XIHA 2ZNMA 4FIWA 2R4VA 4I5QA 3FK8A 3ME7A 4EDYA 1EEMA 1GUMA 3DWVA 5IIZA 3TCOA 4BPYA 2DMLA 1M9AA 5AIXA 2O8VB 5DJMA 3GTUB 5GSSA 1AQWA 4HU7A 1QGVA 4DVCA 2MYGA 1RK4A 5G1LA 1LBKA 2IJYA 4KX4A 5CNWA 1ZOFA 1QFNA 2IIYA 1YZXA 1FW1A 3HZ8A 3GNJA 1JZWA 2YV7A 5B6MA 5FWGA 4F0CA 2JZSA 2JACA 5ECQB 2I9HA 2DMMA 1DSBA 4G19A 1TRWA 4O92A 2VLTA 2FNOA 2WCIA 1WRYA 1XOAA 3RPNA 3VWVA 1EGOA 4ZB8A 2LQQA 2J9HA 5E4WA 3I9V2 3QFAC 2VCVA 3EINA 4RQXA 2L6CA 1UA5A 3UVTA 3GYKA 3LXZA 3CTFA 2VO4A 1PX7A 1XWBA 3HDCA 3UAPA 4OWYA 2H74A 3TOTA 4POMA 19GSA 1AQXA 1ERWA 2DC5A 3L0HA 2E7PA 3TJJA 1C72A 1CQHA 2WULA 2MBTA 2YPMA 4OMVA 2O89A 1TJDA 2A4VA 1THOA 1YJ6A 1XW5A 4WETA 2H0HA 4O7HA 3VPTA 3TJBA 3APSA 4ZXGA 3ZFBA 2LNSA 6GSSA 2K18A 2HZEA 1WE0A 1PKZA 2YZHA 4ILFA 1ST9A 2VL2C 1ML6A 1ZMAA 10GSA 5ELGA 4G9HA 3BOAA 4JBBA 4KCAA 5AN1A 3DXBA 2IMFA 3C73A 2DJ2A 3CXGA 1EP7A 2HZEB 4KNDA 5B7CA 2VLUA 1NSWA 4CW9A 2CV4A 1TRUA 3FZ4A 4V1Ap 3F8UA 3K8NA 1JHBA 4DSSB 2RM5A 4K7OA 4BVYA 5JCUA 3ERGA 3KH9A 1SKSB 3IXRA 5EY6A 17GSA 3W8JA 2OE1A 1M99A 5ECMB 3L9UA 3ME8A 1USBA 2OKAA 5INYA 4K0GA 1U87A 4XS1A 4NV2A 5J9CA 4HJ2A 1TDIA 4TR1A 4ULXA 1QMVA 1FO5A 1T1VA 3D0ZA 3M8NA 3ZTLA 4EO3A 3R2QA 2C4JA 8GSSA 3BCKA 4MLYA 1HNAA 3I69A 3KD0A 3TKPA 1B4QA 3A5WA 1TK0B 4YAVA 4TR1B 3C1SA 4X1UA 3HVVA 4PGTA 1KBNA 5EPFA 1GRXA 2B1LA 4HJMA 3F63A 5HFKA 3O76A 1JLWA 6GSTA 2YCDA 3PH9A 2IFQB 3TJGA 1V98A 1GL8A 2GVPA 5J4UA 5CYYA 5KEJA 2MMNA 4IELA 4DEJA 4YQMA 1EOGA 5CRDA 4HZ2A 4BL7A 3VI5A 2C80A 1LU4A 3QAVA 2MMOA 4K0NA 2V41A 3D4TA 1HNCA 4EE0A 4XRDA 5A4WA 2HNLA 2I3YA 2L4QA 2K8VA 5IMFA 4JEDA 1GNEA 2I1UA 3FZ9A 2GTUA 4MF7A 3MDKA 4NMUA 1BX9A 1ABAA 4ZL8A 1FG4A 1R26A 5D73A 2HT9A 1OAZA 2O87A 5JCGA 1QUWA 3A3TA 3LSZA 1A8LA 1FVKA 4MMMA 5ECPB 5FHIA 3F6DA 3W8SA 5H5RA 5IMAA 2CVDA 2DJ0A 4I6XA 3VWUA 5DALB 2KOKA 5KN0A 4KCEA 1PGTA 3RHBA 22GSA 4FH8A 1FOVA 1N2AA 3C7MA 2C1YA 4O32A 1X5EA 2H1BA 3LQ7A 2XBIA 3LG6A 4HQZA 2VL2A 1XPVA 4Q5RA 3NOFA 4ID0A 4K6XA 2C3NA 2IMEA 2HRFA 3L9VA 3FY7A 2VCXA 1SJZA 2IMKA 5DAKA 2P5QA 2HE3A 1TK5B 1DE1A 3AY8A 2H0IA 3LYKA 3QCPA 4AJ8A 3HCZA 5D96A 1QXHA 3EU4A 3KIJA 1YKAA 3WT1A 4TR3A 2LSTA 1GLPA 4IS0A 5DAKB 2YV9A 1WP0A 5CREA 2VUPA 2LQOA 1AXDA 1A8YA 3WGXA 2H1GA 3EWLA 2GQLA 2GSRA 1VF2A 5ECKB 3D5JA 4TXVA 3ERWA 4K1FA 3ZFLA 1GUHA 3HY2A 5IO0A 2B7JA 1EGRA 1GH2A 3US3A 5DDLA 4L5LA 4F82A 3VURA 5H5QA 3A2WA 3LORA 2HXKA 2PPTA 1Z6MA 2WDUA 4HQSA 1WIKA 4OFTA 4MPGA 4NXIA 2XHFA 1R4WA 1K3OA 4POLA 5EL8A 3OR5A 1X0RA 1EV4A 4MH2A 5G5EA 2C3TA 3N9JA 14GSA 3WGEA 3HKRA 4ZBDA 3HVXA 3DEXA 3PINA 2F51A 5IM9A 3EVIA 2L5LA 3IK7A 1GSDA 2PERA 3M3MA 1ILOA 3CRTA 4ZL7A 4FYUA 3ISOA 3GMFA 4EC0A 2KP2A 2YWIA 3DMLA 2DJ1A 4TW5A 2FWGA 2GT5A 2LRCA 4GSNA 3IR4A 2R5GA 4MF6A 2VD0A 1K0DA 9GSSA 2C0EA 5F8BA 4IQAA 5DQYA 2L57A 3Q74A 1K0BA 1S3DA 3IOSA 3WD6A 2O85A 2KHPA 2X64A 3ZLPA 2TRXA 1Z5YE 3F6FA 2CZ2A 3GL5A 3E0UA 2JL4A 3PR8A 4RUVA 4GTUA 3M1GA 2P0GA 3WYWA 3HJPA 3HYPA 2BMXA 3F4SA 3UEMA 1XW9A 4Q5NA 5COHA 2LRTA 1WJKA 2F9SA 3LFLA 4AGSA 3FRCA 1A24A 4IP6A 3GTUA 3GA4A 1YEPA 5F07A 2V6OA 4WR5A 4D73B 1Z9HA 1O7UA 2GSTA 2K8SA 3L78A 4KSOA 2VL3A 4FYCA 1XWAA 5DCGA 2RUFA 1GSYA 3VI7A 3FYGA 3H8QA 3ZIJA 1VF1A 4ML6A 5ECOB 3RDWA 3MSZA 1FHEA 3EC3A 3E9JB 2H71A 2CZ3A 4Q5FA 3A2XA 1TTZA 2IMDA 4K9ZA 3TKQA 1G6WA 1YQ1A 2GSQA 1KNGA 3UBKA 2X99A 1ZZYA 3QR6A 2FWEA 1AC1A 3NIVA 4GSSA 4IJIA 2IN3A 4ZBBA 3EURA 1JZOA 2H70A 1VRSD 1N8JA 5HR1A 1G6YA 1ZYQB 3EU3A 3LJRA 2YP6A 4NWYA 3ZYWA 1PQNA 1U88A 3KJYA 3E3EA 4DSRA 2GQMA 2VL9A 4L0WA 1AAZA 5ABRA 1ZL9A 4KA0A 4MF5A 3M9KA 4GWRA 4XS4A 2VM2A 1SK2A 3KH7A 3U5RE 4RI7A 4F03A 4OO5A 2GZPA 5F06A 1SYRA 1V57A 1GSUA 2AUVA 2OE0A 1K0OA 3JCML 2GSSA 1I9DA 2LEGA 1GULA 2B7KA 3UVHA 1OE8A 4JRRA 4XS4B 5KN3A 1SL0B 1U3IA 2HLSA 1O6JA 3TUEA 2YANA 5J41A 1PMTA 1EEJA 3DVWA 3KM6A 1F6MC 1OC3A 3O6TA 1ZCPA 3F0IA 3Q6OA 4K7NA 1TRVA 4NPBA 2FWHA 3F3RA 2FHEA 3MWHA 2EIOA 2FCHA 2LJAA 3KP9A 4DSSA 3LEFA 3UIWA 3IK9A 2KP1A 4CDOA 1GTUA 4KSMA 1Q98A 1SD8A 4KDXA 1XZOA 5ENUA 3TKSE 2P5RA 2PGTA 13GSA 1NHYA 1YF1A 2Z9SA 3P90A
chains in the Genus database with same CATH superfamily
4WF4A 2NDOA 3GSSA 5KOXA 1J9BA 2GLRA 4EL1A 4MH3A 5C00A 2C0DA 1B8XA 2A2PA 1FOHA 2M72A 4KB3A 1TI3A 3C71A 1XWGA 1M2BA 4ZB6A 5ECSA 1TXXA 1BYEA 2CX4A 4XCSA 1KEBA 3KXOA 4TR0A 2KLXA 3BCIA 4YAPA 16GSA 1BJXA 1I5GA 2TIRA 2GT6A 1J08A 2GS3A 2C8UA 2R3XA 4EF0A 2CAIA 2N5AA 2QKEA 1HNBA 2IFQA 3ZREA 1UN2A 5J3RA 2H19A 1JZDA 5IMVA 18GSA 1Y25A 5CP1A 1V58A 2EIQA 2AB6A 2B5XA 2LJKA 4MABA 3DD3A 5EVOA 2XPEA 2QGVA 3DKSA 3CBUA 3WT2A 3APOA 1SD9A 3UMAA 2LNTA 3ZVJA 3KZQA 1SL1B 4I8BA 4GRFA 6GSWA 3KP8A 5F05A 2DJKA 2LJRA 2YOIA 2H8LA 1V2AA 3HJOA 2V6KA 5DBQA 2R6KA 5A4UA 1AIUA 2H6XA 3QOUA 4N10A 2B5YA 5DQSA 5ECHB 4EKZA 4MZWA 4HU9A 5GZZB 2EC4A 1OKDA 2QSIA 5DALA 4KH7A 2B3SA 4OCEA 4ECCA 2C0GA 5ELAA 4ZILA 2LS5A 4NHZA 1M0UA 3WGDA 2MMAA 1ACVA 2VIMA 2HSHA 3APQA 3P2AA 4BWQA 4N11A 2V1MA 1EOHA 3QDNA 2E2MA 4RI6A 4IVFA 7GSSA 4USSA 3QFBC 2B6MA 1K3YA 4G0KA 5LNKe 3A2VA 3CSHA 1XW6A 2K9FA 3IAS2 3ZRDA 5DJLA 2YZUA 4EXJA 3HVSA 1WOUA 4PURA 1K3LA 1EV9A 3DVXA 3G7YA 1HQOA 5KOWA 1T8EB 1XWCA 1XWKA 1TU8A 4MA9A 2JADA 2M46A 5IMZA 4LMWA 2PUKC 2H6YA 4MPFA 2VCZA 3GV1A 1EZKA 3P7XA 2H76A 3VK9A 2DJJA 5HR0A 4XHMA 3RHCA 3TOUA 1T4YA 5BRTA 4H86A 3VWXA 4E8HA 3G7IA 5D9VA 3FKFA 1JZRA 3FR6A 1M7TA 1H4OA 2GGTA 1ZGNA 1OC9B 4JE1A 4CHSA 3GL3A 2AYTA 4XTSA 4IW9A 3I6AA 1KTEA 1ERUA 3KTBA 4PX1A 1F37A 1Z3EA 1A2JA 3DRNA 4DSQA 5D9TA 5HFGA 3ZZXA 1PD21 3TKRA 3DYRA 4GQFA 4TRXA 1K0AA 3GHAA 4G0LA 4G10A 1SKWB 2H1DA 5IQYA 1VF4A 1DUGA 1M9BA 4IKHA 1NW2A 2CQ9A 4PUFC 2HFDA 4YH2A 4NHWA 2HI7A 4CY8A 1MD3A 3U6VA 1Y6EA 4BVXA 1RQMA 1X9WB 4FQUA 4KW6A 1ERTA 3LWAA 1SYXA 3HA9A 4F0BA 4FYBA 2CAQA 2X8HA 2JZTA 2FA8A 4RQRA 1G0TA 3IAM2 3VWWA 3D22A 3TJKA 1XCCA 1AUCA 1A23A 4ML1A 3HZ4A 3IDVA 4PQ1A 4YKFA 2JSYA 2C0FA 5G2ZA 5JWQB 3SWLA 2G2QA 4L0UA 3TRPA 4OFNA 4QL9A 3P8WA 3IRAA 4OCFA 1EWXA 2JSZA 2ZUPA 2I81A 4ZIJA 4EDZA 4FO5A 2X8GA 2B5EA 4N0ZA 2QA1A 1GWCA 2PN8A 2H73A 4X43A 1GSQA 4WR4A 1SL2B 3HXSA 4GF0A 2PBJA 2VCTA 4AJ7A 2EIRA 3VFIA 2JU5A 1THXA 1PN9A 2VAFA 2DIZA 1BEDA 3RBTA 4BA7A 1B9YC 2DLXA 2F8FA 6GSYA 4D73A 2ON7A 2B1KA 2OACA 3RAZA 5KN2A 1Z7PA 1Q4JA 1QQ2A 3TB2A 4TKYA 3CRUA 2VLVA 2DBCA 1MEKA 2H0GA 2R0CA 4G0IA 5G30A 4YQVA 1YDKA 1HD2A 1HYUA 2E0QA 2H30A 5HQPA 5E59A 5ECNB 2WJUA 1YEXA 5JWRB 3BBYA 4V2NA 2LV3A 1MTCA 4WF5A 1VGLA 3BD2A 4ISDA 1BQ7A 2L6DA 5A5KA 2VCQA 2L4CA 2A4HA 1ZYEA 1MD4A 4KDYA 3LYPA 1U3AA 1UC7A 1GLQA 1URMA 4JU5A 2L59A 4QQ7A 2N5FA 4NV5A 3LGCA 2CT6A 2DIYA 2TRCP 1T4ZA 2HZFA 1M2AA 4ZBAA 2DJ3A 5ECRB 2ZCTA 3D21A 4PNGA 4OD7A 5CRWA 3EYTA 3KMNA 2D2ZA 5J9BA 4I2UA 4L8EA 1X9SB 5ECIB 4MZCA 2ON5A 3GIXA 3N5OA 1FVJA 1S3AA 2YWMA 11GSA 3HHVA 1M3JA 1R5AA 1PKWA 2G0FA 4HEA2 4Z2UA 4K8MA 1F2EA 3QMXA 2PU9C 3FW2A 2V2GA 4I2TA 1GNWA 4IHUA 2WRTA 1SJIA 4XRAA 4QL7A 1SK0A 2YJHA 1T3BA 1GP1A 3CTGA 4N0VA 3TKSC 1PX6A 2IMIA 3KEBA 4LL1B 3UJ1A 1F9MA 2CVKA 1T00A 2NVLA 1X9MB 1YF0A 6GSVA 3KGKA 4O5RA 5FT3A 1GTAA 5J5NA 4GLTA 4HI7A 4TOPA 4IJ3A 5HFIA 1GTBA 5IPHA 5H5SA 2RUEA 2MZCA 3UOMA 3IPZA 3C8EA 3GX0A 2FWFA 1PFOA 5LD0A 3RPPA 4O5UA 5GAND 5CAXA 4PQHA 4HOJA 3GURA 5IPGA 2NBSA 2R2JA 1ZYNA 3KTLA 4MK3A 2A2RA 1OC8A 1BG5A 2HSYA 1XG8A 4NAXA 3C1RA 4I97A 1SENA 12GSA 1VF3A 2C3QA 4IN0A 3O3TA 4BIKA 1DE2A 3ZL5A 1GTIA 5B6NA 3PPUA 1F3BA 3ZVJD 1TOFA 1A2LA 1ERVA 3ED3A 2IWTA 3GKXA 1WWJA 1ON4A 1IYHA 1O8XA 1YY7A 1GSEA 6GSUA 4KUNA 1CQGA 4E8EA 2OJLA 3VLNA 4AF2A 2N5BA 5G1KA 1B4PA 4ZB9A 2WGRA 2F8AA 1H75A 1GSFA 4MJEA 2FD3A 1R5PA 4V1Ag 4WBJA 4POBA 1PL2A 1K0MA 2ES7A 3GFKA 1OVNA 2LKUA 5CRGA 1O73A 3EMPA 1F3AA 4KGIA 4IGJA 4LLRA 4ECBA 3IHGA 3MNGA 2HRAA 2AHEA 1XIYA 1WMJA 2RIIA 5DCHA 3H4KA 1V9WA 1SJ6A 4BVYB 4MJBA 4IP1A 2LUSA 2XPDA 2P31A 3Q19A 4F2IA 2VD1A 2OA7A 1V40A 2KUCA 1G7EA 1FB0A 5IO2A 5CO3A 5GAPD 4GSTA 2DSAA 5JWOB 4X0XA 5IOWA 3EMXA 2PMTA 4MJAA 5A4VA 1PSQA 2R37A 2WB9A 1LJRA 2YNXA 5F0GA 1A0RP 3TRQA 2OADA 2X8CA 4WEYA 3IBHA 1JLVA 2VOCA 3F9UA 2HRNA 2BTOT 2XBQA 3QPMA 4LA1A 3J7Yb 1E2YA 1OKTA 1PRXA 1W4VA 3IC4A 4IBPA 3MAKA 3FZAA 2CVBA 2REMA 2PWJA 4XS6A 3D4MA 1SU9A 4N30A 3L4NA 3EE2A 1B9XC 2H01A 4BWSA 4G2EA 2FLSA 1K0CA 4EUYA 4GCIA 3IA1A 5BMUA 3TKSA 2YWOA 5HR2A 4WXTA 3ERFA 3KMOA 4A5PA 2NTOA 4Q5QA 3Q18A 1TI1A 5AIVA 3GRXA 4HZ4A 3F4RA 3GKKA 4P3YB 2O7KA 4TR4A 2VM1A 5DVBA 4BL7B 1W89A 1YKCA 1NM3A 2AV4A 3QAWA 3KCMA 4JR4A 1UVZA 2LTKA 3GH6A 4F9ZA 4K2DA 4V2MA 1PA3A 4WKWA 3GKMA 2H75A 4K5RA 5AGYA 1OE7A 4GXZA 1XXUA 3GKNA 2YN1A 3GSTA 3W6GA 2FGXA 2WFCA 3FZ5A 1DBYA 2JZRA 1R7HA 1A0FA 5IMDA 4YQUA 1FB6A 3H79A 5B8AA 4K7IA 4ECIA 1Z6NA 4MP4A 2IPAA 1EP8A 1U6TA 4IQ1A 4JZQA 4GQCA 5ID2A 1B48A 2ALBA 1TRSA 1X5CA 4MCUA 3HD5A 2HSMA 2GQKA 5G31A 1XBSA 4KE3A 2AAWA 3SBCA 3UBLA 4KDUA 2OBKA 3QAGA 5ID2B 2NPBA 3UARA 4ACSA 3J7Yk 2L5OA 1SKRB 3DIEA 2CA8A 1OC9A 2MMZA 4HS1A 4OFMA 4ICYA 4Z7XA 3ZITA 1GUKA 2OBIA 5D9XA 5D8IA 4V2LA 3UL3A 4HDEA 5D93A 2GZYA 3HJMA 1XFLA 4MDCA 3F4TA 4KAEA 3G9BA 3LXTA 2F3MA 1FAAA 5LCZA 5IMCA 2LRNA 1WPIA 3FHKA 1M3IA 1S3RA 5GSTA 4MJCA 1IYIA 4PUAA 3CYNA 3ZMLA 1TKDB 4TN8A 4ZL9A 4OO4A 3PGTA 2I4AA 4KF9A 2YWNA 3NZNA 1TK8B 3GX8A 1E6BA 5AISA 1TW9A 3M9JA 1J0FA 3A5IA 5D9WA 3G7JA 2V32A 2RLIA 4WBRD 5L71A 2HYXA 4L5OA 1SK1A 1M2DA 1O8WA 1XOBA 3H93A 1K0NA 2VCWA 3CSJA 5IOXA 1T7PB 2AJQB 2QC7A 6GSXA 3V1WA 3GH9A 20GSA 1AQVA 3TGZA 1TP9A 5B8BA 2H72A 1A2MA 1GSSA 3BJ5A 3I43A 3TJFA 2K6VA 1PL1A 5C04A 2OE3A 3QD9A 4J2FA 4J56E 3TDGA 5G5FA 1X5DA 1JFUA 1O85A 2GZZA 4EIQA 5HR3A 2PVQA 2R0PA 4PXOA 1BAYA 3M0FA 3S9FA 1XVWA 2WS2A 1QK8A 5KN1A 3ZIVA 4EVMA 2FY6A 1NHOA 3CSIA 2RM6A 3CMIA 3D6IA 3H1NA 1Z7RA 2WZ9A 1MDJA 2FUG2 2A2SA 3F3QA 4TXOA 2H1AA 1G7OA 4JR6A 3GN3A 5JCWA 4PNFA 2GDRA 1MDKA 2IL3A 3FR9A 4ECJA 2E2GA 1RW1A 2YJ7A 3IE3A 1S3CA 2MBSA 2BJXA 2J23A 2R0GA 3FR3A 4TXOB 4PQIA 1MDIA 4LL4B 3VPQA 1TU7A 4MZBA 2M80A 1O81A 4J57E 4POKA 3IHQA 3TRXA 2PVOC 1OYJA 4HUAA 5ECLB 2FA4A 2H6ZA 3DGQA 2CX3A 3ZMKA 1AW9A 4AJ6A 2H66A 3IV4A 3FEUA 5CRHA 1XVQA 4TVEA 4LMVA 2XC2A 3L9SA 4XIHA 2ZNMA 4FIWA 2R4VA 4I5QA 3FK8A 3ME7A 4EDYA 1EEMA 1GUMA 3DWVA 5IIZA 3TCOA 4BPYA 2DMLA 3HVNA 1M9AA 5AIXA 2O8VB 5DJMA 3GTUB 5GSSA 1AQWA 4HU7A 1QGVA 4DVCA 2MYGA 1RK4A 5G1LA 1LBKA 2IJYA 4KX4A 5CNWA 1ZOFA 1QFNA 2IIYA 2DKHA 1YZXA 1FW1A 3HZ8A 3GNJA 1JZWA 2YV7A 5B6MA 5FWGA 4F0CA 2JZSA 2JACA 5ECQB 2I9HA 2DMMA 1DSBA 4G19A 1TRWA 4O92A 2VLTA 2FNOA 2WCIA 1WRYA 1XOAA 3RPNA 3EPTA 3MIXA 3VWVA 1EGOA 4ZB8A 2LQQA 3CQFA 2J9HA 3LW9A 5E4WA 3I9V2 3QFAC 2VCVA 3EINA 4RQXA 2L6CA 1UA5A 3UVTA 3GYKA 3LXZA 3CTFA 2VO4A 2HRKA 1PX7A 1XWBA 3HDCA 3UAPA 4OWYA 2H74A 3TOTA 4POMA 19GSA 1AQXA 1ERWA 2DC5A 3L0HA 2E7PA 3TJJA 1C72A 1CQHA 2WULA 2MBTA 2YPMA 4OMVA 2O89A 1TJDA 2A4VA 1THOA 1YJ6A 1XW5A 4WETA 2H0HA 4O7HA 3VPTA 3TJBA 3APSA 4ZXGA 3ZFBA 2LNSA 6GSSA 2K18A 2HZEA 2DKIA 1WE0A 1PKZA 2YZHA 4ILFA 1ST9A 2VL2C 1ML6A 1ZMAA 10GSA 5ELGA 4G9HA 3BOAA 4JBBA 4KCAA 5AN1A 3IC8A 4EIPA 3DXBA 2IMFA 3C73A 2DJ2A 3CXGA 1EP7A 2HZEB 4KNDA 5B7CA 2VLUA 1NSWA 4CW9A 4HSCX 2CV4A 1TRUA 3FZ4A 4V1Ap 3F8UA 3K8NA 1JHBA 1ZYPA 4DSSB 2RM5A 4K7OA 4BVYA 5JCUA 3ERGA 3KH9A 1SKSB 3IXRA 5EY6A 17GSA 3W8JA 2OE1A 1M99A 5ECMB 3L9UA 3ME8A 1USBA 2OKAA 5INYA 4K0GA 1U87A 4XS1A 4NV2A 5J9CA 4HJ2A 1TDIA 4Z2TA 4TR1A 4ULXA 1QMVA 1FO5A 1T1VA 3D0ZA 3M8NA 3ZTLA 4EO3A 3R2QA 2C4JA 8GSSA 3BCKA 4MLYA 1HNAA 3I69A 3KD0A 3TKPA 1B4QA 3A5WA 1TK0B 4YAVA 4TR1B 3C1SA 4X1UA 3HVVA 4PGTA 1KBNA 5EPFA 1GRXA 2B1LA 4HJMA 3F63A 5HFKA 1PN0A 3O76A 1JLWA 6GSTA 2YCDA 3PH9A 2IFQB 3TJGA 1V98A 1GL8A 2GVPA 5J4UA 5CYYA 5KEJA 2MMNA 4IELA 4DEJA 4YQMA 1EOGA 5CRDA 4HZ2A 4BL7A 3VI5A 2C80A 1LU4A 3QAVA 2UZ8A 2MMOA 4K0NA 2V41A 3D4TA 1HNCA 4EE0A 4XRDA 5A4WA 2HNLA 2I3YA 2L4QA 2K8VA 5IMFA 4JEDA 1GNEA 2I1UA 3FZ9A 4PTSA 2GTUA 4MF7A 3MDKA 4NMUA 1BX9A 1ABAA 4ZL8A 1FG4A 1R26A 5D73A 2QA2A 2HT9A 1OAZA 2O87A 5JCGA 1QUWA 3A3TA 3LSZA 1A8LA 1FVKA 4MMMA 5ECPB 5FHIA 3F6DA 3W8SA 4MNNA 5H5RA 5IMAA 2CVDA 2DJ0A 4I6XA 3VWUA 5DALB 2KOKA 5KN0A 4KCEA 4K2XA 1PGTA 3RHBA 22GSA 4FH8A 1FOVA 1N2AA 3C7MA 2C1YA 4O32A 1X5EA 2H1BA 3LQ7A 2XBIA 3LG6A 4HQZA 2VL2A 1XPVA 4Q5RA 3NOFA 4ID0A 4K6XA 2C3NA 2IMEA 2HRFA 3L9VA 3FY7A 2VCXA 1SJZA 2IMKA 5DAKA 2P5QA 2HE3A 1TK5B 1DE1A 3AY8A 2H0IA 3LYKA 3QCPA 4AJ8A 3HCZA 5D96A 1QXHA 3EU4A 3KIJA 1YKAA 3WT1A 4TR3A 2LSTA 1GLPA 4IS0A 5DAKB 2YV9A 1WP0A 5CREA 2VUPA 2LQOA 1AXDA 1A8YA 3WGXA 2H1GA 3EWLA 2GQLA 2GSRA 1VF2A 5ECKB 3D5JA 4TXVA 3ERWA 4K1FA 3ZFLA 1GUHA 3HY2A 5IO0A 2B7JA 1EGRA 1GH2A 3US3A 5DDLA 4L5LA 4F82A 3VURA 3MYDA 5H5QA 3A2WA 3LORA 2HXKA 2PPTA 1Z6MA 2WDUA 4HQSA 1WIKA 4OFTA 4MPGA 4NXIA 2XHFA 1R4WA 1K3OA 4POLA 5EL8A 3OR5A 1X0RA 1EV4A 4MH2A 5G5EA 2C3TA 3N9JA 14GSA 3WGEA 3HKRA 4ZBDA 3HVXA 3DEXA 3PINA 2F51A 5IM9A 3EVIA 2L5LA 3IK7A 1GSDA 2PERA 3M3MA 1ILOA 4BVXB 3CRTA 4ZL7A 4FYUA 3ISOA 3GMFA 4EC0A 2KP2A 2YWIA 3DMLA 3FMWA 2DJ1A 4TW5A 2FWGA 2GT5A 2LRCA 4GSNA 3IR4A 2R5GA 4MF6A 2VD0A 1K0DA 9GSSA 2C0EA 5F8BA 3P90A 4IQAA 5DQYA 2L57A 3Q74A 1K0BA 1S3DA 3IOSA 3WD6A 2O85A 2KHPA 2X64A 4CY6A 3ZLPA 2TRXA 1Z5YE 3F6FA 2CZ2A 3GL5A 3E0UA 2JL4A 3PR8A 4RUVA 4GTUA 3M1GA 2P0GA 3WYWA 3HJPA 3HYPA 2BMXA 3F4SA 3UEMA 1XW9A 4Q5NA 5COHA 2LRTA 1WJKA 4Z2RA 2F9SA 3LFLA 4AGSA 3FRCA 1A24A 4IP6A 3GTUA 3GA4A 1YEPA 5F07A 2V6OA 4WR5A 4D73B 1Z9HA 1O7UA 2GSTA 2K8SA 3L78A 4KSOA 2VL3A 4FYCA 4YKGA 2X4AA 1XWAA 5DCGA 2RUFA 1GSYA 3VI7A 3FYGA 3H8QA 3ZIJA 1VF1A 4ML6A 5ECOB 3RDWA 3MSZA 1FHEA 2X49A 3EC3A 3E9JB 2H71A 2CZ3A 4Q5FA 3A2XA 1TTZA 2IMDA 4K9ZA 3TKQA 1G6WA 1YQ1A 2GSQA 1KNGA 3UBKA 2X99A 1ZZYA 3QR6A 2FWEA 1AC1A 3NIVA 4GSSA 4IJIA 2IN3A 4ZBBA 3EURA 1JZOA 2H70A 1VRSD 1N8JA 5HR1A 1G6YA 1ZYQB 3EU3A 3LJRA 2YP6A 4NWYA 3ZYWA 1PQNA 1U88A 3KJYA 3E3EA 4DSRA 2GQMA 2VL9A 4L0WA 1AAZA 5ABRA 1ZL9A 4K5SA 4KA0A 4MF5A 3M9KA 4GWRA 4XS4A 2VM2A 1SK2A 3KH7A 3U5RE 4RI7A 4F03A 4OO5A 2GZPA 5F06A 1SYRA 1V57A 1GSUA 2AUVA 3R3EA 2OE0A 4X4JA 1K0OA 3JCML 2GSSA 1I9DA 2LEGA 1GULA 2B7KA 3UVHA 1OE8A 4JRRA 4XS4B 5KN3A 1SL0B 1U3IA 2HLSA 1O6JA 3TUEA 2YANA 5J41A 1PMTA 1EEJA 3DVWA 3KM6A 1F6MC 1OC3A 3O6TA 4O5QA 1ZCPA 3F0IA 3Q6OA 4K7NA 1TRVA 4NPBA 2FWHA 3F3RA 2FHEA 3MWHA 2EIOA 2FCHA 2LJAA 3KP9A 4DSSA 3LEFA 3UIWA 3IK9A 2KP1A 4CDOA 1GTUA 4KSMA 1Q98A 1SD8A 4KDXA 1XZOA 5ENUA 3TKSE 2P5RA 2PGTA 13GSA 1NHYA 1YF1A 2Z9SA 3GUSA
chains in the Genus database with same CATH topology
4WF4A 2NDOA 3GSSA 5KOXA 1J9BA 2GLRA 4EL1A 4MH3A 5C00A 2C0DA 1B8XA 2A2PA 1FOHA 2M72A 4KB3A 1TI3A 3C71A 1XWGA 1M2BA 4ZB6A 5ECSA 1TXXA 1BYEA 2CX4A 4XCSA 1KEBA 3KXOA 4TR0A 2KLXA 3BCIA 4YAPA 16GSA 1BJXA 1I5GA 2TIRA 2GT6A 1J08A 2GS3A 2C8UA 2R3XA 4EF0A 2CAIA 2N5AA 2QKEA 1HNBA 2IFQA 3ZREA 1UN2A 5J3RA 2H19A 1JZDA 5IMVA 18GSA 1Y25A 5CP1A 1V58A 2EIQA 2AB6A 2B5XA 2LJKA 4MABA 3DD3A 5EVOA 2XPEA 2QGVA 3DKSA 3CBUA 3WT2A 3APOA 1SD9A 3UMAA 2LNTA 3ZVJA 3KZQA 1SL1B 4I8BA 4GRFA 6GSWA 3KP8A 5F05A 2DJKA 2LJRA 2YOIA 2H8LA 1V2AA 3HJOA 2V6KA 5DBQA 2R6KA 5A4UA 1AIUA 2H6XA 3QOUA 4N10A 2B5YA 5DQSA 5ECHB 4EKZA 4MZWA 4HU9A 5GZZB 2EC4A 1OKDA 2QSIA 5DALA 4KH7A 2B3SA 4OCEA 4ECCA 2C0GA 5ELAA 4ZILA 2LS5A 4NHZA 1M0UA 3WGDA 2MMAA 1ACVA 2VIMA 2HSHA 3APQA 3P2AA 4BWQA 4N11A 2V1MA 1EOHA 3QDNA 2E2MA 4RI6A 4IVFA 7GSSA 4USSA 3QFBC 2B6MA 1K3YA 4G0KA 5LNKe 3A2VA 3CSHA 1XW6A 2K9FA 3IAS2 3ZRDA 5DJLA 2YZUA 4EXJA 3HVSA 1WOUA 4PURA 1K3LA 1EV9A 3DVXA 3G7YA 1HQOA 5KOWA 1T8EB 1XWCA 1XWKA 1TU8A 4MA9A 2JADA 2M46A 5IMZA 4LMWA 2PUKC 2H6YA 4MPFA 2VCZA 3GV1A 1EZKA 3P7XA 2H76A 3VK9A 2DJJA 5HR0A 4XHMA 3RHCA 3TOUA 1T4YA 5BRTA 4H86A 3VWXA 4E8HA 3G7IA 5D9VA 3FKFA 1JZRA 3FR6A 1M7TA 1H4OA 2GGTA 1ZGNA 1OC9B 4JE1A 4CHSA 3GL3A 2AYTA 4XTSA 4IW9A 3I6AA 1KTEA 1ERUA 3KTBA 4PX1A 1F37A 1Z3EA 1A2JA 3DRNA 4DSQA 5D9TA 5HFGA 3ZZXA 1PD21 3TKRA 3DYRA 4GQFA 4TRXA 1K0AA 3GHAA 4G0LA 4G10A 1SKWB 2H1DA 5IQYA 1VF4A 1DUGA 1M9BA 4IKHA 1NW2A 2CQ9A 4PUFC 2HFDA 4YH2A 4NHWA 2HI7A 4CY8A 1MD3A 3U6VA 1Y6EA 4BVXA 1RQMA 1X9WB 4FQUA 4KW6A 1ERTA 3LWAA 1SYXA 3HA9A 4F0BA 4FYBA 2CAQA 2X8HA 2JZTA 2FA8A 4RQRA 1G0TA 3IAM2 3VWWA 3D22A 3TJKA 1XCCA 1AUCA 1A23A 4ML1A 3HZ4A 3IDVA 4PQ1A 4YKFA 2JSYA 2C0FA 5G2ZA 5JWQB 3SWLA 2G2QA 4L0UA 3TRPA 4OFNA 4QL9A 3P8WA 3IRAA 4OCFA 1EWXA 2JSZA 2ZUPA 2I81A 4ZIJA 4EDZA 4FO5A 2X8GA 2B5EA 4N0ZA 2QA1A 1GWCA 2PN8A 2H73A 4X43A 1GSQA 4WR4A 1SL2B 3HXSA 4GF0A 2PBJA 2VCTA 4AJ7A 2EIRA 3VFIA 2JU5A 1THXA 1PN9A 2VAFA 2DIZA 1BEDA 3RBTA 4BA7A 1B9YC 2DLXA 2F8FA 6GSYA 4D73A 2ON7A 2B1KA 2OACA 3RAZA 5KN2A 1Z7PA 1Q4JA 1QQ2A 3TB2A 4TKYA 3CRUA 2VLVA 2DBCA 1MEKA 2H0GA 2R0CA 4G0IA 5G30A 4YQVA 1YDKA 1HD2A 1HYUA 2E0QA 2H30A 5HQPA 5E59A 5ECNB 2WJUA 1YEXA 5JWRB 3BBYA 4V2NA 2LV3A 1MTCA 4WF5A 1VGLA 3BD2A 4ISDA 1BQ7A 2L6DA 5A5KA 2VCQA 2L4CA 2A4HA 1ZYEA 1MD4A 4KDYA 3LYPA 1U3AA 1UC7A 1GLQA 1URMA 4JU5A 2L59A 4QQ7A 2N5FA 4NV5A 3LGCA 2CT6A 2DIYA 2TRCP 1T4ZA 2HZFA 1M2AA 4ZBAA 2DJ3A 5ECRB 2ZCTA 3D21A 4PNGA 4OD7A 5CRWA 3EYTA 3KMNA 2D2ZA 5J9BA 4I2UA 4L8EA 1X9SB 5ECIB 4MZCA 2ON5A 3GIXA 3N5OA 1FVJA 1S3AA 2YWMA 11GSA 3HHVA 1R5AA 1PKWA 2G0FA 4HEA2 4Z2UA 4K8MA 1F2EA 3QMXA 2PU9C 3FW2A 2V2GA 4I2TA 1GNWA 4IHUA 2WRTA 1SJIA 4XRAA 4QL7A 1SK0A 2YJHA 1T3BA 1GP1A 3CTGA 4N0VA 3TKSC 1PX6A 2IMIA 3KEBA 4LL1B 3UJ1A 1F9MA 2CVKA 1T00A 2NVLA 1X9MB 1YF0A 6GSVA 3KGKA 4O5RA 5FT3A 1GTAA 5J5NA 4GLTA 4HI7A 4TOPA 4IJ3A 5HFIA 1GTBA 5IPHA 5H5SA 2RUEA 2MZCA 3UOMA 3IPZA 3C8EA 3GX0A 2FWFA 5LD0A 3RPPA 4O5UA 5GAND 5CAXA 4PQHA 4HOJA 3GURA 5IPGA 2NBSA 2R2JA 1ZYNA 3KTLA 4MK3A 2A2RA 1OC8A 1BG5A 2HSYA 4NAXA 3C1RA 4I97A 1SENA 12GSA 1VF3A 2C3QA 4IN0A 3O3TA 1DE2A 3ZL5A 1GTIA 5B6NA 3PPUA 1F3BA 3ZVJD 1TOFA 1A2LA 1ERVA 3ED3A 2IWTA 3GKXA 1WWJA 1ON4A 1IYHA 1O8XA 1YY7A 1GSEA 6GSUA 4KUNA 1CQGA 4E8EA 2OJLA 3VLNA 4AF2A 2N5BA 5G1KA 1B4PA 4ZB9A 2WGRA 2F8AA 1H75A 1GSFA 4MJEA 2FD3A 1R5PA 4V1Ag 4WBJA 4POBA 1PL2A 1K0MA 2ES7A 3GFKA 1OVNA 2LKUA 5CRGA 1O73A 3EMPA 1F3AA 4KGIA 4IGJA 4LLRA 4ECBA 3IHGA 3MNGA 2HRAA 2AHEA 1XIYA 1WMJA 2RIIA 5DCHA 3H4KA 1V9WA 1SJ6A 4BVYB 4MJBA 4IP1A 2LUSA 2XPDA 2P31A 3Q19A 4F2IA 2VD1A 2OA7A 1V40A 2KUCA 1G7EA 1FB0A 5IO2A 5CO3A 5GAPD 4GSTA 2DSAA 5JWOB 4X0XA 5IOWA 3EMXA 2PMTA 4MJAA 5A4VA 1PSQA 2R37A 2WB9A 1LJRA 2YNXA 5F0GA 1A0RP 3TRQA 2OADA 2X8CA 4WEYA 3IBHA 1JLVA 2VOCA 3F9UA 2HRNA 2BTOT 2XBQA 3QPMA 4LA1A 3J7Yb 1E2YA 1OKTA 1PRXA 1W4VA 3IC4A 4IBPA 3MAKA 3FZAA 2CVBA 2REMA 2PWJA 4XS6A 3D4MA 1SU9A 4N30A 3L4NA 3EE2A 1B9XC 2H01A 4BWSA 4G2EA 2FLSA 1K0CA 4EUYA 4GCIA 3IA1A 5BMUA 3TKSA 2YWOA 5HR2A 4WXTA 3ERFA 3KMOA 4A5PA 2NTOA 4Q5QA 3Q18A 1TI1A 5AIVA 3GRXA 4HZ4A 3F4RA 3GKKA 4P3YB 2O7KA 4TR4A 2VM1A 5DVBA 4BL7B 1W89A 1YKCA 1NM3A 2AV4A 3QAWA 3KCMA 4JR4A 1UVZA 2LTKA 3GH6A 4F9ZA 4K2DA 4V2MA 1PA3A 4WKWA 3GKMA 2H75A 4K5RA 5AGYA 1OE7A 4GXZA 1XXUA 3GKNA 2YN1A 3GSTA 3W6GA 2FGXA 2WFCA 3FZ5A 1DBYA 2JZRA 1R7HA 1A0FA 5IMDA 4YQUA 1FB6A 3H79A 5B8AA 4K7IA 4ECIA 1Z6NA 4MP4A 2IPAA 1EP8A 1U6TA 4IQ1A 4JZQA 4GQCA 5ID2A 1B48A 2ALBA 1TRSA 1X5CA 4MCUA 3HD5A 2HSMA 2GQKA 5G31A 1XBSA 4KE3A 2AAWA 3SBCA 3UBLA 4KDUA 2OBKA 3QAGA 5ID2B 2NPBA 3UARA 4ACSA 3J7Yk 2L5OA 1SKRB 3DIEA 2CA8A 1OC9A 2MMZA 4HS1A 4OFMA 4ICYA 4Z7XA 3ZITA 1GUKA 2OBIA 5D9XA 5D8IA 4V2LA 3UL3A 4HDEA 5D93A 2GZYA 3HJMA 1XFLA 4MDCA 3F4TA 4KAEA 3G9BA 3LXTA 2F3MA 1FAAA 5LCZA 5IMCA 2LRNA 1WPIA 3FHKA 5GSTA 4MJCA 1IYIA 4PUAA 3CYNA 3ZMLA 1TKDB 4TN8A 4ZL9A 4OO4A 3PGTA 2I4AA 4KF9A 2YWNA 3NZNA 1TK8B 3GX8A 1E6BA 5AISA 1TW9A 3M9JA 1J0FA 3A5IA 5D9WA 3G7JA 2V32A 2RLIA 4WBRD 5L71A 2HYXA 4L5OA 1SK1A 1M2DA 1O8WA 1XOBA 3H93A 1K0NA 2VCWA 3CSJA 5IOXA 1T7PB 2AJQB 2QC7A 6GSXA 3V1WA 3GH9A 20GSA 1AQVA 3TGZA 1TP9A 5B8BA 2H72A 1A2MA 1GSSA 3BJ5A 3I43A 3TJFA 2K6VA 1PL1A 5C04A 2OE3A 3QD9A 4J2FA 4J56E 3TDGA 5G5FA 1X5DA 1JFUA 1O85A 2GZZA 4EIQA 5HR3A 2PVQA 2R0PA 4PXOA 1BAYA 3M0FA 3S9FA 1XVWA 2WS2A 1QK8A 5KN1A 3ZIVA 4EVMA 2FY6A 1NHOA 3CSIA 2RM6A 3CMIA 3D6IA 3H1NA 1Z7RA 2WZ9A 1MDJA 2FUG2 2A2SA 3F3QA 4TXOA 2H1AA 1G7OA 4JR6A 3GN3A 5JCWA 4PNFA 2GDRA 1MDKA 2IL3A 3FR9A 4ECJA 2E2GA 1RW1A 2YJ7A 3IE3A 1S3CA 2MBSA 2BJXA 2J23A 2R0GA 3FR3A 4TXOB 4PQIA 1MDIA 4LL4B 3VPQA 1TU7A 4MZBA 2M80A 1O81A 4J57E 4POKA 3IHQA 3TRXA 2PVOC 1OYJA 4HUAA 5ECLB 2FA4A 2H6ZA 3DGQA 2CX3A 3ZMKA 1AW9A 4AJ6A 2H66A 3IV4A 3FEUA 5CRHA 1XVQA 4TVEA 4LMVA 2XC2A 3L9SA 4XIHA 2ZNMA 4FIWA 2R4VA 4I5QA 3FK8A 3ME7A 4EDYA 1EEMA 1GUMA 3DWVA 5IIZA 3TCOA 4BPYA 2DMLA 1M9AA 5AIXA 2O8VB 5DJMA 3GTUB 5GSSA 1AQWA 4HU7A 1QGVA 4DVCA 2MYGA 1RK4A 5G1LA 1LBKA 2IJYA 4KX4A 5CNWA 1ZOFA 1QFNA 2IIYA 2DKHA 1YZXA 1FW1A 3HZ8A 3GNJA 1JZWA 2YV7A 5B6MA 5FWGA 4F0CA 2JZSA 2JACA 5ECQB 2I9HA 2DMMA 1DSBA 4G19A 1TRWA 4O92A 2VLTA 2FNOA 2WCIA 1WRYA 1XOAA 3RPNA 3EPTA 3MIXA 3VWVA 1EGOA 4ZB8A 2LQQA 2J9HA 3LW9A 5E4WA 3I9V2 3QFAC 2VCVA 3EINA 4RQXA 2L6CA 1UA5A 3UVTA 3GYKA 3LXZA 3CTFA 2VO4A 2HRKA 1PX7A 1XWBA 3HDCA 3UAPA 4OWYA 2H74A 3TOTA 4POMA 19GSA 1AQXA 1ERWA 2DC5A 3L0HA 2E7PA 3TJJA 1C72A 1CQHA 2WULA 2MBTA 2YPMA 4OMVA 2O89A 1TJDA 2A4VA 1THOA 1YJ6A 1XW5A 4WETA 2H0HA 4O7HA 3VPTA 3TJBA 3APSA 4ZXGA 3ZFBA 2LNSA 6GSSA 2K18A 2HZEA 2DKIA 1WE0A 1PKZA 2YZHA 4ILFA 1ST9A 2VL2C 1ML6A 1ZMAA 10GSA 5ELGA 4G9HA 3BOAA 4JBBA 4KCAA 5AN1A 3IC8A 4EIPA 3DXBA 2IMFA 3C73A 2DJ2A 3CXGA 1EP7A 2HZEB 4KNDA 5B7CA 2VLUA 1NSWA 4CW9A 2CV4A 1TRUA 3FZ4A 4V1Ap 3F8UA 3K8NA 1JHBA 1ZYPA 4DSSB 2RM5A 4K7OA 4BVYA 5JCUA 3ERGA 3KH9A 1SKSB 3IXRA 5EY6A 17GSA 3W8JA 2OE1A 1M99A 5ECMB 3L9UA 3ME8A 1USBA 2OKAA 5INYA 4K0GA 1U87A 4XS1A 4NV2A 5J9CA 4HJ2A 1TDIA 4Z2TA 4TR1A 4ULXA 1QMVA 1FO5A 1T1VA 3D0ZA 3M8NA 3ZTLA 4EO3A 3R2QA 2C4JA 8GSSA 3BCKA 4MLYA 1HNAA 3I69A 3KD0A 3TKPA 1B4QA 3A5WA 1TK0B 4YAVA 4TR1B 3C1SA 4X1UA 3HVVA 4PGTA 1KBNA 5EPFA 1GRXA 2B1LA 4HJMA 3F63A 5HFKA 1PN0A 3O76A 1JLWA 6GSTA 2YCDA 3PH9A 2IFQB 3TJGA 1V98A 1GL8A 2GVPA 5J4UA 5CYYA 5KEJA 2MMNA 4IELA 4DEJA 4YQMA 1EOGA 5CRDA 4HZ2A 4BL7A 3VI5A 2C80A 1LU4A 3QAVA 2UZ8A 2MMOA 4K0NA 2V41A 3D4TA 1HNCA 4EE0A 4XRDA 5A4WA 2HNLA 2I3YA 2L4QA 2K8VA 5IMFA 4JEDA 1GNEA 2I1UA 3FZ9A 4PTSA 2GTUA 4MF7A 3MDKA 4NMUA 1BX9A 1ABAA 4ZL8A 1FG4A 1R26A 5D73A 2QA2A 2HT9A 1OAZA 2O87A 5JCGA 1QUWA 3A3TA 3LSZA 1A8LA 1FVKA 4MMMA 5ECPB 5FHIA 3F6DA 3W8SA 4MNNA 5H5RA 5IMAA 2CVDA 2DJ0A 4I6XA 3VWUA 5DALB 2KOKA 5KN0A 4KCEA 4K2XA 1PGTA 3RHBA 22GSA 4FH8A 1FOVA 1N2AA 3C7MA 2C1YA 4O32A 1X5EA 2H1BA 3LQ7A 2XBIA 3LG6A 4HQZA 2VL2A 1XPVA 4Q5RA 3NOFA 4ID0A 4K6XA 2C3NA 2IMEA 2HRFA 3L9VA 3FY7A 2VCXA 1SJZA 2IMKA 5DAKA 2P5QA 2HE3A 1TK5B 1DE1A 3AY8A 2H0IA 3LYKA 3QCPA 4AJ8A 3HCZA 5D96A 1QXHA 3EU4A 3KIJA 1YKAA 3WT1A 4TR3A 2LSTA 1GLPA 4IS0A 5DAKB 2YV9A 1WP0A 5CREA 2VUPA 2LQOA 1AXDA 1A8YA 3WGXA 2H1GA 3EWLA 2GQLA 2GSRA 1VF2A 5ECKB 3D5JA 4TXVA 3ERWA 4K1FA 3ZFLA 1GUHA 3HY2A 5IO0A 2B7JA 1EGRA 1GH2A 3US3A 5DDLA 4L5LA 4F82A 3VURA 3MYDA 5H5QA 3A2WA 3LORA 2HXKA 2PPTA 1Z6MA 2WDUA 4HQSA 1WIKA 4OFTA 4MPGA 4NXIA 2XHFA 1R4WA 1K3OA 4POLA 5EL8A 3OR5A 1X0RA 1EV4A 4MH2A 5G5EA 2C3TA 3N9JA 14GSA 3WGEA 3HKRA 4ZBDA 3HVXA 3DEXA 3PINA 2F51A 5IM9A 3EVIA 2L5LA 3IK7A 1GSDA 2PERA 3M3MA 1ILOA 4BVXB 3CRTA 4ZL7A 4FYUA 3ISOA 3GMFA 4EC0A 2KP2A 2YWIA 3DMLA 3FMWA 2DJ1A 4TW5A 2FWGA 2GT5A 2LRCA 4GSNA 3IR4A 2R5GA 4MF6A 2VD0A 1K0DA 9GSSA 2C0EA 5F8BA 3P90A 4IQAA 5DQYA 2L57A 3Q74A 1K0BA 1S3DA 3IOSA 3WD6A 2O85A 2KHPA 2X64A 4CY6A 3ZLPA 2TRXA 1Z5YE 3F6FA 2CZ2A 3GL5A 3E0UA 2JL4A 3PR8A 4RUVA 4GTUA 3M1GA 2P0GA 3WYWA 3HJPA 3HYPA 2BMXA 3F4SA 3UEMA 1XW9A 4Q5NA 5COHA 2LRTA 1WJKA 4Z2RA 2F9SA 3LFLA 4AGSA 3FRCA 1A24A 4IP6A 3GTUA 3GA4A 1YEPA 5F07A 2V6OA 4WR5A 4D73B 1Z9HA 1O7UA 2GSTA 2K8SA 3L78A 4KSOA 2VL3A 4FYCA 4YKGA 2X4AA 1XWAA 5DCGA 2RUFA 1GSYA 3VI7A 3FYGA 3H8QA 3ZIJA 1VF1A 4ML6A 5ECOB 3RDWA 3MSZA 1FHEA 2X49A 3EC3A 3E9JB 2H71A 2CZ3A 4Q5FA 3A2XA 1TTZA 2IMDA 4K9ZA 3TKQA 1G6WA 1YQ1A 2GSQA 1KNGA 3UBKA 2X99A 1ZZYA 3QR6A 2FWEA 1AC1A 3NIVA 4GSSA 4IJIA 2IN3A 4ZBBA 3EURA 1JZOA 2H70A 1VRSD 1N8JA 5HR1A 1G6YA 1ZYQB 3EU3A 3LJRA 2YP6A 4NWYA 3ZYWA 1PQNA 1U88A 3KJYA 3E3EA 4DSRA 2GQMA 2VL9A 4L0WA 1AAZA 5ABRA 1ZL9A 4K5SA 4KA0A 4MF5A 3M9KA 4GWRA 4XS4A 2VM2A 1SK2A 3KH7A 3U5RE 4RI7A 4F03A 4OO5A 2GZPA 5F06A 1SYRA 1V57A 1GSUA 2AUVA 3R3EA 2OE0A 4X4JA 1K0OA 3JCML 2GSSA 1I9DA 2LEGA 1GULA 2B7KA 3UVHA 1OE8A 4JRRA 4XS4B 5KN3A 1SL0B 1U3IA 2HLSA 1O6JA 3TUEA 2YANA 5J41A 1PMTA 1EEJA 3DVWA 3KM6A 1F6MC 1OC3A 3O6TA 4O5QA 1ZCPA 3F0IA 3Q6OA 4K7NA 1TRVA 4NPBA 2FWHA 3F3RA 2FHEA 3MWHA 2EIOA 2FCHA 2LJAA 3KP9A 4DSSA 3LEFA 3UIWA 3IK9A 2KP1A 4CDOA 1GTUA 4KSMA 1Q98A 1SD8A 4KDXA 1XZOA 5ENUA 3TKSE 2P5RA 2PGTA 13GSA 1NHYA 1YF1A 2Z9SA 3GUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WF4 A;  2NDO A;  3GSS A;  1J9B A;  2GLR A;  4EL1 A;  4MH3 A;  5C00 A;  2C0D A;  1B8X A;  2M72 A;  4KB3 A;  1TI3 A;  3C71 A;  1XWG A;  1M2B A;  4ZB6 A;  5ECS A;  1TXX A;  1BYE A;  2CX4 A;  4XCS A;  1KEB A;  3KXO A;  4TR0 A;  2KLX A;  3BCI A;  4YAP A;  16GS A;  1BJX A;  1I5G A;  2TIR A;  2GT6 A;  1J08 A;  2GS3 A;  2C8U A;  2R3X A;  4EF0 A;  2CAI A;  2N5A A;  2QKE A;  1HNB A;  2IFQ A;  3ZRE A;  1UN2 A;  5J3R A;  2H19 A;  1JZD A;  5IMV A;  18GS A;  1Y25 A;  5CP1 A;  1V58 A;  2EIQ A;  2AB6 A;  2B5X A;  2LJK A;  4MAB A;  3DD3 A;  5EVO A;  2XPE A;  2QGV A;  3DKS A;  3CBU A;  3WT2 A;  3APO A;  1SD9 A;  3UMA A;  2LNT A;  3ZVJ A;  3KZQ A;  1SL1 B;  4I8B A;  4GRF A;  6GSW A;  3KP8 A;  5F05 A;  2DJK A;  2LJR A;  2YOI A;  2H8L A;  1V2A A;  3HJO A;  2V6K A;  5DBQ A;  2R6K A;  5A4U A;  1AIU A;  2H6X A;  3QOU A;  4N10 A;  2B5Y A;  5DQS A;  5ECH B;  4EKZ A;  4MZW A;  4HU9 A;  5GZZ B;  2EC4 A;  1OKD A;  2QSI A;  5DAL A;  4KH7 A;  2B3S A;  4OCE A;  4ECC A;  2C0G A;  5ELA A;  4ZIL A;  2LS5 A;  4NHZ A;  1M0U A;  3WGD A;  2MMA A;  1ACV A;  2VIM A;  2HSH A;  3APQ A;  3P2A A;  3GUS A;  4BWQ A;  4N11 A;  2V1M A;  1EOH A;  3QDN A;  2E2M A;  4RI6 A;  4IVF A;  7GSS A;  3QFB C;  2B6M A;  1K3Y A;  5LNK e;  3A2V A;  3CSH A;  1XW6 A;  2K9F A;  3IAS 2;  3ZRD A;  5DJL A;  2YZU A;  4EXJ A;  3HVS A;  1WOU A;  4PUR A;  1K3L A;  1EV9 A;  3DVX A;  3G7Y A;  1HQO A;  1T8E B;  1XWC A;  1XWK A;  1TU8 A;  4MA9 A;  2JAD A;  2M46 A;  5IMZ A;  4LMW A;  2PUK C;  2H6Y A;  4MPF A;  2VCZ A;  3GV1 A;  1EZK A;  3P7X A;  2H76 A;  3VK9 A;  2DJJ A;  5HR0 A;  4XHM A;  3RHC A;  3TOU A;  1T4Y A;  4H86 A;  3VWX A;  4E8H A;  3G7I A;  5D9V A;  3FKF A;  1JZR A;  3FR6 A;  1M7T A;  1H4O A;  2GGT A;  1ZGN A;  1OC9 B;  4JE1 A;  4CHS A;  3GL3 A;  2AYT A;  4XTS A;  4IW9 A;  3I6A A;  1KTE A;  1ERU A;  3KTB A;  4PX1 A;  1F37 A;  1Z3E A;  1A2J A;  3DRN A;  4DSQ A;  5D9T A;  5HFG A;  3ZZX A;  1PD2 1;  3TKR A;  3DYR A;  4GQF A;  4TRX A;  1K0A A;  3GHA A;  4G10 A;  1SKW B;  2H1D A;  5IQY A;  1VF4 A;  1DUG A;  1M9B A;  4IKH A;  1NW2 A;  2CQ9 A;  4PUF C;  2HFD A;  4YH2 A;  4NHW A;  2HI7 A;  1MD3 A;  3U6V A;  1Y6E A;  4BVX A;  1RQM A;  1X9W B;  4KW6 A;  1ERT A;  3LWA A;  1SYX A;  3HA9 A;  4F0B A;  4FYB A;  2CAQ A;  2X8H A;  2JZT A;  2FA8 A;  4RQR A;  1G0T A;  3IAM 2;  3VWW A;  3D22 A;  3TJK A;  1XCC A;  1AUC A;  1A23 A;  4ML1 A;  3HZ4 A;  3IDV A;  4PQ1 A;  2JSY A;  2C0F A;  5G2Z A;  5JWQ B;  3SWL A;  2G2Q A;  4L0U A;  3TRP A;  4OFN A;  4QL9 A;  3P8W A;  3IRA A;  4OCF A;  1EWX A;  2JSZ A;  2ZUP A;  2I81 A;  4ZIJ A;  4EDZ A;  4FO5 A;  2X8G A;  2B5E A;  4N0Z A;  1GWC A;  2PN8 A;  2H73 A;  4X43 A;  1GSQ A;  4WR4 A;  1SL2 B;  3HXS A;  4GF0 A;  2PBJ A;  2VCT A;  4AJ7 A;  2EIR A;  3VFI A;  2JU5 A;  1THX A;  1PN9 A;  2VAF A;  2DIZ A;  1BED A;  3RBT A;  4BA7 A;  1B9Y C;  2DLX A;  2F8F A;  6GSY A;  4D73 A;  2ON7 A;  2B1K A;  2OAC A;  3RAZ A;  5KN2 A;  1Z7P A;  1Q4J A;  1QQ2 A;  3TB2 A;  3CRU A;  4TKY A;  2VLV A;  2DBC A;  1MEK A;  2H0G A;  5G30 A;  4YQV A;  1YDK A;  1HD2 A;  1HYU A;  2E0Q A;  2H30 A;  5HQP A;  5E59 A;  5ECN B;  2WJU A;  1YEX A;  5JWR B;  3BBY A;  4V2N A;  2LV3 A;  1MTC A;  4WF5 A;  1VGL A;  3BD2 A;  4ISD A;  1BQ7 A;  2L6D A;  5A5K A;  2VCQ A;  2L4C A;  1ZYE A;  1MD4 A;  4KDY A;  3LYP A;  1U3A A;  1UC7 A;  1GLQ A;  1URM A;  4JU5 A;  2L59 A;  4QQ7 A;  2N5F A;  4NV5 A;  3LGC A;  2CT6 A;  2DIY A;  2TRC P;  1T4Z A;  2HZF A;  1M2A A;  4ZBA A;  2DJ3 A;  5ECR B;  2ZCT A;  3D21 A;  4PNG A;  4OD7 A;  5CRW A;  3EYT A;  3KMN A;  2D2Z A;  5J9B A;  4I2U A;  4L8E A;  1X9S B;  5ECI B;  4MZC A;  2ON5 A;  3GIX A;  3N5O A;  1FVJ A;  1S3A A;  2YWM A;  11GS A;  3HHV A;  1R5A A;  1PKW A;  2G0F A;  4HEA 2;  4K8M A;  1F2E A;  3QMX A;  2PU9 C;  3FW2 A;  2V2G A;  4I2T A;  1GNW A;  4IHU A;  2WRT A;  1SJI A;  4XRA A;  4QL7 A;  1SK0 A;  2YJH A;  1T3B A;  1GP1 A;  3CTG A;  4N0V A;  3TKS C;  1PX6 A;  2IMI A;  3KEB A;  4LL1 B;  3UJ1 A;  1F9M A;  2CVK A;  1T00 A;  2NVL A;  1X9M B;  1YF0 A;  6GSV A;  3KGK A;  4O5R A;  5FT3 A;  1GTA A;  5J5N A;  4GLT A;  4HI7 A;  4TOP A;  4IJ3 A;  5HFI A;  1GTB A;  5IPH A;  5H5S A;  2RUE A;  2MZC A;  3UOM A;  3IPZ A;  3C8E A;  3GX0 A;  2FWF A;  5LD0 A;  3RPP A;  5GAN D;  5CAX A;  4PQH A;  4HOJ A;  3GUR A;  5IPG A;  2NBS A;  2R2J A;  3KTL A;  4MK3 A;  2A2R A;  1OC8 A;  1BG5 A;  2HSY A;  4NAX A;  3C1R A;  4I97 A;  1SEN A;  12GS A;  1VF3 A;  2C3Q A;  4IN0 A;  3O3T A;  1DE2 A;  3ZL5 A;  1GTI A;  5B6N A;  1F3B A;  3ZVJ D;  1TOF A;  1A2L A;  1ERV A;  3ED3 A;  2IWT A;  3GKX A;  1WWJ A;  1ON4 A;  1IYH A;  1O8X A;  1YY7 A;  1GSE A;  6GSU A;  4KUN A;  1CQG A;  4E8E A;  2OJL A;  3VLN A;  4AF2 A;  2N5B A;  5G1K A;  1B4P A;  4ZB9 A;  2WGR A;  2F8A A;  1H75 A;  1GSF A;  4MJE A;  2FD3 A;  1R5P A;  4V1A g;  4WBJ A;  4POB A;  1PL2 A;  1K0M A;  2ES7 A;  3GFK A;  1OVN A;  2LKU A;  5CRG A;  1O73 A;  3EMP A;  1F3A A;  4KGI A;  4IGJ A;  4LLR A;  4ECB A;  3MNG A;  2AHE A;  1XIY A;  1WMJ A;  2RII A;  5DCH A;  3H4K A;  1V9W A;  1SJ6 A;  4MJB A;  4IP1 A;  2LUS A;  2XPD A;  2P31 A;  3Q19 A;  4F2I A;  2VD1 A;  2OA7 A;  1V40 A;  2KUC A;  1G7E A;  1FB0 A;  5IO2 A;  5CO3 A;  5GAP D;  4GST A;  2DSA A;  5JWO B;  4X0X A;  5IOW A;  3EMX A;  2PMT A;  4MJA A;  5A4V A;  1PSQ A;  2R37 A;  2WB9 A;  1LJR A;  2YNX A;  5F0G A;  1A0R P;  3TRQ A;  2OAD A;  2X8C A;  4WEY A;  3IBH A;  1JLV A;  2VOC A;  3F9U A;  2HRN A;  2BTO T;  2XBQ A;  3QPM A;  4LA1 A;  3J7Y b;  1E2Y A;  1OKT A;  1PRX A;  1W4V A;  3IC4 A;  4IBP A;  3MAK A;  3FZA A;  2CVB A;  2REM A;  2PWJ A;  4XS6 A;  3D4M A;  1SU9 A;  4N30 A;  3L4N A;  3EE2 A;  1B9X C;  2H01 A;  4BWS A;  4G2E A;  2FLS A;  1K0C A;  4EUY A;  4GCI A;  3IA1 A;  3TKS A;  2YWO A;  5HR2 A;  4WXT A;  3ERF A;  3KMO A;  2NTO A;  4Q5Q A;  3Q18 A;  1TI1 A;  5AIV A;  3GRX A;  4HZ4 A;  3F4R A;  3GKK A;  4P3Y B;  2O7K A;  4TR4 A;  2VM1 A;  5DVB A;  1W89 A;  1YKC A;  1NM3 A;  2AV4 A;  3QAW A;  3KCM A;  4JR4 A;  1UVZ A;  2LTK A;  3GH6 A;  4F9Z A;  4K2D A;  4V2M A;  1PA3 A;  4WKW A;  3GKM A;  2H75 A;  5AGY A;  1OE7 A;  4GXZ A;  1XXU A;  3GKN A;  2YN1 A;  3GST A;  3W6G A;  2FGX A;  2WFC A;  3FZ5 A;  1DBY A;  2JZR A;  1R7H A;  1A0F A;  5IMD A;  4YQU A;  1FB6 A;  3H79 A;  5B8A A;  4K7I A;  4ECI A;  1Z6N A;  4MP4 A;  2IPA A;  1EP8 A;  1U6T A;  4IQ1 A;  4JZQ A;  4GQC A;  5ID2 A;  1B48 A;  2ALB A;  1TRS A;  1X5C A;  4MCU A;  3HD5 A;  2GQK A;  5G31 A;  1XBS A;  4KE3 A;  2AAW A;  3SBC A;  3UBL A;  4KDU A;  2OBK A;  3QAG A;  5ID2 B;  2NPB A;  3UAR A;  4ACS A;  3J7Y k;  2L5O A;  1SKR B;  3DIE A;  2CA8 A;  1OC9 A;  2MMZ A;  4HS1 A;  4OFM A;  4Z7X A;  3ZIT A;  1GUK A;  2OBI A;  5D9X A;  5D8I A;  4V2L A;  3UL3 A;  4HDE A;  5D93 A;  2GZY A;  3HJM A;  1XFL A;  4MDC A;  3F4T A;  4KAE A;  3G9B A;  3LXT A;  2F3M A;  1FAA A;  5LCZ A;  5IMC A;  2LRN A;  1WPI A;  3FHK A;  5GST A;  4MJC A;  1IYI A;  4PUA A;  3CYN A;  3ZML A;  1TKD B;  4TN8 A;  4ZL9 A;  4OO4 A;  3PGT A;  2I4A A;  2YWN A;  3NZN A;  1TK8 B;  3GX8 A;  1E6B A;  5AIS A;  1TW9 A;  3M9J A;  1J0F A;  5D9W A;  3G7J A;  2V32 A;  2RLI A;  4WBR D;  5L71 A;  2HYX A;  4L5O A;  1SK1 A;  1M2D A;  1O8W A;  1XOB A;  3H93 A;  1K0N A;  2VCW A;  3CSJ A;  5IOX A;  1T7P B;  2AJQ B;  2QC7 A;  6GSX A;  3V1W A;  3GH9 A;  20GS A;  1AQV A;  3TGZ A;  1TP9 A;  5B8B A;  2H72 A;  1A2M A;  1GSS A;  3BJ5 A;  3I43 A;  3TJF A;  2K6V A;  1PL1 A;  5C04 A;  2OE3 A;  3QD9 A;  4J2F A;  4J56 E;  3TDG A;  5G5F A;  1X5D A;  1JFU A;  1O85 A;  2GZZ A;  5HR3 A;  2PVQ A;  4PXO A;  1BAY A;  3M0F A;  3S9F A;  1XVW A;  2WS2 A;  1QK8 A;  5KN1 A;  3ZIV A;  4EVM A;  2FY6 A;  1NHO A;  3CSI A;  2RM6 A;  3CMI A;  3D6I A;  3H1N A;  1Z7R A;  2WZ9 A;  1MDJ A;  2FUG 2;  2A2S A;  3F3Q A;  4TXO A;  2H1A A;  1G7O A;  4JR6 A;  3GN3 A;  5JCW A;  4PNF A;  2GDR A;  1MDK A;  2IL3 A;  3FR9 A;  4ECJ A;  2E2G A;  1RW1 A;  2YJ7 A;  3IE3 A;  1S3C A;  2MBS A;  2BJX A;  2J23 A;  3FR3 A;  4TXO B;  4PQI A;  1MDI A;  4LL4 B;  3VPQ A;  1TU7 A;  4MZB A;  2M80 A;  1O81 A;  4J57 E;  4POK A;  3IHQ A;  3TRX A;  2PVO C;  1OYJ A;  4HUA A;  5ECL B;  2FA4 A;  2H6Z A;  3DGQ A;  2CX3 A;  3ZMK A;  1AW9 A;  4AJ6 A;  2H66 A;  3IV4 A;  3FEU A;  5CRH A;  1XVQ A;  4TVE A;  4LMV A;  2XC2 A;  3L9S A;  4XIH A;  2ZNM A;  4FIW A;  2R4V A;  4I5Q A;  3FK8 A;  3ME7 A;  4EDY A;  1EEM A;  1GUM A;  3DWV A;  5IIZ A;  3TCO A;  4BPY A;  2DML A;  1M9A A;  5AIX A;  2O8V B;  5DJM A;  3GTU B;  5GSS A;  1AQW A;  4HU7 A;  1QGV A;  4DVC A;  2MYG A;  1RK4 A;  5G1L A;  1LBK A;  2IJY A;  4KX4 A;  5CNW A;  1ZOF A;  1QFN A;  2IIY A;  1YZX A;  1FW1 A;  3HZ8 A;  3GNJ A;  1JZW A;  2YV7 A;  5B6M A;  5FWG A;  4F0C A;  2JZS A;  2JAC A;  5ECQ B;  2I9H A;  2DMM A;  1DSB A;  4G19 A;  1TRW A;  4O92 A;  2VLT A;  2FNO A;  2WCI A;  1WRY A;  1XOA A;  3RPN A;  3VWV A;  1EGO A;  4ZB8 A;  2LQQ A;  2J9H A;  5E4W A;  3I9V 2;  3QFA C;  2VCV A;  3EIN A;  4RQX A;  2L6C A;  1UA5 A;  3UVT A;  3GYK A;  3LXZ A;  3CTF A;  2VO4 A;  1PX7 A;  1XWB A;  3HDC A;  3UAP A;  4OWY A;  2H74 A;  3TOT A;  4POM A;  19GS A;  1AQX A;  1ERW A;  2DC5 A;  3L0H A;  2E7P A;  3TJJ A;  1C72 A;  1CQH A;  2WUL A;  2MBT A;  2YPM A;  4OMV A;  2O89 A;  1TJD A;  2A4V A;  1THO A;  1YJ6 A;  1XW5 A;  4WET A;  2H0H A;  4O7H A;  3VPT A;  3TJB A;  3APS A;  4ZXG A;  3ZFB A;  2LNS A;  6GSS A;  2K18 A;  2HZE A;  1WE0 A;  1PKZ A;  2YZH A;  4ILF A;  1ST9 A;  2VL2 C;  1ML6 A;  1ZMA A;  10GS A;  5ELG A;  4G9H A;  3BOA A;  4JBB A;  4KCA A;  5AN1 A;  3DXB A;  2IMF A;  3C73 A;  2DJ2 A;  3CXG A;  1EP7 A;  2HZE B;  4KND A;  5B7C A;  2VLU A;  1NSW A;  4CW9 A;  2CV4 A;  1TRU A;  3FZ4 A;  4V1A p;  3F8U A;  3K8N A;  1JHB A;  4DSS B;  2RM5 A;  4K7O A;  4BVY A;  5JCU A;  3ERG A;  3KH9 A;  1SKS B;  3IXR A;  5EY6 A;  17GS A;  3W8J A;  2OE1 A;  1M99 A;  5ECM B;  3L9U A;  3ME8 A;  1USB A;  2OKA A;  5INY A;  4K0G A;  1U87 A;  4XS1 A;  4NV2 A;  5J9C A;  4HJ2 A;  1TDI A;  4TR1 A;  4ULX A;  1QMV A;  1FO5 A;  1T1V A;  3D0Z A;  3M8N A;  3ZTL A;  4EO3 A;  3R2Q A;  2C4J A;  8GSS A;  3BCK A;  4MLY A;  1HNA A;  3I69 A;  3KD0 A;  3TKP A;  1B4Q A;  3A5W A;  1TK0 B;  4YAV A;  4TR1 B;  3C1S A;  4X1U A;  3HVV A;  4PGT A;  1KBN A;  5EPF A;  1GRX A;  2B1L A;  4HJM A;  3F63 A;  5HFK A;  3O76 A;  1JLW A;  6GST A;  2YCD A;  3PH9 A;  2IFQ B;  3TJG A;  1V98 A;  1GL8 A;  2GVP A;  5J4U A;  5CYY A;  5KEJ A;  2MMN A;  4IEL A;  4DEJ A;  4YQM A;  1EOG A;  5CRD A;  4HZ2 A;  4BL7 A;  3VI5 A;  2C80 A;  1LU4 A;  3QAV A;  2MMO A;  4K0N A;  2V41 A;  3D4T A;  1HNC A;  4EE0 A;  4XRD A;  5A4W A;  2HNL A;  2I3Y A;  2L4Q A;  2K8V A;  5IMF A;  4JED A;  1GNE A;  2I1U A;  3FZ9 A;  2GTU A;  4MF7 A;  3MDK A;  4NMU A;  1BX9 A;  1ABA A;  4ZL8 A;  1FG4 A;  1R26 A;  5D73 A;  2HT9 A;  1OAZ A;  2O87 A;  5JCG A;  1QUW A;  3A3T A;  3LSZ A;  1A8L A;  1FVK A;  4MMM A;  5ECP B;  5FHI A;  3F6D A;  3W8S A;  5H5R A;  5IMA A;  2CVD A;  2DJ0 A;  4I6X A;  3VWU A;  5DAL B;  2KOK A;  5KN0 A;  4KCE A;  1PGT A;  3RHB A;  22GS A;  4FH8 A;  1FOV A;  1N2A A;  3C7M A;  2C1Y A;  4O32 A;  1X5E A;  2H1B A;  3LQ7 A;  2XBI A;  3LG6 A;  4HQZ A;  2VL2 A;  1XPV A;  4Q5R A;  3NOF A;  4ID0 A;  4K6X A;  2C3N A;  2IME A;  2HRF A;  3L9V A;  3FY7 A;  2VCX A;  1SJZ A;  2IMK A;  5DAK A;  2P5Q A;  2HE3 A;  1TK5 B;  1DE1 A;  3AY8 A;  2H0I A;  3LYK A;  3QCP A;  4AJ8 A;  3HCZ A;  5D96 A;  1QXH A;  3EU4 A;  3KIJ A;  1YKA A;  3WT1 A;  4TR3 A;  2LST A;  1GLP A;  4IS0 A;  5DAK B;  2YV9 A;  1WP0 A;  5CRE A;  2VUP A;  2LQO A;  1AXD A;  1A8Y A;  3WGX A;  2H1G A;  3EWL A;  2GQL A;  2GSR A;  1VF2 A;  5ECK B;  3D5J A;  4TXV A;  3ERW A;  4K1F A;  3ZFL A;  1GUH A;  3HY2 A;  5IO0 A;  2B7J A;  1EGR A;  1GH2 A;  3US3 A;  5DDL A;  4L5L A;  4F82 A;  3VUR A;  5H5Q A;  3A2W A;  3LOR A;  2HXK A;  2PPT A;  1Z6M A;  2WDU A;  4HQS A;  1WIK A;  4OFT A;  4MPG A;  4NXI A;  2XHF A;  1R4W A;  1K3O A;  4POL A;  5EL8 A;  3OR5 A;  1X0R A;  1EV4 A;  4MH2 A;  5G5E A;  2C3T A;  3N9J A;  14GS A;  3WGE A;  3HKR A;  4ZBD A;  3HVX A;  3DEX A;  3PIN A;  2F51 A;  5IM9 A;  3EVI A;  2L5L A;  3IK7 A;  1GSD A;  2PER A;  3M3M A;  1ILO A;  3CRT A;  4ZL7 A;  4FYU A;  3ISO A;  3GMF A;  4EC0 A;  2KP2 A;  2YWI A;  3DML A;  2DJ1 A;  4TW5 A;  2FWG A;  2GT5 A;  2LRC A;  4GSN A;  3IR4 A;  2R5G A;  4MF6 A;  2VD0 A;  1K0D A;  9GSS A;  2C0E A;  5F8B A;  4IQA A;  5DQY A;  2L57 A;  3Q74 A;  1K0B A;  1S3D A;  3IOS A;  3WD6 A;  2O85 A;  2KHP A;  2X64 A;  3ZLP A;  2TRX A;  1Z5Y E;  3F6F A;  2CZ2 A;  3GL5 A;  3E0U A;  2JL4 A;  3PR8 A;  4RUV A;  4GTU A;  3M1G A;  2P0G A;  3WYW A;  3HJP A;  3HYP A;  2BMX A;  3F4S A;  3UEM A;  1XW9 A;  4Q5N A;  5COH A;  2LRT A;  1WJK A;  2F9S A;  3LFL A;  4AGS A;  3FRC A;  1A24 A;  4IP6 A;  3GTU A;  3GA4 A;  1YEP A;  5F07 A;  2V6O A;  4WR5 A;  4D73 B;  1Z9H A;  1O7U A;  2GST A;  2K8S A;  3L78 A;  4KSO A;  2VL3 A;  4FYC A;  1XWA A;  5DCG A;  2RUF A;  1GSY A;  3VI7 A;  3FYG A;  3H8Q A;  3ZIJ A;  1VF1 A;  4ML6 A;  5ECO B;  3RDW A;  3MSZ A;  1FHE A;  3EC3 A;  3E9J B;  2H71 A;  2CZ3 A;  4Q5F A;  3A2X A;  1TTZ A;  2IMD A;  4K9Z A;  3TKQ A;  1G6W A;  1YQ1 A;  2GSQ A;  1KNG A;  3UBK A;  2X99 A;  1ZZY A;  3QR6 A;  2FWE A;  1AC1 A;  3NIV A;  4GSS A;  4IJI A;  2IN3 A;  4ZBB A;  3EUR A;  1JZO A;  2H70 A;  1VRS D;  1N8J A;  5HR1 A;  1G6Y A;  1ZYQ B;  3EU3 A;  3LJR A;  2YP6 A;  4NWY A;  3ZYW A;  1PQN A;  1U88 A;  3KJY A;  3E3E A;  4DSR A;  2GQM A;  2VL9 A;  4L0W A;  1AAZ A;  5ABR A;  1ZL9 A;  4KA0 A;  4MF5 A;  3M9K A;  4GWR A;  4XS4 A;  2VM2 A;  1SK2 A;  3KH7 A;  3U5R E;  4RI7 A;  4F03 A;  4OO5 A;  2GZP A;  5F06 A;  1SYR A;  1V57 A;  1GSU A;  2AUV A;  2OE0 A;  1K0O A;  3JCM L;  2GSS A;  1I9D A;  2LEG A;  1GUL A;  2B7K A;  3UVH A;  1OE8 A;  4JRR A;  4XS4 B;  5KN3 A;  1SL0 B;  1U3I A;  2HLS A;  1O6J A;  3TUE A;  2YAN A;  5J41 A;  1PMT A;  1EEJ A;  3DVW A;  3KM6 A;  1F6M C;  1OC3 A;  3O6T A;  1ZCP A;  3F0I A;  3Q6O A;  4K7N A;  1TRV A;  4NPB A;  2FWH A;  3F3R A;  2FHE A;  3MWH A;  2EIO A;  2FCH A;  2LJA A;  3KP9 A;  4DSS A;  3LEF A;  3UIW A;  3IK9 A;  2KP1 A;  4CDO A;  1GTU A;  4KSM A;  1Q98 A;  1SD8 A;  4KDX A;  1XZO A;  5ENU A;  3TKS E;  2P5R A;  2PGT A;  13GS A;  1NHY A;  1YF1 A;  2Z9S A;  3P90 A; 
#chains in the Genus database with same CATH topology
 4WF4 A;  2NDO A;  3GSS A;  5KOX A;  1J9B A;  2GLR A;  4EL1 A;  4MH3 A;  5C00 A;  2C0D A;  1B8X A;  2A2P A;  1FOH A;  2M72 A;  4KB3 A;  1TI3 A;  3C71 A;  1XWG A;  1M2B A;  4ZB6 A;  5ECS A;  1TXX A;  1BYE A;  2CX4 A;  4XCS A;  1KEB A;  3KXO A;  4TR0 A;  2KLX A;  3BCI A;  4YAP A;  16GS A;  1BJX A;  1I5G A;  2TIR A;  2GT6 A;  1J08 A;  2GS3 A;  2C8U A;  2R3X A;  4EF0 A;  2CAI A;  2N5A A;  2QKE A;  1HNB A;  2IFQ A;  3ZRE A;  1UN2 A;  5J3R A;  2H19 A;  1JZD A;  5IMV A;  18GS A;  1Y25 A;  5CP1 A;  1V58 A;  2EIQ A;  2AB6 A;  2B5X A;  2LJK A;  4MAB A;  3DD3 A;  5EVO A;  2XPE A;  2QGV A;  3DKS A;  3CBU A;  3WT2 A;  3APO A;  1SD9 A;  3UMA A;  2LNT A;  3ZVJ A;  3KZQ A;  1SL1 B;  4I8B A;  4GRF A;  6GSW A;  3KP8 A;  5F05 A;  2DJK A;  2LJR A;  2YOI A;  2H8L A;  1V2A A;  3HJO A;  2V6K A;  5DBQ A;  2R6K A;  5A4U A;  1AIU A;  2H6X A;  3QOU A;  4N10 A;  2B5Y A;  5DQS A;  5ECH B;  4EKZ A;  4MZW A;  4HU9 A;  5GZZ B;  2EC4 A;  1OKD A;  2QSI A;  5DAL A;  4KH7 A;  2B3S A;  4OCE A;  4ECC A;  2C0G A;  5ELA A;  4ZIL A;  2LS5 A;  4NHZ A;  1M0U A;  3WGD A;  2MMA A;  1ACV A;  2VIM A;  2HSH A;  3APQ A;  3P2A A;  4BWQ A;  4N11 A;  2V1M A;  1EOH A;  3QDN A;  2E2M A;  4RI6 A;  4IVF A;  7GSS A;  4USS A;  3QFB C;  2B6M A;  1K3Y A;  4G0K A;  5LNK e;  3A2V A;  3CSH A;  1XW6 A;  2K9F A;  3IAS 2;  3ZRD A;  5DJL A;  2YZU A;  4EXJ A;  3HVS A;  1WOU A;  4PUR A;  1K3L A;  1EV9 A;  3DVX A;  3G7Y A;  1HQO A;  5KOW A;  1T8E B;  1XWC A;  1XWK A;  1TU8 A;  4MA9 A;  2JAD A;  2M46 A;  5IMZ A;  4LMW A;  2PUK C;  2H6Y A;  4MPF A;  2VCZ A;  3GV1 A;  1EZK A;  3P7X A;  2H76 A;  3VK9 A;  2DJJ A;  5HR0 A;  4XHM A;  3RHC A;  3TOU A;  1T4Y A;  5BRT A;  4H86 A;  3VWX A;  4E8H A;  3G7I A;  5D9V A;  3FKF A;  1JZR A;  3FR6 A;  1M7T A;  1H4O A;  2GGT A;  1ZGN A;  1OC9 B;  4JE1 A;  4CHS A;  3GL3 A;  2AYT A;  4XTS A;  4IW9 A;  3I6A A;  1KTE A;  1ERU A;  3KTB A;  4PX1 A;  1F37 A;  1Z3E A;  1A2J A;  3DRN A;  4DSQ A;  5D9T A;  5HFG A;  3ZZX A;  1PD2 1;  3TKR A;  3DYR A;  4GQF A;  4TRX A;  1K0A A;  3GHA A;  4G0L A;  4G10 A;  1SKW B;  2H1D A;  5IQY A;  1VF4 A;  1DUG A;  1M9B A;  4IKH A;  1NW2 A;  2CQ9 A;  4PUF C;  2HFD A;  4YH2 A;  4NHW A;  2HI7 A;  4CY8 A;  1MD3 A;  3U6V A;  1Y6E A;  4BVX A;  1RQM A;  1X9W B;  4FQU A;  4KW6 A;  1ERT A;  3LWA A;  1SYX A;  3HA9 A;  4F0B A;  4FYB A;  2CAQ A;  2X8H A;  2JZT A;  2FA8 A;  4RQR A;  1G0T A;  3IAM 2;  3VWW A;  3D22 A;  3TJK A;  1XCC A;  1AUC A;  1A23 A;  4ML1 A;  3HZ4 A;  3IDV A;  4PQ1 A;  4YKF A;  2JSY A;  2C0F A;  5G2Z A;  5JWQ B;  3SWL A;  2G2Q A;  4L0U A;  3TRP A;  4OFN A;  4QL9 A;  3P8W A;  3IRA A;  4OCF A;  1EWX A;  2JSZ A;  2ZUP A;  2I81 A;  4ZIJ A;  4EDZ A;  4FO5 A;  2X8G A;  2B5E A;  4N0Z A;  2QA1 A;  1GWC A;  2PN8 A;  2H73 A;  4X43 A;  1GSQ A;  4WR4 A;  1SL2 B;  3HXS A;  4GF0 A;  2PBJ A;  2VCT A;  4AJ7 A;  2EIR A;  3VFI A;  2JU5 A;  1THX A;  1PN9 A;  2VAF A;  2DIZ A;  1BED A;  3RBT A;  4BA7 A;  1B9Y C;  2DLX A;  2F8F A;  6GSY A;  4D73 A;  2ON7 A;  2B1K A;  2OAC A;  3RAZ A;  5KN2 A;  1Z7P A;  1Q4J A;  1QQ2 A;  3TB2 A;  4TKY A;  3CRU A;  2VLV A;  2DBC A;  1MEK A;  2H0G A;  2R0C A;  4G0I A;  5G30 A;  4YQV A;  1YDK A;  1HD2 A;  1HYU A;  2E0Q A;  2H30 A;  5HQP A;  5E59 A;  5ECN B;  2WJU A;  1YEX A;  5JWR B;  3BBY A;  4V2N A;  2LV3 A;  1MTC A;  4WF5 A;  1VGL A;  3BD2 A;  4ISD A;  1BQ7 A;  2L6D A;  5A5K A;  2VCQ A;  2L4C A;  2A4H A;  1ZYE A;  1MD4 A;  4KDY A;  3LYP A;  1U3A A;  1UC7 A;  1GLQ A;  1URM A;  4JU5 A;  2L59 A;  4QQ7 A;  2N5F A;  4NV5 A;  3LGC A;  2CT6 A;  2DIY A;  2TRC P;  1T4Z A;  2HZF A;  1M2A A;  4ZBA A;  2DJ3 A;  5ECR B;  2ZCT A;  3D21 A;  4PNG A;  4OD7 A;  5CRW A;  3EYT A;  3KMN A;  2D2Z A;  5J9B A;  4I2U A;  4L8E A;  1X9S B;  5ECI B;  4MZC A;  2ON5 A;  3GIX A;  3N5O A;  1FVJ A;  1S3A A;  2YWM A;  11GS A;  3HHV A;  1M3J A;  1R5A A;  1PKW A;  2G0F A;  4HEA 2;  4Z2U A;  4K8M A;  1F2E A;  3QMX A;  2PU9 C;  3FW2 A;  2V2G A;  4I2T A;  1GNW A;  4IHU A;  2WRT A;  1SJI A;  4XRA A;  4QL7 A;  1SK0 A;  2YJH A;  1T3B A;  1GP1 A;  3CTG A;  4N0V A;  3TKS C;  1PX6 A;  2IMI A;  3KEB A;  4LL1 B;  3UJ1 A;  1F9M A;  2CVK A;  1T00 A;  2NVL A;  1X9M B;  1YF0 A;  6GSV A;  3KGK A;  4O5R A;  5FT3 A;  1GTA A;  5J5N A;  4GLT A;  4HI7 A;  4TOP A;  4IJ3 A;  5HFI A;  1GTB A;  5IPH A;  5H5S A;  2RUE A;  2MZC A;  3UOM A;  3IPZ A;  3C8E A;  3GX0 A;  2FWF A;  1PFO A;  5LD0 A;  3RPP A;  4O5U A;  5GAN D;  5CAX A;  4PQH A;  4HOJ A;  3GUR A;  5IPG A;  2NBS A;  2R2J A;  1ZYN A;  3KTL A;  4MK3 A;  2A2R A;  1OC8 A;  1BG5 A;  2HSY A;  1XG8 A;  4NAX A;  3C1R A;  4I97 A;  1SEN A;  12GS A;  1VF3 A;  2C3Q A;  4IN0 A;  3O3T A;  4BIK A;  1DE2 A;  3ZL5 A;  1GTI A;  5B6N A;  3PPU A;  1F3B A;  3ZVJ D;  1TOF A;  1A2L A;  1ERV A;  3ED3 A;  2IWT A;  3GKX A;  1WWJ A;  1ON4 A;  1IYH A;  1O8X A;  1YY7 A;  1GSE A;  6GSU A;  4KUN A;  1CQG A;  4E8E A;  2OJL A;  3VLN A;  4AF2 A;  2N5B A;  5G1K A;  1B4P A;  4ZB9 A;  2WGR A;  2F8A A;  1H75 A;  1GSF A;  4MJE A;  2FD3 A;  1R5P A;  4V1A g;  4WBJ A;  4POB A;  1PL2 A;  1K0M A;  2ES7 A;  3GFK A;  1OVN A;  2LKU A;  5CRG A;  1O73 A;  3EMP A;  1F3A A;  4KGI A;  4IGJ A;  4LLR A;  4ECB A;  3IHG A;  3MNG A;  2HRA A;  2AHE A;  1XIY A;  1WMJ A;  2RII A;  5DCH A;  3H4K A;  1V9W A;  1SJ6 A;  4BVY B;  4MJB A;  4IP1 A;  2LUS A;  2XPD A;  2P31 A;  3Q19 A;  4F2I A;  2VD1 A;  2OA7 A;  1V40 A;  2KUC A;  1G7E A;  1FB0 A;  5IO2 A;  5CO3 A;  5GAP D;  4GST A;  2DSA A;  5JWO B;  4X0X A;  5IOW A;  3EMX A;  2PMT A;  4MJA A;  5A4V A;  1PSQ A;  2R37 A;  2WB9 A;  1LJR A;  2YNX A;  5F0G A;  1A0R P;  3TRQ A;  2OAD A;  2X8C A;  4WEY A;  3IBH A;  1JLV A;  2VOC A;  3F9U A;  2HRN A;  2BTO T;  2XBQ A;  3QPM A;  4LA1 A;  3J7Y b;  1E2Y A;  1OKT A;  1PRX A;  1W4V A;  3IC4 A;  4IBP A;  3MAK A;  3FZA A;  2CVB A;  2REM A;  2PWJ A;  4XS6 A;  3D4M A;  1SU9 A;  4N30 A;  3L4N A;  3EE2 A;  1B9X C;  2H01 A;  4BWS A;  4G2E A;  2FLS A;  1K0C A;  4EUY A;  4GCI A;  3IA1 A;  5BMU A;  3TKS A;  2YWO A;  5HR2 A;  4WXT A;  3ERF A;  3KMO A;  4A5P A;  2NTO A;  4Q5Q A;  3Q18 A;  1TI1 A;  5AIV A;  3GRX A;  4HZ4 A;  3F4R A;  3GKK A;  4P3Y B;  2O7K A;  4TR4 A;  2VM1 A;  5DVB A;  4BL7 B;  1W89 A;  1YKC A;  1NM3 A;  2AV4 A;  3QAW A;  3KCM A;  4JR4 A;  1UVZ A;  2LTK A;  3GH6 A;  4F9Z A;  4K2D A;  4V2M A;  1PA3 A;  4WKW A;  3GKM A;  2H75 A;  4K5R A;  5AGY A;  1OE7 A;  4GXZ A;  1XXU A;  3GKN A;  2YN1 A;  3GST A;  3W6G A;  2FGX A;  2WFC A;  3FZ5 A;  1DBY A;  2JZR A;  1R7H A;  1A0F A;  5IMD A;  4YQU A;  1FB6 A;  3H79 A;  5B8A A;  4K7I A;  4ECI A;  1Z6N A;  4MP4 A;  2IPA A;  1EP8 A;  1U6T A;  4IQ1 A;  4JZQ A;  4GQC A;  5ID2 A;  1B48 A;  2ALB A;  1TRS A;  1X5C A;  4MCU A;  3HD5 A;  2HSM A;  2GQK A;  5G31 A;  1XBS A;  4KE3 A;  2AAW A;  3SBC A;  3UBL A;  4KDU A;  2OBK A;  3QAG A;  5ID2 B;  2NPB A;  3UAR A;  4ACS A;  3J7Y k;  2L5O A;  1SKR B;  3DIE A;  2CA8 A;  1OC9 A;  2MMZ A;  4HS1 A;  4OFM A;  4ICY A;  4Z7X A;  3ZIT A;  1GUK A;  2OBI A;  5D9X A;  5D8I A;  4V2L A;  3UL3 A;  4HDE A;  5D93 A;  2GZY A;  3HJM A;  1XFL A;  4MDC A;  3F4T A;  4KAE A;  3G9B A;  3LXT A;  2F3M A;  1FAA A;  5LCZ A;  5IMC A;  2LRN A;  1WPI A;  3FHK A;  1M3I A;  1S3R A;  5GST A;  4MJC A;  1IYI A;  4PUA A;  3CYN A;  3ZML A;  1TKD B;  4TN8 A;  4ZL9 A;  4OO4 A;  3PGT A;  2I4A A;  4KF9 A;  2YWN A;  3NZN A;  1TK8 B;  3GX8 A;  1E6B A;  5AIS A;  1TW9 A;  3M9J A;  1J0F A;  3A5I A;  5D9W A;  3G7J A;  2V32 A;  2RLI A;  4WBR D;  5L71 A;  2HYX A;  4L5O A;  1SK1 A;  1M2D A;  1O8W A;  1XOB A;  3H93 A;  1K0N A;  2VCW A;  3CSJ A;  5IOX A;  1T7P B;  2AJQ B;  2QC7 A;  6GSX A;  3V1W A;  3GH9 A;  20GS A;  1AQV A;  3TGZ A;  1TP9 A;  5B8B A;  2H72 A;  1A2M A;  1GSS A;  3BJ5 A;  3I43 A;  3TJF A;  2K6V A;  1PL1 A;  5C04 A;  2OE3 A;  3QD9 A;  4J2F A;  4J56 E;  3TDG A;  5G5F A;  1X5D A;  1JFU A;  1O85 A;  2GZZ A;  4EIQ A;  5HR3 A;  2PVQ A;  2R0P A;  4PXO A;  1BAY A;  3M0F A;  3S9F A;  1XVW A;  2WS2 A;  1QK8 A;  5KN1 A;  3ZIV A;  4EVM A;  2FY6 A;  1NHO A;  3CSI A;  2RM6 A;  3CMI A;  3D6I A;  3H1N A;  1Z7R A;  2WZ9 A;  1MDJ A;  2FUG 2;  2A2S A;  3F3Q A;  4TXO A;  2H1A A;  1G7O A;  4JR6 A;  3GN3 A;  5JCW A;  4PNF A;  2GDR A;  1MDK A;  2IL3 A;  3FR9 A;  4ECJ A;  2E2G A;  1RW1 A;  2YJ7 A;  3IE3 A;  1S3C A;  2MBS A;  2BJX A;  2J23 A;  2R0G A;  3FR3 A;  4TXO B;  4PQI A;  1MDI A;  4LL4 B;  3VPQ A;  1TU7 A;  4MZB A;  2M80 A;  1O81 A;  4J57 E;  4POK A;  3IHQ A;  3TRX A;  2PVO C;  1OYJ A;  4HUA A;  5ECL B;  2FA4 A;  2H6Z A;  3DGQ A;  2CX3 A;  3ZMK A;  1AW9 A;  4AJ6 A;  2H66 A;  3IV4 A;  3FEU A;  5CRH A;  1XVQ A;  4TVE A;  4LMV A;  2XC2 A;  3L9S A;  4XIH A;  2ZNM A;  4FIW A;  2R4V A;  4I5Q A;  3FK8 A;  3ME7 A;  4EDY A;  1EEM A;  1GUM A;  3DWV A;  5IIZ A;  3TCO A;  4BPY A;  2DML A;  3HVN A;  1M9A A;  5AIX A;  2O8V B;  5DJM A;  3GTU B;  5GSS A;  1AQW A;  4HU7 A;  1QGV A;  4DVC A;  2MYG A;  1RK4 A;  5G1L A;  1LBK A;  2IJY A;  4KX4 A;  5CNW A;  1ZOF A;  1QFN A;  2IIY A;  2DKH A;  1YZX A;  1FW1 A;  3HZ8 A;  3GNJ A;  1JZW A;  2YV7 A;  5B6M A;  5FWG A;  4F0C A;  2JZS A;  2JAC A;  5ECQ B;  2I9H A;  2DMM A;  1DSB A;  4G19 A;  1TRW A;  4O92 A;  2VLT A;  2FNO A;  2WCI A;  1WRY A;  1XOA A;  3RPN A;  3EPT A;  3MIX A;  3VWV A;  1EGO A;  4ZB8 A;  2LQQ A;  3CQF A;  2J9H A;  3LW9 A;  5E4W A;  3I9V 2;  3QFA C;  2VCV A;  3EIN A;  4RQX A;  2L6C A;  1UA5 A;  3UVT A;  3GYK A;  3LXZ A;  3CTF A;  2VO4 A;  2HRK A;  1PX7 A;  1XWB A;  3HDC A;  3UAP A;  4OWY A;  2H74 A;  3TOT A;  4POM A;  19GS A;  1AQX A;  1ERW A;  2DC5 A;  3L0H A;  2E7P A;  3TJJ A;  1C72 A;  1CQH A;  2WUL A;  2MBT A;  2YPM A;  4OMV A;  2O89 A;  1TJD A;  2A4V A;  1THO A;  1YJ6 A;  1XW5 A;  4WET A;  2H0H A;  4O7H A;  3VPT A;  3TJB A;  3APS A;  4ZXG A;  3ZFB A;  2LNS A;  6GSS A;  2K18 A;  2HZE A;  2DKI A;  1WE0 A;  1PKZ A;  2YZH A;  4ILF A;  1ST9 A;  2VL2 C;  1ML6 A;  1ZMA A;  10GS A;  5ELG A;  4G9H A;  3BOA A;  4JBB A;  4KCA A;  5AN1 A;  3IC8 A;  4EIP A;  3DXB A;  2IMF A;  3C73 A;  2DJ2 A;  3CXG A;  1EP7 A;  2HZE B;  4KND A;  5B7C A;  2VLU A;  1NSW A;  4CW9 A;  4HSC X;  2CV4 A;  1TRU A;  3FZ4 A;  4V1A p;  3F8U A;  3K8N A;  1JHB A;  1ZYP A;  4DSS B;  2RM5 A;  4K7O A;  4BVY A;  5JCU A;  3ERG A;  3KH9 A;  1SKS B;  3IXR A;  5EY6 A;  17GS A;  3W8J A;  2OE1 A;  1M99 A;  5ECM B;  3L9U A;  3ME8 A;  1USB A;  2OKA A;  5INY A;  4K0G A;  1U87 A;  4XS1 A;  4NV2 A;  5J9C A;  4HJ2 A;  1TDI A;  4Z2T A;  4TR1 A;  4ULX A;  1QMV A;  1FO5 A;  1T1V A;  3D0Z A;  3M8N A;  3ZTL A;  4EO3 A;  3R2Q A;  2C4J A;  8GSS A;  3BCK A;  4MLY A;  1HNA A;  3I69 A;  3KD0 A;  3TKP A;  1B4Q A;  3A5W A;  1TK0 B;  4YAV A;  4TR1 B;  3C1S A;  4X1U A;  3HVV A;  4PGT A;  1KBN A;  5EPF A;  1GRX A;  2B1L A;  4HJM A;  3F63 A;  5HFK A;  1PN0 A;  3O76 A;  1JLW A;  6GST A;  2YCD A;  3PH9 A;  2IFQ B;  3TJG A;  1V98 A;  1GL8 A;  2GVP A;  5J4U A;  5CYY A;  5KEJ A;  2MMN A;  4IEL A;  4DEJ A;  4YQM A;  1EOG A;  5CRD A;  4HZ2 A;  4BL7 A;  3VI5 A;  2C80 A;  1LU4 A;  3QAV A;  2UZ8 A;  2MMO A;  4K0N A;  2V41 A;  3D4T A;  1HNC A;  4EE0 A;  4XRD A;  5A4W A;  2HNL A;  2I3Y A;  2L4Q A;  2K8V A;  5IMF A;  4JED A;  1GNE A;  2I1U A;  3FZ9 A;  4PTS A;  2GTU A;  4MF7 A;  3MDK A;  4NMU A;  1BX9 A;  1ABA A;  4ZL8 A;  1FG4 A;  1R26 A;  5D73 A;  2QA2 A;  2HT9 A;  1OAZ A;  2O87 A;  5JCG A;  1QUW A;  3A3T A;  3LSZ A;  1A8L A;  1FVK A;  4MMM A;  5ECP B;  5FHI A;  3F6D A;  3W8S A;  4MNN A;  5H5R A;  5IMA A;  2CVD A;  2DJ0 A;  4I6X A;  3VWU A;  5DAL B;  2KOK A;  5KN0 A;  4KCE A;  4K2X A;  1PGT A;  3RHB A;  22GS A;  4FH8 A;  1FOV A;  1N2A A;  3C7M A;  2C1Y A;  4O32 A;  1X5E A;  2H1B A;  3LQ7 A;  2XBI A;  3LG6 A;  4HQZ A;  2VL2 A;  1XPV A;  4Q5R A;  3NOF A;  4ID0 A;  4K6X A;  2C3N A;  2IME A;  2HRF A;  3L9V A;  3FY7 A;  2VCX A;  1SJZ A;  2IMK A;  5DAK A;  2P5Q A;  2HE3 A;  1TK5 B;  1DE1 A;  3AY8 A;  2H0I A;  3LYK A;  3QCP A;  4AJ8 A;  3HCZ A;  5D96 A;  1QXH A;  3EU4 A;  3KIJ A;  1YKA A;  3WT1 A;  4TR3 A;  2LST A;  1GLP A;  4IS0 A;  5DAK B;  2YV9 A;  1WP0 A;  5CRE A;  2VUP A;  2LQO A;  1AXD A;  1A8Y A;  3WGX A;  2H1G A;  3EWL A;  2GQL A;  2GSR A;  1VF2 A;  5ECK B;  3D5J A;  4TXV A;  3ERW A;  4K1F A;  3ZFL A;  1GUH A;  3HY2 A;  5IO0 A;  2B7J A;  1EGR A;  1GH2 A;  3US3 A;  5DDL A;  4L5L A;  4F82 A;  3VUR A;  3MYD A;  5H5Q A;  3A2W A;  3LOR A;  2HXK A;  2PPT A;  1Z6M A;  2WDU A;  4HQS A;  1WIK A;  4OFT A;  4MPG A;  4NXI A;  2XHF A;  1R4W A;  1K3O A;  4POL A;  5EL8 A;  3OR5 A;  1X0R A;  1EV4 A;  4MH2 A;  5G5E A;  2C3T A;  3N9J A;  14GS A;  3WGE A;  3HKR A;  4ZBD A;  3HVX A;  3DEX A;  3PIN A;  2F51 A;  5IM9 A;  3EVI A;  2L5L A;  3IK7 A;  1GSD A;  2PER A;  3M3M A;  1ILO A;  4BVX B;  3CRT A;  4ZL7 A;  4FYU A;  3ISO A;  3GMF A;  4EC0 A;  2KP2 A;  2YWI A;  3DML A;  3FMW A;  2DJ1 A;  4TW5 A;  2FWG A;  2GT5 A;  2LRC A;  4GSN A;  3IR4 A;  2R5G A;  4MF6 A;  2VD0 A;  1K0D A;  9GSS A;  2C0E A;  5F8B A;  3P90 A;  4IQA A;  5DQY A;  2L57 A;  3Q74 A;  1K0B A;  1S3D A;  3IOS A;  3WD6 A;  2O85 A;  2KHP A;  2X64 A;  4CY6 A;  3ZLP A;  2TRX A;  1Z5Y E;  3F6F A;  2CZ2 A;  3GL5 A;  3E0U A;  2JL4 A;  3PR8 A;  4RUV A;  4GTU A;  3M1G A;  2P0G A;  3WYW A;  3HJP A;  3HYP A;  2BMX A;  3F4S A;  3UEM A;  1XW9 A;  4Q5N A;  5COH A;  2LRT A;  1WJK A;  4Z2R A;  2F9S A;  3LFL A;  4AGS A;  3FRC A;  1A24 A;  4IP6 A;  3GTU A;  3GA4 A;  1YEP A;  5F07 A;  2V6O A;  4WR5 A;  4D73 B;  1Z9H A;  1O7U A;  2GST A;  2K8S A;  3L78 A;  4KSO A;  2VL3 A;  4FYC A;  4YKG A;  2X4A A;  1XWA A;  5DCG A;  2RUF A;  1GSY A;  3VI7 A;  3FYG A;  3H8Q A;  3ZIJ A;  1VF1 A;  4ML6 A;  5ECO B;  3RDW A;  3MSZ A;  1FHE A;  2X49 A;  3EC3 A;  3E9J B;  2H71 A;  2CZ3 A;  4Q5F A;  3A2X A;  1TTZ A;  2IMD A;  4K9Z A;  3TKQ A;  1G6W A;  1YQ1 A;  2GSQ A;  1KNG A;  3UBK A;  2X99 A;  1ZZY A;  3QR6 A;  2FWE A;  1AC1 A;  3NIV A;  4GSS A;  4IJI A;  2IN3 A;  4ZBB A;  3EUR A;  1JZO A;  2H70 A;  1VRS D;  1N8J A;  5HR1 A;  1G6Y A;  1ZYQ B;  3EU3 A;  3LJR A;  2YP6 A;  4NWY A;  3ZYW A;  1PQN A;  1U88 A;  3KJY A;  3E3E A;  4DSR A;  2GQM A;  2VL9 A;  4L0W A;  1AAZ A;  5ABR A;  1ZL9 A;  4K5S A;  4KA0 A;  4MF5 A;  3M9K A;  4GWR A;  4XS4 A;  2VM2 A;  1SK2 A;  3KH7 A;  3U5R E;  4RI7 A;  4F03 A;  4OO5 A;  2GZP A;  5F06 A;  1SYR A;  1V57 A;  1GSU A;  2AUV A;  3R3E A;  2OE0 A;  4X4J A;  1K0O A;  3JCM L;  2GSS A;  1I9D A;  2LEG A;  1GUL A;  2B7K A;  3UVH A;  1OE8 A;  4JRR A;  4XS4 B;  5KN3 A;  1SL0 B;  1U3I A;  2HLS A;  1O6J A;  3TUE A;  2YAN A;  5J41 A;  1PMT A;  1EEJ A;  3DVW A;  3KM6 A;  1F6M C;  1OC3 A;  3O6T A;  4O5Q A;  1ZCP A;  3F0I A;  3Q6O A;  4K7N A;  1TRV A;  4NPB A;  2FWH A;  3F3R A;  2FHE A;  3MWH A;  2EIO A;  2FCH A;  2LJA A;  3KP9 A;  4DSS A;  3LEF A;  3UIW A;  3IK9 A;  2KP1 A;  4CDO A;  1GTU A;  4KSM A;  1Q98 A;  1SD8 A;  4KDX A;  1XZO A;  5ENU A;  3TKS E;  2P5R A;  2PGT A;  13GS A;  1NHY A;  1YF1 A;  2Z9S A;  3GUS A; 
#chains in the Genus database with same CATH homology
 4WF4 A;  2NDO A;  3GSS A;  5KOX A;  1J9B A;  2GLR A;  4EL1 A;  4MH3 A;  5C00 A;  2C0D A;  1B8X A;  2A2P A;  1FOH A;  2M72 A;  4KB3 A;  1TI3 A;  3C71 A;  1XWG A;  1M2B A;  4ZB6 A;  5ECS A;  1TXX A;  1BYE A;  2CX4 A;  4XCS A;  1KEB A;  3KXO A;  4TR0 A;  2KLX A;  3BCI A;  4YAP A;  16GS A;  1BJX A;  1I5G A;  2TIR A;  2GT6 A;  1J08 A;  2GS3 A;  2C8U A;  2R3X A;  4EF0 A;  2CAI A;  2N5A A;  2QKE A;  1HNB A;  2IFQ A;  3ZRE A;  1UN2 A;  5J3R A;  2H19 A;  1JZD A;  5IMV A;  18GS A;  1Y25 A;  5CP1 A;  1V58 A;  2EIQ A;  2AB6 A;  2B5X A;  2LJK A;  4MAB A;  3DD3 A;  5EVO A;  2XPE A;  2QGV A;  3DKS A;  3CBU A;  3WT2 A;  3APO A;  1SD9 A;  3UMA A;  2LNT A;  3ZVJ A;  3KZQ A;  1SL1 B;  4I8B A;  4GRF A;  6GSW A;  3KP8 A;  5F05 A;  2DJK A;  2LJR A;  2YOI A;  2H8L A;  1V2A A;  3HJO A;  2V6K A;  5DBQ A;  2R6K A;  5A4U A;  1AIU A;  2H6X A;  3QOU A;  4N10 A;  2B5Y A;  5DQS A;  5ECH B;  4EKZ A;  4MZW A;  4HU9 A;  5GZZ B;  2EC4 A;  1OKD A;  2QSI A;  5DAL A;  4KH7 A;  2B3S A;  4OCE A;  4ECC A;  2C0G A;  5ELA A;  4ZIL A;  2LS5 A;  4NHZ A;  1M0U A;  3WGD A;  2MMA A;  1ACV A;  2VIM A;  2HSH A;  3APQ A;  3P2A A;  4BWQ A;  4N11 A;  2V1M A;  1EOH A;  3QDN A;  2E2M A;  4RI6 A;  4IVF A;  7GSS A;  4USS A;  3QFB C;  2B6M A;  1K3Y A;  4G0K A;  5LNK e;  3A2V A;  3CSH A;  1XW6 A;  2K9F A;  3IAS 2;  3ZRD A;  5DJL A;  2YZU A;  4EXJ A;  3HVS A;  1WOU A;  4PUR A;  1K3L A;  1EV9 A;  3DVX A;  3G7Y A;  1HQO A;  5KOW A;  1T8E B;  1XWC A;  1XWK A;  1TU8 A;  4MA9 A;  2JAD A;  2M46 A;  5IMZ A;  4LMW A;  2PUK C;  2H6Y A;  4MPF A;  2VCZ A;  3GV1 A;  1EZK A;  3P7X A;  2H76 A;  3VK9 A;  2DJJ A;  5HR0 A;  4XHM A;  3RHC A;  3TOU A;  1T4Y A;  5BRT A;  4H86 A;  3VWX A;  4E8H A;  3G7I A;  5D9V A;  3FKF A;  1JZR A;  3FR6 A;  1M7T A;  1H4O A;  2GGT A;  1ZGN A;  1OC9 B;  4JE1 A;  4CHS A;  3GL3 A;  2AYT A;  4XTS A;  4IW9 A;  3I6A A;  1KTE A;  1ERU A;  3KTB A;  4PX1 A;  1F37 A;  1Z3E A;  1A2J A;  3DRN A;  4DSQ A;  5D9T A;  5HFG A;  3ZZX A;  1PD2 1;  3TKR A;  3DYR A;  4GQF A;  4TRX A;  1K0A A;  3GHA A;  4G0L A;  4G10 A;  1SKW B;  2H1D A;  5IQY A;  1VF4 A;  1DUG A;  1M9B A;  4IKH A;  1NW2 A;  2CQ9 A;  4PUF C;  2HFD A;  4YH2 A;  4NHW A;  2HI7 A;  4CY8 A;  1MD3 A;  3U6V A;  1Y6E A;  4BVX A;  1RQM A;  1X9W B;  4FQU A;  4KW6 A;  1ERT A;  3LWA A;  1SYX A;  3HA9 A;  4F0B A;  4FYB A;  2CAQ A;  2X8H A;  2JZT A;  2FA8 A;  4RQR A;  1G0T A;  3IAM 2;  3VWW A;  3D22 A;  3TJK A;  1XCC A;  1AUC A;  1A23 A;  4ML1 A;  3HZ4 A;  3IDV A;  4PQ1 A;  4YKF A;  2JSY A;  2C0F A;  5G2Z A;  5JWQ B;  3SWL A;  2G2Q A;  4L0U A;  3TRP A;  4OFN A;  4QL9 A;  3P8W A;  3IRA A;  4OCF A;  1EWX A;  2JSZ A;  2ZUP A;  2I81 A;  4ZIJ A;  4EDZ A;  4FO5 A;  2X8G A;  2B5E A;  4N0Z A;  2QA1 A;  1GWC A;  2PN8 A;  2H73 A;  4X43 A;  1GSQ A;  4WR4 A;  1SL2 B;  3HXS A;  4GF0 A;  2PBJ A;  2VCT A;  4AJ7 A;  2EIR A;  3VFI A;  2JU5 A;  1THX A;  1PN9 A;  2VAF A;  2DIZ A;  1BED A;  3RBT A;  4BA7 A;  1B9Y C;  2DLX A;  2F8F A;  6GSY A;  4D73 A;  2ON7 A;  2B1K A;  2OAC A;  3RAZ A;  5KN2 A;  1Z7P A;  1Q4J A;  1QQ2 A;  3TB2 A;  4TKY A;  3CRU A;  2VLV A;  2DBC A;  1MEK A;  2H0G A;  2R0C A;  4G0I A;  5G30 A;  4YQV A;  1YDK A;  1HD2 A;  1HYU A;  2E0Q A;  2H30 A;  5HQP A;  5E59 A;  5ECN B;  2WJU A;  1YEX A;  5JWR B;  3BBY A;  4V2N A;  2LV3 A;  1MTC A;  4WF5 A;  1VGL A;  3BD2 A;  4ISD A;  1BQ7 A;  2L6D A;  5A5K A;  2VCQ A;  2L4C A;  2A4H A;  1ZYE A;  1MD4 A;  4KDY A;  3LYP A;  1U3A A;  1UC7 A;  1GLQ A;  1URM A;  4JU5 A;  2L59 A;  4QQ7 A;  2N5F A;  4NV5 A;  3LGC A;  2CT6 A;  2DIY A;  2TRC P;  1T4Z A;  2HZF A;  1M2A A;  4ZBA A;  2DJ3 A;  5ECR B;  2ZCT A;  3D21 A;  4PNG A;  4OD7 A;  5CRW A;  3EYT A;  3KMN A;  2D2Z A;  5J9B A;  4I2U A;  4L8E A;  1X9S B;  5ECI B;  4MZC A;  2ON5 A;  3GIX A;  3N5O A;  1FVJ A;  1S3A A;  2YWM A;  11GS A;  3HHV A;  1R5A A;  1PKW A;  2G0F A;  4HEA 2;  4Z2U A;  4K8M A;  1F2E A;  3QMX A;  2PU9 C;  3FW2 A;  2V2G A;  4I2T A;  1GNW A;  4IHU A;  2WRT A;  1SJI A;  4XRA A;  4QL7 A;  1SK0 A;  2YJH A;  1T3B A;  1GP1 A;  3CTG A;  4N0V A;  3TKS C;  1PX6 A;  2IMI A;  3KEB A;  4LL1 B;  3UJ1 A;  1F9M A;  2CVK A;  1T00 A;  2NVL A;  1X9M B;  1YF0 A;  6GSV A;  3KGK A;  4O5R A;  5FT3 A;  1GTA A;  5J5N A;  4GLT A;  4HI7 A;  4TOP A;  4IJ3 A;  5HFI A;  1GTB A;  5IPH A;  5H5S A;  2RUE A;  2MZC A;  3UOM A;  3IPZ A;  3C8E A;  3GX0 A;  2FWF A;  5LD0 A;  3RPP A;  4O5U A;  5GAN D;  5CAX A;  4PQH A;  4HOJ A;  3GUR A;  5IPG A;  2NBS A;  2R2J A;  1ZYN A;  3KTL A;  4MK3 A;  2A2R A;  1OC8 A;  1BG5 A;  2HSY A;  4NAX A;  3C1R A;  4I97 A;  1SEN A;  12GS A;  1VF3 A;  2C3Q A;  4IN0 A;  3O3T A;  1DE2 A;  3ZL5 A;  1GTI A;  5B6N A;  3PPU A;  1F3B A;  3ZVJ D;  1TOF A;  1A2L A;  1ERV A;  3ED3 A;  2IWT A;  3GKX A;  1WWJ A;  1ON4 A;  1IYH A;  1O8X A;  1YY7 A;  1GSE A;  6GSU A;  4KUN A;  1CQG A;  4E8E A;  2OJL A;  3VLN A;  4AF2 A;  2N5B A;  5G1K A;  1B4P A;  4ZB9 A;  2WGR A;  2F8A A;  1H75 A;  1GSF A;  4MJE A;  2FD3 A;  1R5P A;  4V1A g;  4WBJ A;  4POB A;  1PL2 A;  1K0M A;  2ES7 A;  3GFK A;  1OVN A;  2LKU A;  5CRG A;  1O73 A;  3EMP A;  1F3A A;  4KGI A;  4IGJ A;  4LLR A;  4ECB A;  3IHG A;  3MNG A;  2HRA A;  2AHE A;  1XIY A;  1WMJ A;  2RII A;  5DCH A;  3H4K A;  1V9W A;  1SJ6 A;  4BVY B;  4MJB A;  4IP1 A;  2LUS A;  2XPD A;  2P31 A;  3Q19 A;  4F2I A;  2VD1 A;  2OA7 A;  1V40 A;  2KUC A;  1G7E A;  1FB0 A;  5IO2 A;  5CO3 A;  5GAP D;  4GST A;  2DSA A;  5JWO B;  4X0X A;  5IOW A;  3EMX A;  2PMT A;  4MJA A;  5A4V A;  1PSQ A;  2R37 A;  2WB9 A;  1LJR A;  2YNX A;  5F0G A;  1A0R P;  3TRQ A;  2OAD A;  2X8C A;  4WEY A;  3IBH A;  1JLV A;  2VOC A;  3F9U A;  2HRN A;  2BTO T;  2XBQ A;  3QPM A;  4LA1 A;  3J7Y b;  1E2Y A;  1OKT A;  1PRX A;  1W4V A;  3IC4 A;  4IBP A;  3MAK A;  3FZA A;  2CVB A;  2REM A;  2PWJ A;  4XS6 A;  3D4M A;  1SU9 A;  4N30 A;  3L4N A;  3EE2 A;  1B9X C;  2H01 A;  4BWS A;  4G2E A;  2FLS A;  1K0C A;  4EUY A;  4GCI A;  3IA1 A;  5BMU A;  3TKS A;  2YWO A;  5HR2 A;  4WXT A;  3ERF A;  3KMO A;  4A5P A;  2NTO A;  4Q5Q A;  3Q18 A;  1TI1 A;  5AIV A;  3GRX A;  4HZ4 A;  3F4R A;  3GKK A;  4P3Y B;  2O7K A;  4TR4 A;  2VM1 A;  5DVB A;  4BL7 B;  1W89 A;  1YKC A;  1NM3 A;  2AV4 A;  3QAW A;  3KCM A;  4JR4 A;  1UVZ A;  2LTK A;  3GH6 A;  4F9Z A;  4K2D A;  4V2M A;  1PA3 A;  4WKW A;  3GKM A;  2H75 A;  4K5R A;  5AGY A;  1OE7 A;  4GXZ A;  1XXU A;  3GKN A;  2YN1 A;  3GST A;  3W6G A;  2FGX A;  2WFC A;  3FZ5 A;  1DBY A;  2JZR A;  1R7H A;  1A0F A;  5IMD A;  4YQU A;  1FB6 A;  3H79 A;  5B8A A;  4K7I A;  4ECI A;  1Z6N A;  4MP4 A;  2IPA A;  1EP8 A;  1U6T A;  4IQ1 A;  4JZQ A;  4GQC A;  5ID2 A;  1B48 A;  2ALB A;  1TRS A;  1X5C A;  4MCU A;  3HD5 A;  2HSM A;  2GQK A;  5G31 A;  1XBS A;  4KE3 A;  2AAW A;  3SBC A;  3UBL A;  4KDU A;  2OBK A;  3QAG A;  5ID2 B;  2NPB A;  3UAR A;  4ACS A;  3J7Y k;  2L5O A;  1SKR B;  3DIE A;  2CA8 A;  1OC9 A;  2MMZ A;  4HS1 A;  4OFM A;  4ICY A;  4Z7X A;  3ZIT A;  1GUK A;  2OBI A;  5D9X A;  5D8I A;  4V2L A;  3UL3 A;  4HDE A;  5D93 A;  2GZY A;  3HJM A;  1XFL A;  4MDC A;  3F4T A;  4KAE A;  3G9B A;  3LXT A;  2F3M A;  1FAA A;  5LCZ A;  5IMC A;  2LRN A;  1WPI A;  3FHK A;  5GST A;  4MJC A;  1IYI A;  4PUA A;  3CYN A;  3ZML A;  1TKD B;  4TN8 A;  4ZL9 A;  4OO4 A;  3PGT A;  2I4A A;  4KF9 A;  2YWN A;  3NZN A;  1TK8 B;  3GX8 A;  1E6B A;  5AIS A;  1TW9 A;  3M9J A;  1J0F A;  3A5I A;  5D9W A;  3G7J A;  2V32 A;  2RLI A;  4WBR D;  5L71 A;  2HYX A;  4L5O A;  1SK1 A;  1M2D A;  1O8W A;  1XOB A;  3H93 A;  1K0N A;  2VCW A;  3CSJ A;  5IOX A;  1T7P B;  2AJQ B;  2QC7 A;  6GSX A;  3V1W A;  3GH9 A;  20GS A;  1AQV A;  3TGZ A;  1TP9 A;  5B8B A;  2H72 A;  1A2M A;  1GSS A;  3BJ5 A;  3I43 A;  3TJF A;  2K6V A;  1PL1 A;  5C04 A;  2OE3 A;  3QD9 A;  4J2F A;  4J56 E;  3TDG A;  5G5F A;  1X5D A;  1JFU A;  1O85 A;  2GZZ A;  4EIQ A;  5HR3 A;  2PVQ A;  2R0P A;  4PXO A;  1BAY A;  3M0F A;  3S9F A;  1XVW A;  2WS2 A;  1QK8 A;  5KN1 A;  3ZIV A;  4EVM A;  2FY6 A;  1NHO A;  3CSI A;  2RM6 A;  3CMI A;  3D6I A;  3H1N A;  1Z7R A;  2WZ9 A;  1MDJ A;  2FUG 2;  2A2S A;  3F3Q A;  4TXO A;  2H1A A;  1G7O A;  4JR6 A;  3GN3 A;  5JCW A;  4PNF A;  2GDR A;  1MDK A;  2IL3 A;  3FR9 A;  4ECJ A;  2E2G A;  1RW1 A;  2YJ7 A;  3IE3 A;  1S3C A;  2MBS A;  2BJX A;  2J23 A;  2R0G A;  3FR3 A;  4TXO B;  4PQI A;  1MDI A;  4LL4 B;  3VPQ A;  1TU7 A;  4MZB A;  2M80 A;  1O81 A;  4J57 E;  4POK A;  3IHQ A;  3TRX A;  2PVO C;  1OYJ A;  4HUA A;  5ECL B;  2FA4 A;  2H6Z A;  3DGQ A;  2CX3 A;  3ZMK A;  1AW9 A;  4AJ6 A;  2H66 A;  3IV4 A;  3FEU A;  5CRH A;  1XVQ A;  4TVE A;  4LMV A;  2XC2 A;  3L9S A;  4XIH A;  2ZNM A;  4FIW A;  2R4V A;  4I5Q A;  3FK8 A;  3ME7 A;  4EDY A;  1EEM A;  1GUM A;  3DWV A;  5IIZ A;  3TCO A;  4BPY A;  2DML A;  1M9A A;  5AIX A;  2O8V B;  5DJM A;  3GTU B;  5GSS A;  1AQW A;  4HU7 A;  1QGV A;  4DVC A;  2MYG A;  1RK4 A;  5G1L A;  1LBK A;  2IJY A;  4KX4 A;  5CNW A;  1ZOF A;  1QFN A;  2IIY A;  2DKH A;  1YZX A;  1FW1 A;  3HZ8 A;  3GNJ A;  1JZW A;  2YV7 A;  5B6M A;  5FWG A;  4F0C A;  2JZS A;  2JAC A;  5ECQ B;  2I9H A;  2DMM A;  1DSB A;  4G19 A;  1TRW A;  4O92 A;  2VLT A;  2FNO A;  2WCI A;  1WRY A;  1XOA A;  3RPN A;  3EPT A;  3MIX A;  3VWV A;  1EGO A;  4ZB8 A;  2LQQ A;  2J9H A;  3LW9 A;  5E4W A;  3I9V 2;  3QFA C;  2VCV A;  3EIN A;  4RQX A;  2L6C A;  1UA5 A;  3UVT A;  3GYK A;  3LXZ A;  3CTF A;  2VO4 A;  2HRK A;  1PX7 A;  1XWB A;  3HDC A;  3UAP A;  4OWY A;  2H74 A;  3TOT A;  4POM A;  19GS A;  1AQX A;  1ERW A;  2DC5 A;  3L0H A;  2E7P A;  3TJJ A;  1C72 A;  1CQH A;  2WUL A;  2MBT A;  2YPM A;  4OMV A;  2O89 A;  1TJD A;  2A4V A;  1THO A;  1YJ6 A;  1XW5 A;  4WET A;  2H0H A;  4O7H A;  3VPT A;  3TJB A;  3APS A;  4ZXG A;  3ZFB A;  2LNS A;  6GSS A;  2K18 A;  2HZE A;  2DKI A;  1WE0 A;  1PKZ A;  2YZH A;  4ILF A;  1ST9 A;  2VL2 C;  1ML6 A;  1ZMA A;  10GS A;  5ELG A;  4G9H A;  3BOA A;  4JBB A;  4KCA A;  5AN1 A;  3IC8 A;  4EIP A;  3DXB A;  2IMF A;  3C73 A;  2DJ2 A;  3CXG A;  1EP7 A;  2HZE B;  4KND A;  5B7C A;  2VLU A;  1NSW A;  4CW9 A;  2CV4 A;  1TRU A;  3FZ4 A;  4V1A p;  3F8U A;  3K8N A;  1JHB A;  1ZYP A;  4DSS B;  2RM5 A;  4K7O A;  4BVY A;  5JCU A;  3ERG A;  3KH9 A;  1SKS B;  3IXR A;  5EY6 A;  17GS A;  3W8J A;  2OE1 A;  1M99 A;  5ECM B;  3L9U A;  3ME8 A;  1USB A;  2OKA A;  5INY A;  4K0G A;  1U87 A;  4XS1 A;  4NV2 A;  5J9C A;  4HJ2 A;  1TDI A;  4Z2T A;  4TR1 A;  4ULX A;  1QMV A;  1FO5 A;  1T1V A;  3D0Z A;  3M8N A;  3ZTL A;  4EO3 A;  3R2Q A;  2C4J A;  8GSS A;  3BCK A;  4MLY A;  1HNA A;  3I69 A;  3KD0 A;  3TKP A;  1B4Q A;  3A5W A;  1TK0 B;  4YAV A;  4TR1 B;  3C1S A;  4X1U A;  3HVV A;  4PGT A;  1KBN A;  5EPF A;  1GRX A;  2B1L A;  4HJM A;  3F63 A;  5HFK A;  1PN0 A;  3O76 A;  1JLW A;  6GST A;  2YCD A;  3PH9 A;  2IFQ B;  3TJG A;  1V98 A;  1GL8 A;  2GVP A;  5J4U A;  5CYY A;  5KEJ A;  2MMN A;  4IEL A;  4DEJ A;  4YQM A;  1EOG A;  5CRD A;  4HZ2 A;  4BL7 A;  3VI5 A;  2C80 A;  1LU4 A;  3QAV A;  2UZ8 A;  2MMO A;  4K0N A;  2V41 A;  3D4T A;  1HNC A;  4EE0 A;  4XRD A;  5A4W A;  2HNL A;  2I3Y A;  2L4Q A;  2K8V A;  5IMF A;  4JED A;  1GNE A;  2I1U A;  3FZ9 A;  4PTS A;  2GTU A;  4MF7 A;  3MDK A;  4NMU A;  1BX9 A;  1ABA A;  4ZL8 A;  1FG4 A;  1R26 A;  5D73 A;  2QA2 A;  2HT9 A;  1OAZ A;  2O87 A;  5JCG A;  1QUW A;  3A3T A;  3LSZ A;  1A8L A;  1FVK A;  4MMM A;  5ECP B;  5FHI A;  3F6D A;  3W8S A;  4MNN A;  5H5R A;  5IMA A;  2CVD A;  2DJ0 A;  4I6X A;  3VWU A;  5DAL B;  2KOK A;  5KN0 A;  4KCE A;  4K2X A;  1PGT A;  3RHB A;  22GS A;  4FH8 A;  1FOV A;  1N2A A;  3C7M A;  2C1Y A;  4O32 A;  1X5E A;  2H1B A;  3LQ7 A;  2XBI A;  3LG6 A;  4HQZ A;  2VL2 A;  1XPV A;  4Q5R A;  3NOF A;  4ID0 A;  4K6X A;  2C3N A;  2IME A;  2HRF A;  3L9V A;  3FY7 A;  2VCX A;  1SJZ A;  2IMK A;  5DAK A;  2P5Q A;  2HE3 A;  1TK5 B;  1DE1 A;  3AY8 A;  2H0I A;  3LYK A;  3QCP A;  4AJ8 A;  3HCZ A;  5D96 A;  1QXH A;  3EU4 A;  3KIJ A;  1YKA A;  3WT1 A;  4TR3 A;  2LST A;  1GLP A;  4IS0 A;  5DAK B;  2YV9 A;  1WP0 A;  5CRE A;  2VUP A;  2LQO A;  1AXD A;  1A8Y A;  3WGX A;  2H1G A;  3EWL A;  2GQL A;  2GSR A;  1VF2 A;  5ECK B;  3D5J A;  4TXV A;  3ERW A;  4K1F A;  3ZFL A;  1GUH A;  3HY2 A;  5IO0 A;  2B7J A;  1EGR A;  1GH2 A;  3US3 A;  5DDL A;  4L5L A;  4F82 A;  3VUR A;  3MYD A;  5H5Q A;  3A2W A;  3LOR A;  2HXK A;  2PPT A;  1Z6M A;  2WDU A;  4HQS A;  1WIK A;  4OFT A;  4MPG A;  4NXI A;  2XHF A;  1R4W A;  1K3O A;  4POL A;  5EL8 A;  3OR5 A;  1X0R A;  1EV4 A;  4MH2 A;  5G5E A;  2C3T A;  3N9J A;  14GS A;  3WGE A;  3HKR A;  4ZBD A;  3HVX A;  3DEX A;  3PIN A;  2F51 A;  5IM9 A;  3EVI A;  2L5L A;  3IK7 A;  1GSD A;  2PER A;  3M3M A;  1ILO A;  4BVX B;  3CRT A;  4ZL7 A;  4FYU A;  3ISO A;  3GMF A;  4EC0 A;  2KP2 A;  2YWI A;  3DML A;  3FMW A;  2DJ1 A;  4TW5 A;  2FWG A;  2GT5 A;  2LRC A;  4GSN A;  3IR4 A;  2R5G A;  4MF6 A;  2VD0 A;  1K0D A;  9GSS A;  2C0E A;  5F8B A;  3P90 A;  4IQA A;  5DQY A;  2L57 A;  3Q74 A;  1K0B A;  1S3D A;  3IOS A;  3WD6 A;  2O85 A;  2KHP A;  2X64 A;  4CY6 A;  3ZLP A;  2TRX A;  1Z5Y E;  3F6F A;  2CZ2 A;  3GL5 A;  3E0U A;  2JL4 A;  3PR8 A;  4RUV A;  4GTU A;  3M1G A;  2P0G A;  3WYW A;  3HJP A;  3HYP A;  2BMX A;  3F4S A;  3UEM A;  1XW9 A;  4Q5N A;  5COH A;  2LRT A;  1WJK A;  4Z2R A;  2F9S A;  3LFL A;  4AGS A;  3FRC A;  1A24 A;  4IP6 A;  3GTU A;  3GA4 A;  1YEP A;  5F07 A;  2V6O A;  4WR5 A;  4D73 B;  1Z9H A;  1O7U A;  2GST A;  2K8S A;  3L78 A;  4KSO A;  2VL3 A;  4FYC A;  4YKG A;  2X4A A;  1XWA A;  5DCG A;  2RUF A;  1GSY A;  3VI7 A;  3FYG A;  3H8Q A;  3ZIJ A;  1VF1 A;  4ML6 A;  5ECO B;  3RDW A;  3MSZ A;  1FHE A;  2X49 A;  3EC3 A;  3E9J B;  2H71 A;  2CZ3 A;  4Q5F A;  3A2X A;  1TTZ A;  2IMD A;  4K9Z A;  3TKQ A;  1G6W A;  1YQ1 A;  2GSQ A;  1KNG A;  3UBK A;  2X99 A;  1ZZY A;  3QR6 A;  2FWE A;  1AC1 A;  3NIV A;  4GSS A;  4IJI A;  2IN3 A;  4ZBB A;  3EUR A;  1JZO A;  2H70 A;  1VRS D;  1N8J A;  5HR1 A;  1G6Y A;  1ZYQ B;  3EU3 A;  3LJR A;  2YP6 A;  4NWY A;  3ZYW A;  1PQN A;  1U88 A;  3KJY A;  3E3E A;  4DSR A;  2GQM A;  2VL9 A;  4L0W A;  1AAZ A;  5ABR A;  1ZL9 A;  4K5S A;  4KA0 A;  4MF5 A;  3M9K A;  4GWR A;  4XS4 A;  2VM2 A;  1SK2 A;  3KH7 A;  3U5R E;  4RI7 A;  4F03 A;  4OO5 A;  2GZP A;  5F06 A;  1SYR A;  1V57 A;  1GSU A;  2AUV A;  3R3E A;  2OE0 A;  4X4J A;  1K0O A;  3JCM L;  2GSS A;  1I9D A;  2LEG A;  1GUL A;  2B7K A;  3UVH A;  1OE8 A;  4JRR A;  4XS4 B;  5KN3 A;  1SL0 B;  1U3I A;  2HLS A;  1O6J A;  3TUE A;  2YAN A;  5J41 A;  1PMT A;  1EEJ A;  3DVW A;  3KM6 A;  1F6M C;  1OC3 A;  3O6T A;  4O5Q A;  1ZCP A;  3F0I A;  3Q6O A;  4K7N A;  1TRV A;  4NPB A;  2FWH A;  3F3R A;  2FHE A;  3MWH A;  2EIO A;  2FCH A;  2LJA A;  3KP9 A;  4DSS A;  3LEF A;  3UIW A;  3IK9 A;  2KP1 A;  4CDO A;  1GTU A;  4KSM A;  1Q98 A;  1SD8 A;  4KDX A;  1XZO A;  5ENU A;  3TKS E;  2P5R A;  2PGT A;  13GS A;  1NHY A;  1YF1 A;  2Z9S A;  3GUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...