1HD2A

Human peroxiredoxin 5
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
161
structure length
161
Chain Sequence
APIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXIREDOXIN 5 RESIDUES 54-214
publication title Crystal Structure of Human Peroxiredoxin 5, a Novel Type of Mammalian Peroxiredoxin at 1.5 A Resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antioxidant enzyme
total genus 46
structure length 161
sequence length 161
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2000-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08534 Redoxin Redoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1hd2A00
2QC7A 5GAND 2HZEB 4IVFA 4OO5A 3UJ1A 1G0TA 1FW1A 5D9VA 4XS4A 2CVBA 3F3RA 5COHA 2OJLA 5HFKA 3EINA 4ML6A 2VM1A 4TR4A 1R4WA 2LSTA 1SK1A 3FZ5A 3QFAC 2WDUA 4IKHA 2VLVA 3EU3A 3US3A 5ECOB 3LJRA 3HCZA 1U87A 4LMVA 4KDYA 2LRTA 3D4TA 4K1FA 2VCWA 1OVNA 2C80A 4EC0A 4KH7A 1EP8A 1BEDA 3LEFA 3A5WA 1AUCA 4MF6A 3GSTA 1O7UA 4GTUA 4PQHA 5JCGA 1B9YC 2LEGA 5G5FA 1BJXA 3NZNA 4EL1A 2HRNA 3GKKA 2DJ0A 2WB9A 2GLRA 3WT1A 3ERFA 2BJXA 4WR4A 5CREA 2PERA 5CYYA 4Z7XA 5IOWA 1TK5B 4G2EA 2LNSA 3VFIA 2DJ1A 4K7NA 5IO0A 2XC2A 9GSSA 2X8CA 5J4UA 3CTFA 5ECMB 2IFQA 3FR9A 4V1Ap 1K3LA 2F9SA 1V98A 1F2EA 3UVHA 3HKRA 2H6ZA 4P3YB 2MMAA 2I3YA 2KUCA 2RUEA 2EC4A 2M46A 4ECIA 3N9JA 4TR1A 3TJBA 1V2AA 1XWKA 2YPMA 2YWIA 1NM3A 4F82A 1E2YA 3TCOA 5AISA 1A8LA 1VF2A 2FWFA 2GQLA 1YJ6A 1VF1A 1JZOA 5JCWA 2B7KA 4ZL8A 3VWVA 4HUAA 3KMNA 2V6KA 4L8EA 2O85A 4K7OA 2VLUA 3I6AA 4GLTA 3CBUA 4ISDA 1S3AA 3GL3A 2L4CA 1W4VA 2GGTA 1XCCA 4L5LA 4PX1A 4FIWA 3EURA 2PWJA 3KCMA 2DMLA 5IMCA 3G7JA 1WE0A 1V57A 1PN9A 5DCGA 2GSQA 3W8JA 2DIZA 3TKSC 1A2LA 1XW6A 4K6XA 3RAZA 3APQA 2HFDA 2GT5A 1SD8A 3TOTA 2JZSA 5F05A 3CSHA 1JLVA 2H1AA 5F0GA 1K0AA 3GSSA 3GRXA 1VF4A 2V2GA 2I81A 3LG6A 4MJAA 1KTEA 1EP7A 1M2BA 2B5XA 4GSTA 4FYUA 4YAVA 2RUFA 1EEMA 2VL2C 5HR3A 3IK9A 2N5FA 1B9XC 1HNCA 3LXZA 5IPHA 13GSA 4WR5A 4GRFA 3GL5A 2AB6A 3CSJA 3HY2A 1H75A 3F6FA 3M3MA 1Q4JA 5E4WA 3I43A 3JCML 5J3RA 3WGXA 1OYJA 3BOAA 1TRUA 1GTBA 3KH7A 2P5RA 1A0RP 3KJYA 2B3SA 4AJ8A 4NPBA 3UMAA 1J08A 3G7YA 2L6DA 2YZHA 4HI7A 5GZZB 4MPFA 2VCXA 3F63A 3ZVJD 4RI7A 4IHUA 5EPFA 1Z7PA 3KXOA 4BWSA 1SKWB 4NMUA 2X99A 17GSA 2FD3A 2TRCP 1TI1A 4ZB9A 2GT6A 5KN3A 1XOBA 1OC3A 4E8EA 1X9SB 6GSSA 3PH9A 2V41A 2X8GA 1DE2A 3NOFA 4X43A 1GSDA 3UL3A 3G9BA 3LQ7A 2DBCA 5DJLA 3L78A 1GSYA 3AY8A 1KEBA 5HFIA 4HS1A 2CAQA 5ECQB 2H0IA 2LTKA 1K0OA 2XPDA 3RDWA 5HR1A 3ZL5A 6GSXA 3KMOA 4GSSA 3N5OA 1GLQA 4JE1A 2CQ9A 3GUSA 3C8EA 2OE1A 4EVMA 1URMA 2NTOA 1TKDB 2ON7A 1WP0A 3IRAA 2EIRA 4G10A 2PMTA 4AJ7A 5AIXA 1EGOA 3QD9A 3P7XA 1OAZA 3OR5A 1AIUA 4MMMA 1RW1A 4OCEA 2HE3A 1NSWA 5A5KA 3HVVA 1NHOA 5G30A 1OC9B 4MABA 4YQVA 3IE3A 1QK8A 3L9VA 4I8BA 2O8VB 4MH2A 1TRWA 2GS3A 2PGTA 2K18A 5FHIA 2B7JA 2C4JA 2C0DA 2CT6A 3F9UA 4ZBBA 1PMTA 1GLPA 4V1Ag 2H70A 1YDKA 2GQKA 3E9JB 2MMNA 1MD4A 3VK9A 3HD5A 2VIMA 2DSAA 4OWYA 1A2JA 4KAEA 1CQGA 4WBJA 4ZL9A 3APOA 3C71A 3E3EA 4DSSB 1SD9A 3S9FA 3QAGA 3IBHA 5B8AA 5DALA 1ST9A 3MNGA 4BA7A 1T8EB 1UN2A 2GSRA 1THOA 4IQAA 4J2FA 3GKNA 3C7MA 5D9TA 4JEDA 1EWXA 4BPYA 10GSA 1ZYQB 1M2AA 2JADA 1AW9A 3I69A 1GSUA 4QL7A 3BCIA 3WT2A 4K0GA 2CZ2A 3KD0A 1EOGA 2PBJA 4TR0A 2O89A 2K8SA 6GSUA 4ZBAA 3NIVA 4CHSA 2VL9A 2E0QA 1X5EA 3P8WA 1PSQA 3RPPA 3TKPA 1A8YA 2RIIA 3SBCA 1GH2A 1O73A 2WCIA 2CA8A 5G2ZA 3HZ8A 3M8NA 1Y25A 1ILOA 3L9UA 3RBTA 3ZREA 3DXBA 4NHZA 4MF7A 4ID0A 2DC5A 3GHAA 5IPGA 3GV1A 2C3QA 3TRQA 2VD1A 1XWCA 1BG5A 4Q5RA 3EWLA 6GSWA 3IK7A 4JRRA 3UVTA 2AUVA 1AQXA 2VCVA 4V2MA 2F3MA 3WYWA 5F8BA 3GA4A 2B6MA 4WETA 4QL9A 5F06A 4BVYA 1Z5YE 2OACA 4LL1B 1U88A 2AYTA 3VURA 2OE0A 4TRXA 1SL2B 1OE8A 2WJUA 4PQIA 1Q98A 3FY7A 3HVSA 1RQMA 3DMLA 4MZCA 3LFLA 3DD3A 2IL3A 5HR2A 3K8NA 2LQQA 2YCDA 4KSOA 4K2DA 3ZITA 2WGRA 3ME8A 3O6TA 2O7KA 4JR4A 4F2IA 3TKRA 3VPTA 1ON4A 3ISOA 1Z6MA 3C1SA 2H75A 2C0EA 4OO4A 4NAXA 3QCPA 4MA9A 1B8XA 1ZMAA 3Q19A 5B6NA 4G9HA 1KBNA 3BCKA 3TKSA 3A3TA 2OADA 1GSSA 3TJFA 5JWRB 4O7HA 1ERWA 1FVJA 3VI7A 1GP1A 3VWWA 2OA7A 1F6MC 4D73B 1O6JA 3ZRDA 3DVWA 3PR8A 5CP1A 3E0UA 2PU9C 3D6IA 1W89A 1YEPA 1XBSA 11GSA 1FB6A 3EU4A 3P2AA 4IQ1A 4LMWA 1RK4A 2VL2A 1O81A 1THXA 1WRYA 4CDOA 1FG4A 4KW6A 1YY7A 4OCFA 3GX0A 2C3TA 2LQOA 4KCEA 1MDJA 1F3AA 2PVOC 4H86A 5ECHB 1V58A 1AQWA 2Z9SA 5INYA 4KUNA 2H01A 1S3DA 4I2TA 5B6MA 1XW5A 2YV9A 1U6TA 5ECNB 2H71A 2E2MA 2VL3A 5H5SA 4EE0A 1SK0A 2X8HA 2QKEA 4DSQA 3WD6A 2OE3A 1V40A 4XHMA 1TDIA 4Q5NA 3EYTA 3FR6A 3G7IA 3C73A 3F6DA 3HZ4A 1MEKA 2PPTA 4N30A 4PQ1A 5HR0A 22GSA 4EDYA 1Z6NA 2HT9A 1NW2A 2CX4A 2K9FA 2JZTA 4LL4B 4XS6A 3A2VA 2E2GA 3ZZXA 5J41A 1OE7A 2YV7A 3QAWA 5FT3A 4OMVA 3IR4A 1DE1A 2RLIA 5G31A 3TUEA 5CRHA 4MP4A 5DAKA 2C3NA 2ES7A 4POMA 1LBKA 1K3OA 2C0GA 2JL4A 2P5QA 2WFCA 4MZBA 3IXRA 3M1GA 3F8UA 4FO5A 3Q74A 1X0RA 2YANA 3MSZA 5H5QA 1SL0B 1SJ6A 5C04A 5D93A 2ZCTA 3U5RE 1WWJA 2GTUA 1TU7A 2HSHA 4MJCA 1OKTA 3CYNA 1VF3A 1QMVA 4TW5A 3J7Yb 4KB3A 3H93A 4YQUA 2LUSA 5J9CA 4XS4B 3GIXA 2YNXA 18GSA 5DDLA 4KSMA 3ZYWA 3F4SA 3GYKA 3DKSA 2XPEA 4ZBDA 4V2NA 3HYPA 3EMPA 3TJKA 3HXSA 1T1VA 3KP8A 4L5OA 4IW9A 2N5BA 1I9DA 2IMEA 2DJKA 2P31A 2FUG2 1DSBA 4NWYA 2I1UA 4TXOA 6GSVA 5J5NA 1HNAA 2H0HA 1Y6EA 1K0BA 2H30A 5JWQB 1HYUA 5ECKB 3DGQA 1HD2A 4JZQA 1TOFA 2EIQA 1GUHA 4WKWA 2NDOA 4OFNA 2JZRA 2L5LA 4KGIA 1XZOA 5D73A 3TGZA 4V2LA 3UOMA 1SKRB 4PXOA 1K3YA 3FHKA 3LGCA 1LU4A 2V32A 2YWMA 2L5OA 1JZWA 1NHYA 2IFQB 3H79A 4K0NA 1XVQA 1C72A 4N11A 1ML6A 1K0NA 4IS0A 1J0FA 4KE3A 4CW9A 1EZKA 1PKWA 4TR1B 2H6XA 4GWRA 3IV4A 4ILFA 1JZRA 2MMOA 1GNWA 3Q6OA 3FEUA 5DCHA 1VGLA 5KN2A 2FY6A 2H74A 1ABAA 1WIKA 2C1YA 1GNEA 3KH9A 1TK0B 2ZUPA 4AJ6A 5ENUA 2D2ZA 3IHQA 2C8UA 1AAZA 2J9HA 5CAXA 4E8HA 2FHEA 5IM9A 5ECPB 1FOVA 1BQ7A 5ECRB 1PL2A 1EEJA 3CSIA 3GKXA 1YKCA 2OKAA 1EGRA 2RM5A 3GTUA 2LRCA 1ERUA 2H72A 5A4VA 6GSYA 2LNTA 2V1MA 4IELA 4J57E 2TRXA 1TK8B 2IN3A 1K0CA 5DAKB 2LRNA 1AQVA 1OKDA 3ERGA 2DMMA 1QFNA 2HI7A 1UC7A 4X0XA 2CVKA 2H1BA 3HHVA 3HJOA 1SKSB 1T7PB 1GULA 5G5EA 4K8MA 1Z3EA 2YP6A 3DEXA 5GSTA 2YOIA 3RPNA 4EXJA 4I2UA 2DJ2A 1AC1A 3CTGA 1WMJA 4ZILA 2NVLA 4HQZA 2HZEA 2VD0A 1GRXA 2YWNA 2ALBA 3UEMA 2QGVA 5ID2A 2M80A 2R3XA 1PX6A 5E59A 1EV4A 4RI6A 2OBKA 2IWTA 4MZWA 2B5YA 1A24A 4JR6A 1TW9A 4HEA2 3ZMLA 1TU8A 2KLXA 1FVKA 2GQMA 5ECLB 3WGEA 2I4AA 3BBYA 4RQXA 2PUKC 3ED3A 5IMDA 1X9WB 5LNKe 1K0MA 3TB2A 2LKUA 1WOUA 2VUPA 4ECJA 3UAPA 5IMAA 5AIVA 4NV5A 5D8IA 3ZIVA 1S3CA 2REMA 1T4YA 3GMFA 4ZIJA 1DBYA 1TI3A 3TJGA 3D22A 5CO3A 1SJZA 2R37A 2KP1A 1ERTA 2PN8A 5IMZA 1SYXA 3F4RA 1QXHA 4EUYA 3KEBA 2R4VA 5IOXA 3TDGA 1ACVA 7GSSA 3D21A 3M9KA 2LJRA 1TTZA 1ZL9A 3H8QA 3UBKA 4XTSA 4O5RA 4HDEA 1GUKA 1FB0A 1SU9A 3GH9A 2CZ3A 1PL1A 1JLWA 3IOSA 4BVXA 4YAPA 2AHEA 5J9BA 2GZZA 3FYGA 3P90A 1XWAA 1EOHA 4MJBA 4JU5A 3C1RA 3QDNA 3QPMA 3APSA 2I9HA 2WULA 4I5QA 4XRAA 1XIYA 2WZ9A 2K8VA 5CRWA 2FNOA 2B1KA 3D4MA 3A2WA 3KP9A 4ML1A 2QSIA 1PQNA 4IGJA 1MD3A 3LYKA 2G2QA 3IPZA 4FYCA 5GAPD 3GFKA 4X1UA 1M9AA 4DSRA 4TR3A 3D0ZA 5CRDA 5IMFA 1TRSA 3HJMA 3TKSE 3HJPA 1V9WA 3GKMA 2FWGA 1KNGA 1XW9A 4ZB8A 1XVWA 1U3IA 1HQOA 1X5CA 4HOJA 1ZGNA 1G6YA 3WGDA 3ZTLA 2GDRA 3LWAA 2GZPA 4KNDA 3EC3A 5ID2B 3FZ9A 2H1GA 3HVXA 1PKZA 5ECSA 3EMXA 2DJ3A 3LYPA 5DALB 2H6YA 5D9WA 3HDCA 4MJEA 3DYRA 2DIYA 4LA1A 1CQHA 3PINA 2AAWA 3O3TA 5B8BA 4XIHA 1UA5A 1YEXA 3MWHA 4TKYA 3ZLPA 3GH6A 4PNGA 4IP1A 12GSA 2NPBA 5ELAA 3U6VA 1GTAA 1PD21 2IJYA 2M72A 3ZFBA 4TXVA 1B4PA 1X5DA 4MDCA 4IN0A 4GCIA 2IIYA 1Z9HA 1GSQA 4HU9A 4POBA 4NXIA 1YZXA 1YKAA 4OFTA 3F4TA 1BYEA 4N0ZA 1O8XA 1MDIA 14GSA 2CAIA 3W6GA 2XBQA 3L0HA 2L6CA 3IAS2 2EIOA 4HZ4A 3W8SA 2PVQA 5ELGA 3IDVA 5LD0A 3VLNA 4POLA 4DVCA 1ZYEA 1TRVA 2GSSA 5DJMA 5H5RA 2R5GA 1F37A 3IA1A 3LSZA 3KM6A 4F0CA 2VCZA 16GSA 4F03A 5EVOA 4GXZA 2CX3A 1QUWA 4ZL7A 5KEJA 1IYHA 2VOCA 1FO5A 3FKFA 1GSEA 2H66A 4IJ3A 3UBLA 2R2JA 2FA8A 2C0FA 3BD2A 4MPGA 2O87A 1ERVA 1IYIA 2LJKA 3L4NA 1YQ1A 3FR3A 1SYRA 5EL8A 2H73A 1O8WA 2GZYA 3FRCA 3FK8A 4HU7A 1OC9A 1DUGA 4MCUA 4GF0A 1MTCA 4N0VA 4RUVA 1ZOFA 2VO4A 1TP9A 1R26A 2KP2A 4PNFA 1PX7A 2MMZA 1UVZA 2H19A 4PUFC 5IIZA 3DRNA 4MK3A 1JHBA 2BTOT 4I6XA 1LJRA 2G0FA 2MBSA 4GQFA 1GSFA 4WEYA 2HYXA 8GSSA 5LCZA 5HQPA 1SJIA 2FWHA 2IMDA 3FW2A 3CRTA 2WRTA 1PA3A 3TKQA 1E6BA 1X9MB 4HJ2A 2B1LA 6GSTA 4ECCA 4XRDA 2HSYA 5IQYA 1FHEA 2A2SA 1YF0A 1Z7RA 1A2MA 2VCQA 5JWOB 2AJQB 4DSSA 5CNWA 5DQSA 4MF5A 3J7Yk 1H4OA 5CRGA 2IPAA 2F8FA 4AGSA 2KOKA 2V6OA 2IMKA 4XCSA 2VCTA 2LV3A 4GQCA 1J9BA 1QGVA 1SK2A 4K9ZA 3I9V2 5AN1A 4I97A 3KGKA 3EVIA 2F51A 2H1DA 2WS2A 2FLSA 3DIEA 2AV4A 3GURA 2LS5A 4WF5A 2VLTA 1R7HA 2JU5A 1A0FA 3HA9A 3O76A 3L9SA 2YZUA 2TIRA 3TJJA 4O92A 4EKZA 4KDUA 4F9ZA 5D96A 1O85A 1N8JA 4BWQA 4TOPA 4PURA 3M0FA 2FGXA 3QOUA 4WBRD 4WXTA 5IMVA 3FZ4A 5JCUA 4L0UA 4OD7A 1TXXA 2E7PA 5FWGA 2R6KA 2NBSA 4G19A 4HJMA 2LJAA 3H4KA 2VAFA 4HQSA 2JSZA 1G7OA 1EV9A 1SL1B 5F07A 5EY6A 1JZDA 4WF4A 4GSNA 1FAAA 3VI5A 3CMIA 3KTBA 4MH3A 5AGYA 2DJJA 2L59A 2L57A 2VM2A 4XS1A 4JBBA 1B48A 4KCAA 4NV2A 4MLYA 1GUMA 3R2QA 1XOAA 4PUAA 1XFLA 2HZFA 2MBTA 1GTIA 1ZCPA 5G1LA 5DVBA 2B5EA 5G1KA 3Q18A 2OBIA 4Q5QA 3QAVA 3VWXA 1GWCA 5A4WA 5C00A 1WPIA 2DLXA 3F0IA 1G7EA 1R5AA 4N10A 5IO2A 1GL8A 4KDXA 2GVPA 4QQ7A 3VPQA 1F3BA 4TN8A 5L71A 4DEJA 3LXTA 3KZQA 3H1NA 3SWLA 1USBA 3QR6A 4BL7A 1M9BA 2CVDA 4FH8A 2P0GA 2GSTA 3EE2A 3FZAA 4J56E 3BJ5A 1ZZYA 4IP6A 2YN1A 2J23A 4PGTA 1PGTA 3PGTA 4ZB6A 2XBIA 5HFGA 4D73A 2H8LA 1F9MA 5KN1A 2YWOA 3VWUA 3KIJA 2IMIA 2BMXA 5B7CA 2JSYA 5DQYA 3F3QA 4POKA 1N2AA 4TXOB 2HRFA 1HNBA 4ZXGA 4AF2A 3CRUA 2YJ7A 1T3BA 1XPVA 3QMXA 1K0DA 1XXUA 1VRSD 4EF0A 2H76A 4YQMA 5ABRA 1T4ZA 3ZMKA 2FA4A 4L0WA 2HXKA 3ZVJA 5D9XA 3ME7A 4F0BA 2K6VA 2CV4A 3GNJA 4EDZA 2A2RA 1OC8A 5KN0A 2ON5A 2A4VA 2ZNMA 19GSA 3ZFLA 1M0UA 3ERWA 4ACSA 2HLSA 3UARA 4HZ2A 4LLRA 1SENA 4O32A 3IAM2 4EO3A 3GX8A 3MDKA 2RM6A 3ZIJA 3TOUA 3UIWA 3KTLA 4IBPA 4KX4A 1WJKA 2N5AA 2H0GA 3M9JA 2KHPA 3TRPA 1YF1A 3RHCA 3DWVA 1G6WA 1XWBA 4K7IA 3V1WA 1I5GA 1BAYA 20GSA 2X64A 3A2XA 5A4UA 4TVEA 1M99A 1U3AA 2MZCA 3LORA 1M7TA 5ECIB 4ULXA 1A23A 3D5JA 2MYGA 4RQRA 2L4QA 1AXDA 4NHWA 3IC4A 1TJDA 1T00A 2YJHA 2F8AA 1MDKA 3GTUB 4KA0A 3CXGA 3TRXA 4YH2A 3DVXA 1R5PA 1JFUA 4IJIA 2JACA 1QQ2A 1GTUA 1BX9A 2HNLA 4ECBA 2FWEA 1M2DA 1PRXA 1B4QA 3RHBA 4FYBA 2IMFA 2XHFA 4Q5FA 5GSSA 5DBQA 3QFBC 4OFMA 1XWGA 3GN3A 2FCHA 3MAKA
chains in the Genus database with same CATH superfamily
2QC7A 5GAND 2HZEB 4IVFA 4OO5A 3UJ1A 1G0TA 1FW1A 5D9VA 4XS4A 2CVBA 3F3RA 5COHA 2OJLA 4BL7B 5HFKA 3EINA 4ML6A 2VM1A 4TR4A 1R4WA 2LSTA 1SK1A 3FZ5A 3QFAC 2WDUA 4IKHA 2VLVA 3EU3A 3US3A 5ECOB 3LJRA 3HCZA 1U87A 4LMVA 4KDYA 2LRTA 3D4TA 4K1FA 2VCWA 1OVNA 2C80A 4EC0A 4KH7A 1EP8A 1BEDA 3LEFA 3A5WA 1AUCA 4MF6A 3GSTA 1O7UA 4GTUA 4PQHA 5JCGA 1B9YC 2LEGA 5G5FA 1BJXA 3NZNA 4EL1A 2HRNA 3GKKA 2DJ0A 2WB9A 2GLRA 3WT1A 3ERFA 2BJXA 4WR4A 5CREA 2PERA 5CYYA 4Z7XA 5IOWA 1TK5B 4G2EA 2LNSA 3VFIA 2DJ1A 4K7NA 4O5UA 5IO0A 2XC2A 9GSSA 2X8CA 5J4UA 3CTFA 5ECMB 3A5IA 2IFQA 3FR9A 4V1Ap 1K3LA 2F9SA 1V98A 1F2EA 4KF9A 3UVHA 3HKRA 2H6ZA 4P3YB 2MMAA 2I3YA 2KUCA 2RUEA 2EC4A 2M46A 4ECIA 1PN0A 3N9JA 4TR1A 3TJBA 1V2AA 1XWKA 2YPMA 2YWIA 1NM3A 4F82A 1E2YA 3TCOA 5AISA 1A8LA 1VF2A 2FWFA 2GQLA 1YJ6A 1VF1A 1JZOA 5JCWA 2B7KA 4ZL8A 4BVXB 3VWVA 4HUAA 3KMNA 2V6KA 4L8EA 2O85A 4K7OA 2VLUA 3I6AA 4GLTA 3CBUA 4ISDA 1S3AA 3GL3A 2L4CA 1W4VA 2GGTA 1XCCA 4L5LA 4PX1A 4FIWA 3EURA 2PWJA 3KCMA 2DMLA 5IMCA 3G7JA 1WE0A 1V57A 1PN9A 5DCGA 2GSQA 3W8JA 2DIZA 3TKSC 1A2LA 1XW6A 4K6XA 3RAZA 3APQA 2HFDA 2GT5A 1SD8A 3TOTA 2JZSA 2A2PA 3CSHA 5F05A 1JLVA 2H1AA 5F0GA 1K0AA 3GSSA 3GRXA 1VF4A 2V2GA 2I81A 3LG6A 4MJAA 1KTEA 1EP7A 3MYDA 1M2BA 3EPTA 2B5XA 4GSTA 4FYUA 4YAVA 2RUFA 1EEMA 2VL2C 5HR3A 3IK9A 2N5FA 1B9XC 1HNCA 3LXZA 5IPHA 13GSA 4WR5A 4GRFA 3GL5A 2AB6A 3CSJA 3HY2A 1H75A 3F6FA 3M3MA 1Q4JA 5E4WA 3I43A 3JCML 5J3RA 3WGXA 1OYJA 3BOAA 1TRUA 1GTBA 3KH7A 2P5RA 1A0RP 3KJYA 2B3SA 4AJ8A 4NPBA 3UMAA 1J08A 3G7YA 2L6DA 2YZHA 4HI7A 5GZZB 4MPFA 2VCXA 3F63A 3ZVJD 4RI7A 4IHUA 5EPFA 1Z7PA 3KXOA 4BWSA 1SKWB 4NMUA 2X99A 4G0LA 17GSA 2FD3A 2TRCP 1TI1A 4ZB9A 2GT6A 5KN3A 1XOBA 1OC3A 4E8EA 1X9SB 6GSSA 3PH9A 2V41A 2X8GA 1DE2A 3NOFA 4X43A 1GSDA 3UL3A 3G9BA 3LQ7A 2DBCA 5DJLA 3L78A 1GSYA 3AY8A 1KEBA 5HFIA 4HS1A 2CAQA 5ECQB 2H0IA 2LTKA 1K0OA 2XPDA 3RDWA 5HR1A 3ZL5A 6GSXA 3KMOA 4GSSA 3N5OA 1GLQA 4JE1A 2CQ9A 3GUSA 3C8EA 2OE1A 4EVMA 1URMA 2NTOA 1TKDB 2ON7A 1WP0A 3IRAA 2EIRA 4G10A 2PMTA 4AJ7A 2DKHA 5AIXA 1EGOA 3QD9A 3P7XA 1OAZA 3OR5A 1AIUA 4MMMA 1RW1A 4OCEA 2HE3A 1NSWA 5A5KA 3HVVA 1NHOA 5G30A 1OC9B 4MABA 4YQVA 3IE3A 1QK8A 3L9VA 4I8BA 2O8VB 4MH2A 1TRWA 2GS3A 2PGTA 2K18A 5FHIA 2B7JA 2C4JA 2C0DA 2CT6A 3F9UA 4ZBBA 1PMTA 1GLPA 4V1Ag 2H70A 1YDKA 1M3IA 2GQKA 3E9JB 2MMNA 1MD4A 3VK9A 3HD5A 2VIMA 2DSAA 4OWYA 1A2JA 4KAEA 1CQGA 4EIQA 4WBJA 4ZL9A 3APOA 3C71A 3E3EA 4DSSB 1SD9A 3S9FA 3QAGA 3IBHA 5B8AA 5DALA 1ST9A 4K2XA 3MNGA 4BA7A 1T8EB 1UN2A 2GSRA 1THOA 4IQAA 4J2FA 3GKNA 3C7MA 5D9TA 4JEDA 1EWXA 4BPYA 4CY6A 10GSA 1ZYQB 1M2AA 2JADA 1AW9A 3I69A 1GSUA 4QL7A 4O5QA 3BCIA 3WT2A 4K0GA 2CZ2A 3KD0A 1EOGA 2PBJA 4TR0A 2O89A 2K8SA 6GSUA 4ZBAA 3NIVA 4CHSA 2VL9A 2E0QA 1X5EA 3P8WA 1PSQA 3RPPA 3TKPA 1A8YA 2RIIA 3SBCA 1GH2A 1O73A 2WCIA 2CA8A 5G2ZA 3HZ8A 3M8NA 1Y25A 1ILOA 3L9UA 3RBTA 3ZREA 3DXBA 4NHZA 4MF7A 4ID0A 2DC5A 3GHAA 5IPGA 3GV1A 2C3QA 3TRQA 2VD1A 1XWCA 1BG5A 4Q5RA 3EWLA 6GSWA 3IK7A 4JRRA 3UVTA 2AUVA 1AQXA 2VCVA 4V2MA 2F3MA 3WYWA 5F8BA 3GA4A 2B6MA 4WETA 4QL9A 5F06A 4BVYA 1Z5YE 2OACA 4LL1B 1U88A 2AYTA 3VURA 2OE0A 4TRXA 1SL2B 1OE8A 2WJUA 4PQIA 4USSA 1Q98A 3FY7A 3HVSA 1RQMA 3DMLA 4MZCA 3LFLA 3DD3A 2IL3A 5HR2A 3K8NA 2LQQA 2YCDA 4KSOA 2HRKA 4K2DA 3ZITA 2WGRA 3ME8A 3O6TA 2O7KA 4JR4A 4F2IA 3TKRA 3VPTA 1ON4A 3ISOA 1Z6MA 3C1SA 2H75A 2C0EA 4FQUA 4OO4A 4NAXA 3QCPA 4MA9A 1B8XA 1ZMAA 3Q19A 5B6NA 4G9HA 1KBNA 3BCKA 3TKSA 3A3TA 2OADA 1GSSA 3TJFA 5JWRB 4O7HA 1ERWA 1FVJA 3VI7A 1GP1A 3VWWA 2OA7A 1F6MC 4D73B 1O6JA 3ZRDA 3DVWA 3PR8A 5CP1A 3E0UA 2PU9C 3D6IA 1W89A 1YEPA 1XBSA 11GSA 1FB6A 3EU4A 3P2AA 4IQ1A 4LMWA 1RK4A 2VL2A 1O81A 1THXA 1WRYA 4CDOA 1FG4A 4KW6A 1YY7A 4OCFA 3GX0A 2C3TA 2HSMA 2LQOA 4KCEA 1MDJA 1F3AA 2PVOC 4H86A 5ECHB 1V58A 3PPUA 1AQWA 2Z9SA 5INYA 4KUNA 2H01A 1S3DA 3R3EA 4I2TA 5B6MA 1XW5A 2YV9A 1U6TA 5ECNB 2H71A 2E2MA 2VL3A 5H5SA 4EE0A 1SK0A 2X8HA 2QKEA 4DSQA 3WD6A 2OE3A 1V40A 4XHMA 1TDIA 4Q5NA 3EYTA 3IHGA 3FR6A 3G7IA 3C73A 3F6DA 3HZ4A 1MEKA 2PPTA 4N30A 4PQ1A 5HR0A 22GSA 4EDYA 1Z6NA 2HT9A 1NW2A 2CX4A 2K9FA 2JZTA 4LL4B 4XS6A 3MIXA 4K5RA 3A2VA 3IC8A 2E2GA 3ZZXA 5J41A 1OE7A 2YV7A 3QAWA 5FT3A 4OMVA 3IR4A 1DE1A 2RLIA 4PTSA 5G31A 3TUEA 5CRHA 4MP4A 5DAKA 2C3NA 2ES7A 4POMA 1LBKA 1FOHA 1K3OA 2C0GA 2JL4A 2P5QA 2WFCA 4MZBA 3IXRA 3M1GA 3F8UA 4FO5A 3Q74A 1X0RA 2YANA 3MSZA 5H5QA 1SL0B 1SJ6A 5C04A 5D93A 2ZCTA 3U5RE 1WWJA 2GTUA 1TU7A 2HSHA 4MJCA 1OKTA 3CYNA 1VF3A 1QMVA 4TW5A 5KOWA 3J7Yb 4KB3A 3H93A 4YQUA 2LUSA 5J9CA 4XS4B 3GIXA 2YNXA 18GSA 5DDLA 4KSMA 2UZ8A 3ZYWA 3F4SA 3GYKA 3DKSA 2XPEA 4ZBDA 4V2NA 3HYPA 3EMPA 3TJKA 3HXSA 1T1VA 3KP8A 4L5OA 4X4JA 4IW9A 2N5BA 1I9DA 2IMEA 2DJKA 2P31A 2FUG2 1DSBA 1ZYNA 4NWYA 2I1UA 4TXOA 6GSVA 5J5NA 1HNAA 2H0HA 1Y6EA 1K0BA 2H30A 5JWQB 1HYUA 5ECKB 3DGQA 1HD2A 4JZQA 1TOFA 2EIQA 1GUHA 4WKWA 2NDOA 4OFNA 2JZRA 2L5LA 4KGIA 1XZOA 5D73A 3TGZA 3CQFA 4V2LA 3UOMA 1SKRB 4PXOA 1K3YA 3FHKA 3LGCA 1LU4A 2V32A 2YWMA 2L5OA 1JZWA 1NHYA 2IFQB 3H79A 4K0NA 1XVQA 1C72A 4N11A 1ML6A 4G0KA 1K0NA 4IS0A 1J0FA 4KE3A 5BRTA 4CW9A 1EZKA 1PKWA 4TR1B 2H6XA 4GWRA 3IV4A 4ILFA 1JZRA 2MMOA 1GNWA 3Q6OA 3FEUA 5DCHA 1VGLA 5KN2A 2FY6A 2H74A 1ABAA 1WIKA 2C1YA 1GNEA 3KH9A 1TK0B 2ZUPA 4AJ6A 5ENUA 2D2ZA 3IHQA 2C8UA 1AAZA 2J9HA 5CAXA 4E8HA 2FHEA 5IM9A 5ECPB 1FOVA 1BQ7A 5ECRB 1PL2A 1EEJA 3CSIA 3GKXA 1YKCA 2OKAA 1EGRA 2RM5A 3GTUA 2LRCA 1ERUA 2H72A 5A4VA 6GSYA 2LNTA 2V1MA 4IELA 4J57E 2TRXA 1TK8B 2IN3A 1K0CA 5DAKB 2LRNA 1AQVA 1OKDA 3ERGA 2DMMA 1QFNA 2HI7A 1UC7A 4X0XA 1M3JA 2CVKA 2H1BA 3HHVA 3HJOA 1SKSB 1T7PB 1GULA 5G5EA 4K8MA 1Z3EA 2YP6A 3DEXA 5GSTA 2YOIA 3RPNA 4EXJA 4I2UA 2DJ2A 1AC1A 3CTGA 1WMJA 4Z2UA 4ZILA 2NVLA 4HQZA 4HSCX 2HZEA 2VD0A 1GRXA 2YWNA 2ALBA 3UEMA 2QGVA 5ID2A 2M80A 2R3XA 1PX6A 5E59A 1EV4A 4RI6A 2OBKA 2IWTA 4MZWA 2B5YA 1A24A 4JR6A 1TW9A 4Z2RA 4HEA2 3ZMLA 1TU8A 2KLXA 1FVKA 2GQMA 5ECLB 3WGEA 2I4AA 3BBYA 4RQXA 2PUKC 3ED3A 5IMDA 1X9WB 5LNKe 1S3RA 1K0MA 3TB2A 2LKUA 1WOUA 2VUPA 4ECJA 3UAPA 5IMAA 5AIVA 4NV5A 5D8IA 3ZIVA 1S3CA 2REMA 1T4YA 3GMFA 4ZIJA 1DBYA 1TI3A 3TJGA 3D22A 5CO3A 1SJZA 2R37A 2KP1A 1ERTA 2PN8A 5IMZA 1SYXA 3F4RA 1QXHA 4EUYA 3KEBA 2R4VA 5IOXA 3TDGA 1ACVA 7GSSA 3D21A 3M9KA 2DKIA 2LJRA 1TTZA 4EIPA 1ZL9A 3H8QA 3UBKA 4XTSA 4O5RA 4HDEA 1GUKA 1FB0A 1SU9A 3GH9A 2CZ3A 1PL1A 1JLWA 3IOSA 4BVXA 4YAPA 2AHEA 5J9BA 2GZZA 3FYGA 2X49A 3P90A 1XWAA 1EOHA 4MJBA 4JU5A 3C1RA 3QDNA 3QPMA 3APSA 2I9HA 2WULA 4I5QA 4XRAA 1XIYA 2WZ9A 2K8VA 5CRWA 2FNOA 2B1KA 3D4MA 3A2WA 3KP9A 1PFOA 4ML1A 2QSIA 1PQNA 4IGJA 1MD3A 3LYKA 2G2QA 3IPZA 4FYCA 5GAPD 3GFKA 4X1UA 1M9AA 4DSRA 3HVNA 4A5PA 4TR3A 3D0ZA 5CRDA 5IMFA 3LW9A 1TRSA 3HJMA 3TKSE 3FMWA 3HJPA 1V9WA 3GKMA 2FWGA 1KNGA 1XW9A 4ZB8A 1XVWA 1U3IA 1HQOA 1X5CA 4HOJA 1ZGNA 1G6YA 3WGDA 3ZTLA 2GDRA 3LWAA 2GZPA 4KNDA 3EC3A 5ID2B 3FZ9A 2H1GA 3HVXA 1PKZA 5ECSA 3EMXA 2DJ3A 3LYPA 5DALB 2H6YA 5D9WA 5BMUA 3HDCA 4MJEA 3DYRA 2DIYA 5KOXA 4LA1A 1CQHA 3PINA 2AAWA 3O3TA 5B8BA 4XIHA 1UA5A 1YEXA 3MWHA 4TKYA 3ZLPA 3GH6A 4PNGA 4IP1A 12GSA 2NPBA 5ELAA 3U6VA 1GTAA 1PD21 2IJYA 2M72A 3ZFBA 4TXVA 1B4PA 1X5DA 4MDCA 4IN0A 4GCIA 2IIYA 1Z9HA 1GSQA 4HU9A 4POBA 4NXIA 1YZXA 1YKAA 4OFTA 3F4TA 1BYEA 4N0ZA 1O8XA 1MDIA 14GSA 2CAIA 3W6GA 2XBQA 3L0HA 2L6CA 3IAS2 2EIOA 4HZ4A 3W8SA 2PVQA 5ELGA 3IDVA 5LD0A 3VLNA 4POLA 4DVCA 1ZYEA 1TRVA 2GSSA 5DJMA 5H5RA 2R5GA 1F37A 3IA1A 3LSZA 3KM6A 4F0CA 2VCZA 16GSA 4F03A 5EVOA 4GXZA 2CX3A 1QUWA 4ZL7A 5KEJA 1IYHA 2VOCA 1FO5A 3FKFA 1GSEA 2H66A 4IJ3A 3UBLA 2R2JA 4BVYB 2FA8A 4YKFA 2C0FA 3BD2A 4MPGA 2O87A 1ERVA 1IYIA 2LJKA 3L4NA 1YQ1A 3FR3A 1SYRA 5EL8A 2H73A 1O8WA 2GZYA 3FRCA 3FK8A 4HU7A 1OC9A 1DUGA 4MCUA 4GF0A 1MTCA 4N0VA 4RUVA 1ZOFA 2VO4A 1TP9A 1R26A 2KP2A 4PNFA 4MNNA 1PX7A 2MMZA 1UVZA 2H19A 4PUFC 5IIZA 3DRNA 4MK3A 1JHBA 2BTOT 4I6XA 1LJRA 2G0FA 2MBSA 4GQFA 1GSFA 4WEYA 2HYXA 8GSSA 5LCZA 5HQPA 1SJIA 2FWHA 2IMDA 3FW2A 3CRTA 2WRTA 1PA3A 3TKQA 1E6BA 1X9MB 4HJ2A 2B1LA 4K5SA 6GSTA 4ECCA 4G0IA 4XRDA 2HSYA 5IQYA 1FHEA 2A2SA 1YF0A 1Z7RA 1A2MA 2VCQA 5JWOB 2AJQB 2QA1A 4DSSA 5CNWA 5DQSA 4MF5A 3J7Yk 1ZYPA 1H4OA 5CRGA 2IPAA 2F8FA 4AGSA 2KOKA 2V6OA 2IMKA 4XCSA 2VCTA 2LV3A 4GQCA 1J9BA 1QGVA 1SK2A 4K9ZA 4CY8A 3I9V2 5AN1A 4I97A 3KGKA 3EVIA 2F51A 2H1DA 2WS2A 2FLSA 3DIEA 2AV4A 3GURA 2LS5A 4WF5A 2VLTA 1R7HA 2JU5A 4BIKA 1A0FA 3HA9A 3O76A 3L9SA 2YZUA 2TIRA 3TJJA 4O92A 4EKZA 4KDUA 4F9ZA 5D96A 1O85A 1N8JA 4BWQA 4TOPA 4PURA 3M0FA 2FGXA 1XG8A 3QOUA 4WBRD 4ICYA 4WXTA 5IMVA 3FZ4A 5JCUA 4L0UA 4OD7A 1TXXA 2E7PA 5FWGA 2R6KA 2NBSA 4G19A 4HJMA 2LJAA 3H4KA 2VAFA 4HQSA 2JSZA 1G7OA 1EV9A 1SL1B 5F07A 5EY6A 1JZDA 4WF4A 4GSNA 1FAAA 3VI5A 3CMIA 3KTBA 4MH3A 5AGYA 2DJJA 2L59A 2L57A 2VM2A 4XS1A 4JBBA 2A4HA 1B48A 4KCAA 4NV2A 4MLYA 1GUMA 3R2QA 1XOAA 4PUAA 1XFLA 2HZFA 2MBTA 1GTIA 1ZCPA 5G1LA 5DVBA 2B5EA 5G1KA 3Q18A 2OBIA 4Q5QA 3QAVA 3VWXA 1GWCA 5A4WA 5C00A 1WPIA 2DLXA 3F0IA 1G7EA 1R5AA 4N10A 5IO2A 1GL8A 4KDXA 2GVPA 4QQ7A 3VPQA 1F3BA 4TN8A 5L71A 4DEJA 3LXTA 3KZQA 3H1NA 3SWLA 1USBA 3QR6A 4BL7A 1M9BA 2CVDA 2R0CA 4FH8A 2P0GA 2GSTA 3EE2A 3FZAA 4J56E 3BJ5A 1ZZYA 4IP6A 2YN1A 2J23A 4PGTA 1PGTA 3PGTA 4ZB6A 2XBIA 5HFGA 4D73A 2H8LA 1F9MA 4Z2TA 5KN1A 2YWOA 3VWUA 3KIJA 2IMIA 2BMXA 5B7CA 2JSYA 5DQYA 3F3QA 4POKA 1N2AA 4TXOB 2HRFA 1HNBA 4ZXGA 4AF2A 4YKGA 2R0GA 2HRAA 3CRUA 2YJ7A 1T3BA 1XPVA 3QMXA 1K0DA 1XXUA 1VRSD 4EF0A 2H76A 4YQMA 5ABRA 1T4ZA 3ZMKA 2FA4A 4L0WA 2HXKA 3ZVJA 5D9XA 3ME7A 4F0BA 2K6VA 2CV4A 3GNJA 4EDZA 2A2RA 1OC8A 5KN0A 2ON5A 2A4VA 2ZNMA 19GSA 3ZFLA 1M0UA 3ERWA 4ACSA 2HLSA 3UARA 4HZ2A 4LLRA 1SENA 4O32A 3IAM2 2R0PA 4EO3A 3GX8A 2X4AA 3MDKA 2RM6A 3ZIJA 3TOUA 3UIWA 3KTLA 4IBPA 4KX4A 1WJKA 2N5AA 2H0GA 3M9JA 2KHPA 3TRPA 1YF1A 3RHCA 3DWVA 1G6WA 1XWBA 4K7IA 3V1WA 1I5GA 1BAYA 20GSA 2X64A 3A2XA 5A4UA 4TVEA 1M99A 1U3AA 2MZCA 3LORA 1M7TA 5ECIB 4ULXA 1A23A 3D5JA 2MYGA 2QA2A 4RQRA 2L4QA 1AXDA 4NHWA 3IC4A 1TJDA 1T00A 2YJHA 2F8AA 1MDKA 3GTUB 4KA0A 3CXGA 3TRXA 4YH2A 3DVXA 1R5PA 1JFUA 4IJIA 2JACA 1QQ2A 1GTUA 1BX9A 2HNLA 4ECBA 2FWEA 1M2DA 1PRXA 1B4QA 3RHBA 4FYBA 2IMFA 2XHFA 4Q5FA 5GSSA 5DBQA 3QFBC 4OFMA 1XWGA 3GN3A 2FCHA 3MAKA
chains in the Genus database with same CATH topology
2QC7A 5GAND 2HZEB 4IVFA 4OO5A 3UJ1A 1G0TA 1FW1A 5D9VA 4XS4A 2CVBA 3F3RA 5COHA 2OJLA 4BL7B 5HFKA 3EINA 4ML6A 2VM1A 4TR4A 1R4WA 2LSTA 1SK1A 3FZ5A 3QFAC 2WDUA 4IKHA 2VLVA 3EU3A 3US3A 5ECOB 3LJRA 3HCZA 1U87A 4LMVA 4KDYA 2LRTA 3D4TA 4K1FA 2VCWA 1OVNA 2C80A 4EC0A 4KH7A 1EP8A 1BEDA 3LEFA 3A5WA 1AUCA 4MF6A 3GSTA 1O7UA 4GTUA 4PQHA 5JCGA 1B9YC 2LEGA 5G5FA 1BJXA 3NZNA 4EL1A 2HRNA 3GKKA 2DJ0A 2WB9A 2GLRA 3WT1A 3ERFA 2BJXA 4WR4A 5CREA 2PERA 5CYYA 4Z7XA 5IOWA 1TK5B 4G2EA 2LNSA 3VFIA 2DJ1A 4K7NA 4O5UA 5IO0A 2XC2A 9GSSA 2X8CA 5J4UA 3CTFA 5ECMB 3A5IA 2IFQA 3FR9A 4V1Ap 1K3LA 2F9SA 1V98A 1F2EA 4KF9A 3UVHA 3HKRA 2H6ZA 4P3YB 2MMAA 2I3YA 2KUCA 2RUEA 2EC4A 2M46A 4ECIA 1PN0A 3N9JA 4TR1A 3TJBA 1V2AA 1XWKA 2YPMA 2YWIA 1NM3A 4F82A 1E2YA 3TCOA 5AISA 1A8LA 1VF2A 2FWFA 2GQLA 1YJ6A 1VF1A 1JZOA 5JCWA 2B7KA 4ZL8A 4BVXB 3VWVA 4HUAA 3KMNA 2V6KA 4L8EA 2O85A 4K7OA 2VLUA 3I6AA 4GLTA 3CBUA 4ISDA 1S3AA 3GL3A 2L4CA 1W4VA 2GGTA 1XCCA 4L5LA 4PX1A 4FIWA 3EURA 2PWJA 3KCMA 2DMLA 5IMCA 3G7JA 1WE0A 1V57A 1PN9A 5DCGA 2GSQA 3W8JA 2DIZA 3TKSC 1A2LA 1XW6A 4K6XA 3RAZA 3APQA 2HFDA 2GT5A 1SD8A 3TOTA 2JZSA 2A2PA 3CSHA 5F05A 1JLVA 2H1AA 5F0GA 1K0AA 3GSSA 3GRXA 1VF4A 2V2GA 2I81A 3LG6A 4MJAA 1KTEA 1EP7A 3MYDA 1M2BA 3EPTA 2B5XA 4GSTA 4FYUA 4YAVA 2RUFA 1EEMA 2VL2C 5HR3A 3IK9A 2N5FA 1B9XC 1HNCA 3LXZA 5IPHA 13GSA 4WR5A 4GRFA 3GL5A 2AB6A 3CSJA 3HY2A 1H75A 3F6FA 3M3MA 1Q4JA 5E4WA 3I43A 3JCML 5J3RA 3WGXA 1OYJA 3BOAA 1TRUA 1GTBA 3KH7A 2P5RA 1A0RP 3KJYA 2B3SA 4AJ8A 4NPBA 3UMAA 1J08A 3G7YA 2L6DA 2YZHA 4HI7A 5GZZB 4MPFA 2VCXA 3F63A 3ZVJD 4RI7A 4IHUA 5EPFA 1Z7PA 3KXOA 4BWSA 1SKWB 4NMUA 2X99A 4G0LA 17GSA 2FD3A 2TRCP 1TI1A 4ZB9A 2GT6A 5KN3A 1XOBA 1OC3A 4E8EA 1X9SB 6GSSA 3PH9A 2V41A 2X8GA 1DE2A 3NOFA 4X43A 1GSDA 3UL3A 3G9BA 3LQ7A 2DBCA 5DJLA 3L78A 1GSYA 3AY8A 1KEBA 5HFIA 4HS1A 2CAQA 5ECQB 2H0IA 2LTKA 1K0OA 2XPDA 3RDWA 5HR1A 3ZL5A 6GSXA 3KMOA 4GSSA 3N5OA 1GLQA 4JE1A 2CQ9A 3GUSA 3C8EA 2OE1A 4EVMA 1URMA 2NTOA 1TKDB 2ON7A 1WP0A 3IRAA 2EIRA 4G10A 2PMTA 4AJ7A 2DKHA 5AIXA 1EGOA 3QD9A 3P7XA 1OAZA 3OR5A 1AIUA 4MMMA 1RW1A 4OCEA 2HE3A 1NSWA 5A5KA 3HVVA 1NHOA 5G30A 1OC9B 4MABA 4YQVA 3IE3A 1QK8A 3L9VA 4I8BA 2O8VB 4MH2A 1TRWA 2GS3A 2PGTA 2K18A 5FHIA 2B7JA 2C4JA 2C0DA 2CT6A 3F9UA 4ZBBA 1PMTA 1GLPA 4V1Ag 2H70A 1YDKA 2GQKA 3E9JB 2MMNA 1MD4A 3VK9A 3HD5A 2VIMA 2DSAA 4OWYA 1A2JA 4KAEA 1CQGA 4EIQA 4WBJA 4ZL9A 3APOA 3C71A 3E3EA 4DSSB 1SD9A 3S9FA 3QAGA 3IBHA 5B8AA 5DALA 1ST9A 4K2XA 3MNGA 4BA7A 1T8EB 1UN2A 2GSRA 1THOA 4IQAA 4J2FA 3GKNA 3C7MA 5D9TA 4JEDA 1EWXA 4BPYA 4CY6A 10GSA 1ZYQB 1M2AA 2JADA 1AW9A 3I69A 1GSUA 4QL7A 4O5QA 3BCIA 3WT2A 4K0GA 2CZ2A 3KD0A 1EOGA 2PBJA 4TR0A 2O89A 2K8SA 6GSUA 4ZBAA 3NIVA 4CHSA 2VL9A 2E0QA 1X5EA 3P8WA 1PSQA 3RPPA 3TKPA 1A8YA 2RIIA 3SBCA 1GH2A 1O73A 2WCIA 2CA8A 5G2ZA 3HZ8A 3M8NA 1Y25A 1ILOA 3L9UA 3RBTA 3ZREA 3DXBA 4NHZA 4MF7A 4ID0A 2DC5A 3GHAA 5IPGA 3GV1A 2C3QA 3TRQA 2VD1A 1XWCA 1BG5A 4Q5RA 3EWLA 6GSWA 3IK7A 4JRRA 3UVTA 2AUVA 1AQXA 2VCVA 4V2MA 2F3MA 3WYWA 5F8BA 3GA4A 2B6MA 4WETA 4QL9A 5F06A 4BVYA 1Z5YE 2OACA 4LL1B 1U88A 2AYTA 3VURA 2OE0A 4TRXA 1SL2B 1OE8A 2WJUA 4PQIA 4USSA 1Q98A 3FY7A 3HVSA 1RQMA 3DMLA 4MZCA 3LFLA 3DD3A 2IL3A 5HR2A 3K8NA 2LQQA 2YCDA 4KSOA 2HRKA 4K2DA 3ZITA 2WGRA 3ME8A 3O6TA 2O7KA 4JR4A 4F2IA 3TKRA 3VPTA 1ON4A 3ISOA 1Z6MA 3C1SA 2H75A 2C0EA 4FQUA 4OO4A 4NAXA 3QCPA 4MA9A 1B8XA 1ZMAA 3Q19A 5B6NA 4G9HA 1KBNA 3BCKA 3TKSA 3A3TA 2OADA 1GSSA 3TJFA 5JWRB 4O7HA 1ERWA 1FVJA 3VI7A 1GP1A 3VWWA 2OA7A 1F6MC 4D73B 1O6JA 3ZRDA 3DVWA 3PR8A 5CP1A 3E0UA 2PU9C 3D6IA 1W89A 1YEPA 1XBSA 11GSA 1FB6A 3EU4A 3P2AA 4IQ1A 4LMWA 1RK4A 2VL2A 1O81A 1THXA 1WRYA 4CDOA 1FG4A 4KW6A 1YY7A 4OCFA 3GX0A 2C3TA 2HSMA 2LQOA 4KCEA 1MDJA 1F3AA 2PVOC 4H86A 5ECHB 1V58A 3PPUA 1AQWA 2Z9SA 5INYA 4KUNA 2H01A 1S3DA 3R3EA 4I2TA 5B6MA 1XW5A 2YV9A 1U6TA 5ECNB 2H71A 2E2MA 2VL3A 5H5SA 4EE0A 1SK0A 2X8HA 2QKEA 4DSQA 3WD6A 2OE3A 1V40A 4XHMA 1TDIA 4Q5NA 3EYTA 3IHGA 3FR6A 3G7IA 3C73A 3F6DA 3HZ4A 1MEKA 2PPTA 4N30A 4PQ1A 5HR0A 22GSA 4EDYA 1Z6NA 2HT9A 1NW2A 2CX4A 2K9FA 2JZTA 4LL4B 4XS6A 3MIXA 4K5RA 3A2VA 3IC8A 2E2GA 3ZZXA 5J41A 1OE7A 2YV7A 3QAWA 5FT3A 4OMVA 3IR4A 1DE1A 2RLIA 4PTSA 5G31A 3TUEA 5CRHA 4MP4A 5DAKA 2C3NA 2ES7A 4POMA 1LBKA 1FOHA 1K3OA 2C0GA 2JL4A 2P5QA 2WFCA 4MZBA 3IXRA 3M1GA 3F8UA 4FO5A 3Q74A 1X0RA 2YANA 3MSZA 5H5QA 1SL0B 1SJ6A 5C04A 5D93A 2ZCTA 3U5RE 1WWJA 2GTUA 1TU7A 2HSHA 4MJCA 1OKTA 3CYNA 1VF3A 1QMVA 4TW5A 5KOWA 3J7Yb 4KB3A 3H93A 4YQUA 2LUSA 5J9CA 4XS4B 3GIXA 2YNXA 18GSA 5DDLA 4KSMA 2UZ8A 3ZYWA 3F4SA 3GYKA 3DKSA 2XPEA 4ZBDA 4V2NA 3HYPA 3EMPA 3TJKA 3HXSA 1T1VA 3KP8A 4L5OA 4X4JA 4IW9A 2N5BA 1I9DA 2IMEA 2DJKA 2P31A 2FUG2 1DSBA 1ZYNA 4NWYA 2I1UA 4TXOA 6GSVA 5J5NA 1HNAA 2H0HA 1Y6EA 1K0BA 2H30A 5JWQB 1HYUA 5ECKB 3DGQA 1HD2A 4JZQA 1TOFA 2EIQA 1GUHA 4WKWA 2NDOA 4OFNA 2JZRA 2L5LA 4KGIA 1XZOA 5D73A 3TGZA 4V2LA 3UOMA 1SKRB 4PXOA 1K3YA 3FHKA 3LGCA 1LU4A 2V32A 2YWMA 2L5OA 1JZWA 1NHYA 2IFQB 3H79A 4K0NA 1XVQA 1C72A 4N11A 1ML6A 4G0KA 1K0NA 4IS0A 1J0FA 4KE3A 5BRTA 4CW9A 1EZKA 1PKWA 4TR1B 2H6XA 4GWRA 3IV4A 4ILFA 1JZRA 2MMOA 1GNWA 3Q6OA 3FEUA 5DCHA 1VGLA 5KN2A 2FY6A 2H74A 1ABAA 1WIKA 2C1YA 1GNEA 3KH9A 1TK0B 2ZUPA 4AJ6A 5ENUA 2D2ZA 3IHQA 2C8UA 1AAZA 2J9HA 5CAXA 4E8HA 2FHEA 5IM9A 5ECPB 1FOVA 1BQ7A 5ECRB 1PL2A 1EEJA 3CSIA 3GKXA 1YKCA 2OKAA 1EGRA 2RM5A 3GTUA 2LRCA 1ERUA 2H72A 5A4VA 6GSYA 2LNTA 2V1MA 4IELA 4J57E 2TRXA 1TK8B 2IN3A 1K0CA 5DAKB 2LRNA 1AQVA 1OKDA 3ERGA 2DMMA 1QFNA 2HI7A 1UC7A 4X0XA 2CVKA 2H1BA 3HHVA 3HJOA 1SKSB 1T7PB 1GULA 5G5EA 4K8MA 1Z3EA 2YP6A 3DEXA 5GSTA 2YOIA 3RPNA 4EXJA 4I2UA 2DJ2A 1AC1A 3CTGA 1WMJA 4Z2UA 4ZILA 2NVLA 4HQZA 2HZEA 2VD0A 1GRXA 2YWNA 2ALBA 3UEMA 2QGVA 5ID2A 2M80A 2R3XA 1PX6A 5E59A 1EV4A 4RI6A 2OBKA 2IWTA 4MZWA 2B5YA 1A24A 4JR6A 1TW9A 4Z2RA 4HEA2 3ZMLA 1TU8A 2KLXA 1FVKA 2GQMA 5ECLB 3WGEA 2I4AA 3BBYA 4RQXA 2PUKC 3ED3A 5IMDA 1X9WB 5LNKe 1K0MA 3TB2A 2LKUA 1WOUA 2VUPA 4ECJA 3UAPA 5IMAA 5AIVA 4NV5A 5D8IA 3ZIVA 1S3CA 2REMA 1T4YA 3GMFA 4ZIJA 1DBYA 1TI3A 3TJGA 3D22A 5CO3A 1SJZA 2R37A 2KP1A 1ERTA 2PN8A 5IMZA 1SYXA 3F4RA 1QXHA 4EUYA 3KEBA 2R4VA 5IOXA 3TDGA 1ACVA 7GSSA 3D21A 3M9KA 2DKIA 2LJRA 1TTZA 4EIPA 1ZL9A 3H8QA 3UBKA 4XTSA 4O5RA 4HDEA 1GUKA 1FB0A 1SU9A 3GH9A 2CZ3A 1PL1A 1JLWA 3IOSA 4BVXA 4YAPA 2AHEA 5J9BA 2GZZA 3FYGA 2X49A 3P90A 1XWAA 1EOHA 4MJBA 4JU5A 3C1RA 3QDNA 3QPMA 3APSA 2I9HA 2WULA 4I5QA 4XRAA 1XIYA 2WZ9A 2K8VA 5CRWA 2FNOA 2B1KA 3D4MA 3A2WA 3KP9A 4ML1A 2QSIA 1PQNA 4IGJA 1MD3A 3LYKA 2G2QA 3IPZA 4FYCA 5GAPD 3GFKA 4X1UA 1M9AA 4DSRA 4A5PA 4TR3A 3D0ZA 5CRDA 5IMFA 3LW9A 1TRSA 3HJMA 3TKSE 3FMWA 3HJPA 1V9WA 3GKMA 2FWGA 1KNGA 1XW9A 4ZB8A 1XVWA 1U3IA 1HQOA 1X5CA 4HOJA 1ZGNA 1G6YA 3WGDA 3ZTLA 2GDRA 3LWAA 2GZPA 4KNDA 3EC3A 5ID2B 3FZ9A 2H1GA 3HVXA 1PKZA 5ECSA 3EMXA 2DJ3A 3LYPA 5DALB 2H6YA 5D9WA 5BMUA 3HDCA 4MJEA 3DYRA 2DIYA 5KOXA 4LA1A 1CQHA 3PINA 2AAWA 3O3TA 5B8BA 4XIHA 1UA5A 1YEXA 3MWHA 4TKYA 3ZLPA 3GH6A 4PNGA 4IP1A 12GSA 2NPBA 5ELAA 3U6VA 1GTAA 1PD21 2IJYA 2M72A 3ZFBA 4TXVA 1B4PA 1X5DA 4MDCA 4IN0A 4GCIA 2IIYA 1Z9HA 1GSQA 4HU9A 4POBA 4NXIA 1YZXA 1YKAA 4OFTA 3F4TA 1BYEA 4N0ZA 1O8XA 1MDIA 14GSA 2CAIA 3W6GA 2XBQA 3L0HA 2L6CA 3IAS2 2EIOA 4HZ4A 3W8SA 2PVQA 5ELGA 3IDVA 5LD0A 3VLNA 4POLA 4DVCA 1ZYEA 1TRVA 2GSSA 5DJMA 5H5RA 2R5GA 1F37A 3IA1A 3LSZA 3KM6A 4F0CA 2VCZA 16GSA 4F03A 5EVOA 4GXZA 2CX3A 1QUWA 4ZL7A 5KEJA 1IYHA 2VOCA 1FO5A 3FKFA 1GSEA 2H66A 4IJ3A 3UBLA 2R2JA 4BVYB 2FA8A 4YKFA 2C0FA 3BD2A 4MPGA 2O87A 1ERVA 1IYIA 2LJKA 3L4NA 1YQ1A 3FR3A 1SYRA 5EL8A 2H73A 1O8WA 2GZYA 3FRCA 3FK8A 4HU7A 1OC9A 1DUGA 4MCUA 4GF0A 1MTCA 4N0VA 4RUVA 1ZOFA 2VO4A 1TP9A 1R26A 2KP2A 4PNFA 4MNNA 1PX7A 2MMZA 1UVZA 2H19A 4PUFC 5IIZA 3DRNA 4MK3A 1JHBA 2BTOT 4I6XA 1LJRA 2G0FA 2MBSA 4GQFA 1GSFA 4WEYA 2HYXA 8GSSA 5LCZA 5HQPA 1SJIA 2FWHA 2IMDA 3FW2A 3CRTA 2WRTA 1PA3A 3TKQA 1E6BA 1X9MB 4HJ2A 2B1LA 4K5SA 6GSTA 4ECCA 4G0IA 4XRDA 2HSYA 5IQYA 1FHEA 2A2SA 1YF0A 1Z7RA 1A2MA 2VCQA 5JWOB 2AJQB 2QA1A 4DSSA 5CNWA 5DQSA 4MF5A 3J7Yk 1ZYPA 1H4OA 5CRGA 2IPAA 2F8FA 4AGSA 2KOKA 2V6OA 2IMKA 4XCSA 2VCTA 2LV3A 4GQCA 1J9BA 1QGVA 1SK2A 4K9ZA 4CY8A 3I9V2 5AN1A 4I97A 3KGKA 3EVIA 2F51A 2H1DA 2WS2A 2FLSA 3DIEA 2AV4A 3GURA 2LS5A 4WF5A 2VLTA 1R7HA 2JU5A 1A0FA 3HA9A 3O76A 3L9SA 2YZUA 2TIRA 3TJJA 4O92A 4EKZA 4KDUA 4F9ZA 5D96A 1O85A 1N8JA 4BWQA 4TOPA 4PURA 3M0FA 2FGXA 3QOUA 4WBRD 4ICYA 4WXTA 5IMVA 3FZ4A 5JCUA 4L0UA 4OD7A 1TXXA 2E7PA 5FWGA 2R6KA 2NBSA 4G19A 4HJMA 2LJAA 3H4KA 2VAFA 4HQSA 2JSZA 1G7OA 1EV9A 1SL1B 5F07A 5EY6A 1JZDA 4WF4A 4GSNA 1FAAA 3VI5A 3CMIA 3KTBA 4MH3A 5AGYA 2DJJA 2L59A 2L57A 2VM2A 4XS1A 4JBBA 2A4HA 1B48A 4KCAA 4NV2A 4MLYA 1GUMA 3R2QA 1XOAA 4PUAA 1XFLA 2HZFA 2MBTA 1GTIA 1ZCPA 5G1LA 5DVBA 2B5EA 5G1KA 3Q18A 2OBIA 4Q5QA 3QAVA 3VWXA 1GWCA 5A4WA 5C00A 1WPIA 2DLXA 3F0IA 1G7EA 1R5AA 4N10A 5IO2A 1GL8A 4KDXA 2GVPA 4QQ7A 3VPQA 1F3BA 4TN8A 5L71A 4DEJA 3LXTA 3KZQA 3H1NA 3SWLA 1USBA 3QR6A 4BL7A 1M9BA 2CVDA 2R0CA 4FH8A 2P0GA 2GSTA 3EE2A 3FZAA 4J56E 3BJ5A 1ZZYA 4IP6A 2YN1A 2J23A 4PGTA 1PGTA 3PGTA 4ZB6A 2XBIA 5HFGA 4D73A 2H8LA 1F9MA 4Z2TA 5KN1A 2YWOA 3VWUA 3KIJA 2IMIA 2BMXA 5B7CA 2JSYA 5DQYA 3F3QA 4POKA 1N2AA 4TXOB 2HRFA 1HNBA 4ZXGA 4AF2A 4YKGA 2R0GA 2HRAA 3CRUA 2YJ7A 1T3BA 1XPVA 3QMXA 1K0DA 1XXUA 1VRSD 4EF0A 2H76A 4YQMA 5ABRA 1T4ZA 3ZMKA 2FA4A 4L0WA 2HXKA 3ZVJA 5D9XA 3ME7A 4F0BA 2K6VA 2CV4A 3GNJA 4EDZA 2A2RA 1OC8A 5KN0A 2ON5A 2A4VA 2ZNMA 19GSA 3ZFLA 1M0UA 3ERWA 4ACSA 2HLSA 3UARA 4HZ2A 4LLRA 1SENA 4O32A 3IAM2 2R0PA 4EO3A 3GX8A 2X4AA 3MDKA 2RM6A 3ZIJA 3TOUA 3UIWA 3KTLA 4IBPA 4KX4A 1WJKA 2N5AA 2H0GA 3M9JA 2KHPA 3TRPA 1YF1A 3RHCA 3DWVA 1G6WA 1XWBA 4K7IA 3V1WA 1I5GA 1BAYA 20GSA 2X64A 3A2XA 5A4UA 4TVEA 1M99A 1U3AA 2MZCA 3LORA 1M7TA 5ECIB 4ULXA 1A23A 3D5JA 2MYGA 2QA2A 4RQRA 2L4QA 1AXDA 4NHWA 3IC4A 1TJDA 1T00A 2YJHA 2F8AA 1MDKA 3GTUB 4KA0A 3CXGA 3TRXA 4YH2A 3DVXA 1R5PA 1JFUA 4IJIA 2JACA 1QQ2A 1GTUA 1BX9A 2HNLA 4ECBA 2FWEA 1M2DA 1PRXA 1B4QA 3RHBA 4FYBA 2IMFA 2XHFA 4Q5FA 5GSSA 5DBQA 3QFBC 4OFMA 1XWGA 3GN3A 2FCHA 3MAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QC7 A;  5GAN D;  2HZE B;  4IVF A;  4OO5 A;  3UJ1 A;  1G0T A;  1FW1 A;  5D9V A;  4XS4 A;  2CVB A;  3F3R A;  5COH A;  2OJL A;  5HFK A;  3EIN A;  4ML6 A;  2VM1 A;  4TR4 A;  1R4W A;  2LST A;  1SK1 A;  3FZ5 A;  3QFA C;  2WDU A;  4IKH A;  2VLV A;  3EU3 A;  3US3 A;  5ECO B;  3LJR A;  3HCZ A;  1U87 A;  4LMV A;  4KDY A;  2LRT A;  3D4T A;  4K1F A;  2VCW A;  1OVN A;  2C80 A;  4EC0 A;  4KH7 A;  1EP8 A;  1BED A;  3LEF A;  3A5W A;  1AUC A;  4MF6 A;  3GST A;  1O7U A;  4GTU A;  4PQH A;  5JCG A;  1B9Y C;  2LEG A;  5G5F A;  1BJX A;  3NZN A;  4EL1 A;  2HRN A;  3GKK A;  2DJ0 A;  2WB9 A;  2GLR A;  3WT1 A;  3ERF A;  2BJX A;  4WR4 A;  5CRE A;  2PER A;  5CYY A;  4Z7X A;  5IOW A;  1TK5 B;  4G2E A;  2LNS A;  3VFI A;  2DJ1 A;  4K7N A;  5IO0 A;  2XC2 A;  9GSS A;  2X8C A;  5J4U A;  3CTF A;  5ECM B;  2IFQ A;  3FR9 A;  4V1A p;  1K3L A;  2F9S A;  1V98 A;  1F2E A;  3UVH A;  3HKR A;  2H6Z A;  4P3Y B;  2MMA A;  2I3Y A;  2KUC A;  2RUE A;  2EC4 A;  2M46 A;  4ECI A;  3N9J A;  4TR1 A;  3TJB A;  1V2A A;  1XWK A;  2YPM A;  2YWI A;  1NM3 A;  4F82 A;  1E2Y A;  3TCO A;  5AIS A;  1A8L A;  1VF2 A;  2FWF A;  2GQL A;  1YJ6 A;  1VF1 A;  1JZO A;  5JCW A;  2B7K A;  4ZL8 A;  3VWV A;  4HUA A;  3KMN A;  2V6K A;  4L8E A;  2O85 A;  4K7O A;  2VLU A;  3I6A A;  4GLT A;  3CBU A;  4ISD A;  1S3A A;  3GL3 A;  2L4C A;  1W4V A;  2GGT A;  1XCC A;  4L5L A;  4PX1 A;  4FIW A;  3EUR A;  2PWJ A;  3KCM A;  2DML A;  5IMC A;  3G7J A;  1WE0 A;  1V57 A;  1PN9 A;  5DCG A;  2GSQ A;  3W8J A;  2DIZ A;  3TKS C;  1A2L A;  1XW6 A;  4K6X A;  3RAZ A;  3APQ A;  2HFD A;  2GT5 A;  1SD8 A;  3TOT A;  2JZS A;  5F05 A;  3CSH A;  1JLV A;  2H1A A;  5F0G A;  1K0A A;  3GSS A;  3GRX A;  1VF4 A;  2V2G A;  2I81 A;  3LG6 A;  4MJA A;  1KTE A;  1EP7 A;  1M2B A;  2B5X A;  4GST A;  4FYU A;  4YAV A;  2RUF A;  1EEM A;  2VL2 C;  5HR3 A;  3IK9 A;  2N5F A;  1B9X C;  1HNC A;  3LXZ A;  5IPH A;  13GS A;  4WR5 A;  4GRF A;  3GL5 A;  2AB6 A;  3CSJ A;  3HY2 A;  1H75 A;  3F6F A;  3M3M A;  1Q4J A;  5E4W A;  3I43 A;  3JCM L;  5J3R A;  3WGX A;  1OYJ A;  3BOA A;  1TRU A;  1GTB A;  3KH7 A;  2P5R A;  1A0R P;  3KJY A;  2B3S A;  4AJ8 A;  4NPB A;  3UMA A;  1J08 A;  3G7Y A;  2L6D A;  2YZH A;  4HI7 A;  5GZZ B;  4MPF A;  2VCX A;  3F63 A;  3ZVJ D;  4RI7 A;  4IHU A;  5EPF A;  1Z7P A;  3KXO A;  4BWS A;  1SKW B;  4NMU A;  2X99 A;  17GS A;  2FD3 A;  2TRC P;  1TI1 A;  4ZB9 A;  2GT6 A;  5KN3 A;  1XOB A;  1OC3 A;  4E8E A;  1X9S B;  6GSS A;  3PH9 A;  2V41 A;  2X8G A;  1DE2 A;  3NOF A;  4X43 A;  1GSD A;  3UL3 A;  3G9B A;  3LQ7 A;  2DBC A;  5DJL A;  3L78 A;  1GSY A;  3AY8 A;  1KEB A;  5HFI A;  4HS1 A;  2CAQ A;  5ECQ B;  2H0I A;  2LTK A;  1K0O A;  2XPD A;  3RDW A;  5HR1 A;  3ZL5 A;  6GSX A;  3KMO A;  4GSS A;  3N5O A;  1GLQ A;  4JE1 A;  2CQ9 A;  3GUS A;  3C8E A;  2OE1 A;  4EVM A;  1URM A;  2NTO A;  1TKD B;  2ON7 A;  1WP0 A;  3IRA A;  2EIR A;  4G10 A;  2PMT A;  4AJ7 A;  5AIX A;  1EGO A;  3QD9 A;  3P7X A;  1OAZ A;  3OR5 A;  1AIU A;  4MMM A;  1RW1 A;  4OCE A;  2HE3 A;  1NSW A;  5A5K A;  3HVV A;  1NHO A;  5G30 A;  1OC9 B;  4MAB A;  4YQV A;  3IE3 A;  1QK8 A;  3L9V A;  4I8B A;  2O8V B;  4MH2 A;  1TRW A;  2GS3 A;  2PGT A;  2K18 A;  5FHI A;  2B7J A;  2C4J A;  2C0D A;  2CT6 A;  3F9U A;  4ZBB A;  1PMT A;  1GLP A;  4V1A g;  2H70 A;  1YDK A;  2GQK A;  3E9J B;  2MMN A;  1MD4 A;  3VK9 A;  3HD5 A;  2VIM A;  2DSA A;  4OWY A;  1A2J A;  4KAE A;  1CQG A;  4WBJ A;  4ZL9 A;  3APO A;  3C71 A;  3E3E A;  4DSS B;  1SD9 A;  3S9F A;  3QAG A;  3IBH A;  5B8A A;  5DAL A;  1ST9 A;  3MNG A;  4BA7 A;  1T8E B;  1UN2 A;  2GSR A;  1THO A;  4IQA A;  4J2F A;  3GKN A;  3C7M A;  5D9T A;  4JED A;  1EWX A;  4BPY A;  10GS A;  1ZYQ B;  1M2A A;  2JAD A;  1AW9 A;  3I69 A;  1GSU A;  4QL7 A;  3BCI A;  3WT2 A;  4K0G A;  2CZ2 A;  3KD0 A;  1EOG A;  2PBJ A;  4TR0 A;  2O89 A;  2K8S A;  6GSU A;  4ZBA A;  3NIV A;  4CHS A;  2VL9 A;  2E0Q A;  1X5E A;  3P8W A;  1PSQ A;  3RPP A;  3TKP A;  1A8Y A;  2RII A;  3SBC A;  1GH2 A;  1O73 A;  2WCI A;  2CA8 A;  5G2Z A;  3HZ8 A;  3M8N A;  1Y25 A;  1ILO A;  3L9U A;  3RBT A;  3ZRE A;  3DXB A;  4NHZ A;  4MF7 A;  4ID0 A;  2DC5 A;  3GHA A;  5IPG A;  3GV1 A;  2C3Q A;  3TRQ A;  2VD1 A;  1XWC A;  1BG5 A;  4Q5R A;  3EWL A;  6GSW A;  3IK7 A;  4JRR A;  3UVT A;  2AUV A;  1AQX A;  2VCV A;  4V2M A;  2F3M A;  3WYW A;  5F8B A;  3GA4 A;  2B6M A;  4WET A;  4QL9 A;  5F06 A;  4BVY A;  1Z5Y E;  2OAC A;  4LL1 B;  1U88 A;  2AYT A;  3VUR A;  2OE0 A;  4TRX A;  1SL2 B;  1OE8 A;  2WJU A;  4PQI A;  1Q98 A;  3FY7 A;  3HVS A;  1RQM A;  3DML A;  4MZC A;  3LFL A;  3DD3 A;  2IL3 A;  5HR2 A;  3K8N A;  2LQQ A;  2YCD A;  4KSO A;  4K2D A;  3ZIT A;  2WGR A;  3ME8 A;  3O6T A;  2O7K A;  4JR4 A;  4F2I A;  3TKR A;  3VPT A;  1ON4 A;  3ISO A;  1Z6M A;  3C1S A;  2H75 A;  2C0E A;  4OO4 A;  4NAX A;  3QCP A;  4MA9 A;  1B8X A;  1ZMA A;  3Q19 A;  5B6N A;  4G9H A;  1KBN A;  3BCK A;  3TKS A;  3A3T A;  2OAD A;  1GSS A;  3TJF A;  5JWR B;  4O7H A;  1ERW A;  1FVJ A;  3VI7 A;  1GP1 A;  3VWW A;  2OA7 A;  1F6M C;  4D73 B;  1O6J A;  3ZRD A;  3DVW A;  3PR8 A;  5CP1 A;  3E0U A;  2PU9 C;  3D6I A;  1W89 A;  1YEP A;  1XBS A;  11GS A;  1FB6 A;  3EU4 A;  3P2A A;  4IQ1 A;  4LMW A;  1RK4 A;  2VL2 A;  1O81 A;  1THX A;  1WRY A;  4CDO A;  1FG4 A;  4KW6 A;  1YY7 A;  4OCF A;  3GX0 A;  2C3T A;  2LQO A;  4KCE A;  1MDJ A;  1F3A A;  2PVO C;  4H86 A;  5ECH B;  1V58 A;  1AQW A;  2Z9S A;  5INY A;  4KUN A;  2H01 A;  1S3D A;  4I2T A;  5B6M A;  1XW5 A;  2YV9 A;  1U6T A;  5ECN B;  2H71 A;  2E2M A;  2VL3 A;  5H5S A;  4EE0 A;  1SK0 A;  2X8H A;  2QKE A;  4DSQ A;  3WD6 A;  2OE3 A;  1V40 A;  4XHM A;  1TDI A;  4Q5N A;  3EYT A;  3FR6 A;  3G7I A;  3C73 A;  3F6D A;  3HZ4 A;  1MEK A;  2PPT A;  4N30 A;  4PQ1 A;  5HR0 A;  22GS A;  4EDY A;  1Z6N A;  2HT9 A;  1NW2 A;  2CX4 A;  2K9F A;  2JZT A;  4LL4 B;  4XS6 A;  3A2V A;  2E2G A;  3ZZX A;  5J41 A;  1OE7 A;  2YV7 A;  3QAW A;  5FT3 A;  4OMV A;  3IR4 A;  1DE1 A;  2RLI A;  5G31 A;  3TUE A;  5CRH A;  4MP4 A;  5DAK A;  2C3N A;  2ES7 A;  4POM A;  1LBK A;  1K3O A;  2C0G A;  2JL4 A;  2P5Q A;  2WFC A;  4MZB A;  3IXR A;  3M1G A;  3F8U A;  4FO5 A;  3Q74 A;  1X0R A;  2YAN A;  3MSZ A;  5H5Q A;  1SL0 B;  1SJ6 A;  5C04 A;  5D93 A;  2ZCT A;  3U5R E;  1WWJ A;  2GTU A;  1TU7 A;  2HSH A;  4MJC A;  1OKT A;  3CYN A;  1VF3 A;  1QMV A;  4TW5 A;  3J7Y b;  4KB3 A;  3H93 A;  4YQU A;  2LUS A;  5J9C A;  4XS4 B;  3GIX A;  2YNX A;  18GS A;  5DDL A;  4KSM A;  3ZYW A;  3F4S A;  3GYK A;  3DKS A;  2XPE A;  4ZBD A;  4V2N A;  3HYP A;  3EMP A;  3TJK A;  3HXS A;  1T1V A;  3KP8 A;  4L5O A;  4IW9 A;  2N5B A;  1I9D A;  2IME A;  2DJK A;  2P31 A;  2FUG 2;  1DSB A;  4NWY A;  2I1U A;  4TXO A;  6GSV A;  5J5N A;  1HNA A;  2H0H A;  1Y6E A;  1K0B A;  2H30 A;  5JWQ B;  1HYU A;  5ECK B;  3DGQ A;  1HD2 A;  4JZQ A;  1TOF A;  2EIQ A;  1GUH A;  4WKW A;  2NDO A;  4OFN A;  2JZR A;  2L5L A;  4KGI A;  1XZO A;  5D73 A;  3TGZ A;  4V2L A;  3UOM A;  1SKR B;  4PXO A;  1K3Y A;  3FHK A;  3LGC A;  1LU4 A;  2V32 A;  2YWM A;  2L5O A;  1JZW A;  1NHY A;  2IFQ B;  3H79 A;  4K0N A;  1XVQ A;  1C72 A;  4N11 A;  1ML6 A;  1K0N A;  4IS0 A;  1J0F A;  4KE3 A;  4CW9 A;  1EZK A;  1PKW A;  4TR1 B;  2H6X A;  4GWR A;  3IV4 A;  4ILF A;  1JZR A;  2MMO A;  1GNW A;  3Q6O A;  3FEU A;  5DCH A;  1VGL A;  5KN2 A;  2FY6 A;  2H74 A;  1ABA A;  1WIK A;  2C1Y A;  1GNE A;  3KH9 A;  1TK0 B;  2ZUP A;  4AJ6 A;  5ENU A;  2D2Z A;  3IHQ A;  2C8U A;  1AAZ A;  2J9H A;  5CAX A;  4E8H A;  2FHE A;  5IM9 A;  5ECP B;  1FOV A;  1BQ7 A;  5ECR B;  1PL2 A;  1EEJ A;  3CSI A;  3GKX A;  1YKC A;  2OKA A;  1EGR A;  2RM5 A;  3GTU A;  2LRC A;  1ERU A;  2H72 A;  5A4V A;  6GSY A;  2LNT A;  2V1M A;  4IEL A;  4J57 E;  2TRX A;  1TK8 B;  2IN3 A;  1K0C A;  5DAK B;  2LRN A;  1AQV A;  1OKD A;  3ERG A;  2DMM A;  1QFN A;  2HI7 A;  1UC7 A;  4X0X A;  2CVK A;  2H1B A;  3HHV A;  3HJO A;  1SKS B;  1T7P B;  1GUL A;  5G5E A;  4K8M A;  1Z3E A;  2YP6 A;  3DEX A;  5GST A;  2YOI A;  3RPN A;  4EXJ A;  4I2U A;  2DJ2 A;  1AC1 A;  3CTG A;  1WMJ A;  4ZIL A;  2NVL A;  4HQZ A;  2HZE A;  2VD0 A;  1GRX A;  2YWN A;  2ALB A;  3UEM A;  2QGV A;  5ID2 A;  2M80 A;  2R3X A;  1PX6 A;  5E59 A;  1EV4 A;  4RI6 A;  2OBK A;  2IWT A;  4MZW A;  2B5Y A;  1A24 A;  4JR6 A;  1TW9 A;  4HEA 2;  3ZML A;  1TU8 A;  2KLX A;  1FVK A;  2GQM A;  5ECL B;  3WGE A;  2I4A A;  3BBY A;  4RQX A;  2PUK C;  3ED3 A;  5IMD A;  1X9W B;  5LNK e;  1K0M A;  3TB2 A;  2LKU A;  1WOU A;  2VUP A;  4ECJ A;  3UAP A;  5IMA A;  5AIV A;  4NV5 A;  5D8I A;  3ZIV A;  1S3C A;  2REM A;  1T4Y A;  3GMF A;  4ZIJ A;  1DBY A;  1TI3 A;  3TJG A;  3D22 A;  5CO3 A;  1SJZ A;  2R37 A;  2KP1 A;  1ERT A;  2PN8 A;  5IMZ A;  1SYX A;  3F4R A;  1QXH A;  4EUY A;  3KEB A;  2R4V A;  5IOX A;  3TDG A;  1ACV A;  7GSS A;  3D21 A;  3M9K A;  2LJR A;  1TTZ A;  1ZL9 A;  3H8Q A;  3UBK A;  4XTS A;  4O5R A;  4HDE A;  1GUK A;  1FB0 A;  1SU9 A;  3GH9 A;  2CZ3 A;  1PL1 A;  1JLW A;  3IOS A;  4BVX A;  4YAP A;  2AHE A;  5J9B A;  2GZZ A;  3FYG A;  3P90 A;  1XWA A;  1EOH A;  4MJB A;  4JU5 A;  3C1R A;  3QDN A;  3QPM A;  3APS A;  2I9H A;  2WUL A;  4I5Q A;  4XRA A;  1XIY A;  2WZ9 A;  2K8V A;  5CRW A;  2FNO A;  2B1K A;  3D4M A;  3A2W A;  3KP9 A;  4ML1 A;  2QSI A;  1PQN A;  4IGJ A;  1MD3 A;  3LYK A;  2G2Q A;  3IPZ A;  4FYC A;  5GAP D;  3GFK A;  4X1U A;  1M9A A;  4DSR A;  4TR3 A;  3D0Z A;  5CRD A;  5IMF A;  1TRS A;  3HJM A;  3TKS E;  3HJP A;  1V9W A;  3GKM A;  2FWG A;  1KNG A;  1XW9 A;  4ZB8 A;  1XVW A;  1U3I A;  1HQO A;  1X5C A;  4HOJ A;  1ZGN A;  1G6Y A;  3WGD A;  3ZTL A;  2GDR A;  3LWA A;  2GZP A;  4KND A;  3EC3 A;  5ID2 B;  3FZ9 A;  2H1G A;  3HVX A;  1PKZ A;  5ECS A;  3EMX A;  2DJ3 A;  3LYP A;  5DAL B;  2H6Y A;  5D9W A;  3HDC A;  4MJE A;  3DYR A;  2DIY A;  4LA1 A;  1CQH A;  3PIN A;  2AAW A;  3O3T A;  5B8B A;  4XIH A;  1UA5 A;  1YEX A;  3MWH A;  4TKY A;  3ZLP A;  3GH6 A;  4PNG A;  4IP1 A;  12GS A;  2NPB A;  5ELA A;  3U6V A;  1GTA A;  1PD2 1;  2IJY A;  2M72 A;  3ZFB A;  4TXV A;  1B4P A;  1X5D A;  4MDC A;  4IN0 A;  4GCI A;  2IIY A;  1Z9H A;  1GSQ A;  4HU9 A;  4POB A;  4NXI A;  1YZX A;  1YKA A;  4OFT A;  3F4T A;  1BYE A;  4N0Z A;  1O8X A;  1MDI A;  14GS A;  2CAI A;  3W6G A;  2XBQ A;  3L0H A;  2L6C A;  3IAS 2;  2EIO A;  4HZ4 A;  3W8S A;  2PVQ A;  5ELG A;  3IDV A;  5LD0 A;  3VLN A;  4POL A;  4DVC A;  1ZYE A;  1TRV A;  2GSS A;  5DJM A;  5H5R A;  2R5G A;  1F37 A;  3IA1 A;  3LSZ A;  3KM6 A;  4F0C A;  2VCZ A;  16GS A;  4F03 A;  5EVO A;  4GXZ A;  2CX3 A;  1QUW A;  4ZL7 A;  5KEJ A;  1IYH A;  2VOC A;  1FO5 A;  3FKF A;  1GSE A;  2H66 A;  4IJ3 A;  3UBL A;  2R2J A;  2FA8 A;  2C0F A;  3BD2 A;  4MPG A;  2O87 A;  1ERV A;  1IYI A;  2LJK A;  3L4N A;  1YQ1 A;  3FR3 A;  1SYR A;  5EL8 A;  2H73 A;  1O8W A;  2GZY A;  3FRC A;  3FK8 A;  4HU7 A;  1OC9 A;  1DUG A;  4MCU A;  4GF0 A;  1MTC A;  4N0V A;  4RUV A;  1ZOF A;  2VO4 A;  1TP9 A;  1R26 A;  2KP2 A;  4PNF A;  1PX7 A;  2MMZ A;  1UVZ A;  2H19 A;  4PUF C;  5IIZ A;  3DRN A;  4MK3 A;  1JHB A;  2BTO T;  4I6X A;  1LJR A;  2G0F A;  2MBS A;  4GQF A;  1GSF A;  4WEY A;  2HYX A;  8GSS A;  5LCZ A;  5HQP A;  1SJI A;  2FWH A;  2IMD A;  3FW2 A;  3CRT A;  2WRT A;  1PA3 A;  3TKQ A;  1E6B A;  1X9M B;  4HJ2 A;  2B1L A;  6GST A;  4ECC A;  4XRD A;  2HSY A;  5IQY A;  1FHE A;  2A2S A;  1YF0 A;  1Z7R A;  1A2M A;  2VCQ A;  5JWO B;  2AJQ B;  4DSS A;  5CNW A;  5DQS A;  4MF5 A;  3J7Y k;  1H4O A;  5CRG A;  2IPA A;  2F8F A;  4AGS A;  2KOK A;  2V6O A;  2IMK A;  4XCS A;  2VCT A;  2LV3 A;  4GQC A;  1J9B A;  1QGV A;  1SK2 A;  4K9Z A;  3I9V 2;  5AN1 A;  4I97 A;  3KGK A;  3EVI A;  2F51 A;  2H1D A;  2WS2 A;  2FLS A;  3DIE A;  2AV4 A;  3GUR A;  2LS5 A;  4WF5 A;  2VLT A;  1R7H A;  2JU5 A;  1A0F A;  3HA9 A;  3O76 A;  3L9S A;  2YZU A;  2TIR A;  3TJJ A;  4O92 A;  4EKZ A;  4KDU A;  4F9Z A;  5D96 A;  1O85 A;  1N8J A;  4BWQ A;  4TOP A;  4PUR A;  3M0F A;  2FGX A;  3QOU A;  4WBR D;  4WXT A;  5IMV A;  3FZ4 A;  5JCU A;  4L0U A;  4OD7 A;  1TXX A;  2E7P A;  5FWG A;  2R6K A;  2NBS A;  4G19 A;  4HJM A;  2LJA A;  3H4K A;  2VAF A;  4HQS A;  2JSZ A;  1G7O A;  1EV9 A;  1SL1 B;  5F07 A;  5EY6 A;  1JZD A;  4WF4 A;  4GSN A;  1FAA A;  3VI5 A;  3CMI A;  3KTB A;  4MH3 A;  5AGY A;  2DJJ A;  2L59 A;  2L57 A;  2VM2 A;  4XS1 A;  4JBB A;  1B48 A;  4KCA A;  4NV2 A;  4MLY A;  1GUM A;  3R2Q A;  1XOA A;  4PUA A;  1XFL A;  2HZF A;  2MBT A;  1GTI A;  1ZCP A;  5G1L A;  5DVB A;  2B5E A;  5G1K A;  3Q18 A;  2OBI A;  4Q5Q A;  3QAV A;  3VWX A;  1GWC A;  5A4W A;  5C00 A;  1WPI A;  2DLX A;  3F0I A;  1G7E A;  1R5A A;  4N10 A;  5IO2 A;  1GL8 A;  4KDX A;  2GVP A;  4QQ7 A;  3VPQ A;  1F3B A;  4TN8 A;  5L71 A;  4DEJ A;  3LXT A;  3KZQ A;  3H1N A;  3SWL A;  1USB A;  3QR6 A;  4BL7 A;  1M9B A;  2CVD A;  4FH8 A;  2P0G A;  2GST A;  3EE2 A;  3FZA A;  4J56 E;  3BJ5 A;  1ZZY A;  4IP6 A;  2YN1 A;  2J23 A;  4PGT A;  1PGT A;  3PGT A;  4ZB6 A;  2XBI A;  5HFG A;  4D73 A;  2H8L A;  1F9M A;  5KN1 A;  2YWO A;  3VWU A;  3KIJ A;  2IMI A;  2BMX A;  5B7C A;  2JSY A;  5DQY A;  3F3Q A;  4POK A;  1N2A A;  4TXO B;  2HRF A;  1HNB A;  4ZXG A;  4AF2 A;  3CRU A;  2YJ7 A;  1T3B A;  1XPV A;  3QMX A;  1K0D A;  1XXU A;  1VRS D;  4EF0 A;  2H76 A;  4YQM A;  5ABR A;  1T4Z A;  3ZMK A;  2FA4 A;  4L0W A;  2HXK A;  3ZVJ A;  5D9X A;  3ME7 A;  4F0B A;  2K6V A;  2CV4 A;  3GNJ A;  4EDZ A;  2A2R A;  1OC8 A;  5KN0 A;  2ON5 A;  2A4V A;  2ZNM A;  19GS A;  3ZFL A;  1M0U A;  3ERW A;  4ACS A;  2HLS A;  3UAR A;  4HZ2 A;  4LLR A;  1SEN A;  4O32 A;  3IAM 2;  4EO3 A;  3GX8 A;  3MDK A;  2RM6 A;  3ZIJ A;  3TOU A;  3UIW A;  3KTL A;  4IBP A;  4KX4 A;  1WJK A;  2N5A A;  2H0G A;  3M9J A;  2KHP A;  3TRP A;  1YF1 A;  3RHC A;  3DWV A;  1G6W A;  1XWB A;  4K7I A;  3V1W A;  1I5G A;  1BAY A;  20GS A;  2X64 A;  3A2X A;  5A4U A;  4TVE A;  1M99 A;  1U3A A;  2MZC A;  3LOR A;  1M7T A;  5ECI B;  4ULX A;  1A23 A;  3D5J A;  2MYG A;  4RQR A;  2L4Q A;  1AXD A;  4NHW A;  3IC4 A;  1TJD A;  1T00 A;  2YJH A;  2F8A A;  1MDK A;  3GTU B;  4KA0 A;  3CXG A;  3TRX A;  4YH2 A;  3DVX A;  1R5P A;  1JFU A;  4IJI A;  2JAC A;  1QQ2 A;  1GTU A;  1BX9 A;  2HNL A;  4ECB A;  2FWE A;  1M2D A;  1PRX A;  1B4Q A;  3RHB A;  4FYB A;  2IMF A;  2XHF A;  4Q5F A;  5GSS A;  5DBQ A;  3QFB C;  4OFM A;  1XWG A;  3GN3 A;  2FCH A;  3MAK A; 
#chains in the Genus database with same CATH topology
 2QC7 A;  5GAN D;  2HZE B;  4IVF A;  4OO5 A;  3UJ1 A;  1G0T A;  1FW1 A;  5D9V A;  4XS4 A;  2CVB A;  3F3R A;  5COH A;  2OJL A;  4BL7 B;  5HFK A;  3EIN A;  4ML6 A;  2VM1 A;  4TR4 A;  1R4W A;  2LST A;  1SK1 A;  3FZ5 A;  3QFA C;  2WDU A;  4IKH A;  2VLV A;  3EU3 A;  3US3 A;  5ECO B;  3LJR A;  3HCZ A;  1U87 A;  4LMV A;  4KDY A;  2LRT A;  3D4T A;  4K1F A;  2VCW A;  1OVN A;  2C80 A;  4EC0 A;  4KH7 A;  1EP8 A;  1BED A;  3LEF A;  3A5W A;  1AUC A;  4MF6 A;  3GST A;  1O7U A;  4GTU A;  4PQH A;  5JCG A;  1B9Y C;  2LEG A;  5G5F A;  1BJX A;  3NZN A;  4EL1 A;  2HRN A;  3GKK A;  2DJ0 A;  2WB9 A;  2GLR A;  3WT1 A;  3ERF A;  2BJX A;  4WR4 A;  5CRE A;  2PER A;  5CYY A;  4Z7X A;  5IOW A;  1TK5 B;  4G2E A;  2LNS A;  3VFI A;  2DJ1 A;  4K7N A;  4O5U A;  5IO0 A;  2XC2 A;  9GSS A;  2X8C A;  5J4U A;  3CTF A;  5ECM B;  3A5I A;  2IFQ A;  3FR9 A;  4V1A p;  1K3L A;  2F9S A;  1V98 A;  1F2E A;  4KF9 A;  3UVH A;  3HKR A;  2H6Z A;  4P3Y B;  2MMA A;  2I3Y A;  2KUC A;  2RUE A;  2EC4 A;  2M46 A;  4ECI A;  1PN0 A;  3N9J A;  4TR1 A;  3TJB A;  1V2A A;  1XWK A;  2YPM A;  2YWI A;  1NM3 A;  4F82 A;  1E2Y A;  3TCO A;  5AIS A;  1A8L A;  1VF2 A;  2FWF A;  2GQL A;  1YJ6 A;  1VF1 A;  1JZO A;  5JCW A;  2B7K A;  4ZL8 A;  4BVX B;  3VWV A;  4HUA A;  3KMN A;  2V6K A;  4L8E A;  2O85 A;  4K7O A;  2VLU A;  3I6A A;  4GLT A;  3CBU A;  4ISD A;  1S3A A;  3GL3 A;  2L4C A;  1W4V A;  2GGT A;  1XCC A;  4L5L A;  4PX1 A;  4FIW A;  3EUR A;  2PWJ A;  3KCM A;  2DML A;  5IMC A;  3G7J A;  1WE0 A;  1V57 A;  1PN9 A;  5DCG A;  2GSQ A;  3W8J A;  2DIZ A;  3TKS C;  1A2L A;  1XW6 A;  4K6X A;  3RAZ A;  3APQ A;  2HFD A;  2GT5 A;  1SD8 A;  3TOT A;  2JZS A;  2A2P A;  3CSH A;  5F05 A;  1JLV A;  2H1A A;  5F0G A;  1K0A A;  3GSS A;  3GRX A;  1VF4 A;  2V2G A;  2I81 A;  3LG6 A;  4MJA A;  1KTE A;  1EP7 A;  3MYD A;  1M2B A;  3EPT A;  2B5X A;  4GST A;  4FYU A;  4YAV A;  2RUF A;  1EEM A;  2VL2 C;  5HR3 A;  3IK9 A;  2N5F A;  1B9X C;  1HNC A;  3LXZ A;  5IPH A;  13GS A;  4WR5 A;  4GRF A;  3GL5 A;  2AB6 A;  3CSJ A;  3HY2 A;  1H75 A;  3F6F A;  3M3M A;  1Q4J A;  5E4W A;  3I43 A;  3JCM L;  5J3R A;  3WGX A;  1OYJ A;  3BOA A;  1TRU A;  1GTB A;  3KH7 A;  2P5R A;  1A0R P;  3KJY A;  2B3S A;  4AJ8 A;  4NPB A;  3UMA A;  1J08 A;  3G7Y A;  2L6D A;  2YZH A;  4HI7 A;  5GZZ B;  4MPF A;  2VCX A;  3F63 A;  3ZVJ D;  4RI7 A;  4IHU A;  5EPF A;  1Z7P A;  3KXO A;  4BWS A;  1SKW B;  4NMU A;  2X99 A;  4G0L A;  17GS A;  2FD3 A;  2TRC P;  1TI1 A;  4ZB9 A;  2GT6 A;  5KN3 A;  1XOB A;  1OC3 A;  4E8E A;  1X9S B;  6GSS A;  3PH9 A;  2V41 A;  2X8G A;  1DE2 A;  3NOF A;  4X43 A;  1GSD A;  3UL3 A;  3G9B A;  3LQ7 A;  2DBC A;  5DJL A;  3L78 A;  1GSY A;  3AY8 A;  1KEB A;  5HFI A;  4HS1 A;  2CAQ A;  5ECQ B;  2H0I A;  2LTK A;  1K0O A;  2XPD A;  3RDW A;  5HR1 A;  3ZL5 A;  6GSX A;  3KMO A;  4GSS A;  3N5O A;  1GLQ A;  4JE1 A;  2CQ9 A;  3GUS A;  3C8E A;  2OE1 A;  4EVM A;  1URM A;  2NTO A;  1TKD B;  2ON7 A;  1WP0 A;  3IRA A;  2EIR A;  4G10 A;  2PMT A;  4AJ7 A;  2DKH A;  5AIX A;  1EGO A;  3QD9 A;  3P7X A;  1OAZ A;  3OR5 A;  1AIU A;  4MMM A;  1RW1 A;  4OCE A;  2HE3 A;  1NSW A;  5A5K A;  3HVV A;  1NHO A;  5G30 A;  1OC9 B;  4MAB A;  4YQV A;  3IE3 A;  1QK8 A;  3L9V A;  4I8B A;  2O8V B;  4MH2 A;  1TRW A;  2GS3 A;  2PGT A;  2K18 A;  5FHI A;  2B7J A;  2C4J A;  2C0D A;  2CT6 A;  3F9U A;  4ZBB A;  1PMT A;  1GLP A;  4V1A g;  2H70 A;  1YDK A;  1M3I A;  2GQK A;  3E9J B;  2MMN A;  1MD4 A;  3VK9 A;  3HD5 A;  2VIM A;  2DSA A;  4OWY A;  1A2J A;  4KAE A;  1CQG A;  4EIQ A;  4WBJ A;  4ZL9 A;  3APO A;  3C71 A;  3E3E A;  4DSS B;  1SD9 A;  3S9F A;  3QAG A;  3IBH A;  5B8A A;  5DAL A;  1ST9 A;  4K2X A;  3MNG A;  4BA7 A;  1T8E B;  1UN2 A;  2GSR A;  1THO A;  4IQA A;  4J2F A;  3GKN A;  3C7M A;  5D9T A;  4JED A;  1EWX A;  4BPY A;  4CY6 A;  10GS A;  1ZYQ B;  1M2A A;  2JAD A;  1AW9 A;  3I69 A;  1GSU A;  4QL7 A;  4O5Q A;  3BCI A;  3WT2 A;  4K0G A;  2CZ2 A;  3KD0 A;  1EOG A;  2PBJ A;  4TR0 A;  2O89 A;  2K8S A;  6GSU A;  4ZBA A;  3NIV A;  4CHS A;  2VL9 A;  2E0Q A;  1X5E A;  3P8W A;  1PSQ A;  3RPP A;  3TKP A;  1A8Y A;  2RII A;  3SBC A;  1GH2 A;  1O73 A;  2WCI A;  2CA8 A;  5G2Z A;  3HZ8 A;  3M8N A;  1Y25 A;  1ILO A;  3L9U A;  3RBT A;  3ZRE A;  3DXB A;  4NHZ A;  4MF7 A;  4ID0 A;  2DC5 A;  3GHA A;  5IPG A;  3GV1 A;  2C3Q A;  3TRQ A;  2VD1 A;  1XWC A;  1BG5 A;  4Q5R A;  3EWL A;  6GSW A;  3IK7 A;  4JRR A;  3UVT A;  2AUV A;  1AQX A;  2VCV A;  4V2M A;  2F3M A;  3WYW A;  5F8B A;  3GA4 A;  2B6M A;  4WET A;  4QL9 A;  5F06 A;  4BVY A;  1Z5Y E;  2OAC A;  4LL1 B;  1U88 A;  2AYT A;  3VUR A;  2OE0 A;  4TRX A;  1SL2 B;  1OE8 A;  2WJU A;  4PQI A;  4USS A;  1Q98 A;  3FY7 A;  3HVS A;  1RQM A;  3DML A;  4MZC A;  3LFL A;  3DD3 A;  2IL3 A;  5HR2 A;  3K8N A;  2LQQ A;  2YCD A;  4KSO A;  2HRK A;  4K2D A;  3ZIT A;  2WGR A;  3ME8 A;  3O6T A;  2O7K A;  4JR4 A;  4F2I A;  3TKR A;  3VPT A;  1ON4 A;  3ISO A;  1Z6M A;  3C1S A;  2H75 A;  2C0E A;  4FQU A;  4OO4 A;  4NAX A;  3QCP A;  4MA9 A;  1B8X A;  1ZMA A;  3Q19 A;  5B6N A;  4G9H A;  1KBN A;  3BCK A;  3TKS A;  3A3T A;  2OAD A;  1GSS A;  3TJF A;  5JWR B;  4O7H A;  1ERW A;  1FVJ A;  3VI7 A;  1GP1 A;  3VWW A;  2OA7 A;  1F6M C;  4D73 B;  1O6J A;  3ZRD A;  3DVW A;  3PR8 A;  5CP1 A;  3E0U A;  2PU9 C;  3D6I A;  1W89 A;  1YEP A;  1XBS A;  11GS A;  1FB6 A;  3EU4 A;  3P2A A;  4IQ1 A;  4LMW A;  1RK4 A;  2VL2 A;  1O81 A;  1THX A;  1WRY A;  4CDO A;  1FG4 A;  4KW6 A;  1YY7 A;  4OCF A;  3GX0 A;  2C3T A;  2HSM A;  2LQO A;  4KCE A;  1MDJ A;  1F3A A;  2PVO C;  4H86 A;  5ECH B;  1V58 A;  3PPU A;  1AQW A;  2Z9S A;  5INY A;  4KUN A;  2H01 A;  1S3D A;  3R3E A;  4I2T A;  5B6M A;  1XW5 A;  2YV9 A;  1U6T A;  5ECN B;  2H71 A;  2E2M A;  2VL3 A;  5H5S A;  4EE0 A;  1SK0 A;  2X8H A;  2QKE A;  4DSQ A;  3WD6 A;  2OE3 A;  1V40 A;  4XHM A;  1TDI A;  4Q5N A;  3EYT A;  3IHG A;  3FR6 A;  3G7I A;  3C73 A;  3F6D A;  3HZ4 A;  1MEK A;  2PPT A;  4N30 A;  4PQ1 A;  5HR0 A;  22GS A;  4EDY A;  1Z6N A;  2HT9 A;  1NW2 A;  2CX4 A;  2K9F A;  2JZT A;  4LL4 B;  4XS6 A;  3MIX A;  4K5R A;  3A2V A;  3IC8 A;  2E2G A;  3ZZX A;  5J41 A;  1OE7 A;  2YV7 A;  3QAW A;  5FT3 A;  4OMV A;  3IR4 A;  1DE1 A;  2RLI A;  4PTS A;  5G31 A;  3TUE A;  5CRH A;  4MP4 A;  5DAK A;  2C3N A;  2ES7 A;  4POM A;  1LBK A;  1FOH A;  1K3O A;  2C0G A;  2JL4 A;  2P5Q A;  2WFC A;  4MZB A;  3IXR A;  3M1G A;  3F8U A;  4FO5 A;  3Q74 A;  1X0R A;  2YAN A;  3MSZ A;  5H5Q A;  1SL0 B;  1SJ6 A;  5C04 A;  5D93 A;  2ZCT A;  3U5R E;  1WWJ A;  2GTU A;  1TU7 A;  2HSH A;  4MJC A;  1OKT A;  3CYN A;  1VF3 A;  1QMV A;  4TW5 A;  5KOW A;  3J7Y b;  4KB3 A;  3H93 A;  4YQU A;  2LUS A;  5J9C A;  4XS4 B;  3GIX A;  2YNX A;  18GS A;  5DDL A;  4KSM A;  2UZ8 A;  3ZYW A;  3F4S A;  3GYK A;  3DKS A;  2XPE A;  4ZBD A;  4V2N A;  3HYP A;  3EMP A;  3TJK A;  3HXS A;  1T1V A;  3KP8 A;  4L5O A;  4X4J A;  4IW9 A;  2N5B A;  1I9D A;  2IME A;  2DJK A;  2P31 A;  2FUG 2;  1DSB A;  1ZYN A;  4NWY A;  2I1U A;  4TXO A;  6GSV A;  5J5N A;  1HNA A;  2H0H A;  1Y6E A;  1K0B A;  2H30 A;  5JWQ B;  1HYU A;  5ECK B;  3DGQ A;  1HD2 A;  4JZQ A;  1TOF A;  2EIQ A;  1GUH A;  4WKW A;  2NDO A;  4OFN A;  2JZR A;  2L5L A;  4KGI A;  1XZO A;  5D73 A;  3TGZ A;  3CQF A;  4V2L A;  3UOM A;  1SKR B;  4PXO A;  1K3Y A;  3FHK A;  3LGC A;  1LU4 A;  2V32 A;  2YWM A;  2L5O A;  1JZW A;  1NHY A;  2IFQ B;  3H79 A;  4K0N A;  1XVQ A;  1C72 A;  4N11 A;  1ML6 A;  4G0K A;  1K0N A;  4IS0 A;  1J0F A;  4KE3 A;  5BRT A;  4CW9 A;  1EZK A;  1PKW A;  4TR1 B;  2H6X A;  4GWR A;  3IV4 A;  4ILF A;  1JZR A;  2MMO A;  1GNW A;  3Q6O A;  3FEU A;  5DCH A;  1VGL A;  5KN2 A;  2FY6 A;  2H74 A;  1ABA A;  1WIK A;  2C1Y A;  1GNE A;  3KH9 A;  1TK0 B;  2ZUP A;  4AJ6 A;  5ENU A;  2D2Z A;  3IHQ A;  2C8U A;  1AAZ A;  2J9H A;  5CAX A;  4E8H A;  2FHE A;  5IM9 A;  5ECP B;  1FOV A;  1BQ7 A;  5ECR B;  1PL2 A;  1EEJ A;  3CSI A;  3GKX A;  1YKC A;  2OKA A;  1EGR A;  2RM5 A;  3GTU A;  2LRC A;  1ERU A;  2H72 A;  5A4V A;  6GSY A;  2LNT A;  2V1M A;  4IEL A;  4J57 E;  2TRX A;  1TK8 B;  2IN3 A;  1K0C A;  5DAK B;  2LRN A;  1AQV A;  1OKD A;  3ERG A;  2DMM A;  1QFN A;  2HI7 A;  1UC7 A;  4X0X A;  1M3J A;  2CVK A;  2H1B A;  3HHV A;  3HJO A;  1SKS B;  1T7P B;  1GUL A;  5G5E A;  4K8M A;  1Z3E A;  2YP6 A;  3DEX A;  5GST A;  2YOI A;  3RPN A;  4EXJ A;  4I2U A;  2DJ2 A;  1AC1 A;  3CTG A;  1WMJ A;  4Z2U A;  4ZIL A;  2NVL A;  4HQZ A;  4HSC X;  2HZE A;  2VD0 A;  1GRX A;  2YWN A;  2ALB A;  3UEM A;  2QGV A;  5ID2 A;  2M80 A;  2R3X A;  1PX6 A;  5E59 A;  1EV4 A;  4RI6 A;  2OBK A;  2IWT A;  4MZW A;  2B5Y A;  1A24 A;  4JR6 A;  1TW9 A;  4Z2R A;  4HEA 2;  3ZML A;  1TU8 A;  2KLX A;  1FVK A;  2GQM A;  5ECL B;  3WGE A;  2I4A A;  3BBY A;  4RQX A;  2PUK C;  3ED3 A;  5IMD A;  1X9W B;  5LNK e;  1S3R A;  1K0M A;  3TB2 A;  2LKU A;  1WOU A;  2VUP A;  4ECJ A;  3UAP A;  5IMA A;  5AIV A;  4NV5 A;  5D8I A;  3ZIV A;  1S3C A;  2REM A;  1T4Y A;  3GMF A;  4ZIJ A;  1DBY A;  1TI3 A;  3TJG A;  3D22 A;  5CO3 A;  1SJZ A;  2R37 A;  2KP1 A;  1ERT A;  2PN8 A;  5IMZ A;  1SYX A;  3F4R A;  1QXH A;  4EUY A;  3KEB A;  2R4V A;  5IOX A;  3TDG A;  1ACV A;  7GSS A;  3D21 A;  3M9K A;  2DKI A;  2LJR A;  1TTZ A;  4EIP A;  1ZL9 A;  3H8Q A;  3UBK A;  4XTS A;  4O5R A;  4HDE A;  1GUK A;  1FB0 A;  1SU9 A;  3GH9 A;  2CZ3 A;  1PL1 A;  1JLW A;  3IOS A;  4BVX A;  4YAP A;  2AHE A;  5J9B A;  2GZZ A;  3FYG A;  2X49 A;  3P90 A;  1XWA A;  1EOH A;  4MJB A;  4JU5 A;  3C1R A;  3QDN A;  3QPM A;  3APS A;  2I9H A;  2WUL A;  4I5Q A;  4XRA A;  1XIY A;  2WZ9 A;  2K8V A;  5CRW A;  2FNO A;  2B1K A;  3D4M A;  3A2W A;  3KP9 A;  1PFO A;  4ML1 A;  2QSI A;  1PQN A;  4IGJ A;  1MD3 A;  3LYK A;  2G2Q A;  3IPZ A;  4FYC A;  5GAP D;  3GFK A;  4X1U A;  1M9A A;  4DSR A;  3HVN A;  4A5P A;  4TR3 A;  3D0Z A;  5CRD A;  5IMF A;  3LW9 A;  1TRS A;  3HJM A;  3TKS E;  3FMW A;  3HJP A;  1V9W A;  3GKM A;  2FWG A;  1KNG A;  1XW9 A;  4ZB8 A;  1XVW A;  1U3I A;  1HQO A;  1X5C A;  4HOJ A;  1ZGN A;  1G6Y A;  3WGD A;  3ZTL A;  2GDR A;  3LWA A;  2GZP A;  4KND A;  3EC3 A;  5ID2 B;  3FZ9 A;  2H1G A;  3HVX A;  1PKZ A;  5ECS A;  3EMX A;  2DJ3 A;  3LYP A;  5DAL B;  2H6Y A;  5D9W A;  5BMU A;  3HDC A;  4MJE A;  3DYR A;  2DIY A;  5KOX A;  4LA1 A;  1CQH A;  3PIN A;  2AAW A;  3O3T A;  5B8B A;  4XIH A;  1UA5 A;  1YEX A;  3MWH A;  4TKY A;  3ZLP A;  3GH6 A;  4PNG A;  4IP1 A;  12GS A;  2NPB A;  5ELA A;  3U6V A;  1GTA A;  1PD2 1;  2IJY A;  2M72 A;  3ZFB A;  4TXV A;  1B4P A;  1X5D A;  4MDC A;  4IN0 A;  4GCI A;  2IIY A;  1Z9H A;  1GSQ A;  4HU9 A;  4POB A;  4NXI A;  1YZX A;  1YKA A;  4OFT A;  3F4T A;  1BYE A;  4N0Z A;  1O8X A;  1MDI A;  14GS A;  2CAI A;  3W6G A;  2XBQ A;  3L0H A;  2L6C A;  3IAS 2;  2EIO A;  4HZ4 A;  3W8S A;  2PVQ A;  5ELG A;  3IDV A;  5LD0 A;  3VLN A;  4POL A;  4DVC A;  1ZYE A;  1TRV A;  2GSS A;  5DJM A;  5H5R A;  2R5G A;  1F37 A;  3IA1 A;  3LSZ A;  3KM6 A;  4F0C A;  2VCZ A;  16GS A;  4F03 A;  5EVO A;  4GXZ A;  2CX3 A;  1QUW A;  4ZL7 A;  5KEJ A;  1IYH A;  2VOC A;  1FO5 A;  3FKF A;  1GSE A;  2H66 A;  4IJ3 A;  3UBL A;  2R2J A;  4BVY B;  2FA8 A;  4YKF A;  2C0F A;  3BD2 A;  4MPG A;  2O87 A;  1ERV A;  1IYI A;  2LJK A;  3L4N A;  1YQ1 A;  3FR3 A;  1SYR A;  5EL8 A;  2H73 A;  1O8W A;  2GZY A;  3FRC A;  3FK8 A;  4HU7 A;  1OC9 A;  1DUG A;  4MCU A;  4GF0 A;  1MTC A;  4N0V A;  4RUV A;  1ZOF A;  2VO4 A;  1TP9 A;  1R26 A;  2KP2 A;  4PNF A;  4MNN A;  1PX7 A;  2MMZ A;  1UVZ A;  2H19 A;  4PUF C;  5IIZ A;  3DRN A;  4MK3 A;  1JHB A;  2BTO T;  4I6X A;  1LJR A;  2G0F A;  2MBS A;  4GQF A;  1GSF A;  4WEY A;  2HYX A;  8GSS A;  5LCZ A;  5HQP A;  1SJI A;  2FWH A;  2IMD A;  3FW2 A;  3CRT A;  2WRT A;  1PA3 A;  3TKQ A;  1E6B A;  1X9M B;  4HJ2 A;  2B1L A;  4K5S A;  6GST A;  4ECC A;  4G0I A;  4XRD A;  2HSY A;  5IQY A;  1FHE A;  2A2S A;  1YF0 A;  1Z7R A;  1A2M A;  2VCQ A;  5JWO B;  2AJQ B;  2QA1 A;  4DSS A;  5CNW A;  5DQS A;  4MF5 A;  3J7Y k;  1ZYP A;  1H4O A;  5CRG A;  2IPA A;  2F8F A;  4AGS A;  2KOK A;  2V6O A;  2IMK A;  4XCS A;  2VCT A;  2LV3 A;  4GQC A;  1J9B A;  1QGV A;  1SK2 A;  4K9Z A;  4CY8 A;  3I9V 2;  5AN1 A;  4I97 A;  3KGK A;  3EVI A;  2F51 A;  2H1D A;  2WS2 A;  2FLS A;  3DIE A;  2AV4 A;  3GUR A;  2LS5 A;  4WF5 A;  2VLT A;  1R7H A;  2JU5 A;  4BIK A;  1A0F A;  3HA9 A;  3O76 A;  3L9S A;  2YZU A;  2TIR A;  3TJJ A;  4O92 A;  4EKZ A;  4KDU A;  4F9Z A;  5D96 A;  1O85 A;  1N8J A;  4BWQ A;  4TOP A;  4PUR A;  3M0F A;  2FGX A;  1XG8 A;  3QOU A;  4WBR D;  4ICY A;  4WXT A;  5IMV A;  3FZ4 A;  5JCU A;  4L0U A;  4OD7 A;  1TXX A;  2E7P A;  5FWG A;  2R6K A;  2NBS A;  4G19 A;  4HJM A;  2LJA A;  3H4K A;  2VAF A;  4HQS A;  2JSZ A;  1G7O A;  1EV9 A;  1SL1 B;  5F07 A;  5EY6 A;  1JZD A;  4WF4 A;  4GSN A;  1FAA A;  3VI5 A;  3CMI A;  3KTB A;  4MH3 A;  5AGY A;  2DJJ A;  2L59 A;  2L57 A;  2VM2 A;  4XS1 A;  4JBB A;  2A4H A;  1B48 A;  4KCA A;  4NV2 A;  4MLY A;  1GUM A;  3R2Q A;  1XOA A;  4PUA A;  1XFL A;  2HZF A;  2MBT A;  1GTI A;  1ZCP A;  5G1L A;  5DVB A;  2B5E A;  5G1K A;  3Q18 A;  2OBI A;  4Q5Q A;  3QAV A;  3VWX A;  1GWC A;  5A4W A;  5C00 A;  1WPI A;  2DLX A;  3F0I A;  1G7E A;  1R5A A;  4N10 A;  5IO2 A;  1GL8 A;  4KDX A;  2GVP A;  4QQ7 A;  3VPQ A;  1F3B A;  4TN8 A;  5L71 A;  4DEJ A;  3LXT A;  3KZQ A;  3H1N A;  3SWL A;  1USB A;  3QR6 A;  4BL7 A;  1M9B A;  2CVD A;  2R0C A;  4FH8 A;  2P0G A;  2GST A;  3EE2 A;  3FZA A;  4J56 E;  3BJ5 A;  1ZZY A;  4IP6 A;  2YN1 A;  2J23 A;  4PGT A;  1PGT A;  3PGT A;  4ZB6 A;  2XBI A;  5HFG A;  4D73 A;  2H8L A;  1F9M A;  4Z2T A;  5KN1 A;  2YWO A;  3VWU A;  3KIJ A;  2IMI A;  2BMX A;  5B7C A;  2JSY A;  5DQY A;  3F3Q A;  4POK A;  1N2A A;  4TXO B;  2HRF A;  1HNB A;  4ZXG A;  4AF2 A;  4YKG A;  2R0G A;  2HRA A;  3CRU A;  2YJ7 A;  1T3B A;  1XPV A;  3QMX A;  1K0D A;  1XXU A;  1VRS D;  4EF0 A;  2H76 A;  4YQM A;  5ABR A;  1T4Z A;  3ZMK A;  2FA4 A;  4L0W A;  2HXK A;  3ZVJ A;  5D9X A;  3ME7 A;  4F0B A;  2K6V A;  2CV4 A;  3GNJ A;  4EDZ A;  2A2R A;  1OC8 A;  5KN0 A;  2ON5 A;  2A4V A;  2ZNM A;  19GS A;  3ZFL A;  1M0U A;  3ERW A;  4ACS A;  2HLS A;  3UAR A;  4HZ2 A;  4LLR A;  1SEN A;  4O32 A;  3IAM 2;  2R0P A;  4EO3 A;  3GX8 A;  2X4A A;  3MDK A;  2RM6 A;  3ZIJ A;  3TOU A;  3UIW A;  3KTL A;  4IBP A;  4KX4 A;  1WJK A;  2N5A A;  2H0G A;  3M9J A;  2KHP A;  3TRP A;  1YF1 A;  3RHC A;  3DWV A;  1G6W A;  1XWB A;  4K7I A;  3V1W A;  1I5G A;  1BAY A;  20GS A;  2X64 A;  3A2X A;  5A4U A;  4TVE A;  1M99 A;  1U3A A;  2MZC A;  3LOR A;  1M7T A;  5ECI B;  4ULX A;  1A23 A;  3D5J A;  2MYG A;  2QA2 A;  4RQR A;  2L4Q A;  1AXD A;  4NHW A;  3IC4 A;  1TJD A;  1T00 A;  2YJH A;  2F8A A;  1MDK A;  3GTU B;  4KA0 A;  3CXG A;  3TRX A;  4YH2 A;  3DVX A;  1R5P A;  1JFU A;  4IJI A;  2JAC A;  1QQ2 A;  1GTU A;  1BX9 A;  2HNL A;  4ECB A;  2FWE A;  1M2D A;  1PRX A;  1B4Q A;  3RHB A;  4FYB A;  2IMF A;  2XHF A;  4Q5F A;  5GSS A;  5DBQ A;  3QFB C;  4OFM A;  1XWG A;  3GN3 A;  2FCH A;  3MAK A; 
#chains in the Genus database with same CATH homology
 2QC7 A;  5GAN D;  2HZE B;  4IVF A;  4OO5 A;  3UJ1 A;  1G0T A;  1FW1 A;  5D9V A;  4XS4 A;  2CVB A;  3F3R A;  5COH A;  2OJL A;  4BL7 B;  5HFK A;  3EIN A;  4ML6 A;  2VM1 A;  4TR4 A;  1R4W A;  2LST A;  1SK1 A;  3FZ5 A;  3QFA C;  2WDU A;  4IKH A;  2VLV A;  3EU3 A;  3US3 A;  5ECO B;  3LJR A;  3HCZ A;  1U87 A;  4LMV A;  4KDY A;  2LRT A;  3D4T A;  4K1F A;  2VCW A;  1OVN A;  2C80 A;  4EC0 A;  4KH7 A;  1EP8 A;  1BED A;  3LEF A;  3A5W A;  1AUC A;  4MF6 A;  3GST A;  1O7U A;  4GTU A;  4PQH A;  5JCG A;  1B9Y C;  2LEG A;  5G5F A;  1BJX A;  3NZN A;  4EL1 A;  2HRN A;  3GKK A;  2DJ0 A;  2WB9 A;  2GLR A;  3WT1 A;  3ERF A;  2BJX A;  4WR4 A;  5CRE A;  2PER A;  5CYY A;  4Z7X A;  5IOW A;  1TK5 B;  4G2E A;  2LNS A;  3VFI A;  2DJ1 A;  4K7N A;  4O5U A;  5IO0 A;  2XC2 A;  9GSS A;  2X8C A;  5J4U A;  3CTF A;  5ECM B;  3A5I A;  2IFQ A;  3FR9 A;  4V1A p;  1K3L A;  2F9S A;  1V98 A;  1F2E A;  4KF9 A;  3UVH A;  3HKR A;  2H6Z A;  4P3Y B;  2MMA A;  2I3Y A;  2KUC A;  2RUE A;  2EC4 A;  2M46 A;  4ECI A;  1PN0 A;  3N9J A;  4TR1 A;  3TJB A;  1V2A A;  1XWK A;  2YPM A;  2YWI A;  1NM3 A;  4F82 A;  1E2Y A;  3TCO A;  5AIS A;  1A8L A;  1VF2 A;  2FWF A;  2GQL A;  1YJ6 A;  1VF1 A;  1JZO A;  5JCW A;  2B7K A;  4ZL8 A;  4BVX B;  3VWV A;  4HUA A;  3KMN A;  2V6K A;  4L8E A;  2O85 A;  4K7O A;  2VLU A;  3I6A A;  4GLT A;  3CBU A;  4ISD A;  1S3A A;  3GL3 A;  2L4C A;  1W4V A;  2GGT A;  1XCC A;  4L5L A;  4PX1 A;  4FIW A;  3EUR A;  2PWJ A;  3KCM A;  2DML A;  5IMC A;  3G7J A;  1WE0 A;  1V57 A;  1PN9 A;  5DCG A;  2GSQ A;  3W8J A;  2DIZ A;  3TKS C;  1A2L A;  1XW6 A;  4K6X A;  3RAZ A;  3APQ A;  2HFD A;  2GT5 A;  1SD8 A;  3TOT A;  2JZS A;  2A2P A;  3CSH A;  5F05 A;  1JLV A;  2H1A A;  5F0G A;  1K0A A;  3GSS A;  3GRX A;  1VF4 A;  2V2G A;  2I81 A;  3LG6 A;  4MJA A;  1KTE A;  1EP7 A;  3MYD A;  1M2B A;  3EPT A;  2B5X A;  4GST A;  4FYU A;  4YAV A;  2RUF A;  1EEM A;  2VL2 C;  5HR3 A;  3IK9 A;  2N5F A;  1B9X C;  1HNC A;  3LXZ A;  5IPH A;  13GS A;  4WR5 A;  4GRF A;  3GL5 A;  2AB6 A;  3CSJ A;  3HY2 A;  1H75 A;  3F6F A;  3M3M A;  1Q4J A;  5E4W A;  3I43 A;  3JCM L;  5J3R A;  3WGX A;  1OYJ A;  3BOA A;  1TRU A;  1GTB A;  3KH7 A;  2P5R A;  1A0R P;  3KJY A;  2B3S A;  4AJ8 A;  4NPB A;  3UMA A;  1J08 A;  3G7Y A;  2L6D A;  2YZH A;  4HI7 A;  5GZZ B;  4MPF A;  2VCX A;  3F63 A;  3ZVJ D;  4RI7 A;  4IHU A;  5EPF A;  1Z7P A;  3KXO A;  4BWS A;  1SKW B;  4NMU A;  2X99 A;  4G0L A;  17GS A;  2FD3 A;  2TRC P;  1TI1 A;  4ZB9 A;  2GT6 A;  5KN3 A;  1XOB A;  1OC3 A;  4E8E A;  1X9S B;  6GSS A;  3PH9 A;  2V41 A;  2X8G A;  1DE2 A;  3NOF A;  4X43 A;  1GSD A;  3UL3 A;  3G9B A;  3LQ7 A;  2DBC A;  5DJL A;  3L78 A;  1GSY A;  3AY8 A;  1KEB A;  5HFI A;  4HS1 A;  2CAQ A;  5ECQ B;  2H0I A;  2LTK A;  1K0O A;  2XPD A;  3RDW A;  5HR1 A;  3ZL5 A;  6GSX A;  3KMO A;  4GSS A;  3N5O A;  1GLQ A;  4JE1 A;  2CQ9 A;  3GUS A;  3C8E A;  2OE1 A;  4EVM A;  1URM A;  2NTO A;  1TKD B;  2ON7 A;  1WP0 A;  3IRA A;  2EIR A;  4G10 A;  2PMT A;  4AJ7 A;  2DKH A;  5AIX A;  1EGO A;  3QD9 A;  3P7X A;  1OAZ A;  3OR5 A;  1AIU A;  4MMM A;  1RW1 A;  4OCE A;  2HE3 A;  1NSW A;  5A5K A;  3HVV A;  1NHO A;  5G30 A;  1OC9 B;  4MAB A;  4YQV A;  3IE3 A;  1QK8 A;  3L9V A;  4I8B A;  2O8V B;  4MH2 A;  1TRW A;  2GS3 A;  2PGT A;  2K18 A;  5FHI A;  2B7J A;  2C4J A;  2C0D A;  2CT6 A;  3F9U A;  4ZBB A;  1PMT A;  1GLP A;  4V1A g;  2H70 A;  1YDK A;  2GQK A;  3E9J B;  2MMN A;  1MD4 A;  3VK9 A;  3HD5 A;  2VIM A;  2DSA A;  4OWY A;  1A2J A;  4KAE A;  1CQG A;  4EIQ A;  4WBJ A;  4ZL9 A;  3APO A;  3C71 A;  3E3E A;  4DSS B;  1SD9 A;  3S9F A;  3QAG A;  3IBH A;  5B8A A;  5DAL A;  1ST9 A;  4K2X A;  3MNG A;  4BA7 A;  1T8E B;  1UN2 A;  2GSR A;  1THO A;  4IQA A;  4J2F A;  3GKN A;  3C7M A;  5D9T A;  4JED A;  1EWX A;  4BPY A;  4CY6 A;  10GS A;  1ZYQ B;  1M2A A;  2JAD A;  1AW9 A;  3I69 A;  1GSU A;  4QL7 A;  4O5Q A;  3BCI A;  3WT2 A;  4K0G A;  2CZ2 A;  3KD0 A;  1EOG A;  2PBJ A;  4TR0 A;  2O89 A;  2K8S A;  6GSU A;  4ZBA A;  3NIV A;  4CHS A;  2VL9 A;  2E0Q A;  1X5E A;  3P8W A;  1PSQ A;  3RPP A;  3TKP A;  1A8Y A;  2RII A;  3SBC A;  1GH2 A;  1O73 A;  2WCI A;  2CA8 A;  5G2Z A;  3HZ8 A;  3M8N A;  1Y25 A;  1ILO A;  3L9U A;  3RBT A;  3ZRE A;  3DXB A;  4NHZ A;  4MF7 A;  4ID0 A;  2DC5 A;  3GHA A;  5IPG A;  3GV1 A;  2C3Q A;  3TRQ A;  2VD1 A;  1XWC A;  1BG5 A;  4Q5R A;  3EWL A;  6GSW A;  3IK7 A;  4JRR A;  3UVT A;  2AUV A;  1AQX A;  2VCV A;  4V2M A;  2F3M A;  3WYW A;  5F8B A;  3GA4 A;  2B6M A;  4WET A;  4QL9 A;  5F06 A;  4BVY A;  1Z5Y E;  2OAC A;  4LL1 B;  1U88 A;  2AYT A;  3VUR A;  2OE0 A;  4TRX A;  1SL2 B;  1OE8 A;  2WJU A;  4PQI A;  4USS A;  1Q98 A;  3FY7 A;  3HVS A;  1RQM A;  3DML A;  4MZC A;  3LFL A;  3DD3 A;  2IL3 A;  5HR2 A;  3K8N A;  2LQQ A;  2YCD A;  4KSO A;  2HRK A;  4K2D A;  3ZIT A;  2WGR A;  3ME8 A;  3O6T A;  2O7K A;  4JR4 A;  4F2I A;  3TKR A;  3VPT A;  1ON4 A;  3ISO A;  1Z6M A;  3C1S A;  2H75 A;  2C0E A;  4FQU A;  4OO4 A;  4NAX A;  3QCP A;  4MA9 A;  1B8X A;  1ZMA A;  3Q19 A;  5B6N A;  4G9H A;  1KBN A;  3BCK A;  3TKS A;  3A3T A;  2OAD A;  1GSS A;  3TJF A;  5JWR B;  4O7H A;  1ERW A;  1FVJ A;  3VI7 A;  1GP1 A;  3VWW A;  2OA7 A;  1F6M C;  4D73 B;  1O6J A;  3ZRD A;  3DVW A;  3PR8 A;  5CP1 A;  3E0U A;  2PU9 C;  3D6I A;  1W89 A;  1YEP A;  1XBS A;  11GS A;  1FB6 A;  3EU4 A;  3P2A A;  4IQ1 A;  4LMW A;  1RK4 A;  2VL2 A;  1O81 A;  1THX A;  1WRY A;  4CDO A;  1FG4 A;  4KW6 A;  1YY7 A;  4OCF A;  3GX0 A;  2C3T A;  2HSM A;  2LQO A;  4KCE A;  1MDJ A;  1F3A A;  2PVO C;  4H86 A;  5ECH B;  1V58 A;  3PPU A;  1AQW A;  2Z9S A;  5INY A;  4KUN A;  2H01 A;  1S3D A;  3R3E A;  4I2T A;  5B6M A;  1XW5 A;  2YV9 A;  1U6T A;  5ECN B;  2H71 A;  2E2M A;  2VL3 A;  5H5S A;  4EE0 A;  1SK0 A;  2X8H A;  2QKE A;  4DSQ A;  3WD6 A;  2OE3 A;  1V40 A;  4XHM A;  1TDI A;  4Q5N A;  3EYT A;  3IHG A;  3FR6 A;  3G7I A;  3C73 A;  3F6D A;  3HZ4 A;  1MEK A;  2PPT A;  4N30 A;  4PQ1 A;  5HR0 A;  22GS A;  4EDY A;  1Z6N A;  2HT9 A;  1NW2 A;  2CX4 A;  2K9F A;  2JZT A;  4LL4 B;  4XS6 A;  3MIX A;  4K5R A;  3A2V A;  3IC8 A;  2E2G A;  3ZZX A;  5J41 A;  1OE7 A;  2YV7 A;  3QAW A;  5FT3 A;  4OMV A;  3IR4 A;  1DE1 A;  2RLI A;  4PTS A;  5G31 A;  3TUE A;  5CRH A;  4MP4 A;  5DAK A;  2C3N A;  2ES7 A;  4POM A;  1LBK A;  1FOH A;  1K3O A;  2C0G A;  2JL4 A;  2P5Q A;  2WFC A;  4MZB A;  3IXR A;  3M1G A;  3F8U A;  4FO5 A;  3Q74 A;  1X0R A;  2YAN A;  3MSZ A;  5H5Q A;  1SL0 B;  1SJ6 A;  5C04 A;  5D93 A;  2ZCT A;  3U5R E;  1WWJ A;  2GTU A;  1TU7 A;  2HSH A;  4MJC A;  1OKT A;  3CYN A;  1VF3 A;  1QMV A;  4TW5 A;  5KOW A;  3J7Y b;  4KB3 A;  3H93 A;  4YQU A;  2LUS A;  5J9C A;  4XS4 B;  3GIX A;  2YNX A;  18GS A;  5DDL A;  4KSM A;  2UZ8 A;  3ZYW A;  3F4S A;  3GYK A;  3DKS A;  2XPE A;  4ZBD A;  4V2N A;  3HYP A;  3EMP A;  3TJK A;  3HXS A;  1T1V A;  3KP8 A;  4L5O A;  4X4J A;  4IW9 A;  2N5B A;  1I9D A;  2IME A;  2DJK A;  2P31 A;  2FUG 2;  1DSB A;  1ZYN A;  4NWY A;  2I1U A;  4TXO A;  6GSV A;  5J5N A;  1HNA A;  2H0H A;  1Y6E A;  1K0B A;  2H30 A;  5JWQ B;  1HYU A;  5ECK B;  3DGQ A;  1HD2 A;  4JZQ A;  1TOF A;  2EIQ A;  1GUH A;  4WKW A;  2NDO A;  4OFN A;  2JZR A;  2L5L A;  4KGI A;  1XZO A;  5D73 A;  3TGZ A;  4V2L A;  3UOM A;  1SKR B;  4PXO A;  1K3Y A;  3FHK A;  3LGC A;  1LU4 A;  2V32 A;  2YWM A;  2L5O A;  1JZW A;  1NHY A;  2IFQ B;  3H79 A;  4K0N A;  1XVQ A;  1C72 A;  4N11 A;  1ML6 A;  4G0K A;  1K0N A;  4IS0 A;  1J0F A;  4KE3 A;  5BRT A;  4CW9 A;  1EZK A;  1PKW A;  4TR1 B;  2H6X A;  4GWR A;  3IV4 A;  4ILF A;  1JZR A;  2MMO A;  1GNW A;  3Q6O A;  3FEU A;  5DCH A;  1VGL A;  5KN2 A;  2FY6 A;  2H74 A;  1ABA A;  1WIK A;  2C1Y A;  1GNE A;  3KH9 A;  1TK0 B;  2ZUP A;  4AJ6 A;  5ENU A;  2D2Z A;  3IHQ A;  2C8U A;  1AAZ A;  2J9H A;  5CAX A;  4E8H A;  2FHE A;  5IM9 A;  5ECP B;  1FOV A;  1BQ7 A;  5ECR B;  1PL2 A;  1EEJ A;  3CSI A;  3GKX A;  1YKC A;  2OKA A;  1EGR A;  2RM5 A;  3GTU A;  2LRC A;  1ERU A;  2H72 A;  5A4V A;  6GSY A;  2LNT A;  2V1M A;  4IEL A;  4J57 E;  2TRX A;  1TK8 B;  2IN3 A;  1K0C A;  5DAK B;  2LRN A;  1AQV A;  1OKD A;  3ERG A;  2DMM A;  1QFN A;  2HI7 A;  1UC7 A;  4X0X A;  2CVK A;  2H1B A;  3HHV A;  3HJO A;  1SKS B;  1T7P B;  1GUL A;  5G5E A;  4K8M A;  1Z3E A;  2YP6 A;  3DEX A;  5GST A;  2YOI A;  3RPN A;  4EXJ A;  4I2U A;  2DJ2 A;  1AC1 A;  3CTG A;  1WMJ A;  4Z2U A;  4ZIL A;  2NVL A;  4HQZ A;  2HZE A;  2VD0 A;  1GRX A;  2YWN A;  2ALB A;  3UEM A;  2QGV A;  5ID2 A;  2M80 A;  2R3X A;  1PX6 A;  5E59 A;  1EV4 A;  4RI6 A;  2OBK A;  2IWT A;  4MZW A;  2B5Y A;  1A24 A;  4JR6 A;  1TW9 A;  4Z2R A;  4HEA 2;  3ZML A;  1TU8 A;  2KLX A;  1FVK A;  2GQM A;  5ECL B;  3WGE A;  2I4A A;  3BBY A;  4RQX A;  2PUK C;  3ED3 A;  5IMD A;  1X9W B;  5LNK e;  1K0M A;  3TB2 A;  2LKU A;  1WOU A;  2VUP A;  4ECJ A;  3UAP A;  5IMA A;  5AIV A;  4NV5 A;  5D8I A;  3ZIV A;  1S3C A;  2REM A;  1T4Y A;  3GMF A;  4ZIJ A;  1DBY A;  1TI3 A;  3TJG A;  3D22 A;  5CO3 A;  1SJZ A;  2R37 A;  2KP1 A;  1ERT A;  2PN8 A;  5IMZ A;  1SYX A;  3F4R A;  1QXH A;  4EUY A;  3KEB A;  2R4V A;  5IOX A;  3TDG A;  1ACV A;  7GSS A;  3D21 A;  3M9K A;  2DKI A;  2LJR A;  1TTZ A;  4EIP A;  1ZL9 A;  3H8Q A;  3UBK A;  4XTS A;  4O5R A;  4HDE A;  1GUK A;  1FB0 A;  1SU9 A;  3GH9 A;  2CZ3 A;  1PL1 A;  1JLW A;  3IOS A;  4BVX A;  4YAP A;  2AHE A;  5J9B A;  2GZZ A;  3FYG A;  2X49 A;  3P90 A;  1XWA A;  1EOH A;  4MJB A;  4JU5 A;  3C1R A;  3QDN A;  3QPM A;  3APS A;  2I9H A;  2WUL A;  4I5Q A;  4XRA A;  1XIY A;  2WZ9 A;  2K8V A;  5CRW A;  2FNO A;  2B1K A;  3D4M A;  3A2W A;  3KP9 A;  4ML1 A;  2QSI A;  1PQN A;  4IGJ A;  1MD3 A;  3LYK A;  2G2Q A;  3IPZ A;  4FYC A;  5GAP D;  3GFK A;  4X1U A;  1M9A A;  4DSR A;  4A5P A;  4TR3 A;  3D0Z A;  5CRD A;  5IMF A;  3LW9 A;  1TRS A;  3HJM A;  3TKS E;  3FMW A;  3HJP A;  1V9W A;  3GKM A;  2FWG A;  1KNG A;  1XW9 A;  4ZB8 A;  1XVW A;  1U3I A;  1HQO A;  1X5C A;  4HOJ A;  1ZGN A;  1G6Y A;  3WGD A;  3ZTL A;  2GDR A;  3LWA A;  2GZP A;  4KND A;  3EC3 A;  5ID2 B;  3FZ9 A;  2H1G A;  3HVX A;  1PKZ A;  5ECS A;  3EMX A;  2DJ3 A;  3LYP A;  5DAL B;  2H6Y A;  5D9W A;  5BMU A;  3HDC A;  4MJE A;  3DYR A;  2DIY A;  5KOX A;  4LA1 A;  1CQH A;  3PIN A;  2AAW A;  3O3T A;  5B8B A;  4XIH A;  1UA5 A;  1YEX A;  3MWH A;  4TKY A;  3ZLP A;  3GH6 A;  4PNG A;  4IP1 A;  12GS A;  2NPB A;  5ELA A;  3U6V A;  1GTA A;  1PD2 1;  2IJY A;  2M72 A;  3ZFB A;  4TXV A;  1B4P A;  1X5D A;  4MDC A;  4IN0 A;  4GCI A;  2IIY A;  1Z9H A;  1GSQ A;  4HU9 A;  4POB A;  4NXI A;  1YZX A;  1YKA A;  4OFT A;  3F4T A;  1BYE A;  4N0Z A;  1O8X A;  1MDI A;  14GS A;  2CAI A;  3W6G A;  2XBQ A;  3L0H A;  2L6C A;  3IAS 2;  2EIO A;  4HZ4 A;  3W8S A;  2PVQ A;  5ELG A;  3IDV A;  5LD0 A;  3VLN A;  4POL A;  4DVC A;  1ZYE A;  1TRV A;  2GSS A;  5DJM A;  5H5R A;  2R5G A;  1F37 A;  3IA1 A;  3LSZ A;  3KM6 A;  4F0C A;  2VCZ A;  16GS A;  4F03 A;  5EVO A;  4GXZ A;  2CX3 A;  1QUW A;  4ZL7 A;  5KEJ A;  1IYH A;  2VOC A;  1FO5 A;  3FKF A;  1GSE A;  2H66 A;  4IJ3 A;  3UBL A;  2R2J A;  4BVY B;  2FA8 A;  4YKF A;  2C0F A;  3BD2 A;  4MPG A;  2O87 A;  1ERV A;  1IYI A;  2LJK A;  3L4N A;  1YQ1 A;  3FR3 A;  1SYR A;  5EL8 A;  2H73 A;  1O8W A;  2GZY A;  3FRC A;  3FK8 A;  4HU7 A;  1OC9 A;  1DUG A;  4MCU A;  4GF0 A;  1MTC A;  4N0V A;  4RUV A;  1ZOF A;  2VO4 A;  1TP9 A;  1R26 A;  2KP2 A;  4PNF A;  4MNN A;  1PX7 A;  2MMZ A;  1UVZ A;  2H19 A;  4PUF C;  5IIZ A;  3DRN A;  4MK3 A;  1JHB A;  2BTO T;  4I6X A;  1LJR A;  2G0F A;  2MBS A;  4GQF A;  1GSF A;  4WEY A;  2HYX A;  8GSS A;  5LCZ A;  5HQP A;  1SJI A;  2FWH A;  2IMD A;  3FW2 A;  3CRT A;  2WRT A;  1PA3 A;  3TKQ A;  1E6B A;  1X9M B;  4HJ2 A;  2B1L A;  4K5S A;  6GST A;  4ECC A;  4G0I A;  4XRD A;  2HSY A;  5IQY A;  1FHE A;  2A2S A;  1YF0 A;  1Z7R A;  1A2M A;  2VCQ A;  5JWO B;  2AJQ B;  2QA1 A;  4DSS A;  5CNW A;  5DQS A;  4MF5 A;  3J7Y k;  1ZYP A;  1H4O A;  5CRG A;  2IPA A;  2F8F A;  4AGS A;  2KOK A;  2V6O A;  2IMK A;  4XCS A;  2VCT A;  2LV3 A;  4GQC A;  1J9B A;  1QGV A;  1SK2 A;  4K9Z A;  4CY8 A;  3I9V 2;  5AN1 A;  4I97 A;  3KGK A;  3EVI A;  2F51 A;  2H1D A;  2WS2 A;  2FLS A;  3DIE A;  2AV4 A;  3GUR A;  2LS5 A;  4WF5 A;  2VLT A;  1R7H A;  2JU5 A;  1A0F A;  3HA9 A;  3O76 A;  3L9S A;  2YZU A;  2TIR A;  3TJJ A;  4O92 A;  4EKZ A;  4KDU A;  4F9Z A;  5D96 A;  1O85 A;  1N8J A;  4BWQ A;  4TOP A;  4PUR A;  3M0F A;  2FGX A;  3QOU A;  4WBR D;  4ICY A;  4WXT A;  5IMV A;  3FZ4 A;  5JCU A;  4L0U A;  4OD7 A;  1TXX A;  2E7P A;  5FWG A;  2R6K A;  2NBS A;  4G19 A;  4HJM A;  2LJA A;  3H4K A;  2VAF A;  4HQS A;  2JSZ A;  1G7O A;  1EV9 A;  1SL1 B;  5F07 A;  5EY6 A;  1JZD A;  4WF4 A;  4GSN A;  1FAA A;  3VI5 A;  3CMI A;  3KTB A;  4MH3 A;  5AGY A;  2DJJ A;  2L59 A;  2L57 A;  2VM2 A;  4XS1 A;  4JBB A;  2A4H A;  1B48 A;  4KCA A;  4NV2 A;  4MLY A;  1GUM A;  3R2Q A;  1XOA A;  4PUA A;  1XFL A;  2HZF A;  2MBT A;  1GTI A;  1ZCP A;  5G1L A;  5DVB A;  2B5E A;  5G1K A;  3Q18 A;  2OBI A;  4Q5Q A;  3QAV A;  3VWX A;  1GWC A;  5A4W A;  5C00 A;  1WPI A;  2DLX A;  3F0I A;  1G7E A;  1R5A A;  4N10 A;  5IO2 A;  1GL8 A;  4KDX A;  2GVP A;  4QQ7 A;  3VPQ A;  1F3B A;  4TN8 A;  5L71 A;  4DEJ A;  3LXT A;  3KZQ A;  3H1N A;  3SWL A;  1USB A;  3QR6 A;  4BL7 A;  1M9B A;  2CVD A;  2R0C A;  4FH8 A;  2P0G A;  2GST A;  3EE2 A;  3FZA A;  4J56 E;  3BJ5 A;  1ZZY A;  4IP6 A;  2YN1 A;  2J23 A;  4PGT A;  1PGT A;  3PGT A;  4ZB6 A;  2XBI A;  5HFG A;  4D73 A;  2H8L A;  1F9M A;  4Z2T A;  5KN1 A;  2YWO A;  3VWU A;  3KIJ A;  2IMI A;  2BMX A;  5B7C A;  2JSY A;  5DQY A;  3F3Q A;  4POK A;  1N2A A;  4TXO B;  2HRF A;  1HNB A;  4ZXG A;  4AF2 A;  4YKG A;  2R0G A;  2HRA A;  3CRU A;  2YJ7 A;  1T3B A;  1XPV A;  3QMX A;  1K0D A;  1XXU A;  1VRS D;  4EF0 A;  2H76 A;  4YQM A;  5ABR A;  1T4Z A;  3ZMK A;  2FA4 A;  4L0W A;  2HXK A;  3ZVJ A;  5D9X A;  3ME7 A;  4F0B A;  2K6V A;  2CV4 A;  3GNJ A;  4EDZ A;  2A2R A;  1OC8 A;  5KN0 A;  2ON5 A;  2A4V A;  2ZNM A;  19GS A;  3ZFL A;  1M0U A;  3ERW A;  4ACS A;  2HLS A;  3UAR A;  4HZ2 A;  4LLR A;  1SEN A;  4O32 A;  3IAM 2;  2R0P A;  4EO3 A;  3GX8 A;  2X4A A;  3MDK A;  2RM6 A;  3ZIJ A;  3TOU A;  3UIW A;  3KTL A;  4IBP A;  4KX4 A;  1WJK A;  2N5A A;  2H0G A;  3M9J A;  2KHP A;  3TRP A;  1YF1 A;  3RHC A;  3DWV A;  1G6W A;  1XWB A;  4K7I A;  3V1W A;  1I5G A;  1BAY A;  20GS A;  2X64 A;  3A2X A;  5A4U A;  4TVE A;  1M99 A;  1U3A A;  2MZC A;  3LOR A;  1M7T A;  5ECI B;  4ULX A;  1A23 A;  3D5J A;  2MYG A;  2QA2 A;  4RQR A;  2L4Q A;  1AXD A;  4NHW A;  3IC4 A;  1TJD A;  1T00 A;  2YJH A;  2F8A A;  1MDK A;  3GTU B;  4KA0 A;  3CXG A;  3TRX A;  4YH2 A;  3DVX A;  1R5P A;  1JFU A;  4IJI A;  2JAC A;  1QQ2 A;  1GTU A;  1BX9 A;  2HNL A;  4ECB A;  2FWE A;  1M2D A;  1PRX A;  1B4Q A;  3RHB A;  4FYB A;  2IMF A;  2XHF A;  4Q5F A;  5GSS A;  5DBQ A;  3QFB C;  4OFM A;  1XWG A;  3GN3 A;  2FCH A;  3MAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...