4PQ1A

Crystal structure and functional implications of a dsbf homologue from corynebacterium diphtheriae
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
157
structure length
157
Chain Sequence
GTFQFHSPGGKTEIFYDEGERAPVSEIRGEGLTSDSVSLADYKDKIVVLNAWGQWCAPCRSESDDLQEVHEYLGDKGTVVGINVRDYSKNIAQDFVKDNGITYPSIYDPPFKTAAQLGGVPASVVPTTIVLDKQHRPAAVFLREVTAQDLIKVIDSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative electron transport related protein
publication title Structure of a DsbF homologue from Corynebacterium diphtheriae
doi rcsb
source organism Corynebacterium diphtheriae
total genus 49
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4pq1A01
3UJ1A 1S3AA 1NHYA 2DJ3A 4KDXA 2KOKA 5JWQB 4QL7A 2MBTA 2H19A 3KP9A 3IAM2 3LSZA 3QR6A 4OWYA 2B5XA 2IN3A 3UIWA 3TKSE 2CT6A 4OFNA 4WF4A 1EGRA 2WCIA 3GV1A 2WZ9A 1TOFA 2B5YA 5A4WA 1JZWA 3L9SA 2FA8A 1A23A 3LYPA 4KCAA 3RAZA 3ZYWA 3FHKA 4WR5A 1GH2A 3O3TA 4IS0A 1X9WB 1EEMA 5JCWA 1Y6EA 4MLYA 3CRUA 5HFGA 4PGTA 1OE7A 4YAPA 2IMEA 4TR0A 5GAND 5HFKA 1USBA 3ME8A 2R3XA 1YEXA 2CA8A 1TI3A 2RM6A 3G7JA 4MJEA 2CV4A 1QFNA 2KP1A 1K0DA 1QUWA 1AAZA 2HLSA 4ZL7A 4IQAA 2F51A 4JRRA 2FCHA 2OBIA 2HRNA 4YQVA 2R37A 3TJKA 3H8QA 4GSTA 1QGVA 2DIZA 2AV4A 2GTUA 4J56E 2CX3A 5IMVA 4V2NA 4K2DA 1X5DA 2F3MA 1GUHA 1SJZA 3HY2A 2AHEA 5FT3A 5IQYA 2VLVA 3GH9A 4L5OA 1YKCA 2C3NA 6GSXA 3FY7A 4FYCA 3KTLA 1XFLA 2X8CA 4EDZA 5EL8A 4DSRA 4KSMA 2Z9SA 5A4UA 3FZ5A 2FWEA 5ECPB 4E8EA 4F82A 1YQ1A 3P90A 1XW9A 1TP9A 5DALA 4ZBBA 3L0HA 5CRWA 3DGQA 1Y25A 3PINA 3Q18A 4MF7A 1THOA 2K18A 5CYYA 2NTOA 1A0RP 1VF4A 3BCKA 3GMFA 4I6XA 3LQ7A 1JLVA 1BJXA 2TIRA 1EGOA 5GSTA 2L4QA 2CQ9A 5ELGA 5KN3A 4HQZA 4FO5A 2H71A 3FKFA 2CVBA 4ML6A 2CVKA 1JZRA 4V1Ap 4EXJA 1ZOFA 5L71A 4N0ZA 5EVOA 4IN0A 5HR3A 5KN1A 3ISOA 1YZXA 1U6TA 2YV9A 2QSIA 6GSWA 1JZDA 4XS4B 3GX0A 17GSA 1XIYA 3ZITA 1O81A 2VL2A 3NIVA 4HOJA 1GSSA 2OA7A 2V32A 2AYTA 3GKXA 3EC3A 5JWRB 3UVHA 3D5JA 5DCHA 3E3EA 3JCML 1R5AA 3EURA 4MF6A 2VAFA 1UVZA 3LGCA 3HDCA 2KUCA 3H4KA 2C0EA 1A2LA 4ISDA 3GL5A 3QOUA 1Z6MA 3I43A 4MJAA 4G9HA 3HD5A 4AJ6A 4TXOB 1XOAA 4KE3A 5ECMB 1T4ZA 3F8UA 5HR2A 2G2QA 5F05A 4IGJA 4K7NA 4XRDA 4TVEA 3VI5A 4IHUA 3ZLPA 2LJRA 3QAGA 1PD21 4Q5NA 5J5NA 5J41A 5G30A 1Z7PA 1AC1A 2C0DA 3W8JA 1XWBA 1SKWB 1YJ6A 3KIJA 1VF1A 3CSHA 4BPYA 2GDRA 2GT5A 4FH8A 5ECRB 3RHCA 5FHIA 2BJXA 2N5BA 3IA1A 2O87A 4KA0A 3ERGA 2WFCA 3LYKA 5IM9A 3KD0A 4KUNA 1TRWA 1E6BA 1B9XC 1XWCA 2I4AA 2CZ2A 5AIVA 4YQUA 5DJMA 4PUAA 2N5FA 1W89A 2CX4A 2P5RA 1Z9HA 2PPTA 1XZOA 2GSRA 1BYEA 5G1LA 2A2RA 3NZNA 5LCZA 5C04A 4D73A 4TW5A 2CAQA 5GAPD 1LJRA 4P3YB 3M0FA 4IJ3A 4ZBDA 4ZL8A 3EU4A 1AQVA 4ZILA 2I3YA 3SBCA 5D9XA 1GSFA 3EU3A 4PUFC 4MK3A 4OCEA 1EV9A 3BJ5A 1K3LA 1OAZA 1BEDA 4DVCA 1TDIA 5IMFA 2LKUA 1PSQA 1OC8A 2VD0A 2JZSA 3QMXA 4GTUA 2PVOC 4N0VA 8GSSA 4FYBA 3NOFA 2GSTA 4EO3A 1GSQA 4L0WA 1OC3A 3F9UA 2V2GA 1NW2A 3ZFLA 2NBSA 4L8EA 4ILFA 1Q98A 4ECIA 4QL9A 1QQ2A 1S3DA 1AUCA 1LU4A 4CHSA 2YWNA 4G2EA 3M3MA 5B8AA 9GSSA 3FEUA 3GSTA 4TOPA 1M99A 4ACSA 5B6NA 2CZ3A 3GHAA 3LXTA 4X0XA 4MH2A 3W6GA 4LMWA 4WETA 3P2AA 4HU7A 2DIYA 5A4VA 3TOTA 2JADA 3EWLA 1NM3A 2C1YA 1PA3A 1T3BA 5ECIB 3CTGA 1FHEA 4NHZA 3ZVJD 4TRXA 3VURA 3TKSA 2IMDA 2VCTA 1M0UA 2DJ0A 1R7HA 5D73A 2FY6A 4BVXA 1ML6A 5G5FA 5F8BA 3TKQA 2PGTA 5J9CA 4LMVA 1F9MA 1O8WA 3GIXA 1PX6A 1XVQA 1OKTA 2H74A 4NPBA 4F0CA 3IK7A 3ZFBA 1T00A 3GTUB 2ES7A 3C8EA 4ZB6A 3EE2A 4WKWA 3PH9A 4I2UA 5ECOB 4X1UA 4XS1A 3D22A 2LNTA 1X0RA 3D6IA 4H86A 1O73A 2JU5A 2IFQA 2V41A 4IKHA 1A2JA 3IC4A 3ZMKA 5IPHA 2HRFA 2DJ2A 3CRTA 5E4WA 5B7CA 1J0FA 4V2LA 1VRSD 1GLPA 3M1GA 2G0FA 3ZL5A 1G6WA 3FZ4A 2HSHA 4POBA 4NHWA 2YANA 4KSOA 1SKRB 3FRCA 3W8SA 2QC7A 2VUPA 1SD8A 1XWAA 2GT6A 5CRDA 2LSTA 1T7PB 1ERWA 4YAVA 1T8EB 1K0BA 5DAKB 4TR1A 3GH6A 5IMCA 2D2ZA 1WP0A 5B8BA 2X8HA 1NSWA 4AF2A 2VM1A 5B6MA 5INYA 1WIKA 1GUKA 1ZGNA 2A4VA 4KGIA 3IHQA 3LWAA 1VF2A 2XC2A 1HQOA 5F06A 5JCGA 4ECCA 2OACA 2N5AA 4MMMA 1AXDA 3TRXA 1EWXA 2EIOA 3ERWA 3QDNA 1PKWA 2GZPA 3VFIA 3UBLA 2IWTA 2IMIA 3A2WA 3IOSA 1A2MA 5GSSA 2NDOA 3KMNA 1M2AA 5IO0A 4DSSA 1V9WA 1O6JA 4AJ8A 2DJJA 3LG6A 2IMFA 3DVXA 4K8MA 1A24A 3IR4A 1OYJA 4WR4A 4Z7XA 1T1VA 2C4JA 2B7JA 2WJUA 4GRFA 12GSA 1PL2A 4ECJA 2HI7A 3DEXA 2GSSA 1EZKA 2GQLA 4IVFA 2ALBA 1DSBA 4GSNA 2VCQA 1BQ7A 4N11A 2E2MA 1DBYA 3TKRA 5JWOB 4PXOA 4KDYA 4KH7A 2NVLA 2VL3A 3A5WA 4KAEA 2H0HA 2ZNMA 5EY6A 1AQXA 1ILOA 4AJ7A 4V2MA 1XWGA 1MDKA 4GCIA 2REMA 2JSZA 4JE1A 2F8FA 1VF3A 1K0AA 2GZYA 3F3RA 3GX8A 4XRAA 1SL0B 1B48A 2C0FA 2ZCTA 3WD6A 2LRCA 2C8UA 3BD2A 3I6AA 2GQKA 2FWHA 3FYGA 2PBJA 1SJIA 3I9V2 5E59A 3F4SA 2X64A 2F9SA 2O89A 3EMXA 2LS5A 1GWCA 1QMVA 4N10A 4CDOA 2XBIA 5DQYA 1HNAA 2DSAA 1MEKA 4O32A 4K1FA 1SENA 2V6OA 1OKDA 4BA7A 4EL1A 2IJYA 1JHBA 1F37A 1G7EA 1GTBA 1U87A 2H0GA 4Q5QA 1KEBA 1GNEA 3US3A 1FAAA 2KLXA 3HZ4A 4KNDA 3G7YA 4HJ2A 4K7IA 1U3AA 2LQQA 4GWRA 4OFMA 6GSUA 3A2VA 3V1WA 3FR9A 3MWHA 2R2JA 1XXUA 1J08A 1ZZYA 2TRCP 4KCEA 4ZIJA 3KXOA 3A2XA 3GYKA 3F63A 3KGKA 3ED3A 2M46A 1GTUA 4MPGA 2L5LA 4K0GA 4JBBA 1SL2B 1PMTA 4WF5A 1F2EA 4HQSA 2QKEA 3H1NA 4PX1A 3C7MA 2PWJA 4NV5A 2MMAA 2VCXA 1GSEA 1W4VA 2YZHA 1Z6NA 4HZ4A 4LL4B 1PRXA 4RQXA 2MMOA 5AIXA 4MJCA 4IP1A 1GSDA 2I81A 3D4TA 1FG4A 2FLSA 2MBSA 1MDIA 3HXSA 1GL8A 2L4CA 1GNWA 3HCZA 2ON7A 3FR6A 2RUFA 3LJRA 1SU9A 3UBKA 2LNSA 2PMTA 5D9TA 5CP1A 4JR4A 3WGDA 2LQOA 3WGXA 3IK9A 3CBUA 3DXBA 2WGRA 1DE1A 1SKSB 2JACA 4MH3A 2PVQA 4I8BA 2J23A 2A2SA 3GURA 3VWUA 2HZEB 3APQA 1SYRA 5ECKB 2L6DA 4OMVA 4MABA 5IMZA 1TXXA 3Q6OA 3C73A 4BL7A 1DUGA 2HT9A 4MP4A 3ME7A 1I9DA 4GXZA 2GQMA 5DQSA 5JCUA 4ECBA 2MMZA 1FB6A 4FYUA 2E7PA 1FOVA 1X9SB 3HJPA 3S9FA 3N9JA 5ABRA 3H93A 2H1DA 2FNOA 4TXOA 3Q19A 1U88A 3QCPA 4CW9A 3KP8A 3APOA 4D73B 1F3AA 5IOXA 1HNBA 3TJFA 3RBTA 2GS3A 1I5GA 3VPQA 2DBCA 5IO2A 3KM6A 4NAXA 2K6VA 2X8GA 2YOIA 3HVVA 3QAVA 1OE8A 4YQMA 3ZVJA 2K8SA 2H6YA 2FHEA 1IYIA 1TRSA 1ZYEA 4EF0A 5D8IA 2L57A 3D4MA 4LL1B 6GSVA 1ABAA 5ID2A 4J57E 1TJDA 3QAWA 1TRVA 3TB2A 2L59A 2X99A 5DCGA 1A8YA 2H1GA 4YH2A 3M9JA 2IL3A 4F0BA 1GTAA 2EIQA 2EC4A 3WT1A 1KBNA 7GSSA 1N8JA 2QGVA 5G1KA 5ECQB 1GTIA 1TU7A 3UL3A 1K3YA 3HZ8A 3PR8A 1V57A 3LFLA 4MCUA 2R6KA 3KZQA 1FO5A 2XBQA 1G0TA 4ZB9A 3SWLA 1XCCA 2HNLA 1TU8A 3WGEA 3GKMA 2WRTA 3L9VA 5D9VA 3MNGA 1GLQA 1JZOA 2B6MA 3TJGA 4EVMA 3DRNA 1XWKA 1M2BA 2XHFA 2F8AA 3ZRDA 1SD9A 4NWYA 3TJJA 3J7Yb 1HYUA 1TK0B 3TRQA 1GULA 5J3RA 4F9ZA 1JFUA 2ON5A 2PERA 2YV7A 20GSA 1ERVA 3TCOA 3ERFA 1PX7A 3BOAA 3O6TA 4OCFA 2RUEA 1O7UA 4GLTA 5LD0A 4TR3A 1PQNA 4PQHA 3IBHA 3C1SA 5CAXA 1X5CA 3GSSA 2H66A 3BBYA 3FK8A 4ZB8A 3KH9A 1SK1A 3M8NA 2IFQB 5C00A 3CSJA 4E8HA 3BCIA 1T4YA 2RIIA 3MAKA 2P0GA 1YY7A 5H5SA 1J9BA 4POMA 3MSZA 1YF0A 4OFTA 1RQMA 1YF1A 2JZTA 3CYNA 4N30A 2JZRA 4XCSA 2YWIA 4ML1A 2MYGA 2C3TA 2H75A 2VIMA 3EMPA 3GL3A 4AGSA 3L9UA 3F3QA 5H5QA 1MDJA 2HZFA 2CAIA 3HJMA 2V1MA 3UVTA 3GTUA 3P8WA 1CQHA 1WJKA 3IXRA 4MZCA 3L78A 1QK8A 4WEYA 1TW9A 1TKDB 5IPGA 4NV2A 2LTKA 2FUG2 4XIHA 2LUSA 1B4QA 3PGTA 3GKNA 2IIYA 4G19A 1Z5YE 3M9KA 4KDUA 3C1RA 3DIEA 1G7OA 4DSSB 4POKA 2H70A 3HVXA 3RPNA 1UN2A 5ECNB 1BAYA 3R2QA 4RI6A 1YEPA 4PQIA 4DSQA 4XS6A 2FWGA 1A8LA 1BG5A 3CMIA 3CTFA 3UOMA 4KW6A 2KP2A 3RHBA 2I9HA 3APSA 1SK2A 4EE0A 1V98A 19GSA 5KEJA 4IQ1A 1OC9A 5D9WA 2NPBA 3TDGA 2B7KA 1K0CA 3TKPA 3HA9A 1XOBA 4HJMA 3H79A 2OADA 3IDVA 1O8XA 5J4UA 3J7Yk 4I2TA 3HHVA 3HJOA 1IYHA 2B1LA 4IW9A 1PN9A 4PNGA 3L4NA 1WOUA 6GSYA 3EINA 1KNGA 2DC5A 1GRXA 5ECHB 5D93A 4I97A 3QPMA 2C3QA 3VK9A 2O85A 2VCZA 4ZBAA 4PURA 1ST9A 4O5RA 3GUSA 1GSYA 3VWWA 3ZTLA 5IOWA 2E2GA 2M72A 4EUYA 2YJHA 1WRYA 5G2ZA 1ZMAA 2C80A 2L5OA 2RM5A 1CQGA 5KN0A 1UA5A 3ZZXA 2YCDA 2HXKA 2AB6A 2VL2C 3C71A 1PL1A 1Z3EA 4MF5A 4HZ2A 1V58A 2YWOA 5CRGA 3UEMA 4K7OA 4FIWA 3KH7A 1B9YC 4DEJA 3VI7A 3KJYA 2H72A 2ZUPA 1Q4JA 4RUVA 4HEA2 2XPDA 4PNFA 3CXGA 2OE3A 1EP7A 3GKKA 2YPMA 4WBJA 4O7HA 1F6MC 4F2IA 3N5OA 2AUVA 1U3IA 4O92A 1SYXA 3DMLA 1H4OA 1TI1A 2JSYA 5DALB 3O76A 2AAWA 4LLRA 2M80A 1FVJA 2WULA 2TRXA 1K3OA 4HUAA 3WYWA 3F4TA 2B3SA 14GSA 5IMDA 2VD1A 3EVIA 1R4WA 1URMA 3ZIVA 1UC7A 1K0MA 2H0IA 3F6DA 1M9BA 4K6XA 2PN8A 2VLUA 5D96A 3TGZA 4MDCA 6GSTA 2DJ1A 3DWVA 3DD3A 3HYPA 1ZL9A 4MZBA 1XVWA 2K8VA 3DVWA 5IMAA 1YDKA 2KHPA 2B1KA 2LJKA 5A5KA 1SL1B 5HR1A 1PGTA 1BX9A 2H8LA 4IELA 2YN1A 3D21A 4G10A 3QFAC 1ZCPA 4HU9A 1GUMA 2LV3A 4IBPA 4K9ZA 22GSA 4TKYA 4PQ1A 2DJKA 1F3BA 2PU9C 2HSYA 3RDWA 1RK4A 1XW5A 1V2AA 1EP8A 2FD3A 4L0UA 5H5RA 3VPTA 4XHMA 5ELAA 1S3CA 2WS2A 3KMOA 1GSUA 3IE3A 4WBRD 3D0ZA 5J9BA 4TN8A 4XS4A 4RI7A 11GSA 2VO4A 18GSA 3VWXA 3TUEA 4JEDA 2VCWA 4KX4A 1O85A 16GSA 3GN3A 3Q74A 2YJ7A 2OBKA 1AIUA 3IPZA 1K0OA 5HR0A 1ERUA 1WMJA 2H1AA 3LEFA 3IV4A 4Q5FA 4HI7A 4LA1A 3F0IA 5ECLB 4QQ7A 1C72A 4BWSA 4WXTA 5DBQA 1X5EA 4BWQA 1MD3A 3QD9A 3FZ9A 1TK5B 5CREA 2HZEA 4TR4A 4X43A 1THXA 1B4PA 1ON4A 3TKSC 5LNKe 3LXZA 2H76A 5ID2B 2GZZA 2P5QA 1LBKA 4OO5A 5CNWA 1B8XA 2DMMA 3LORA 4MA9A 2OE1A 3DKSA 3DYRA 5G31A 3OR5A 1TRUA 5DDLA 2V6KA 4OD7A 1PKZA 2YWMA 4EKZA 1Z7RA 2BTOT 4Q5RA 5GZZB 2R4VA 4POLA 3E9JB 2GGTA 5ECSA 5DVBA 4IJIA 2VLTA 2WB9A 2FGXA 3GA4A 3G7IA 1R26A 2PUKC 4NMUA 3P7XA 3VWVA 4ULXA 2CVDA 2E0QA 2H30A 1DE2A 4K0NA 2HYXA 1K0NA 2O7KA 1X9MB 3F6FA 3WT2A 3U6VA 3HKRA 5CO3A 2XPEA 4L5LA 1MD4A 1R5PA 3GNJA 2H01A 2FA4A 3KCMA 4NXIA 2HE3A 3EYTA 2LJAA 1XBSA 4HDEA 2H6XA 3CSIA 5CRHA 3TJBA 1GP1A 4V1Ag 3GRXA 3I69A 4GSSA 2HFDA 2R5GA 2OE0A 1MTCA 2O8VB 4JU5A 4RQRA 2DLXA 4ID0A 1ACVA 1ERTA 2YP6A 5ENUA 2H1BA 2IMKA 1V40A 2L6CA 1QXHA 4F03A 1AW9A 1HNCA 5FWGA 3G9BA 3VLNA 1H75A 4GQFA 1FVKA 1OVNA 2LEGA 5G5EA 4EDYA 1SJ6A 3FZAA 5HFIA 4TXVA 1EOHA 4KB3A 5AN1A 5AGYA 1SK0A 2DMLA 2MMNA 3IRAA 3A3TA 3QFBC 2K9FA 2H73A 3UAPA 2B5EA 2OJLA 4JR6A 3RPPA 6GSSA 1YKAA 3ZREA 5EPFA 4MJBA 1WE0A 4MPFA 5DJLA 4EC0A 3TRPA 1TK8B 1M2DA 3ZIJA 1FW1A 1M7TA 1JLWA 3ZMLA 1A0FA 3K8NA 2BMXA 2JL4A 2LRNA 1TTZA 2OKAA 1WPIA 3UMAA 4JZQA 5AISA 4I5QA 2C0GA 4IP6A 1M9AA 1VGLA 3TOUA 4TR1B 2MZCA 1E2YA 3AY8A 3FW2A 10GSA 2GLRA 4MZWA 1HD2A 1N2AA 3HVSA 4OO4A 4GQCA 1WWJA 2IPAA 1XPVA 3KTBA 1RW1A 2I1UA 2GSQA 2GVPA 4BVYA 4XTSA 1EV4A 3U5RE 2LRTA 2H6ZA 2VCVA 3FR3A 3UARA 2YZUA 4ZL9A 5KN2A 4ZXGA 2YNXA 4J2FA 1AQWA 2FWFA 3E0UA 4HS1A 5HQPA 5IIZA 3MDKA 1ZYQB 1EOGA 1XW6A 2VOCA 3F4RA 3IAS2 1KTEA 2VM2A 2EIRA 1NHOA 2RLIA 1OC9B 5COHA 2P31A 2WDUA 5F07A 2J9HA 3GFKA 2VL9A 3KEBA 1G6YA 1EEJA 13GSA 5DAKA 1FB0A 4GF0A 5F0GA 2AJQB
chains in the Genus database with same CATH superfamily
3UJ1A 1S3AA 1NHYA 2DJ3A 4KDXA 2KOKA 5JWQB 4QL7A 2MBTA 2H19A 3KP9A 3IAM2 3LSZA 3QR6A 4OWYA 4G0LA 2B5XA 2IN3A 3UIWA 3TKSE 2CT6A 4OFNA 4WF4A 2R0GA 1EGRA 2WCIA 3GV1A 2WZ9A 1TOFA 2B5YA 5A4WA 1JZWA 3L9SA 2FA8A 1A23A 3LYPA 4KCAA 3RAZA 3ZYWA 3FHKA 4WR5A 1GH2A 3O3TA 4IS0A 1X9WB 1EEMA 5JCWA 1Y6EA 4MLYA 3CRUA 5HFGA 4PGTA 1OE7A 4YAPA 2IMEA 4TR0A 5GAND 5HFKA 1USBA 3ME8A 2R3XA 1YEXA 2CA8A 1TI3A 2RM6A 3G7JA 4MJEA 2CV4A 1QFNA 2KP1A 3IHGA 1K0DA 1QUWA 1AAZA 2HLSA 4ZL7A 4IQAA 2F51A 4JRRA 2FCHA 2OBIA 2HRNA 4YQVA 2R37A 3TJKA 3H8QA 4GSTA 1QGVA 2DIZA 2AV4A 2GTUA 4J56E 4G0KA 2CX3A 5IMVA 4V2NA 4K2DA 1X5DA 2F3MA 1GUHA 1SJZA 3HY2A 2AHEA 5FT3A 5IQYA 2VLVA 3GH9A 4L5OA 1YKCA 2C3NA 6GSXA 4A5PA 3FY7A 4FYCA 3KTLA 1XFLA 2X8CA 4EDZA 5EL8A 4DSRA 4KSMA 2Z9SA 5A4UA 3FZ5A 2FWEA 5ECPB 4E8EA 4F82A 1YQ1A 3P90A 1XW9A 1TP9A 5DALA 4ZBBA 3L0HA 5CRWA 3DGQA 1Y25A 3PINA 3Q18A 4MF7A 1THOA 2K18A 5CYYA 2NTOA 1A0RP 1VF4A 3BCKA 3GMFA 4I6XA 3LQ7A 1JLVA 1BJXA 2TIRA 1EGOA 5GSTA 2L4QA 2CQ9A 5ELGA 5KN3A 4HQZA 4FO5A 2H71A 3FKFA 2CVBA 4ML6A 2CVKA 1JZRA 4V1Ap 4EXJA 1ZOFA 5L71A 4N0ZA 5EVOA 4IN0A 5HR3A 5KN1A 3ISOA 1YZXA 1U6TA 2YV9A 2QSIA 6GSWA 1JZDA 4XS4B 3GX0A 17GSA 1XIYA 3ZITA 1O81A 2VL2A 3NIVA 4HOJA 1GSSA 2OA7A 2V32A 2AYTA 3GKXA 4Z2UA 3EC3A 5JWRB 3UVHA 3D5JA 5DCHA 3E3EA 3JCML 1R5AA 3EURA 4MF6A 2VAFA 1UVZA 3LGCA 3HDCA 2KUCA 3H4KA 2C0EA 1A2LA 4ISDA 3GL5A 3QOUA 1Z6MA 3I43A 4MJAA 4G9HA 3HD5A 4AJ6A 4TXOB 1XOAA 4KE3A 5ECMB 1T4ZA 3F8UA 5HR2A 2G2QA 5F05A 4IGJA 4K7NA 4XRDA 4TVEA 3VI5A 4IHUA 3ZLPA 2LJRA 3QAGA 1PD21 4Q5NA 5J5NA 5J41A 5G30A 1Z7PA 1AC1A 2C0DA 3W8JA 1XWBA 1SKWB 1YJ6A 3KIJA 1VF1A 3CSHA 4BPYA 2GDRA 2GT5A 4FH8A 5ECRB 3RHCA 5FHIA 2BJXA 2N5BA 3IA1A 1M3JA 2O87A 4KA0A 3ERGA 2WFCA 3LYKA 5IM9A 3KD0A 4KUNA 1TRWA 1E6BA 1B9XC 1XWCA 2I4AA 1PN0A 2CZ2A 5AIVA 4YQUA 5DJMA 4PUAA 2N5FA 1W89A 2CX4A 2P5RA 1Z9HA 2PPTA 1XZOA 2GSRA 1BYEA 5G1LA 2A2RA 4MNNA 3NZNA 5LCZA 5C04A 4D73A 4TW5A 2CAQA 5GAPD 1LJRA 4P3YB 3M0FA 4IJ3A 4O5UA 4ZBDA 4ZL8A 3EU4A 1AQVA 4ZILA 2I3YA 3SBCA 5D9XA 1GSFA 3PPUA 3EU3A 4PUFC 4MK3A 4OCEA 1EV9A 2HRKA 3BJ5A 1K3LA 1OAZA 1BEDA 4DVCA 1TDIA 5IMFA 2LKUA 1PSQA 1OC8A 2VD0A 2JZSA 3QMXA 3MYDA 4GTUA 2PVOC 4N0VA 8GSSA 4FYBA 3NOFA 2GSTA 4EO3A 1GSQA 4L0WA 1OC3A 3F9UA 2V2GA 1NW2A 3ZFLA 2NBSA 4L8EA 4ILFA 1Q98A 4ECIA 4QL9A 1QQ2A 1S3DA 1AUCA 1LU4A 4CHSA 2YWNA 4G2EA 3M3MA 5B8AA 9GSSA 3FEUA 3GSTA 4TOPA 1M99A 4ACSA 5B6NA 2CZ3A 3GHAA 3LXTA 2QA1A 4X0XA 4MH2A 3W6GA 4LMWA 4K2XA 4WETA 3P2AA 4HU7A 2DIYA 5A4VA 3TOTA 2JADA 3CQFA 3EWLA 1NM3A 2C1YA 1PA3A 1T3BA 5ECIB 3CTGA 1FHEA 4NHZA 3ZVJD 4TRXA 3VURA 3TKSA 2IMDA 4PTSA 2VCTA 1M0UA 2DJ0A 1R7HA 5D73A 2FY6A 4BVXA 1ML6A 5G5FA 5F8BA 3TKQA 2PGTA 5J9CA 4LMVA 1F9MA 1O8WA 3GIXA 1PX6A 1S3RA 1XVQA 1OKTA 4USSA 2H74A 4NPBA 4F0CA 3IK7A 3ZFBA 1T00A 4EIPA 3GTUB 2ES7A 3C8EA 4ZB6A 3EE2A 4WKWA 3PH9A 4I2UA 5ECOB 4X1UA 4XS1A 3D22A 2LNTA 1X0RA 3D6IA 4H86A 1O73A 2JU5A 2IFQA 2V41A 4IKHA 4BVYB 1A2JA 3IC4A 3ZMKA 5IPHA 2HRFA 2DJ2A 3CRTA 5E4WA 5B7CA 1J0FA 4V2LA 1VRSD 1GLPA 3M1GA 2G0FA 3ZL5A 2A2PA 1G6WA 3FZ4A 2HSHA 4POBA 4NHWA 2YANA 4KSOA 1SKRB 3FRCA 3W8SA 2QC7A 2VUPA 1SD8A 1XWAA 2GT6A 5CRDA 2LSTA 4G0IA 2DKIA 1T7PB 1ERWA 4YAVA 1T8EB 1K0BA 5DAKB 4Z2TA 4TR1A 3GH6A 5IMCA 2D2ZA 1WP0A 5B8BA 2X8HA 1NSWA 4AF2A 2VM1A 5B6MA 5INYA 1WIKA 1GUKA 1ZGNA 2A4VA 4KGIA 3IHQA 3LWAA 1VF2A 2XC2A 1HQOA 5F06A 5JCGA 4ECCA 2OACA 2N5AA 4MMMA 4HSCX 1AXDA 3TRXA 1EWXA 2EIOA 3ERWA 3QDNA 1PKWA 2GZPA 3VFIA 3UBLA 5KOWA 2IWTA 2IMIA 3A2WA 3IOSA 1A2MA 5GSSA 2NDOA 3KMNA 1M2AA 5IO0A 4DSSA 1V9WA 1O6JA 4AJ8A 2DJJA 3LG6A 2IMFA 3DVXA 4K8MA 1A24A 3IR4A 1OYJA 4WR4A 4Z7XA 1T1VA 2C4JA 2B7JA 2WJUA 4GRFA 12GSA 1PL2A 4ECJA 4CY8A 2HI7A 3DEXA 4O5QA 2GSSA 1EZKA 2GQLA 4IVFA 2ALBA 1DSBA 4X4JA 4GSNA 3MIXA 2VCQA 1BQ7A 4N11A 2E2MA 1DBYA 3LW9A 3TKRA 5JWOB 4PXOA 4KDYA 4KH7A 2NVLA 2VL3A 3A5WA 4KAEA 2H0HA 2ZNMA 5EY6A 1AQXA 1ILOA 4AJ7A 4V2MA 1XWGA 1MDKA 4GCIA 2REMA 2JSZA 4JE1A 2F8FA 1VF3A 1K0AA 2GZYA 3F3RA 3GX8A 4XRAA 1SL0B 1B48A 2C0FA 2ZCTA 3WD6A 2LRCA 2C8UA 3BD2A 3I6AA 2GQKA 2FWHA 3FYGA 2PBJA 1SJIA 3I9V2 5E59A 3F4SA 2X64A 3R3EA 2F9SA 2O89A 3EMXA 2LS5A 1GWCA 1QMVA 4N10A 4CDOA 2XBIA 5DQYA 1HNAA 2DSAA 1MEKA 4O32A 4K1FA 1SENA 2V6OA 1OKDA 1M3IA 4BA7A 4EL1A 2IJYA 1JHBA 1F37A 1G7EA 1GTBA 1U87A 2H0GA 4Q5QA 1KEBA 1GNEA 3US3A 1FAAA 2KLXA 3HZ4A 4KNDA 3G7YA 4HJ2A 4K7IA 1U3AA 2LQQA 4GWRA 4OFMA 6GSUA 3A2VA 3V1WA 3FR9A 3MWHA 2R2JA 1XXUA 1J08A 1ZZYA 2TRCP 4KCEA 4ZIJA 3KXOA 3A2XA 3GYKA 3F63A 3KGKA 5BRTA 3ED3A 2M46A 1GTUA 4MPGA 2L5LA 4K0GA 4JBBA 1SL2B 1PMTA 1XG8A 4WF5A 1F2EA 4HQSA 2QKEA 3A5IA 2R0CA 3H1NA 4PX1A 3C7MA 2PWJA 4NV5A 2MMAA 2VCXA 1GSEA 1W4VA 2YZHA 1Z6NA 4HZ4A 4LL4B 1PRXA 4RQXA 2MMOA 5AIXA 4MJCA 4IP1A 1GSDA 2I81A 3D4TA 1FG4A 2FLSA 2MBSA 1MDIA 3HXSA 1GL8A 2L4CA 1GNWA 3HCZA 2ON7A 3FR6A 2RUFA 3LJRA 1SU9A 3UBKA 2LNSA 2PMTA 5D9TA 5CP1A 4JR4A 3WGDA 2LQOA 3WGXA 3IK9A 3CBUA 3DXBA 2WGRA 1DE1A 1SKSB 2JACA 4MH3A 2PVQA 4I8BA 2J23A 2A2SA 3GURA 3VWUA 2HZEB 3APQA 1SYRA 5ECKB 2L6DA 4OMVA 4MABA 5IMZA 1TXXA 3Q6OA 3C73A 3EPTA 4Z2RA 4BL7A 1DUGA 2HT9A 4MP4A 3ME7A 1I9DA 4GXZA 2GQMA 5DQSA 5JCUA 4ECBA 2MMZA 1FB6A 4FYUA 2E7PA 1FOVA 1X9SB 3HJPA 3S9FA 3N9JA 5ABRA 3H93A 2H1DA 2FNOA 4TXOA 3Q19A 1U88A 3QCPA 4CW9A 5BMUA 3KP8A 3APOA 4D73B 1F3AA 5IOXA 1HNBA 3TJFA 3RBTA 2GS3A 2UZ8A 1I5GA 3VPQA 2DBCA 5IO2A 3KM6A 4NAXA 2K6VA 2X8GA 2YOIA 3HVVA 3QAVA 1OE8A 4YQMA 3ZVJA 2K8SA 2H6YA 2FHEA 1IYIA 1TRSA 1ZYEA 4EF0A 2QA2A 5D8IA 2L57A 3D4MA 4LL1B 6GSVA 1ABAA 5ID2A 4J57E 1TJDA 3QAWA 1TRVA 3TB2A 3IC8A 2L59A 2X99A 5DCGA 1A8YA 2H1GA 4YH2A 3M9JA 2IL3A 4F0BA 1GTAA 2EIQA 2EC4A 3WT1A 1KBNA 7GSSA 1N8JA 2QGVA 4ICYA 5G1KA 5ECQB 1GTIA 1TU7A 3UL3A 1K3YA 3HZ8A 3PR8A 1V57A 3LFLA 4MCUA 2R6KA 3KZQA 1FO5A 2XBQA 1G0TA 4ZB9A 3SWLA 1XCCA 2HNLA 1TU8A 3WGEA 3GKMA 2WRTA 3L9VA 5D9VA 3MNGA 1GLQA 4CY6A 1JZOA 2B6MA 3TJGA 4EVMA 3DRNA 1XWKA 1M2BA 2XHFA 2F8AA 3ZRDA 1SD9A 4NWYA 3TJJA 3J7Yb 1HYUA 4BVXB 1TK0B 3TRQA 1GULA 5J3RA 4F9ZA 1JFUA 2ON5A 2PERA 2YV7A 20GSA 1ERVA 3TCOA 3ERFA 1PX7A 3BOAA 3O6TA 4OCFA 2RUEA 1O7UA 4GLTA 5LD0A 4TR3A 1PQNA 4PQHA 3IBHA 3C1SA 5CAXA 1X5CA 3GSSA 2H66A 3BBYA 3FK8A 4ZB8A 1ZYNA 3KH9A 1SK1A 3M8NA 2IFQB 2R0PA 5C00A 3CSJA 4E8HA 3BCIA 1T4YA 2RIIA 3MAKA 2P0GA 1YY7A 5H5SA 1J9BA 4POMA 3MSZA 1YF0A 4OFTA 1RQMA 1YF1A 2JZTA 3CYNA 4N30A 2JZRA 4XCSA 2YWIA 4ML1A 2MYGA 2C3TA 2H75A 2VIMA 3EMPA 3GL3A 4AGSA 3L9UA 3F3QA 5H5QA 1MDJA 2HZFA 2CAIA 3HJMA 2V1MA 3UVTA 3GTUA 3P8WA 1CQHA 1WJKA 3IXRA 4MZCA 3L78A 1QK8A 4WEYA 1TW9A 1ZYPA 1TKDB 5IPGA 4NV2A 2LTKA 2FUG2 4XIHA 2LUSA 1B4QA 3PGTA 3GKNA 2IIYA 4G19A 1Z5YE 3M9KA 4KDUA 3C1RA 3DIEA 1G7OA 4DSSB 4POKA 2H70A 3HVXA 3RPNA 1UN2A 5ECNB 1BAYA 3R2QA 4RI6A 1YEPA 4PQIA 4DSQA 4XS6A 2FWGA 1A8LA 1BG5A 3CMIA 3CTFA 3UOMA 4KW6A 2KP2A 3RHBA 2I9HA 3APSA 1SK2A 4EE0A 1V98A 19GSA 5KEJA 4IQ1A 1OC9A 5D9WA 2NPBA 3TDGA 2B7KA 1K0CA 3TKPA 3HA9A 1XOBA 4HJMA 3H79A 2OADA 3IDVA 1O8XA 1PFOA 5J4UA 3J7Yk 4I2TA 3HHVA 3HJOA 1IYHA 2B1LA 4IW9A 1PN9A 4PNGA 3L4NA 1WOUA 6GSYA 3EINA 1KNGA 2DC5A 1GRXA 5ECHB 5D93A 4I97A 3QPMA 2C3QA 3VK9A 2O85A 2VCZA 4ZBAA 4PURA 1ST9A 4O5RA 3GUSA 1GSYA 3VWWA 3ZTLA 5IOWA 2E2GA 2M72A 4EUYA 2YJHA 1WRYA 5G2ZA 1ZMAA 2C80A 2L5OA 2RM5A 1CQGA 5KN0A 1UA5A 3ZZXA 2YCDA 3FMWA 2HXKA 2AB6A 2VL2C 3C71A 1PL1A 1Z3EA 4MF5A 4HZ2A 1V58A 2YWOA 5CRGA 3UEMA 4K7OA 4FIWA 3KH7A 1B9YC 4DEJA 3VI7A 3KJYA 2H72A 2ZUPA 1Q4JA 4RUVA 4HEA2 2XPDA 4PNFA 3CXGA 2OE3A 1EP7A 3GKKA 2YPMA 4WBJA 4O7HA 1F6MC 4F2IA 3N5OA 2AUVA 1U3IA 4O92A 1SYXA 3DMLA 1H4OA 1TI1A 2JSYA 5DALB 3O76A 2AAWA 4LLRA 2M80A 1FVJA 2WULA 2TRXA 1K3OA 4HUAA 3WYWA 3F4TA 2B3SA 14GSA 5IMDA 2VD1A 3EVIA 1R4WA 1URMA 3ZIVA 1UC7A 1K0MA 2H0IA 3F6DA 4YKFA 1M9BA 4K6XA 2PN8A 2VLUA 5D96A 3TGZA 4EIQA 4MDCA 6GSTA 2DJ1A 3DWVA 3DD3A 3HYPA 1ZL9A 4MZBA 1XVWA 2K8VA 3DVWA 5IMAA 1YDKA 2KHPA 2B1KA 2LJKA 5A5KA 1SL1B 5HR1A 1PGTA 1BX9A 2H8LA 4IELA 2YN1A 3D21A 4G10A 3QFAC 1ZCPA 4HU9A 1GUMA 2LV3A 4IBPA 4K9ZA 22GSA 2X4AA 4TKYA 4PQ1A 2DJKA 1F3BA 2PU9C 2HSYA 3RDWA 1RK4A 1XW5A 1V2AA 1EP8A 2FD3A 4L0UA 5H5RA 3VPTA 4XHMA 5ELAA 1S3CA 2WS2A 3KMOA 1GSUA 3IE3A 4WBRD 3D0ZA 4BL7B 5J9BA 4TN8A 4XS4A 4RI7A 11GSA 2VO4A 18GSA 3VWXA 3TUEA 4JEDA 2VCWA 4KX4A 1O85A 16GSA 3GN3A 3Q74A 2YJ7A 2OBKA 1AIUA 3IPZA 1K0OA 4YKGA 5HR0A 1ERUA 1WMJA 2H1AA 3LEFA 3IV4A 4Q5FA 4HI7A 4LA1A 3F0IA 5ECLB 4QQ7A 1C72A 4BWSA 4WXTA 5DBQA 1X5EA 4BWQA 1MD3A 3QD9A 3FZ9A 1TK5B 5CREA 2X49A 2HZEA 4TR4A 4X43A 1THXA 1B4PA 1ON4A 3TKSC 5LNKe 3LXZA 2H76A 5ID2B 2GZZA 2P5QA 1LBKA 4OO5A 5CNWA 1B8XA 2DMMA 3LORA 4MA9A 2OE1A 3DKSA 3DYRA 5G31A 3OR5A 1TRUA 5DDLA 2V6KA 2HRAA 4OD7A 4KF9A 1PKZA 2YWMA 4EKZA 1Z7RA 2BTOT 4Q5RA 5GZZB 2R4VA 4POLA 3E9JB 2GGTA 5ECSA 5DVBA 4IJIA 2VLTA 2WB9A 4BIKA 2FGXA 3GA4A 3G7IA 1R26A 2PUKC 4NMUA 3P7XA 3VWVA 4ULXA 2CVDA 2E0QA 2H30A 1DE2A 4K0NA 2HYXA 1FOHA 3HVNA 4K5RA 1K0NA 2O7KA 1X9MB 4FQUA 3F6FA 3WT2A 3U6VA 3HKRA 5CO3A 2XPEA 4L5LA 1MD4A 1R5PA 3GNJA 2H01A 2FA4A 3KCMA 4NXIA 2HE3A 3EYTA 2LJAA 1XBSA 4HDEA 2H6XA 3CSIA 5CRHA 3TJBA 1GP1A 4V1Ag 3GRXA 3I69A 4GSSA 2HFDA 2R5GA 2OE0A 1MTCA 2O8VB 4JU5A 4RQRA 2DKHA 2DLXA 4ID0A 1ACVA 1ERTA 2YP6A 5ENUA 2H1BA 2IMKA 1V40A 2L6CA 1QXHA 4F03A 1AW9A 1HNCA 5FWGA 3G9BA 3VLNA 1H75A 4GQFA 1FVKA 1OVNA 2LEGA 5G5EA 4EDYA 1SJ6A 3FZAA 5HFIA 4TXVA 1EOHA 4KB3A 5AN1A 5AGYA 1SK0A 2DMLA 2MMNA 3IRAA 3A3TA 3QFBC 2K9FA 2H73A 5KOXA 3UAPA 2B5EA 2OJLA 4JR6A 3RPPA 6GSSA 1YKAA 3ZREA 5EPFA 4MJBA 1WE0A 4MPFA 5DJLA 4EC0A 3TRPA 1TK8B 1M2DA 3ZIJA 4K5SA 1FW1A 1M7TA 1JLWA 3ZMLA 1A0FA 3K8NA 2BMXA 2JL4A 2LRNA 1TTZA 2OKAA 1WPIA 3UMAA 4JZQA 5AISA 4I5QA 2C0GA 4IP6A 1M9AA 1VGLA 3TOUA 4TR1B 2MZCA 2HSMA 1E2YA 3AY8A 3FW2A 10GSA 2GLRA 4MZWA 1HD2A 1N2AA 3HVSA 4OO4A 4GQCA 1WWJA 2IPAA 1XPVA 3KTBA 1RW1A 2I1UA 2GSQA 2GVPA 4BVYA 4XTSA 1EV4A 2A4HA 3U5RE 2LRTA 2H6ZA 2VCVA 3FR3A 3UARA 2YZUA 4ZL9A 5KN2A 4ZXGA 2YNXA 4J2FA 1AQWA 2FWFA 3E0UA 4HS1A 5HQPA 5IIZA 3MDKA 1ZYQB 1EOGA 1XW6A 2VOCA 3F4RA 3IAS2 1KTEA 2VM2A 2EIRA 1NHOA 2RLIA 1OC9B 5COHA 2P31A 2WDUA 5F07A 2J9HA 3GFKA 2VL9A 3KEBA 1G6YA 1EEJA 13GSA 5DAKA 1FB0A 4GF0A 5F0GA 2AJQB
chains in the Genus database with same CATH topology
3UJ1A 1S3AA 1NHYA 2DJ3A 4KDXA 2KOKA 5JWQB 4QL7A 2MBTA 2H19A 3KP9A 3IAM2 3LSZA 3QR6A 4OWYA 4G0LA 2B5XA 2IN3A 3UIWA 3TKSE 2CT6A 4OFNA 4WF4A 2R0GA 1EGRA 2WCIA 3GV1A 2WZ9A 1TOFA 2B5YA 5A4WA 1JZWA 3L9SA 2FA8A 1A23A 3LYPA 4KCAA 3RAZA 3ZYWA 3FHKA 4WR5A 1GH2A 3O3TA 4IS0A 1X9WB 1EEMA 5JCWA 1Y6EA 4MLYA 3CRUA 5HFGA 4PGTA 1OE7A 4YAPA 2IMEA 4TR0A 5GAND 5HFKA 1USBA 3ME8A 2R3XA 1YEXA 2CA8A 1TI3A 2RM6A 3G7JA 4MJEA 2CV4A 1QFNA 2KP1A 3IHGA 1K0DA 1QUWA 1AAZA 2HLSA 4ZL7A 4IQAA 2F51A 4JRRA 2FCHA 2OBIA 2HRNA 4YQVA 2R37A 3TJKA 3H8QA 4GSTA 1QGVA 2DIZA 2AV4A 2GTUA 4J56E 4G0KA 2CX3A 5IMVA 4V2NA 4K2DA 1X5DA 2F3MA 1GUHA 1SJZA 3HY2A 2AHEA 5FT3A 5IQYA 2VLVA 3GH9A 4L5OA 1YKCA 2C3NA 6GSXA 4A5PA 3FY7A 4FYCA 3KTLA 1XFLA 2X8CA 4EDZA 5EL8A 4DSRA 4KSMA 2Z9SA 5A4UA 3FZ5A 2FWEA 5ECPB 4E8EA 4F82A 1YQ1A 3P90A 1XW9A 1TP9A 5DALA 4ZBBA 3L0HA 5CRWA 3DGQA 1Y25A 3PINA 3Q18A 4MF7A 1THOA 2K18A 5CYYA 2NTOA 1A0RP 1VF4A 3BCKA 3GMFA 4I6XA 3LQ7A 1JLVA 1BJXA 2TIRA 1EGOA 5GSTA 2L4QA 2CQ9A 5ELGA 5KN3A 4HQZA 4FO5A 2H71A 3FKFA 2CVBA 4ML6A 2CVKA 1JZRA 4V1Ap 4EXJA 1ZOFA 5L71A 4N0ZA 5EVOA 4IN0A 5HR3A 5KN1A 3ISOA 1YZXA 1U6TA 2YV9A 2QSIA 6GSWA 1JZDA 4XS4B 3GX0A 17GSA 1XIYA 3ZITA 1O81A 2VL2A 3NIVA 4HOJA 1GSSA 2OA7A 2V32A 2AYTA 3GKXA 4Z2UA 3EC3A 5JWRB 3UVHA 3D5JA 5DCHA 3E3EA 3JCML 1R5AA 3EURA 4MF6A 2VAFA 1UVZA 3LGCA 3HDCA 2KUCA 3H4KA 2C0EA 1A2LA 4ISDA 3GL5A 3QOUA 1Z6MA 3I43A 4MJAA 4G9HA 3HD5A 4AJ6A 4TXOB 1XOAA 4KE3A 5ECMB 1T4ZA 3F8UA 5HR2A 2G2QA 5F05A 4IGJA 4K7NA 4XRDA 4TVEA 3VI5A 4IHUA 3ZLPA 2LJRA 3QAGA 1PD21 4Q5NA 5J5NA 5J41A 5G30A 1Z7PA 1AC1A 2C0DA 3W8JA 1XWBA 1SKWB 1YJ6A 3KIJA 1VF1A 3CSHA 4BPYA 2GDRA 2GT5A 4FH8A 5ECRB 3RHCA 5FHIA 2BJXA 2N5BA 3IA1A 2O87A 4KA0A 3ERGA 2WFCA 3LYKA 5IM9A 3KD0A 4KUNA 1TRWA 1E6BA 1B9XC 1XWCA 2I4AA 1PN0A 2CZ2A 5AIVA 4YQUA 5DJMA 4PUAA 2N5FA 1W89A 2CX4A 2P5RA 1Z9HA 2PPTA 1XZOA 2GSRA 1BYEA 5G1LA 2A2RA 4MNNA 3NZNA 5LCZA 5C04A 4D73A 4TW5A 2CAQA 5GAPD 1LJRA 4P3YB 3M0FA 4IJ3A 4O5UA 4ZBDA 4ZL8A 3EU4A 1AQVA 4ZILA 2I3YA 3SBCA 5D9XA 1GSFA 3PPUA 3EU3A 4PUFC 4MK3A 4OCEA 1EV9A 2HRKA 3BJ5A 1K3LA 1OAZA 1BEDA 4DVCA 1TDIA 5IMFA 2LKUA 1PSQA 1OC8A 2VD0A 2JZSA 3QMXA 3MYDA 4GTUA 2PVOC 4N0VA 8GSSA 4FYBA 3NOFA 2GSTA 4EO3A 1GSQA 4L0WA 1OC3A 3F9UA 2V2GA 1NW2A 3ZFLA 2NBSA 4L8EA 4ILFA 1Q98A 4ECIA 4QL9A 1QQ2A 1S3DA 1AUCA 1LU4A 4CHSA 2YWNA 4G2EA 3M3MA 5B8AA 9GSSA 3FEUA 3GSTA 4TOPA 1M99A 4ACSA 5B6NA 2CZ3A 3GHAA 3LXTA 2QA1A 4X0XA 4MH2A 3W6GA 4LMWA 4K2XA 4WETA 3P2AA 4HU7A 2DIYA 5A4VA 3TOTA 2JADA 3EWLA 1NM3A 2C1YA 1PA3A 1T3BA 5ECIB 3CTGA 1FHEA 4NHZA 3ZVJD 4TRXA 3VURA 3TKSA 2IMDA 4PTSA 2VCTA 1M0UA 2DJ0A 1R7HA 5D73A 2FY6A 4BVXA 1ML6A 5G5FA 5F8BA 3TKQA 2PGTA 5J9CA 4LMVA 1F9MA 1O8WA 3GIXA 1PX6A 1XVQA 1OKTA 4USSA 2H74A 4NPBA 4F0CA 3IK7A 3ZFBA 1T00A 4EIPA 3GTUB 2ES7A 3C8EA 4ZB6A 3EE2A 4WKWA 3PH9A 4I2UA 5ECOB 4X1UA 4XS1A 3D22A 2LNTA 1X0RA 3D6IA 4H86A 1O73A 2JU5A 2IFQA 2V41A 4IKHA 4BVYB 1A2JA 3IC4A 3ZMKA 5IPHA 2HRFA 2DJ2A 3CRTA 5E4WA 5B7CA 1J0FA 4V2LA 1VRSD 1GLPA 3M1GA 2G0FA 3ZL5A 2A2PA 1G6WA 3FZ4A 2HSHA 4POBA 4NHWA 2YANA 4KSOA 1SKRB 3FRCA 3W8SA 2QC7A 2VUPA 1SD8A 1XWAA 2GT6A 5CRDA 2LSTA 4G0IA 2DKIA 1T7PB 1ERWA 4YAVA 1T8EB 1K0BA 5DAKB 4Z2TA 4TR1A 3GH6A 5IMCA 2D2ZA 1WP0A 5B8BA 2X8HA 1NSWA 4AF2A 2VM1A 5B6MA 5INYA 1WIKA 1GUKA 1ZGNA 2A4VA 4KGIA 3IHQA 3LWAA 1VF2A 2XC2A 1HQOA 5F06A 5JCGA 4ECCA 2OACA 2N5AA 4MMMA 1AXDA 3TRXA 1EWXA 2EIOA 3ERWA 3QDNA 1PKWA 2GZPA 3VFIA 3UBLA 5KOWA 2IWTA 2IMIA 3A2WA 3IOSA 1A2MA 5GSSA 2NDOA 3KMNA 1M2AA 5IO0A 4DSSA 1V9WA 1O6JA 4AJ8A 2DJJA 3LG6A 2IMFA 3DVXA 4K8MA 1A24A 3IR4A 1OYJA 4WR4A 4Z7XA 1T1VA 2C4JA 2B7JA 2WJUA 4GRFA 12GSA 1PL2A 4ECJA 4CY8A 2HI7A 3DEXA 4O5QA 2GSSA 1EZKA 2GQLA 4IVFA 2ALBA 1DSBA 4X4JA 4GSNA 3MIXA 2VCQA 1BQ7A 4N11A 2E2MA 1DBYA 3LW9A 3TKRA 5JWOB 4PXOA 4KDYA 4KH7A 2NVLA 2VL3A 3A5WA 4KAEA 2H0HA 2ZNMA 5EY6A 1AQXA 1ILOA 4AJ7A 4V2MA 1XWGA 1MDKA 4GCIA 2REMA 2JSZA 4JE1A 2F8FA 1VF3A 1K0AA 2GZYA 3F3RA 3GX8A 4XRAA 1SL0B 1B48A 2C0FA 2ZCTA 3WD6A 2LRCA 2C8UA 3BD2A 3I6AA 2GQKA 2FWHA 3FYGA 2PBJA 1SJIA 3I9V2 5E59A 3F4SA 2X64A 3R3EA 2F9SA 2O89A 3EMXA 2LS5A 1GWCA 1QMVA 4N10A 4CDOA 2XBIA 5DQYA 1HNAA 2DSAA 1MEKA 4O32A 4K1FA 1SENA 2V6OA 1OKDA 4BA7A 4EL1A 2IJYA 1JHBA 1F37A 1G7EA 1GTBA 1U87A 2H0GA 4Q5QA 1KEBA 1GNEA 3US3A 1FAAA 2KLXA 3HZ4A 4KNDA 3G7YA 4HJ2A 4K7IA 1U3AA 2LQQA 4GWRA 4OFMA 6GSUA 3A2VA 3V1WA 3FR9A 3MWHA 2R2JA 1XXUA 1J08A 1ZZYA 2TRCP 4KCEA 4ZIJA 3KXOA 3A2XA 3GYKA 3F63A 3KGKA 5BRTA 3ED3A 2M46A 1GTUA 4MPGA 2L5LA 4K0GA 4JBBA 1SL2B 1PMTA 4WF5A 1F2EA 4HQSA 2QKEA 3A5IA 2R0CA 3H1NA 4PX1A 3C7MA 2PWJA 4NV5A 2MMAA 2VCXA 1GSEA 1W4VA 2YZHA 1Z6NA 4HZ4A 4LL4B 1PRXA 4RQXA 2MMOA 5AIXA 4MJCA 4IP1A 1GSDA 2I81A 3D4TA 1FG4A 2FLSA 2MBSA 1MDIA 3HXSA 1GL8A 2L4CA 1GNWA 3HCZA 2ON7A 3FR6A 2RUFA 3LJRA 1SU9A 3UBKA 2LNSA 2PMTA 5D9TA 5CP1A 4JR4A 3WGDA 2LQOA 3WGXA 3IK9A 3CBUA 3DXBA 2WGRA 1DE1A 1SKSB 2JACA 4MH3A 2PVQA 4I8BA 2J23A 2A2SA 3GURA 3VWUA 2HZEB 3APQA 1SYRA 5ECKB 2L6DA 4OMVA 4MABA 5IMZA 1TXXA 3Q6OA 3C73A 3EPTA 4Z2RA 4BL7A 1DUGA 2HT9A 4MP4A 3ME7A 1I9DA 4GXZA 2GQMA 5DQSA 5JCUA 4ECBA 2MMZA 1FB6A 4FYUA 2E7PA 1FOVA 1X9SB 3HJPA 3S9FA 3N9JA 5ABRA 3H93A 2H1DA 2FNOA 4TXOA 3Q19A 1U88A 3QCPA 4CW9A 5BMUA 3KP8A 3APOA 4D73B 1F3AA 5IOXA 1HNBA 3TJFA 3RBTA 2GS3A 2UZ8A 1I5GA 3VPQA 2DBCA 5IO2A 3KM6A 4NAXA 2K6VA 2X8GA 2YOIA 3HVVA 3QAVA 1OE8A 4YQMA 3ZVJA 2K8SA 2H6YA 2FHEA 1IYIA 1TRSA 1ZYEA 4EF0A 2QA2A 5D8IA 2L57A 3D4MA 4LL1B 6GSVA 1ABAA 5ID2A 4J57E 1TJDA 3QAWA 1TRVA 3TB2A 3IC8A 2L59A 2X99A 5DCGA 1A8YA 2H1GA 4YH2A 3M9JA 2IL3A 4F0BA 1GTAA 2EIQA 2EC4A 3WT1A 1KBNA 7GSSA 1N8JA 2QGVA 4ICYA 5G1KA 5ECQB 1GTIA 1TU7A 3UL3A 1K3YA 3HZ8A 3PR8A 1V57A 3LFLA 4MCUA 2R6KA 3KZQA 1FO5A 2XBQA 1G0TA 4ZB9A 3SWLA 1XCCA 2HNLA 1TU8A 3WGEA 3GKMA 2WRTA 3L9VA 5D9VA 3MNGA 1GLQA 4CY6A 1JZOA 2B6MA 3TJGA 4EVMA 3DRNA 1XWKA 1M2BA 2XHFA 2F8AA 3ZRDA 1SD9A 4NWYA 3TJJA 3J7Yb 1HYUA 4BVXB 1TK0B 3TRQA 1GULA 5J3RA 4F9ZA 1JFUA 2ON5A 2PERA 2YV7A 20GSA 1ERVA 3TCOA 3ERFA 1PX7A 3BOAA 3O6TA 4OCFA 2RUEA 1O7UA 4GLTA 5LD0A 4TR3A 1PQNA 4PQHA 3IBHA 3C1SA 5CAXA 1X5CA 3GSSA 2H66A 3BBYA 3FK8A 4ZB8A 1ZYNA 3KH9A 1SK1A 3M8NA 2IFQB 2R0PA 5C00A 3CSJA 4E8HA 3BCIA 1T4YA 2RIIA 3MAKA 2P0GA 1YY7A 5H5SA 1J9BA 4POMA 3MSZA 1YF0A 4OFTA 1RQMA 1YF1A 2JZTA 3CYNA 4N30A 2JZRA 4XCSA 2YWIA 4ML1A 2MYGA 2C3TA 2H75A 2VIMA 3EMPA 3GL3A 4AGSA 3L9UA 3F3QA 5H5QA 1MDJA 2HZFA 2CAIA 3HJMA 2V1MA 3UVTA 3GTUA 3P8WA 1CQHA 1WJKA 3IXRA 4MZCA 3L78A 1QK8A 4WEYA 1TW9A 1ZYPA 1TKDB 5IPGA 4NV2A 2LTKA 2FUG2 4XIHA 2LUSA 1B4QA 3PGTA 3GKNA 2IIYA 4G19A 1Z5YE 3M9KA 4KDUA 3C1RA 3DIEA 1G7OA 4DSSB 4POKA 2H70A 3HVXA 3RPNA 1UN2A 5ECNB 1BAYA 3R2QA 4RI6A 1YEPA 4PQIA 4DSQA 4XS6A 2FWGA 1A8LA 1BG5A 3CMIA 3CTFA 3UOMA 4KW6A 2KP2A 3RHBA 2I9HA 3APSA 1SK2A 4EE0A 1V98A 19GSA 5KEJA 4IQ1A 1OC9A 5D9WA 2NPBA 3TDGA 2B7KA 1K0CA 3TKPA 3HA9A 1XOBA 4HJMA 3H79A 2OADA 3IDVA 1O8XA 5J4UA 3J7Yk 4I2TA 3HHVA 3HJOA 1IYHA 2B1LA 4IW9A 1PN9A 4PNGA 3L4NA 1WOUA 6GSYA 3EINA 1KNGA 2DC5A 1GRXA 5ECHB 5D93A 4I97A 3QPMA 2C3QA 3VK9A 2O85A 2VCZA 4ZBAA 4PURA 1ST9A 4O5RA 3GUSA 1GSYA 3VWWA 3ZTLA 5IOWA 2E2GA 2M72A 4EUYA 2YJHA 1WRYA 5G2ZA 1ZMAA 2C80A 2L5OA 2RM5A 1CQGA 5KN0A 1UA5A 3ZZXA 2YCDA 3FMWA 2HXKA 2AB6A 2VL2C 3C71A 1PL1A 1Z3EA 4MF5A 4HZ2A 1V58A 2YWOA 5CRGA 3UEMA 4K7OA 4FIWA 3KH7A 1B9YC 4DEJA 3VI7A 3KJYA 2H72A 2ZUPA 1Q4JA 4RUVA 4HEA2 2XPDA 4PNFA 3CXGA 2OE3A 1EP7A 3GKKA 2YPMA 4WBJA 4O7HA 1F6MC 4F2IA 3N5OA 2AUVA 1U3IA 4O92A 1SYXA 3DMLA 1H4OA 1TI1A 2JSYA 5DALB 3O76A 2AAWA 4LLRA 2M80A 1FVJA 2WULA 2TRXA 1K3OA 4HUAA 3WYWA 3F4TA 2B3SA 14GSA 5IMDA 2VD1A 3EVIA 1R4WA 1URMA 3ZIVA 1UC7A 1K0MA 2H0IA 3F6DA 4YKFA 1M9BA 4K6XA 2PN8A 2VLUA 5D96A 3TGZA 4EIQA 4MDCA 6GSTA 2DJ1A 3DWVA 3DD3A 3HYPA 1ZL9A 4MZBA 1XVWA 2K8VA 3DVWA 5IMAA 1YDKA 2KHPA 2B1KA 2LJKA 5A5KA 1SL1B 5HR1A 1PGTA 1BX9A 2H8LA 4IELA 2YN1A 3D21A 4G10A 3QFAC 1ZCPA 4HU9A 1GUMA 2LV3A 4IBPA 4K9ZA 22GSA 2X4AA 4TKYA 4PQ1A 2DJKA 1F3BA 2PU9C 2HSYA 3RDWA 1RK4A 1XW5A 1V2AA 1EP8A 2FD3A 4L0UA 5H5RA 3VPTA 4XHMA 5ELAA 1S3CA 2WS2A 3KMOA 1GSUA 3IE3A 4WBRD 3D0ZA 4BL7B 5J9BA 4TN8A 4XS4A 4RI7A 11GSA 2VO4A 18GSA 3VWXA 3TUEA 4JEDA 2VCWA 4KX4A 1O85A 16GSA 3GN3A 3Q74A 2YJ7A 2OBKA 1AIUA 3IPZA 1K0OA 4YKGA 5HR0A 1ERUA 1WMJA 2H1AA 3LEFA 3IV4A 4Q5FA 4HI7A 4LA1A 3F0IA 5ECLB 4QQ7A 1C72A 4BWSA 4WXTA 5DBQA 1X5EA 4BWQA 1MD3A 3QD9A 3FZ9A 1TK5B 5CREA 2X49A 2HZEA 4TR4A 4X43A 1THXA 1B4PA 1ON4A 3TKSC 5LNKe 3LXZA 2H76A 5ID2B 2GZZA 2P5QA 1LBKA 4OO5A 5CNWA 1B8XA 2DMMA 3LORA 4MA9A 2OE1A 3DKSA 3DYRA 5G31A 3OR5A 1TRUA 5DDLA 2V6KA 2HRAA 4OD7A 4KF9A 1PKZA 2YWMA 4EKZA 1Z7RA 2BTOT 4Q5RA 5GZZB 2R4VA 4POLA 3E9JB 2GGTA 5ECSA 5DVBA 4IJIA 2VLTA 2WB9A 2FGXA 3GA4A 3G7IA 1R26A 2PUKC 4NMUA 3P7XA 3VWVA 4ULXA 2CVDA 2E0QA 2H30A 1DE2A 4K0NA 2HYXA 1FOHA 4K5RA 1K0NA 2O7KA 1X9MB 4FQUA 3F6FA 3WT2A 3U6VA 3HKRA 5CO3A 2XPEA 4L5LA 1MD4A 1R5PA 3GNJA 2H01A 2FA4A 3KCMA 4NXIA 2HE3A 3EYTA 2LJAA 1XBSA 4HDEA 2H6XA 3CSIA 5CRHA 3TJBA 1GP1A 4V1Ag 3GRXA 3I69A 4GSSA 2HFDA 2R5GA 2OE0A 1MTCA 2O8VB 4JU5A 4RQRA 2DKHA 2DLXA 4ID0A 1ACVA 1ERTA 2YP6A 5ENUA 2H1BA 2IMKA 1V40A 2L6CA 1QXHA 4F03A 1AW9A 1HNCA 5FWGA 3G9BA 3VLNA 1H75A 4GQFA 1FVKA 1OVNA 2LEGA 5G5EA 4EDYA 1SJ6A 3FZAA 5HFIA 4TXVA 1EOHA 4KB3A 5AN1A 5AGYA 1SK0A 2DMLA 2MMNA 3IRAA 3A3TA 3QFBC 2K9FA 2H73A 5KOXA 3UAPA 2B5EA 2OJLA 4JR6A 3RPPA 6GSSA 1YKAA 3ZREA 5EPFA 4MJBA 1WE0A 4MPFA 5DJLA 4EC0A 3TRPA 1TK8B 1M2DA 3ZIJA 4K5SA 1FW1A 1M7TA 1JLWA 3ZMLA 1A0FA 3K8NA 2BMXA 2JL4A 2LRNA 1TTZA 2OKAA 1WPIA 3UMAA 4JZQA 5AISA 4I5QA 2C0GA 4IP6A 1M9AA 1VGLA 3TOUA 4TR1B 2MZCA 2HSMA 1E2YA 3AY8A 3FW2A 10GSA 2GLRA 4MZWA 1HD2A 1N2AA 3HVSA 4OO4A 4GQCA 1WWJA 2IPAA 1XPVA 3KTBA 1RW1A 2I1UA 2GSQA 2GVPA 4BVYA 4XTSA 1EV4A 2A4HA 3U5RE 2LRTA 2H6ZA 2VCVA 3FR3A 3UARA 2YZUA 4ZL9A 5KN2A 4ZXGA 2YNXA 4J2FA 1AQWA 2FWFA 3E0UA 4HS1A 5HQPA 5IIZA 3MDKA 1ZYQB 1EOGA 1XW6A 2VOCA 3F4RA 3IAS2 1KTEA 2VM2A 2EIRA 1NHOA 2RLIA 1OC9B 5COHA 2P31A 2WDUA 5F07A 2J9HA 3GFKA 2VL9A 3KEBA 1G6YA 1EEJA 13GSA 5DAKA 1FB0A 4GF0A 5F0GA 2AJQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UJ1 A;  1S3A A;  1NHY A;  2DJ3 A;  4KDX A;  2KOK A;  5JWQ B;  4QL7 A;  2MBT A;  2H19 A;  3KP9 A;  3IAM 2;  3LSZ A;  3QR6 A;  4OWY A;  2B5X A;  2IN3 A;  3UIW A;  3TKS E;  2CT6 A;  4OFN A;  4WF4 A;  1EGR A;  2WCI A;  3GV1 A;  2WZ9 A;  1TOF A;  2B5Y A;  5A4W A;  1JZW A;  3L9S A;  2FA8 A;  1A23 A;  3LYP A;  4KCA A;  3RAZ A;  3ZYW A;  3FHK A;  4WR5 A;  1GH2 A;  3O3T A;  4IS0 A;  1X9W B;  1EEM A;  5JCW A;  1Y6E A;  4MLY A;  3CRU A;  5HFG A;  4PGT A;  1OE7 A;  4YAP A;  2IME A;  4TR0 A;  5GAN D;  5HFK A;  1USB A;  3ME8 A;  2R3X A;  1YEX A;  2CA8 A;  1TI3 A;  2RM6 A;  3G7J A;  4MJE A;  2CV4 A;  1QFN A;  2KP1 A;  1K0D A;  1QUW A;  1AAZ A;  2HLS A;  4ZL7 A;  4IQA A;  2F51 A;  4JRR A;  2FCH A;  2OBI A;  2HRN A;  4YQV A;  2R37 A;  3TJK A;  3H8Q A;  4GST A;  1QGV A;  2DIZ A;  2AV4 A;  2GTU A;  4J56 E;  2CX3 A;  5IMV A;  4V2N A;  4K2D A;  1X5D A;  2F3M A;  1GUH A;  1SJZ A;  3HY2 A;  2AHE A;  5FT3 A;  5IQY A;  2VLV A;  3GH9 A;  4L5O A;  1YKC A;  2C3N A;  6GSX A;  3FY7 A;  4FYC A;  3KTL A;  1XFL A;  2X8C A;  4EDZ A;  5EL8 A;  4DSR A;  4KSM A;  2Z9S A;  5A4U A;  3FZ5 A;  2FWE A;  5ECP B;  4E8E A;  4F82 A;  1YQ1 A;  3P90 A;  1XW9 A;  1TP9 A;  5DAL A;  4ZBB A;  3L0H A;  5CRW A;  3DGQ A;  1Y25 A;  3PIN A;  3Q18 A;  4MF7 A;  1THO A;  2K18 A;  5CYY A;  2NTO A;  1A0R P;  1VF4 A;  3BCK A;  3GMF A;  4I6X A;  3LQ7 A;  1JLV A;  1BJX A;  2TIR A;  1EGO A;  5GST A;  2L4Q A;  2CQ9 A;  5ELG A;  5KN3 A;  4HQZ A;  4FO5 A;  2H71 A;  3FKF A;  2CVB A;  4ML6 A;  2CVK A;  1JZR A;  4V1A p;  4EXJ A;  1ZOF A;  5L71 A;  4N0Z A;  5EVO A;  4IN0 A;  5HR3 A;  5KN1 A;  3ISO A;  1YZX A;  1U6T A;  2YV9 A;  2QSI A;  6GSW A;  1JZD A;  4XS4 B;  3GX0 A;  17GS A;  1XIY A;  3ZIT A;  1O81 A;  2VL2 A;  3NIV A;  4HOJ A;  1GSS A;  2OA7 A;  2V32 A;  2AYT A;  3GKX A;  3EC3 A;  5JWR B;  3UVH A;  3D5J A;  5DCH A;  3E3E A;  3JCM L;  1R5A A;  3EUR A;  4MF6 A;  2VAF A;  1UVZ A;  3LGC A;  3HDC A;  2KUC A;  3H4K A;  2C0E A;  1A2L A;  4ISD A;  3GL5 A;  3QOU A;  1Z6M A;  3I43 A;  4MJA A;  4G9H A;  3HD5 A;  4AJ6 A;  4TXO B;  1XOA A;  4KE3 A;  5ECM B;  1T4Z A;  3F8U A;  5HR2 A;  2G2Q A;  5F05 A;  4IGJ A;  4K7N A;  4XRD A;  4TVE A;  3VI5 A;  4IHU A;  3ZLP A;  2LJR A;  3QAG A;  1PD2 1;  4Q5N A;  5J5N A;  5J41 A;  5G30 A;  1Z7P A;  1AC1 A;  2C0D A;  3W8J A;  1XWB A;  1SKW B;  1YJ6 A;  3KIJ A;  1VF1 A;  3CSH A;  4BPY A;  2GDR A;  2GT5 A;  4FH8 A;  5ECR B;  3RHC A;  5FHI A;  2BJX A;  2N5B A;  3IA1 A;  2O87 A;  4KA0 A;  3ERG A;  2WFC A;  3LYK A;  5IM9 A;  3KD0 A;  4KUN A;  1TRW A;  1E6B A;  1B9X C;  1XWC A;  2I4A A;  2CZ2 A;  5AIV A;  4YQU A;  5DJM A;  4PUA A;  2N5F A;  1W89 A;  2CX4 A;  2P5R A;  1Z9H A;  2PPT A;  1XZO A;  2GSR A;  1BYE A;  5G1L A;  2A2R A;  3NZN A;  5LCZ A;  5C04 A;  4D73 A;  4TW5 A;  2CAQ A;  5GAP D;  1LJR A;  4P3Y B;  3M0F A;  4IJ3 A;  4ZBD A;  4ZL8 A;  3EU4 A;  1AQV A;  4ZIL A;  2I3Y A;  3SBC A;  5D9X A;  1GSF A;  3EU3 A;  4PUF C;  4MK3 A;  4OCE A;  1EV9 A;  3BJ5 A;  1K3L A;  1OAZ A;  1BED A;  4DVC A;  1TDI A;  5IMF A;  2LKU A;  1PSQ A;  1OC8 A;  2VD0 A;  2JZS A;  3QMX A;  4GTU A;  2PVO C;  4N0V A;  8GSS A;  4FYB A;  3NOF A;  2GST A;  4EO3 A;  1GSQ A;  4L0W A;  1OC3 A;  3F9U A;  2V2G A;  1NW2 A;  3ZFL A;  2NBS A;  4L8E A;  4ILF A;  1Q98 A;  4ECI A;  4QL9 A;  1QQ2 A;  1S3D A;  1AUC A;  1LU4 A;  4CHS A;  2YWN A;  4G2E A;  3M3M A;  5B8A A;  9GSS A;  3FEU A;  3GST A;  4TOP A;  1M99 A;  4ACS A;  5B6N A;  2CZ3 A;  3GHA A;  3LXT A;  4X0X A;  4MH2 A;  3W6G A;  4LMW A;  4WET A;  3P2A A;  4HU7 A;  2DIY A;  5A4V A;  3TOT A;  2JAD A;  3EWL A;  1NM3 A;  2C1Y A;  1PA3 A;  1T3B A;  5ECI B;  3CTG A;  1FHE A;  4NHZ A;  3ZVJ D;  4TRX A;  3VUR A;  3TKS A;  2IMD A;  2VCT A;  1M0U A;  2DJ0 A;  1R7H A;  5D73 A;  2FY6 A;  4BVX A;  1ML6 A;  5G5F A;  5F8B A;  3TKQ A;  2PGT A;  5J9C A;  4LMV A;  1F9M A;  1O8W A;  3GIX A;  1PX6 A;  1XVQ A;  1OKT A;  2H74 A;  4NPB A;  4F0C A;  3IK7 A;  3ZFB A;  1T00 A;  3GTU B;  2ES7 A;  3C8E A;  4ZB6 A;  3EE2 A;  4WKW A;  3PH9 A;  4I2U A;  5ECO B;  4X1U A;  4XS1 A;  3D22 A;  2LNT A;  1X0R A;  3D6I A;  4H86 A;  1O73 A;  2JU5 A;  2IFQ A;  2V41 A;  4IKH A;  1A2J A;  3IC4 A;  3ZMK A;  5IPH A;  2HRF A;  2DJ2 A;  3CRT A;  5E4W A;  5B7C A;  1J0F A;  4V2L A;  1VRS D;  1GLP A;  3M1G A;  2G0F A;  3ZL5 A;  1G6W A;  3FZ4 A;  2HSH A;  4POB A;  4NHW A;  2YAN A;  4KSO A;  1SKR B;  3FRC A;  3W8S A;  2QC7 A;  2VUP A;  1SD8 A;  1XWA A;  2GT6 A;  5CRD A;  2LST A;  1T7P B;  1ERW A;  4YAV A;  1T8E B;  1K0B A;  5DAK B;  4TR1 A;  3GH6 A;  5IMC A;  2D2Z A;  1WP0 A;  5B8B A;  2X8H A;  1NSW A;  4AF2 A;  2VM1 A;  5B6M A;  5INY A;  1WIK A;  1GUK A;  1ZGN A;  2A4V A;  4KGI A;  3IHQ A;  3LWA A;  1VF2 A;  2XC2 A;  1HQO A;  5F06 A;  5JCG A;  4ECC A;  2OAC A;  2N5A A;  4MMM A;  1AXD A;  3TRX A;  1EWX A;  2EIO A;  3ERW A;  3QDN A;  1PKW A;  2GZP A;  3VFI A;  3UBL A;  2IWT A;  2IMI A;  3A2W A;  3IOS A;  1A2M A;  5GSS A;  2NDO A;  3KMN A;  1M2A A;  5IO0 A;  4DSS A;  1V9W A;  1O6J A;  4AJ8 A;  2DJJ A;  3LG6 A;  2IMF A;  3DVX A;  4K8M A;  1A24 A;  3IR4 A;  1OYJ A;  4WR4 A;  4Z7X A;  1T1V A;  2C4J A;  2B7J A;  2WJU A;  4GRF A;  12GS A;  1PL2 A;  4ECJ A;  2HI7 A;  3DEX A;  2GSS A;  1EZK A;  2GQL A;  4IVF A;  2ALB A;  1DSB A;  4GSN A;  2VCQ A;  1BQ7 A;  4N11 A;  2E2M A;  1DBY A;  3TKR A;  5JWO B;  4PXO A;  4KDY A;  4KH7 A;  2NVL A;  2VL3 A;  3A5W A;  4KAE A;  2H0H A;  2ZNM A;  5EY6 A;  1AQX A;  1ILO A;  4AJ7 A;  4V2M A;  1XWG A;  1MDK A;  4GCI A;  2REM A;  2JSZ A;  4JE1 A;  2F8F A;  1VF3 A;  1K0A A;  2GZY A;  3F3R A;  3GX8 A;  4XRA A;  1SL0 B;  1B48 A;  2C0F A;  2ZCT A;  3WD6 A;  2LRC A;  2C8U A;  3BD2 A;  3I6A A;  2GQK A;  2FWH A;  3FYG A;  2PBJ A;  1SJI A;  3I9V 2;  5E59 A;  3F4S A;  2X64 A;  2F9S A;  2O89 A;  3EMX A;  2LS5 A;  1GWC A;  1QMV A;  4N10 A;  4CDO A;  2XBI A;  5DQY A;  1HNA A;  2DSA A;  1MEK A;  4O32 A;  4K1F A;  1SEN A;  2V6O A;  1OKD A;  4BA7 A;  4EL1 A;  2IJY A;  1JHB A;  1F37 A;  1G7E A;  1GTB A;  1U87 A;  2H0G A;  4Q5Q A;  1KEB A;  1GNE A;  3US3 A;  1FAA A;  2KLX A;  3HZ4 A;  4KND A;  3G7Y A;  4HJ2 A;  4K7I A;  1U3A A;  2LQQ A;  4GWR A;  4OFM A;  6GSU A;  3A2V A;  3V1W A;  3FR9 A;  3MWH A;  2R2J A;  1XXU A;  1J08 A;  1ZZY A;  2TRC P;  4KCE A;  4ZIJ A;  3KXO A;  3A2X A;  3GYK A;  3F63 A;  3KGK A;  3ED3 A;  2M46 A;  1GTU A;  4MPG A;  2L5L A;  4K0G A;  4JBB A;  1SL2 B;  1PMT A;  4WF5 A;  1F2E A;  4HQS A;  2QKE A;  3H1N A;  4PX1 A;  3C7M A;  2PWJ A;  4NV5 A;  2MMA A;  2VCX A;  1GSE A;  1W4V A;  2YZH A;  1Z6N A;  4HZ4 A;  4LL4 B;  1PRX A;  4RQX A;  2MMO A;  5AIX A;  4MJC A;  4IP1 A;  1GSD A;  2I81 A;  3D4T A;  1FG4 A;  2FLS A;  2MBS A;  1MDI A;  3HXS A;  1GL8 A;  2L4C A;  1GNW A;  3HCZ A;  2ON7 A;  3FR6 A;  2RUF A;  3LJR A;  1SU9 A;  3UBK A;  2LNS A;  2PMT A;  5D9T A;  5CP1 A;  4JR4 A;  3WGD A;  2LQO A;  3WGX A;  3IK9 A;  3CBU A;  3DXB A;  2WGR A;  1DE1 A;  1SKS B;  2JAC A;  4MH3 A;  2PVQ A;  4I8B A;  2J23 A;  2A2S A;  3GUR A;  3VWU A;  2HZE B;  3APQ A;  1SYR A;  5ECK B;  2L6D A;  4OMV A;  4MAB A;  5IMZ A;  1TXX A;  3Q6O A;  3C73 A;  4BL7 A;  1DUG A;  2HT9 A;  4MP4 A;  3ME7 A;  1I9D A;  4GXZ A;  2GQM A;  5DQS A;  5JCU A;  4ECB A;  2MMZ A;  1FB6 A;  4FYU A;  2E7P A;  1FOV A;  1X9S B;  3HJP A;  3S9F A;  3N9J A;  5ABR A;  3H93 A;  2H1D A;  2FNO A;  4TXO A;  3Q19 A;  1U88 A;  3QCP A;  4CW9 A;  3KP8 A;  3APO A;  4D73 B;  1F3A A;  5IOX A;  1HNB A;  3TJF A;  3RBT A;  2GS3 A;  1I5G A;  3VPQ A;  2DBC A;  5IO2 A;  3KM6 A;  4NAX A;  2K6V A;  2X8G A;  2YOI A;  3HVV A;  3QAV A;  1OE8 A;  4YQM A;  3ZVJ A;  2K8S A;  2H6Y A;  2FHE A;  1IYI A;  1TRS A;  1ZYE A;  4EF0 A;  5D8I A;  2L57 A;  3D4M A;  4LL1 B;  6GSV A;  1ABA A;  5ID2 A;  4J57 E;  1TJD A;  3QAW A;  1TRV A;  3TB2 A;  2L59 A;  2X99 A;  5DCG A;  1A8Y A;  2H1G A;  4YH2 A;  3M9J A;  2IL3 A;  4F0B A;  1GTA A;  2EIQ A;  2EC4 A;  3WT1 A;  1KBN A;  7GSS A;  1N8J A;  2QGV A;  5G1K A;  5ECQ B;  1GTI A;  1TU7 A;  3UL3 A;  1K3Y A;  3HZ8 A;  3PR8 A;  1V57 A;  3LFL A;  4MCU A;  2R6K A;  3KZQ A;  1FO5 A;  2XBQ A;  1G0T A;  4ZB9 A;  3SWL A;  1XCC A;  2HNL A;  1TU8 A;  3WGE A;  3GKM A;  2WRT A;  3L9V A;  5D9V A;  3MNG A;  1GLQ A;  1JZO A;  2B6M A;  3TJG A;  4EVM A;  3DRN A;  1XWK A;  1M2B A;  2XHF A;  2F8A A;  3ZRD A;  1SD9 A;  4NWY A;  3TJJ A;  3J7Y b;  1HYU A;  1TK0 B;  3TRQ A;  1GUL A;  5J3R A;  4F9Z A;  1JFU A;  2ON5 A;  2PER A;  2YV7 A;  20GS A;  1ERV A;  3TCO A;  3ERF A;  1PX7 A;  3BOA A;  3O6T A;  4OCF A;  2RUE A;  1O7U A;  4GLT A;  5LD0 A;  4TR3 A;  1PQN A;  4PQH A;  3IBH A;  3C1S A;  5CAX A;  1X5C A;  3GSS A;  2H66 A;  3BBY A;  3FK8 A;  4ZB8 A;  3KH9 A;  1SK1 A;  3M8N A;  2IFQ B;  5C00 A;  3CSJ A;  4E8H A;  3BCI A;  1T4Y A;  2RII A;  3MAK A;  2P0G A;  1YY7 A;  5H5S A;  1J9B A;  4POM A;  3MSZ A;  1YF0 A;  4OFT A;  1RQM A;  1YF1 A;  2JZT A;  3CYN A;  4N30 A;  2JZR A;  4XCS A;  2YWI A;  4ML1 A;  2MYG A;  2C3T A;  2H75 A;  2VIM A;  3EMP A;  3GL3 A;  4AGS A;  3L9U A;  3F3Q A;  5H5Q A;  1MDJ A;  2HZF A;  2CAI A;  3HJM A;  2V1M A;  3UVT A;  3GTU A;  3P8W A;  1CQH A;  1WJK A;  3IXR A;  4MZC A;  3L78 A;  1QK8 A;  4WEY A;  1TW9 A;  1TKD B;  5IPG A;  4NV2 A;  2LTK A;  2FUG 2;  4XIH A;  2LUS A;  1B4Q A;  3PGT A;  3GKN A;  2IIY A;  4G19 A;  1Z5Y E;  3M9K A;  4KDU A;  3C1R A;  3DIE A;  1G7O A;  4DSS B;  4POK A;  2H70 A;  3HVX A;  3RPN A;  1UN2 A;  5ECN B;  1BAY A;  3R2Q A;  4RI6 A;  1YEP A;  4PQI A;  4DSQ A;  4XS6 A;  2FWG A;  1A8L A;  1BG5 A;  3CMI A;  3CTF A;  3UOM A;  4KW6 A;  2KP2 A;  3RHB A;  2I9H A;  3APS A;  1SK2 A;  4EE0 A;  1V98 A;  19GS A;  5KEJ A;  4IQ1 A;  1OC9 A;  5D9W A;  2NPB A;  3TDG A;  2B7K A;  1K0C A;  3TKP A;  3HA9 A;  1XOB A;  4HJM A;  3H79 A;  2OAD A;  3IDV A;  1O8X A;  5J4U A;  3J7Y k;  4I2T A;  3HHV A;  3HJO A;  1IYH A;  2B1L A;  4IW9 A;  1PN9 A;  4PNG A;  3L4N A;  1WOU A;  6GSY A;  3EIN A;  1KNG A;  2DC5 A;  1GRX A;  5ECH B;  5D93 A;  4I97 A;  3QPM A;  2C3Q A;  3VK9 A;  2O85 A;  2VCZ A;  4ZBA A;  4PUR A;  1ST9 A;  4O5R A;  3GUS A;  1GSY A;  3VWW A;  3ZTL A;  5IOW A;  2E2G A;  2M72 A;  4EUY A;  2YJH A;  1WRY A;  5G2Z A;  1ZMA A;  2C80 A;  2L5O A;  2RM5 A;  1CQG A;  5KN0 A;  1UA5 A;  3ZZX A;  2YCD A;  2HXK A;  2AB6 A;  2VL2 C;  3C71 A;  1PL1 A;  1Z3E A;  4MF5 A;  4HZ2 A;  1V58 A;  2YWO A;  5CRG A;  3UEM A;  4K7O A;  4FIW A;  3KH7 A;  1B9Y C;  4DEJ A;  3VI7 A;  3KJY A;  2H72 A;  2ZUP A;  1Q4J A;  4RUV A;  4HEA 2;  2XPD A;  4PNF A;  3CXG A;  2OE3 A;  1EP7 A;  3GKK A;  2YPM A;  4WBJ A;  4O7H A;  1F6M C;  4F2I A;  3N5O A;  2AUV A;  1U3I A;  4O92 A;  1SYX A;  3DML A;  1H4O A;  1TI1 A;  2JSY A;  5DAL B;  3O76 A;  2AAW A;  4LLR A;  2M80 A;  1FVJ A;  2WUL A;  2TRX A;  1K3O A;  4HUA A;  3WYW A;  3F4T A;  2B3S A;  14GS A;  5IMD A;  2VD1 A;  3EVI A;  1R4W A;  1URM A;  3ZIV A;  1UC7 A;  1K0M A;  2H0I A;  3F6D A;  1M9B A;  4K6X A;  2PN8 A;  2VLU A;  5D96 A;  3TGZ A;  4MDC A;  6GST A;  2DJ1 A;  3DWV A;  3DD3 A;  3HYP A;  1ZL9 A;  4MZB A;  1XVW A;  2K8V A;  3DVW A;  5IMA A;  1YDK A;  2KHP A;  2B1K A;  2LJK A;  5A5K A;  1SL1 B;  5HR1 A;  1PGT A;  1BX9 A;  2H8L A;  4IEL A;  2YN1 A;  3D21 A;  4G10 A;  3QFA C;  1ZCP A;  4HU9 A;  1GUM A;  2LV3 A;  4IBP A;  4K9Z A;  22GS A;  4TKY A;  4PQ1 A;  2DJK A;  1F3B A;  2PU9 C;  2HSY A;  3RDW A;  1RK4 A;  1XW5 A;  1V2A A;  1EP8 A;  2FD3 A;  4L0U A;  5H5R A;  3VPT A;  4XHM A;  5ELA A;  1S3C A;  2WS2 A;  3KMO A;  1GSU A;  3IE3 A;  4WBR D;  3D0Z A;  5J9B A;  4TN8 A;  4XS4 A;  4RI7 A;  11GS A;  2VO4 A;  18GS A;  3VWX A;  3TUE A;  4JED A;  2VCW A;  4KX4 A;  1O85 A;  16GS A;  3GN3 A;  3Q74 A;  2YJ7 A;  2OBK A;  1AIU A;  3IPZ A;  1K0O A;  5HR0 A;  1ERU A;  1WMJ A;  2H1A A;  3LEF A;  3IV4 A;  4Q5F A;  4HI7 A;  4LA1 A;  3F0I A;  5ECL B;  4QQ7 A;  1C72 A;  4BWS A;  4WXT A;  5DBQ A;  1X5E A;  4BWQ A;  1MD3 A;  3QD9 A;  3FZ9 A;  1TK5 B;  5CRE A;  2HZE A;  4TR4 A;  4X43 A;  1THX A;  1B4P A;  1ON4 A;  3TKS C;  5LNK e;  3LXZ A;  2H76 A;  5ID2 B;  2GZZ A;  2P5Q A;  1LBK A;  4OO5 A;  5CNW A;  1B8X A;  2DMM A;  3LOR A;  4MA9 A;  2OE1 A;  3DKS A;  3DYR A;  5G31 A;  3OR5 A;  1TRU A;  5DDL A;  2V6K A;  4OD7 A;  1PKZ A;  2YWM A;  4EKZ A;  1Z7R A;  2BTO T;  4Q5R A;  5GZZ B;  2R4V A;  4POL A;  3E9J B;  2GGT A;  5ECS A;  5DVB A;  4IJI A;  2VLT A;  2WB9 A;  2FGX A;  3GA4 A;  3G7I A;  1R26 A;  2PUK C;  4NMU A;  3P7X A;  3VWV A;  4ULX A;  2CVD A;  2E0Q A;  2H30 A;  1DE2 A;  4K0N A;  2HYX A;  1K0N A;  2O7K A;  1X9M B;  3F6F A;  3WT2 A;  3U6V A;  3HKR A;  5CO3 A;  2XPE A;  4L5L A;  1MD4 A;  1R5P A;  3GNJ A;  2H01 A;  2FA4 A;  3KCM A;  4NXI A;  2HE3 A;  3EYT A;  2LJA A;  1XBS A;  4HDE A;  2H6X A;  3CSI A;  5CRH A;  3TJB A;  1GP1 A;  4V1A g;  3GRX A;  3I69 A;  4GSS A;  2HFD A;  2R5G A;  2OE0 A;  1MTC A;  2O8V B;  4JU5 A;  4RQR A;  2DLX A;  4ID0 A;  1ACV A;  1ERT A;  2YP6 A;  5ENU A;  2H1B A;  2IMK A;  1V40 A;  2L6C A;  1QXH A;  4F03 A;  1AW9 A;  1HNC A;  5FWG A;  3G9B A;  3VLN A;  1H75 A;  4GQF A;  1FVK A;  1OVN A;  2LEG A;  5G5E A;  4EDY A;  1SJ6 A;  3FZA A;  5HFI A;  4TXV A;  1EOH A;  4KB3 A;  5AN1 A;  5AGY A;  1SK0 A;  2DML A;  2MMN A;  3IRA A;  3A3T A;  3QFB C;  2K9F A;  2H73 A;  3UAP A;  2B5E A;  2OJL A;  4JR6 A;  3RPP A;  6GSS A;  1YKA A;  3ZRE A;  5EPF A;  4MJB A;  1WE0 A;  4MPF A;  5DJL A;  4EC0 A;  3TRP A;  1TK8 B;  1M2D A;  3ZIJ A;  1FW1 A;  1M7T A;  1JLW A;  3ZML A;  1A0F A;  3K8N A;  2BMX A;  2JL4 A;  2LRN A;  1TTZ A;  2OKA A;  1WPI A;  3UMA A;  4JZQ A;  5AIS A;  4I5Q A;  2C0G A;  4IP6 A;  1M9A A;  1VGL A;  3TOU A;  4TR1 B;  2MZC A;  1E2Y A;  3AY8 A;  3FW2 A;  10GS A;  2GLR A;  4MZW A;  1HD2 A;  1N2A A;  3HVS A;  4OO4 A;  4GQC A;  1WWJ A;  2IPA A;  1XPV A;  3KTB A;  1RW1 A;  2I1U A;  2GSQ A;  2GVP A;  4BVY A;  4XTS A;  1EV4 A;  3U5R E;  2LRT A;  2H6Z A;  2VCV A;  3FR3 A;  3UAR A;  2YZU A;  4ZL9 A;  5KN2 A;  4ZXG A;  2YNX A;  4J2F A;  1AQW A;  2FWF A;  3E0U A;  4HS1 A;  5HQP A;  5IIZ A;  3MDK A;  1ZYQ B;  1EOG A;  1XW6 A;  2VOC A;  3F4R A;  3IAS 2;  1KTE A;  2VM2 A;  2EIR A;  1NHO A;  2RLI A;  1OC9 B;  5COH A;  2P31 A;  2WDU A;  5F07 A;  2J9H A;  3GFK A;  2VL9 A;  3KEB A;  1G6Y A;  1EEJ A;  13GS A;  5DAK A;  1FB0 A;  4GF0 A;  5F0G A;  2AJQ B; 
#chains in the Genus database with same CATH topology
 3UJ1 A;  1S3A A;  1NHY A;  2DJ3 A;  4KDX A;  2KOK A;  5JWQ B;  4QL7 A;  2MBT A;  2H19 A;  3KP9 A;  3IAM 2;  3LSZ A;  3QR6 A;  4OWY A;  4G0L A;  2B5X A;  2IN3 A;  3UIW A;  3TKS E;  2CT6 A;  4OFN A;  4WF4 A;  2R0G A;  1EGR A;  2WCI A;  3GV1 A;  2WZ9 A;  1TOF A;  2B5Y A;  5A4W A;  1JZW A;  3L9S A;  2FA8 A;  1A23 A;  3LYP A;  4KCA A;  3RAZ A;  3ZYW A;  3FHK A;  4WR5 A;  1GH2 A;  3O3T A;  4IS0 A;  1X9W B;  1EEM A;  5JCW A;  1Y6E A;  4MLY A;  3CRU A;  5HFG A;  4PGT A;  1OE7 A;  4YAP A;  2IME A;  4TR0 A;  5GAN D;  5HFK A;  1USB A;  3ME8 A;  2R3X A;  1YEX A;  2CA8 A;  1TI3 A;  2RM6 A;  3G7J A;  4MJE A;  2CV4 A;  1QFN A;  2KP1 A;  3IHG A;  1K0D A;  1QUW A;  1AAZ A;  2HLS A;  4ZL7 A;  4IQA A;  2F51 A;  4JRR A;  2FCH A;  2OBI A;  2HRN A;  4YQV A;  2R37 A;  3TJK A;  3H8Q A;  4GST A;  1QGV A;  2DIZ A;  2AV4 A;  2GTU A;  4J56 E;  4G0K A;  2CX3 A;  5IMV A;  4V2N A;  4K2D A;  1X5D A;  2F3M A;  1GUH A;  1SJZ A;  3HY2 A;  2AHE A;  5FT3 A;  5IQY A;  2VLV A;  3GH9 A;  4L5O A;  1YKC A;  2C3N A;  6GSX A;  4A5P A;  3FY7 A;  4FYC A;  3KTL A;  1XFL A;  2X8C A;  4EDZ A;  5EL8 A;  4DSR A;  4KSM A;  2Z9S A;  5A4U A;  3FZ5 A;  2FWE A;  5ECP B;  4E8E A;  4F82 A;  1YQ1 A;  3P90 A;  1XW9 A;  1TP9 A;  5DAL A;  4ZBB A;  3L0H A;  5CRW A;  3DGQ A;  1Y25 A;  3PIN A;  3Q18 A;  4MF7 A;  1THO A;  2K18 A;  5CYY A;  2NTO A;  1A0R P;  1VF4 A;  3BCK A;  3GMF A;  4I6X A;  3LQ7 A;  1JLV A;  1BJX A;  2TIR A;  1EGO A;  5GST A;  2L4Q A;  2CQ9 A;  5ELG A;  5KN3 A;  4HQZ A;  4FO5 A;  2H71 A;  3FKF A;  2CVB A;  4ML6 A;  2CVK A;  1JZR A;  4V1A p;  4EXJ A;  1ZOF A;  5L71 A;  4N0Z A;  5EVO A;  4IN0 A;  5HR3 A;  5KN1 A;  3ISO A;  1YZX A;  1U6T A;  2YV9 A;  2QSI A;  6GSW A;  1JZD A;  4XS4 B;  3GX0 A;  17GS A;  1XIY A;  3ZIT A;  1O81 A;  2VL2 A;  3NIV A;  4HOJ A;  1GSS A;  2OA7 A;  2V32 A;  2AYT A;  3GKX A;  4Z2U A;  3EC3 A;  5JWR B;  3UVH A;  3D5J A;  5DCH A;  3E3E A;  3JCM L;  1R5A A;  3EUR A;  4MF6 A;  2VAF A;  1UVZ A;  3LGC A;  3HDC A;  2KUC A;  3H4K A;  2C0E A;  1A2L A;  4ISD A;  3GL5 A;  3QOU A;  1Z6M A;  3I43 A;  4MJA A;  4G9H A;  3HD5 A;  4AJ6 A;  4TXO B;  1XOA A;  4KE3 A;  5ECM B;  1T4Z A;  3F8U A;  5HR2 A;  2G2Q A;  5F05 A;  4IGJ A;  4K7N A;  4XRD A;  4TVE A;  3VI5 A;  4IHU A;  3ZLP A;  2LJR A;  3QAG A;  1PD2 1;  4Q5N A;  5J5N A;  5J41 A;  5G30 A;  1Z7P A;  1AC1 A;  2C0D A;  3W8J A;  1XWB A;  1SKW B;  1YJ6 A;  3KIJ A;  1VF1 A;  3CSH A;  4BPY A;  2GDR A;  2GT5 A;  4FH8 A;  5ECR B;  3RHC A;  5FHI A;  2BJX A;  2N5B A;  3IA1 A;  1M3J A;  2O87 A;  4KA0 A;  3ERG A;  2WFC A;  3LYK A;  5IM9 A;  3KD0 A;  4KUN A;  1TRW A;  1E6B A;  1B9X C;  1XWC A;  2I4A A;  1PN0 A;  2CZ2 A;  5AIV A;  4YQU A;  5DJM A;  4PUA A;  2N5F A;  1W89 A;  2CX4 A;  2P5R A;  1Z9H A;  2PPT A;  1XZO A;  2GSR A;  1BYE A;  5G1L A;  2A2R A;  4MNN A;  3NZN A;  5LCZ A;  5C04 A;  4D73 A;  4TW5 A;  2CAQ A;  5GAP D;  1LJR A;  4P3Y B;  3M0F A;  4IJ3 A;  4O5U A;  4ZBD A;  4ZL8 A;  3EU4 A;  1AQV A;  4ZIL A;  2I3Y A;  3SBC A;  5D9X A;  1GSF A;  3PPU A;  3EU3 A;  4PUF C;  4MK3 A;  4OCE A;  1EV9 A;  2HRK A;  3BJ5 A;  1K3L A;  1OAZ A;  1BED A;  4DVC A;  1TDI A;  5IMF A;  2LKU A;  1PSQ A;  1OC8 A;  2VD0 A;  2JZS A;  3QMX A;  3MYD A;  4GTU A;  2PVO C;  4N0V A;  8GSS A;  4FYB A;  3NOF A;  2GST A;  4EO3 A;  1GSQ A;  4L0W A;  1OC3 A;  3F9U A;  2V2G A;  1NW2 A;  3ZFL A;  2NBS A;  4L8E A;  4ILF A;  1Q98 A;  4ECI A;  4QL9 A;  1QQ2 A;  1S3D A;  1AUC A;  1LU4 A;  4CHS A;  2YWN A;  4G2E A;  3M3M A;  5B8A A;  9GSS A;  3FEU A;  3GST A;  4TOP A;  1M99 A;  4ACS A;  5B6N A;  2CZ3 A;  3GHA A;  3LXT A;  2QA1 A;  4X0X A;  4MH2 A;  3W6G A;  4LMW A;  4K2X A;  4WET A;  3P2A A;  4HU7 A;  2DIY A;  5A4V A;  3TOT A;  2JAD A;  3CQF A;  3EWL A;  1NM3 A;  2C1Y A;  1PA3 A;  1T3B A;  5ECI B;  3CTG A;  1FHE A;  4NHZ A;  3ZVJ D;  4TRX A;  3VUR A;  3TKS A;  2IMD A;  4PTS A;  2VCT A;  1M0U A;  2DJ0 A;  1R7H A;  5D73 A;  2FY6 A;  4BVX A;  1ML6 A;  5G5F A;  5F8B A;  3TKQ A;  2PGT A;  5J9C A;  4LMV A;  1F9M A;  1O8W A;  3GIX A;  1PX6 A;  1S3R A;  1XVQ A;  1OKT A;  4USS A;  2H74 A;  4NPB A;  4F0C A;  3IK7 A;  3ZFB A;  1T00 A;  4EIP A;  3GTU B;  2ES7 A;  3C8E A;  4ZB6 A;  3EE2 A;  4WKW A;  3PH9 A;  4I2U A;  5ECO B;  4X1U A;  4XS1 A;  3D22 A;  2LNT A;  1X0R A;  3D6I A;  4H86 A;  1O73 A;  2JU5 A;  2IFQ A;  2V41 A;  4IKH A;  4BVY B;  1A2J A;  3IC4 A;  3ZMK A;  5IPH A;  2HRF A;  2DJ2 A;  3CRT A;  5E4W A;  5B7C A;  1J0F A;  4V2L A;  1VRS D;  1GLP A;  3M1G A;  2G0F A;  3ZL5 A;  2A2P A;  1G6W A;  3FZ4 A;  2HSH A;  4POB A;  4NHW A;  2YAN A;  4KSO A;  1SKR B;  3FRC A;  3W8S A;  2QC7 A;  2VUP A;  1SD8 A;  1XWA A;  2GT6 A;  5CRD A;  2LST A;  4G0I A;  2DKI A;  1T7P B;  1ERW A;  4YAV A;  1T8E B;  1K0B A;  5DAK B;  4Z2T A;  4TR1 A;  3GH6 A;  5IMC A;  2D2Z A;  1WP0 A;  5B8B A;  2X8H A;  1NSW A;  4AF2 A;  2VM1 A;  5B6M A;  5INY A;  1WIK A;  1GUK A;  1ZGN A;  2A4V A;  4KGI A;  3IHQ A;  3LWA A;  1VF2 A;  2XC2 A;  1HQO A;  5F06 A;  5JCG A;  4ECC A;  2OAC A;  2N5A A;  4MMM A;  4HSC X;  1AXD A;  3TRX A;  1EWX A;  2EIO A;  3ERW A;  3QDN A;  1PKW A;  2GZP A;  3VFI A;  3UBL A;  5KOW A;  2IWT A;  2IMI A;  3A2W A;  3IOS A;  1A2M A;  5GSS A;  2NDO A;  3KMN A;  1M2A A;  5IO0 A;  4DSS A;  1V9W A;  1O6J A;  4AJ8 A;  2DJJ A;  3LG6 A;  2IMF A;  3DVX A;  4K8M A;  1A24 A;  3IR4 A;  1OYJ A;  4WR4 A;  4Z7X A;  1T1V A;  2C4J A;  2B7J A;  2WJU A;  4GRF A;  12GS A;  1PL2 A;  4ECJ A;  4CY8 A;  2HI7 A;  3DEX A;  4O5Q A;  2GSS A;  1EZK A;  2GQL A;  4IVF A;  2ALB A;  1DSB A;  4X4J A;  4GSN A;  3MIX A;  2VCQ A;  1BQ7 A;  4N11 A;  2E2M A;  1DBY A;  3LW9 A;  3TKR A;  5JWO B;  4PXO A;  4KDY A;  4KH7 A;  2NVL A;  2VL3 A;  3A5W A;  4KAE A;  2H0H A;  2ZNM A;  5EY6 A;  1AQX A;  1ILO A;  4AJ7 A;  4V2M A;  1XWG A;  1MDK A;  4GCI A;  2REM A;  2JSZ A;  4JE1 A;  2F8F A;  1VF3 A;  1K0A A;  2GZY A;  3F3R A;  3GX8 A;  4XRA A;  1SL0 B;  1B48 A;  2C0F A;  2ZCT A;  3WD6 A;  2LRC A;  2C8U A;  3BD2 A;  3I6A A;  2GQK A;  2FWH A;  3FYG A;  2PBJ A;  1SJI A;  3I9V 2;  5E59 A;  3F4S A;  2X64 A;  3R3E A;  2F9S A;  2O89 A;  3EMX A;  2LS5 A;  1GWC A;  1QMV A;  4N10 A;  4CDO A;  2XBI A;  5DQY A;  1HNA A;  2DSA A;  1MEK A;  4O32 A;  4K1F A;  1SEN A;  2V6O A;  1OKD A;  1M3I A;  4BA7 A;  4EL1 A;  2IJY A;  1JHB A;  1F37 A;  1G7E A;  1GTB A;  1U87 A;  2H0G A;  4Q5Q A;  1KEB A;  1GNE A;  3US3 A;  1FAA A;  2KLX A;  3HZ4 A;  4KND A;  3G7Y A;  4HJ2 A;  4K7I A;  1U3A A;  2LQQ A;  4GWR A;  4OFM A;  6GSU A;  3A2V A;  3V1W A;  3FR9 A;  3MWH A;  2R2J A;  1XXU A;  1J08 A;  1ZZY A;  2TRC P;  4KCE A;  4ZIJ A;  3KXO A;  3A2X A;  3GYK A;  3F63 A;  3KGK A;  5BRT A;  3ED3 A;  2M46 A;  1GTU A;  4MPG A;  2L5L A;  4K0G A;  4JBB A;  1SL2 B;  1PMT A;  1XG8 A;  4WF5 A;  1F2E A;  4HQS A;  2QKE A;  3A5I A;  2R0C A;  3H1N A;  4PX1 A;  3C7M A;  2PWJ A;  4NV5 A;  2MMA A;  2VCX A;  1GSE A;  1W4V A;  2YZH A;  1Z6N A;  4HZ4 A;  4LL4 B;  1PRX A;  4RQX A;  2MMO A;  5AIX A;  4MJC A;  4IP1 A;  1GSD A;  2I81 A;  3D4T A;  1FG4 A;  2FLS A;  2MBS A;  1MDI A;  3HXS A;  1GL8 A;  2L4C A;  1GNW A;  3HCZ A;  2ON7 A;  3FR6 A;  2RUF A;  3LJR A;  1SU9 A;  3UBK A;  2LNS A;  2PMT A;  5D9T A;  5CP1 A;  4JR4 A;  3WGD A;  2LQO A;  3WGX A;  3IK9 A;  3CBU A;  3DXB A;  2WGR A;  1DE1 A;  1SKS B;  2JAC A;  4MH3 A;  2PVQ A;  4I8B A;  2J23 A;  2A2S A;  3GUR A;  3VWU A;  2HZE B;  3APQ A;  1SYR A;  5ECK B;  2L6D A;  4OMV A;  4MAB A;  5IMZ A;  1TXX A;  3Q6O A;  3C73 A;  3EPT A;  4Z2R A;  4BL7 A;  1DUG A;  2HT9 A;  4MP4 A;  3ME7 A;  1I9D A;  4GXZ A;  2GQM A;  5DQS A;  5JCU A;  4ECB A;  2MMZ A;  1FB6 A;  4FYU A;  2E7P A;  1FOV A;  1X9S B;  3HJP A;  3S9F A;  3N9J A;  5ABR A;  3H93 A;  2H1D A;  2FNO A;  4TXO A;  3Q19 A;  1U88 A;  3QCP A;  4CW9 A;  5BMU A;  3KP8 A;  3APO A;  4D73 B;  1F3A A;  5IOX A;  1HNB A;  3TJF A;  3RBT A;  2GS3 A;  2UZ8 A;  1I5G A;  3VPQ A;  2DBC A;  5IO2 A;  3KM6 A;  4NAX A;  2K6V A;  2X8G A;  2YOI A;  3HVV A;  3QAV A;  1OE8 A;  4YQM A;  3ZVJ A;  2K8S A;  2H6Y A;  2FHE A;  1IYI A;  1TRS A;  1ZYE A;  4EF0 A;  2QA2 A;  5D8I A;  2L57 A;  3D4M A;  4LL1 B;  6GSV A;  1ABA A;  5ID2 A;  4J57 E;  1TJD A;  3QAW A;  1TRV A;  3TB2 A;  3IC8 A;  2L59 A;  2X99 A;  5DCG A;  1A8Y A;  2H1G A;  4YH2 A;  3M9J A;  2IL3 A;  4F0B A;  1GTA A;  2EIQ A;  2EC4 A;  3WT1 A;  1KBN A;  7GSS A;  1N8J A;  2QGV A;  4ICY A;  5G1K A;  5ECQ B;  1GTI A;  1TU7 A;  3UL3 A;  1K3Y A;  3HZ8 A;  3PR8 A;  1V57 A;  3LFL A;  4MCU A;  2R6K A;  3KZQ A;  1FO5 A;  2XBQ A;  1G0T A;  4ZB9 A;  3SWL A;  1XCC A;  2HNL A;  1TU8 A;  3WGE A;  3GKM A;  2WRT A;  3L9V A;  5D9V A;  3MNG A;  1GLQ A;  4CY6 A;  1JZO A;  2B6M A;  3TJG A;  4EVM A;  3DRN A;  1XWK A;  1M2B A;  2XHF A;  2F8A A;  3ZRD A;  1SD9 A;  4NWY A;  3TJJ A;  3J7Y b;  1HYU A;  4BVX B;  1TK0 B;  3TRQ A;  1GUL A;  5J3R A;  4F9Z A;  1JFU A;  2ON5 A;  2PER A;  2YV7 A;  20GS A;  1ERV A;  3TCO A;  3ERF A;  1PX7 A;  3BOA A;  3O6T A;  4OCF A;  2RUE A;  1O7U A;  4GLT A;  5LD0 A;  4TR3 A;  1PQN A;  4PQH A;  3IBH A;  3C1S A;  5CAX A;  1X5C A;  3GSS A;  2H66 A;  3BBY A;  3FK8 A;  4ZB8 A;  1ZYN A;  3KH9 A;  1SK1 A;  3M8N A;  2IFQ B;  2R0P A;  5C00 A;  3CSJ A;  4E8H A;  3BCI A;  1T4Y A;  2RII A;  3MAK A;  2P0G A;  1YY7 A;  5H5S A;  1J9B A;  4POM A;  3MSZ A;  1YF0 A;  4OFT A;  1RQM A;  1YF1 A;  2JZT A;  3CYN A;  4N30 A;  2JZR A;  4XCS A;  2YWI A;  4ML1 A;  2MYG A;  2C3T A;  2H75 A;  2VIM A;  3EMP A;  3GL3 A;  4AGS A;  3L9U A;  3F3Q A;  5H5Q A;  1MDJ A;  2HZF A;  2CAI A;  3HJM A;  2V1M A;  3UVT A;  3GTU A;  3P8W A;  1CQH A;  1WJK A;  3IXR A;  4MZC A;  3L78 A;  1QK8 A;  4WEY A;  1TW9 A;  1ZYP A;  1TKD B;  5IPG A;  4NV2 A;  2LTK A;  2FUG 2;  4XIH A;  2LUS A;  1B4Q A;  3PGT A;  3GKN A;  2IIY A;  4G19 A;  1Z5Y E;  3M9K A;  4KDU A;  3C1R A;  3DIE A;  1G7O A;  4DSS B;  4POK A;  2H70 A;  3HVX A;  3RPN A;  1UN2 A;  5ECN B;  1BAY A;  3R2Q A;  4RI6 A;  1YEP A;  4PQI A;  4DSQ A;  4XS6 A;  2FWG A;  1A8L A;  1BG5 A;  3CMI A;  3CTF A;  3UOM A;  4KW6 A;  2KP2 A;  3RHB A;  2I9H A;  3APS A;  1SK2 A;  4EE0 A;  1V98 A;  19GS A;  5KEJ A;  4IQ1 A;  1OC9 A;  5D9W A;  2NPB A;  3TDG A;  2B7K A;  1K0C A;  3TKP A;  3HA9 A;  1XOB A;  4HJM A;  3H79 A;  2OAD A;  3IDV A;  1O8X A;  1PFO A;  5J4U A;  3J7Y k;  4I2T A;  3HHV A;  3HJO A;  1IYH A;  2B1L A;  4IW9 A;  1PN9 A;  4PNG A;  3L4N A;  1WOU A;  6GSY A;  3EIN A;  1KNG A;  2DC5 A;  1GRX A;  5ECH B;  5D93 A;  4I97 A;  3QPM A;  2C3Q A;  3VK9 A;  2O85 A;  2VCZ A;  4ZBA A;  4PUR A;  1ST9 A;  4O5R A;  3GUS A;  1GSY A;  3VWW A;  3ZTL A;  5IOW A;  2E2G A;  2M72 A;  4EUY A;  2YJH A;  1WRY A;  5G2Z A;  1ZMA A;  2C80 A;  2L5O A;  2RM5 A;  1CQG A;  5KN0 A;  1UA5 A;  3ZZX A;  2YCD A;  3FMW A;  2HXK A;  2AB6 A;  2VL2 C;  3C71 A;  1PL1 A;  1Z3E A;  4MF5 A;  4HZ2 A;  1V58 A;  2YWO A;  5CRG A;  3UEM A;  4K7O A;  4FIW A;  3KH7 A;  1B9Y C;  4DEJ A;  3VI7 A;  3KJY A;  2H72 A;  2ZUP A;  1Q4J A;  4RUV A;  4HEA 2;  2XPD A;  4PNF A;  3CXG A;  2OE3 A;  1EP7 A;  3GKK A;  2YPM A;  4WBJ A;  4O7H A;  1F6M C;  4F2I A;  3N5O A;  2AUV A;  1U3I A;  4O92 A;  1SYX A;  3DML A;  1H4O A;  1TI1 A;  2JSY A;  5DAL B;  3O76 A;  2AAW A;  4LLR A;  2M80 A;  1FVJ A;  2WUL A;  2TRX A;  1K3O A;  4HUA A;  3WYW A;  3F4T A;  2B3S A;  14GS A;  5IMD A;  2VD1 A;  3EVI A;  1R4W A;  1URM A;  3ZIV A;  1UC7 A;  1K0M A;  2H0I A;  3F6D A;  4YKF A;  1M9B A;  4K6X A;  2PN8 A;  2VLU A;  5D96 A;  3TGZ A;  4EIQ A;  4MDC A;  6GST A;  2DJ1 A;  3DWV A;  3DD3 A;  3HYP A;  1ZL9 A;  4MZB A;  1XVW A;  2K8V A;  3DVW A;  5IMA A;  1YDK A;  2KHP A;  2B1K A;  2LJK A;  5A5K A;  1SL1 B;  5HR1 A;  1PGT A;  1BX9 A;  2H8L A;  4IEL A;  2YN1 A;  3D21 A;  4G10 A;  3QFA C;  1ZCP A;  4HU9 A;  1GUM A;  2LV3 A;  4IBP A;  4K9Z A;  22GS A;  2X4A A;  4TKY A;  4PQ1 A;  2DJK A;  1F3B A;  2PU9 C;  2HSY A;  3RDW A;  1RK4 A;  1XW5 A;  1V2A A;  1EP8 A;  2FD3 A;  4L0U A;  5H5R A;  3VPT A;  4XHM A;  5ELA A;  1S3C A;  2WS2 A;  3KMO A;  1GSU A;  3IE3 A;  4WBR D;  3D0Z A;  4BL7 B;  5J9B A;  4TN8 A;  4XS4 A;  4RI7 A;  11GS A;  2VO4 A;  18GS A;  3VWX A;  3TUE A;  4JED A;  2VCW A;  4KX4 A;  1O85 A;  16GS A;  3GN3 A;  3Q74 A;  2YJ7 A;  2OBK A;  1AIU A;  3IPZ A;  1K0O A;  4YKG A;  5HR0 A;  1ERU A;  1WMJ A;  2H1A A;  3LEF A;  3IV4 A;  4Q5F A;  4HI7 A;  4LA1 A;  3F0I A;  5ECL B;  4QQ7 A;  1C72 A;  4BWS A;  4WXT A;  5DBQ A;  1X5E A;  4BWQ A;  1MD3 A;  3QD9 A;  3FZ9 A;  1TK5 B;  5CRE A;  2X49 A;  2HZE A;  4TR4 A;  4X43 A;  1THX A;  1B4P A;  1ON4 A;  3TKS C;  5LNK e;  3LXZ A;  2H76 A;  5ID2 B;  2GZZ A;  2P5Q A;  1LBK A;  4OO5 A;  5CNW A;  1B8X A;  2DMM A;  3LOR A;  4MA9 A;  2OE1 A;  3DKS A;  3DYR A;  5G31 A;  3OR5 A;  1TRU A;  5DDL A;  2V6K A;  2HRA A;  4OD7 A;  4KF9 A;  1PKZ A;  2YWM A;  4EKZ A;  1Z7R A;  2BTO T;  4Q5R A;  5GZZ B;  2R4V A;  4POL A;  3E9J B;  2GGT A;  5ECS A;  5DVB A;  4IJI A;  2VLT A;  2WB9 A;  4BIK A;  2FGX A;  3GA4 A;  3G7I A;  1R26 A;  2PUK C;  4NMU A;  3P7X A;  3VWV A;  4ULX A;  2CVD A;  2E0Q A;  2H30 A;  1DE2 A;  4K0N A;  2HYX A;  1FOH A;  3HVN A;  4K5R A;  1K0N A;  2O7K A;  1X9M B;  4FQU A;  3F6F A;  3WT2 A;  3U6V A;  3HKR A;  5CO3 A;  2XPE A;  4L5L A;  1MD4 A;  1R5P A;  3GNJ A;  2H01 A;  2FA4 A;  3KCM A;  4NXI A;  2HE3 A;  3EYT A;  2LJA A;  1XBS A;  4HDE A;  2H6X A;  3CSI A;  5CRH A;  3TJB A;  1GP1 A;  4V1A g;  3GRX A;  3I69 A;  4GSS A;  2HFD A;  2R5G A;  2OE0 A;  1MTC A;  2O8V B;  4JU5 A;  4RQR A;  2DKH A;  2DLX A;  4ID0 A;  1ACV A;  1ERT A;  2YP6 A;  5ENU A;  2H1B A;  2IMK A;  1V40 A;  2L6C A;  1QXH A;  4F03 A;  1AW9 A;  1HNC A;  5FWG A;  3G9B A;  3VLN A;  1H75 A;  4GQF A;  1FVK A;  1OVN A;  2LEG A;  5G5E A;  4EDY A;  1SJ6 A;  3FZA A;  5HFI A;  4TXV A;  1EOH A;  4KB3 A;  5AN1 A;  5AGY A;  1SK0 A;  2DML A;  2MMN A;  3IRA A;  3A3T A;  3QFB C;  2K9F A;  2H73 A;  5KOX A;  3UAP A;  2B5E A;  2OJL A;  4JR6 A;  3RPP A;  6GSS A;  1YKA A;  3ZRE A;  5EPF A;  4MJB A;  1WE0 A;  4MPF A;  5DJL A;  4EC0 A;  3TRP A;  1TK8 B;  1M2D A;  3ZIJ A;  4K5S A;  1FW1 A;  1M7T A;  1JLW A;  3ZML A;  1A0F A;  3K8N A;  2BMX A;  2JL4 A;  2LRN A;  1TTZ A;  2OKA A;  1WPI A;  3UMA A;  4JZQ A;  5AIS A;  4I5Q A;  2C0G A;  4IP6 A;  1M9A A;  1VGL A;  3TOU A;  4TR1 B;  2MZC A;  2HSM A;  1E2Y A;  3AY8 A;  3FW2 A;  10GS A;  2GLR A;  4MZW A;  1HD2 A;  1N2A A;  3HVS A;  4OO4 A;  4GQC A;  1WWJ A;  2IPA A;  1XPV A;  3KTB A;  1RW1 A;  2I1U A;  2GSQ A;  2GVP A;  4BVY A;  4XTS A;  1EV4 A;  2A4H A;  3U5R E;  2LRT A;  2H6Z A;  2VCV A;  3FR3 A;  3UAR A;  2YZU A;  4ZL9 A;  5KN2 A;  4ZXG A;  2YNX A;  4J2F A;  1AQW A;  2FWF A;  3E0U A;  4HS1 A;  5HQP A;  5IIZ A;  3MDK A;  1ZYQ B;  1EOG A;  1XW6 A;  2VOC A;  3F4R A;  3IAS 2;  1KTE A;  2VM2 A;  2EIR A;  1NHO A;  2RLI A;  1OC9 B;  5COH A;  2P31 A;  2WDU A;  5F07 A;  2J9H A;  3GFK A;  2VL9 A;  3KEB A;  1G6Y A;  1EEJ A;  13GS A;  5DAK A;  1FB0 A;  4GF0 A;  5F0G A;  2AJQ B; 
#chains in the Genus database with same CATH homology
 3UJ1 A;  1S3A A;  1NHY A;  2DJ3 A;  4KDX A;  2KOK A;  5JWQ B;  4QL7 A;  2MBT A;  2H19 A;  3KP9 A;  3IAM 2;  3LSZ A;  3QR6 A;  4OWY A;  4G0L A;  2B5X A;  2IN3 A;  3UIW A;  3TKS E;  2CT6 A;  4OFN A;  4WF4 A;  2R0G A;  1EGR A;  2WCI A;  3GV1 A;  2WZ9 A;  1TOF A;  2B5Y A;  5A4W A;  1JZW A;  3L9S A;  2FA8 A;  1A23 A;  3LYP A;  4KCA A;  3RAZ A;  3ZYW A;  3FHK A;  4WR5 A;  1GH2 A;  3O3T A;  4IS0 A;  1X9W B;  1EEM A;  5JCW A;  1Y6E A;  4MLY A;  3CRU A;  5HFG A;  4PGT A;  1OE7 A;  4YAP A;  2IME A;  4TR0 A;  5GAN D;  5HFK A;  1USB A;  3ME8 A;  2R3X A;  1YEX A;  2CA8 A;  1TI3 A;  2RM6 A;  3G7J A;  4MJE A;  2CV4 A;  1QFN A;  2KP1 A;  3IHG A;  1K0D A;  1QUW A;  1AAZ A;  2HLS A;  4ZL7 A;  4IQA A;  2F51 A;  4JRR A;  2FCH A;  2OBI A;  2HRN A;  4YQV A;  2R37 A;  3TJK A;  3H8Q A;  4GST A;  1QGV A;  2DIZ A;  2AV4 A;  2GTU A;  4J56 E;  4G0K A;  2CX3 A;  5IMV A;  4V2N A;  4K2D A;  1X5D A;  2F3M A;  1GUH A;  1SJZ A;  3HY2 A;  2AHE A;  5FT3 A;  5IQY A;  2VLV A;  3GH9 A;  4L5O A;  1YKC A;  2C3N A;  6GSX A;  4A5P A;  3FY7 A;  4FYC A;  3KTL A;  1XFL A;  2X8C A;  4EDZ A;  5EL8 A;  4DSR A;  4KSM A;  2Z9S A;  5A4U A;  3FZ5 A;  2FWE A;  5ECP B;  4E8E A;  4F82 A;  1YQ1 A;  3P90 A;  1XW9 A;  1TP9 A;  5DAL A;  4ZBB A;  3L0H A;  5CRW A;  3DGQ A;  1Y25 A;  3PIN A;  3Q18 A;  4MF7 A;  1THO A;  2K18 A;  5CYY A;  2NTO A;  1A0R P;  1VF4 A;  3BCK A;  3GMF A;  4I6X A;  3LQ7 A;  1JLV A;  1BJX A;  2TIR A;  1EGO A;  5GST A;  2L4Q A;  2CQ9 A;  5ELG A;  5KN3 A;  4HQZ A;  4FO5 A;  2H71 A;  3FKF A;  2CVB A;  4ML6 A;  2CVK A;  1JZR A;  4V1A p;  4EXJ A;  1ZOF A;  5L71 A;  4N0Z A;  5EVO A;  4IN0 A;  5HR3 A;  5KN1 A;  3ISO A;  1YZX A;  1U6T A;  2YV9 A;  2QSI A;  6GSW A;  1JZD A;  4XS4 B;  3GX0 A;  17GS A;  1XIY A;  3ZIT A;  1O81 A;  2VL2 A;  3NIV A;  4HOJ A;  1GSS A;  2OA7 A;  2V32 A;  2AYT A;  3GKX A;  4Z2U A;  3EC3 A;  5JWR B;  3UVH A;  3D5J A;  5DCH A;  3E3E A;  3JCM L;  1R5A A;  3EUR A;  4MF6 A;  2VAF A;  1UVZ A;  3LGC A;  3HDC A;  2KUC A;  3H4K A;  2C0E A;  1A2L A;  4ISD A;  3GL5 A;  3QOU A;  1Z6M A;  3I43 A;  4MJA A;  4G9H A;  3HD5 A;  4AJ6 A;  4TXO B;  1XOA A;  4KE3 A;  5ECM B;  1T4Z A;  3F8U A;  5HR2 A;  2G2Q A;  5F05 A;  4IGJ A;  4K7N A;  4XRD A;  4TVE A;  3VI5 A;  4IHU A;  3ZLP A;  2LJR A;  3QAG A;  1PD2 1;  4Q5N A;  5J5N A;  5J41 A;  5G30 A;  1Z7P A;  1AC1 A;  2C0D A;  3W8J A;  1XWB A;  1SKW B;  1YJ6 A;  3KIJ A;  1VF1 A;  3CSH A;  4BPY A;  2GDR A;  2GT5 A;  4FH8 A;  5ECR B;  3RHC A;  5FHI A;  2BJX A;  2N5B A;  3IA1 A;  2O87 A;  4KA0 A;  3ERG A;  2WFC A;  3LYK A;  5IM9 A;  3KD0 A;  4KUN A;  1TRW A;  1E6B A;  1B9X C;  1XWC A;  2I4A A;  1PN0 A;  2CZ2 A;  5AIV A;  4YQU A;  5DJM A;  4PUA A;  2N5F A;  1W89 A;  2CX4 A;  2P5R A;  1Z9H A;  2PPT A;  1XZO A;  2GSR A;  1BYE A;  5G1L A;  2A2R A;  4MNN A;  3NZN A;  5LCZ A;  5C04 A;  4D73 A;  4TW5 A;  2CAQ A;  5GAP D;  1LJR A;  4P3Y B;  3M0F A;  4IJ3 A;  4O5U A;  4ZBD A;  4ZL8 A;  3EU4 A;  1AQV A;  4ZIL A;  2I3Y A;  3SBC A;  5D9X A;  1GSF A;  3PPU A;  3EU3 A;  4PUF C;  4MK3 A;  4OCE A;  1EV9 A;  2HRK A;  3BJ5 A;  1K3L A;  1OAZ A;  1BED A;  4DVC A;  1TDI A;  5IMF A;  2LKU A;  1PSQ A;  1OC8 A;  2VD0 A;  2JZS A;  3QMX A;  3MYD A;  4GTU A;  2PVO C;  4N0V A;  8GSS A;  4FYB A;  3NOF A;  2GST A;  4EO3 A;  1GSQ A;  4L0W A;  1OC3 A;  3F9U A;  2V2G A;  1NW2 A;  3ZFL A;  2NBS A;  4L8E A;  4ILF A;  1Q98 A;  4ECI A;  4QL9 A;  1QQ2 A;  1S3D A;  1AUC A;  1LU4 A;  4CHS A;  2YWN A;  4G2E A;  3M3M A;  5B8A A;  9GSS A;  3FEU A;  3GST A;  4TOP A;  1M99 A;  4ACS A;  5B6N A;  2CZ3 A;  3GHA A;  3LXT A;  2QA1 A;  4X0X A;  4MH2 A;  3W6G A;  4LMW A;  4K2X A;  4WET A;  3P2A A;  4HU7 A;  2DIY A;  5A4V A;  3TOT A;  2JAD A;  3EWL A;  1NM3 A;  2C1Y A;  1PA3 A;  1T3B A;  5ECI B;  3CTG A;  1FHE A;  4NHZ A;  3ZVJ D;  4TRX A;  3VUR A;  3TKS A;  2IMD A;  4PTS A;  2VCT A;  1M0U A;  2DJ0 A;  1R7H A;  5D73 A;  2FY6 A;  4BVX A;  1ML6 A;  5G5F A;  5F8B A;  3TKQ A;  2PGT A;  5J9C A;  4LMV A;  1F9M A;  1O8W A;  3GIX A;  1PX6 A;  1XVQ A;  1OKT A;  4USS A;  2H74 A;  4NPB A;  4F0C A;  3IK7 A;  3ZFB A;  1T00 A;  4EIP A;  3GTU B;  2ES7 A;  3C8E A;  4ZB6 A;  3EE2 A;  4WKW A;  3PH9 A;  4I2U A;  5ECO B;  4X1U A;  4XS1 A;  3D22 A;  2LNT A;  1X0R A;  3D6I A;  4H86 A;  1O73 A;  2JU5 A;  2IFQ A;  2V41 A;  4IKH A;  4BVY B;  1A2J A;  3IC4 A;  3ZMK A;  5IPH A;  2HRF A;  2DJ2 A;  3CRT A;  5E4W A;  5B7C A;  1J0F A;  4V2L A;  1VRS D;  1GLP A;  3M1G A;  2G0F A;  3ZL5 A;  2A2P A;  1G6W A;  3FZ4 A;  2HSH A;  4POB A;  4NHW A;  2YAN A;  4KSO A;  1SKR B;  3FRC A;  3W8S A;  2QC7 A;  2VUP A;  1SD8 A;  1XWA A;  2GT6 A;  5CRD A;  2LST A;  4G0I A;  2DKI A;  1T7P B;  1ERW A;  4YAV A;  1T8E B;  1K0B A;  5DAK B;  4Z2T A;  4TR1 A;  3GH6 A;  5IMC A;  2D2Z A;  1WP0 A;  5B8B A;  2X8H A;  1NSW A;  4AF2 A;  2VM1 A;  5B6M A;  5INY A;  1WIK A;  1GUK A;  1ZGN A;  2A4V A;  4KGI A;  3IHQ A;  3LWA A;  1VF2 A;  2XC2 A;  1HQO A;  5F06 A;  5JCG A;  4ECC A;  2OAC A;  2N5A A;  4MMM A;  1AXD A;  3TRX A;  1EWX A;  2EIO A;  3ERW A;  3QDN A;  1PKW A;  2GZP A;  3VFI A;  3UBL A;  5KOW A;  2IWT A;  2IMI A;  3A2W A;  3IOS A;  1A2M A;  5GSS A;  2NDO A;  3KMN A;  1M2A A;  5IO0 A;  4DSS A;  1V9W A;  1O6J A;  4AJ8 A;  2DJJ A;  3LG6 A;  2IMF A;  3DVX A;  4K8M A;  1A24 A;  3IR4 A;  1OYJ A;  4WR4 A;  4Z7X A;  1T1V A;  2C4J A;  2B7J A;  2WJU A;  4GRF A;  12GS A;  1PL2 A;  4ECJ A;  4CY8 A;  2HI7 A;  3DEX A;  4O5Q A;  2GSS A;  1EZK A;  2GQL A;  4IVF A;  2ALB A;  1DSB A;  4X4J A;  4GSN A;  3MIX A;  2VCQ A;  1BQ7 A;  4N11 A;  2E2M A;  1DBY A;  3LW9 A;  3TKR A;  5JWO B;  4PXO A;  4KDY A;  4KH7 A;  2NVL A;  2VL3 A;  3A5W A;  4KAE A;  2H0H A;  2ZNM A;  5EY6 A;  1AQX A;  1ILO A;  4AJ7 A;  4V2M A;  1XWG A;  1MDK A;  4GCI A;  2REM A;  2JSZ A;  4JE1 A;  2F8F A;  1VF3 A;  1K0A A;  2GZY A;  3F3R A;  3GX8 A;  4XRA A;  1SL0 B;  1B48 A;  2C0F A;  2ZCT A;  3WD6 A;  2LRC A;  2C8U A;  3BD2 A;  3I6A A;  2GQK A;  2FWH A;  3FYG A;  2PBJ A;  1SJI A;  3I9V 2;  5E59 A;  3F4S A;  2X64 A;  3R3E A;  2F9S A;  2O89 A;  3EMX A;  2LS5 A;  1GWC A;  1QMV A;  4N10 A;  4CDO A;  2XBI A;  5DQY A;  1HNA A;  2DSA A;  1MEK A;  4O32 A;  4K1F A;  1SEN A;  2V6O A;  1OKD A;  4BA7 A;  4EL1 A;  2IJY A;  1JHB A;  1F37 A;  1G7E A;  1GTB A;  1U87 A;  2H0G A;  4Q5Q A;  1KEB A;  1GNE A;  3US3 A;  1FAA A;  2KLX A;  3HZ4 A;  4KND A;  3G7Y A;  4HJ2 A;  4K7I A;  1U3A A;  2LQQ A;  4GWR A;  4OFM A;  6GSU A;  3A2V A;  3V1W A;  3FR9 A;  3MWH A;  2R2J A;  1XXU A;  1J08 A;  1ZZY A;  2TRC P;  4KCE A;  4ZIJ A;  3KXO A;  3A2X A;  3GYK A;  3F63 A;  3KGK A;  5BRT A;  3ED3 A;  2M46 A;  1GTU A;  4MPG A;  2L5L A;  4K0G A;  4JBB A;  1SL2 B;  1PMT A;  4WF5 A;  1F2E A;  4HQS A;  2QKE A;  3A5I A;  2R0C A;  3H1N A;  4PX1 A;  3C7M A;  2PWJ A;  4NV5 A;  2MMA A;  2VCX A;  1GSE A;  1W4V A;  2YZH A;  1Z6N A;  4HZ4 A;  4LL4 B;  1PRX A;  4RQX A;  2MMO A;  5AIX A;  4MJC A;  4IP1 A;  1GSD A;  2I81 A;  3D4T A;  1FG4 A;  2FLS A;  2MBS A;  1MDI A;  3HXS A;  1GL8 A;  2L4C A;  1GNW A;  3HCZ A;  2ON7 A;  3FR6 A;  2RUF A;  3LJR A;  1SU9 A;  3UBK A;  2LNS A;  2PMT A;  5D9T A;  5CP1 A;  4JR4 A;  3WGD A;  2LQO A;  3WGX A;  3IK9 A;  3CBU A;  3DXB A;  2WGR A;  1DE1 A;  1SKS B;  2JAC A;  4MH3 A;  2PVQ A;  4I8B A;  2J23 A;  2A2S A;  3GUR A;  3VWU A;  2HZE B;  3APQ A;  1SYR A;  5ECK B;  2L6D A;  4OMV A;  4MAB A;  5IMZ A;  1TXX A;  3Q6O A;  3C73 A;  3EPT A;  4Z2R A;  4BL7 A;  1DUG A;  2HT9 A;  4MP4 A;  3ME7 A;  1I9D A;  4GXZ A;  2GQM A;  5DQS A;  5JCU A;  4ECB A;  2MMZ A;  1FB6 A;  4FYU A;  2E7P A;  1FOV A;  1X9S B;  3HJP A;  3S9F A;  3N9J A;  5ABR A;  3H93 A;  2H1D A;  2FNO A;  4TXO A;  3Q19 A;  1U88 A;  3QCP A;  4CW9 A;  5BMU A;  3KP8 A;  3APO A;  4D73 B;  1F3A A;  5IOX A;  1HNB A;  3TJF A;  3RBT A;  2GS3 A;  2UZ8 A;  1I5G A;  3VPQ A;  2DBC A;  5IO2 A;  3KM6 A;  4NAX A;  2K6V A;  2X8G A;  2YOI A;  3HVV A;  3QAV A;  1OE8 A;  4YQM A;  3ZVJ A;  2K8S A;  2H6Y A;  2FHE A;  1IYI A;  1TRS A;  1ZYE A;  4EF0 A;  2QA2 A;  5D8I A;  2L57 A;  3D4M A;  4LL1 B;  6GSV A;  1ABA A;  5ID2 A;  4J57 E;  1TJD A;  3QAW A;  1TRV A;  3TB2 A;  3IC8 A;  2L59 A;  2X99 A;  5DCG A;  1A8Y A;  2H1G A;  4YH2 A;  3M9J A;  2IL3 A;  4F0B A;  1GTA A;  2EIQ A;  2EC4 A;  3WT1 A;  1KBN A;  7GSS A;  1N8J A;  2QGV A;  4ICY A;  5G1K A;  5ECQ B;  1GTI A;  1TU7 A;  3UL3 A;  1K3Y A;  3HZ8 A;  3PR8 A;  1V57 A;  3LFL A;  4MCU A;  2R6K A;  3KZQ A;  1FO5 A;  2XBQ A;  1G0T A;  4ZB9 A;  3SWL A;  1XCC A;  2HNL A;  1TU8 A;  3WGE A;  3GKM A;  2WRT A;  3L9V A;  5D9V A;  3MNG A;  1GLQ A;  4CY6 A;  1JZO A;  2B6M A;  3TJG A;  4EVM A;  3DRN A;  1XWK A;  1M2B A;  2XHF A;  2F8A A;  3ZRD A;  1SD9 A;  4NWY A;  3TJJ A;  3J7Y b;  1HYU A;  4BVX B;  1TK0 B;  3TRQ A;  1GUL A;  5J3R A;  4F9Z A;  1JFU A;  2ON5 A;  2PER A;  2YV7 A;  20GS A;  1ERV A;  3TCO A;  3ERF A;  1PX7 A;  3BOA A;  3O6T A;  4OCF A;  2RUE A;  1O7U A;  4GLT A;  5LD0 A;  4TR3 A;  1PQN A;  4PQH A;  3IBH A;  3C1S A;  5CAX A;  1X5C A;  3GSS A;  2H66 A;  3BBY A;  3FK8 A;  4ZB8 A;  1ZYN A;  3KH9 A;  1SK1 A;  3M8N A;  2IFQ B;  2R0P A;  5C00 A;  3CSJ A;  4E8H A;  3BCI A;  1T4Y A;  2RII A;  3MAK A;  2P0G A;  1YY7 A;  5H5S A;  1J9B A;  4POM A;  3MSZ A;  1YF0 A;  4OFT A;  1RQM A;  1YF1 A;  2JZT A;  3CYN A;  4N30 A;  2JZR A;  4XCS A;  2YWI A;  4ML1 A;  2MYG A;  2C3T A;  2H75 A;  2VIM A;  3EMP A;  3GL3 A;  4AGS A;  3L9U A;  3F3Q A;  5H5Q A;  1MDJ A;  2HZF A;  2CAI A;  3HJM A;  2V1M A;  3UVT A;  3GTU A;  3P8W A;  1CQH A;  1WJK A;  3IXR A;  4MZC A;  3L78 A;  1QK8 A;  4WEY A;  1TW9 A;  1ZYP A;  1TKD B;  5IPG A;  4NV2 A;  2LTK A;  2FUG 2;  4XIH A;  2LUS A;  1B4Q A;  3PGT A;  3GKN A;  2IIY A;  4G19 A;  1Z5Y E;  3M9K A;  4KDU A;  3C1R A;  3DIE A;  1G7O A;  4DSS B;  4POK A;  2H70 A;  3HVX A;  3RPN A;  1UN2 A;  5ECN B;  1BAY A;  3R2Q A;  4RI6 A;  1YEP A;  4PQI A;  4DSQ A;  4XS6 A;  2FWG A;  1A8L A;  1BG5 A;  3CMI A;  3CTF A;  3UOM A;  4KW6 A;  2KP2 A;  3RHB A;  2I9H A;  3APS A;  1SK2 A;  4EE0 A;  1V98 A;  19GS A;  5KEJ A;  4IQ1 A;  1OC9 A;  5D9W A;  2NPB A;  3TDG A;  2B7K A;  1K0C A;  3TKP A;  3HA9 A;  1XOB A;  4HJM A;  3H79 A;  2OAD A;  3IDV A;  1O8X A;  5J4U A;  3J7Y k;  4I2T A;  3HHV A;  3HJO A;  1IYH A;  2B1L A;  4IW9 A;  1PN9 A;  4PNG A;  3L4N A;  1WOU A;  6GSY A;  3EIN A;  1KNG A;  2DC5 A;  1GRX A;  5ECH B;  5D93 A;  4I97 A;  3QPM A;  2C3Q A;  3VK9 A;  2O85 A;  2VCZ A;  4ZBA A;  4PUR A;  1ST9 A;  4O5R A;  3GUS A;  1GSY A;  3VWW A;  3ZTL A;  5IOW A;  2E2G A;  2M72 A;  4EUY A;  2YJH A;  1WRY A;  5G2Z A;  1ZMA A;  2C80 A;  2L5O A;  2RM5 A;  1CQG A;  5KN0 A;  1UA5 A;  3ZZX A;  2YCD A;  3FMW A;  2HXK A;  2AB6 A;  2VL2 C;  3C71 A;  1PL1 A;  1Z3E A;  4MF5 A;  4HZ2 A;  1V58 A;  2YWO A;  5CRG A;  3UEM A;  4K7O A;  4FIW A;  3KH7 A;  1B9Y C;  4DEJ A;  3VI7 A;  3KJY A;  2H72 A;  2ZUP A;  1Q4J A;  4RUV A;  4HEA 2;  2XPD A;  4PNF A;  3CXG A;  2OE3 A;  1EP7 A;  3GKK A;  2YPM A;  4WBJ A;  4O7H A;  1F6M C;  4F2I A;  3N5O A;  2AUV A;  1U3I A;  4O92 A;  1SYX A;  3DML A;  1H4O A;  1TI1 A;  2JSY A;  5DAL B;  3O76 A;  2AAW A;  4LLR A;  2M80 A;  1FVJ A;  2WUL A;  2TRX A;  1K3O A;  4HUA A;  3WYW A;  3F4T A;  2B3S A;  14GS A;  5IMD A;  2VD1 A;  3EVI A;  1R4W A;  1URM A;  3ZIV A;  1UC7 A;  1K0M A;  2H0I A;  3F6D A;  4YKF A;  1M9B A;  4K6X A;  2PN8 A;  2VLU A;  5D96 A;  3TGZ A;  4EIQ A;  4MDC A;  6GST A;  2DJ1 A;  3DWV A;  3DD3 A;  3HYP A;  1ZL9 A;  4MZB A;  1XVW A;  2K8V A;  3DVW A;  5IMA A;  1YDK A;  2KHP A;  2B1K A;  2LJK A;  5A5K A;  1SL1 B;  5HR1 A;  1PGT A;  1BX9 A;  2H8L A;  4IEL A;  2YN1 A;  3D21 A;  4G10 A;  3QFA C;  1ZCP A;  4HU9 A;  1GUM A;  2LV3 A;  4IBP A;  4K9Z A;  22GS A;  2X4A A;  4TKY A;  4PQ1 A;  2DJK A;  1F3B A;  2PU9 C;  2HSY A;  3RDW A;  1RK4 A;  1XW5 A;  1V2A A;  1EP8 A;  2FD3 A;  4L0U A;  5H5R A;  3VPT A;  4XHM A;  5ELA A;  1S3C A;  2WS2 A;  3KMO A;  1GSU A;  3IE3 A;  4WBR D;  3D0Z A;  4BL7 B;  5J9B A;  4TN8 A;  4XS4 A;  4RI7 A;  11GS A;  2VO4 A;  18GS A;  3VWX A;  3TUE A;  4JED A;  2VCW A;  4KX4 A;  1O85 A;  16GS A;  3GN3 A;  3Q74 A;  2YJ7 A;  2OBK A;  1AIU A;  3IPZ A;  1K0O A;  4YKG A;  5HR0 A;  1ERU A;  1WMJ A;  2H1A A;  3LEF A;  3IV4 A;  4Q5F A;  4HI7 A;  4LA1 A;  3F0I A;  5ECL B;  4QQ7 A;  1C72 A;  4BWS A;  4WXT A;  5DBQ A;  1X5E A;  4BWQ A;  1MD3 A;  3QD9 A;  3FZ9 A;  1TK5 B;  5CRE A;  2X49 A;  2HZE A;  4TR4 A;  4X43 A;  1THX A;  1B4P A;  1ON4 A;  3TKS C;  5LNK e;  3LXZ A;  2H76 A;  5ID2 B;  2GZZ A;  2P5Q A;  1LBK A;  4OO5 A;  5CNW A;  1B8X A;  2DMM A;  3LOR A;  4MA9 A;  2OE1 A;  3DKS A;  3DYR A;  5G31 A;  3OR5 A;  1TRU A;  5DDL A;  2V6K A;  2HRA A;  4OD7 A;  4KF9 A;  1PKZ A;  2YWM A;  4EKZ A;  1Z7R A;  2BTO T;  4Q5R A;  5GZZ B;  2R4V A;  4POL A;  3E9J B;  2GGT A;  5ECS A;  5DVB A;  4IJI A;  2VLT A;  2WB9 A;  2FGX A;  3GA4 A;  3G7I A;  1R26 A;  2PUK C;  4NMU A;  3P7X A;  3VWV A;  4ULX A;  2CVD A;  2E0Q A;  2H30 A;  1DE2 A;  4K0N A;  2HYX A;  1FOH A;  4K5R A;  1K0N A;  2O7K A;  1X9M B;  4FQU A;  3F6F A;  3WT2 A;  3U6V A;  3HKR A;  5CO3 A;  2XPE A;  4L5L A;  1MD4 A;  1R5P A;  3GNJ A;  2H01 A;  2FA4 A;  3KCM A;  4NXI A;  2HE3 A;  3EYT A;  2LJA A;  1XBS A;  4HDE A;  2H6X A;  3CSI A;  5CRH A;  3TJB A;  1GP1 A;  4V1A g;  3GRX A;  3I69 A;  4GSS A;  2HFD A;  2R5G A;  2OE0 A;  1MTC A;  2O8V B;  4JU5 A;  4RQR A;  2DKH A;  2DLX A;  4ID0 A;  1ACV A;  1ERT A;  2YP6 A;  5ENU A;  2H1B A;  2IMK A;  1V40 A;  2L6C A;  1QXH A;  4F03 A;  1AW9 A;  1HNC A;  5FWG A;  3G9B A;  3VLN A;  1H75 A;  4GQF A;  1FVK A;  1OVN A;  2LEG A;  5G5E A;  4EDY A;  1SJ6 A;  3FZA A;  5HFI A;  4TXV A;  1EOH A;  4KB3 A;  5AN1 A;  5AGY A;  1SK0 A;  2DML A;  2MMN A;  3IRA A;  3A3T A;  3QFB C;  2K9F A;  2H73 A;  5KOX A;  3UAP A;  2B5E A;  2OJL A;  4JR6 A;  3RPP A;  6GSS A;  1YKA A;  3ZRE A;  5EPF A;  4MJB A;  1WE0 A;  4MPF A;  5DJL A;  4EC0 A;  3TRP A;  1TK8 B;  1M2D A;  3ZIJ A;  4K5S A;  1FW1 A;  1M7T A;  1JLW A;  3ZML A;  1A0F A;  3K8N A;  2BMX A;  2JL4 A;  2LRN A;  1TTZ A;  2OKA A;  1WPI A;  3UMA A;  4JZQ A;  5AIS A;  4I5Q A;  2C0G A;  4IP6 A;  1M9A A;  1VGL A;  3TOU A;  4TR1 B;  2MZC A;  2HSM A;  1E2Y A;  3AY8 A;  3FW2 A;  10GS A;  2GLR A;  4MZW A;  1HD2 A;  1N2A A;  3HVS A;  4OO4 A;  4GQC A;  1WWJ A;  2IPA A;  1XPV A;  3KTB A;  1RW1 A;  2I1U A;  2GSQ A;  2GVP A;  4BVY A;  4XTS A;  1EV4 A;  2A4H A;  3U5R E;  2LRT A;  2H6Z A;  2VCV A;  3FR3 A;  3UAR A;  2YZU A;  4ZL9 A;  5KN2 A;  4ZXG A;  2YNX A;  4J2F A;  1AQW A;  2FWF A;  3E0U A;  4HS1 A;  5HQP A;  5IIZ A;  3MDK A;  1ZYQ B;  1EOG A;  1XW6 A;  2VOC A;  3F4R A;  3IAS 2;  1KTE A;  2VM2 A;  2EIR A;  1NHO A;  2RLI A;  1OC9 B;  5COH A;  2P31 A;  2WDU A;  5F07 A;  2J9H A;  3GFK A;  2VL9 A;  3KEB A;  1G6Y A;  1EEJ A;  13GS A;  5DAK A;  1FB0 A;  4GF0 A;  5F0G A;  2AJQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...