3ZYWA

Crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
108
structure length
108
Chain Sequence
b'DLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAAENLYFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAREDOXIN-3
publication title Crystal Structure of the First Glutaredoxin Domain of Human Glutaredoxin 3 (Glrx3)
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 37
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zywA01
3H79A 1IYIA 3QAVA 5IMZA 3P7XA 1F9MA 2ON7A 2YV9A 3EU3A 1HNAA 1GSDA 1GNEA 2G2QA 2V32A 3ZTLA 1GP1A 3D0ZA 2L59A 1BYEA 3R2QA 4DVCA 4Q5RA 3DVWA 2QGVA 2HNLA 5CNWA 2EC4A 1I5GA 1O6JA 3GRXA 2V41A 2VLUA 2VLVA 5HFIA 2MZCA 3TDGA 2X8HA 1QQ2A 3M9KA 2DBCA 1QUWA 3G9BA 5IO0A 2RIIA 4IVFA 3HKRA 3F8UA 2LEGA 1ACVA 6GSXA 3CSJA 3CSHA 3HJOA 4GF0A 1SK1A 1GTBA 3KTLA 5D96A 4HU7A 5JCUA 3Q74A 2R4VA 2OACA 2C0EA 3FZ9A 2CVDA 5F06A 1O85A 5ECIB 3A3TA 4KDYA 1TRVA 4PNFA 4IKHA 3EYTA 4BWSA 5DQSA 3M0FA 2FA8A 4EXJA 2A2RA 5J5NA 3Q18A 4K0GA 1PL2A 5INYA 2VCQA 3G7JA 5DAKA 2FY6A 2I4AA 1A0FA 3CXGA 1USBA 3JCML 5IOWA 3RAZA 3AY8A 1KTEA 4XCSA 3TJBA 3C1RA 3DWVA 1EOGA 5GSSA 2OA7A 1YF1A 5ECNB 4RQXA 4ACSA 4EUYA 3BJ5A 4GTUA 4MPFA 3DXBA 3LEFA 4EVMA 1XVWA 2B1LA 2YJ7A 2F51A 3MWHA 1W4VA 4E8EA 3IC4A 2H73A 5CRDA 2B7JA 2VL9A 3TKPA 2CX4A 1MD3A 1A8YA 5AISA 4EKZA 2DJKA 2WCIA 3IPZA 1M2AA 3ED3A 3APOA 4G10A 2K9FA 2YV7A 4ECIA 2ALBA 20GSA 5ELAA 5G1LA 3KIJA 2YZHA 2VM1A 1O8XA 1TRUA 4O92A 2AJQB 1QFNA 3TUEA 2KP2A 3LGCA 1FOVA 1OYJA 1A2JA 2MMAA 3GTUA 1Z6MA 1RK4A 4RI7A 1OC3A 4IP1A 2HYXA 1PMTA 4KSMA 5J9CA 2M80A 2OKAA 1OE7A 2PVQA 2HXKA 1V57A 1BEDA 5C04A 3PR8A 3KD0A 4DSSB 4FIWA 1ERWA 2H1DA 5B6NA 9GSSA 1GSUA 1ZCPA 3GX8A 1O81A 4GCIA 5EL8A 2LNTA 3IAM2 5ELGA 1AAZA 3ERGA 4PX1A 2AB6A 4H86A 3GA4A 1Z5YE 1O7UA 1FO5A 2OADA 2HI7A 1Z6NA 4F0BA 2TIRA 4L5LA 3IV4A 1X9MB 5D9TA 5A5KA 1ZZYA 1HNBA 5EVOA 5E4WA 1WPIA 1K3LA 22GSA 1GSFA 3VWWA 3L0HA 4BVXA 2R37A 4V1Ap 4CDOA 3MNGA 2AHEA 2GGTA 1YZXA 2B5EA 2JU5A 4TXVA 3QMXA 1PD21 4JRRA 1EGRA 4HDEA 3P2AA 5H5QA 2HLSA 3CYNA 1X5EA 3ZZXA 2I81A 1EZKA 1Q4JA 3GV1A 3VWUA 2H71A 1FW1A 2JZTA 4JBBA 3ZREA 2PMTA 2EIOA 1AIUA 2N5FA 1HD2A 1R4WA 3F4SA 3UAPA 2H0GA 1G7OA 3D5JA 2GS3A 4GSTA 1V58A 4BL7A 4PQIA 1PA3A 4OWYA 2J9HA 1PX6A 4XS1A 3KJYA 4K7OA 3CSIA 1AC1A 2WB9A 2OE1A 4TOPA 2FUG2 4D73B 5JWRB 3FRCA 2FWEA 3CRTA 5AIXA 1A2MA 1I9DA 3G7IA 5H5SA 1DE2A 1LBKA 1NHYA 3UEMA 4F03A 1THOA 1B4PA 3GURA 2C3QA 4XIHA 1VRSD 2RM6A 5HFKA 1YJ6A 1XXUA 2FLSA 3TB2A 3EMPA 4HZ2A 1BG5A 3W8SA 4KCEA 3APSA 5ECQB 4ZL8A 1XPVA 3GKNA 3DGQA 3GL5A 1BQ7A 5JCWA 1F2EA 4V2NA 1MEKA 2KLXA 3M8NA 3H1NA 4FYBA 4Q5QA 5DQYA 2CX3A 3GSTA 1ZMAA 1B9YC 4G9HA 3S9FA 3MSZA 3BCIA 2JSYA 1NM3A 2X99A 1GUKA 1JLWA 3IBHA 2H72A 4IELA 2N5AA 3CRUA 3GSSA 1LU4A 2DC5A 2H1BA 2ZNMA 2VCXA 3NIVA 2VUPA 2LS5A 2HE3A 1IYHA 1JZWA 1M99A 5HR0A 4RI6A 5GZZB 3QFBC 4ISDA 1JZRA 2P31A 1V9WA 5ECMB 3VFIA 2H19A 3ME7A 3QOUA 1XFLA 3F3QA 1GLQA 3O76A 3LWAA 2KUCA 4XHMA 5D8IA 5ABRA 5J9BA 3V1WA 2LRTA 4K8MA 1ON4A 2VD0A 5KN2A 2C0GA 2YANA 5JWOB 4ECCA 2OBIA 2PWJA 4ML1A 3GX0A 3E3EA 4IS0A 1G7EA 3I9V2 1M9AA 5IQYA 1RW1A 4LL4B 4ILFA 3F3RA 1XW9A 1OC8A 1PGTA 2E2MA 4N0ZA 2X8GA 4JEDA 2YN1A 5CP1A 3FZAA 1PKZA 4GQCA 2O87A 4Z7XA 2H75A 3LFLA 4GSNA 2LNSA 1J08A 2WDUA 4LMVA 4P3YB 1GTAA 2VO4A 4GRFA 1XWBA 5AGYA 11GSA 1R5PA 1XWGA 3M1GA 6GSYA 4TN8A 4HU9A 1A8LA 3C73A 5LNKe 3Q6OA 3VURA 3EINA 5B8AA 4TW5A 1H4OA 3KP8A 2V6OA 1X9SB 10GSA 2P5RA 3BCKA 5D73A 3WGXA 1SL2B 1SYXA 4V2MA 4OCEA 3CBUA 5ID2A 1U3AA 1UC7A 3C7MA 1YQ1A 1UVZA 2GT6A 3L9VA 2IFQA 2REMA 4L5OA 4BVYA 3G7YA 3O3TA 2HT9A 1XCCA 1PKWA 2GTUA 2BTOT 4HJMA 4WF5A 4PURA 5GAPD 1B9XC 4YQMA 2ON5A 1U88A 2PPTA 3QR6A 4YAPA 3KH7A 1GTIA 3L9SA 2VLTA 3HDCA 5IOXA 1TK0B 7GSSA 2GZZA 1XWCA 1S3CA 2X64A 3ZITA 1TKDB 2L4CA 4KDUA 2Z9SA 3M9JA 1XW5A 1EGOA 4HZ4A 3VI5A 2VD1A 4TR1A 3RPPA 1EWXA 4AJ6A 3C71A 4GWRA 2M72A 1DUGA 5D9XA 2FNOA 4ZB9A 4XTSA 3ZVJA 2VL3A 1SJ6A 1NHOA 2IWTA 1VF4A 4NHWA 1FG4A 13GSA 4EE0A 2N5BA 1S3DA 3F6FA 2B3SA 3HD5A 4IGJA 2V2GA 3A5WA 1THXA 4KX4A 3RDWA 1MDIA 1JLVA 4PXOA 5CREA 2LKUA 4NMUA 5D9VA 1ZL9A 4MK3A 1Y25A 5DAKB 4MZWA 2TRXA 4EL1A 4O5RA 2D2ZA 2H6YA 3TJFA 4EO3A 3TJKA 2VCVA 5F0GA 4KCAA 12GSA 2HSHA 2JADA 2CQ9A 4ZB8A 4N10A 4TVEA 4PNGA 2B5YA 5IPGA 3KM6A 4FYCA 2LSTA 3APQA 2HRNA 3C8EA 5F07A 1G6YA 2R5GA 3EE2A 2NPBA 4E8HA 5G2ZA 2X8CA 4POBA 2C1YA 4RQRA 5IMFA 2G0FA 2H6XA 3SWLA 3MDKA 3PH9A 2LRNA 2PBJA 4MP4A 1M9BA 2GZPA 3I69A 1GSQA 5DDLA 4K6XA 1F6MC 2NVLA 1YKCA 4HQZA 2C0FA 2YZUA 2YP6A 3KCMA 3TKSE 4EDZA 2IMIA 1AQVA 1M2DA 3GTUB 4HUAA 4ECJA 5JCGA 3FEUA 4QL9A 18GSA 3H8QA 2C0DA 2YWMA 5IO2A 3Q19A 4FO5A 4ZL9A 3FY7A 5B7CA 1XOBA 1Y6EA 19GSA 3LXTA 2V6KA 4DSSA 3BD2A 2JL4A 2AUVA 5KN3A 1B4QA 4I2TA 3HYPA 4LMWA 2NBSA 1BX9A 3FKFA 1FB0A 3IE3A 3OR5A 2YPMA 1TW9A 3UJ1A 3KXOA 2C3NA 2JZSA 4IBPA 1PQNA 5H5RA 3GH6A 5DALA 2L6DA 3IA1A 4MCUA 2R3XA 3RHBA 4HOJA 5AIVA 2MMNA 2F8FA 3KH9A 1PN9A 2IJYA 2MBSA 4ECBA 3UVHA 3D4TA 3QFAC 1ZOFA 1SD8A 1MD4A 5CRHA 4KSOA 2MBTA 1K0NA 1RQMA 2GSRA 1OKDA 1T7PB 2CV4A 5CRGA 4ML6A 2FWGA 3W6GA 3LG6A 4IHUA 2AAWA 1K0MA 3FK8A 1DBYA 3L78A 1SU9A 4RUVA 4WF4A 3F4RA 4MF7A 3ZIVA 4TKYA 5EPFA 2L4QA 2WS2A 4TXOA 3SBCA 3TKQA 2JZRA 3HJMA 4MA9A 5ECSA 2IN3A 2FWHA 2LV3A 4HEA2 5LD0A 3J7Yk 3W8JA 4KE3A 4JR4A 4WBRD 4POMA 3ME8A 2AYTA 4IJIA 1O8WA 6GSUA 3HY2A 3LXZA 1WWJA 2I9HA 1X5CA 2E0QA 3QCPA 4D73A 2DMMA 2F9SA 1B48A 3WD6A 3GYKA 2OE3A 4X1UA 1UN2A 1EP7A 2XC2A 2PU9C 1SENA 2LQOA 1XW6A 4XS6A 2VCWA 2YOIA 1XZOA 2H1GA 2HZEA 4NV2A 2PUKC 3FR6A 5HR3A 2WZ9A 1AQXA 2H6ZA 4TR3A 4GQFA 2ES7A 1YF0A 4NXIA 1FVKA 4AJ8A 4QL7A 3LJRA 1O73A 4O7HA 1CQHA 5IMVA 3GIXA 3KGKA 2VAFA 5HR1A 1KBNA 2E2GA 1XWKA 2FGXA 4ZL7A 3HXSA 3UARA 3US3A 1HNCA 1JZDA 2F8AA 1T3BA 3UMAA 2LJKA 1PX7A 2LUSA 3GHAA 2WJUA 4G19A 1ERVA 4LA1A 2EIQA 4KNDA 3EC3A 2IL3A 4LLRA 5HR2A 3UBLA 4K9ZA 1SJZA 3KTBA 1R26A 4KA0A 1OC9B 3MAKA 1XWAA 3J7Yb 1U87A 2GQLA 1J0FA 3QAWA 3D22A 1K0AA 2EIRA 2WULA 1GL8A 4KB3A 4OCFA 1LJRA 1ZGNA 3GN3A 1SKSB 1X5DA 2CZ2A 2H66A 1YEXA 2BMXA 5G1KA 2YWOA 2H8LA 2AV4A 2PGTA 1MDKA 4TRXA 2GZYA 1EV9A 5A4VA 1M2BA 2H30A 3F6DA 4MDCA 2XPDA 1QK8A 3C1SA 2DIZA 2OBKA 4NAXA 4I2UA 5G5EA 1T4ZA 3LORA 4ID0A 1YEPA 1YKAA 1JHBA 4DSRA 1EEJA 1YY7A 5CAXA 3TOUA 2LTKA 4K1FA 4HI7A 2K8SA 1TRWA 5AN1A 2FCHA 3EVIA 4O32A 1K0CA 3FYGA 5C00A 3GH9A 1GULA 1WOUA 2KOKA 5GAND 4POLA 5G30A 5HFGA 4CW9A 5L71A 1F37A 1U3IA 3N5OA 4I5QA 4MPGA 4GSSA 2LRCA 1XOAA 1C72A 1Q98A 5DJMA 2CVKA 2C3TA 2O7KA 3TOTA 2RM5A 3TKSC 4N30A 1J9BA 2WGRA 5ECPB 3P8WA 1GUMA 1TOFA 1W89A 4MJBA 4V1Ag 1ERTA 5COHA 5CO3A 2JSZA 5J41A 4K2DA 4OO4A 3WYWA 4XS4B 1GSEA 2H76A 2FHEA 4FYUA 3U5RE 1UA5A 2OJLA 3PINA 1PL1A 2RUEA 5IMAA 5ID2B 3D21A 2O8VB 1V40A 3FR3A 3LYPA 2R6KA 5B6MA 3HA9A 1HYUA 2GDRA 1HQOA 2CZ3A 2GSQA 2YNXA 3TGZA 1TP9A 5LCZA 4ZBAA 2IFQB 3ZVJD 4OO5A 3VWVA 1PRXA 2KP1A 3ZFLA 3TRQA 4MJAA 4YH2A 3CMIA 2VCTA 3EURA 3ZFBA 1T00A 4F2IA 4OD7A 2DJJA 4K0NA 3RBTA 3O6TA 1EEMA 2DMLA 4J56E 4MF5A 4X43A 3UBKA 2CAQA 1SK0A 5A4WA 4OFMA 3EMXA 2RLIA 2I1UA 5HQPA 1SD9A 2JACA 2CVBA 2PVOC 4IN0A 1URMA 3EU4A 3FW2A 3WGDA 4PUAA 4L8EA 4NV5A 4TR1B 3UVTA 4AGSA 1V2AA 1SYRA 2DLXA 1N8JA 4MH2A 3GKKA 1K0DA 4AJ7A 4WKWA 4PQHA 1SKRB 5B8BA 3P90A 4FH8A 3WT1A 1TDIA 3HZ8A 4EF0A 3ZLPA 4YQVA 2VL2A 4MJEA 1R5AA 2GSSA 3QAGA 1EV4A 1NSWA 1M0UA 1E2YA 2C80A 1U6TA 4OFTA 1WMJA 5DCHA 5GSTA 5IIZA 3GUSA 1JZOA 3IK9A 3TKSA 3KEBA 1EP8A 2FA4A 5KN1A 4WR5A 1VF2A 1ABAA 2HRFA 4MJCA 1TU7A 3IOSA 4ZXGA 2CAIA 4F9ZA 2B1KA 4MMMA 3LSZA 3EWLA 2R2JA 3GKMA 2H01A 2B6MA 1XIYA 3DEXA 2XBQA 2L6CA 2XBIA 2DJ1A 4PGTA 3IAS2 3HVVA 3VI7A 5J3RA 3RPNA 4HJ2A 4ZBBA 2B5XA 3A2WA 3A2XA 1WP0A 4KUNA 1X9WB 3IRAA 3UL3A 4YAVA 4TR4A 1F3BA 6GSWA 1GTUA 1JFUA 2ZUPA 2PN8A 6GSTA 1KNGA 4HS1A 4JU5A 1KEBA 1ERUA 5D93A 1QGVA 1XBSA 2IIYA 5J4UA 4DEJA 2YJHA 3NOFA 4WBJA 3DRNA 2P0GA 4L0WA 4KAEA 5CRWA 3H93A 4ULXA 3ERWA 1S3AA 4X0XA 3CTFA 3L9UA 1QMVA 2O85A 1R7HA 3HVXA 5IM9A 1PSQA 2LQQA 1M7TA 5ECHB 3KZQA 3GMFA 5DJLA 2IPAA 3HVSA 3BBYA 3F9UA 5IPHA 1K3OA 1GUHA 4G2EA 4POKA 1Z7RA 2IMEA 4XRAA 3K8NA 1Z7PA 3VWXA 2L57A 4MF6A 3RHCA 2IMKA 3FHKA 3DYRA 2F3MA 1TI3A 2O89A 5EY6A 1X0RA 2ZCTA 3DKSA 5FHIA 5JWQB 2VM2A 2IMFA 1BAYA 4IQ1A 5ECKB 4J57E 5DALB 4YQUA 1YDKA 3E9JB 4K7IA 4NPBA 1GH2A 2HSYA 2XPEA 1T4YA 1Z9HA 2QC7A 5ENUA 4WXTA 3HCZA 2MMZA 3NZNA 4N0VA 5DCGA 4I6XA 4IJ3A 1ML6A 1WE0A 2LJRA 1GRXA 1H75A 1AQWA 3KMOA 1A23A 3ZIJA 3D6IA 1TXXA 3TJGA 4WR4A 2QKEA 5ECLB 1EOHA 2QSIA 1SK2A 1T8EB 2NTOA 4MABA 2WRTA 1A0RP 3N9JA 3VLNA 3ZYWA 2VCZA 4TXOB 3TRXA 2GT5A 2GVPA 3I6AA 5CYYA 3GFKA 2TRCP 2DJ3A 4MH3A 2H1AA 4BA7A 5IMCA 4MZBA 1A24A 2BJXA 14GSA 5FT3A 1V98A 5F05A 2I3YA 1TK8B 2K6VA 4KGIA 1XVQA 1T1VA 3IXRA 4IQAA 2WFCA 2XHFA 2NDOA 3DMLA 3DD3A 4CHSA 1WRYA 1MTCA 1VF1A 5ECRB 4IW9A 1TJDA 4ZIJA 3DVXA 16GSA 2OE0A 3LYKA 2IMDA 3F4TA 3VPTA 4WEYA 2DSAA 5KN0A 2HZEB 1AW9A 1K0OA 4OFNA 3VPQA 1ZYEA 3FZ5A 1K0BA 1OE8A 5E59A 2YWNA 1NW2A 1WJKA 1TI1A 2KHPA 4V2LA 1SJIA 2LJAA 3KMNA 2MYGA 3E0UA 1N2AA 2C8UA 4IP6A 1TK5B 3QD9A 4J2FA 3VK9A 4I8BA 3QPMA 2HZFA 4I97A 1GNWA 3GL3A 1QXHA 1ZYQB 3IDVA 2A2SA 3F0IA 1FHEA 1F3AA 8GSSA 1A2LA 1GSYA 2DIYA 3D4MA 4WETA 4LL1B 17GSA 4BPYA 1DSBA 6GSSA 2K8VA 2L5LA 3U6VA 2C4JA 1AXDA 4HQSA 3ZMKA 2YCDA 1OAZA 4KW6A 3WGEA 2A4VA 1B8XA 5A4UA 1BJXA 1TRSA 3UIWA 1OKTA 3ERFA 1WIKA 3CTGA 4GLTA 1OC9A 2CT6A 4Q5NA 2L5OA 3TRPA 1VGLA 2DJ0A 4MLYA 1SL1B 4QQ7A 3M3MA 4MZCA 4ZBDA 2H74A 4K7NA 4DSQA 2K18A 2GQKA 2GSTA 1CQGA 4F0CA 5KEJA 4OMVA 2CA8A 2VIMA 4BWQA 3WT2A 2HFDA 2MMOA 3HJPA 3IK7A 1OVNA 4ZB6A 3IHQA 2V1MA 2DJ2A 1FAAA 1K3YA 3IR4A 2H0HA 4L0UA 5ECOB 3FR9A 1GLPA 2E7PA 1E6BA 5D9WA 4Q5FA 5IMDA 3HZ4A 1MDJA 1SKWB 1Z3EA 3ZMLA 1DE1A 3KP9A 6GSVA 2PERA 1VF3A 3H4KA 4F82A 3PGTA 3ZL5A 4PUFC 4PQ1A 3TCOA 4GXZA 1ST9A 1G0TA 3GKXA 4JZQA 2FWFA 2VL2C 3F63A 1AUCA 5FWGA 1GWCA 4EC0A 2GLRA 5F8BA 4ZILA 3A2VA 3QDNA 5DBQA 1SL0B 4NWYA 4TR0A 5G5FA 1GSSA 1FB6A 2B7KA 5DVBA 2YWIA 3ZRDA 1FVJA 3I43A 4JR6A 2P5QA 1TU8A 4JE1A 3TJJA 4KDXA 3GNJA 2H70A 4XS4A 3TKRA 2GQMA 5G31A 3FZ4A 2J23A 2FD3A 3L4NA 4AF2A 3HHVA 4KH7A 1G6WA 1TTZA 4XRDA 3DIEA 3BOAA 2VOCA 2M46A 2RUFA 3LQ7A 4NHZA 1ILOA 2H0IA 4N11A 4EDYA 3UOMA 3ISOA
chains in the Genus database with same CATH superfamily
3H79A 1IYIA 3QAVA 5IMZA 3P7XA 2A4HA 1F9MA 2ON7A 2YV9A 3EU3A 1HNAA 1GSDA 1GNEA 2G2QA 2V32A 3ZTLA 1GP1A 3D0ZA 2L59A 1BYEA 3R2QA 4DVCA 4Q5RA 3DVWA 2QGVA 2HNLA 5CNWA 2EC4A 1I5GA 1O6JA 3GRXA 2V41A 2VLUA 2VLVA 5HFIA 2MZCA 3TDGA 2X8HA 1QQ2A 3M9KA 2DBCA 1QUWA 3G9BA 5IO0A 2RIIA 4IVFA 3HKRA 3F8UA 2LEGA 1ACVA 6GSXA 3CSJA 3CSHA 3HJOA 4GF0A 1SK1A 1GTBA 3KTLA 5D96A 4HU7A 5JCUA 3Q74A 2R4VA 2OACA 2C0EA 4K5RA 3FZ9A 5BMUA 2CVDA 5F06A 1O85A 5ECIB 3A3TA 4KDYA 1TRVA 4PNFA 4IKHA 3EYTA 4BWSA 5DQSA 3M0FA 2FA8A 4EXJA 2A2RA 5J5NA 3Q18A 4K0GA 1PL2A 5INYA 2VCQA 3G7JA 5DAKA 2FY6A 2I4AA 1A0FA 3CXGA 1USBA 3MIXA 3JCML 5IOWA 3RAZA 3AY8A 1KTEA 4XCSA 3TJBA 3C1RA 3DWVA 1EOGA 5GSSA 2OA7A 1YF1A 5ECNB 4RQXA 4ACSA 4EUYA 3BJ5A 4GTUA 4MPFA 3DXBA 3LEFA 4EVMA 1XVWA 2B1LA 2YJ7A 2F51A 3MWHA 1W4VA 4E8EA 3IC4A 2H73A 5CRDA 2B7JA 4MNNA 2VL9A 3TKPA 2CX4A 1MD3A 1A8YA 5AISA 4EKZA 2DJKA 2WCIA 3IPZA 1M2AA 3ED3A 3APOA 4G10A 2K9FA 2YV7A 4ECIA 2ALBA 20GSA 5ELAA 5G1LA 3KIJA 2R0GA 2YZHA 2VM1A 1O8XA 1TRUA 4O92A 2AJQB 1QFNA 3TUEA 2KP2A 3LGCA 1FOVA 1OYJA 1A2JA 2MMAA 3GTUA 1Z6MA 1RK4A 4RI7A 1OC3A 4IP1A 2HYXA 3MYDA 1PMTA 4KSMA 5J9CA 2M80A 2OKAA 1OE7A 2PVQA 2HXKA 1V57A 1BEDA 5C04A 3PR8A 3KD0A 4DSSB 4FIWA 4G0KA 1ERWA 2H1DA 5B6NA 9GSSA 1GSUA 1ZCPA 3GX8A 1O81A 4O5UA 4GCIA 5EL8A 2LNTA 3IAM2 5ELGA 1AAZA 3ERGA 4PX1A 1ZYNA 2AB6A 3FMWA 2R0CA 3GA4A 4H86A 1Z5YE 1O7UA 1FO5A 2OADA 2HI7A 1Z6NA 4F0BA 2TIRA 4L5LA 3IV4A 1X9MB 5D9TA 5A5KA 1ZZYA 1HNBA 5EVOA 5E4WA 1WPIA 1K3LA 22GSA 4YKFA 1GSFA 3VWWA 3L0HA 4BVXA 4O5QA 2R37A 4V1Ap 4CDOA 3MNGA 2AHEA 2GGTA 1YZXA 2B5EA 2JU5A 4TXVA 5BRTA 3QMXA 1PD21 4JRRA 1EGRA 4HDEA 3P2AA 5H5QA 2HLSA 3CYNA 1X5EA 3ZZXA 2I81A 1EZKA 5KOWA 1Q4JA 3GV1A 3VWUA 2H71A 1FW1A 2JZTA 4JBBA 3ZREA 2PMTA 2EIOA 1AIUA 2N5FA 4K5SA 1HD2A 1R4WA 3F4SA 3UAPA 2H0GA 1G7OA 3D5JA 2GS3A 4GSTA 1V58A 4BL7A 4PQIA 1PA3A 4OWYA 2J9HA 1PX6A 4XS1A 3KJYA 4K7OA 3CSIA 1AC1A 2WB9A 2OE1A 4TOPA 2FUG2 4D73B 5JWRB 3FRCA 2FWEA 3CRTA 5AIXA 1A2MA 1I9DA 3G7IA 1XG8A 5H5SA 1DE2A 1LBKA 1NHYA 3UEMA 4F03A 1THOA 1B4PA 3GURA 2C3QA 4XIHA 1VRSD 2RM6A 5HFKA 1YJ6A 4Z2TA 1XXUA 2FLSA 3TB2A 3EMPA 4HZ2A 1BG5A 3W8SA 4KCEA 3APSA 5ECQB 4ZL8A 1XPVA 3GKNA 3DGQA 3GL5A 1BQ7A 5JCWA 1F2EA 4V2NA 1MEKA 2HRAA 4Z2UA 2KLXA 1M3IA 3M8NA 3H1NA 4FYBA 4Q5QA 5DQYA 2CX3A 3GSTA 1ZMAA 1B9YC 4G9HA 3HVNA 3S9FA 3MSZA 3BCIA 2JSYA 1NM3A 2X99A 1GUKA 1JLWA 3IBHA 2H72A 4IELA 2N5AA 3CRUA 3GSSA 1LU4A 2DC5A 2H1BA 2ZNMA 2VCXA 3NIVA 2VUPA 2LS5A 2HE3A 1IYHA 1JZWA 1M99A 4KF9A 5HR0A 4RI6A 5GZZB 3QFBC 4ISDA 1JZRA 2P31A 1V9WA 5ECMB 3VFIA 2H19A 3CQFA 3ME7A 3QOUA 1XFLA 3F3QA 1GLQA 3O76A 3LWAA 2KUCA 4XHMA 5D8IA 5ABRA 5J9BA 3V1WA 2LRTA 4K8MA 1ON4A 2VD0A 5KN2A 2C0GA 2YANA 5JWOB 4ECCA 2OBIA 2PWJA 4ML1A 4PTSA 3GX0A 3E3EA 4IS0A 1G7EA 3I9V2 1M9AA 5IQYA 1RW1A 4LL4B 4ILFA 3F3RA 1XW9A 1OC8A 1PGTA 2E2MA 5KOXA 4N0ZA 2X8GA 4JEDA 2YN1A 5CP1A 3FZAA 1PKZA 4GQCA 2O87A 4Z7XA 2H75A 3LFLA 4GSNA 2LNSA 1J08A 2WDUA 4LMVA 4P3YB 1GTAA 2VO4A 4GRFA 1XWBA 5AGYA 11GSA 1R5PA 1XWGA 3M1GA 6GSYA 4TN8A 4HU9A 1A8LA 3C73A 5LNKe 3Q6OA 3VURA 3EINA 5B8AA 4TW5A 1H4OA 3KP8A 2V6OA 1X9SB 10GSA 2P5RA 3BCKA 5D73A 3WGXA 1SL2B 1SYXA 4V2MA 4OCEA 3CBUA 5ID2A 1U3AA 1UC7A 3C7MA 1YQ1A 1UVZA 2GT6A 4EIPA 3L9VA 2IFQA 2REMA 4L5OA 4BVYA 3G7YA 3O3TA 2HT9A 1XCCA 1PKWA 2GTUA 2BTOT 4HJMA 4WF5A 4PURA 5GAPD 1B9XC 4YQMA 2ON5A 1U88A 2PPTA 4YAPA 3QR6A 3KH7A 1GTIA 3L9SA 2VLTA 3HDCA 5IOXA 1TK0B 7GSSA 2GZZA 1XWCA 1S3CA 2X64A 3ZITA 1TKDB 2L4CA 4KDUA 2Z9SA 3M9JA 1XW5A 1EGOA 4HZ4A 3VI5A 2VD1A 4TR1A 3RPPA 1EWXA 4AJ6A 3C71A 4GWRA 2M72A 1DUGA 5D9XA 2FNOA 3IC8A 4ZB9A 4XTSA 3ZVJA 2VL3A 1SJ6A 1NHOA 2IWTA 1VF4A 4NHWA 1FG4A 13GSA 4EE0A 2N5BA 1S3DA 3F6FA 2B3SA 3HD5A 4IGJA 2V2GA 3A5WA 1THXA 4KX4A 3RDWA 1MDIA 1JLVA 4PXOA 5CREA 2LKUA 4NMUA 5D9VA 1ZL9A 4MK3A 1Y25A 5DAKB 4MZWA 2TRXA 4EL1A 4O5RA 2D2ZA 2H6YA 3TJFA 4EO3A 3TJKA 2VCVA 5F0GA 4KCAA 12GSA 2HSHA 2JADA 2CQ9A 4ZB8A 4N10A 4TVEA 4PNGA 2B5YA 5IPGA 3KM6A 4FYCA 2LSTA 3APQA 2HRNA 3C8EA 5F07A 1G6YA 2R5GA 3EE2A 2NPBA 4E8HA 5G2ZA 2X8CA 4POBA 2C1YA 4RQRA 5IMFA 2G0FA 2H6XA 3SWLA 3MDKA 3PH9A 2LRNA 2PBJA 4MP4A 1M9BA 2GZPA 3I69A 1GSQA 1ZYPA 5DDLA 4K6XA 1F6MC 2NVLA 1YKCA 4HQZA 2C0FA 2YZUA 2YP6A 3KCMA 3TKSE 4EDZA 2IMIA 1AQVA 1M2DA 3GTUB 4HUAA 4ECJA 5JCGA 3FEUA 4QL9A 18GSA 3H8QA 2C0DA 2YWMA 5IO2A 3Q19A 4FO5A 4ZL9A 2X4AA 3FY7A 5B7CA 1XOBA 1Y6EA 19GSA 3LXTA 2V6KA 4DSSA 3BD2A 2JL4A 2AUVA 5KN3A 1B4QA 4I2TA 3HYPA 4LMWA 2NBSA 1BX9A 3FKFA 1FB0A 3IE3A 3OR5A 2YPMA 1TW9A 3UJ1A 3KXOA 2C3NA 2JZSA 4IBPA 1PQNA 5H5RA 3GH6A 5DALA 2HSMA 2L6DA 3IA1A 4MCUA 2R3XA 3RHBA 4HOJA 5AIVA 2MMNA 2F8FA 3KH9A 3PPUA 1PN9A 2IJYA 2MBSA 4ECBA 3UVHA 3D4TA 3QFAC 1ZOFA 1SD8A 1MD4A 1FOHA 5CRHA 4KSOA 2MBTA 1K0NA 1RQMA 2GSRA 1OKDA 1T7PB 2CV4A 5CRGA 4ML6A 2R0PA 2FWGA 3W6GA 3LG6A 4IHUA 2AAWA 1K0MA 3FK8A 1DBYA 3L78A 1SU9A 4RUVA 4WF4A 3F4RA 4MF7A 1S3RA 1M3JA 3ZIVA 4TKYA 5EPFA 2L4QA 2WS2A 4TXOA 3SBCA 3TKQA 2JZRA 3HJMA 4MA9A 5ECSA 2IN3A 2FWHA 2LV3A 4HEA2 5LD0A 3J7Yk 3W8JA 4KE3A 4JR4A 4WBRD 4BL7B 4POMA 3ME8A 2AYTA 4IJIA 4A5PA 1O8WA 6GSUA 3HY2A 3LXZA 1WWJA 2I9HA 1X5CA 2E0QA 3QCPA 4D73A 2DMMA 2F9SA 1B48A 3WD6A 3GYKA 2OE3A 4X1UA 1UN2A 1EP7A 2XC2A 2PU9C 1SENA 2LQOA 1XW6A 4XS6A 2VCWA 2YOIA 1XZOA 2H1GA 2HZEA 4NV2A 2PUKC 3FR6A 5HR3A 2WZ9A 1AQXA 2H6ZA 4TR3A 4GQFA 2ES7A 1YF0A 4NXIA 1FVKA 4AJ8A 4QL7A 3LJRA 1O73A 4O7HA 1CQHA 5IMVA 3GIXA 2QA1A 3KGKA 2VAFA 5HR1A 1KBNA 2E2GA 1XWKA 2FGXA 4ZL7A 3HXSA 3UARA 3US3A 1HNCA 1JZDA 2F8AA 1T3BA 3UMAA 2LJKA 1PX7A 2LUSA 3GHAA 2WJUA 4G19A 1ERVA 4LA1A 2EIQA 4KNDA 3EC3A 2IL3A 4LLRA 5HR2A 3UBLA 4K9ZA 1SJZA 3KTBA 1R26A 4KA0A 1OC9B 3MAKA 1XWAA 3J7Yb 1U87A 2GQLA 1J0FA 3QAWA 3D22A 1K0AA 2EIRA 2WULA 1GL8A 4KB3A 4OCFA 1LJRA 1ZGNA 3GN3A 1SKSB 1X5DA 2CZ2A 2H66A 1YEXA 2BMXA 5G1KA 2YWOA 2H8LA 2AV4A 2PGTA 1MDKA 4TRXA 2GZYA 1EV9A 5A4VA 1M2BA 2H30A 3F6DA 4MDCA 2XPDA 3LW9A 1QK8A 3C1SA 2DIZA 2OBKA 4NAXA 4I2UA 5G5EA 1T4ZA 3LORA 4ID0A 1YEPA 1YKAA 1JHBA 4DSRA 1EEJA 1YY7A 5CAXA 3TOUA 2LTKA 4K1FA 4HI7A 2K8SA 1TRWA 5AN1A 2FCHA 3EVIA 4O32A 1K0CA 3FYGA 5C00A 2DKHA 3GH9A 1GULA 1WOUA 2KOKA 5GAND 4POLA 5G30A 5HFGA 4CW9A 5L71A 1F37A 1U3IA 3N5OA 4I5QA 4MPGA 4GSSA 2LRCA 1XOAA 1C72A 1Q98A 5DJMA 2CVKA 2C3TA 2O7KA 3TOTA 2RM5A 3TKSC 4N30A 1J9BA 2WGRA 5ECPB 3P8WA 1GUMA 4ICYA 1TOFA 1W89A 4MJBA 4V1Ag 1ERTA 5COHA 5CO3A 2JSZA 5J41A 4K2DA 4OO4A 3WYWA 4XS4B 1GSEA 2H76A 2FHEA 4FYUA 3U5RE 1UA5A 2OJLA 3PINA 1PL1A 2RUEA 5IMAA 5ID2B 3D21A 2O8VB 1V40A 3FR3A 3LYPA 2R6KA 5B6MA 3HA9A 1HYUA 2GDRA 2UZ8A 1HQOA 2CZ3A 2GSQA 2YNXA 3TGZA 1TP9A 3A5IA 5LCZA 4ZBAA 2IFQB 3ZVJD 4OO5A 3VWVA 1PRXA 2KP1A 3ZFLA 3TRQA 4MJAA 4YH2A 3CMIA 2VCTA 3EURA 3ZFBA 1T00A 4F2IA 4OD7A 2DJJA 4K0NA 3RBTA 3O6TA 1EEMA 2DMLA 4J56E 4MF5A 4X43A 3UBKA 2CAQA 1SK0A 5A4WA 4OFMA 3EMXA 2RLIA 2I1UA 5HQPA 1SD9A 2JACA 4HSCX 2CVBA 2PVOC 4IN0A 1URMA 3EU4A 3FW2A 3WGDA 4PUAA 4L8EA 4NV5A 4TR1B 3UVTA 4AGSA 1V2AA 3EPTA 1SYRA 2DLXA 1N8JA 4MH2A 3GKKA 1K0DA 4AJ7A 4WKWA 4PQHA 1SKRB 5B8BA 3P90A 4FH8A 3WT1A 1TDIA 3HZ8A 4EF0A 3ZLPA 4YQVA 2VL2A 4MJEA 1R5AA 2GSSA 3QAGA 1EV4A 1NSWA 1M0UA 1E2YA 2C80A 1U6TA 4OFTA 1WMJA 5DCHA 5GSTA 5IIZA 3GUSA 1JZOA 3IK9A 3TKSA 3KEBA 1EP8A 2FA4A 5KN1A 4WR5A 1VF2A 1ABAA 2HRFA 4MJCA 1TU7A 3IOSA 4ZXGA 2CAIA 4F9ZA 4CY6A 2B1KA 4MMMA 3LSZA 3EWLA 2R2JA 3GKMA 2H01A 2B6MA 1XIYA 3DEXA 2XBQA 2L6CA 2XBIA 2DJ1A 4PGTA 3IAS2 3HVVA 3VI7A 5J3RA 3RPNA 4HJ2A 4ZBBA 2B5XA 3A2WA 3A2XA 1WP0A 4KUNA 1X9WB 3IRAA 3UL3A 4YAVA 4TR4A 1F3BA 6GSWA 1PFOA 1GTUA 4YKGA 1JFUA 2ZUPA 2PN8A 6GSTA 1KNGA 4HS1A 4JU5A 1KEBA 1ERUA 5D93A 1QGVA 1XBSA 2IIYA 5J4UA 4DEJA 2YJHA 3NOFA 4WBJA 3DRNA 2P0GA 4L0WA 4KAEA 5CRWA 3H93A 4ULXA 3ERWA 1S3AA 1PN0A 4X0XA 3CTFA 3L9UA 1QMVA 2O85A 1R7HA 3HVXA 5IM9A 1PSQA 2LQQA 1M7TA 5ECHB 3KZQA 3GMFA 5DJLA 2IPAA 3HVSA 4EIQA 3BBYA 3F9UA 5IPHA 3R3EA 1K3OA 1GUHA 4G2EA 4POKA 1Z7RA 2IMEA 4XRAA 3K8NA 1Z7PA 3VWXA 2A2PA 4CY8A 2L57A 4MF6A 3RHCA 2IMKA 3FHKA 3DYRA 2F3MA 1TI3A 2O89A 5EY6A 1X0RA 2ZCTA 3DKSA 5FHIA 5JWQB 2VM2A 2IMFA 1BAYA 4IQ1A 5ECKB 4J57E 5DALB 4YQUA 1YDKA 3E9JB 4K7IA 4BVXB 4NPBA 1GH2A 2HSYA 2XPEA 1T4YA 1Z9HA 2QC7A 5ENUA 4WXTA 3HCZA 2MMZA 3NZNA 4N0VA 5DCGA 4I6XA 4IJ3A 1ML6A 1WE0A 2LJRA 1GRXA 1H75A 4Z2RA 1AQWA 3KMOA 1A23A 3ZIJA 3D6IA 3IHGA 1TXXA 3TJGA 4WR4A 2QKEA 5ECLB 1EOHA 2QSIA 1SK2A 1T8EB 2NTOA 4MABA 2WRTA 1A0RP 3N9JA 3VLNA 3ZYWA 2VCZA 4TXOB 3TRXA 2GT5A 2GVPA 3I6AA 5CYYA 2DKIA 3GFKA 2TRCP 2DJ3A 4MH3A 2H1AA 4BA7A 5IMCA 4MZBA 1A24A 2BJXA 14GSA 5FT3A 4G0LA 1V98A 5F05A 2I3YA 1TK8B 2K6VA 4KGIA 1XVQA 1T1VA 3IXRA 4IQAA 2WFCA 2XHFA 2NDOA 3DMLA 3DD3A 4CHSA 4X4JA 1WRYA 1MTCA 2X49A 1VF1A 5ECRB 4IW9A 1TJDA 4ZIJA 3DVXA 16GSA 2OE0A 3LYKA 2IMDA 3F4TA 3VPTA 4WEYA 2DSAA 4K2XA 5KN0A 2HZEB 1AW9A 4G0IA 1K0OA 4OFNA 3VPQA 1ZYEA 3FZ5A 1K0BA 4FQUA 1OE8A 5E59A 2YWNA 1NW2A 1WJKA 1TI1A 2KHPA 4V2LA 1SJIA 2LJAA 3KMNA 2MYGA 3E0UA 1N2AA 2C8UA 4IP6A 1TK5B 3QD9A 4J2FA 3VK9A 4I8BA 3QPMA 2HZFA 4I97A 1GNWA 3GL3A 1QXHA 1ZYQB 3IDVA 2A2SA 3F0IA 1FHEA 1F3AA 8GSSA 1A2LA 1GSYA 2DIYA 3D4MA 4WETA 4LL1B 17GSA 4BPYA 1DSBA 6GSSA 2K8VA 2L5LA 3U6VA 2C4JA 1AXDA 4HQSA 3ZMKA 2YCDA 1OAZA 4KW6A 3WGEA 2A4VA 1B8XA 5A4UA 1BJXA 1TRSA 3UIWA 1OKTA 3ERFA 1WIKA 3CTGA 4GLTA 1OC9A 2CT6A 4Q5NA 2L5OA 3TRPA 1VGLA 4BIKA 2DJ0A 4MLYA 1SL1B 4QQ7A 3M3MA 4MZCA 4ZBDA 2H74A 4K7NA 4DSQA 2K18A 2GQKA 2GSTA 1CQGA 4F0CA 5KEJA 4OMVA 2CA8A 2VIMA 4BWQA 3WT2A 2HFDA 2MMOA 3HJPA 3IK7A 1OVNA 4ZB6A 3IHQA 2V1MA 2DJ2A 1FAAA 1K3YA 3IR4A 2H0HA 4L0UA 5ECOB 3FR9A 1GLPA 2E7PA 1E6BA 5D9WA 4Q5FA 5IMDA 3HZ4A 1MDJA 1SKWB 1Z3EA 3ZMLA 1DE1A 3KP9A 6GSVA 2PERA 1VF3A 2QA2A 3H4KA 4F82A 3PGTA 3ZL5A 4PUFC 4PQ1A 3TCOA 4GXZA 1ST9A 1G0TA 3GKXA 4JZQA 2FWFA 2VL2C 3F63A 1AUCA 5FWGA 1GWCA 4EC0A 2GLRA 5F8BA 4ZILA 3A2VA 3QDNA 5DBQA 1SL0B 4NWYA 4TR0A 5G5FA 4USSA 1GSSA 1FB6A 2B7KA 5DVBA 2YWIA 3ZRDA 1FVJA 3I43A 4JR6A 2P5QA 1TU8A 4JE1A 3TJJA 4KDXA 3GNJA 2H70A 4XS4A 3TKRA 2GQMA 5G31A 3FZ4A 2J23A 2FD3A 3L4NA 4AF2A 3HHVA 4KH7A 1G6WA 1TTZA 4XRDA 3DIEA 4BVYB 3BOAA 2VOCA 2M46A 2HRKA 2RUFA 3LQ7A 4NHZA 1ILOA 2H0IA 4N11A 4EDYA 3UOMA 3ISOA
chains in the Genus database with same CATH topology
3H79A 1IYIA 3QAVA 5IMZA 3P7XA 2A4HA 1F9MA 2ON7A 2YV9A 3EU3A 1HNAA 1GSDA 1GNEA 2G2QA 2V32A 3ZTLA 1GP1A 3D0ZA 2L59A 1BYEA 3R2QA 4DVCA 4Q5RA 3DVWA 2QGVA 2HNLA 5CNWA 2EC4A 1I5GA 1O6JA 3GRXA 2V41A 2VLUA 2VLVA 5HFIA 2MZCA 3TDGA 2X8HA 1QQ2A 3M9KA 2DBCA 1QUWA 3G9BA 5IO0A 2RIIA 4IVFA 3HKRA 3F8UA 2LEGA 1ACVA 6GSXA 3CSJA 3CSHA 3HJOA 4GF0A 1SK1A 1GTBA 3KTLA 5D96A 4HU7A 5JCUA 3Q74A 2R4VA 2OACA 2C0EA 4K5RA 3FZ9A 5BMUA 2CVDA 5F06A 1O85A 5ECIB 3A3TA 4KDYA 1TRVA 4PNFA 4IKHA 3EYTA 4BWSA 5DQSA 3M0FA 2FA8A 4EXJA 2A2RA 5J5NA 3Q18A 4K0GA 1PL2A 5INYA 2VCQA 3G7JA 5DAKA 2FY6A 2I4AA 1A0FA 3CXGA 1USBA 3MIXA 3JCML 5IOWA 3RAZA 3AY8A 1KTEA 4XCSA 3TJBA 3C1RA 3DWVA 1EOGA 5GSSA 2OA7A 1YF1A 5ECNB 4RQXA 4ACSA 4EUYA 3BJ5A 4GTUA 4MPFA 3DXBA 3LEFA 4EVMA 1XVWA 2B1LA 2YJ7A 2F51A 3MWHA 1W4VA 4E8EA 3IC4A 2H73A 5CRDA 2B7JA 4MNNA 2VL9A 3TKPA 2CX4A 1MD3A 1A8YA 5AISA 4EKZA 2DJKA 2WCIA 3IPZA 1M2AA 3ED3A 3APOA 4G10A 2K9FA 2YV7A 4ECIA 2ALBA 20GSA 5ELAA 5G1LA 3KIJA 2R0GA 2YZHA 2VM1A 1O8XA 1TRUA 4O92A 2AJQB 1QFNA 3TUEA 2KP2A 3LGCA 1FOVA 1OYJA 1A2JA 2MMAA 3GTUA 1Z6MA 1RK4A 4RI7A 1OC3A 4IP1A 2HYXA 3MYDA 1PMTA 4KSMA 5J9CA 2M80A 2OKAA 1OE7A 2PVQA 2HXKA 1V57A 1BEDA 5C04A 3PR8A 3KD0A 4DSSB 4FIWA 4G0KA 1ERWA 2H1DA 5B6NA 9GSSA 1GSUA 1ZCPA 3GX8A 1O81A 4O5UA 4GCIA 5EL8A 2LNTA 3IAM2 5ELGA 1AAZA 3ERGA 4PX1A 1ZYNA 2AB6A 3FMWA 2R0CA 3GA4A 4H86A 1Z5YE 1O7UA 1FO5A 2OADA 2HI7A 1Z6NA 4F0BA 2TIRA 4L5LA 3IV4A 1X9MB 5D9TA 5A5KA 1ZZYA 1HNBA 5EVOA 5E4WA 1WPIA 1K3LA 22GSA 4YKFA 1GSFA 3VWWA 3L0HA 4BVXA 4O5QA 2R37A 4V1Ap 4CDOA 3MNGA 2AHEA 2GGTA 1YZXA 2B5EA 2JU5A 4TXVA 5BRTA 3QMXA 1PD21 4JRRA 1EGRA 4HDEA 3P2AA 5H5QA 2HLSA 3CYNA 1X5EA 3ZZXA 2I81A 1EZKA 5KOWA 1Q4JA 3GV1A 3VWUA 2H71A 1FW1A 2JZTA 4JBBA 3ZREA 2PMTA 2EIOA 1AIUA 2N5FA 4K5SA 1HD2A 1R4WA 3F4SA 3UAPA 2H0GA 1G7OA 3D5JA 2GS3A 4GSTA 1V58A 4BL7A 4PQIA 1PA3A 4OWYA 2J9HA 1PX6A 4XS1A 3KJYA 4K7OA 3CSIA 1AC1A 2WB9A 2OE1A 4TOPA 2FUG2 4D73B 5JWRB 3FRCA 2FWEA 3CRTA 5AIXA 1A2MA 1I9DA 3G7IA 5H5SA 1DE2A 1LBKA 1NHYA 3UEMA 4F03A 1THOA 1B4PA 3GURA 2C3QA 4XIHA 1VRSD 2RM6A 5HFKA 1YJ6A 4Z2TA 1XXUA 2FLSA 3TB2A 3EMPA 4HZ2A 1BG5A 3W8SA 4KCEA 3APSA 5ECQB 4ZL8A 1XPVA 3GKNA 3DGQA 3GL5A 1BQ7A 5JCWA 1F2EA 4V2NA 1MEKA 2HRAA 4Z2UA 2KLXA 3M8NA 3H1NA 4FYBA 4Q5QA 5DQYA 2CX3A 3GSTA 1ZMAA 1B9YC 4G9HA 3S9FA 3MSZA 3BCIA 2JSYA 1NM3A 2X99A 1GUKA 1JLWA 3IBHA 2H72A 4IELA 2N5AA 3CRUA 3GSSA 1LU4A 2DC5A 2H1BA 2ZNMA 2VCXA 3NIVA 2VUPA 2LS5A 2HE3A 1IYHA 1JZWA 1M99A 4KF9A 5HR0A 4RI6A 5GZZB 3QFBC 4ISDA 1JZRA 2P31A 1V9WA 5ECMB 3VFIA 2H19A 3ME7A 3QOUA 1XFLA 3F3QA 1GLQA 3O76A 3LWAA 2KUCA 4XHMA 5D8IA 5ABRA 5J9BA 3V1WA 2LRTA 4K8MA 1ON4A 2VD0A 5KN2A 2C0GA 2YANA 5JWOB 4ECCA 2OBIA 2PWJA 4ML1A 4PTSA 3GX0A 3E3EA 4IS0A 1G7EA 3I9V2 1M9AA 5IQYA 1RW1A 4LL4B 4ILFA 3F3RA 1XW9A 1OC8A 1PGTA 2E2MA 5KOXA 4N0ZA 2X8GA 4JEDA 2YN1A 5CP1A 3FZAA 1PKZA 4GQCA 2O87A 4Z7XA 2H75A 3LFLA 4GSNA 2LNSA 1J08A 2WDUA 4LMVA 4P3YB 1GTAA 2VO4A 4GRFA 1XWBA 5AGYA 11GSA 1R5PA 1XWGA 3M1GA 6GSYA 4TN8A 4HU9A 1A8LA 3C73A 5LNKe 3Q6OA 3VURA 3EINA 5B8AA 4TW5A 1H4OA 3KP8A 2V6OA 1X9SB 10GSA 2P5RA 3BCKA 5D73A 3WGXA 1SL2B 1SYXA 4V2MA 4OCEA 3CBUA 5ID2A 1U3AA 1UC7A 3C7MA 1YQ1A 1UVZA 2GT6A 4EIPA 3L9VA 2IFQA 2REMA 4L5OA 4BVYA 3G7YA 3O3TA 2HT9A 1XCCA 1PKWA 2GTUA 2BTOT 4HJMA 4WF5A 4PURA 5GAPD 1B9XC 4YQMA 2ON5A 1U88A 2PPTA 4YAPA 3QR6A 3KH7A 1GTIA 3L9SA 2VLTA 3HDCA 5IOXA 1TK0B 7GSSA 2GZZA 1XWCA 1S3CA 2X64A 3ZITA 1TKDB 2L4CA 4KDUA 2Z9SA 3M9JA 1XW5A 1EGOA 4HZ4A 3VI5A 2VD1A 4TR1A 3RPPA 1EWXA 4AJ6A 3C71A 4GWRA 2M72A 1DUGA 5D9XA 2FNOA 3IC8A 4ZB9A 4XTSA 3ZVJA 2VL3A 1SJ6A 1NHOA 2IWTA 1VF4A 4NHWA 1FG4A 13GSA 4EE0A 2N5BA 1S3DA 3F6FA 2B3SA 3HD5A 4IGJA 2V2GA 3A5WA 1THXA 4KX4A 3RDWA 1MDIA 1JLVA 4PXOA 5CREA 2LKUA 4NMUA 5D9VA 1ZL9A 4MK3A 1Y25A 5DAKB 4MZWA 2TRXA 4EL1A 4O5RA 2D2ZA 2H6YA 3TJFA 4EO3A 3TJKA 2VCVA 5F0GA 4KCAA 12GSA 2HSHA 2JADA 2CQ9A 4ZB8A 4N10A 4TVEA 4PNGA 2B5YA 5IPGA 3KM6A 4FYCA 2LSTA 3APQA 2HRNA 3C8EA 5F07A 1G6YA 2R5GA 3EE2A 2NPBA 4E8HA 5G2ZA 2X8CA 4POBA 2C1YA 4RQRA 5IMFA 2G0FA 2H6XA 3SWLA 3MDKA 3PH9A 2LRNA 2PBJA 4MP4A 1M9BA 2GZPA 3I69A 1GSQA 1ZYPA 5DDLA 4K6XA 1F6MC 2NVLA 1YKCA 4HQZA 2C0FA 2YZUA 2YP6A 3KCMA 3TKSE 4EDZA 2IMIA 1AQVA 1M2DA 3GTUB 4HUAA 4ECJA 5JCGA 3FEUA 4QL9A 18GSA 3H8QA 2C0DA 2YWMA 5IO2A 3Q19A 4FO5A 4ZL9A 2X4AA 3FY7A 5B7CA 1XOBA 1Y6EA 19GSA 3LXTA 2V6KA 4DSSA 3BD2A 2JL4A 2AUVA 5KN3A 1B4QA 4I2TA 3HYPA 4LMWA 2NBSA 1BX9A 3FKFA 1FB0A 3IE3A 3OR5A 2YPMA 1TW9A 3UJ1A 3KXOA 2C3NA 2JZSA 4IBPA 1PQNA 5H5RA 3GH6A 5DALA 2HSMA 2L6DA 3IA1A 4MCUA 2R3XA 3RHBA 4HOJA 5AIVA 2MMNA 2F8FA 3KH9A 3PPUA 1PN9A 2IJYA 2MBSA 4ECBA 3UVHA 3D4TA 3QFAC 1ZOFA 1SD8A 1MD4A 1FOHA 5CRHA 4KSOA 2MBTA 1K0NA 1RQMA 2GSRA 1OKDA 1T7PB 2CV4A 5CRGA 4ML6A 2R0PA 2FWGA 3W6GA 3LG6A 4IHUA 2AAWA 1K0MA 3FK8A 1DBYA 3L78A 1SU9A 4RUVA 4WF4A 3F4RA 4MF7A 3ZIVA 4TKYA 5EPFA 2L4QA 2WS2A 4TXOA 3SBCA 3TKQA 2JZRA 3HJMA 4MA9A 5ECSA 2IN3A 2FWHA 2LV3A 4HEA2 5LD0A 3J7Yk 3W8JA 4KE3A 4JR4A 4WBRD 4BL7B 4POMA 3ME8A 2AYTA 4IJIA 4A5PA 1O8WA 6GSUA 3HY2A 3LXZA 1WWJA 2I9HA 1X5CA 2E0QA 3QCPA 4D73A 2DMMA 2F9SA 1B48A 3WD6A 3GYKA 2OE3A 4X1UA 1UN2A 1EP7A 2XC2A 2PU9C 1SENA 2LQOA 1XW6A 4XS6A 2VCWA 2YOIA 1XZOA 2H1GA 2HZEA 4NV2A 2PUKC 3FR6A 5HR3A 2WZ9A 1AQXA 2H6ZA 4TR3A 4GQFA 2ES7A 1YF0A 4NXIA 1FVKA 4AJ8A 4QL7A 3LJRA 1O73A 4O7HA 1CQHA 5IMVA 3GIXA 2QA1A 3KGKA 2VAFA 5HR1A 1KBNA 2E2GA 1XWKA 2FGXA 4ZL7A 3HXSA 3UARA 3US3A 1HNCA 1JZDA 2F8AA 1T3BA 3UMAA 2LJKA 1PX7A 2LUSA 3GHAA 2WJUA 4G19A 1ERVA 4LA1A 2EIQA 4KNDA 3EC3A 2IL3A 4LLRA 5HR2A 3UBLA 4K9ZA 1SJZA 3KTBA 1R26A 4KA0A 1OC9B 3MAKA 1XWAA 3J7Yb 1U87A 2GQLA 1J0FA 3QAWA 3D22A 1K0AA 2EIRA 2WULA 1GL8A 4KB3A 4OCFA 1LJRA 1ZGNA 3GN3A 1SKSB 1X5DA 2CZ2A 2H66A 1YEXA 2BMXA 5G1KA 2YWOA 2H8LA 2AV4A 2PGTA 1MDKA 4TRXA 2GZYA 1EV9A 5A4VA 1M2BA 2H30A 3F6DA 4MDCA 2XPDA 3LW9A 1QK8A 3C1SA 2DIZA 2OBKA 4NAXA 4I2UA 5G5EA 1T4ZA 3LORA 4ID0A 1YEPA 1YKAA 1JHBA 4DSRA 1EEJA 1YY7A 5CAXA 3TOUA 2LTKA 4K1FA 4HI7A 2K8SA 1TRWA 5AN1A 2FCHA 3EVIA 4O32A 1K0CA 3FYGA 5C00A 2DKHA 3GH9A 1GULA 1WOUA 2KOKA 5GAND 4POLA 5G30A 5HFGA 4CW9A 5L71A 1F37A 1U3IA 3N5OA 4I5QA 4MPGA 4GSSA 2LRCA 1XOAA 1C72A 1Q98A 5DJMA 2CVKA 2C3TA 2O7KA 3TOTA 2RM5A 3TKSC 4N30A 1J9BA 2WGRA 5ECPB 3P8WA 1GUMA 4ICYA 1TOFA 1W89A 4MJBA 4V1Ag 1ERTA 5COHA 5CO3A 2JSZA 5J41A 4K2DA 4OO4A 3WYWA 4XS4B 1GSEA 2H76A 2FHEA 4FYUA 3U5RE 1UA5A 2OJLA 3PINA 1PL1A 2RUEA 5IMAA 5ID2B 3D21A 2O8VB 1V40A 3FR3A 3LYPA 2R6KA 5B6MA 3HA9A 1HYUA 2GDRA 2UZ8A 1HQOA 2CZ3A 2GSQA 2YNXA 3TGZA 1TP9A 3A5IA 5LCZA 4ZBAA 2IFQB 3ZVJD 4OO5A 3VWVA 1PRXA 2KP1A 3ZFLA 3TRQA 4MJAA 4YH2A 3CMIA 2VCTA 3EURA 3ZFBA 1T00A 4F2IA 4OD7A 2DJJA 4K0NA 3RBTA 3O6TA 1EEMA 2DMLA 4J56E 4MF5A 4X43A 3UBKA 2CAQA 1SK0A 5A4WA 4OFMA 3EMXA 2RLIA 2I1UA 5HQPA 1SD9A 2JACA 2CVBA 2PVOC 4IN0A 1URMA 3EU4A 3FW2A 3WGDA 4PUAA 4L8EA 4NV5A 4TR1B 3UVTA 4AGSA 1V2AA 3EPTA 1SYRA 2DLXA 1N8JA 4MH2A 3GKKA 1K0DA 4AJ7A 4WKWA 4PQHA 1SKRB 5B8BA 3P90A 4FH8A 3WT1A 1TDIA 3HZ8A 4EF0A 3ZLPA 4YQVA 2VL2A 4MJEA 1R5AA 2GSSA 3QAGA 1EV4A 1NSWA 1M0UA 1E2YA 2C80A 1U6TA 4OFTA 1WMJA 5DCHA 5GSTA 5IIZA 3GUSA 1JZOA 3IK9A 3TKSA 3KEBA 1EP8A 2FA4A 5KN1A 4WR5A 1VF2A 1ABAA 2HRFA 4MJCA 1TU7A 3IOSA 4ZXGA 2CAIA 4F9ZA 4CY6A 2B1KA 4MMMA 3LSZA 3EWLA 2R2JA 3GKMA 2H01A 2B6MA 1XIYA 3DEXA 2XBQA 2L6CA 2XBIA 2DJ1A 4PGTA 3IAS2 3HVVA 3VI7A 5J3RA 3RPNA 4HJ2A 4ZBBA 2B5XA 3A2WA 3A2XA 1WP0A 4KUNA 1X9WB 3IRAA 3UL3A 4YAVA 4TR4A 1F3BA 6GSWA 1GTUA 4YKGA 1JFUA 2ZUPA 2PN8A 6GSTA 1KNGA 4HS1A 4JU5A 1KEBA 1ERUA 5D93A 1QGVA 1XBSA 2IIYA 5J4UA 4DEJA 2YJHA 3NOFA 4WBJA 3DRNA 2P0GA 4L0WA 4KAEA 5CRWA 3H93A 4ULXA 3ERWA 1S3AA 1PN0A 4X0XA 3CTFA 3L9UA 1QMVA 2O85A 1R7HA 3HVXA 5IM9A 1PSQA 2LQQA 1M7TA 5ECHB 3KZQA 3GMFA 5DJLA 2IPAA 3HVSA 4EIQA 3BBYA 3F9UA 5IPHA 3R3EA 1K3OA 1GUHA 4G2EA 4POKA 1Z7RA 2IMEA 4XRAA 3K8NA 1Z7PA 3VWXA 2A2PA 4CY8A 2L57A 4MF6A 3RHCA 2IMKA 3FHKA 3DYRA 2F3MA 1TI3A 2O89A 5EY6A 1X0RA 2ZCTA 3DKSA 5FHIA 5JWQB 2VM2A 2IMFA 1BAYA 4IQ1A 5ECKB 4J57E 5DALB 4YQUA 1YDKA 3E9JB 4K7IA 4BVXB 4NPBA 1GH2A 2HSYA 2XPEA 1T4YA 1Z9HA 2QC7A 5ENUA 4WXTA 3HCZA 2MMZA 3NZNA 4N0VA 5DCGA 4I6XA 4IJ3A 1ML6A 1WE0A 2LJRA 1GRXA 1H75A 4Z2RA 1AQWA 3KMOA 1A23A 3ZIJA 3D6IA 3IHGA 1TXXA 3TJGA 4WR4A 2QKEA 5ECLB 1EOHA 2QSIA 1SK2A 1T8EB 2NTOA 4MABA 2WRTA 1A0RP 3N9JA 3VLNA 3ZYWA 2VCZA 4TXOB 3TRXA 2GT5A 2GVPA 3I6AA 5CYYA 2DKIA 3GFKA 2TRCP 2DJ3A 4MH3A 2H1AA 4BA7A 5IMCA 4MZBA 1A24A 2BJXA 14GSA 5FT3A 4G0LA 1V98A 5F05A 2I3YA 1TK8B 2K6VA 4KGIA 1XVQA 1T1VA 3IXRA 4IQAA 2WFCA 2XHFA 2NDOA 3DMLA 3DD3A 4CHSA 4X4JA 1WRYA 1MTCA 2X49A 1VF1A 5ECRB 4IW9A 1TJDA 4ZIJA 3DVXA 16GSA 2OE0A 3LYKA 2IMDA 3F4TA 3VPTA 4WEYA 2DSAA 4K2XA 5KN0A 2HZEB 1AW9A 4G0IA 1K0OA 4OFNA 3VPQA 1ZYEA 3FZ5A 1K0BA 4FQUA 1OE8A 5E59A 2YWNA 1NW2A 1WJKA 1TI1A 2KHPA 4V2LA 1SJIA 2LJAA 3KMNA 2MYGA 3E0UA 1N2AA 2C8UA 4IP6A 1TK5B 3QD9A 4J2FA 3VK9A 4I8BA 3QPMA 2HZFA 4I97A 1GNWA 3GL3A 1QXHA 1ZYQB 3IDVA 2A2SA 3F0IA 1FHEA 1F3AA 8GSSA 1A2LA 1GSYA 2DIYA 3D4MA 4WETA 4LL1B 17GSA 4BPYA 1DSBA 6GSSA 2K8VA 2L5LA 3U6VA 2C4JA 1AXDA 4HQSA 3ZMKA 2YCDA 1OAZA 4KW6A 3WGEA 2A4VA 1B8XA 5A4UA 1BJXA 1TRSA 3UIWA 1OKTA 3ERFA 1WIKA 3CTGA 4GLTA 1OC9A 2CT6A 4Q5NA 2L5OA 3TRPA 1VGLA 2DJ0A 4MLYA 1SL1B 4QQ7A 3M3MA 4MZCA 4ZBDA 2H74A 4K7NA 4DSQA 2K18A 2GQKA 2GSTA 1CQGA 4F0CA 5KEJA 4OMVA 2CA8A 2VIMA 4BWQA 3WT2A 2HFDA 2MMOA 3HJPA 3IK7A 1OVNA 4ZB6A 3IHQA 2V1MA 2DJ2A 1FAAA 1K3YA 3IR4A 2H0HA 4L0UA 5ECOB 3FR9A 1GLPA 2E7PA 1E6BA 5D9WA 4Q5FA 5IMDA 3HZ4A 1MDJA 1SKWB 1Z3EA 3ZMLA 1DE1A 3KP9A 6GSVA 2PERA 1VF3A 2QA2A 3H4KA 4F82A 3PGTA 3ZL5A 4PUFC 4PQ1A 3TCOA 4GXZA 1ST9A 1G0TA 3GKXA 4JZQA 2FWFA 2VL2C 3F63A 1AUCA 5FWGA 1GWCA 4EC0A 2GLRA 5F8BA 4ZILA 3A2VA 3QDNA 5DBQA 1SL0B 4NWYA 4TR0A 5G5FA 4USSA 1GSSA 1FB6A 2B7KA 5DVBA 2YWIA 3ZRDA 1FVJA 3I43A 4JR6A 2P5QA 1TU8A 4JE1A 3TJJA 4KDXA 3GNJA 2H70A 4XS4A 3TKRA 2GQMA 5G31A 3FZ4A 2J23A 2FD3A 3L4NA 4AF2A 3HHVA 4KH7A 1G6WA 1TTZA 4XRDA 3DIEA 4BVYB 3BOAA 2VOCA 2M46A 2HRKA 2RUFA 3LQ7A 4NHZA 1ILOA 2H0IA 4N11A 4EDYA 3UOMA 3ISOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H79 A;  1IYI A;  3QAV A;  5IMZ A;  3P7X A;  1F9M A;  2ON7 A;  2YV9 A;  3EU3 A;  1HNA A;  1GSD A;  1GNE A;  2G2Q A;  2V32 A;  3ZTL A;  1GP1 A;  3D0Z A;  2L59 A;  1BYE A;  3R2Q A;  4DVC A;  4Q5R A;  3DVW A;  2QGV A;  2HNL A;  5CNW A;  2EC4 A;  1I5G A;  1O6J A;  3GRX A;  2V41 A;  2VLU A;  2VLV A;  5HFI A;  2MZC A;  3TDG A;  2X8H A;  1QQ2 A;  3M9K A;  2DBC A;  1QUW A;  3G9B A;  5IO0 A;  2RII A;  4IVF A;  3HKR A;  3F8U A;  2LEG A;  1ACV A;  6GSX A;  3CSJ A;  3CSH A;  3HJO A;  4GF0 A;  1SK1 A;  1GTB A;  3KTL A;  5D96 A;  4HU7 A;  5JCU A;  3Q74 A;  2R4V A;  2OAC A;  2C0E A;  3FZ9 A;  2CVD A;  5F06 A;  1O85 A;  5ECI B;  3A3T A;  4KDY A;  1TRV A;  4PNF A;  4IKH A;  3EYT A;  4BWS A;  5DQS A;  3M0F A;  2FA8 A;  4EXJ A;  2A2R A;  5J5N A;  3Q18 A;  4K0G A;  1PL2 A;  5INY A;  2VCQ A;  3G7J A;  5DAK A;  2FY6 A;  2I4A A;  1A0F A;  3CXG A;  1USB A;  3JCM L;  5IOW A;  3RAZ A;  3AY8 A;  1KTE A;  4XCS A;  3TJB A;  3C1R A;  3DWV A;  1EOG A;  5GSS A;  2OA7 A;  1YF1 A;  5ECN B;  4RQX A;  4ACS A;  4EUY A;  3BJ5 A;  4GTU A;  4MPF A;  3DXB A;  3LEF A;  4EVM A;  1XVW A;  2B1L A;  2YJ7 A;  2F51 A;  3MWH A;  1W4V A;  4E8E A;  3IC4 A;  2H73 A;  5CRD A;  2B7J A;  2VL9 A;  3TKP A;  2CX4 A;  1MD3 A;  1A8Y A;  5AIS A;  4EKZ A;  2DJK A;  2WCI A;  3IPZ A;  1M2A A;  3ED3 A;  3APO A;  4G10 A;  2K9F A;  2YV7 A;  4ECI A;  2ALB A;  20GS A;  5ELA A;  5G1L A;  3KIJ A;  2YZH A;  2VM1 A;  1O8X A;  1TRU A;  4O92 A;  2AJQ B;  1QFN A;  3TUE A;  2KP2 A;  3LGC A;  1FOV A;  1OYJ A;  1A2J A;  2MMA A;  3GTU A;  1Z6M A;  1RK4 A;  4RI7 A;  1OC3 A;  4IP1 A;  2HYX A;  1PMT A;  4KSM A;  5J9C A;  2M80 A;  2OKA A;  1OE7 A;  2PVQ A;  2HXK A;  1V57 A;  1BED A;  5C04 A;  3PR8 A;  3KD0 A;  4DSS B;  4FIW A;  1ERW A;  2H1D A;  5B6N A;  9GSS A;  1GSU A;  1ZCP A;  3GX8 A;  1O81 A;  4GCI A;  5EL8 A;  2LNT A;  3IAM 2;  5ELG A;  1AAZ A;  3ERG A;  4PX1 A;  2AB6 A;  4H86 A;  3GA4 A;  1Z5Y E;  1O7U A;  1FO5 A;  2OAD A;  2HI7 A;  1Z6N A;  4F0B A;  2TIR A;  4L5L A;  3IV4 A;  1X9M B;  5D9T A;  5A5K A;  1ZZY A;  1HNB A;  5EVO A;  5E4W A;  1WPI A;  1K3L A;  22GS A;  1GSF A;  3VWW A;  3L0H A;  4BVX A;  2R37 A;  4V1A p;  4CDO A;  3MNG A;  2AHE A;  2GGT A;  1YZX A;  2B5E A;  2JU5 A;  4TXV A;  3QMX A;  1PD2 1;  4JRR A;  1EGR A;  4HDE A;  3P2A A;  5H5Q A;  2HLS A;  3CYN A;  1X5E A;  3ZZX A;  2I81 A;  1EZK A;  1Q4J A;  3GV1 A;  3VWU A;  2H71 A;  1FW1 A;  2JZT A;  4JBB A;  3ZRE A;  2PMT A;  2EIO A;  1AIU A;  2N5F A;  1HD2 A;  1R4W A;  3F4S A;  3UAP A;  2H0G A;  1G7O A;  3D5J A;  2GS3 A;  4GST A;  1V58 A;  4BL7 A;  4PQI A;  1PA3 A;  4OWY A;  2J9H A;  1PX6 A;  4XS1 A;  3KJY A;  4K7O A;  3CSI A;  1AC1 A;  2WB9 A;  2OE1 A;  4TOP A;  2FUG 2;  4D73 B;  5JWR B;  3FRC A;  2FWE A;  3CRT A;  5AIX A;  1A2M A;  1I9D A;  3G7I A;  5H5S A;  1DE2 A;  1LBK A;  1NHY A;  3UEM A;  4F03 A;  1THO A;  1B4P A;  3GUR A;  2C3Q A;  4XIH A;  1VRS D;  2RM6 A;  5HFK A;  1YJ6 A;  1XXU A;  2FLS A;  3TB2 A;  3EMP A;  4HZ2 A;  1BG5 A;  3W8S A;  4KCE A;  3APS A;  5ECQ B;  4ZL8 A;  1XPV A;  3GKN A;  3DGQ A;  3GL5 A;  1BQ7 A;  5JCW A;  1F2E A;  4V2N A;  1MEK A;  2KLX A;  3M8N A;  3H1N A;  4FYB A;  4Q5Q A;  5DQY A;  2CX3 A;  3GST A;  1ZMA A;  1B9Y C;  4G9H A;  3S9F A;  3MSZ A;  3BCI A;  2JSY A;  1NM3 A;  2X99 A;  1GUK A;  1JLW A;  3IBH A;  2H72 A;  4IEL A;  2N5A A;  3CRU A;  3GSS A;  1LU4 A;  2DC5 A;  2H1B A;  2ZNM A;  2VCX A;  3NIV A;  2VUP A;  2LS5 A;  2HE3 A;  1IYH A;  1JZW A;  1M99 A;  5HR0 A;  4RI6 A;  5GZZ B;  3QFB C;  4ISD A;  1JZR A;  2P31 A;  1V9W A;  5ECM B;  3VFI A;  2H19 A;  3ME7 A;  3QOU A;  1XFL A;  3F3Q A;  1GLQ A;  3O76 A;  3LWA A;  2KUC A;  4XHM A;  5D8I A;  5ABR A;  5J9B A;  3V1W A;  2LRT A;  4K8M A;  1ON4 A;  2VD0 A;  5KN2 A;  2C0G A;  2YAN A;  5JWO B;  4ECC A;  2OBI A;  2PWJ A;  4ML1 A;  3GX0 A;  3E3E A;  4IS0 A;  1G7E A;  3I9V 2;  1M9A A;  5IQY A;  1RW1 A;  4LL4 B;  4ILF A;  3F3R A;  1XW9 A;  1OC8 A;  1PGT A;  2E2M A;  4N0Z A;  2X8G A;  4JED A;  2YN1 A;  5CP1 A;  3FZA A;  1PKZ A;  4GQC A;  2O87 A;  4Z7X A;  2H75 A;  3LFL A;  4GSN A;  2LNS A;  1J08 A;  2WDU A;  4LMV A;  4P3Y B;  1GTA A;  2VO4 A;  4GRF A;  1XWB A;  5AGY A;  11GS A;  1R5P A;  1XWG A;  3M1G A;  6GSY A;  4TN8 A;  4HU9 A;  1A8L A;  3C73 A;  5LNK e;  3Q6O A;  3VUR A;  3EIN A;  5B8A A;  4TW5 A;  1H4O A;  3KP8 A;  2V6O A;  1X9S B;  10GS A;  2P5R A;  3BCK A;  5D73 A;  3WGX A;  1SL2 B;  1SYX A;  4V2M A;  4OCE A;  3CBU A;  5ID2 A;  1U3A A;  1UC7 A;  3C7M A;  1YQ1 A;  1UVZ A;  2GT6 A;  3L9V A;  2IFQ A;  2REM A;  4L5O A;  4BVY A;  3G7Y A;  3O3T A;  2HT9 A;  1XCC A;  1PKW A;  2GTU A;  2BTO T;  4HJM A;  4WF5 A;  4PUR A;  5GAP D;  1B9X C;  4YQM A;  2ON5 A;  1U88 A;  2PPT A;  3QR6 A;  4YAP A;  3KH7 A;  1GTI A;  3L9S A;  2VLT A;  3HDC A;  5IOX A;  1TK0 B;  7GSS A;  2GZZ A;  1XWC A;  1S3C A;  2X64 A;  3ZIT A;  1TKD B;  2L4C A;  4KDU A;  2Z9S A;  3M9J A;  1XW5 A;  1EGO A;  4HZ4 A;  3VI5 A;  2VD1 A;  4TR1 A;  3RPP A;  1EWX A;  4AJ6 A;  3C71 A;  4GWR A;  2M72 A;  1DUG A;  5D9X A;  2FNO A;  4ZB9 A;  4XTS A;  3ZVJ A;  2VL3 A;  1SJ6 A;  1NHO A;  2IWT A;  1VF4 A;  4NHW A;  1FG4 A;  13GS A;  4EE0 A;  2N5B A;  1S3D A;  3F6F A;  2B3S A;  3HD5 A;  4IGJ A;  2V2G A;  3A5W A;  1THX A;  4KX4 A;  3RDW A;  1MDI A;  1JLV A;  4PXO A;  5CRE A;  2LKU A;  4NMU A;  5D9V A;  1ZL9 A;  4MK3 A;  1Y25 A;  5DAK B;  4MZW A;  2TRX A;  4EL1 A;  4O5R A;  2D2Z A;  2H6Y A;  3TJF A;  4EO3 A;  3TJK A;  2VCV A;  5F0G A;  4KCA A;  12GS A;  2HSH A;  2JAD A;  2CQ9 A;  4ZB8 A;  4N10 A;  4TVE A;  4PNG A;  2B5Y A;  5IPG A;  3KM6 A;  4FYC A;  2LST A;  3APQ A;  2HRN A;  3C8E A;  5F07 A;  1G6Y A;  2R5G A;  3EE2 A;  2NPB A;  4E8H A;  5G2Z A;  2X8C A;  4POB A;  2C1Y A;  4RQR A;  5IMF A;  2G0F A;  2H6X A;  3SWL A;  3MDK A;  3PH9 A;  2LRN A;  2PBJ A;  4MP4 A;  1M9B A;  2GZP A;  3I69 A;  1GSQ A;  5DDL A;  4K6X A;  1F6M C;  2NVL A;  1YKC A;  4HQZ A;  2C0F A;  2YZU A;  2YP6 A;  3KCM A;  3TKS E;  4EDZ A;  2IMI A;  1AQV A;  1M2D A;  3GTU B;  4HUA A;  4ECJ A;  5JCG A;  3FEU A;  4QL9 A;  18GS A;  3H8Q A;  2C0D A;  2YWM A;  5IO2 A;  3Q19 A;  4FO5 A;  4ZL9 A;  3FY7 A;  5B7C A;  1XOB A;  1Y6E A;  19GS A;  3LXT A;  2V6K A;  4DSS A;  3BD2 A;  2JL4 A;  2AUV A;  5KN3 A;  1B4Q A;  4I2T A;  3HYP A;  4LMW A;  2NBS A;  1BX9 A;  3FKF A;  1FB0 A;  3IE3 A;  3OR5 A;  2YPM A;  1TW9 A;  3UJ1 A;  3KXO A;  2C3N A;  2JZS A;  4IBP A;  1PQN A;  5H5R A;  3GH6 A;  5DAL A;  2L6D A;  3IA1 A;  4MCU A;  2R3X A;  3RHB A;  4HOJ A;  5AIV A;  2MMN A;  2F8F A;  3KH9 A;  1PN9 A;  2IJY A;  2MBS A;  4ECB A;  3UVH A;  3D4T A;  3QFA C;  1ZOF A;  1SD8 A;  1MD4 A;  5CRH A;  4KSO A;  2MBT A;  1K0N A;  1RQM A;  2GSR A;  1OKD A;  1T7P B;  2CV4 A;  5CRG A;  4ML6 A;  2FWG A;  3W6G A;  3LG6 A;  4IHU A;  2AAW A;  1K0M A;  3FK8 A;  1DBY A;  3L78 A;  1SU9 A;  4RUV A;  4WF4 A;  3F4R A;  4MF7 A;  3ZIV A;  4TKY A;  5EPF A;  2L4Q A;  2WS2 A;  4TXO A;  3SBC A;  3TKQ A;  2JZR A;  3HJM A;  4MA9 A;  5ECS A;  2IN3 A;  2FWH A;  2LV3 A;  4HEA 2;  5LD0 A;  3J7Y k;  3W8J A;  4KE3 A;  4JR4 A;  4WBR D;  4POM A;  3ME8 A;  2AYT A;  4IJI A;  1O8W A;  6GSU A;  3HY2 A;  3LXZ A;  1WWJ A;  2I9H A;  1X5C A;  2E0Q A;  3QCP A;  4D73 A;  2DMM A;  2F9S A;  1B48 A;  3WD6 A;  3GYK A;  2OE3 A;  4X1U A;  1UN2 A;  1EP7 A;  2XC2 A;  2PU9 C;  1SEN A;  2LQO A;  1XW6 A;  4XS6 A;  2VCW A;  2YOI A;  1XZO A;  2H1G A;  2HZE A;  4NV2 A;  2PUK C;  3FR6 A;  5HR3 A;  2WZ9 A;  1AQX A;  2H6Z A;  4TR3 A;  4GQF A;  2ES7 A;  1YF0 A;  4NXI A;  1FVK A;  4AJ8 A;  4QL7 A;  3LJR A;  1O73 A;  4O7H A;  1CQH A;  5IMV A;  3GIX A;  3KGK A;  2VAF A;  5HR1 A;  1KBN A;  2E2G A;  1XWK A;  2FGX A;  4ZL7 A;  3HXS A;  3UAR A;  3US3 A;  1HNC A;  1JZD A;  2F8A A;  1T3B A;  3UMA A;  2LJK A;  1PX7 A;  2LUS A;  3GHA A;  2WJU A;  4G19 A;  1ERV A;  4LA1 A;  2EIQ A;  4KND A;  3EC3 A;  2IL3 A;  4LLR A;  5HR2 A;  3UBL A;  4K9Z A;  1SJZ A;  3KTB A;  1R26 A;  4KA0 A;  1OC9 B;  3MAK A;  1XWA A;  3J7Y b;  1U87 A;  2GQL A;  1J0F A;  3QAW A;  3D22 A;  1K0A A;  2EIR A;  2WUL A;  1GL8 A;  4KB3 A;  4OCF A;  1LJR A;  1ZGN A;  3GN3 A;  1SKS B;  1X5D A;  2CZ2 A;  2H66 A;  1YEX A;  2BMX A;  5G1K A;  2YWO A;  2H8L A;  2AV4 A;  2PGT A;  1MDK A;  4TRX A;  2GZY A;  1EV9 A;  5A4V A;  1M2B A;  2H30 A;  3F6D A;  4MDC A;  2XPD A;  1QK8 A;  3C1S A;  2DIZ A;  2OBK A;  4NAX A;  4I2U A;  5G5E A;  1T4Z A;  3LOR A;  4ID0 A;  1YEP A;  1YKA A;  1JHB A;  4DSR A;  1EEJ A;  1YY7 A;  5CAX A;  3TOU A;  2LTK A;  4K1F A;  4HI7 A;  2K8S A;  1TRW A;  5AN1 A;  2FCH A;  3EVI A;  4O32 A;  1K0C A;  3FYG A;  5C00 A;  3GH9 A;  1GUL A;  1WOU A;  2KOK A;  5GAN D;  4POL A;  5G30 A;  5HFG A;  4CW9 A;  5L71 A;  1F37 A;  1U3I A;  3N5O A;  4I5Q A;  4MPG A;  4GSS A;  2LRC A;  1XOA A;  1C72 A;  1Q98 A;  5DJM A;  2CVK A;  2C3T A;  2O7K A;  3TOT A;  2RM5 A;  3TKS C;  4N30 A;  1J9B A;  2WGR A;  5ECP B;  3P8W A;  1GUM A;  1TOF A;  1W89 A;  4MJB A;  4V1A g;  1ERT A;  5COH A;  5CO3 A;  2JSZ A;  5J41 A;  4K2D A;  4OO4 A;  3WYW A;  4XS4 B;  1GSE A;  2H76 A;  2FHE A;  4FYU A;  3U5R E;  1UA5 A;  2OJL A;  3PIN A;  1PL1 A;  2RUE A;  5IMA A;  5ID2 B;  3D21 A;  2O8V B;  1V40 A;  3FR3 A;  3LYP A;  2R6K A;  5B6M A;  3HA9 A;  1HYU A;  2GDR A;  1HQO A;  2CZ3 A;  2GSQ A;  2YNX A;  3TGZ A;  1TP9 A;  5LCZ A;  4ZBA A;  2IFQ B;  3ZVJ D;  4OO5 A;  3VWV A;  1PRX A;  2KP1 A;  3ZFL A;  3TRQ A;  4MJA A;  4YH2 A;  3CMI A;  2VCT A;  3EUR A;  3ZFB A;  1T00 A;  4F2I A;  4OD7 A;  2DJJ A;  4K0N A;  3RBT A;  3O6T A;  1EEM A;  2DML A;  4J56 E;  4MF5 A;  4X43 A;  3UBK A;  2CAQ A;  1SK0 A;  5A4W A;  4OFM A;  3EMX A;  2RLI A;  2I1U A;  5HQP A;  1SD9 A;  2JAC A;  2CVB A;  2PVO C;  4IN0 A;  1URM A;  3EU4 A;  3FW2 A;  3WGD A;  4PUA A;  4L8E A;  4NV5 A;  4TR1 B;  3UVT A;  4AGS A;  1V2A A;  1SYR A;  2DLX A;  1N8J A;  4MH2 A;  3GKK A;  1K0D A;  4AJ7 A;  4WKW A;  4PQH A;  1SKR B;  5B8B A;  3P90 A;  4FH8 A;  3WT1 A;  1TDI A;  3HZ8 A;  4EF0 A;  3ZLP A;  4YQV A;  2VL2 A;  4MJE A;  1R5A A;  2GSS A;  3QAG A;  1EV4 A;  1NSW A;  1M0U A;  1E2Y A;  2C80 A;  1U6T A;  4OFT A;  1WMJ A;  5DCH A;  5GST A;  5IIZ A;  3GUS A;  1JZO A;  3IK9 A;  3TKS A;  3KEB A;  1EP8 A;  2FA4 A;  5KN1 A;  4WR5 A;  1VF2 A;  1ABA A;  2HRF A;  4MJC A;  1TU7 A;  3IOS A;  4ZXG A;  2CAI A;  4F9Z A;  2B1K A;  4MMM A;  3LSZ A;  3EWL A;  2R2J A;  3GKM A;  2H01 A;  2B6M A;  1XIY A;  3DEX A;  2XBQ A;  2L6C A;  2XBI A;  2DJ1 A;  4PGT A;  3IAS 2;  3HVV A;  3VI7 A;  5J3R A;  3RPN A;  4HJ2 A;  4ZBB A;  2B5X A;  3A2W A;  3A2X A;  1WP0 A;  4KUN A;  1X9W B;  3IRA A;  3UL3 A;  4YAV A;  4TR4 A;  1F3B A;  6GSW A;  1GTU A;  1JFU A;  2ZUP A;  2PN8 A;  6GST A;  1KNG A;  4HS1 A;  4JU5 A;  1KEB A;  1ERU A;  5D93 A;  1QGV A;  1XBS A;  2IIY A;  5J4U A;  4DEJ A;  2YJH A;  3NOF A;  4WBJ A;  3DRN A;  2P0G A;  4L0W A;  4KAE A;  5CRW A;  3H93 A;  4ULX A;  3ERW A;  1S3A A;  4X0X A;  3CTF A;  3L9U A;  1QMV A;  2O85 A;  1R7H A;  3HVX A;  5IM9 A;  1PSQ A;  2LQQ A;  1M7T A;  5ECH B;  3KZQ A;  3GMF A;  5DJL A;  2IPA A;  3HVS A;  3BBY A;  3F9U A;  5IPH A;  1K3O A;  1GUH A;  4G2E A;  4POK A;  1Z7R A;  2IME A;  4XRA A;  3K8N A;  1Z7P A;  3VWX A;  2L57 A;  4MF6 A;  3RHC A;  2IMK A;  3FHK A;  3DYR A;  2F3M A;  1TI3 A;  2O89 A;  5EY6 A;  1X0R A;  2ZCT A;  3DKS A;  5FHI A;  5JWQ B;  2VM2 A;  2IMF A;  1BAY A;  4IQ1 A;  5ECK B;  4J57 E;  5DAL B;  4YQU A;  1YDK A;  3E9J B;  4K7I A;  4NPB A;  1GH2 A;  2HSY A;  2XPE A;  1T4Y A;  1Z9H A;  2QC7 A;  5ENU A;  4WXT A;  3HCZ A;  2MMZ A;  3NZN A;  4N0V A;  5DCG A;  4I6X A;  4IJ3 A;  1ML6 A;  1WE0 A;  2LJR A;  1GRX A;  1H75 A;  1AQW A;  3KMO A;  1A23 A;  3ZIJ A;  3D6I A;  1TXX A;  3TJG A;  4WR4 A;  2QKE A;  5ECL B;  1EOH A;  2QSI A;  1SK2 A;  1T8E B;  2NTO A;  4MAB A;  2WRT A;  1A0R P;  3N9J A;  3VLN A;  3ZYW A;  2VCZ A;  4TXO B;  3TRX A;  2GT5 A;  2GVP A;  3I6A A;  5CYY A;  3GFK A;  2TRC P;  2DJ3 A;  4MH3 A;  2H1A A;  4BA7 A;  5IMC A;  4MZB A;  1A24 A;  2BJX A;  14GS A;  5FT3 A;  1V98 A;  5F05 A;  2I3Y A;  1TK8 B;  2K6V A;  4KGI A;  1XVQ A;  1T1V A;  3IXR A;  4IQA A;  2WFC A;  2XHF A;  2NDO A;  3DML A;  3DD3 A;  4CHS A;  1WRY A;  1MTC A;  1VF1 A;  5ECR B;  4IW9 A;  1TJD A;  4ZIJ A;  3DVX A;  16GS A;  2OE0 A;  3LYK A;  2IMD A;  3F4T A;  3VPT A;  4WEY A;  2DSA A;  5KN0 A;  2HZE B;  1AW9 A;  1K0O A;  4OFN A;  3VPQ A;  1ZYE A;  3FZ5 A;  1K0B A;  1OE8 A;  5E59 A;  2YWN A;  1NW2 A;  1WJK A;  1TI1 A;  2KHP A;  4V2L A;  1SJI A;  2LJA A;  3KMN A;  2MYG A;  3E0U A;  1N2A A;  2C8U A;  4IP6 A;  1TK5 B;  3QD9 A;  4J2F A;  3VK9 A;  4I8B A;  3QPM A;  2HZF A;  4I97 A;  1GNW A;  3GL3 A;  1QXH A;  1ZYQ B;  3IDV A;  2A2S A;  3F0I A;  1FHE A;  1F3A A;  8GSS A;  1A2L A;  1GSY A;  2DIY A;  3D4M A;  4WET A;  4LL1 B;  17GS A;  4BPY A;  1DSB A;  6GSS A;  2K8V A;  2L5L A;  3U6V A;  2C4J A;  1AXD A;  4HQS A;  3ZMK A;  2YCD A;  1OAZ A;  4KW6 A;  3WGE A;  2A4V A;  1B8X A;  5A4U A;  1BJX A;  1TRS A;  3UIW A;  1OKT A;  3ERF A;  1WIK A;  3CTG A;  4GLT A;  1OC9 A;  2CT6 A;  4Q5N A;  2L5O A;  3TRP A;  1VGL A;  2DJ0 A;  4MLY A;  1SL1 B;  4QQ7 A;  3M3M A;  4MZC A;  4ZBD A;  2H74 A;  4K7N A;  4DSQ A;  2K18 A;  2GQK A;  2GST A;  1CQG A;  4F0C A;  5KEJ A;  4OMV A;  2CA8 A;  2VIM A;  4BWQ A;  3WT2 A;  2HFD A;  2MMO A;  3HJP A;  3IK7 A;  1OVN A;  4ZB6 A;  3IHQ A;  2V1M A;  2DJ2 A;  1FAA A;  1K3Y A;  3IR4 A;  2H0H A;  4L0U A;  5ECO B;  3FR9 A;  1GLP A;  2E7P A;  1E6B A;  5D9W A;  4Q5F A;  5IMD A;  3HZ4 A;  1MDJ A;  1SKW B;  1Z3E A;  3ZML A;  1DE1 A;  3KP9 A;  6GSV A;  2PER A;  1VF3 A;  3H4K A;  4F82 A;  3PGT A;  3ZL5 A;  4PUF C;  4PQ1 A;  3TCO A;  4GXZ A;  1ST9 A;  1G0T A;  3GKX A;  4JZQ A;  2FWF A;  2VL2 C;  3F63 A;  1AUC A;  5FWG A;  1GWC A;  4EC0 A;  2GLR A;  5F8B A;  4ZIL A;  3A2V A;  3QDN A;  5DBQ A;  1SL0 B;  4NWY A;  4TR0 A;  5G5F A;  1GSS A;  1FB6 A;  2B7K A;  5DVB A;  2YWI A;  3ZRD A;  1FVJ A;  3I43 A;  4JR6 A;  2P5Q A;  1TU8 A;  4JE1 A;  3TJJ A;  4KDX A;  3GNJ A;  2H70 A;  4XS4 A;  3TKR A;  2GQM A;  5G31 A;  3FZ4 A;  2J23 A;  2FD3 A;  3L4N A;  4AF2 A;  3HHV A;  4KH7 A;  1G6W A;  1TTZ A;  4XRD A;  3DIE A;  3BOA A;  2VOC A;  2M46 A;  2RUF A;  3LQ7 A;  4NHZ A;  1ILO A;  2H0I A;  4N11 A;  4EDY A;  3UOM A;  3ISO A; 
#chains in the Genus database with same CATH topology
 3H79 A;  1IYI A;  3QAV A;  5IMZ A;  3P7X A;  2A4H A;  1F9M A;  2ON7 A;  2YV9 A;  3EU3 A;  1HNA A;  1GSD A;  1GNE A;  2G2Q A;  2V32 A;  3ZTL A;  1GP1 A;  3D0Z A;  2L59 A;  1BYE A;  3R2Q A;  4DVC A;  4Q5R A;  3DVW A;  2QGV A;  2HNL A;  5CNW A;  2EC4 A;  1I5G A;  1O6J A;  3GRX A;  2V41 A;  2VLU A;  2VLV A;  5HFI A;  2MZC A;  3TDG A;  2X8H A;  1QQ2 A;  3M9K A;  2DBC A;  1QUW A;  3G9B A;  5IO0 A;  2RII A;  4IVF A;  3HKR A;  3F8U A;  2LEG A;  1ACV A;  6GSX A;  3CSJ A;  3CSH A;  3HJO A;  4GF0 A;  1SK1 A;  1GTB A;  3KTL A;  5D96 A;  4HU7 A;  5JCU A;  3Q74 A;  2R4V A;  2OAC A;  2C0E A;  4K5R A;  3FZ9 A;  5BMU A;  2CVD A;  5F06 A;  1O85 A;  5ECI B;  3A3T A;  4KDY A;  1TRV A;  4PNF A;  4IKH A;  3EYT A;  4BWS A;  5DQS A;  3M0F A;  2FA8 A;  4EXJ A;  2A2R A;  5J5N A;  3Q18 A;  4K0G A;  1PL2 A;  5INY A;  2VCQ A;  3G7J A;  5DAK A;  2FY6 A;  2I4A A;  1A0F A;  3CXG A;  1USB A;  3MIX A;  3JCM L;  5IOW A;  3RAZ A;  3AY8 A;  1KTE A;  4XCS A;  3TJB A;  3C1R A;  3DWV A;  1EOG A;  5GSS A;  2OA7 A;  1YF1 A;  5ECN B;  4RQX A;  4ACS A;  4EUY A;  3BJ5 A;  4GTU A;  4MPF A;  3DXB A;  3LEF A;  4EVM A;  1XVW A;  2B1L A;  2YJ7 A;  2F51 A;  3MWH A;  1W4V A;  4E8E A;  3IC4 A;  2H73 A;  5CRD A;  2B7J A;  4MNN A;  2VL9 A;  3TKP A;  2CX4 A;  1MD3 A;  1A8Y A;  5AIS A;  4EKZ A;  2DJK A;  2WCI A;  3IPZ A;  1M2A A;  3ED3 A;  3APO A;  4G10 A;  2K9F A;  2YV7 A;  4ECI A;  2ALB A;  20GS A;  5ELA A;  5G1L A;  3KIJ A;  2R0G A;  2YZH A;  2VM1 A;  1O8X A;  1TRU A;  4O92 A;  2AJQ B;  1QFN A;  3TUE A;  2KP2 A;  3LGC A;  1FOV A;  1OYJ A;  1A2J A;  2MMA A;  3GTU A;  1Z6M A;  1RK4 A;  4RI7 A;  1OC3 A;  4IP1 A;  2HYX A;  3MYD A;  1PMT A;  4KSM A;  5J9C A;  2M80 A;  2OKA A;  1OE7 A;  2PVQ A;  2HXK A;  1V57 A;  1BED A;  5C04 A;  3PR8 A;  3KD0 A;  4DSS B;  4FIW A;  4G0K A;  1ERW A;  2H1D A;  5B6N A;  9GSS A;  1GSU A;  1ZCP A;  3GX8 A;  1O81 A;  4O5U A;  4GCI A;  5EL8 A;  2LNT A;  3IAM 2;  5ELG A;  1AAZ A;  3ERG A;  4PX1 A;  1ZYN A;  2AB6 A;  3FMW A;  2R0C A;  3GA4 A;  4H86 A;  1Z5Y E;  1O7U A;  1FO5 A;  2OAD A;  2HI7 A;  1Z6N A;  4F0B A;  2TIR A;  4L5L A;  3IV4 A;  1X9M B;  5D9T A;  5A5K A;  1ZZY A;  1HNB A;  5EVO A;  5E4W A;  1WPI A;  1K3L A;  22GS A;  4YKF A;  1GSF A;  3VWW A;  3L0H A;  4BVX A;  4O5Q A;  2R37 A;  4V1A p;  4CDO A;  3MNG A;  2AHE A;  2GGT A;  1YZX A;  2B5E A;  2JU5 A;  4TXV A;  5BRT A;  3QMX A;  1PD2 1;  4JRR A;  1EGR A;  4HDE A;  3P2A A;  5H5Q A;  2HLS A;  3CYN A;  1X5E A;  3ZZX A;  2I81 A;  1EZK A;  5KOW A;  1Q4J A;  3GV1 A;  3VWU A;  2H71 A;  1FW1 A;  2JZT A;  4JBB A;  3ZRE A;  2PMT A;  2EIO A;  1AIU A;  2N5F A;  4K5S A;  1HD2 A;  1R4W A;  3F4S A;  3UAP A;  2H0G A;  1G7O A;  3D5J A;  2GS3 A;  4GST A;  1V58 A;  4BL7 A;  4PQI A;  1PA3 A;  4OWY A;  2J9H A;  1PX6 A;  4XS1 A;  3KJY A;  4K7O A;  3CSI A;  1AC1 A;  2WB9 A;  2OE1 A;  4TOP A;  2FUG 2;  4D73 B;  5JWR B;  3FRC A;  2FWE A;  3CRT A;  5AIX A;  1A2M A;  1I9D A;  3G7I A;  1XG8 A;  5H5S A;  1DE2 A;  1LBK A;  1NHY A;  3UEM A;  4F03 A;  1THO A;  1B4P A;  3GUR A;  2C3Q A;  4XIH A;  1VRS D;  2RM6 A;  5HFK A;  1YJ6 A;  4Z2T A;  1XXU A;  2FLS A;  3TB2 A;  3EMP A;  4HZ2 A;  1BG5 A;  3W8S A;  4KCE A;  3APS A;  5ECQ B;  4ZL8 A;  1XPV A;  3GKN A;  3DGQ A;  3GL5 A;  1BQ7 A;  5JCW A;  1F2E A;  4V2N A;  1MEK A;  2HRA A;  4Z2U A;  2KLX A;  1M3I A;  3M8N A;  3H1N A;  4FYB A;  4Q5Q A;  5DQY A;  2CX3 A;  3GST A;  1ZMA A;  1B9Y C;  4G9H A;  3HVN A;  3S9F A;  3MSZ A;  3BCI A;  2JSY A;  1NM3 A;  2X99 A;  1GUK A;  1JLW A;  3IBH A;  2H72 A;  4IEL A;  2N5A A;  3CRU A;  3GSS A;  1LU4 A;  2DC5 A;  2H1B A;  2ZNM A;  2VCX A;  3NIV A;  2VUP A;  2LS5 A;  2HE3 A;  1IYH A;  1JZW A;  1M99 A;  4KF9 A;  5HR0 A;  4RI6 A;  5GZZ B;  3QFB C;  4ISD A;  1JZR A;  2P31 A;  1V9W A;  5ECM B;  3VFI A;  2H19 A;  3CQF A;  3ME7 A;  3QOU A;  1XFL A;  3F3Q A;  1GLQ A;  3O76 A;  3LWA A;  2KUC A;  4XHM A;  5D8I A;  5ABR A;  5J9B A;  3V1W A;  2LRT A;  4K8M A;  1ON4 A;  2VD0 A;  5KN2 A;  2C0G A;  2YAN A;  5JWO B;  4ECC A;  2OBI A;  2PWJ A;  4ML1 A;  4PTS A;  3GX0 A;  3E3E A;  4IS0 A;  1G7E A;  3I9V 2;  1M9A A;  5IQY A;  1RW1 A;  4LL4 B;  4ILF A;  3F3R A;  1XW9 A;  1OC8 A;  1PGT A;  2E2M A;  5KOX A;  4N0Z A;  2X8G A;  4JED A;  2YN1 A;  5CP1 A;  3FZA A;  1PKZ A;  4GQC A;  2O87 A;  4Z7X A;  2H75 A;  3LFL A;  4GSN A;  2LNS A;  1J08 A;  2WDU A;  4LMV A;  4P3Y B;  1GTA A;  2VO4 A;  4GRF A;  1XWB A;  5AGY A;  11GS A;  1R5P A;  1XWG A;  3M1G A;  6GSY A;  4TN8 A;  4HU9 A;  1A8L A;  3C73 A;  5LNK e;  3Q6O A;  3VUR A;  3EIN A;  5B8A A;  4TW5 A;  1H4O A;  3KP8 A;  2V6O A;  1X9S B;  10GS A;  2P5R A;  3BCK A;  5D73 A;  3WGX A;  1SL2 B;  1SYX A;  4V2M A;  4OCE A;  3CBU A;  5ID2 A;  1U3A A;  1UC7 A;  3C7M A;  1YQ1 A;  1UVZ A;  2GT6 A;  4EIP A;  3L9V A;  2IFQ A;  2REM A;  4L5O A;  4BVY A;  3G7Y A;  3O3T A;  2HT9 A;  1XCC A;  1PKW A;  2GTU A;  2BTO T;  4HJM A;  4WF5 A;  4PUR A;  5GAP D;  1B9X C;  4YQM A;  2ON5 A;  1U88 A;  2PPT A;  4YAP A;  3QR6 A;  3KH7 A;  1GTI A;  3L9S A;  2VLT A;  3HDC A;  5IOX A;  1TK0 B;  7GSS A;  2GZZ A;  1XWC A;  1S3C A;  2X64 A;  3ZIT A;  1TKD B;  2L4C A;  4KDU A;  2Z9S A;  3M9J A;  1XW5 A;  1EGO A;  4HZ4 A;  3VI5 A;  2VD1 A;  4TR1 A;  3RPP A;  1EWX A;  4AJ6 A;  3C71 A;  4GWR A;  2M72 A;  1DUG A;  5D9X A;  2FNO A;  3IC8 A;  4ZB9 A;  4XTS A;  3ZVJ A;  2VL3 A;  1SJ6 A;  1NHO A;  2IWT A;  1VF4 A;  4NHW A;  1FG4 A;  13GS A;  4EE0 A;  2N5B A;  1S3D A;  3F6F A;  2B3S A;  3HD5 A;  4IGJ A;  2V2G A;  3A5W A;  1THX A;  4KX4 A;  3RDW A;  1MDI A;  1JLV A;  4PXO A;  5CRE A;  2LKU A;  4NMU A;  5D9V A;  1ZL9 A;  4MK3 A;  1Y25 A;  5DAK B;  4MZW A;  2TRX A;  4EL1 A;  4O5R A;  2D2Z A;  2H6Y A;  3TJF A;  4EO3 A;  3TJK A;  2VCV A;  5F0G A;  4KCA A;  12GS A;  2HSH A;  2JAD A;  2CQ9 A;  4ZB8 A;  4N10 A;  4TVE A;  4PNG A;  2B5Y A;  5IPG A;  3KM6 A;  4FYC A;  2LST A;  3APQ A;  2HRN A;  3C8E A;  5F07 A;  1G6Y A;  2R5G A;  3EE2 A;  2NPB A;  4E8H A;  5G2Z A;  2X8C A;  4POB A;  2C1Y A;  4RQR A;  5IMF A;  2G0F A;  2H6X A;  3SWL A;  3MDK A;  3PH9 A;  2LRN A;  2PBJ A;  4MP4 A;  1M9B A;  2GZP A;  3I69 A;  1GSQ A;  1ZYP A;  5DDL A;  4K6X A;  1F6M C;  2NVL A;  1YKC A;  4HQZ A;  2C0F A;  2YZU A;  2YP6 A;  3KCM A;  3TKS E;  4EDZ A;  2IMI A;  1AQV A;  1M2D A;  3GTU B;  4HUA A;  4ECJ A;  5JCG A;  3FEU A;  4QL9 A;  18GS A;  3H8Q A;  2C0D A;  2YWM A;  5IO2 A;  3Q19 A;  4FO5 A;  4ZL9 A;  2X4A A;  3FY7 A;  5B7C A;  1XOB A;  1Y6E A;  19GS A;  3LXT A;  2V6K A;  4DSS A;  3BD2 A;  2JL4 A;  2AUV A;  5KN3 A;  1B4Q A;  4I2T A;  3HYP A;  4LMW A;  2NBS A;  1BX9 A;  3FKF A;  1FB0 A;  3IE3 A;  3OR5 A;  2YPM A;  1TW9 A;  3UJ1 A;  3KXO A;  2C3N A;  2JZS A;  4IBP A;  1PQN A;  5H5R A;  3GH6 A;  5DAL A;  2HSM A;  2L6D A;  3IA1 A;  4MCU A;  2R3X A;  3RHB A;  4HOJ A;  5AIV A;  2MMN A;  2F8F A;  3KH9 A;  3PPU A;  1PN9 A;  2IJY A;  2MBS A;  4ECB A;  3UVH A;  3D4T A;  3QFA C;  1ZOF A;  1SD8 A;  1MD4 A;  1FOH A;  5CRH A;  4KSO A;  2MBT A;  1K0N A;  1RQM A;  2GSR A;  1OKD A;  1T7P B;  2CV4 A;  5CRG A;  4ML6 A;  2R0P A;  2FWG A;  3W6G A;  3LG6 A;  4IHU A;  2AAW A;  1K0M A;  3FK8 A;  1DBY A;  3L78 A;  1SU9 A;  4RUV A;  4WF4 A;  3F4R A;  4MF7 A;  1S3R A;  1M3J A;  3ZIV A;  4TKY A;  5EPF A;  2L4Q A;  2WS2 A;  4TXO A;  3SBC A;  3TKQ A;  2JZR A;  3HJM A;  4MA9 A;  5ECS A;  2IN3 A;  2FWH A;  2LV3 A;  4HEA 2;  5LD0 A;  3J7Y k;  3W8J A;  4KE3 A;  4JR4 A;  4WBR D;  4BL7 B;  4POM A;  3ME8 A;  2AYT A;  4IJI A;  4A5P A;  1O8W A;  6GSU A;  3HY2 A;  3LXZ A;  1WWJ A;  2I9H A;  1X5C A;  2E0Q A;  3QCP A;  4D73 A;  2DMM A;  2F9S A;  1B48 A;  3WD6 A;  3GYK A;  2OE3 A;  4X1U A;  1UN2 A;  1EP7 A;  2XC2 A;  2PU9 C;  1SEN A;  2LQO A;  1XW6 A;  4XS6 A;  2VCW A;  2YOI A;  1XZO A;  2H1G A;  2HZE A;  4NV2 A;  2PUK C;  3FR6 A;  5HR3 A;  2WZ9 A;  1AQX A;  2H6Z A;  4TR3 A;  4GQF A;  2ES7 A;  1YF0 A;  4NXI A;  1FVK A;  4AJ8 A;  4QL7 A;  3LJR A;  1O73 A;  4O7H A;  1CQH A;  5IMV A;  3GIX A;  2QA1 A;  3KGK A;  2VAF A;  5HR1 A;  1KBN A;  2E2G A;  1XWK A;  2FGX A;  4ZL7 A;  3HXS A;  3UAR A;  3US3 A;  1HNC A;  1JZD A;  2F8A A;  1T3B A;  3UMA A;  2LJK A;  1PX7 A;  2LUS A;  3GHA A;  2WJU A;  4G19 A;  1ERV A;  4LA1 A;  2EIQ A;  4KND A;  3EC3 A;  2IL3 A;  4LLR A;  5HR2 A;  3UBL A;  4K9Z A;  1SJZ A;  3KTB A;  1R26 A;  4KA0 A;  1OC9 B;  3MAK A;  1XWA A;  3J7Y b;  1U87 A;  2GQL A;  1J0F A;  3QAW A;  3D22 A;  1K0A A;  2EIR A;  2WUL A;  1GL8 A;  4KB3 A;  4OCF A;  1LJR A;  1ZGN A;  3GN3 A;  1SKS B;  1X5D A;  2CZ2 A;  2H66 A;  1YEX A;  2BMX A;  5G1K A;  2YWO A;  2H8L A;  2AV4 A;  2PGT A;  1MDK A;  4TRX A;  2GZY A;  1EV9 A;  5A4V A;  1M2B A;  2H30 A;  3F6D A;  4MDC A;  2XPD A;  3LW9 A;  1QK8 A;  3C1S A;  2DIZ A;  2OBK A;  4NAX A;  4I2U A;  5G5E A;  1T4Z A;  3LOR A;  4ID0 A;  1YEP A;  1YKA A;  1JHB A;  4DSR A;  1EEJ A;  1YY7 A;  5CAX A;  3TOU A;  2LTK A;  4K1F A;  4HI7 A;  2K8S A;  1TRW A;  5AN1 A;  2FCH A;  3EVI A;  4O32 A;  1K0C A;  3FYG A;  5C00 A;  2DKH A;  3GH9 A;  1GUL A;  1WOU A;  2KOK A;  5GAN D;  4POL A;  5G30 A;  5HFG A;  4CW9 A;  5L71 A;  1F37 A;  1U3I A;  3N5O A;  4I5Q A;  4MPG A;  4GSS A;  2LRC A;  1XOA A;  1C72 A;  1Q98 A;  5DJM A;  2CVK A;  2C3T A;  2O7K A;  3TOT A;  2RM5 A;  3TKS C;  4N30 A;  1J9B A;  2WGR A;  5ECP B;  3P8W A;  1GUM A;  4ICY A;  1TOF A;  1W89 A;  4MJB A;  4V1A g;  1ERT A;  5COH A;  5CO3 A;  2JSZ A;  5J41 A;  4K2D A;  4OO4 A;  3WYW A;  4XS4 B;  1GSE A;  2H76 A;  2FHE A;  4FYU A;  3U5R E;  1UA5 A;  2OJL A;  3PIN A;  1PL1 A;  2RUE A;  5IMA A;  5ID2 B;  3D21 A;  2O8V B;  1V40 A;  3FR3 A;  3LYP A;  2R6K A;  5B6M A;  3HA9 A;  1HYU A;  2GDR A;  2UZ8 A;  1HQO A;  2CZ3 A;  2GSQ A;  2YNX A;  3TGZ A;  1TP9 A;  3A5I A;  5LCZ A;  4ZBA A;  2IFQ B;  3ZVJ D;  4OO5 A;  3VWV A;  1PRX A;  2KP1 A;  3ZFL A;  3TRQ A;  4MJA A;  4YH2 A;  3CMI A;  2VCT A;  3EUR A;  3ZFB A;  1T00 A;  4F2I A;  4OD7 A;  2DJJ A;  4K0N A;  3RBT A;  3O6T A;  1EEM A;  2DML A;  4J56 E;  4MF5 A;  4X43 A;  3UBK A;  2CAQ A;  1SK0 A;  5A4W A;  4OFM A;  3EMX A;  2RLI A;  2I1U A;  5HQP A;  1SD9 A;  2JAC A;  4HSC X;  2CVB A;  2PVO C;  4IN0 A;  1URM A;  3EU4 A;  3FW2 A;  3WGD A;  4PUA A;  4L8E A;  4NV5 A;  4TR1 B;  3UVT A;  4AGS A;  1V2A A;  3EPT A;  1SYR A;  2DLX A;  1N8J A;  4MH2 A;  3GKK A;  1K0D A;  4AJ7 A;  4WKW A;  4PQH A;  1SKR B;  5B8B A;  3P90 A;  4FH8 A;  3WT1 A;  1TDI A;  3HZ8 A;  4EF0 A;  3ZLP A;  4YQV A;  2VL2 A;  4MJE A;  1R5A A;  2GSS A;  3QAG A;  1EV4 A;  1NSW A;  1M0U A;  1E2Y A;  2C80 A;  1U6T A;  4OFT A;  1WMJ A;  5DCH A;  5GST A;  5IIZ A;  3GUS A;  1JZO A;  3IK9 A;  3TKS A;  3KEB A;  1EP8 A;  2FA4 A;  5KN1 A;  4WR5 A;  1VF2 A;  1ABA A;  2HRF A;  4MJC A;  1TU7 A;  3IOS A;  4ZXG A;  2CAI A;  4F9Z A;  4CY6 A;  2B1K A;  4MMM A;  3LSZ A;  3EWL A;  2R2J A;  3GKM A;  2H01 A;  2B6M A;  1XIY A;  3DEX A;  2XBQ A;  2L6C A;  2XBI A;  2DJ1 A;  4PGT A;  3IAS 2;  3HVV A;  3VI7 A;  5J3R A;  3RPN A;  4HJ2 A;  4ZBB A;  2B5X A;  3A2W A;  3A2X A;  1WP0 A;  4KUN A;  1X9W B;  3IRA A;  3UL3 A;  4YAV A;  4TR4 A;  1F3B A;  6GSW A;  1PFO A;  1GTU A;  4YKG A;  1JFU A;  2ZUP A;  2PN8 A;  6GST A;  1KNG A;  4HS1 A;  4JU5 A;  1KEB A;  1ERU A;  5D93 A;  1QGV A;  1XBS A;  2IIY A;  5J4U A;  4DEJ A;  2YJH A;  3NOF A;  4WBJ A;  3DRN A;  2P0G A;  4L0W A;  4KAE A;  5CRW A;  3H93 A;  4ULX A;  3ERW A;  1S3A A;  1PN0 A;  4X0X A;  3CTF A;  3L9U A;  1QMV A;  2O85 A;  1R7H A;  3HVX A;  5IM9 A;  1PSQ A;  2LQQ A;  1M7T A;  5ECH B;  3KZQ A;  3GMF A;  5DJL A;  2IPA A;  3HVS A;  4EIQ A;  3BBY A;  3F9U A;  5IPH A;  3R3E A;  1K3O A;  1GUH A;  4G2E A;  4POK A;  1Z7R A;  2IME A;  4XRA A;  3K8N A;  1Z7P A;  3VWX A;  2A2P A;  4CY8 A;  2L57 A;  4MF6 A;  3RHC A;  2IMK A;  3FHK A;  3DYR A;  2F3M A;  1TI3 A;  2O89 A;  5EY6 A;  1X0R A;  2ZCT A;  3DKS A;  5FHI A;  5JWQ B;  2VM2 A;  2IMF A;  1BAY A;  4IQ1 A;  5ECK B;  4J57 E;  5DAL B;  4YQU A;  1YDK A;  3E9J B;  4K7I A;  4BVX B;  4NPB A;  1GH2 A;  2HSY A;  2XPE A;  1T4Y A;  1Z9H A;  2QC7 A;  5ENU A;  4WXT A;  3HCZ A;  2MMZ A;  3NZN A;  4N0V A;  5DCG A;  4I6X A;  4IJ3 A;  1ML6 A;  1WE0 A;  2LJR A;  1GRX A;  1H75 A;  4Z2R A;  1AQW A;  3KMO A;  1A23 A;  3ZIJ A;  3D6I A;  3IHG A;  1TXX A;  3TJG A;  4WR4 A;  2QKE A;  5ECL B;  1EOH A;  2QSI A;  1SK2 A;  1T8E B;  2NTO A;  4MAB A;  2WRT A;  1A0R P;  3N9J A;  3VLN A;  3ZYW A;  2VCZ A;  4TXO B;  3TRX A;  2GT5 A;  2GVP A;  3I6A A;  5CYY A;  2DKI A;  3GFK A;  2TRC P;  2DJ3 A;  4MH3 A;  2H1A A;  4BA7 A;  5IMC A;  4MZB A;  1A24 A;  2BJX A;  14GS A;  5FT3 A;  4G0L A;  1V98 A;  5F05 A;  2I3Y A;  1TK8 B;  2K6V A;  4KGI A;  1XVQ A;  1T1V A;  3IXR A;  4IQA A;  2WFC A;  2XHF A;  2NDO A;  3DML A;  3DD3 A;  4CHS A;  4X4J A;  1WRY A;  1MTC A;  2X49 A;  1VF1 A;  5ECR B;  4IW9 A;  1TJD A;  4ZIJ A;  3DVX A;  16GS A;  2OE0 A;  3LYK A;  2IMD A;  3F4T A;  3VPT A;  4WEY A;  2DSA A;  4K2X A;  5KN0 A;  2HZE B;  1AW9 A;  4G0I A;  1K0O A;  4OFN A;  3VPQ A;  1ZYE A;  3FZ5 A;  1K0B A;  4FQU A;  1OE8 A;  5E59 A;  2YWN A;  1NW2 A;  1WJK A;  1TI1 A;  2KHP A;  4V2L A;  1SJI A;  2LJA A;  3KMN A;  2MYG A;  3E0U A;  1N2A A;  2C8U A;  4IP6 A;  1TK5 B;  3QD9 A;  4J2F A;  3VK9 A;  4I8B A;  3QPM A;  2HZF A;  4I97 A;  1GNW A;  3GL3 A;  1QXH A;  1ZYQ B;  3IDV A;  2A2S A;  3F0I A;  1FHE A;  1F3A A;  8GSS A;  1A2L A;  1GSY A;  2DIY A;  3D4M A;  4WET A;  4LL1 B;  17GS A;  4BPY A;  1DSB A;  6GSS A;  2K8V A;  2L5L A;  3U6V A;  2C4J A;  1AXD A;  4HQS A;  3ZMK A;  2YCD A;  1OAZ A;  4KW6 A;  3WGE A;  2A4V A;  1B8X A;  5A4U A;  1BJX A;  1TRS A;  3UIW A;  1OKT A;  3ERF A;  1WIK A;  3CTG A;  4GLT A;  1OC9 A;  2CT6 A;  4Q5N A;  2L5O A;  3TRP A;  1VGL A;  4BIK A;  2DJ0 A;  4MLY A;  1SL1 B;  4QQ7 A;  3M3M A;  4MZC A;  4ZBD A;  2H74 A;  4K7N A;  4DSQ A;  2K18 A;  2GQK A;  2GST A;  1CQG A;  4F0C A;  5KEJ A;  4OMV A;  2CA8 A;  2VIM A;  4BWQ A;  3WT2 A;  2HFD A;  2MMO A;  3HJP A;  3IK7 A;  1OVN A;  4ZB6 A;  3IHQ A;  2V1M A;  2DJ2 A;  1FAA A;  1K3Y A;  3IR4 A;  2H0H A;  4L0U A;  5ECO B;  3FR9 A;  1GLP A;  2E7P A;  1E6B A;  5D9W A;  4Q5F A;  5IMD A;  3HZ4 A;  1MDJ A;  1SKW B;  1Z3E A;  3ZML A;  1DE1 A;  3KP9 A;  6GSV A;  2PER A;  1VF3 A;  2QA2 A;  3H4K A;  4F82 A;  3PGT A;  3ZL5 A;  4PUF C;  4PQ1 A;  3TCO A;  4GXZ A;  1ST9 A;  1G0T A;  3GKX A;  4JZQ A;  2FWF A;  2VL2 C;  3F63 A;  1AUC A;  5FWG A;  1GWC A;  4EC0 A;  2GLR A;  5F8B A;  4ZIL A;  3A2V A;  3QDN A;  5DBQ A;  1SL0 B;  4NWY A;  4TR0 A;  5G5F A;  4USS A;  1GSS A;  1FB6 A;  2B7K A;  5DVB A;  2YWI A;  3ZRD A;  1FVJ A;  3I43 A;  4JR6 A;  2P5Q A;  1TU8 A;  4JE1 A;  3TJJ A;  4KDX A;  3GNJ A;  2H70 A;  4XS4 A;  3TKR A;  2GQM A;  5G31 A;  3FZ4 A;  2J23 A;  2FD3 A;  3L4N A;  4AF2 A;  3HHV A;  4KH7 A;  1G6W A;  1TTZ A;  4XRD A;  3DIE A;  4BVY B;  3BOA A;  2VOC A;  2M46 A;  2HRK A;  2RUF A;  3LQ7 A;  4NHZ A;  1ILO A;  2H0I A;  4N11 A;  4EDY A;  3UOM A;  3ISO A; 
#chains in the Genus database with same CATH homology
 3H79 A;  1IYI A;  3QAV A;  5IMZ A;  3P7X A;  2A4H A;  1F9M A;  2ON7 A;  2YV9 A;  3EU3 A;  1HNA A;  1GSD A;  1GNE A;  2G2Q A;  2V32 A;  3ZTL A;  1GP1 A;  3D0Z A;  2L59 A;  1BYE A;  3R2Q A;  4DVC A;  4Q5R A;  3DVW A;  2QGV A;  2HNL A;  5CNW A;  2EC4 A;  1I5G A;  1O6J A;  3GRX A;  2V41 A;  2VLU A;  2VLV A;  5HFI A;  2MZC A;  3TDG A;  2X8H A;  1QQ2 A;  3M9K A;  2DBC A;  1QUW A;  3G9B A;  5IO0 A;  2RII A;  4IVF A;  3HKR A;  3F8U A;  2LEG A;  1ACV A;  6GSX A;  3CSJ A;  3CSH A;  3HJO A;  4GF0 A;  1SK1 A;  1GTB A;  3KTL A;  5D96 A;  4HU7 A;  5JCU A;  3Q74 A;  2R4V A;  2OAC A;  2C0E A;  4K5R A;  3FZ9 A;  5BMU A;  2CVD A;  5F06 A;  1O85 A;  5ECI B;  3A3T A;  4KDY A;  1TRV A;  4PNF A;  4IKH A;  3EYT A;  4BWS A;  5DQS A;  3M0F A;  2FA8 A;  4EXJ A;  2A2R A;  5J5N A;  3Q18 A;  4K0G A;  1PL2 A;  5INY A;  2VCQ A;  3G7J A;  5DAK A;  2FY6 A;  2I4A A;  1A0F A;  3CXG A;  1USB A;  3MIX A;  3JCM L;  5IOW A;  3RAZ A;  3AY8 A;  1KTE A;  4XCS A;  3TJB A;  3C1R A;  3DWV A;  1EOG A;  5GSS A;  2OA7 A;  1YF1 A;  5ECN B;  4RQX A;  4ACS A;  4EUY A;  3BJ5 A;  4GTU A;  4MPF A;  3DXB A;  3LEF A;  4EVM A;  1XVW A;  2B1L A;  2YJ7 A;  2F51 A;  3MWH A;  1W4V A;  4E8E A;  3IC4 A;  2H73 A;  5CRD A;  2B7J A;  4MNN A;  2VL9 A;  3TKP A;  2CX4 A;  1MD3 A;  1A8Y A;  5AIS A;  4EKZ A;  2DJK A;  2WCI A;  3IPZ A;  1M2A A;  3ED3 A;  3APO A;  4G10 A;  2K9F A;  2YV7 A;  4ECI A;  2ALB A;  20GS A;  5ELA A;  5G1L A;  3KIJ A;  2R0G A;  2YZH A;  2VM1 A;  1O8X A;  1TRU A;  4O92 A;  2AJQ B;  1QFN A;  3TUE A;  2KP2 A;  3LGC A;  1FOV A;  1OYJ A;  1A2J A;  2MMA A;  3GTU A;  1Z6M A;  1RK4 A;  4RI7 A;  1OC3 A;  4IP1 A;  2HYX A;  3MYD A;  1PMT A;  4KSM A;  5J9C A;  2M80 A;  2OKA A;  1OE7 A;  2PVQ A;  2HXK A;  1V57 A;  1BED A;  5C04 A;  3PR8 A;  3KD0 A;  4DSS B;  4FIW A;  4G0K A;  1ERW A;  2H1D A;  5B6N A;  9GSS A;  1GSU A;  1ZCP A;  3GX8 A;  1O81 A;  4O5U A;  4GCI A;  5EL8 A;  2LNT A;  3IAM 2;  5ELG A;  1AAZ A;  3ERG A;  4PX1 A;  1ZYN A;  2AB6 A;  3FMW A;  2R0C A;  3GA4 A;  4H86 A;  1Z5Y E;  1O7U A;  1FO5 A;  2OAD A;  2HI7 A;  1Z6N A;  4F0B A;  2TIR A;  4L5L A;  3IV4 A;  1X9M B;  5D9T A;  5A5K A;  1ZZY A;  1HNB A;  5EVO A;  5E4W A;  1WPI A;  1K3L A;  22GS A;  4YKF A;  1GSF A;  3VWW A;  3L0H A;  4BVX A;  4O5Q A;  2R37 A;  4V1A p;  4CDO A;  3MNG A;  2AHE A;  2GGT A;  1YZX A;  2B5E A;  2JU5 A;  4TXV A;  5BRT A;  3QMX A;  1PD2 1;  4JRR A;  1EGR A;  4HDE A;  3P2A A;  5H5Q A;  2HLS A;  3CYN A;  1X5E A;  3ZZX A;  2I81 A;  1EZK A;  5KOW A;  1Q4J A;  3GV1 A;  3VWU A;  2H71 A;  1FW1 A;  2JZT A;  4JBB A;  3ZRE A;  2PMT A;  2EIO A;  1AIU A;  2N5F A;  4K5S A;  1HD2 A;  1R4W A;  3F4S A;  3UAP A;  2H0G A;  1G7O A;  3D5J A;  2GS3 A;  4GST A;  1V58 A;  4BL7 A;  4PQI A;  1PA3 A;  4OWY A;  2J9H A;  1PX6 A;  4XS1 A;  3KJY A;  4K7O A;  3CSI A;  1AC1 A;  2WB9 A;  2OE1 A;  4TOP A;  2FUG 2;  4D73 B;  5JWR B;  3FRC A;  2FWE A;  3CRT A;  5AIX A;  1A2M A;  1I9D A;  3G7I A;  5H5S A;  1DE2 A;  1LBK A;  1NHY A;  3UEM A;  4F03 A;  1THO A;  1B4P A;  3GUR A;  2C3Q A;  4XIH A;  1VRS D;  2RM6 A;  5HFK A;  1YJ6 A;  4Z2T A;  1XXU A;  2FLS A;  3TB2 A;  3EMP A;  4HZ2 A;  1BG5 A;  3W8S A;  4KCE A;  3APS A;  5ECQ B;  4ZL8 A;  1XPV A;  3GKN A;  3DGQ A;  3GL5 A;  1BQ7 A;  5JCW A;  1F2E A;  4V2N A;  1MEK A;  2HRA A;  4Z2U A;  2KLX A;  3M8N A;  3H1N A;  4FYB A;  4Q5Q A;  5DQY A;  2CX3 A;  3GST A;  1ZMA A;  1B9Y C;  4G9H A;  3S9F A;  3MSZ A;  3BCI A;  2JSY A;  1NM3 A;  2X99 A;  1GUK A;  1JLW A;  3IBH A;  2H72 A;  4IEL A;  2N5A A;  3CRU A;  3GSS A;  1LU4 A;  2DC5 A;  2H1B A;  2ZNM A;  2VCX A;  3NIV A;  2VUP A;  2LS5 A;  2HE3 A;  1IYH A;  1JZW A;  1M99 A;  4KF9 A;  5HR0 A;  4RI6 A;  5GZZ B;  3QFB C;  4ISD A;  1JZR A;  2P31 A;  1V9W A;  5ECM B;  3VFI A;  2H19 A;  3ME7 A;  3QOU A;  1XFL A;  3F3Q A;  1GLQ A;  3O76 A;  3LWA A;  2KUC A;  4XHM A;  5D8I A;  5ABR A;  5J9B A;  3V1W A;  2LRT A;  4K8M A;  1ON4 A;  2VD0 A;  5KN2 A;  2C0G A;  2YAN A;  5JWO B;  4ECC A;  2OBI A;  2PWJ A;  4ML1 A;  4PTS A;  3GX0 A;  3E3E A;  4IS0 A;  1G7E A;  3I9V 2;  1M9A A;  5IQY A;  1RW1 A;  4LL4 B;  4ILF A;  3F3R A;  1XW9 A;  1OC8 A;  1PGT A;  2E2M A;  5KOX A;  4N0Z A;  2X8G A;  4JED A;  2YN1 A;  5CP1 A;  3FZA A;  1PKZ A;  4GQC A;  2O87 A;  4Z7X A;  2H75 A;  3LFL A;  4GSN A;  2LNS A;  1J08 A;  2WDU A;  4LMV A;  4P3Y B;  1GTA A;  2VO4 A;  4GRF A;  1XWB A;  5AGY A;  11GS A;  1R5P A;  1XWG A;  3M1G A;  6GSY A;  4TN8 A;  4HU9 A;  1A8L A;  3C73 A;  5LNK e;  3Q6O A;  3VUR A;  3EIN A;  5B8A A;  4TW5 A;  1H4O A;  3KP8 A;  2V6O A;  1X9S B;  10GS A;  2P5R A;  3BCK A;  5D73 A;  3WGX A;  1SL2 B;  1SYX A;  4V2M A;  4OCE A;  3CBU A;  5ID2 A;  1U3A A;  1UC7 A;  3C7M A;  1YQ1 A;  1UVZ A;  2GT6 A;  4EIP A;  3L9V A;  2IFQ A;  2REM A;  4L5O A;  4BVY A;  3G7Y A;  3O3T A;  2HT9 A;  1XCC A;  1PKW A;  2GTU A;  2BTO T;  4HJM A;  4WF5 A;  4PUR A;  5GAP D;  1B9X C;  4YQM A;  2ON5 A;  1U88 A;  2PPT A;  4YAP A;  3QR6 A;  3KH7 A;  1GTI A;  3L9S A;  2VLT A;  3HDC A;  5IOX A;  1TK0 B;  7GSS A;  2GZZ A;  1XWC A;  1S3C A;  2X64 A;  3ZIT A;  1TKD B;  2L4C A;  4KDU A;  2Z9S A;  3M9J A;  1XW5 A;  1EGO A;  4HZ4 A;  3VI5 A;  2VD1 A;  4TR1 A;  3RPP A;  1EWX A;  4AJ6 A;  3C71 A;  4GWR A;  2M72 A;  1DUG A;  5D9X A;  2FNO A;  3IC8 A;  4ZB9 A;  4XTS A;  3ZVJ A;  2VL3 A;  1SJ6 A;  1NHO A;  2IWT A;  1VF4 A;  4NHW A;  1FG4 A;  13GS A;  4EE0 A;  2N5B A;  1S3D A;  3F6F A;  2B3S A;  3HD5 A;  4IGJ A;  2V2G A;  3A5W A;  1THX A;  4KX4 A;  3RDW A;  1MDI A;  1JLV A;  4PXO A;  5CRE A;  2LKU A;  4NMU A;  5D9V A;  1ZL9 A;  4MK3 A;  1Y25 A;  5DAK B;  4MZW A;  2TRX A;  4EL1 A;  4O5R A;  2D2Z A;  2H6Y A;  3TJF A;  4EO3 A;  3TJK A;  2VCV A;  5F0G A;  4KCA A;  12GS A;  2HSH A;  2JAD A;  2CQ9 A;  4ZB8 A;  4N10 A;  4TVE A;  4PNG A;  2B5Y A;  5IPG A;  3KM6 A;  4FYC A;  2LST A;  3APQ A;  2HRN A;  3C8E A;  5F07 A;  1G6Y A;  2R5G A;  3EE2 A;  2NPB A;  4E8H A;  5G2Z A;  2X8C A;  4POB A;  2C1Y A;  4RQR A;  5IMF A;  2G0F A;  2H6X A;  3SWL A;  3MDK A;  3PH9 A;  2LRN A;  2PBJ A;  4MP4 A;  1M9B A;  2GZP A;  3I69 A;  1GSQ A;  1ZYP A;  5DDL A;  4K6X A;  1F6M C;  2NVL A;  1YKC A;  4HQZ A;  2C0F A;  2YZU A;  2YP6 A;  3KCM A;  3TKS E;  4EDZ A;  2IMI A;  1AQV A;  1M2D A;  3GTU B;  4HUA A;  4ECJ A;  5JCG A;  3FEU A;  4QL9 A;  18GS A;  3H8Q A;  2C0D A;  2YWM A;  5IO2 A;  3Q19 A;  4FO5 A;  4ZL9 A;  2X4A A;  3FY7 A;  5B7C A;  1XOB A;  1Y6E A;  19GS A;  3LXT A;  2V6K A;  4DSS A;  3BD2 A;  2JL4 A;  2AUV A;  5KN3 A;  1B4Q A;  4I2T A;  3HYP A;  4LMW A;  2NBS A;  1BX9 A;  3FKF A;  1FB0 A;  3IE3 A;  3OR5 A;  2YPM A;  1TW9 A;  3UJ1 A;  3KXO A;  2C3N A;  2JZS A;  4IBP A;  1PQN A;  5H5R A;  3GH6 A;  5DAL A;  2HSM A;  2L6D A;  3IA1 A;  4MCU A;  2R3X A;  3RHB A;  4HOJ A;  5AIV A;  2MMN A;  2F8F A;  3KH9 A;  3PPU A;  1PN9 A;  2IJY A;  2MBS A;  4ECB A;  3UVH A;  3D4T A;  3QFA C;  1ZOF A;  1SD8 A;  1MD4 A;  1FOH A;  5CRH A;  4KSO A;  2MBT A;  1K0N A;  1RQM A;  2GSR A;  1OKD A;  1T7P B;  2CV4 A;  5CRG A;  4ML6 A;  2R0P A;  2FWG A;  3W6G A;  3LG6 A;  4IHU A;  2AAW A;  1K0M A;  3FK8 A;  1DBY A;  3L78 A;  1SU9 A;  4RUV A;  4WF4 A;  3F4R A;  4MF7 A;  3ZIV A;  4TKY A;  5EPF A;  2L4Q A;  2WS2 A;  4TXO A;  3SBC A;  3TKQ A;  2JZR A;  3HJM A;  4MA9 A;  5ECS A;  2IN3 A;  2FWH A;  2LV3 A;  4HEA 2;  5LD0 A;  3J7Y k;  3W8J A;  4KE3 A;  4JR4 A;  4WBR D;  4BL7 B;  4POM A;  3ME8 A;  2AYT A;  4IJI A;  4A5P A;  1O8W A;  6GSU A;  3HY2 A;  3LXZ A;  1WWJ A;  2I9H A;  1X5C A;  2E0Q A;  3QCP A;  4D73 A;  2DMM A;  2F9S A;  1B48 A;  3WD6 A;  3GYK A;  2OE3 A;  4X1U A;  1UN2 A;  1EP7 A;  2XC2 A;  2PU9 C;  1SEN A;  2LQO A;  1XW6 A;  4XS6 A;  2VCW A;  2YOI A;  1XZO A;  2H1G A;  2HZE A;  4NV2 A;  2PUK C;  3FR6 A;  5HR3 A;  2WZ9 A;  1AQX A;  2H6Z A;  4TR3 A;  4GQF A;  2ES7 A;  1YF0 A;  4NXI A;  1FVK A;  4AJ8 A;  4QL7 A;  3LJR A;  1O73 A;  4O7H A;  1CQH A;  5IMV A;  3GIX A;  2QA1 A;  3KGK A;  2VAF A;  5HR1 A;  1KBN A;  2E2G A;  1XWK A;  2FGX A;  4ZL7 A;  3HXS A;  3UAR A;  3US3 A;  1HNC A;  1JZD A;  2F8A A;  1T3B A;  3UMA A;  2LJK A;  1PX7 A;  2LUS A;  3GHA A;  2WJU A;  4G19 A;  1ERV A;  4LA1 A;  2EIQ A;  4KND A;  3EC3 A;  2IL3 A;  4LLR A;  5HR2 A;  3UBL A;  4K9Z A;  1SJZ A;  3KTB A;  1R26 A;  4KA0 A;  1OC9 B;  3MAK A;  1XWA A;  3J7Y b;  1U87 A;  2GQL A;  1J0F A;  3QAW A;  3D22 A;  1K0A A;  2EIR A;  2WUL A;  1GL8 A;  4KB3 A;  4OCF A;  1LJR A;  1ZGN A;  3GN3 A;  1SKS B;  1X5D A;  2CZ2 A;  2H66 A;  1YEX A;  2BMX A;  5G1K A;  2YWO A;  2H8L A;  2AV4 A;  2PGT A;  1MDK A;  4TRX A;  2GZY A;  1EV9 A;  5A4V A;  1M2B A;  2H30 A;  3F6D A;  4MDC A;  2XPD A;  3LW9 A;  1QK8 A;  3C1S A;  2DIZ A;  2OBK A;  4NAX A;  4I2U A;  5G5E A;  1T4Z A;  3LOR A;  4ID0 A;  1YEP A;  1YKA A;  1JHB A;  4DSR A;  1EEJ A;  1YY7 A;  5CAX A;  3TOU A;  2LTK A;  4K1F A;  4HI7 A;  2K8S A;  1TRW A;  5AN1 A;  2FCH A;  3EVI A;  4O32 A;  1K0C A;  3FYG A;  5C00 A;  2DKH A;  3GH9 A;  1GUL A;  1WOU A;  2KOK A;  5GAN D;  4POL A;  5G30 A;  5HFG A;  4CW9 A;  5L71 A;  1F37 A;  1U3I A;  3N5O A;  4I5Q A;  4MPG A;  4GSS A;  2LRC A;  1XOA A;  1C72 A;  1Q98 A;  5DJM A;  2CVK A;  2C3T A;  2O7K A;  3TOT A;  2RM5 A;  3TKS C;  4N30 A;  1J9B A;  2WGR A;  5ECP B;  3P8W A;  1GUM A;  4ICY A;  1TOF A;  1W89 A;  4MJB A;  4V1A g;  1ERT A;  5COH A;  5CO3 A;  2JSZ A;  5J41 A;  4K2D A;  4OO4 A;  3WYW A;  4XS4 B;  1GSE A;  2H76 A;  2FHE A;  4FYU A;  3U5R E;  1UA5 A;  2OJL A;  3PIN A;  1PL1 A;  2RUE A;  5IMA A;  5ID2 B;  3D21 A;  2O8V B;  1V40 A;  3FR3 A;  3LYP A;  2R6K A;  5B6M A;  3HA9 A;  1HYU A;  2GDR A;  2UZ8 A;  1HQO A;  2CZ3 A;  2GSQ A;  2YNX A;  3TGZ A;  1TP9 A;  3A5I A;  5LCZ A;  4ZBA A;  2IFQ B;  3ZVJ D;  4OO5 A;  3VWV A;  1PRX A;  2KP1 A;  3ZFL A;  3TRQ A;  4MJA A;  4YH2 A;  3CMI A;  2VCT A;  3EUR A;  3ZFB A;  1T00 A;  4F2I A;  4OD7 A;  2DJJ A;  4K0N A;  3RBT A;  3O6T A;  1EEM A;  2DML A;  4J56 E;  4MF5 A;  4X43 A;  3UBK A;  2CAQ A;  1SK0 A;  5A4W A;  4OFM A;  3EMX A;  2RLI A;  2I1U A;  5HQP A;  1SD9 A;  2JAC A;  2CVB A;  2PVO C;  4IN0 A;  1URM A;  3EU4 A;  3FW2 A;  3WGD A;  4PUA A;  4L8E A;  4NV5 A;  4TR1 B;  3UVT A;  4AGS A;  1V2A A;  3EPT A;  1SYR A;  2DLX A;  1N8J A;  4MH2 A;  3GKK A;  1K0D A;  4AJ7 A;  4WKW A;  4PQH A;  1SKR B;  5B8B A;  3P90 A;  4FH8 A;  3WT1 A;  1TDI A;  3HZ8 A;  4EF0 A;  3ZLP A;  4YQV A;  2VL2 A;  4MJE A;  1R5A A;  2GSS A;  3QAG A;  1EV4 A;  1NSW A;  1M0U A;  1E2Y A;  2C80 A;  1U6T A;  4OFT A;  1WMJ A;  5DCH A;  5GST A;  5IIZ A;  3GUS A;  1JZO A;  3IK9 A;  3TKS A;  3KEB A;  1EP8 A;  2FA4 A;  5KN1 A;  4WR5 A;  1VF2 A;  1ABA A;  2HRF A;  4MJC A;  1TU7 A;  3IOS A;  4ZXG A;  2CAI A;  4F9Z A;  4CY6 A;  2B1K A;  4MMM A;  3LSZ A;  3EWL A;  2R2J A;  3GKM A;  2H01 A;  2B6M A;  1XIY A;  3DEX A;  2XBQ A;  2L6C A;  2XBI A;  2DJ1 A;  4PGT A;  3IAS 2;  3HVV A;  3VI7 A;  5J3R A;  3RPN A;  4HJ2 A;  4ZBB A;  2B5X A;  3A2W A;  3A2X A;  1WP0 A;  4KUN A;  1X9W B;  3IRA A;  3UL3 A;  4YAV A;  4TR4 A;  1F3B A;  6GSW A;  1GTU A;  4YKG A;  1JFU A;  2ZUP A;  2PN8 A;  6GST A;  1KNG A;  4HS1 A;  4JU5 A;  1KEB A;  1ERU A;  5D93 A;  1QGV A;  1XBS A;  2IIY A;  5J4U A;  4DEJ A;  2YJH A;  3NOF A;  4WBJ A;  3DRN A;  2P0G A;  4L0W A;  4KAE A;  5CRW A;  3H93 A;  4ULX A;  3ERW A;  1S3A A;  1PN0 A;  4X0X A;  3CTF A;  3L9U A;  1QMV A;  2O85 A;  1R7H A;  3HVX A;  5IM9 A;  1PSQ A;  2LQQ A;  1M7T A;  5ECH B;  3KZQ A;  3GMF A;  5DJL A;  2IPA A;  3HVS A;  4EIQ A;  3BBY A;  3F9U A;  5IPH A;  3R3E A;  1K3O A;  1GUH A;  4G2E A;  4POK A;  1Z7R A;  2IME A;  4XRA A;  3K8N A;  1Z7P A;  3VWX A;  2A2P A;  4CY8 A;  2L57 A;  4MF6 A;  3RHC A;  2IMK A;  3FHK A;  3DYR A;  2F3M A;  1TI3 A;  2O89 A;  5EY6 A;  1X0R A;  2ZCT A;  3DKS A;  5FHI A;  5JWQ B;  2VM2 A;  2IMF A;  1BAY A;  4IQ1 A;  5ECK B;  4J57 E;  5DAL B;  4YQU A;  1YDK A;  3E9J B;  4K7I A;  4BVX B;  4NPB A;  1GH2 A;  2HSY A;  2XPE A;  1T4Y A;  1Z9H A;  2QC7 A;  5ENU A;  4WXT A;  3HCZ A;  2MMZ A;  3NZN A;  4N0V A;  5DCG A;  4I6X A;  4IJ3 A;  1ML6 A;  1WE0 A;  2LJR A;  1GRX A;  1H75 A;  4Z2R A;  1AQW A;  3KMO A;  1A23 A;  3ZIJ A;  3D6I A;  3IHG A;  1TXX A;  3TJG A;  4WR4 A;  2QKE A;  5ECL B;  1EOH A;  2QSI A;  1SK2 A;  1T8E B;  2NTO A;  4MAB A;  2WRT A;  1A0R P;  3N9J A;  3VLN A;  3ZYW A;  2VCZ A;  4TXO B;  3TRX A;  2GT5 A;  2GVP A;  3I6A A;  5CYY A;  2DKI A;  3GFK A;  2TRC P;  2DJ3 A;  4MH3 A;  2H1A A;  4BA7 A;  5IMC A;  4MZB A;  1A24 A;  2BJX A;  14GS A;  5FT3 A;  4G0L A;  1V98 A;  5F05 A;  2I3Y A;  1TK8 B;  2K6V A;  4KGI A;  1XVQ A;  1T1V A;  3IXR A;  4IQA A;  2WFC A;  2XHF A;  2NDO A;  3DML A;  3DD3 A;  4CHS A;  4X4J A;  1WRY A;  1MTC A;  2X49 A;  1VF1 A;  5ECR B;  4IW9 A;  1TJD A;  4ZIJ A;  3DVX A;  16GS A;  2OE0 A;  3LYK A;  2IMD A;  3F4T A;  3VPT A;  4WEY A;  2DSA A;  4K2X A;  5KN0 A;  2HZE B;  1AW9 A;  4G0I A;  1K0O A;  4OFN A;  3VPQ A;  1ZYE A;  3FZ5 A;  1K0B A;  4FQU A;  1OE8 A;  5E59 A;  2YWN A;  1NW2 A;  1WJK A;  1TI1 A;  2KHP A;  4V2L A;  1SJI A;  2LJA A;  3KMN A;  2MYG A;  3E0U A;  1N2A A;  2C8U A;  4IP6 A;  1TK5 B;  3QD9 A;  4J2F A;  3VK9 A;  4I8B A;  3QPM A;  2HZF A;  4I97 A;  1GNW A;  3GL3 A;  1QXH A;  1ZYQ B;  3IDV A;  2A2S A;  3F0I A;  1FHE A;  1F3A A;  8GSS A;  1A2L A;  1GSY A;  2DIY A;  3D4M A;  4WET A;  4LL1 B;  17GS A;  4BPY A;  1DSB A;  6GSS A;  2K8V A;  2L5L A;  3U6V A;  2C4J A;  1AXD A;  4HQS A;  3ZMK A;  2YCD A;  1OAZ A;  4KW6 A;  3WGE A;  2A4V A;  1B8X A;  5A4U A;  1BJX A;  1TRS A;  3UIW A;  1OKT A;  3ERF A;  1WIK A;  3CTG A;  4GLT A;  1OC9 A;  2CT6 A;  4Q5N A;  2L5O A;  3TRP A;  1VGL A;  2DJ0 A;  4MLY A;  1SL1 B;  4QQ7 A;  3M3M A;  4MZC A;  4ZBD A;  2H74 A;  4K7N A;  4DSQ A;  2K18 A;  2GQK A;  2GST A;  1CQG A;  4F0C A;  5KEJ A;  4OMV A;  2CA8 A;  2VIM A;  4BWQ A;  3WT2 A;  2HFD A;  2MMO A;  3HJP A;  3IK7 A;  1OVN A;  4ZB6 A;  3IHQ A;  2V1M A;  2DJ2 A;  1FAA A;  1K3Y A;  3IR4 A;  2H0H A;  4L0U A;  5ECO B;  3FR9 A;  1GLP A;  2E7P A;  1E6B A;  5D9W A;  4Q5F A;  5IMD A;  3HZ4 A;  1MDJ A;  1SKW B;  1Z3E A;  3ZML A;  1DE1 A;  3KP9 A;  6GSV A;  2PER A;  1VF3 A;  2QA2 A;  3H4K A;  4F82 A;  3PGT A;  3ZL5 A;  4PUF C;  4PQ1 A;  3TCO A;  4GXZ A;  1ST9 A;  1G0T A;  3GKX A;  4JZQ A;  2FWF A;  2VL2 C;  3F63 A;  1AUC A;  5FWG A;  1GWC A;  4EC0 A;  2GLR A;  5F8B A;  4ZIL A;  3A2V A;  3QDN A;  5DBQ A;  1SL0 B;  4NWY A;  4TR0 A;  5G5F A;  4USS A;  1GSS A;  1FB6 A;  2B7K A;  5DVB A;  2YWI A;  3ZRD A;  1FVJ A;  3I43 A;  4JR6 A;  2P5Q A;  1TU8 A;  4JE1 A;  3TJJ A;  4KDX A;  3GNJ A;  2H70 A;  4XS4 A;  3TKR A;  2GQM A;  5G31 A;  3FZ4 A;  2J23 A;  2FD3 A;  3L4N A;  4AF2 A;  3HHV A;  4KH7 A;  1G6W A;  1TTZ A;  4XRD A;  3DIE A;  4BVY B;  3BOA A;  2VOC A;  2M46 A;  2HRK A;  2RUF A;  3LQ7 A;  4NHZ A;  1ILO A;  2H0I A;  4N11 A;  4EDY A;  3UOM A;  3ISO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...