3ZYWA

Crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
108
structure length
108
Chain Sequence
b'DLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAAENLYFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the First Glutaredoxin Domain of Human Glutaredoxin 3 (Glrx3)
rcsb
molecule keywords GLUTAREDOXIN-3
source organism Homo sapiens
molecule tags Metal binding protein
total genus 37
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zywA01
1PQNA 3TKQA 1U87A 4WXTA 1E2YA 3FR3A 1J08A 1X5EA 2B5EA 4HZ2A 5D9VA 1GUKA 1GP1A 2F8AA 5GAPD 3QD9A 4ZIJA 3N5OA 2E0QA 3RBTA 4V2MA 1AQVA 1URMA 2C4JA 3DVXA 4CW9A 3UBLA 2V6KA 2GGTA 1SL1B 3TKSC 3GTUB 4MJEA 1GSUA 5ENUA 1QMVA 2R2JA 3UIWA 3ZRDA 1TRSA 2HNLA 3EE2A 1VGLA 2X64A 4KCEA 3HCZA 4I97A 5B7CA 14GSA 3RPPA 2MYGA 1QFNA 1GTIA 1FVJA 2QGVA 4OFMA 4BWQA 3VURA 1LJRA 5FWGA 1ERWA 2C3TA 1V98A 4E8HA 3A2VA 4IJ3A 4LL1B 2HSYA 5J5NA 2YPMA 3IR4A 3D0ZA 1IYIA 2XHFA 3EVIA 4KAEA 1X5CA 2DJ0A 2VM1A 4TR0A 2JU5A 1OC3A 2BTOT 5IPGA 1DSBA 2ZCTA 3UVTA 1Z3EA 2OE3A 4ML1A 2O85A 1S3AA 2RUEA 1VF1A 4HU9A 4NWYA 4F0CA 1QK8A 4IJIA 1UC7A 3GRXA 2WDUA 4ZBBA 1EEJA 3VLNA 1OE8A 1B8XA 2WGRA 3KGKA 3GKMA 2VLUA 1FVKA 2DSAA 2GTUA 1FAAA 1A24A 2LSTA 2MZCA 1N2AA 5G30A 1AW9A 4IS0A 2I9HA 1M9BA 2B5YA 5IQYA 3F63A 3P7XA 3UAPA 3QFAC 5A4UA 3RPNA 4TR4A 2HI7A 2B7KA 2Z9SA 4BVYA 3FEUA 4OWYA 2YZHA 1T7PB 3HVXA 1K0BA 4NHWA 2B7JA 3WYWA 4KB3A 3Q19A 1HNBA 3FR6A 2CAIA 8GSSA 20GSA 3ME7A 4PX1A 4FH8A 3VWWA 2P0GA 1O73A 1BQ7A 1K0CA 3HZ4A 1ZMAA 4OFTA 5HR1A 2RIIA 4CHSA 3NOFA 4KSMA 2C0FA 1AQWA 1OC8A 4GQFA 2PERA 3A2XA 4N11A 1IYHA 5JCWA 4NPBA 3APOA 4HJMA 1X9WB 1I5GA 4ISDA 2O87A 1SYRA 5J4UA 2MMOA 2DIZA 4XIHA 1NHYA 11GSA 1SD9A 1HNAA 3APQA 3EC3A 1ZCPA 2DMMA 2C0EA 3M0FA 4DSRA 3UL3A 3KTLA 4WBJA 1TW9A 4I2TA 4K9ZA 4V1Ap 2DC5A 4XHMA 3GX0A 4WKWA 3L78A 4KA0A 5KN1A 6GSSA 4MZCA 2VO4A 3HVVA 1GTBA 3HD5A 2VL3A 4IELA 2GDRA 3C73A 4YQUA 1XCCA 3I6AA 2LJKA 4MF6A 3J7Yb 1F6MC 3ED3A 3IRAA 5KN0A 4HEA2 2PU9C 4MZWA 3N9JA 1F9MA 4Q5FA 3DEXA 3HZ8A 3KMOA 1XBSA 3H4KA 5ECIB 1XWCA 1XWAA 3EU4A 4XCSA 2AB6A 2NVLA 3QOUA 1MD4A 2X8CA 1YKAA 2DJ3A 5E4WA 4YQVA 2GT5A 2XPEA 1V40A 3DIEA 3O76A 4CDOA 2GQMA 4TXVA 4TRXA 3DXBA 1YJ6A 4KDYA 3FYGA 4QL7A 5JWQB 5IMCA 4O7HA 5GSTA 1WWJA 4JR6A 4ECIA 1SD8A 1MEKA 1GUMA 1JZRA 2VD0A 4MF5A 4ECBA 1Z6NA 2L4CA 5ECOB 1MDIA 10GSA 2OACA 1OE7A 1AXDA 4MPGA 5ID2B 1QXHA 2QKEA 2LRTA 2X8GA 3GN3A 3RHCA 4Q5NA 3CSIA 4YH2A 1FG4A 2CVBA 4HI7A 5D8IA 2G2QA 1E6BA 3F4SA 2K8VA 3LGCA 2LEGA 1H4OA 4KSOA 2H6YA 3BJ5A 2N5AA 4FYUA 3UBKA 1XOAA 1PMTA 2R6KA 4OFNA 3TJKA 5CRHA 3GMFA 5LCZA 4TW5A 3DMLA 4XS4B 2MBTA 1TU8A 2M46A 2CQ9A 5IMDA 4EL1A 5G2ZA 19GSA 1A0RP 1UA5A 4I5QA 1ACVA 5DJMA 3KEBA 3QDNA 1J0FA 2LRNA 3FZ4A 4L5OA 4ZB6A 4X1UA 4IVFA 2X8HA 1ZZYA 3IBHA 3K8NA 2VIMA 4EO3A 2LQQA 4L5LA 3CSHA 3CYNA 3D22A 4TKYA 2OBKA 3H93A 4K6XA 5J9BA 1T4ZA 5ECHB 3IAS2 5L71A 4LA1A 1XIYA 1AIUA 4OMVA 1A8YA 4JBBA 4YQMA 4JR4A 1OVNA 1FHEA 3FY7A 2TIRA 4Q5RA 4PNGA 2E2MA 1TTZA 2L59A 5CP1A 1M9AA 2F9SA 3GNJA 3DWVA 2OBIA 4MH3A 1XWBA 2WCIA 2PN8A 4K0NA 4DSSA 4HU7A 1H75A 4PQIA 1QQ2A 5AISA 1TK5B 5JWOB 1YF0A 3QAVA 1OYJA 1YEXA 4IHUA 4DSSB 2VUPA 2CZ3A 2F8FA 2H1AA 5JCGA 1B4PA 17GSA 3A5WA 3AY8A 5GSSA 3E0UA 2HSHA 1UVZA 1PKZA 1MTCA 4HS1A 9GSSA 2CX3A 1M99A 4FYCA 4NAXA 4RI6A 5IPHA 2JADA 3DGQA 1X0RA 2P5RA 2NPBA 5CNWA 2HZFA 5ECQB 4AJ8A 5G1KA 2X99A 3QCPA 2GSTA 2YV9A 5EY6A 2PMTA 2B6MA 3LORA 5EL8A 2JSYA 1T00A 2H73A 1U3IA 1V58A 4WBRD 4JEDA 4ECCA 2B3SA 3FKFA 3IC4A 1TRWA 3PH9A 2C1YA 3KD0A 3DKSA 4K2DA 1ERVA 1NM3A 1XFLA 3RAZA 3DYRA 1X9SB 2H19A 4L8EA 3TJBA 1BAYA 5CRWA 4IGJA 1A2MA 5JCUA 4ZXGA 3WT2A 1SK2A 1YKCA 4MABA 1QUWA 5DCHA 5G31A 1SKWB 4N30A 5IM9A 3ISOA 2JZRA 4F0BA 3MNGA 3WGXA 2AUVA 3G9BA 1ZL9A 4EUYA 1XW5A 4WF5A 3VI5A 5KN2A 1PL1A 3FZ9A 5D9XA 4MJBA 3LXTA 3KM6A 4GXZA 2V6OA 4FIWA 1SK1A 2LS5A 3H79A 22GSA 3IPZA 3I43A 4N0ZA 3IAM2 3HYPA 1JFUA 2H66A 3OR5A 4TOPA 2AV4A 3V1WA 4GLTA 3P2AA 2WZ9A 4K8MA 3TKSE 1O8WA 1EP8A 1GSFA 2P31A 5AN1A 4EKZA 3L4NA 2VL2A 1JZDA 3BCKA 1WIKA 2DIYA 1V2AA 4O92A 3MWHA 1XW6A 2JZTA 4NXIA 3L9VA 4L0UA 4AJ7A 1G6WA 4OCFA 4OO5A 5C00A 5B6MA 1Q4JA 1JHBA 2XPDA 4EVMA 1EP7A 4ZILA 4GSNA 2L6CA 2HRFA 4RUVA 3G7IA 4LMWA 5HQPA 5IOXA 1A23A 2HT9A 4ML6A 1YY7A 3H1NA 3GKXA 2HE3A 5ECNB 1N8JA 4J56E 3UEMA 1HNCA 5DBQA 1SL2B 2R37A 4HOJA 5GZZB 1FW1A 2LQOA 1OC9A 2LKUA 5D93A 4D73A 6GSUA 2EC4A 3L0HA 4TXOA 3GL5A 1O85A 4EXJA 1YZXA 1RQMA 3PR8A 1OC9B 3A3TA 3HXSA 4D73B 3HY2A 2XBQA 3LQ7A 4MCUA 4TXOB 3F8UA 1JZOA 4KGIA 2ALBA 1BX9A 5DQSA 2H0GA 4JRRA 4OO4A 4WF4A 4E8EA 2HLSA 1BJXA 1GTAA 2H0IA 1GSSA 2H71A 3LFLA 1CQGA 3TB2A 16GSA 2KOKA 4POLA 2H1GA 2JACA 4ZB8A 2A2SA 2YJ7A 3CTGA 5F8BA 2IWTA 1BEDA 1MDJA 2GLRA 3ZTLA 5F0GA 4IW9A 5JWRB 1XVWA 1TJDA 2L5LA 3KTBA 2RM6A 2CVKA 2P5QA 5KN3A 3ERWA 1SJ6A 1GRXA 2C0DA 4QQ7A 4KNDA 2AYTA 2LTKA 3VPTA 1M2DA 2WJUA 2H8LA 1PN9A 2YOIA 2ZNMA 3IK9A 3BCIA 3LYPA 1BYEA 2JSZA 2VCTA 2YWMA 4GWRA 2CZ2A 4MF7A 5FT3A 2FA4A 5E59A 2MBSA 7GSSA 2V41A 3C1SA 2YWNA 3MSZA 4EF0A 2H1BA 5DALA 4PQHA 3QAWA 2DLXA 4LLRA 1W89A 5J9CA 4TR1A 5DALB 3RHBA 4XRAA 2IL3A 1RW1A 1Z7PA 5IMVA 1PSQA 1HYUA 2AAWA 3TUEA 2REMA 1EGRA 4PXOA 3GH9A 4F82A 4IP1A 1GH2A 1O7UA 5GAND 4HQZA 1PRXA 3VWUA 3HA9A 2F3MA 1A2LA 1THXA 2FNOA 2EIOA 3PGTA 3APSA 2XC2A 4KW6A 3WGDA 1VF4A 1V57A 3UVHA 1GNWA 4G19A 3TJGA 3SWLA 3Q18A 2PBJA 2GSSA 2WB9A 6GSVA 1SYXA 2PVQA 3F3QA 4WR4A 5J41A 2IMFA 5DDLA 4F2IA 1PL2A 2VCXA 5CRDA 4MZBA 6GSYA 5COHA 4TR3A 2IMEA 2OADA 1SJZA 3LYKA 2AHEA 3C8EA 1YEPA 3FZAA 2FWGA 3QFBC 4HUAA 1SJIA 1Y25A 3FR9A 4ULXA 1EV9A 5HR0A 5CREA 1WJKA 1XPVA 4YAPA 5EVOA 1TK8B 1K3LA 4I8BA 4N10A 2TRXA 3KMNA 4XRDA 1ML6A 1XWKA 1A8LA 4I6XA 2L57A 5HR3A 2LNSA 2A4VA 2HYXA 3TJJA 2O8VB 2YWIA 4V2NA 2GS3A 4MH2A 4MJCA 5ECSA 1J9BA 2GZPA 3KCMA 2HRNA 1USBA 1GL8A 3BD2A 2A2RA 2WRTA 1ERUA 4RQXA 4MLYA 3ZMKA 1M7TA 2H72A 3S9FA 4ID0A 3P90A 1FOVA 2CX4A 1XW9A 2E2GA 1OAZA 4BPYA 2M72A 2NDOA 2C80A 2KUCA 5ECLB 3GFKA 5HFKA 3VFIA 3GSTA 3KZQA 2FHEA 3PINA 4HZ4A 2GSQA 4TVEA 2VOCA 2YV7A 3Q74A 2L6DA 1NHOA 3QR6A 1GSQA 1TI3A 3IK7A 2XBIA 3L9UA 4V2LA 3CMIA 4KX4A 2YWOA 1KBNA 3EYTA 5LNKe 3DVWA 5CYYA 3LSZA 3CTFA 1SU9A 4BL7A 1ZGNA 4LMVA 4ZBAA 3GYKA 2R4VA 1U6TA 3EWLA 3ZFLA 5B6NA 2IN3A 4ECJA 2GQLA 3ZZXA 2YN1A 4K7OA 5IMFA 3CBUA 1G6YA 5D9WA 2ON5A 1GSYA 3FW2A 2WFCA 2MMAA 4ZL7A 4J2FA 3BBYA 2FA8A 1O81A 1PX6A 2FUG2 3ZMLA 2YP6A 4WR5A 2I3YA 4JZQA 1SENA 2VCQA 1TK0B 3E9JB 1F3AA 1T3BA 3GKKA 3IA1A 1U3AA 3KH9A 3M1GA 5IO0A 4GCIA 2KHPA 2ON7A 4IQ1A 5H5RA 1G7EA 5D9TA 4Z7XA 2F51A 2H76A 4F03A 4PQ1A 3QAGA 4KH7A 3RDWA 5IIZA 1LU4A 4MA9A 2V32A 1HQOA 4XS1A 1EOHA 3ZREA 2FWFA 2CA8A 4ACSA 4KDXA 5FHIA 1EV4A 2OE0A 3M3MA 5KEJA 3C71A 3LEFA 1B4QA 2CAQA 5ABRA 2LRCA 2GQKA 3UMAA 4GRFA 5A4VA 1SKRB 1XOBA 4X0XA 2N5FA 3EMPA 2QSIA 4KUNA 1R5PA 1OKTA 2M80A 1EZKA 1ZYEA 4PUAA 3CSJA 1ST9A 1Z6MA 5EPFA 2CT6A 3ZIJA 4NV2A 4GTUA 1PKWA 1TKDB 4K7NA 2K8SA 3GHAA 2H75A 1DE2A 2JL4A 3JCML 4WETA 1Z5YE 3HVSA 5ECKB 1TRUA 2YZUA 1T4YA 2I81A 3GL3A 4MK3A 1SK0A 3GX8A 1DBYA 4P3YB 5DJLA 2FY6A 3GIXA 1K3OA 2VL2C 2DJJA 1A0FA 4IQAA 1MDKA 2IJYA 4K0GA 4LL4B 1KTEA 2VAFA 3NIVA 4JU5A 3GTUA 2ES7A 3D21A 2VCVA 4RI7A 5ECRB 5F05A 1ZYQB 4POMA 1NSWA 3M8NA 1S3CA 2V2GA 5ECMB 4O5RA 3IV4A 3LXZA 1WOUA 1F2EA 3ME8A 3MDKA 2MMNA 1G7OA 1QGVA 3GUSA 1XZOA 1YQ1A 2BMXA 3W6GA 2K6VA 4WEYA 1AC1A 4H86A 2FWEA 3W8SA 3TKSA 2YANA 3HKRA 2PWJA 1X5DA 2R3XA 3TOUA 2R5GA 4PUFC 4HQSA 3KP8A 3ZLPA 2WULA 3CRTA 2L5OA 2GSRA 3GH6A 3HJMA 3O6TA 1XXUA 1Z9HA 6GSWA 4NV5A 3ZVJD 5ELAA 2N5BA 3F6FA 4K7IA 3US3A 2IPAA 6GSTA 1GLPA 2H01A 4MJAA 1THOA 2PVOC 4PGTA 5H5SA 2H0HA 4HDEA 5IMZA 1ON4A 1O8XA 2C0GA 3D6IA 2VCWA 1S3DA 1WP0A 5HR2A 2WS2A 2I4AA 2GVPA 3G7YA 4MP4A 4XTSA 3J7Yk 1T1VA 1K0DA 5HFIA 3TKRA 1GUHA 2MMZA 3FHKA 4BWSA 4NHZA 3TOTA 1M0UA 1JZWA 1XVQA 1K0OA 1U88A 2IMKA 1B9XC 3KIJA 3IHQA 1T8EB 4AGSA 1UN2A 3C1RA 4GF0A 1JLVA 2B1KA 1K3YA 3WT1A 1Y6EA 3EMXA 4BVXA 2C8UA 4N0VA 1JLWA 1GLQA 2DJ2A 3F9UA 1GNEA 4KE3A 2HFDA 3C7MA 2RUFA 3KXOA 5LD0A 1GULA 3D4MA 4XS6A 2OE1A 13GSA 1KNGA 4EE0A 3HJPA 3G7JA 3HJOA 1YDKA 3F4RA 1KEBA 1TDIA 3VK9A 2VM2A 3GSSA 3L9SA 1TI1A 3D5JA 1PD21 3P8WA 1W4VA 3GV1A 4GQCA 2VD1A 4TN8A 5DAKA 2BJXA 1I9DA 2PPTA 2OKAA 5DAKB 4G2EA 2ZUPA 2TRCP 2IFQA 2PUKC 3ZVJA 3CXGA 6GSXA 5F06A 5G5FA 1WPIA 2IIYA 3IE3A 4EDZA 1GTUA 1MD3A 2IFQB 3GKNA 1FO5A 2FGXA 1GWCA 1PA3A 1R5AA 4TR1B 1FB0A 1M2BA 4MDCA 5CRGA 4POKA 2E7PA 4YAVA 2K9FA 4OD7A 4I2UA 2DBCA 5CAXA 1PX7A 2DJKA 2GT6A 4V1Ag 5B8BA 2DMLA 2RLIA 3TRQA 3D4TA 3LWAA 3VI7A 4PNFA 3UJ1A 1GSDA 18GSA 3U6VA 1GSEA 2J9HA 1NW2A 2QC7A 3IXRA 2FLSA 1WE0A 3FZ5A 2H74A 2LJRA 3MAKA 1AQXA 3SBCA 3EU3A 1EWXA 3H8QA 2KP2A 1K0MA 3LJRA 5A4WA 2IMIA 5G1LA 3VWXA 1WMJA 4HJ2A 2O89A 1RK4A 4IKHA 3QPMA 5D73A 2H70A 4FO5A 1OKDA 3KJYA 4QL9A 4F9ZA 2VL9A 5CO3A 2L4QA 4IBPA 2RM5A 3TRPA 3QMXA 4ZBDA 2B1LA 1R7HA 3IDVA 3I9V2 2PGTA 3U5RE 5A5KA 1VF3A 2YNXA 1Z7RA 2LJAA 1VRSD 1M2AA 1TOFA 1AAZA 1EGOA 2H6ZA 4GSSA 1O6JA 5ID2A 1AUCA 5C04A 2D2ZA 2H1DA 3BOAA 1TU7A 5AIVA 5AIXA 2FWHA 1R26A 1TRVA 1ABAA 4ILFA 3EINA 4ZB9A 4ZL9A 4DEJA 2JZSA 2LUSA 4K1FA 3ZIVA 4EC0A 4PURA 3ZITA 4MMMA 2VLVA 1B9YC 4G10A 2YJHA 5IOWA 2YCDA 1TXXA 2K18A 1HD2A 1R4WA 4Q5QA 2H6XA 5G5EA 4DSQA 2CV4A 2GZYA 2C3NA 3FK8A 4XS4A 2GZZA 2HXKA 4FYBA 3IOSA 1PGTA 5HFGA 3VPQA 2IMDA 2C3QA 2KP1A 3HHVA 4L0WA 3FRCA 1YF1A 4POBA 4O32A 5D96A 2O7KA 3LG6A 3R2QA 4BA7A 5DVBA 2AJQB 1DE1A 5ELGA 1F37A 4DVCA 2I1UA 3DD3A 1VF2A 4RQRA 3HDCA 5IMAA 2NBSA 3Q6OA 1TP9A 2VCZA 1FB6A 1ZOFA 3TKPA 2HZEA 1CQHA 1C72A 1K0AA 3A2WA 2HZEB 5AGYA 4J57E 3F0IA 2LNTA 2EIRA 5IO2A 3O3TA 1A2JA 2KLXA 2J23A 2H30A 4NMUA 4X43A 1SL0B 3E3EA 3GA4A 5INYA 4AF2A 3CRUA 2OJLA 4MPFA 5DCGA 1F3BA 2EIQA 1BG5A 3M9KA 4ZL8A 5F07A 4IN0A 1ILOA 2OA7A 5J3RA 3ZL5A 4JE1A 3UOMA 5ECPB 12GSA 2CVDA 5B8AA 2B5XA 5DQYA 2FCHA 3M9JA 4OCEA 2DJ1A 1LBKA 3GURA 3WD6A 4KDUA 3F6DA 2G0FA 1DUGA 1XWGA 2FD3A 2VLTA 3EURA 3DRNA 3KH7A 3TGZA 3TRXA 3UARA 2NTOA 1V9WA 3ERFA 1G0TA 3NZNA 3W8JA 3KP9A 4AJ6A 1EOGA 5H5QA 3ZYWA 1Q98A 3TCOA 1K0NA 3ZFBA 1WRYA 2LV3A 3VWVA 3I69A 3F3RA 4IP6A 3F4TA 1X9MB 4G9HA 4EDYA 1SKSB 1EEMA 1ERTA 4GSTA 2V1MA 3ERGA 3TDGA 1B48A 4KCAA 3WGEA 3TJFA
chains in the Genus database with same CATH superfamily
1PQNA 3TKQA 1U87A 4WXTA 1E2YA 3FR3A 1J08A 1X5EA 2B5EA 4HZ2A 5D9VA 1GUKA 1GP1A 2F8AA 5GAPD 3QD9A 4ZIJA 3N5OA 2E0QA 3RBTA 4V2MA 1AQVA 1URMA 2C4JA 3DVXA 4CW9A 3UBLA 2V6KA 2GGTA 1SL1B 3TKSC 3GTUB 4MJEA 1GSUA 5ENUA 1QMVA 2R2JA 3UIWA 3ZRDA 2DKHA 1TRSA 2HNLA 3EE2A 1VGLA 2X64A 4KCEA 1FOHA 3HCZA 4I97A 5B7CA 14GSA 3RPPA 2MYGA 1QFNA 1GTIA 1FVJA 2QGVA 4OFMA 4BWQA 3VURA 1LJRA 5FWGA 1ERWA 2C3TA 1V98A 4E8HA 3A2VA 4IJ3A 4LL1B 2HSYA 2QA2A 2YPMA 5J5NA 3IR4A 3D0ZA 1IYIA 2XHFA 3EVIA 4KAEA 1X5CA 2DJ0A 2VM1A 4TR0A 2JU5A 1OC3A 2BTOT 5IPGA 1DSBA 2ZCTA 3UVTA 1Z3EA 2OE3A 4ML1A 2O85A 1S3AA 2RUEA 1VF1A 4HU9A 4NWYA 4F0CA 1QK8A 4IJIA 1UC7A 3GRXA 2WDUA 4ZBBA 1EEJA 3VLNA 1OE8A 1B8XA 2WGRA 3KGKA 3GKMA 2VLUA 1FVKA 2DSAA 2GTUA 1FAAA 1A24A 4FQUA 2LSTA 2MZCA 1N2AA 5G30A 1AW9A 4IS0A 2I9HA 1M9BA 2B5YA 5IQYA 3F63A 3P7XA 3UAPA 3QFAC 5A4UA 3RPNA 4TR4A 2HI7A 2B7KA 2Z9SA 4BVYA 3FEUA 4OWYA 2YZHA 1T7PB 3HVXA 1K0BA 4NHWA 2B7JA 3WYWA 4KB3A 3Q19A 1HNBA 3FR6A 2CAIA 8GSSA 20GSA 3ME7A 4PX1A 4FH8A 3VWWA 2P0GA 1O73A 1BQ7A 1K0CA 3HZ4A 1ZMAA 4OFTA 5HR1A 2RIIA 4CHSA 3NOFA 4KSMA 2C0FA 1AQWA 1OC8A 4GQFA 2PERA 3A2XA 4N11A 1IYHA 5JCWA 4NPBA 3APOA 4HJMA 1X9WB 1I5GA 4ISDA 2UZ8A 2O87A 1SYRA 5J4UA 2MMOA 2DIZA 4XIHA 1NHYA 11GSA 1SD9A 1HNAA 3APQA 3EC3A 1ZCPA 2DMMA 2C0EA 3M0FA 4DSRA 3UL3A 3KTLA 4WBJA 2HRAA 1TW9A 4I2TA 4K9ZA 4V1Ap 2DC5A 4XHMA 3GX0A 4WKWA 3L78A 4KA0A 5KN1A 6GSSA 4MZCA 2VO4A 3HVVA 1GTBA 3HD5A 2VL3A 4IELA 2GDRA 3C73A 4YQUA 1XCCA 3I6AA 2LJKA 4MF6A 3J7Yb 1F6MC 3ED3A 3IRAA 5KN0A 4HEA2 2PU9C 4MZWA 3N9JA 1M3IA 1F9MA 4Q5FA 3DEXA 3HZ8A 3KMOA 4ICYA 1XBSA 3H4KA 5ECIB 1XWCA 1XWAA 3EU4A 4XCSA 2AB6A 2NVLA 3QOUA 1MD4A 2X8CA 1YKAA 2DJ3A 5KOWA 5E4WA 4YQVA 4HSCX 2GT5A 2XPEA 4YKGA 1V40A 3DIEA 3O76A 4K5SA 4CDOA 2GQMA 4TXVA 4TRXA 3DXBA 1YJ6A 4KDYA 3FYGA 4QL7A 5JWQB 5IMCA 4O7HA 1ZYNA 5GSTA 1WWJA 4JR6A 4ECIA 1SD8A 1MEKA 1GUMA 1JZRA 2VD0A 4MF5A 4ECBA 1Z6NA 2L4CA 5ECOB 1MDIA 10GSA 2OACA 1OE7A 1AXDA 4MPGA 5ID2B 1QXHA 2QKEA 2LRTA 2X8GA 3GN3A 3RHCA 4Q5NA 3CSIA 4YH2A 1FG4A 2CVBA 4HI7A 5D8IA 2G2QA 1E6BA 3F4SA 2K8VA 3LGCA 2LEGA 1H4OA 4KSOA 2H6YA 3BJ5A 2N5AA 4FYUA 3UBKA 1XOAA 1PMTA 2R6KA 4OFNA 3TJKA 5CRHA 3GMFA 5LCZA 4TW5A 3DMLA 4XS4B 2MBTA 1TU8A 2M46A 2CQ9A 5IMDA 4EL1A 5G2ZA 19GSA 1A0RP 1UA5A 4I5QA 1ACVA 5DJMA 3KEBA 3QDNA 1J0FA 2LRNA 3FZ4A 4L5OA 4ZB6A 4X1UA 4IVFA 2X8HA 1ZZYA 3IBHA 3K8NA 2VIMA 4EO3A 2LQQA 4L5LA 3CSHA 3CYNA 3D22A 4TKYA 2OBKA 3H93A 4K6XA 5J9BA 1T4ZA 5ECHB 3IAS2 5L71A 4LA1A 1XIYA 1AIUA 4OMVA 1A8YA 4JBBA 4YQMA 4JR4A 1OVNA 1FHEA 3FY7A 2TIRA 4Q5RA 4PNGA 2E2MA 1TTZA 2L59A 5CP1A 1M9AA 2A2PA 2F9SA 3GNJA 3DWVA 2OBIA 4MH3A 1XWBA 2WCIA 2PN8A 4K0NA 4DSSA 4HU7A 1H75A 4PQIA 1QQ2A 5AISA 1TK5B 5JWOB 1YF0A 3QAVA 1OYJA 1YEXA 4IHUA 2X4AA 4DSSB 2VUPA 2CZ3A 2F8FA 4CY6A 2H1AA 5JCGA 1B4PA 17GSA 3A5WA 3AY8A 5GSSA 3E0UA 2HSHA 1UVZA 1PKZA 1MTCA 4HS1A 9GSSA 2CX3A 1M99A 4FYCA 4NAXA 4RI6A 5IPHA 2JADA 3DGQA 1X0RA 2P5RA 2NPBA 5CNWA 2HZFA 5ECQB 4AJ8A 5G1KA 2X99A 3QCPA 2GSTA 1PN0A 2YV9A 5EY6A 2PMTA 2B6MA 3LORA 5EL8A 2JSYA 1T00A 2H73A 1U3IA 1V58A 4WBRD 4JEDA 4ECCA 2B3SA 3FKFA 3IC4A 1TRWA 3PH9A 2C1YA 3KD0A 3DKSA 4K2DA 1ERVA 1NM3A 1XFLA 3RAZA 3DYRA 1X9SB 2H19A 4L8EA 3TJBA 1BAYA 5CRWA 4IGJA 1A2MA 1S3RA 5JCUA 4ZXGA 3WT2A 1SK2A 1YKCA 4MABA 1QUWA 5DCHA 5G31A 1SKWB 4N30A 5IM9A 3ISOA 2JZRA 4F0BA 3MNGA 3WGXA 2AUVA 3G9BA 1ZL9A 4EUYA 1XW5A 4WF5A 3VI5A 5KN2A 1PL1A 3FZ9A 5D9XA 4MJBA 3LXTA 3KM6A 4GXZA 2V6OA 4FIWA 1SK1A 2LS5A 3H79A 22GSA 3IPZA 3I43A 4N0ZA 3IAM2 3HYPA 1JFUA 2H66A 3OR5A 4TOPA 2AV4A 3V1WA 4GLTA 3P2AA 2WZ9A 4K8MA 3TKSE 1O8WA 1EP8A 1GSFA 2P31A 5AN1A 4EKZA 3L4NA 2VL2A 1JZDA 3BCKA 1WIKA 2DIYA 1V2AA 4O92A 3MWHA 1XW6A 2JZTA 4NXIA 3L9VA 4L0UA 4AJ7A 1G6WA 4OCFA 4OO5A 5C00A 5B6MA 1Q4JA 4X4JA 1JHBA 2XPDA 4EVMA 1EP7A 4ZILA 4GSNA 2L6CA 2HRFA 4RUVA 3G7IA 4LMWA 5HQPA 5IOXA 1A23A 2HT9A 4ML6A 1YY7A 3H1NA 3GKXA 2HE3A 5ECNB 3FMWA 1N8JA 4J56E 3UEMA 1HNCA 5DBQA 1SL2B 2R37A 4HOJA 5GZZB 1FW1A 2LQOA 1OC9A 2LKUA 5D93A 4D73A 6GSUA 2EC4A 3L0HA 4TXOA 3GL5A 1O85A 4EXJA 1YZXA 1RQMA 3PR8A 1OC9B 3A3TA 3HXSA 4D73B 3HY2A 2XBQA 3LQ7A 4MCUA 4TXOB 3F8UA 1JZOA 4KGIA 2ALBA 1BX9A 5DQSA 2H0GA 4JRRA 4OO4A 4WF4A 4E8EA 2HLSA 1BJXA 1GTAA 2H0IA 2HRKA 1GSSA 2H71A 3LFLA 1CQGA 3TB2A 16GSA 2R0CA 2KOKA 4POLA 2H1GA 2JACA 4CY8A 4ZB8A 2A2SA 2YJ7A 3CTGA 4BVYB 5F8BA 2IWTA 5BMUA 1BEDA 1MDJA 2GLRA 3ZTLA 5F0GA 4IW9A 5JWRB 1XVWA 1TJDA 2DKIA 2L5LA 3KTBA 2RM6A 2CVKA 2P5QA 5KN3A 3ERWA 1SJ6A 1GRXA 2R0GA 2C0DA 4QQ7A 4KNDA 2AYTA 2LTKA 3VPTA 1M2DA 2WJUA 2H8LA 1PN9A 4PTSA 2YOIA 2ZNMA 3IK9A 3BCIA 3LYPA 1BYEA 2JSZA 2VCTA 2YWMA 4GWRA 2CZ2A 4MF7A 5FT3A 2FA4A 5E59A 2MBSA 7GSSA 2V41A 3C1SA 2YWNA 3MSZA 4EF0A 2H1BA 5DALA 4PQHA 3QAWA 2DLXA 4LLRA 1W89A 5J9CA 4TR1A 5DALB 3RHBA 4XRAA 2IL3A 1RW1A 1Z7PA 5IMVA 1PSQA 1HYUA 2AAWA 3TUEA 2REMA 1EGRA 4PXOA 3GH9A 4F82A 4IP1A 1GH2A 1O7UA 1XG8A 5GAND 4HQZA 1PRXA 3VWUA 3HA9A 2F3MA 1A2LA 1THXA 2FNOA 2EIOA 3PGTA 3APSA 2XC2A 4KW6A 3WGDA 1VF4A 1V57A 3UVHA 1GNWA 4G19A 3TJGA 4BIKA 3SWLA 3Q18A 2PBJA 2GSSA 2WB9A 6GSVA 1SYXA 2PVQA 3F3QA 4WR4A 3MYDA 5J41A 2IMFA 5DDLA 4F2IA 1PL2A 2VCXA 5CRDA 4MZBA 6GSYA 2R0PA 5COHA 4TR3A 2IMEA 2OADA 1SJZA 3LYKA 2AHEA 3C8EA 1YEPA 3FZAA 2FWGA 3QFBC 4HUAA 1SJIA 1Y25A 3FR9A 4ULXA 1EV9A 5HR0A 5CREA 1WJKA 1XPVA 4EIPA 4YAPA 5EVOA 1TK8B 1K3LA 4I8BA 4N10A 2TRXA 3KMNA 4XRDA 1ML6A 1XWKA 1A8LA 4I6XA 2L57A 5HR3A 2LNSA 2A4VA 2HYXA 3TJJA 2O8VB 2YWIA 4V2NA 2GS3A 4MH2A 4MJCA 5ECSA 1J9BA 2GZPA 3KCMA 2HRNA 1USBA 1GL8A 3BD2A 2A2RA 2WRTA 1ERUA 4RQXA 4MLYA 3ZMKA 1M7TA 2H72A 3S9FA 4ID0A 3P90A 1FOVA 2CX4A 1XW9A 2E2GA 1OAZA 4BPYA 2M72A 2NDOA 2C80A 2KUCA 5ECLB 3CQFA 3GFKA 5HFKA 3VFIA 3GSTA 1ZYPA 3KZQA 2FHEA 3PINA 4HZ4A 2GSQA 4TVEA 2VOCA 2YV7A 3Q74A 2L6DA 1NHOA 3QR6A 1GSQA 1TI3A 3IK7A 2XBIA 3L9UA 4V2LA 3CMIA 4KX4A 2YWOA 1KBNA 3EYTA 4EIQA 5LNKe 3DVWA 5CYYA 3LSZA 3CTFA 1SU9A 4BL7A 4Z2UA 4Z2RA 1ZGNA 4LMVA 4ZBAA 3GYKA 2R4VA 1U6TA 3EWLA 3ZFLA 5B6NA 2IN3A 4BL7B 4ECJA 2GQLA 3ZZXA 2YN1A 4K7OA 5IMFA 3CBUA 1G6YA 5D9WA 2ON5A 1GSYA 3FW2A 2WFCA 2MMAA 4ZL7A 4J2FA 3BBYA 2FA8A 1O81A 1PX6A 2FUG2 3ZMLA 2YP6A 3IHGA 4WR5A 2I3YA 4JZQA 1SENA 2VCQA 1TK0B 3E9JB 1F3AA 1T3BA 3GKKA 3IA1A 1U3AA 3PPUA 3KH9A 3M1GA 5IO0A 4GCIA 2KHPA 2ON7A 4IQ1A 5H5RA 1G7EA 5D9TA 4Z7XA 2F51A 2H76A 4F03A 1PFOA 4PQ1A 3QAGA 4KH7A 3RDWA 5IIZA 1LU4A 4MA9A 2V32A 1HQOA 4XS1A 1EOHA 3ZREA 2FWFA 2CA8A 4ACSA 4KDXA 5FHIA 1EV4A 3EPTA 2OE0A 3M3MA 5KEJA 3C71A 3LEFA 1B4QA 2CAQA 5ABRA 2LRCA 2GQKA 3UMAA 4GRFA 5A4VA 1SKRB 1XOBA 4X0XA 2N5FA 3EMPA 2QSIA 4KUNA 1R5PA 1OKTA 2M80A 1EZKA 1ZYEA 4PUAA 3CSJA 1ST9A 1Z6MA 5EPFA 2CT6A 3ZIJA 4NV2A 4GTUA 1PKWA 1TKDB 4K7NA 2K8SA 3GHAA 2H75A 1DE2A 2JL4A 3JCML 4WETA 1Z5YE 3HVSA 5ECKB 1TRUA 2YZUA 1T4YA 2I81A 3GL3A 4MK3A 1SK0A 3GX8A 1DBYA 4P3YB 5DJLA 2FY6A 3GIXA 3A5IA 1K3OA 2VL2C 2DJJA 1A0FA 4IQAA 1MDKA 2IJYA 4K0GA 4LL4B 1KTEA 2VAFA 3NIVA 4JU5A 1M3JA 3GTUA 2ES7A 3D21A 2VCVA 4RI7A 5ECRB 5F05A 1ZYQB 4POMA 1NSWA 3M8NA 1S3CA 2V2GA 5ECMB 4O5RA 3IV4A 3LXZA 1WOUA 1F2EA 3ME8A 3MDKA 2MMNA 1G7OA 1QGVA 3GUSA 1XZOA 1YQ1A 2BMXA 3W6GA 2K6VA 4WEYA 1AC1A 4H86A 2FWEA 3W8SA 3TKSA 2YANA 3HKRA 2PWJA 1X5DA 2R3XA 3TOUA 2R5GA 4PUFC 4YKFA 4HQSA 3KP8A 3ZLPA 2WULA 3CRTA 2L5OA 2GSRA 3GH6A 3HJMA 3O6TA 1XXUA 1Z9HA 6GSWA 4NV5A 3ZVJD 5ELAA 2N5BA 3F6FA 4K7IA 3US3A 2IPAA 6GSTA 1GLPA 2H01A 4MJAA 1THOA 2PVOC 4PGTA 5H5SA 2H0HA 4HDEA 5IMZA 1ON4A 1O8XA 2C0GA 3D6IA 2VCWA 1S3DA 1WP0A 5HR2A 2WS2A 2I4AA 2GVPA 3G7YA 4MP4A 4XTSA 3J7Yk 1T1VA 1K0DA 5HFIA 3TKRA 1GUHA 2MMZA 3FHKA 4BWSA 4NHZA 4G0KA 3TOTA 1M0UA 1JZWA 1XVQA 1K0OA 1U88A 2IMKA 1B9XC 3KIJA 3IHQA 1T8EB 4AGSA 1UN2A 3C1RA 4GF0A 1JLVA 2B1KA 4K5RA 1K3YA 3WT1A 1Y6EA 3EMXA 4BVXA 2C8UA 4N0VA 1JLWA 1GLQA 2DJ2A 3F9UA 1GNEA 4KE3A 2HFDA 3C7MA 4BVXB 2RUFA 3KXOA 5LD0A 1GULA 3D4MA 4XS6A 2OE1A 13GSA 1KNGA 4EE0A 3HJPA 3G7JA 3HJOA 1YDKA 3F4RA 1KEBA 1TDIA 3VK9A 2VM2A 3GSSA 3L9SA 1TI1A 3D5JA 1PD21 3P8WA 1W4VA 3GV1A 4GQCA 2VD1A 4TN8A 5DAKA 2BJXA 1I9DA 5KOXA 2PPTA 2HSMA 2OKAA 5DAKB 4G2EA 2ZUPA 2TRCP 2IFQA 2PUKC 3ZVJA 3CXGA 6GSXA 5F06A 5G5FA 4MNNA 1WPIA 2IIYA 3IE3A 4EDZA 1GTUA 1MD3A 2IFQB 3GKNA 1FO5A 2FGXA 1GWCA 1PA3A 1R5AA 4TR1B 1FB0A 1M2BA 4MDCA 5CRGA 4POKA 2E7PA 4YAVA 2X49A 2K9FA 4OD7A 4I2UA 2DBCA 5CAXA 1PX7A 2DJKA 3R3EA 2GT6A 4V1Ag 5B8BA 2DMLA 2RLIA 3TRQA 3D4TA 3LWAA 3VI7A 4PNFA 3UJ1A 1GSDA 18GSA 3U6VA 1GSEA 2J9HA 1NW2A 2QC7A 3IXRA 2FLSA 1WE0A 3FZ5A 2H74A 2LJRA 3MAKA 1AQXA 3SBCA 3EU3A 1EWXA 3H8QA 2KP2A 1K0MA 3LJRA 4O5UA 5A4WA 2IMIA 5G1LA 3VWXA 1WMJA 4HJ2A 2O89A 1RK4A 4IKHA 3QPMA 5D73A 2H70A 4FO5A 1OKDA 3KJYA 2QA1A 4QL9A 4F9ZA 2VL9A 2A4HA 5CO3A 2L4QA 4IBPA 2RM5A 3TRPA 3QMXA 4ZBDA 2B1LA 1R7HA 3IDVA 3I9V2 2PGTA 3U5RE 5A5KA 1VF3A 2YNXA 1Z7RA 2LJAA 1VRSD 4A5PA 1M2AA 1TOFA 1AAZA 1EGOA 2H6ZA 4GSSA 1O6JA 5ID2A 1AUCA 5C04A 2D2ZA 2H1DA 3BOAA 1TU7A 5AIVA 5AIXA 2FWHA 1R26A 3LW9A 1TRVA 1ABAA 4ILFA 3EINA 4ZB9A 4ZL9A 4DEJA 2JZSA 2LUSA 4K1FA 3ZIVA 4EC0A 4PURA 3ZITA 4MMMA 2VLVA 1B9YC 4G10A 2YJHA 5IOWA 2YCDA 1TXXA 2K18A 1HD2A 1R4WA 4Q5QA 2H6XA 5G5EA 4DSQA 2CV4A 4G0LA 2GZYA 2C3NA 3FK8A 4XS4A 2GZZA 2HXKA 4K2XA 4FYBA 3IOSA 1PGTA 5HFGA 3VPQA 2IMDA 2C3QA 2KP1A 3HHVA 4L0WA 3FRCA 1YF1A 4POBA 4O32A 5D96A 2O7KA 3IC8A 3LG6A 3R2QA 4BA7A 5DVBA 2AJQB 1DE1A 5ELGA 1F37A 4DVCA 2I1UA 3DD3A 1VF2A 4RQRA 3HDCA 5IMAA 2NBSA 3Q6OA 1TP9A 2VCZA 1FB6A 1ZOFA 3TKPA 2HZEA 1CQHA 1C72A 1K0AA 3A2WA 2HZEB 5AGYA 4J57E 3F0IA 2LNTA 2EIRA 5IO2A 3O3TA 1A2JA 2KLXA 2J23A 2H30A 4NMUA 4X43A 1SL0B 3E3EA 3GA4A 5INYA 4O5QA 4AF2A 3CRUA 2OJLA 4MPFA 5DCGA 1F3BA 2EIQA 1BG5A 3M9KA 4ZL8A 5F07A 4IN0A 1ILOA 2OA7A 5J3RA 3ZL5A 4JE1A 3UOMA 5ECPB 12GSA 2CVDA 5B8AA 2B5XA 5DQYA 2FCHA 3M9JA 4OCEA 2DJ1A 4KF9A 1LBKA 3GURA 3WD6A 4KDUA 3F6DA 2G0FA 1DUGA 1XWGA 2FD3A 3MIXA 2VLTA 3EURA 5BRTA 3DRNA 3KH7A 3TGZA 3TRXA 3UARA 2NTOA 1V9WA 3ERFA 1G0TA 3NZNA 3W8JA 3KP9A 4AJ6A 1EOGA 5H5QA 3ZYWA 1Q98A 3TCOA 1K0NA 3ZFBA 1WRYA 2LV3A 3VWVA 3I69A 3F3RA 4IP6A 3F4TA 1X9MB 4G9HA 4EDYA 4G0IA 1SKSB 1EEMA 4USSA 1ERTA 3HVNA 4GSTA 4Z2TA 2V1MA 3ERGA 3TDGA 1B48A 4KCAA 3WGEA 3TJFA
chains in the Genus database with same CATH topology
1PQNA 3TKQA 1U87A 4WXTA 1E2YA 3FR3A 1J08A 1X5EA 2B5EA 4HZ2A 5D9VA 1GUKA 1GP1A 2F8AA 5GAPD 3QD9A 4ZIJA 3N5OA 2E0QA 3RBTA 4V2MA 1AQVA 1URMA 2C4JA 3DVXA 4CW9A 3UBLA 2V6KA 2GGTA 1SL1B 3TKSC 3GTUB 4MJEA 1GSUA 5ENUA 1QMVA 2R2JA 3UIWA 3ZRDA 2DKHA 1TRSA 2HNLA 3EE2A 1VGLA 2X64A 4KCEA 1FOHA 3HCZA 4I97A 5B7CA 14GSA 3RPPA 2MYGA 1QFNA 1GTIA 1FVJA 2QGVA 4OFMA 4BWQA 3VURA 1LJRA 5FWGA 1ERWA 2C3TA 1V98A 4E8HA 3A2VA 4IJ3A 4LL1B 2HSYA 2QA2A 2YPMA 5J5NA 3IR4A 3D0ZA 1IYIA 2XHFA 3EVIA 4KAEA 1X5CA 2DJ0A 2VM1A 4TR0A 2JU5A 1OC3A 2BTOT 5IPGA 1DSBA 2ZCTA 3UVTA 1Z3EA 2OE3A 4ML1A 2O85A 1S3AA 2RUEA 1VF1A 4HU9A 4NWYA 4F0CA 1QK8A 4IJIA 1UC7A 3GRXA 2WDUA 4ZBBA 1EEJA 3VLNA 1OE8A 1B8XA 2WGRA 3KGKA 3GKMA 2VLUA 1FVKA 2DSAA 2GTUA 1FAAA 1A24A 4FQUA 2LSTA 2MZCA 1N2AA 5G30A 1AW9A 4IS0A 2I9HA 1M9BA 2B5YA 5IQYA 3F63A 3P7XA 3UAPA 3QFAC 5A4UA 3RPNA 4TR4A 2HI7A 2B7KA 2Z9SA 4BVYA 3FEUA 4OWYA 2YZHA 1T7PB 3HVXA 1K0BA 4NHWA 2B7JA 3WYWA 4KB3A 3Q19A 1HNBA 3FR6A 2CAIA 8GSSA 20GSA 3ME7A 4PX1A 4FH8A 3VWWA 2P0GA 1O73A 1BQ7A 1K0CA 3HZ4A 1ZMAA 4OFTA 5HR1A 2RIIA 4CHSA 3NOFA 4KSMA 2C0FA 1AQWA 1OC8A 4GQFA 2PERA 3A2XA 4N11A 1IYHA 5JCWA 4NPBA 3APOA 4HJMA 1X9WB 1I5GA 4ISDA 2UZ8A 2O87A 1SYRA 5J4UA 2MMOA 2DIZA 4XIHA 1NHYA 11GSA 1SD9A 1HNAA 3APQA 3EC3A 1ZCPA 2DMMA 2C0EA 3M0FA 4DSRA 3UL3A 3KTLA 4WBJA 2HRAA 1TW9A 4I2TA 4K9ZA 4V1Ap 2DC5A 4XHMA 3GX0A 4WKWA 3L78A 4KA0A 5KN1A 6GSSA 4MZCA 2VO4A 3HVVA 1GTBA 3HD5A 2VL3A 4IELA 2GDRA 3C73A 4YQUA 1XCCA 3I6AA 2LJKA 4MF6A 3J7Yb 1F6MC 3ED3A 3IRAA 5KN0A 4HEA2 2PU9C 4MZWA 3N9JA 1F9MA 4Q5FA 3DEXA 3HZ8A 3KMOA 4ICYA 1XBSA 3H4KA 5ECIB 1XWCA 1XWAA 3EU4A 4XCSA 2AB6A 2NVLA 3QOUA 1MD4A 2X8CA 1YKAA 2DJ3A 5KOWA 5E4WA 4YQVA 2GT5A 2XPEA 4YKGA 1V40A 3DIEA 3O76A 4K5SA 4CDOA 2GQMA 4TXVA 4TRXA 3DXBA 1YJ6A 4KDYA 3FYGA 4QL7A 5JWQB 5IMCA 4O7HA 1ZYNA 5GSTA 1WWJA 4JR6A 4ECIA 1SD8A 1MEKA 1GUMA 1JZRA 2VD0A 4MF5A 4ECBA 1Z6NA 2L4CA 5ECOB 1MDIA 10GSA 2OACA 1OE7A 1AXDA 4MPGA 5ID2B 1QXHA 2QKEA 2LRTA 2X8GA 3GN3A 3RHCA 4Q5NA 3CSIA 4YH2A 1FG4A 2CVBA 4HI7A 5D8IA 2G2QA 1E6BA 3F4SA 2K8VA 3LGCA 2LEGA 1H4OA 4KSOA 2H6YA 3BJ5A 2N5AA 4FYUA 3UBKA 1XOAA 1PMTA 2R6KA 4OFNA 3TJKA 5CRHA 3GMFA 5LCZA 4TW5A 3DMLA 4XS4B 2MBTA 1TU8A 2M46A 2CQ9A 5IMDA 4EL1A 5G2ZA 19GSA 1A0RP 1UA5A 4I5QA 1ACVA 5DJMA 3KEBA 3QDNA 1J0FA 2LRNA 3FZ4A 4L5OA 4ZB6A 4X1UA 4IVFA 2X8HA 1ZZYA 3IBHA 3K8NA 2VIMA 4EO3A 2LQQA 4L5LA 3CSHA 3CYNA 3D22A 4TKYA 2OBKA 3H93A 4K6XA 5J9BA 1T4ZA 5ECHB 3IAS2 5L71A 4LA1A 1XIYA 1AIUA 4OMVA 1A8YA 4JBBA 4YQMA 4JR4A 1OVNA 1FHEA 3FY7A 2TIRA 4Q5RA 4PNGA 2E2MA 1TTZA 2L59A 5CP1A 1M9AA 2A2PA 2F9SA 3GNJA 3DWVA 2OBIA 4MH3A 1XWBA 2WCIA 2PN8A 4K0NA 4DSSA 4HU7A 1H75A 4PQIA 1QQ2A 5AISA 1TK5B 5JWOB 1YF0A 3QAVA 1OYJA 1YEXA 4IHUA 2X4AA 4DSSB 2VUPA 2CZ3A 2F8FA 4CY6A 2H1AA 5JCGA 1B4PA 17GSA 3A5WA 3AY8A 5GSSA 3E0UA 2HSHA 1UVZA 1PKZA 1MTCA 4HS1A 9GSSA 2CX3A 1M99A 4FYCA 4NAXA 4RI6A 5IPHA 2JADA 3DGQA 1X0RA 2P5RA 2NPBA 5CNWA 2HZFA 5ECQB 4AJ8A 5G1KA 2X99A 3QCPA 2GSTA 1PN0A 2YV9A 5EY6A 2PMTA 2B6MA 3LORA 5EL8A 2JSYA 1T00A 2H73A 1U3IA 1V58A 4WBRD 4JEDA 4ECCA 2B3SA 3FKFA 3IC4A 1TRWA 3PH9A 2C1YA 3KD0A 3DKSA 4K2DA 1ERVA 1NM3A 1XFLA 3RAZA 3DYRA 1X9SB 2H19A 4L8EA 3TJBA 1BAYA 5CRWA 4IGJA 1A2MA 5JCUA 4ZXGA 3WT2A 1SK2A 1YKCA 4MABA 1QUWA 5DCHA 5G31A 1SKWB 4N30A 5IM9A 3ISOA 2JZRA 4F0BA 3MNGA 3WGXA 2AUVA 3G9BA 1ZL9A 4EUYA 1XW5A 4WF5A 3VI5A 5KN2A 1PL1A 3FZ9A 5D9XA 4MJBA 3LXTA 3KM6A 4GXZA 2V6OA 4FIWA 1SK1A 2LS5A 3H79A 22GSA 3IPZA 3I43A 4N0ZA 3IAM2 3HYPA 1JFUA 2H66A 3OR5A 4TOPA 2AV4A 3V1WA 4GLTA 3P2AA 2WZ9A 4K8MA 3TKSE 1O8WA 1EP8A 1GSFA 2P31A 5AN1A 4EKZA 3L4NA 2VL2A 1JZDA 3BCKA 1WIKA 2DIYA 1V2AA 4O92A 3MWHA 1XW6A 2JZTA 4NXIA 3L9VA 4L0UA 4AJ7A 1G6WA 4OCFA 4OO5A 5C00A 5B6MA 1Q4JA 4X4JA 1JHBA 2XPDA 4EVMA 1EP7A 4ZILA 4GSNA 2L6CA 2HRFA 4RUVA 3G7IA 4LMWA 5HQPA 5IOXA 1A23A 2HT9A 4ML6A 1YY7A 3H1NA 3GKXA 2HE3A 5ECNB 3FMWA 1N8JA 4J56E 3UEMA 1HNCA 5DBQA 1SL2B 2R37A 4HOJA 5GZZB 1FW1A 2LQOA 1OC9A 2LKUA 5D93A 4D73A 6GSUA 2EC4A 3L0HA 4TXOA 3GL5A 1O85A 4EXJA 1YZXA 1RQMA 3PR8A 1OC9B 3A3TA 3HXSA 4D73B 3HY2A 2XBQA 3LQ7A 4MCUA 4TXOB 3F8UA 1JZOA 4KGIA 2ALBA 1BX9A 5DQSA 2H0GA 4JRRA 4OO4A 4WF4A 4E8EA 2HLSA 1BJXA 1GTAA 2H0IA 2HRKA 1GSSA 2H71A 3LFLA 1CQGA 3TB2A 16GSA 2R0CA 2KOKA 4POLA 2H1GA 2JACA 4CY8A 4ZB8A 2A2SA 2YJ7A 3CTGA 4BVYB 5F8BA 2IWTA 5BMUA 1BEDA 1MDJA 2GLRA 3ZTLA 5F0GA 4IW9A 5JWRB 1XVWA 1TJDA 2DKIA 2L5LA 3KTBA 2RM6A 2CVKA 2P5QA 5KN3A 3ERWA 1SJ6A 1GRXA 2R0GA 2C0DA 4QQ7A 4KNDA 2AYTA 2LTKA 3VPTA 1M2DA 2WJUA 2H8LA 1PN9A 4PTSA 2YOIA 2ZNMA 3IK9A 3BCIA 3LYPA 1BYEA 2JSZA 2VCTA 2YWMA 4GWRA 2CZ2A 4MF7A 5FT3A 2FA4A 5E59A 2MBSA 7GSSA 2V41A 3C1SA 2YWNA 3MSZA 4EF0A 2H1BA 5DALA 4PQHA 3QAWA 2DLXA 4LLRA 1W89A 5J9CA 4TR1A 5DALB 3RHBA 4XRAA 2IL3A 1RW1A 1Z7PA 5IMVA 1PSQA 1HYUA 2AAWA 3TUEA 2REMA 1EGRA 4PXOA 3GH9A 4F82A 4IP1A 1GH2A 1O7UA 5GAND 4HQZA 1PRXA 3VWUA 3HA9A 2F3MA 1A2LA 1THXA 2FNOA 2EIOA 3PGTA 3APSA 2XC2A 4KW6A 3WGDA 1VF4A 1V57A 3UVHA 1GNWA 4G19A 3TJGA 3SWLA 3Q18A 2PBJA 2GSSA 2WB9A 6GSVA 1SYXA 2PVQA 3F3QA 4WR4A 3MYDA 5J41A 2IMFA 5DDLA 4F2IA 1PL2A 2VCXA 5CRDA 4MZBA 6GSYA 2R0PA 5COHA 4TR3A 2IMEA 2OADA 1SJZA 3LYKA 2AHEA 3C8EA 1YEPA 3FZAA 2FWGA 3QFBC 4HUAA 1SJIA 1Y25A 3FR9A 4ULXA 1EV9A 5HR0A 5CREA 1WJKA 1XPVA 4EIPA 4YAPA 5EVOA 1TK8B 1K3LA 4I8BA 4N10A 2TRXA 3KMNA 4XRDA 1ML6A 1XWKA 1A8LA 4I6XA 2L57A 5HR3A 2LNSA 2A4VA 2HYXA 3TJJA 2O8VB 2YWIA 4V2NA 2GS3A 4MH2A 4MJCA 5ECSA 1J9BA 2GZPA 3KCMA 2HRNA 1USBA 1GL8A 3BD2A 2A2RA 2WRTA 1ERUA 4RQXA 4MLYA 3ZMKA 1M7TA 2H72A 3S9FA 4ID0A 3P90A 1FOVA 2CX4A 1XW9A 2E2GA 1OAZA 4BPYA 2M72A 2NDOA 2C80A 2KUCA 5ECLB 3GFKA 5HFKA 3VFIA 3GSTA 1ZYPA 3KZQA 2FHEA 3PINA 4HZ4A 2GSQA 4TVEA 2VOCA 2YV7A 3Q74A 2L6DA 1NHOA 3QR6A 1GSQA 1TI3A 3IK7A 2XBIA 3L9UA 4V2LA 3CMIA 4KX4A 2YWOA 1KBNA 3EYTA 4EIQA 5LNKe 3DVWA 5CYYA 3LSZA 3CTFA 1SU9A 4BL7A 4Z2UA 4Z2RA 1ZGNA 4LMVA 4ZBAA 3GYKA 2R4VA 1U6TA 3EWLA 3ZFLA 5B6NA 2IN3A 4BL7B 4ECJA 2GQLA 3ZZXA 2YN1A 4K7OA 5IMFA 3CBUA 1G6YA 5D9WA 2ON5A 1GSYA 3FW2A 2WFCA 2MMAA 4ZL7A 4J2FA 3BBYA 2FA8A 1O81A 1PX6A 2FUG2 3ZMLA 2YP6A 3IHGA 4WR5A 2I3YA 4JZQA 1SENA 2VCQA 1TK0B 3E9JB 1F3AA 1T3BA 3GKKA 3IA1A 1U3AA 3PPUA 3KH9A 3M1GA 5IO0A 4GCIA 2KHPA 2ON7A 4IQ1A 5H5RA 1G7EA 5D9TA 4Z7XA 2F51A 2H76A 4F03A 4PQ1A 3QAGA 4KH7A 3RDWA 5IIZA 1LU4A 4MA9A 2V32A 1HQOA 4XS1A 1EOHA 3ZREA 2FWFA 2CA8A 4ACSA 4KDXA 5FHIA 1EV4A 3EPTA 2OE0A 3M3MA 5KEJA 3C71A 3LEFA 1B4QA 2CAQA 5ABRA 2LRCA 2GQKA 3UMAA 4GRFA 5A4VA 1SKRB 1XOBA 4X0XA 2N5FA 3EMPA 2QSIA 4KUNA 1R5PA 1OKTA 2M80A 1EZKA 1ZYEA 4PUAA 3CSJA 1ST9A 1Z6MA 5EPFA 2CT6A 3ZIJA 4NV2A 4GTUA 1PKWA 1TKDB 4K7NA 2K8SA 3GHAA 2H75A 1DE2A 2JL4A 3JCML 4WETA 1Z5YE 3HVSA 5ECKB 1TRUA 2YZUA 1T4YA 2I81A 3GL3A 4MK3A 1SK0A 3GX8A 1DBYA 4P3YB 5DJLA 2FY6A 3GIXA 3A5IA 1K3OA 2VL2C 2DJJA 1A0FA 4IQAA 1MDKA 2IJYA 4K0GA 4LL4B 1KTEA 2VAFA 3NIVA 4JU5A 3GTUA 2ES7A 3D21A 2VCVA 4RI7A 5ECRB 5F05A 1ZYQB 4POMA 1NSWA 3M8NA 1S3CA 2V2GA 5ECMB 4O5RA 3IV4A 3LXZA 1WOUA 1F2EA 3ME8A 3MDKA 2MMNA 1G7OA 1QGVA 3GUSA 1XZOA 1YQ1A 2BMXA 3W6GA 2K6VA 4WEYA 1AC1A 4H86A 2FWEA 3W8SA 3TKSA 2YANA 3HKRA 2PWJA 1X5DA 2R3XA 3TOUA 2R5GA 4PUFC 4YKFA 4HQSA 3KP8A 3ZLPA 2WULA 3CRTA 2L5OA 2GSRA 3GH6A 3HJMA 3O6TA 1XXUA 1Z9HA 6GSWA 4NV5A 3ZVJD 5ELAA 2N5BA 3F6FA 4K7IA 3US3A 2IPAA 6GSTA 1GLPA 2H01A 4MJAA 1THOA 2PVOC 4PGTA 5H5SA 2H0HA 4HDEA 5IMZA 1ON4A 1O8XA 2C0GA 3D6IA 2VCWA 1S3DA 1WP0A 5HR2A 2WS2A 2I4AA 2GVPA 3G7YA 4MP4A 4XTSA 3J7Yk 1T1VA 1K0DA 5HFIA 3TKRA 1GUHA 2MMZA 3FHKA 4BWSA 4NHZA 4G0KA 3TOTA 1M0UA 1JZWA 1XVQA 1K0OA 1U88A 2IMKA 1B9XC 3KIJA 3IHQA 1T8EB 4AGSA 1UN2A 3C1RA 4GF0A 1JLVA 2B1KA 4K5RA 1K3YA 3WT1A 1Y6EA 3EMXA 4BVXA 2C8UA 4N0VA 1JLWA 1GLQA 2DJ2A 3F9UA 1GNEA 4KE3A 2HFDA 3C7MA 4BVXB 2RUFA 3KXOA 5LD0A 1GULA 3D4MA 4XS6A 2OE1A 13GSA 1KNGA 4EE0A 3HJPA 3G7JA 3HJOA 1YDKA 3F4RA 1KEBA 1TDIA 3VK9A 2VM2A 3GSSA 3L9SA 1TI1A 3D5JA 1PD21 3P8WA 1W4VA 3GV1A 4GQCA 2VD1A 4TN8A 5DAKA 2BJXA 1I9DA 5KOXA 2PPTA 2HSMA 2OKAA 5DAKB 4G2EA 2ZUPA 2TRCP 2IFQA 2PUKC 3ZVJA 3CXGA 6GSXA 5F06A 5G5FA 4MNNA 1WPIA 2IIYA 3IE3A 4EDZA 1GTUA 1MD3A 2IFQB 3GKNA 1FO5A 2FGXA 1GWCA 1PA3A 1R5AA 4TR1B 1FB0A 1M2BA 4MDCA 5CRGA 4POKA 2E7PA 4YAVA 2X49A 2K9FA 4OD7A 4I2UA 2DBCA 5CAXA 1PX7A 2DJKA 3R3EA 2GT6A 4V1Ag 5B8BA 2DMLA 2RLIA 3TRQA 3D4TA 3LWAA 3VI7A 4PNFA 3UJ1A 1GSDA 18GSA 3U6VA 1GSEA 2J9HA 1NW2A 2QC7A 3IXRA 2FLSA 1WE0A 3FZ5A 2H74A 2LJRA 3MAKA 1AQXA 3SBCA 3EU3A 1EWXA 3H8QA 2KP2A 1K0MA 3LJRA 4O5UA 5A4WA 2IMIA 5G1LA 3VWXA 1WMJA 4HJ2A 2O89A 1RK4A 4IKHA 3QPMA 5D73A 2H70A 4FO5A 1OKDA 3KJYA 2QA1A 4QL9A 4F9ZA 2VL9A 2A4HA 5CO3A 2L4QA 4IBPA 2RM5A 3TRPA 3QMXA 4ZBDA 2B1LA 1R7HA 3IDVA 3I9V2 2PGTA 3U5RE 5A5KA 1VF3A 2YNXA 1Z7RA 2LJAA 1VRSD 4A5PA 1M2AA 1TOFA 1AAZA 1EGOA 2H6ZA 4GSSA 1O6JA 5ID2A 1AUCA 5C04A 2D2ZA 2H1DA 3BOAA 1TU7A 5AIVA 5AIXA 2FWHA 1R26A 3LW9A 1TRVA 1ABAA 4ILFA 3EINA 4ZB9A 4ZL9A 4DEJA 2JZSA 2LUSA 4K1FA 3ZIVA 4EC0A 4PURA 3ZITA 4MMMA 2VLVA 1B9YC 4G10A 2YJHA 5IOWA 2YCDA 1TXXA 2K18A 1HD2A 1R4WA 4Q5QA 2H6XA 5G5EA 4DSQA 2CV4A 4G0LA 2GZYA 2C3NA 3FK8A 4XS4A 2GZZA 2HXKA 4K2XA 4FYBA 3IOSA 1PGTA 5HFGA 3VPQA 2IMDA 2C3QA 2KP1A 3HHVA 4L0WA 3FRCA 1YF1A 4POBA 4O32A 5D96A 2O7KA 3IC8A 3LG6A 3R2QA 4BA7A 5DVBA 2AJQB 1DE1A 5ELGA 1F37A 4DVCA 2I1UA 3DD3A 1VF2A 4RQRA 3HDCA 5IMAA 2NBSA 3Q6OA 1TP9A 2VCZA 1FB6A 1ZOFA 3TKPA 2HZEA 1CQHA 1C72A 1K0AA 3A2WA 2HZEB 5AGYA 4J57E 3F0IA 2LNTA 2EIRA 5IO2A 3O3TA 1A2JA 2KLXA 2J23A 2H30A 4NMUA 4X43A 1SL0B 3E3EA 3GA4A 5INYA 4O5QA 4AF2A 3CRUA 2OJLA 4MPFA 5DCGA 1F3BA 2EIQA 1BG5A 3M9KA 4ZL8A 5F07A 4IN0A 1ILOA 2OA7A 5J3RA 3ZL5A 4JE1A 3UOMA 5ECPB 12GSA 2CVDA 5B8AA 2B5XA 5DQYA 2FCHA 3M9JA 4OCEA 2DJ1A 4KF9A 1LBKA 3GURA 3WD6A 4KDUA 3F6DA 2G0FA 1DUGA 1XWGA 2FD3A 3MIXA 2VLTA 3EURA 5BRTA 3DRNA 3KH7A 3TGZA 3TRXA 3UARA 2NTOA 1V9WA 3ERFA 1G0TA 3NZNA 3W8JA 3KP9A 4AJ6A 1EOGA 5H5QA 3ZYWA 1Q98A 3TCOA 1K0NA 3ZFBA 1WRYA 2LV3A 3VWVA 3I69A 3F3RA 4IP6A 3F4TA 1X9MB 4G9HA 4EDYA 4G0IA 1SKSB 1EEMA 4USSA 1ERTA 4GSTA 4Z2TA 2V1MA 3ERGA 3TDGA 1B48A 4KCAA 3WGEA 3TJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PQN A;  3TKQ A;  1U87 A;  4WXT A;  1E2Y A;  3FR3 A;  1J08 A;  1X5E A;  2B5E A;  4HZ2 A;  5D9V A;  1GUK A;  1GP1 A;  2F8A A;  5GAP D;  3QD9 A;  4ZIJ A;  3N5O A;  2E0Q A;  3RBT A;  4V2M A;  1AQV A;  1URM A;  2C4J A;  3DVX A;  4CW9 A;  3UBL A;  2V6K A;  2GGT A;  1SL1 B;  3TKS C;  3GTU B;  4MJE A;  1GSU A;  5ENU A;  1QMV A;  2R2J A;  3UIW A;  3ZRD A;  1TRS A;  2HNL A;  3EE2 A;  1VGL A;  2X64 A;  4KCE A;  3HCZ A;  4I97 A;  5B7C A;  14GS A;  3RPP A;  2MYG A;  1QFN A;  1GTI A;  1FVJ A;  2QGV A;  4OFM A;  4BWQ A;  3VUR A;  1LJR A;  5FWG A;  1ERW A;  2C3T A;  1V98 A;  4E8H A;  3A2V A;  4IJ3 A;  4LL1 B;  2HSY A;  5J5N A;  2YPM A;  3IR4 A;  3D0Z A;  1IYI A;  2XHF A;  3EVI A;  4KAE A;  1X5C A;  2DJ0 A;  2VM1 A;  4TR0 A;  2JU5 A;  1OC3 A;  2BTO T;  5IPG A;  1DSB A;  2ZCT A;  3UVT A;  1Z3E A;  2OE3 A;  4ML1 A;  2O85 A;  1S3A A;  2RUE A;  1VF1 A;  4HU9 A;  4NWY A;  4F0C A;  1QK8 A;  4IJI A;  1UC7 A;  3GRX A;  2WDU A;  4ZBB A;  1EEJ A;  3VLN A;  1OE8 A;  1B8X A;  2WGR A;  3KGK A;  3GKM A;  2VLU A;  1FVK A;  2DSA A;  2GTU A;  1FAA A;  1A24 A;  2LST A;  2MZC A;  1N2A A;  5G30 A;  1AW9 A;  4IS0 A;  2I9H A;  1M9B A;  2B5Y A;  5IQY A;  3F63 A;  3P7X A;  3UAP A;  3QFA C;  5A4U A;  3RPN A;  4TR4 A;  2HI7 A;  2B7K A;  2Z9S A;  4BVY A;  3FEU A;  4OWY A;  2YZH A;  1T7P B;  3HVX A;  1K0B A;  4NHW A;  2B7J A;  3WYW A;  4KB3 A;  3Q19 A;  1HNB A;  3FR6 A;  2CAI A;  8GSS A;  20GS A;  3ME7 A;  4PX1 A;  4FH8 A;  3VWW A;  2P0G A;  1O73 A;  1BQ7 A;  1K0C A;  3HZ4 A;  1ZMA A;  4OFT A;  5HR1 A;  2RII A;  4CHS A;  3NOF A;  4KSM A;  2C0F A;  1AQW A;  1OC8 A;  4GQF A;  2PER A;  3A2X A;  4N11 A;  1IYH A;  5JCW A;  4NPB A;  3APO A;  4HJM A;  1X9W B;  1I5G A;  4ISD A;  2O87 A;  1SYR A;  5J4U A;  2MMO A;  2DIZ A;  4XIH A;  1NHY A;  11GS A;  1SD9 A;  1HNA A;  3APQ A;  3EC3 A;  1ZCP A;  2DMM A;  2C0E A;  3M0F A;  4DSR A;  3UL3 A;  3KTL A;  4WBJ A;  1TW9 A;  4I2T A;  4K9Z A;  4V1A p;  2DC5 A;  4XHM A;  3GX0 A;  4WKW A;  3L78 A;  4KA0 A;  5KN1 A;  6GSS A;  4MZC A;  2VO4 A;  3HVV A;  1GTB A;  3HD5 A;  2VL3 A;  4IEL A;  2GDR A;  3C73 A;  4YQU A;  1XCC A;  3I6A A;  2LJK A;  4MF6 A;  3J7Y b;  1F6M C;  3ED3 A;  3IRA A;  5KN0 A;  4HEA 2;  2PU9 C;  4MZW A;  3N9J A;  1F9M A;  4Q5F A;  3DEX A;  3HZ8 A;  3KMO A;  1XBS A;  3H4K A;  5ECI B;  1XWC A;  1XWA A;  3EU4 A;  4XCS A;  2AB6 A;  2NVL A;  3QOU A;  1MD4 A;  2X8C A;  1YKA A;  2DJ3 A;  5E4W A;  4YQV A;  2GT5 A;  2XPE A;  1V40 A;  3DIE A;  3O76 A;  4CDO A;  2GQM A;  4TXV A;  4TRX A;  3DXB A;  1YJ6 A;  4KDY A;  3FYG A;  4QL7 A;  5JWQ B;  5IMC A;  4O7H A;  5GST A;  1WWJ A;  4JR6 A;  4ECI A;  1SD8 A;  1MEK A;  1GUM A;  1JZR A;  2VD0 A;  4MF5 A;  4ECB A;  1Z6N A;  2L4C A;  5ECO B;  1MDI A;  10GS A;  2OAC A;  1OE7 A;  1AXD A;  4MPG A;  5ID2 B;  1QXH A;  2QKE A;  2LRT A;  2X8G A;  3GN3 A;  3RHC A;  4Q5N A;  3CSI A;  4YH2 A;  1FG4 A;  2CVB A;  4HI7 A;  5D8I A;  2G2Q A;  1E6B A;  3F4S A;  2K8V A;  3LGC A;  2LEG A;  1H4O A;  4KSO A;  2H6Y A;  3BJ5 A;  2N5A A;  4FYU A;  3UBK A;  1XOA A;  1PMT A;  2R6K A;  4OFN A;  3TJK A;  5CRH A;  3GMF A;  5LCZ A;  4TW5 A;  3DML A;  4XS4 B;  2MBT A;  1TU8 A;  2M46 A;  2CQ9 A;  5IMD A;  4EL1 A;  5G2Z A;  19GS A;  1A0R P;  1UA5 A;  4I5Q A;  1ACV A;  5DJM A;  3KEB A;  3QDN A;  1J0F A;  2LRN A;  3FZ4 A;  4L5O A;  4ZB6 A;  4X1U A;  4IVF A;  2X8H A;  1ZZY A;  3IBH A;  3K8N A;  2VIM A;  4EO3 A;  2LQQ A;  4L5L A;  3CSH A;  3CYN A;  3D22 A;  4TKY A;  2OBK A;  3H93 A;  4K6X A;  5J9B A;  1T4Z A;  5ECH B;  3IAS 2;  5L71 A;  4LA1 A;  1XIY A;  1AIU A;  4OMV A;  1A8Y A;  4JBB A;  4YQM A;  4JR4 A;  1OVN A;  1FHE A;  3FY7 A;  2TIR A;  4Q5R A;  4PNG A;  2E2M A;  1TTZ A;  2L59 A;  5CP1 A;  1M9A A;  2F9S A;  3GNJ A;  3DWV A;  2OBI A;  4MH3 A;  1XWB A;  2WCI A;  2PN8 A;  4K0N A;  4DSS A;  4HU7 A;  1H75 A;  4PQI A;  1QQ2 A;  5AIS A;  1TK5 B;  5JWO B;  1YF0 A;  3QAV A;  1OYJ A;  1YEX A;  4IHU A;  4DSS B;  2VUP A;  2CZ3 A;  2F8F A;  2H1A A;  5JCG A;  1B4P A;  17GS A;  3A5W A;  3AY8 A;  5GSS A;  3E0U A;  2HSH A;  1UVZ A;  1PKZ A;  1MTC A;  4HS1 A;  9GSS A;  2CX3 A;  1M99 A;  4FYC A;  4NAX A;  4RI6 A;  5IPH A;  2JAD A;  3DGQ A;  1X0R A;  2P5R A;  2NPB A;  5CNW A;  2HZF A;  5ECQ B;  4AJ8 A;  5G1K A;  2X99 A;  3QCP A;  2GST A;  2YV9 A;  5EY6 A;  2PMT A;  2B6M A;  3LOR A;  5EL8 A;  2JSY A;  1T00 A;  2H73 A;  1U3I A;  1V58 A;  4WBR D;  4JED A;  4ECC A;  2B3S A;  3FKF A;  3IC4 A;  1TRW A;  3PH9 A;  2C1Y A;  3KD0 A;  3DKS A;  4K2D A;  1ERV A;  1NM3 A;  1XFL A;  3RAZ A;  3DYR A;  1X9S B;  2H19 A;  4L8E A;  3TJB A;  1BAY A;  5CRW A;  4IGJ A;  1A2M A;  5JCU A;  4ZXG A;  3WT2 A;  1SK2 A;  1YKC A;  4MAB A;  1QUW A;  5DCH A;  5G31 A;  1SKW B;  4N30 A;  5IM9 A;  3ISO A;  2JZR A;  4F0B A;  3MNG A;  3WGX A;  2AUV A;  3G9B A;  1ZL9 A;  4EUY A;  1XW5 A;  4WF5 A;  3VI5 A;  5KN2 A;  1PL1 A;  3FZ9 A;  5D9X A;  4MJB A;  3LXT A;  3KM6 A;  4GXZ A;  2V6O A;  4FIW A;  1SK1 A;  2LS5 A;  3H79 A;  22GS A;  3IPZ A;  3I43 A;  4N0Z A;  3IAM 2;  3HYP A;  1JFU A;  2H66 A;  3OR5 A;  4TOP A;  2AV4 A;  3V1W A;  4GLT A;  3P2A A;  2WZ9 A;  4K8M A;  3TKS E;  1O8W A;  1EP8 A;  1GSF A;  2P31 A;  5AN1 A;  4EKZ A;  3L4N A;  2VL2 A;  1JZD A;  3BCK A;  1WIK A;  2DIY A;  1V2A A;  4O92 A;  3MWH A;  1XW6 A;  2JZT A;  4NXI A;  3L9V A;  4L0U A;  4AJ7 A;  1G6W A;  4OCF A;  4OO5 A;  5C00 A;  5B6M A;  1Q4J A;  1JHB A;  2XPD A;  4EVM A;  1EP7 A;  4ZIL A;  4GSN A;  2L6C A;  2HRF A;  4RUV A;  3G7I A;  4LMW A;  5HQP A;  5IOX A;  1A23 A;  2HT9 A;  4ML6 A;  1YY7 A;  3H1N A;  3GKX A;  2HE3 A;  5ECN B;  1N8J A;  4J56 E;  3UEM A;  1HNC A;  5DBQ A;  1SL2 B;  2R37 A;  4HOJ A;  5GZZ B;  1FW1 A;  2LQO A;  1OC9 A;  2LKU A;  5D93 A;  4D73 A;  6GSU A;  2EC4 A;  3L0H A;  4TXO A;  3GL5 A;  1O85 A;  4EXJ A;  1YZX A;  1RQM A;  3PR8 A;  1OC9 B;  3A3T A;  3HXS A;  4D73 B;  3HY2 A;  2XBQ A;  3LQ7 A;  4MCU A;  4TXO B;  3F8U A;  1JZO A;  4KGI A;  2ALB A;  1BX9 A;  5DQS A;  2H0G A;  4JRR A;  4OO4 A;  4WF4 A;  4E8E A;  2HLS A;  1BJX A;  1GTA A;  2H0I A;  1GSS A;  2H71 A;  3LFL A;  1CQG A;  3TB2 A;  16GS A;  2KOK A;  4POL A;  2H1G A;  2JAC A;  4ZB8 A;  2A2S A;  2YJ7 A;  3CTG A;  5F8B A;  2IWT A;  1BED A;  1MDJ A;  2GLR A;  3ZTL A;  5F0G A;  4IW9 A;  5JWR B;  1XVW A;  1TJD A;  2L5L A;  3KTB A;  2RM6 A;  2CVK A;  2P5Q A;  5KN3 A;  3ERW A;  1SJ6 A;  1GRX A;  2C0D A;  4QQ7 A;  4KND A;  2AYT A;  2LTK A;  3VPT A;  1M2D A;  2WJU A;  2H8L A;  1PN9 A;  2YOI A;  2ZNM A;  3IK9 A;  3BCI A;  3LYP A;  1BYE A;  2JSZ A;  2VCT A;  2YWM A;  4GWR A;  2CZ2 A;  4MF7 A;  5FT3 A;  2FA4 A;  5E59 A;  2MBS A;  7GSS A;  2V41 A;  3C1S A;  2YWN A;  3MSZ A;  4EF0 A;  2H1B A;  5DAL A;  4PQH A;  3QAW A;  2DLX A;  4LLR A;  1W89 A;  5J9C A;  4TR1 A;  5DAL B;  3RHB A;  4XRA A;  2IL3 A;  1RW1 A;  1Z7P A;  5IMV A;  1PSQ A;  1HYU A;  2AAW A;  3TUE A;  2REM A;  1EGR A;  4PXO A;  3GH9 A;  4F82 A;  4IP1 A;  1GH2 A;  1O7U A;  5GAN D;  4HQZ A;  1PRX A;  3VWU A;  3HA9 A;  2F3M A;  1A2L A;  1THX A;  2FNO A;  2EIO A;  3PGT A;  3APS A;  2XC2 A;  4KW6 A;  3WGD A;  1VF4 A;  1V57 A;  3UVH A;  1GNW A;  4G19 A;  3TJG A;  3SWL A;  3Q18 A;  2PBJ A;  2GSS A;  2WB9 A;  6GSV A;  1SYX A;  2PVQ A;  3F3Q A;  4WR4 A;  5J41 A;  2IMF A;  5DDL A;  4F2I A;  1PL2 A;  2VCX A;  5CRD A;  4MZB A;  6GSY A;  5COH A;  4TR3 A;  2IME A;  2OAD A;  1SJZ A;  3LYK A;  2AHE A;  3C8E A;  1YEP A;  3FZA A;  2FWG A;  3QFB C;  4HUA A;  1SJI A;  1Y25 A;  3FR9 A;  4ULX A;  1EV9 A;  5HR0 A;  5CRE A;  1WJK A;  1XPV A;  4YAP A;  5EVO A;  1TK8 B;  1K3L A;  4I8B A;  4N10 A;  2TRX A;  3KMN A;  4XRD A;  1ML6 A;  1XWK A;  1A8L A;  4I6X A;  2L57 A;  5HR3 A;  2LNS A;  2A4V A;  2HYX A;  3TJJ A;  2O8V B;  2YWI A;  4V2N A;  2GS3 A;  4MH2 A;  4MJC A;  5ECS A;  1J9B A;  2GZP A;  3KCM A;  2HRN A;  1USB A;  1GL8 A;  3BD2 A;  2A2R A;  2WRT A;  1ERU A;  4RQX A;  4MLY A;  3ZMK A;  1M7T A;  2H72 A;  3S9F A;  4ID0 A;  3P90 A;  1FOV A;  2CX4 A;  1XW9 A;  2E2G A;  1OAZ A;  4BPY A;  2M72 A;  2NDO A;  2C80 A;  2KUC A;  5ECL B;  3GFK A;  5HFK A;  3VFI A;  3GST A;  3KZQ A;  2FHE A;  3PIN A;  4HZ4 A;  2GSQ A;  4TVE A;  2VOC A;  2YV7 A;  3Q74 A;  2L6D A;  1NHO A;  3QR6 A;  1GSQ A;  1TI3 A;  3IK7 A;  2XBI A;  3L9U A;  4V2L A;  3CMI A;  4KX4 A;  2YWO A;  1KBN A;  3EYT A;  5LNK e;  3DVW A;  5CYY A;  3LSZ A;  3CTF A;  1SU9 A;  4BL7 A;  1ZGN A;  4LMV A;  4ZBA A;  3GYK A;  2R4V A;  1U6T A;  3EWL A;  3ZFL A;  5B6N A;  2IN3 A;  4ECJ A;  2GQL A;  3ZZX A;  2YN1 A;  4K7O A;  5IMF A;  3CBU A;  1G6Y A;  5D9W A;  2ON5 A;  1GSY A;  3FW2 A;  2WFC A;  2MMA A;  4ZL7 A;  4J2F A;  3BBY A;  2FA8 A;  1O81 A;  1PX6 A;  2FUG 2;  3ZML A;  2YP6 A;  4WR5 A;  2I3Y A;  4JZQ A;  1SEN A;  2VCQ A;  1TK0 B;  3E9J B;  1F3A A;  1T3B A;  3GKK A;  3IA1 A;  1U3A A;  3KH9 A;  3M1G A;  5IO0 A;  4GCI A;  2KHP A;  2ON7 A;  4IQ1 A;  5H5R A;  1G7E A;  5D9T A;  4Z7X A;  2F51 A;  2H76 A;  4F03 A;  4PQ1 A;  3QAG A;  4KH7 A;  3RDW A;  5IIZ A;  1LU4 A;  4MA9 A;  2V32 A;  1HQO A;  4XS1 A;  1EOH A;  3ZRE A;  2FWF A;  2CA8 A;  4ACS A;  4KDX A;  5FHI A;  1EV4 A;  2OE0 A;  3M3M A;  5KEJ A;  3C71 A;  3LEF A;  1B4Q A;  2CAQ A;  5ABR A;  2LRC A;  2GQK A;  3UMA A;  4GRF A;  5A4V A;  1SKR B;  1XOB A;  4X0X A;  2N5F A;  3EMP A;  2QSI A;  4KUN A;  1R5P A;  1OKT A;  2M80 A;  1EZK A;  1ZYE A;  4PUA A;  3CSJ A;  1ST9 A;  1Z6M A;  5EPF A;  2CT6 A;  3ZIJ A;  4NV2 A;  4GTU A;  1PKW A;  1TKD B;  4K7N A;  2K8S A;  3GHA A;  2H75 A;  1DE2 A;  2JL4 A;  3JCM L;  4WET A;  1Z5Y E;  3HVS A;  5ECK B;  1TRU A;  2YZU A;  1T4Y A;  2I81 A;  3GL3 A;  4MK3 A;  1SK0 A;  3GX8 A;  1DBY A;  4P3Y B;  5DJL A;  2FY6 A;  3GIX A;  1K3O A;  2VL2 C;  2DJJ A;  1A0F A;  4IQA A;  1MDK A;  2IJY A;  4K0G A;  4LL4 B;  1KTE A;  2VAF A;  3NIV A;  4JU5 A;  3GTU A;  2ES7 A;  3D21 A;  2VCV A;  4RI7 A;  5ECR B;  5F05 A;  1ZYQ B;  4POM A;  1NSW A;  3M8N A;  1S3C A;  2V2G A;  5ECM B;  4O5R A;  3IV4 A;  3LXZ A;  1WOU A;  1F2E A;  3ME8 A;  3MDK A;  2MMN A;  1G7O A;  1QGV A;  3GUS A;  1XZO A;  1YQ1 A;  2BMX A;  3W6G A;  2K6V A;  4WEY A;  1AC1 A;  4H86 A;  2FWE A;  3W8S A;  3TKS A;  2YAN A;  3HKR A;  2PWJ A;  1X5D A;  2R3X A;  3TOU A;  2R5G A;  4PUF C;  4HQS A;  3KP8 A;  3ZLP A;  2WUL A;  3CRT A;  2L5O A;  2GSR A;  3GH6 A;  3HJM A;  3O6T A;  1XXU A;  1Z9H A;  6GSW A;  4NV5 A;  3ZVJ D;  5ELA A;  2N5B A;  3F6F A;  4K7I A;  3US3 A;  2IPA A;  6GST A;  1GLP A;  2H01 A;  4MJA A;  1THO A;  2PVO C;  4PGT A;  5H5S A;  2H0H A;  4HDE A;  5IMZ A;  1ON4 A;  1O8X A;  2C0G A;  3D6I A;  2VCW A;  1S3D A;  1WP0 A;  5HR2 A;  2WS2 A;  2I4A A;  2GVP A;  3G7Y A;  4MP4 A;  4XTS A;  3J7Y k;  1T1V A;  1K0D A;  5HFI A;  3TKR A;  1GUH A;  2MMZ A;  3FHK A;  4BWS A;  4NHZ A;  3TOT A;  1M0U A;  1JZW A;  1XVQ A;  1K0O A;  1U88 A;  2IMK A;  1B9X C;  3KIJ A;  3IHQ A;  1T8E B;  4AGS A;  1UN2 A;  3C1R A;  4GF0 A;  1JLV A;  2B1K A;  1K3Y A;  3WT1 A;  1Y6E A;  3EMX A;  4BVX A;  2C8U A;  4N0V A;  1JLW A;  1GLQ A;  2DJ2 A;  3F9U A;  1GNE A;  4KE3 A;  2HFD A;  3C7M A;  2RUF A;  3KXO A;  5LD0 A;  1GUL A;  3D4M A;  4XS6 A;  2OE1 A;  13GS A;  1KNG A;  4EE0 A;  3HJP A;  3G7J A;  3HJO A;  1YDK A;  3F4R A;  1KEB A;  1TDI A;  3VK9 A;  2VM2 A;  3GSS A;  3L9S A;  1TI1 A;  3D5J A;  1PD2 1;  3P8W A;  1W4V A;  3GV1 A;  4GQC A;  2VD1 A;  4TN8 A;  5DAK A;  2BJX A;  1I9D A;  2PPT A;  2OKA A;  5DAK B;  4G2E A;  2ZUP A;  2TRC P;  2IFQ A;  2PUK C;  3ZVJ A;  3CXG A;  6GSX A;  5F06 A;  5G5F A;  1WPI A;  2IIY A;  3IE3 A;  4EDZ A;  1GTU A;  1MD3 A;  2IFQ B;  3GKN A;  1FO5 A;  2FGX A;  1GWC A;  1PA3 A;  1R5A A;  4TR1 B;  1FB0 A;  1M2B A;  4MDC A;  5CRG A;  4POK A;  2E7P A;  4YAV A;  2K9F A;  4OD7 A;  4I2U A;  2DBC A;  5CAX A;  1PX7 A;  2DJK A;  2GT6 A;  4V1A g;  5B8B A;  2DML A;  2RLI A;  3TRQ A;  3D4T A;  3LWA A;  3VI7 A;  4PNF A;  3UJ1 A;  1GSD A;  18GS A;  3U6V A;  1GSE A;  2J9H A;  1NW2 A;  2QC7 A;  3IXR A;  2FLS A;  1WE0 A;  3FZ5 A;  2H74 A;  2LJR A;  3MAK A;  1AQX A;  3SBC A;  3EU3 A;  1EWX A;  3H8Q A;  2KP2 A;  1K0M A;  3LJR A;  5A4W A;  2IMI A;  5G1L A;  3VWX A;  1WMJ A;  4HJ2 A;  2O89 A;  1RK4 A;  4IKH A;  3QPM A;  5D73 A;  2H70 A;  4FO5 A;  1OKD A;  3KJY A;  4QL9 A;  4F9Z A;  2VL9 A;  5CO3 A;  2L4Q A;  4IBP A;  2RM5 A;  3TRP A;  3QMX A;  4ZBD A;  2B1L A;  1R7H A;  3IDV A;  3I9V 2;  2PGT A;  3U5R E;  5A5K A;  1VF3 A;  2YNX A;  1Z7R A;  2LJA A;  1VRS D;  1M2A A;  1TOF A;  1AAZ A;  1EGO A;  2H6Z A;  4GSS A;  1O6J A;  5ID2 A;  1AUC A;  5C04 A;  2D2Z A;  2H1D A;  3BOA A;  1TU7 A;  5AIV A;  5AIX A;  2FWH A;  1R26 A;  1TRV A;  1ABA A;  4ILF A;  3EIN A;  4ZB9 A;  4ZL9 A;  4DEJ A;  2JZS A;  2LUS A;  4K1F A;  3ZIV A;  4EC0 A;  4PUR A;  3ZIT A;  4MMM A;  2VLV A;  1B9Y C;  4G10 A;  2YJH A;  5IOW A;  2YCD A;  1TXX A;  2K18 A;  1HD2 A;  1R4W A;  4Q5Q A;  2H6X A;  5G5E A;  4DSQ A;  2CV4 A;  2GZY A;  2C3N A;  3FK8 A;  4XS4 A;  2GZZ A;  2HXK A;  4FYB A;  3IOS A;  1PGT A;  5HFG A;  3VPQ A;  2IMD A;  2C3Q A;  2KP1 A;  3HHV A;  4L0W A;  3FRC A;  1YF1 A;  4POB A;  4O32 A;  5D96 A;  2O7K A;  3LG6 A;  3R2Q A;  4BA7 A;  5DVB A;  2AJQ B;  1DE1 A;  5ELG A;  1F37 A;  4DVC A;  2I1U A;  3DD3 A;  1VF2 A;  4RQR A;  3HDC A;  5IMA A;  2NBS A;  3Q6O A;  1TP9 A;  2VCZ A;  1FB6 A;  1ZOF A;  3TKP A;  2HZE A;  1CQH A;  1C72 A;  1K0A A;  3A2W A;  2HZE B;  5AGY A;  4J57 E;  3F0I A;  2LNT A;  2EIR A;  5IO2 A;  3O3T A;  1A2J A;  2KLX A;  2J23 A;  2H30 A;  4NMU A;  4X43 A;  1SL0 B;  3E3E A;  3GA4 A;  5INY A;  4AF2 A;  3CRU A;  2OJL A;  4MPF A;  5DCG A;  1F3B A;  2EIQ A;  1BG5 A;  3M9K A;  4ZL8 A;  5F07 A;  4IN0 A;  1ILO A;  2OA7 A;  5J3R A;  3ZL5 A;  4JE1 A;  3UOM A;  5ECP B;  12GS A;  2CVD A;  5B8A A;  2B5X A;  5DQY A;  2FCH A;  3M9J A;  4OCE A;  2DJ1 A;  1LBK A;  3GUR A;  3WD6 A;  4KDU A;  3F6D A;  2G0F A;  1DUG A;  1XWG A;  2FD3 A;  2VLT A;  3EUR A;  3DRN A;  3KH7 A;  3TGZ A;  3TRX A;  3UAR A;  2NTO A;  1V9W A;  3ERF A;  1G0T A;  3NZN A;  3W8J A;  3KP9 A;  4AJ6 A;  1EOG A;  5H5Q A;  3ZYW A;  1Q98 A;  3TCO A;  1K0N A;  3ZFB A;  1WRY A;  2LV3 A;  3VWV A;  3I69 A;  3F3R A;  4IP6 A;  3F4T A;  1X9M B;  4G9H A;  4EDY A;  1SKS B;  1EEM A;  1ERT A;  4GST A;  2V1M A;  3ERG A;  3TDG A;  1B48 A;  4KCA A;  3WGE A;  3TJF A; 
#chains in the Genus database with same CATH topology
 1PQN A;  3TKQ A;  1U87 A;  4WXT A;  1E2Y A;  3FR3 A;  1J08 A;  1X5E A;  2B5E A;  4HZ2 A;  5D9V A;  1GUK A;  1GP1 A;  2F8A A;  5GAP D;  3QD9 A;  4ZIJ A;  3N5O A;  2E0Q A;  3RBT A;  4V2M A;  1AQV A;  1URM A;  2C4J A;  3DVX A;  4CW9 A;  3UBL A;  2V6K A;  2GGT A;  1SL1 B;  3TKS C;  3GTU B;  4MJE A;  1GSU A;  5ENU A;  1QMV A;  2R2J A;  3UIW A;  3ZRD A;  2DKH A;  1TRS A;  2HNL A;  3EE2 A;  1VGL A;  2X64 A;  4KCE A;  1FOH A;  3HCZ A;  4I97 A;  5B7C A;  14GS A;  3RPP A;  2MYG A;  1QFN A;  1GTI A;  1FVJ A;  2QGV A;  4OFM A;  4BWQ A;  3VUR A;  1LJR A;  5FWG A;  1ERW A;  2C3T A;  1V98 A;  4E8H A;  3A2V A;  4IJ3 A;  4LL1 B;  2HSY A;  2QA2 A;  2YPM A;  5J5N A;  3IR4 A;  3D0Z A;  1IYI A;  2XHF A;  3EVI A;  4KAE A;  1X5C A;  2DJ0 A;  2VM1 A;  4TR0 A;  2JU5 A;  1OC3 A;  2BTO T;  5IPG A;  1DSB A;  2ZCT A;  3UVT A;  1Z3E A;  2OE3 A;  4ML1 A;  2O85 A;  1S3A A;  2RUE A;  1VF1 A;  4HU9 A;  4NWY A;  4F0C A;  1QK8 A;  4IJI A;  1UC7 A;  3GRX A;  2WDU A;  4ZBB A;  1EEJ A;  3VLN A;  1OE8 A;  1B8X A;  2WGR A;  3KGK A;  3GKM A;  2VLU A;  1FVK A;  2DSA A;  2GTU A;  1FAA A;  1A24 A;  4FQU A;  2LST A;  2MZC A;  1N2A A;  5G30 A;  1AW9 A;  4IS0 A;  2I9H A;  1M9B A;  2B5Y A;  5IQY A;  3F63 A;  3P7X A;  3UAP A;  3QFA C;  5A4U A;  3RPN A;  4TR4 A;  2HI7 A;  2B7K A;  2Z9S A;  4BVY A;  3FEU A;  4OWY A;  2YZH A;  1T7P B;  3HVX A;  1K0B A;  4NHW A;  2B7J A;  3WYW A;  4KB3 A;  3Q19 A;  1HNB A;  3FR6 A;  2CAI A;  8GSS A;  20GS A;  3ME7 A;  4PX1 A;  4FH8 A;  3VWW A;  2P0G A;  1O73 A;  1BQ7 A;  1K0C A;  3HZ4 A;  1ZMA A;  4OFT A;  5HR1 A;  2RII A;  4CHS A;  3NOF A;  4KSM A;  2C0F A;  1AQW A;  1OC8 A;  4GQF A;  2PER A;  3A2X A;  4N11 A;  1IYH A;  5JCW A;  4NPB A;  3APO A;  4HJM A;  1X9W B;  1I5G A;  4ISD A;  2UZ8 A;  2O87 A;  1SYR A;  5J4U A;  2MMO A;  2DIZ A;  4XIH A;  1NHY A;  11GS A;  1SD9 A;  1HNA A;  3APQ A;  3EC3 A;  1ZCP A;  2DMM A;  2C0E A;  3M0F A;  4DSR A;  3UL3 A;  3KTL A;  4WBJ A;  2HRA A;  1TW9 A;  4I2T A;  4K9Z A;  4V1A p;  2DC5 A;  4XHM A;  3GX0 A;  4WKW A;  3L78 A;  4KA0 A;  5KN1 A;  6GSS A;  4MZC A;  2VO4 A;  3HVV A;  1GTB A;  3HD5 A;  2VL3 A;  4IEL A;  2GDR A;  3C73 A;  4YQU A;  1XCC A;  3I6A A;  2LJK A;  4MF6 A;  3J7Y b;  1F6M C;  3ED3 A;  3IRA A;  5KN0 A;  4HEA 2;  2PU9 C;  4MZW A;  3N9J A;  1M3I A;  1F9M A;  4Q5F A;  3DEX A;  3HZ8 A;  3KMO A;  4ICY A;  1XBS A;  3H4K A;  5ECI B;  1XWC A;  1XWA A;  3EU4 A;  4XCS A;  2AB6 A;  2NVL A;  3QOU A;  1MD4 A;  2X8C A;  1YKA A;  2DJ3 A;  5KOW A;  5E4W A;  4YQV A;  4HSC X;  2GT5 A;  2XPE A;  4YKG A;  1V40 A;  3DIE A;  3O76 A;  4K5S A;  4CDO A;  2GQM A;  4TXV A;  4TRX A;  3DXB A;  1YJ6 A;  4KDY A;  3FYG A;  4QL7 A;  5JWQ B;  5IMC A;  4O7H A;  1ZYN A;  5GST A;  1WWJ A;  4JR6 A;  4ECI A;  1SD8 A;  1MEK A;  1GUM A;  1JZR A;  2VD0 A;  4MF5 A;  4ECB A;  1Z6N A;  2L4C A;  5ECO B;  1MDI A;  10GS A;  2OAC A;  1OE7 A;  1AXD A;  4MPG A;  5ID2 B;  1QXH A;  2QKE A;  2LRT A;  2X8G A;  3GN3 A;  3RHC A;  4Q5N A;  3CSI A;  4YH2 A;  1FG4 A;  2CVB A;  4HI7 A;  5D8I A;  2G2Q A;  1E6B A;  3F4S A;  2K8V A;  3LGC A;  2LEG A;  1H4O A;  4KSO A;  2H6Y A;  3BJ5 A;  2N5A A;  4FYU A;  3UBK A;  1XOA A;  1PMT A;  2R6K A;  4OFN A;  3TJK A;  5CRH A;  3GMF A;  5LCZ A;  4TW5 A;  3DML A;  4XS4 B;  2MBT A;  1TU8 A;  2M46 A;  2CQ9 A;  5IMD A;  4EL1 A;  5G2Z A;  19GS A;  1A0R P;  1UA5 A;  4I5Q A;  1ACV A;  5DJM A;  3KEB A;  3QDN A;  1J0F A;  2LRN A;  3FZ4 A;  4L5O A;  4ZB6 A;  4X1U A;  4IVF A;  2X8H A;  1ZZY A;  3IBH A;  3K8N A;  2VIM A;  4EO3 A;  2LQQ A;  4L5L A;  3CSH A;  3CYN A;  3D22 A;  4TKY A;  2OBK A;  3H93 A;  4K6X A;  5J9B A;  1T4Z A;  5ECH B;  3IAS 2;  5L71 A;  4LA1 A;  1XIY A;  1AIU A;  4OMV A;  1A8Y A;  4JBB A;  4YQM A;  4JR4 A;  1OVN A;  1FHE A;  3FY7 A;  2TIR A;  4Q5R A;  4PNG A;  2E2M A;  1TTZ A;  2L59 A;  5CP1 A;  1M9A A;  2A2P A;  2F9S A;  3GNJ A;  3DWV A;  2OBI A;  4MH3 A;  1XWB A;  2WCI A;  2PN8 A;  4K0N A;  4DSS A;  4HU7 A;  1H75 A;  4PQI A;  1QQ2 A;  5AIS A;  1TK5 B;  5JWO B;  1YF0 A;  3QAV A;  1OYJ A;  1YEX A;  4IHU A;  2X4A A;  4DSS B;  2VUP A;  2CZ3 A;  2F8F A;  4CY6 A;  2H1A A;  5JCG A;  1B4P A;  17GS A;  3A5W A;  3AY8 A;  5GSS A;  3E0U A;  2HSH A;  1UVZ A;  1PKZ A;  1MTC A;  4HS1 A;  9GSS A;  2CX3 A;  1M99 A;  4FYC A;  4NAX A;  4RI6 A;  5IPH A;  2JAD A;  3DGQ A;  1X0R A;  2P5R A;  2NPB A;  5CNW A;  2HZF A;  5ECQ B;  4AJ8 A;  5G1K A;  2X99 A;  3QCP A;  2GST A;  1PN0 A;  2YV9 A;  5EY6 A;  2PMT A;  2B6M A;  3LOR A;  5EL8 A;  2JSY A;  1T00 A;  2H73 A;  1U3I A;  1V58 A;  4WBR D;  4JED A;  4ECC A;  2B3S A;  3FKF A;  3IC4 A;  1TRW A;  3PH9 A;  2C1Y A;  3KD0 A;  3DKS A;  4K2D A;  1ERV A;  1NM3 A;  1XFL A;  3RAZ A;  3DYR A;  1X9S B;  2H19 A;  4L8E A;  3TJB A;  1BAY A;  5CRW A;  4IGJ A;  1A2M A;  1S3R A;  5JCU A;  4ZXG A;  3WT2 A;  1SK2 A;  1YKC A;  4MAB A;  1QUW A;  5DCH A;  5G31 A;  1SKW B;  4N30 A;  5IM9 A;  3ISO A;  2JZR A;  4F0B A;  3MNG A;  3WGX A;  2AUV A;  3G9B A;  1ZL9 A;  4EUY A;  1XW5 A;  4WF5 A;  3VI5 A;  5KN2 A;  1PL1 A;  3FZ9 A;  5D9X A;  4MJB A;  3LXT A;  3KM6 A;  4GXZ A;  2V6O A;  4FIW A;  1SK1 A;  2LS5 A;  3H79 A;  22GS A;  3IPZ A;  3I43 A;  4N0Z A;  3IAM 2;  3HYP A;  1JFU A;  2H66 A;  3OR5 A;  4TOP A;  2AV4 A;  3V1W A;  4GLT A;  3P2A A;  2WZ9 A;  4K8M A;  3TKS E;  1O8W A;  1EP8 A;  1GSF A;  2P31 A;  5AN1 A;  4EKZ A;  3L4N A;  2VL2 A;  1JZD A;  3BCK A;  1WIK A;  2DIY A;  1V2A A;  4O92 A;  3MWH A;  1XW6 A;  2JZT A;  4NXI A;  3L9V A;  4L0U A;  4AJ7 A;  1G6W A;  4OCF A;  4OO5 A;  5C00 A;  5B6M A;  1Q4J A;  4X4J A;  1JHB A;  2XPD A;  4EVM A;  1EP7 A;  4ZIL A;  4GSN A;  2L6C A;  2HRF A;  4RUV A;  3G7I A;  4LMW A;  5HQP A;  5IOX A;  1A23 A;  2HT9 A;  4ML6 A;  1YY7 A;  3H1N A;  3GKX A;  2HE3 A;  5ECN B;  3FMW A;  1N8J A;  4J56 E;  3UEM A;  1HNC A;  5DBQ A;  1SL2 B;  2R37 A;  4HOJ A;  5GZZ B;  1FW1 A;  2LQO A;  1OC9 A;  2LKU A;  5D93 A;  4D73 A;  6GSU A;  2EC4 A;  3L0H A;  4TXO A;  3GL5 A;  1O85 A;  4EXJ A;  1YZX A;  1RQM A;  3PR8 A;  1OC9 B;  3A3T A;  3HXS A;  4D73 B;  3HY2 A;  2XBQ A;  3LQ7 A;  4MCU A;  4TXO B;  3F8U A;  1JZO A;  4KGI A;  2ALB A;  1BX9 A;  5DQS A;  2H0G A;  4JRR A;  4OO4 A;  4WF4 A;  4E8E A;  2HLS A;  1BJX A;  1GTA A;  2H0I A;  2HRK A;  1GSS A;  2H71 A;  3LFL A;  1CQG A;  3TB2 A;  16GS A;  2R0C A;  2KOK A;  4POL A;  2H1G A;  2JAC A;  4CY8 A;  4ZB8 A;  2A2S A;  2YJ7 A;  3CTG A;  4BVY B;  5F8B A;  2IWT A;  5BMU A;  1BED A;  1MDJ A;  2GLR A;  3ZTL A;  5F0G A;  4IW9 A;  5JWR B;  1XVW A;  1TJD A;  2DKI A;  2L5L A;  3KTB A;  2RM6 A;  2CVK A;  2P5Q A;  5KN3 A;  3ERW A;  1SJ6 A;  1GRX A;  2R0G A;  2C0D A;  4QQ7 A;  4KND A;  2AYT A;  2LTK A;  3VPT A;  1M2D A;  2WJU A;  2H8L A;  1PN9 A;  4PTS A;  2YOI A;  2ZNM A;  3IK9 A;  3BCI A;  3LYP A;  1BYE A;  2JSZ A;  2VCT A;  2YWM A;  4GWR A;  2CZ2 A;  4MF7 A;  5FT3 A;  2FA4 A;  5E59 A;  2MBS A;  7GSS A;  2V41 A;  3C1S A;  2YWN A;  3MSZ A;  4EF0 A;  2H1B A;  5DAL A;  4PQH A;  3QAW A;  2DLX A;  4LLR A;  1W89 A;  5J9C A;  4TR1 A;  5DAL B;  3RHB A;  4XRA A;  2IL3 A;  1RW1 A;  1Z7P A;  5IMV A;  1PSQ A;  1HYU A;  2AAW A;  3TUE A;  2REM A;  1EGR A;  4PXO A;  3GH9 A;  4F82 A;  4IP1 A;  1GH2 A;  1O7U A;  1XG8 A;  5GAN D;  4HQZ A;  1PRX A;  3VWU A;  3HA9 A;  2F3M A;  1A2L A;  1THX A;  2FNO A;  2EIO A;  3PGT A;  3APS A;  2XC2 A;  4KW6 A;  3WGD A;  1VF4 A;  1V57 A;  3UVH A;  1GNW A;  4G19 A;  3TJG A;  4BIK A;  3SWL A;  3Q18 A;  2PBJ A;  2GSS A;  2WB9 A;  6GSV A;  1SYX A;  2PVQ A;  3F3Q A;  4WR4 A;  3MYD A;  5J41 A;  2IMF A;  5DDL A;  4F2I A;  1PL2 A;  2VCX A;  5CRD A;  4MZB A;  6GSY A;  2R0P A;  5COH A;  4TR3 A;  2IME A;  2OAD A;  1SJZ A;  3LYK A;  2AHE A;  3C8E A;  1YEP A;  3FZA A;  2FWG A;  3QFB C;  4HUA A;  1SJI A;  1Y25 A;  3FR9 A;  4ULX A;  1EV9 A;  5HR0 A;  5CRE A;  1WJK A;  1XPV A;  4EIP A;  4YAP A;  5EVO A;  1TK8 B;  1K3L A;  4I8B A;  4N10 A;  2TRX A;  3KMN A;  4XRD A;  1ML6 A;  1XWK A;  1A8L A;  4I6X A;  2L57 A;  5HR3 A;  2LNS A;  2A4V A;  2HYX A;  3TJJ A;  2O8V B;  2YWI A;  4V2N A;  2GS3 A;  4MH2 A;  4MJC A;  5ECS A;  1J9B A;  2GZP A;  3KCM A;  2HRN A;  1USB A;  1GL8 A;  3BD2 A;  2A2R A;  2WRT A;  1ERU A;  4RQX A;  4MLY A;  3ZMK A;  1M7T A;  2H72 A;  3S9F A;  4ID0 A;  3P90 A;  1FOV A;  2CX4 A;  1XW9 A;  2E2G A;  1OAZ A;  4BPY A;  2M72 A;  2NDO A;  2C80 A;  2KUC A;  5ECL B;  3CQF A;  3GFK A;  5HFK A;  3VFI A;  3GST A;  1ZYP A;  3KZQ A;  2FHE A;  3PIN A;  4HZ4 A;  2GSQ A;  4TVE A;  2VOC A;  2YV7 A;  3Q74 A;  2L6D A;  1NHO A;  3QR6 A;  1GSQ A;  1TI3 A;  3IK7 A;  2XBI A;  3L9U A;  4V2L A;  3CMI A;  4KX4 A;  2YWO A;  1KBN A;  3EYT A;  4EIQ A;  5LNK e;  3DVW A;  5CYY A;  3LSZ A;  3CTF A;  1SU9 A;  4BL7 A;  4Z2U A;  4Z2R A;  1ZGN A;  4LMV A;  4ZBA A;  3GYK A;  2R4V A;  1U6T A;  3EWL A;  3ZFL A;  5B6N A;  2IN3 A;  4BL7 B;  4ECJ A;  2GQL A;  3ZZX A;  2YN1 A;  4K7O A;  5IMF A;  3CBU A;  1G6Y A;  5D9W A;  2ON5 A;  1GSY A;  3FW2 A;  2WFC A;  2MMA A;  4ZL7 A;  4J2F A;  3BBY A;  2FA8 A;  1O81 A;  1PX6 A;  2FUG 2;  3ZML A;  2YP6 A;  3IHG A;  4WR5 A;  2I3Y A;  4JZQ A;  1SEN A;  2VCQ A;  1TK0 B;  3E9J B;  1F3A A;  1T3B A;  3GKK A;  3IA1 A;  1U3A A;  3PPU A;  3KH9 A;  3M1G A;  5IO0 A;  4GCI A;  2KHP A;  2ON7 A;  4IQ1 A;  5H5R A;  1G7E A;  5D9T A;  4Z7X A;  2F51 A;  2H76 A;  4F03 A;  1PFO A;  4PQ1 A;  3QAG A;  4KH7 A;  3RDW A;  5IIZ A;  1LU4 A;  4MA9 A;  2V32 A;  1HQO A;  4XS1 A;  1EOH A;  3ZRE A;  2FWF A;  2CA8 A;  4ACS A;  4KDX A;  5FHI A;  1EV4 A;  3EPT A;  2OE0 A;  3M3M A;  5KEJ A;  3C71 A;  3LEF A;  1B4Q A;  2CAQ A;  5ABR A;  2LRC A;  2GQK A;  3UMA A;  4GRF A;  5A4V A;  1SKR B;  1XOB A;  4X0X A;  2N5F A;  3EMP A;  2QSI A;  4KUN A;  1R5P A;  1OKT A;  2M80 A;  1EZK A;  1ZYE A;  4PUA A;  3CSJ A;  1ST9 A;  1Z6M A;  5EPF A;  2CT6 A;  3ZIJ A;  4NV2 A;  4GTU A;  1PKW A;  1TKD B;  4K7N A;  2K8S A;  3GHA A;  2H75 A;  1DE2 A;  2JL4 A;  3JCM L;  4WET A;  1Z5Y E;  3HVS A;  5ECK B;  1TRU A;  2YZU A;  1T4Y A;  2I81 A;  3GL3 A;  4MK3 A;  1SK0 A;  3GX8 A;  1DBY A;  4P3Y B;  5DJL A;  2FY6 A;  3GIX A;  3A5I A;  1K3O A;  2VL2 C;  2DJJ A;  1A0F A;  4IQA A;  1MDK A;  2IJY A;  4K0G A;  4LL4 B;  1KTE A;  2VAF A;  3NIV A;  4JU5 A;  1M3J A;  3GTU A;  2ES7 A;  3D21 A;  2VCV A;  4RI7 A;  5ECR B;  5F05 A;  1ZYQ B;  4POM A;  1NSW A;  3M8N A;  1S3C A;  2V2G A;  5ECM B;  4O5R A;  3IV4 A;  3LXZ A;  1WOU A;  1F2E A;  3ME8 A;  3MDK A;  2MMN A;  1G7O A;  1QGV A;  3GUS A;  1XZO A;  1YQ1 A;  2BMX A;  3W6G A;  2K6V A;  4WEY A;  1AC1 A;  4H86 A;  2FWE A;  3W8S A;  3TKS A;  2YAN A;  3HKR A;  2PWJ A;  1X5D A;  2R3X A;  3TOU A;  2R5G A;  4PUF C;  4YKF A;  4HQS A;  3KP8 A;  3ZLP A;  2WUL A;  3CRT A;  2L5O A;  2GSR A;  3GH6 A;  3HJM A;  3O6T A;  1XXU A;  1Z9H A;  6GSW A;  4NV5 A;  3ZVJ D;  5ELA A;  2N5B A;  3F6F A;  4K7I A;  3US3 A;  2IPA A;  6GST A;  1GLP A;  2H01 A;  4MJA A;  1THO A;  2PVO C;  4PGT A;  5H5S A;  2H0H A;  4HDE A;  5IMZ A;  1ON4 A;  1O8X A;  2C0G A;  3D6I A;  2VCW A;  1S3D A;  1WP0 A;  5HR2 A;  2WS2 A;  2I4A A;  2GVP A;  3G7Y A;  4MP4 A;  4XTS A;  3J7Y k;  1T1V A;  1K0D A;  5HFI A;  3TKR A;  1GUH A;  2MMZ A;  3FHK A;  4BWS A;  4NHZ A;  4G0K A;  3TOT A;  1M0U A;  1JZW A;  1XVQ A;  1K0O A;  1U88 A;  2IMK A;  1B9X C;  3KIJ A;  3IHQ A;  1T8E B;  4AGS A;  1UN2 A;  3C1R A;  4GF0 A;  1JLV A;  2B1K A;  4K5R A;  1K3Y A;  3WT1 A;  1Y6E A;  3EMX A;  4BVX A;  2C8U A;  4N0V A;  1JLW A;  1GLQ A;  2DJ2 A;  3F9U A;  1GNE A;  4KE3 A;  2HFD A;  3C7M A;  4BVX B;  2RUF A;  3KXO A;  5LD0 A;  1GUL A;  3D4M A;  4XS6 A;  2OE1 A;  13GS A;  1KNG A;  4EE0 A;  3HJP A;  3G7J A;  3HJO A;  1YDK A;  3F4R A;  1KEB A;  1TDI A;  3VK9 A;  2VM2 A;  3GSS A;  3L9S A;  1TI1 A;  3D5J A;  1PD2 1;  3P8W A;  1W4V A;  3GV1 A;  4GQC A;  2VD1 A;  4TN8 A;  5DAK A;  2BJX A;  1I9D A;  5KOX A;  2PPT A;  2HSM A;  2OKA A;  5DAK B;  4G2E A;  2ZUP A;  2TRC P;  2IFQ A;  2PUK C;  3ZVJ A;  3CXG A;  6GSX A;  5F06 A;  5G5F A;  4MNN A;  1WPI A;  2IIY A;  3IE3 A;  4EDZ A;  1GTU A;  1MD3 A;  2IFQ B;  3GKN A;  1FO5 A;  2FGX A;  1GWC A;  1PA3 A;  1R5A A;  4TR1 B;  1FB0 A;  1M2B A;  4MDC A;  5CRG A;  4POK A;  2E7P A;  4YAV A;  2X49 A;  2K9F A;  4OD7 A;  4I2U A;  2DBC A;  5CAX A;  1PX7 A;  2DJK A;  3R3E A;  2GT6 A;  4V1A g;  5B8B A;  2DML A;  2RLI A;  3TRQ A;  3D4T A;  3LWA A;  3VI7 A;  4PNF A;  3UJ1 A;  1GSD A;  18GS A;  3U6V A;  1GSE A;  2J9H A;  1NW2 A;  2QC7 A;  3IXR A;  2FLS A;  1WE0 A;  3FZ5 A;  2H74 A;  2LJR A;  3MAK A;  1AQX A;  3SBC A;  3EU3 A;  1EWX A;  3H8Q A;  2KP2 A;  1K0M A;  3LJR A;  4O5U A;  5A4W A;  2IMI A;  5G1L A;  3VWX A;  1WMJ A;  4HJ2 A;  2O89 A;  1RK4 A;  4IKH A;  3QPM A;  5D73 A;  2H70 A;  4FO5 A;  1OKD A;  3KJY A;  2QA1 A;  4QL9 A;  4F9Z A;  2VL9 A;  2A4H A;  5CO3 A;  2L4Q A;  4IBP A;  2RM5 A;  3TRP A;  3QMX A;  4ZBD A;  2B1L A;  1R7H A;  3IDV A;  3I9V 2;  2PGT A;  3U5R E;  5A5K A;  1VF3 A;  2YNX A;  1Z7R A;  2LJA A;  1VRS D;  4A5P A;  1M2A A;  1TOF A;  1AAZ A;  1EGO A;  2H6Z A;  4GSS A;  1O6J A;  5ID2 A;  1AUC A;  5C04 A;  2D2Z A;  2H1D A;  3BOA A;  1TU7 A;  5AIV A;  5AIX A;  2FWH A;  1R26 A;  3LW9 A;  1TRV A;  1ABA A;  4ILF A;  3EIN A;  4ZB9 A;  4ZL9 A;  4DEJ A;  2JZS A;  2LUS A;  4K1F A;  3ZIV A;  4EC0 A;  4PUR A;  3ZIT A;  4MMM A;  2VLV A;  1B9Y C;  4G10 A;  2YJH A;  5IOW A;  2YCD A;  1TXX A;  2K18 A;  1HD2 A;  1R4W A;  4Q5Q A;  2H6X A;  5G5E A;  4DSQ A;  2CV4 A;  4G0L A;  2GZY A;  2C3N A;  3FK8 A;  4XS4 A;  2GZZ A;  2HXK A;  4K2X A;  4FYB A;  3IOS A;  1PGT A;  5HFG A;  3VPQ A;  2IMD A;  2C3Q A;  2KP1 A;  3HHV A;  4L0W A;  3FRC A;  1YF1 A;  4POB A;  4O32 A;  5D96 A;  2O7K A;  3IC8 A;  3LG6 A;  3R2Q A;  4BA7 A;  5DVB A;  2AJQ B;  1DE1 A;  5ELG A;  1F37 A;  4DVC A;  2I1U A;  3DD3 A;  1VF2 A;  4RQR A;  3HDC A;  5IMA A;  2NBS A;  3Q6O A;  1TP9 A;  2VCZ A;  1FB6 A;  1ZOF A;  3TKP A;  2HZE A;  1CQH A;  1C72 A;  1K0A A;  3A2W A;  2HZE B;  5AGY A;  4J57 E;  3F0I A;  2LNT A;  2EIR A;  5IO2 A;  3O3T A;  1A2J A;  2KLX A;  2J23 A;  2H30 A;  4NMU A;  4X43 A;  1SL0 B;  3E3E A;  3GA4 A;  5INY A;  4O5Q A;  4AF2 A;  3CRU A;  2OJL A;  4MPF A;  5DCG A;  1F3B A;  2EIQ A;  1BG5 A;  3M9K A;  4ZL8 A;  5F07 A;  4IN0 A;  1ILO A;  2OA7 A;  5J3R A;  3ZL5 A;  4JE1 A;  3UOM A;  5ECP B;  12GS A;  2CVD A;  5B8A A;  2B5X A;  5DQY A;  2FCH A;  3M9J A;  4OCE A;  2DJ1 A;  4KF9 A;  1LBK A;  3GUR A;  3WD6 A;  4KDU A;  3F6D A;  2G0F A;  1DUG A;  1XWG A;  2FD3 A;  3MIX A;  2VLT A;  3EUR A;  5BRT A;  3DRN A;  3KH7 A;  3TGZ A;  3TRX A;  3UAR A;  2NTO A;  1V9W A;  3ERF A;  1G0T A;  3NZN A;  3W8J A;  3KP9 A;  4AJ6 A;  1EOG A;  5H5Q A;  3ZYW A;  1Q98 A;  3TCO A;  1K0N A;  3ZFB A;  1WRY A;  2LV3 A;  3VWV A;  3I69 A;  3F3R A;  4IP6 A;  3F4T A;  1X9M B;  4G9H A;  4EDY A;  4G0I A;  1SKS B;  1EEM A;  4USS A;  1ERT A;  3HVN A;  4GST A;  4Z2T A;  2V1M A;  3ERG A;  3TDG A;  1B48 A;  4KCA A;  3WGE A;  3TJF A; 
#chains in the Genus database with same CATH homology
 1PQN A;  3TKQ A;  1U87 A;  4WXT A;  1E2Y A;  3FR3 A;  1J08 A;  1X5E A;  2B5E A;  4HZ2 A;  5D9V A;  1GUK A;  1GP1 A;  2F8A A;  5GAP D;  3QD9 A;  4ZIJ A;  3N5O A;  2E0Q A;  3RBT A;  4V2M A;  1AQV A;  1URM A;  2C4J A;  3DVX A;  4CW9 A;  3UBL A;  2V6K A;  2GGT A;  1SL1 B;  3TKS C;  3GTU B;  4MJE A;  1GSU A;  5ENU A;  1QMV A;  2R2J A;  3UIW A;  3ZRD A;  2DKH A;  1TRS A;  2HNL A;  3EE2 A;  1VGL A;  2X64 A;  4KCE A;  1FOH A;  3HCZ A;  4I97 A;  5B7C A;  14GS A;  3RPP A;  2MYG A;  1QFN A;  1GTI A;  1FVJ A;  2QGV A;  4OFM A;  4BWQ A;  3VUR A;  1LJR A;  5FWG A;  1ERW A;  2C3T A;  1V98 A;  4E8H A;  3A2V A;  4IJ3 A;  4LL1 B;  2HSY A;  2QA2 A;  2YPM A;  5J5N A;  3IR4 A;  3D0Z A;  1IYI A;  2XHF A;  3EVI A;  4KAE A;  1X5C A;  2DJ0 A;  2VM1 A;  4TR0 A;  2JU5 A;  1OC3 A;  2BTO T;  5IPG A;  1DSB A;  2ZCT A;  3UVT A;  1Z3E A;  2OE3 A;  4ML1 A;  2O85 A;  1S3A A;  2RUE A;  1VF1 A;  4HU9 A;  4NWY A;  4F0C A;  1QK8 A;  4IJI A;  1UC7 A;  3GRX A;  2WDU A;  4ZBB A;  1EEJ A;  3VLN A;  1OE8 A;  1B8X A;  2WGR A;  3KGK A;  3GKM A;  2VLU A;  1FVK A;  2DSA A;  2GTU A;  1FAA A;  1A24 A;  4FQU A;  2LST A;  2MZC A;  1N2A A;  5G30 A;  1AW9 A;  4IS0 A;  2I9H A;  1M9B A;  2B5Y A;  5IQY A;  3F63 A;  3P7X A;  3UAP A;  3QFA C;  5A4U A;  3RPN A;  4TR4 A;  2HI7 A;  2B7K A;  2Z9S A;  4BVY A;  3FEU A;  4OWY A;  2YZH A;  1T7P B;  3HVX A;  1K0B A;  4NHW A;  2B7J A;  3WYW A;  4KB3 A;  3Q19 A;  1HNB A;  3FR6 A;  2CAI A;  8GSS A;  20GS A;  3ME7 A;  4PX1 A;  4FH8 A;  3VWW A;  2P0G A;  1O73 A;  1BQ7 A;  1K0C A;  3HZ4 A;  1ZMA A;  4OFT A;  5HR1 A;  2RII A;  4CHS A;  3NOF A;  4KSM A;  2C0F A;  1AQW A;  1OC8 A;  4GQF A;  2PER A;  3A2X A;  4N11 A;  1IYH A;  5JCW A;  4NPB A;  3APO A;  4HJM A;  1X9W B;  1I5G A;  4ISD A;  2UZ8 A;  2O87 A;  1SYR A;  5J4U A;  2MMO A;  2DIZ A;  4XIH A;  1NHY A;  11GS A;  1SD9 A;  1HNA A;  3APQ A;  3EC3 A;  1ZCP A;  2DMM A;  2C0E A;  3M0F A;  4DSR A;  3UL3 A;  3KTL A;  4WBJ A;  2HRA A;  1TW9 A;  4I2T A;  4K9Z A;  4V1A p;  2DC5 A;  4XHM A;  3GX0 A;  4WKW A;  3L78 A;  4KA0 A;  5KN1 A;  6GSS A;  4MZC A;  2VO4 A;  3HVV A;  1GTB A;  3HD5 A;  2VL3 A;  4IEL A;  2GDR A;  3C73 A;  4YQU A;  1XCC A;  3I6A A;  2LJK A;  4MF6 A;  3J7Y b;  1F6M C;  3ED3 A;  3IRA A;  5KN0 A;  4HEA 2;  2PU9 C;  4MZW A;  3N9J A;  1F9M A;  4Q5F A;  3DEX A;  3HZ8 A;  3KMO A;  4ICY A;  1XBS A;  3H4K A;  5ECI B;  1XWC A;  1XWA A;  3EU4 A;  4XCS A;  2AB6 A;  2NVL A;  3QOU A;  1MD4 A;  2X8C A;  1YKA A;  2DJ3 A;  5KOW A;  5E4W A;  4YQV A;  2GT5 A;  2XPE A;  4YKG A;  1V40 A;  3DIE A;  3O76 A;  4K5S A;  4CDO A;  2GQM A;  4TXV A;  4TRX A;  3DXB A;  1YJ6 A;  4KDY A;  3FYG A;  4QL7 A;  5JWQ B;  5IMC A;  4O7H A;  1ZYN A;  5GST A;  1WWJ A;  4JR6 A;  4ECI A;  1SD8 A;  1MEK A;  1GUM A;  1JZR A;  2VD0 A;  4MF5 A;  4ECB A;  1Z6N A;  2L4C A;  5ECO B;  1MDI A;  10GS A;  2OAC A;  1OE7 A;  1AXD A;  4MPG A;  5ID2 B;  1QXH A;  2QKE A;  2LRT A;  2X8G A;  3GN3 A;  3RHC A;  4Q5N A;  3CSI A;  4YH2 A;  1FG4 A;  2CVB A;  4HI7 A;  5D8I A;  2G2Q A;  1E6B A;  3F4S A;  2K8V A;  3LGC A;  2LEG A;  1H4O A;  4KSO A;  2H6Y A;  3BJ5 A;  2N5A A;  4FYU A;  3UBK A;  1XOA A;  1PMT A;  2R6K A;  4OFN A;  3TJK A;  5CRH A;  3GMF A;  5LCZ A;  4TW5 A;  3DML A;  4XS4 B;  2MBT A;  1TU8 A;  2M46 A;  2CQ9 A;  5IMD A;  4EL1 A;  5G2Z A;  19GS A;  1A0R P;  1UA5 A;  4I5Q A;  1ACV A;  5DJM A;  3KEB A;  3QDN A;  1J0F A;  2LRN A;  3FZ4 A;  4L5O A;  4ZB6 A;  4X1U A;  4IVF A;  2X8H A;  1ZZY A;  3IBH A;  3K8N A;  2VIM A;  4EO3 A;  2LQQ A;  4L5L A;  3CSH A;  3CYN A;  3D22 A;  4TKY A;  2OBK A;  3H93 A;  4K6X A;  5J9B A;  1T4Z A;  5ECH B;  3IAS 2;  5L71 A;  4LA1 A;  1XIY A;  1AIU A;  4OMV A;  1A8Y A;  4JBB A;  4YQM A;  4JR4 A;  1OVN A;  1FHE A;  3FY7 A;  2TIR A;  4Q5R A;  4PNG A;  2E2M A;  1TTZ A;  2L59 A;  5CP1 A;  1M9A A;  2A2P A;  2F9S A;  3GNJ A;  3DWV A;  2OBI A;  4MH3 A;  1XWB A;  2WCI A;  2PN8 A;  4K0N A;  4DSS A;  4HU7 A;  1H75 A;  4PQI A;  1QQ2 A;  5AIS A;  1TK5 B;  5JWO B;  1YF0 A;  3QAV A;  1OYJ A;  1YEX A;  4IHU A;  2X4A A;  4DSS B;  2VUP A;  2CZ3 A;  2F8F A;  4CY6 A;  2H1A A;  5JCG A;  1B4P A;  17GS A;  3A5W A;  3AY8 A;  5GSS A;  3E0U A;  2HSH A;  1UVZ A;  1PKZ A;  1MTC A;  4HS1 A;  9GSS A;  2CX3 A;  1M99 A;  4FYC A;  4NAX A;  4RI6 A;  5IPH A;  2JAD A;  3DGQ A;  1X0R A;  2P5R A;  2NPB A;  5CNW A;  2HZF A;  5ECQ B;  4AJ8 A;  5G1K A;  2X99 A;  3QCP A;  2GST A;  1PN0 A;  2YV9 A;  5EY6 A;  2PMT A;  2B6M A;  3LOR A;  5EL8 A;  2JSY A;  1T00 A;  2H73 A;  1U3I A;  1V58 A;  4WBR D;  4JED A;  4ECC A;  2B3S A;  3FKF A;  3IC4 A;  1TRW A;  3PH9 A;  2C1Y A;  3KD0 A;  3DKS A;  4K2D A;  1ERV A;  1NM3 A;  1XFL A;  3RAZ A;  3DYR A;  1X9S B;  2H19 A;  4L8E A;  3TJB A;  1BAY A;  5CRW A;  4IGJ A;  1A2M A;  5JCU A;  4ZXG A;  3WT2 A;  1SK2 A;  1YKC A;  4MAB A;  1QUW A;  5DCH A;  5G31 A;  1SKW B;  4N30 A;  5IM9 A;  3ISO A;  2JZR A;  4F0B A;  3MNG A;  3WGX A;  2AUV A;  3G9B A;  1ZL9 A;  4EUY A;  1XW5 A;  4WF5 A;  3VI5 A;  5KN2 A;  1PL1 A;  3FZ9 A;  5D9X A;  4MJB A;  3LXT A;  3KM6 A;  4GXZ A;  2V6O A;  4FIW A;  1SK1 A;  2LS5 A;  3H79 A;  22GS A;  3IPZ A;  3I43 A;  4N0Z A;  3IAM 2;  3HYP A;  1JFU A;  2H66 A;  3OR5 A;  4TOP A;  2AV4 A;  3V1W A;  4GLT A;  3P2A A;  2WZ9 A;  4K8M A;  3TKS E;  1O8W A;  1EP8 A;  1GSF A;  2P31 A;  5AN1 A;  4EKZ A;  3L4N A;  2VL2 A;  1JZD A;  3BCK A;  1WIK A;  2DIY A;  1V2A A;  4O92 A;  3MWH A;  1XW6 A;  2JZT A;  4NXI A;  3L9V A;  4L0U A;  4AJ7 A;  1G6W A;  4OCF A;  4OO5 A;  5C00 A;  5B6M A;  1Q4J A;  4X4J A;  1JHB A;  2XPD A;  4EVM A;  1EP7 A;  4ZIL A;  4GSN A;  2L6C A;  2HRF A;  4RUV A;  3G7I A;  4LMW A;  5HQP A;  5IOX A;  1A23 A;  2HT9 A;  4ML6 A;  1YY7 A;  3H1N A;  3GKX A;  2HE3 A;  5ECN B;  3FMW A;  1N8J A;  4J56 E;  3UEM A;  1HNC A;  5DBQ A;  1SL2 B;  2R37 A;  4HOJ A;  5GZZ B;  1FW1 A;  2LQO A;  1OC9 A;  2LKU A;  5D93 A;  4D73 A;  6GSU A;  2EC4 A;  3L0H A;  4TXO A;  3GL5 A;  1O85 A;  4EXJ A;  1YZX A;  1RQM A;  3PR8 A;  1OC9 B;  3A3T A;  3HXS A;  4D73 B;  3HY2 A;  2XBQ A;  3LQ7 A;  4MCU A;  4TXO B;  3F8U A;  1JZO A;  4KGI A;  2ALB A;  1BX9 A;  5DQS A;  2H0G A;  4JRR A;  4OO4 A;  4WF4 A;  4E8E A;  2HLS A;  1BJX A;  1GTA A;  2H0I A;  2HRK A;  1GSS A;  2H71 A;  3LFL A;  1CQG A;  3TB2 A;  16GS A;  2R0C A;  2KOK A;  4POL A;  2H1G A;  2JAC A;  4CY8 A;  4ZB8 A;  2A2S A;  2YJ7 A;  3CTG A;  4BVY B;  5F8B A;  2IWT A;  5BMU A;  1BED A;  1MDJ A;  2GLR A;  3ZTL A;  5F0G A;  4IW9 A;  5JWR B;  1XVW A;  1TJD A;  2DKI A;  2L5L A;  3KTB A;  2RM6 A;  2CVK A;  2P5Q A;  5KN3 A;  3ERW A;  1SJ6 A;  1GRX A;  2R0G A;  2C0D A;  4QQ7 A;  4KND A;  2AYT A;  2LTK A;  3VPT A;  1M2D A;  2WJU A;  2H8L A;  1PN9 A;  4PTS A;  2YOI A;  2ZNM A;  3IK9 A;  3BCI A;  3LYP A;  1BYE A;  2JSZ A;  2VCT A;  2YWM A;  4GWR A;  2CZ2 A;  4MF7 A;  5FT3 A;  2FA4 A;  5E59 A;  2MBS A;  7GSS A;  2V41 A;  3C1S A;  2YWN A;  3MSZ A;  4EF0 A;  2H1B A;  5DAL A;  4PQH A;  3QAW A;  2DLX A;  4LLR A;  1W89 A;  5J9C A;  4TR1 A;  5DAL B;  3RHB A;  4XRA A;  2IL3 A;  1RW1 A;  1Z7P A;  5IMV A;  1PSQ A;  1HYU A;  2AAW A;  3TUE A;  2REM A;  1EGR A;  4PXO A;  3GH9 A;  4F82 A;  4IP1 A;  1GH2 A;  1O7U A;  5GAN D;  4HQZ A;  1PRX A;  3VWU A;  3HA9 A;  2F3M A;  1A2L A;  1THX A;  2FNO A;  2EIO A;  3PGT A;  3APS A;  2XC2 A;  4KW6 A;  3WGD A;  1VF4 A;  1V57 A;  3UVH A;  1GNW A;  4G19 A;  3TJG A;  3SWL A;  3Q18 A;  2PBJ A;  2GSS A;  2WB9 A;  6GSV A;  1SYX A;  2PVQ A;  3F3Q A;  4WR4 A;  3MYD A;  5J41 A;  2IMF A;  5DDL A;  4F2I A;  1PL2 A;  2VCX A;  5CRD A;  4MZB A;  6GSY A;  2R0P A;  5COH A;  4TR3 A;  2IME A;  2OAD A;  1SJZ A;  3LYK A;  2AHE A;  3C8E A;  1YEP A;  3FZA A;  2FWG A;  3QFB C;  4HUA A;  1SJI A;  1Y25 A;  3FR9 A;  4ULX A;  1EV9 A;  5HR0 A;  5CRE A;  1WJK A;  1XPV A;  4EIP A;  4YAP A;  5EVO A;  1TK8 B;  1K3L A;  4I8B A;  4N10 A;  2TRX A;  3KMN A;  4XRD A;  1ML6 A;  1XWK A;  1A8L A;  4I6X A;  2L57 A;  5HR3 A;  2LNS A;  2A4V A;  2HYX A;  3TJJ A;  2O8V B;  2YWI A;  4V2N A;  2GS3 A;  4MH2 A;  4MJC A;  5ECS A;  1J9B A;  2GZP A;  3KCM A;  2HRN A;  1USB A;  1GL8 A;  3BD2 A;  2A2R A;  2WRT A;  1ERU A;  4RQX A;  4MLY A;  3ZMK A;  1M7T A;  2H72 A;  3S9F A;  4ID0 A;  3P90 A;  1FOV A;  2CX4 A;  1XW9 A;  2E2G A;  1OAZ A;  4BPY A;  2M72 A;  2NDO A;  2C80 A;  2KUC A;  5ECL B;  3GFK A;  5HFK A;  3VFI A;  3GST A;  1ZYP A;  3KZQ A;  2FHE A;  3PIN A;  4HZ4 A;  2GSQ A;  4TVE A;  2VOC A;  2YV7 A;  3Q74 A;  2L6D A;  1NHO A;  3QR6 A;  1GSQ A;  1TI3 A;  3IK7 A;  2XBI A;  3L9U A;  4V2L A;  3CMI A;  4KX4 A;  2YWO A;  1KBN A;  3EYT A;  4EIQ A;  5LNK e;  3DVW A;  5CYY A;  3LSZ A;  3CTF A;  1SU9 A;  4BL7 A;  4Z2U A;  4Z2R A;  1ZGN A;  4LMV A;  4ZBA A;  3GYK A;  2R4V A;  1U6T A;  3EWL A;  3ZFL A;  5B6N A;  2IN3 A;  4BL7 B;  4ECJ A;  2GQL A;  3ZZX A;  2YN1 A;  4K7O A;  5IMF A;  3CBU A;  1G6Y A;  5D9W A;  2ON5 A;  1GSY A;  3FW2 A;  2WFC A;  2MMA A;  4ZL7 A;  4J2F A;  3BBY A;  2FA8 A;  1O81 A;  1PX6 A;  2FUG 2;  3ZML A;  2YP6 A;  3IHG A;  4WR5 A;  2I3Y A;  4JZQ A;  1SEN A;  2VCQ A;  1TK0 B;  3E9J B;  1F3A A;  1T3B A;  3GKK A;  3IA1 A;  1U3A A;  3PPU A;  3KH9 A;  3M1G A;  5IO0 A;  4GCI A;  2KHP A;  2ON7 A;  4IQ1 A;  5H5R A;  1G7E A;  5D9T A;  4Z7X A;  2F51 A;  2H76 A;  4F03 A;  4PQ1 A;  3QAG A;  4KH7 A;  3RDW A;  5IIZ A;  1LU4 A;  4MA9 A;  2V32 A;  1HQO A;  4XS1 A;  1EOH A;  3ZRE A;  2FWF A;  2CA8 A;  4ACS A;  4KDX A;  5FHI A;  1EV4 A;  3EPT A;  2OE0 A;  3M3M A;  5KEJ A;  3C71 A;  3LEF A;  1B4Q A;  2CAQ A;  5ABR A;  2LRC A;  2GQK A;  3UMA A;  4GRF A;  5A4V A;  1SKR B;  1XOB A;  4X0X A;  2N5F A;  3EMP A;  2QSI A;  4KUN A;  1R5P A;  1OKT A;  2M80 A;  1EZK A;  1ZYE A;  4PUA A;  3CSJ A;  1ST9 A;  1Z6M A;  5EPF A;  2CT6 A;  3ZIJ A;  4NV2 A;  4GTU A;  1PKW A;  1TKD B;  4K7N A;  2K8S A;  3GHA A;  2H75 A;  1DE2 A;  2JL4 A;  3JCM L;  4WET A;  1Z5Y E;  3HVS A;  5ECK B;  1TRU A;  2YZU A;  1T4Y A;  2I81 A;  3GL3 A;  4MK3 A;  1SK0 A;  3GX8 A;  1DBY A;  4P3Y B;  5DJL A;  2FY6 A;  3GIX A;  3A5I A;  1K3O A;  2VL2 C;  2DJJ A;  1A0F A;  4IQA A;  1MDK A;  2IJY A;  4K0G A;  4LL4 B;  1KTE A;  2VAF A;  3NIV A;  4JU5 A;  3GTU A;  2ES7 A;  3D21 A;  2VCV A;  4RI7 A;  5ECR B;  5F05 A;  1ZYQ B;  4POM A;  1NSW A;  3M8N A;  1S3C A;  2V2G A;  5ECM B;  4O5R A;  3IV4 A;  3LXZ A;  1WOU A;  1F2E A;  3ME8 A;  3MDK A;  2MMN A;  1G7O A;  1QGV A;  3GUS A;  1XZO A;  1YQ1 A;  2BMX A;  3W6G A;  2K6V A;  4WEY A;  1AC1 A;  4H86 A;  2FWE A;  3W8S A;  3TKS A;  2YAN A;  3HKR A;  2PWJ A;  1X5D A;  2R3X A;  3TOU A;  2R5G A;  4PUF C;  4YKF A;  4HQS A;  3KP8 A;  3ZLP A;  2WUL A;  3CRT A;  2L5O A;  2GSR A;  3GH6 A;  3HJM A;  3O6T A;  1XXU A;  1Z9H A;  6GSW A;  4NV5 A;  3ZVJ D;  5ELA A;  2N5B A;  3F6F A;  4K7I A;  3US3 A;  2IPA A;  6GST A;  1GLP A;  2H01 A;  4MJA A;  1THO A;  2PVO C;  4PGT A;  5H5S A;  2H0H A;  4HDE A;  5IMZ A;  1ON4 A;  1O8X A;  2C0G A;  3D6I A;  2VCW A;  1S3D A;  1WP0 A;  5HR2 A;  2WS2 A;  2I4A A;  2GVP A;  3G7Y A;  4MP4 A;  4XTS A;  3J7Y k;  1T1V A;  1K0D A;  5HFI A;  3TKR A;  1GUH A;  2MMZ A;  3FHK A;  4BWS A;  4NHZ A;  4G0K A;  3TOT A;  1M0U A;  1JZW A;  1XVQ A;  1K0O A;  1U88 A;  2IMK A;  1B9X C;  3KIJ A;  3IHQ A;  1T8E B;  4AGS A;  1UN2 A;  3C1R A;  4GF0 A;  1JLV A;  2B1K A;  4K5R A;  1K3Y A;  3WT1 A;  1Y6E A;  3EMX A;  4BVX A;  2C8U A;  4N0V A;  1JLW A;  1GLQ A;  2DJ2 A;  3F9U A;  1GNE A;  4KE3 A;  2HFD A;  3C7M A;  4BVX B;  2RUF A;  3KXO A;  5LD0 A;  1GUL A;  3D4M A;  4XS6 A;  2OE1 A;  13GS A;  1KNG A;  4EE0 A;  3HJP A;  3G7J A;  3HJO A;  1YDK A;  3F4R A;  1KEB A;  1TDI A;  3VK9 A;  2VM2 A;  3GSS A;  3L9S A;  1TI1 A;  3D5J A;  1PD2 1;  3P8W A;  1W4V A;  3GV1 A;  4GQC A;  2VD1 A;  4TN8 A;  5DAK A;  2BJX A;  1I9D A;  5KOX A;  2PPT A;  2HSM A;  2OKA A;  5DAK B;  4G2E A;  2ZUP A;  2TRC P;  2IFQ A;  2PUK C;  3ZVJ A;  3CXG A;  6GSX A;  5F06 A;  5G5F A;  4MNN A;  1WPI A;  2IIY A;  3IE3 A;  4EDZ A;  1GTU A;  1MD3 A;  2IFQ B;  3GKN A;  1FO5 A;  2FGX A;  1GWC A;  1PA3 A;  1R5A A;  4TR1 B;  1FB0 A;  1M2B A;  4MDC A;  5CRG A;  4POK A;  2E7P A;  4YAV A;  2X49 A;  2K9F A;  4OD7 A;  4I2U A;  2DBC A;  5CAX A;  1PX7 A;  2DJK A;  3R3E A;  2GT6 A;  4V1A g;  5B8B A;  2DML A;  2RLI A;  3TRQ A;  3D4T A;  3LWA A;  3VI7 A;  4PNF A;  3UJ1 A;  1GSD A;  18GS A;  3U6V A;  1GSE A;  2J9H A;  1NW2 A;  2QC7 A;  3IXR A;  2FLS A;  1WE0 A;  3FZ5 A;  2H74 A;  2LJR A;  3MAK A;  1AQX A;  3SBC A;  3EU3 A;  1EWX A;  3H8Q A;  2KP2 A;  1K0M A;  3LJR A;  4O5U A;  5A4W A;  2IMI A;  5G1L A;  3VWX A;  1WMJ A;  4HJ2 A;  2O89 A;  1RK4 A;  4IKH A;  3QPM A;  5D73 A;  2H70 A;  4FO5 A;  1OKD A;  3KJY A;  2QA1 A;  4QL9 A;  4F9Z A;  2VL9 A;  2A4H A;  5CO3 A;  2L4Q A;  4IBP A;  2RM5 A;  3TRP A;  3QMX A;  4ZBD A;  2B1L A;  1R7H A;  3IDV A;  3I9V 2;  2PGT A;  3U5R E;  5A5K A;  1VF3 A;  2YNX A;  1Z7R A;  2LJA A;  1VRS D;  4A5P A;  1M2A A;  1TOF A;  1AAZ A;  1EGO A;  2H6Z A;  4GSS A;  1O6J A;  5ID2 A;  1AUC A;  5C04 A;  2D2Z A;  2H1D A;  3BOA A;  1TU7 A;  5AIV A;  5AIX A;  2FWH A;  1R26 A;  3LW9 A;  1TRV A;  1ABA A;  4ILF A;  3EIN A;  4ZB9 A;  4ZL9 A;  4DEJ A;  2JZS A;  2LUS A;  4K1F A;  3ZIV A;  4EC0 A;  4PUR A;  3ZIT A;  4MMM A;  2VLV A;  1B9Y C;  4G10 A;  2YJH A;  5IOW A;  2YCD A;  1TXX A;  2K18 A;  1HD2 A;  1R4W A;  4Q5Q A;  2H6X A;  5G5E A;  4DSQ A;  2CV4 A;  4G0L A;  2GZY A;  2C3N A;  3FK8 A;  4XS4 A;  2GZZ A;  2HXK A;  4K2X A;  4FYB A;  3IOS A;  1PGT A;  5HFG A;  3VPQ A;  2IMD A;  2C3Q A;  2KP1 A;  3HHV A;  4L0W A;  3FRC A;  1YF1 A;  4POB A;  4O32 A;  5D96 A;  2O7K A;  3IC8 A;  3LG6 A;  3R2Q A;  4BA7 A;  5DVB A;  2AJQ B;  1DE1 A;  5ELG A;  1F37 A;  4DVC A;  2I1U A;  3DD3 A;  1VF2 A;  4RQR A;  3HDC A;  5IMA A;  2NBS A;  3Q6O A;  1TP9 A;  2VCZ A;  1FB6 A;  1ZOF A;  3TKP A;  2HZE A;  1CQH A;  1C72 A;  1K0A A;  3A2W A;  2HZE B;  5AGY A;  4J57 E;  3F0I A;  2LNT A;  2EIR A;  5IO2 A;  3O3T A;  1A2J A;  2KLX A;  2J23 A;  2H30 A;  4NMU A;  4X43 A;  1SL0 B;  3E3E A;  3GA4 A;  5INY A;  4O5Q A;  4AF2 A;  3CRU A;  2OJL A;  4MPF A;  5DCG A;  1F3B A;  2EIQ A;  1BG5 A;  3M9K A;  4ZL8 A;  5F07 A;  4IN0 A;  1ILO A;  2OA7 A;  5J3R A;  3ZL5 A;  4JE1 A;  3UOM A;  5ECP B;  12GS A;  2CVD A;  5B8A A;  2B5X A;  5DQY A;  2FCH A;  3M9J A;  4OCE A;  2DJ1 A;  4KF9 A;  1LBK A;  3GUR A;  3WD6 A;  4KDU A;  3F6D A;  2G0F A;  1DUG A;  1XWG A;  2FD3 A;  3MIX A;  2VLT A;  3EUR A;  5BRT A;  3DRN A;  3KH7 A;  3TGZ A;  3TRX A;  3UAR A;  2NTO A;  1V9W A;  3ERF A;  1G0T A;  3NZN A;  3W8J A;  3KP9 A;  4AJ6 A;  1EOG A;  5H5Q A;  3ZYW A;  1Q98 A;  3TCO A;  1K0N A;  3ZFB A;  1WRY A;  2LV3 A;  3VWV A;  3I69 A;  3F3R A;  4IP6 A;  3F4T A;  1X9M B;  4G9H A;  4EDY A;  4G0I A;  1SKS B;  1EEM A;  4USS A;  1ERT A;  4GST A;  4Z2T A;  2V1M A;  3ERG A;  3TDG A;  1B48 A;  4KCA A;  3WGE A;  3TJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...