3ZYWA

Crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
108
structure length
108
Chain Sequence
DLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords GLUTAREDOXIN-3
publication title Crystal Structure of the First Glutaredoxin Domain of Human Glutaredoxin 3 (Glrx3)
rcsb
source organism Homo sapiens
total genus 37
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zywA01
2NPBA 3N5OA 2MMZA 2YNXA 1V9WA 2H6YA 3FR6A 2H73A 1WJKA 2O7KA 2C3TA 3APOA 2N5FA 3P7XA 1O8WA 3HCZA 4IS0A 3TOTA 1FHEA 3QDNA 1K0MA 1T7PB 2ES7A 2YOIA 2F51A 2E7PA 3EINA 4OFMA 4O32A 5DQSA 3C1RA 2HSYA 2VD1A 1GLQA 2FWEA 3FW2A 3ZIVA 1GRXA 1WPIA 1ON4A 2K8VA 2XBIA 4K0GA 4I97A 3S9FA 1KNGA 1FVJA 5ELGA 1BYEA 1K0DA 1O7UA 2VM2A 5GSTA 3IXRA 1G0TA 2OE1A 1TW9A 1R4WA 1YJ6A 4L0WA 2QKEA 4ZXGA 1VF4A 4BPYA 4L8EA 4MK3A 1SJ6A 1J0FA 10GSA 3L9UA 4YH2A 1SKSB 3MNGA 1ZGNA 4OCFA 2GDRA 4GTUA 3IK7A 1OC9A 4KB3A 5H5RA 5EY6A 2ZCTA 4GWRA 5G1KA 4HU7A 4DSQA 1PN9A 2BJXA 4J57E 1TK8B 1BQ7A 1M99A 1O6JA 4L0UA 3CRTA 2H1GA 3HVVA 5FT3A 3BCIA 3SWLA 2C80A 1ILOA 2JU5A 2CAQA 2QC7A 5CRDA 4X1UA 3HKRA 2L5OA 3P90A 2DJJA 2MMNA 3TJBA 1WP0A 2GSSA 3GMFA 5INYA 4GSSA 2IWTA 4BVYA 1UVZA 4KAEA 4NHZA 5J41A 4XTSA 4OD7A 5IIZA 1TI1A 2DC5A 4GCIA 4O92A 4POLA 2AAWA 2RM6A 2VCXA 4GLTA 1WMJA 1EOGA 2PPTA 2JSZA 1OC8A 2PWJA 3KTLA 2MYGA 3PR8A 4D73B 1HYUA 5CAXA 1W89A 2CQ9A 1U88A 4OFTA 3ZZXA 2FWFA 2DBCA 2M46A 2FWHA 2AUVA 3KH7A 5CNWA 2NDOA 4XS4B 5ECIB 1LU4A 1T8EB 4OO5A 3AY8A 4I6XA 3CTFA 5B6NA 2VCZA 1F3BA 4LMWA 2YPMA 2DJ1A 3A3TA 1J08A 1ACVA 1TU7A 3KJYA 3TOUA 5KN1A 2PN8A 3DVXA 4G10A 2YWMA 3QAGA 1XIYA 5J5NA 4HEA2 2YWOA 5JCGA 1O81A 2CZ3A 2VL3A 3TKRA 1X5CA 4MA9A 5IO0A 5G2ZA 3DD3A 3Q6OA 5ECRB 4K7NA 2GLRA 3C71A 3E9JB 4WXTA 2HSHA 1ST9A 3LGCA 4I5QA 4PUFC 3TUEA 3FR9A 6GSYA 3FK8A 3KXOA 1V98A 3BD2A 2P31A 3DVWA 12GSA 5AGYA 4GSTA 4EKZA 2LQQA 4XRDA 1M7TA 1ZMAA 22GSA 4AJ7A 2L6DA 1SD9A 1WE0A 2C0DA 4F0CA 3APSA 1OC9B 1TDIA 3UBKA 3A2XA 1N2AA 2V2GA 1SKWB 1I9DA 3TCOA 1XFLA 4K7IA 2DJ3A 2IMFA 2BMXA 2KHPA 4YQMA 2KP2A 2H1BA 5J9CA 1V2AA 4ISDA 2JSYA 2VCWA 3FY7A 2H0GA 3K8NA 1Z7PA 3ERFA 2AV4A 3DKSA 3RHBA 2IN3A 4ZL8A 4NMUA 1GSYA 1PGTA 17GSA 5KN2A 2H75A 4KW6A 2R6KA 1TP9A 3GKXA 4WF4A 1AC1A 1SYXA 1B9XC 4WETA 2VO4A 4IGJA 2VLVA 3HZ4A 3IBHA 1PRXA 4TN8A 3CBUA 1TJDA 5HFGA 2JACA 3TJGA 2YV7A 1PKWA 1T1VA 5CRWA 1AXDA 5DQYA 2K8SA 1EV9A 6GSTA 3F63A 4NPBA 1ZZYA 5E4WA 3GX8A 2ON7A 3ZYWA 2YZUA 1AIUA 3BCKA 4WF5A 3WD6A 2CV4A 2L4QA 3IAS2 3TJKA 1OKDA 2VL2C 4J56E 2R5GA 3G7JA 1TOFA 4O5RA 3MAKA 1M0UA 2NVLA 5B6MA 3RPPA 2LJRA 1TRWA 5A5KA 1XVQA 2KLXA 5HQPA 1AQVA 2LKUA 2MZCA 4PX1A 1TI3A 4MH3A 1XWCA 4YAVA 4WR4A 3IHQA 2G0FA 5F06A 3HXSA 5B8BA 1ML6A 2RLIA 4HI7A 5AN1A 1EZKA 5IOXA 3GRXA 4TKYA 1M9BA 2V1MA 1GL8A 1BEDA 2IMKA 4DSRA 1JZWA 4OFNA 3F4TA 5ECNB 1GH2A 5AIVA 2O8VB 1E6BA 4I8BA 1V57A 2E0QA 1XOAA 4GXZA 4DEJA 1GP1A 3D0ZA 2WULA 2I81A 4N0VA 2DMMA 4AJ8A 1THXA 4ECBA 2YWIA 4YQUA 3EE2A 1VF1A 1RW1A 1SD8A 3PINA 2X8HA 2TRXA 2I1UA 2QSIA 1TU8A 2V6OA 1OE7A 4MF5A 3M9KA 3WGEA 1K3LA 2ALBA 2XHFA 2TIRA 5J4UA 3DXBA 3HJOA 2VCQA 1PKZA 4KA0A 3D4TA 2IMDA 1AAZA 3EC3A 2HRFA 1YDKA 3PGTA 4XS1A 1S3AA 1PX6A 3DWVA 3FKFA 1PL2A 1HD2A 2HLSA 4TVEA 1GUKA 3IR4A 3KD0A 1YF1A 5F0GA 2DSAA 3D4MA 3QD9A 1N8JA 2YN1A 2H0HA 3GSSA 4GRFA 1IYHA 1BJXA 3GN3A 1U6TA 3SBCA 4EC0A 5A4VA 4HZ4A 3KM6A 4FYUA 5KN0A 4G19A 2YWNA 3A5WA 2GGTA 2IPAA 1SKRB 4FYBA 4AGSA 4DVCA 1U3AA 1PA3A 2WRTA 3I6AA 1LBKA 6GSXA 5DVBA 3M3MA 1YZXA 1QGVA 2O89A 4MZCA 3ZVJA 3GHAA 3F6FA 1T4ZA 5G30A 5F07A 3LFLA 3H1NA 3EWLA 3FHKA 4WKWA 5JCUA 2FLSA 5HFKA 3TKQA 4TR0A 3ZFLA 1TK5B 3LG6A 2I9HA 1QXHA 2K6VA 5HR1A 2WDUA 2MBSA 4QL7A 5HR0A 4GSNA 3EMXA 3VPTA 1EEMA 4IP1A 3UJ1A 2H1DA 1USBA 3PH9A 3M8NA 4ID0A 4ZBBA 1G6YA 1GLPA 2B7JA 2CX4A 1XXUA 3TRPA 7GSSA 1XOBA 5COHA 1IYIA 4TXOA 4OWYA 4J2FA 1V58A 1WOUA 2H72A 1B4QA 4POBA 2HRNA 4FH8A 2LRCA 3GURA 2FNOA 2A4VA 3HD5A 5JWRB 1X5EA 4JEDA 1OAZA 5IMDA 1K0CA 2MMOA 1GSFA 4KGIA 1F2EA 1GUHA 16GSA 1QQ2A 3IV4A 2EIOA 3QFBC 2CT6A 2V6KA 1JLWA 2C3QA 2HYXA 3ZL5A 4RQXA 4TW5A 2GTUA 2ZNMA 1A0FA 1FG4A 2LRTA 3HJMA 4E8EA 5HR3A 3F9UA 2LNSA 1XW9A 4Q5QA 4RI6A 2LSTA 5D93A 2OA7A 3VK9A 5IMVA 1QK8A 3GL5A 2PU9C 1YF0A 1XVWA 3ZLPA 4EUYA 1GSDA 2WS2A 4IQ1A 5FHIA 2MBTA 5G5FA 5CP1A 2KOKA 1PSQA 3ZITA 4KUNA 2FD3A 4PURA 2GVPA 1YKCA 2DLXA 3KTBA 4ACSA 3KMOA 1R5PA 3F4RA 3DGQA 2B1KA 3G9BA 3EYTA 4NAXA 5CRHA 4KSMA 5C04A 5IM9A 3TKSA 2WFCA 4Z7XA 1EGOA 3EURA 5KN3A 4ECJA 1B48A 1A2LA 2OKAA 3RPNA 3A2WA 3TB2A 3HA9A 2XC2A 1GNEA 1GUMA 4RUVA 3CSJA 4ZIJA 2V32A 3QCPA 1PQNA 1HNBA 2WB9A 5IPGA 2GSRA 5F05A 4F0BA 1F9MA 2FA4A 4XCSA 3IRAA 3KH9A 3GH9A 2VIMA 3H93A 5G5EA 3UAPA 5D9XA 3RDWA 1SK0A 1U3IA 2L6CA 4GF0A 1OC3A 2EC4A 2YJ7A 1Z7RA 2Z9SA 5L71A 1XCCA 4OMVA 4PGTA 3FYGA 1H75A 3C8EA 2HT9A 1ZCPA 1TRSA 2GSTA 1S3DA 1SL0B 1T4YA 5CRGA 3APQA 2JZRA 2JL4A 1DE1A 2N5BA 5AIXA 3QMXA 1DBYA 3LYPA 2G2QA 4L5OA 1EP8A 2LUSA 2H76A 3RBTA 3VFIA 2CVKA 2RUFA 5E59A 3KP9A 2RM5A 5IMCA 1VRSD 3FEUA 4BA7A 4KSOA 3R2QA 1X0RA 4TXOB 1THOA 4V1Ag 2GT5A 3QR6A 3UOMA 3ZRDA 3FZ9A 11GSA 5ID2A 4WBRD 5ECKB 2DIZA 2B6MA 2LNTA 1Y25A 2K18A 3ZMKA 3FZAA 1XWKA 4MZWA 4EL1A 2L5LA 4TOPA 3QAWA 1X9SB 3NZNA 1ERTA 1O73A 3ME8A 4TR4A 3VI7A 2C0FA 1Z9HA 1FVKA 2L59A 1A0RP 1B4PA 4N30A 2H71A 2E2MA 4JE1A 1K0AA 4CHSA 4K0NA 1Y6EA 1WIKA 2PUKC 4MPGA 2R4VA 1TKDB 3M9JA 2FA8A 3LSZA 4MH2A 3I69A 3MWHA 1JZRA 2XPDA 4ZB9A 1SJZA 1I5GA 2LTKA 3GTUA 5DALA 2H6ZA 2DMLA 1FO5A 3KIJA 2C3NA 3J7Yb 5B8AA 2PGTA 3ZIJA 1EP7A 3LJRA 2LJAA 1F37A 3L4NA 3I43A 2B3SA 18GSA 4KDXA 2AJQB 4K8MA 3GA4A 2B1LA 4IVFA 5A4WA 2KUCA 4EDYA 3JCML 4PNGA 3HHVA 1QUWA 3V1WA 2OADA 1ABAA 3GFKA 4KX4A 4EVMA 1G7EA 3ED3A 2OBKA 1F6MC 3D6IA 2HXKA 2P0GA 1R5AA 2AHEA 2E2GA 4MF6A 3TDGA 4HDEA 3QAVA 3ZTLA 3H4KA 2CX3A 4ZL7A 4LA1A 1O8XA 2JZSA 4N10A 4KDUA 2PVQA 1JZOA 5DBQA 6GSSA 4ML6A 4AF2A 3F0IA 2IMEA 2WGRA 2DJ0A 2F8FA 3WT1A 2LRNA 2VLTA 2H70A 1YQ1A 4YQVA 3UL3A 3IC4A 4MLYA 1GSEA 2CVBA 3KZQA 2WJUA 4NV5A 3GYKA 2C0GA 2H1AA 3J7Yk 1HNCA 1NW2A 2LQOA 5G1LA 4KE3A 2KP1A 3VPQA 3IE3A 4ECCA 1S3CA 3ME7A 4OCEA 4WR5A 5IPHA 1VF2A 3HYPA 1XW6A 3HJPA 1RK4A 2ON5A 4XS6A 4N0ZA 1A2JA 1K0NA 1JFUA 3Q18A 3H8QA 1VF3A 2VM1A 1FOVA 2CA8A 2H6XA 2YCDA 4KCEA 5IMAA 2H01A 3P8WA 4LL1B 5G31A 2YANA 3C7MA 2NBSA 1SYRA 3W6GA 1SJIA 2VCVA 5HR2A 5GAND 4IJ3A 3D21A 1DSBA 3GTUB 5DALB 4TR3A 5H5QA 3CXGA 2CVDA 14GSA 2FY6A 4E8HA 4TRXA 4IJIA 2YZHA 4K9ZA 3OR5A 1OE8A 3NIVA 1B9YC 5GSSA 5GZZB 4V2NA 5GAPD 3MSZA 3QPMA 3CMIA 4I2UA 3EVIA 3Q19A 3M0FA 2K9FA 1T3BA 3CSIA 2VAFA 1HQOA 4JZQA 1GTAA 3BBYA 2N5AA 1HNAA 5DJLA 4HU9A 2LJKA 5DDLA 5IMFA 1OYJA 3TKPA 4V2LA 2YJHA 1A2MA 2CAIA 4EXJA 3DRNA 2F3MA 1X9WB 4PQ1A 1GSSA 1EWXA 3WT2A 1NHYA 4WEYA 2H0IA 3IK9A 3IDVA 4TXVA 1G7OA 4X43A 1K0OA 1CQGA 2X8CA 1B8XA 1MDIA 4MABA 5D73A 4HQSA 4MF7A 5ABRA 2LEGA 2WZ9A 4RQRA 5EVOA 5IQYA 2R2JA 2BTOT 4F82A 3GV1A 2C8UA 2XPEA 4IELA 3L9VA 3VWVA 3GKKA 1O85A 4RI7A 1FAAA 2IL3A 4XHMA 4V1Ap 5J3RA 2P5QA 1Z6MA 4PQHA 5LD0A 4EDZA 3US3A 1Q4JA 4XS4A 4GQCA 5DJMA 5ECSA 1XWBA 2H74A 1W4VA 1GNWA 3KGKA 2R37A 1X5DA 4PXOA 3EMPA 3ZFBA 4L5LA 2F9SA 1KEBA 4MCUA 2JZTA 1YKAA 1TRVA 2HE3A 5KEJA 1SK1A 5DCGA 3FZ4A 2DJKA 5D9WA 1ZOFA 4HQZA 3BOAA 3LWAA 3C73A 4EF0A 6GSVA 2CZ2A 1VGLA 2DIYA 4ML1A 3GKMA 3D5JA 2YV9A 1TK0B 3FZ5A 4MP4A 3ISOA 2WCIA 1YEXA 4G9HA 6GSWA 3QFAC 2LV3A 1K0BA 3EU4A 4LL4B 1LJRA 1CQHA 2HNLA 2M72A 3ZMLA 4ZBDA 3UARA 3VURA 2J9HA 2VD0A 3FRCA 1ERVA 2A2RA 4KH7A 2PERA 5J9BA 1NM3A 2FHEA 2H19A 4K2DA 4HJ2A 3ERWA 3F8UA 1MTCA 1A8LA 1GTUA 1UN2A 1A8YA 2J23A 1YY7A 1TXXA 4KDYA 2X64A 3F3QA 3G7YA 2P5RA 4WBJA 1DUGA 1SL2B 2IJYA 5C00A 2C1YA 3G7IA 4Q5RA 2HZEA 2MMAA 3F3RA 2HFDA 3HY2A 1H4OA 2AB6A 4ZBAA 1JLVA 4LMVA 4ZB6A 4I2TA 4K6XA 2HZFA 3VI5A 4FO5A 4IHUA 3WYWA 2ZUPA 8GSSA 3ZREA 1M9AA 20GSA 4K7OA 4F9ZA 2O87A 2PVOC 4EO3A 3GSTA 4F2IA 1GTBA 4V2MA 3P2AA 1GULA 2YP6A 3DIEA 3L78A 5JWQB 2X99A 2RUEA 1RQMA 2REMA 1YEPA 2V41A 4MJEA 2H30A 3MDKA 4JR6A 2GSQA 2HI7A 3UMAA 4Q5FA 5DCHA 5D9VA 1WRYA 1AQXA 2LS5A 4TR1A 1GSUA 4ZB8A 4HOJA 3GH6A 3UVHA 3NOFA 3I9V2 4IN0A 2B5XA 3LORA 1JHBA 2XBQA 4K1FA 2I4AA 4KCAA 4JBBA 3U6VA 4IKHA 5ECMB 2OJLA 3H79A 3LEFA 5H5SA 4LLRA 2X8GA 1OKTA 1JZDA 4XRAA 2EIQA 4NWYA 1EOHA 19GSA 5DAKA 3HZ8A 4BVXA 5D9TA 2B7KA 1BX9A 1FB6A 3KEBA 2R3XA 2GQLA 1Z6NA 4ZILA 5F8BA 1Z5YE 1GTIA 1SK2A 3RAZA 2OACA 1UC7A 2OE3A 2FGXA 5ECPB 1KBNA 13GSA 5EPFA 4IW9A 4YAPA 5JCWA 3TGZA 1M2BA 3CRUA 3QOUA 4IP6A 4ZL9A 3GNJA 3IAM2 5IOWA 4CW9A 4BWQA 1ZYQB 3HDCA 1GSQA 4CDOA 4DSSA 2VCTA 1URMA 3TJFA 1KTEA 4HZ2A 2TRCP 3RHCA 1EV4A 3GKNA 4MPFA 2EIRA 2IFQA 2OBIA 3TRQA 2A2SA 1TTZA 3IOSA 1ERUA 2IMIA 2JADA 1XBSA 1NHOA 3TJJA 1MD3A 5AISA 3W8SA 1XW5A 1ERWA 1BAYA 4MDCA 3D22A 3LQ7A 4FYCA 3WGXA 1FB0A 3C1SA 3VLNA 1PX7A 4Q5NA 3VWWA 1DE2A 3F4SA 1XPVA 3WGDA 2HZEB 1AW9A 3W8JA 4OO4A 4IBPA 4MZBA 4ULXA 3LXTA 1QMVA 2GQMA 3F6DA 4MJCA 2B5YA 3CSHA 1Q98A 1MEKA 4QL9A 1Z3EA 6GSUA 4HS1A 4F03A 5JWOB 2FUG2 4ILFA 4G2EA 4HUAA 3E3EA 4PNFA 5HFIA 4HJMA 1XZOA 1F3AA 2IIYA 3LYKA 5A4UA 5ECOB 1G6WA 2C0EA 3LXZA 3ZVJD 4TR1B 3UBLA 1X9MB 2RIIA 5ENUA 1AUCA 2GQKA 2VL9A 5ID2B 1T00A 3Q74A 4BWSA 2AYTA 1K3YA 2DJ2A 3CTGA 1PMTA 5FWGA 2VLUA 2FWGA 5IMZA 3DYRA 3O76A 2C4JA 1XWGA 4ECIA 5CREA 2FCHA 1QFNA 3O6TA 5DAKB 1V40A 2GS3A 5B7CA 2L4CA 2L57A 1MDJA 4MMMA 5ECLB 4QQ7A 3KP8A 4AJ6A 3M1GA 1ZL9A 1J9BA 2B5EA 1UA5A 2NTOA 1FW1A 3L9SA 2GZYA 3IA1A 4X0XA 1AQWA 3ERGA 4PQIA 3TKSE 1OVNA 2H8LA 1EEJA 3TRXA 9GSSA 2GZZA 3L0HA 1EGRA 5EL8A 5ECQB 3UIWA 4DSSB 4BL7A 2F8AA 1PL1A 1SENA 3O3TA 1C72A 4EE0A 3GX0A 4XIHA 4MJBA 1BG5A 3U5RE 1MDKA 3EU3A 4POKA 1R26A 2IFQB 4PUAA 5D8IA 3VWUA 1M2DA 1K3OA 4POMA 3GIXA 4GQFA 1SU9A 2GT6A 4JU5A 3KMNA 2D2ZA 1NSWA 2M80A 1PD21 3UEMA 2VUPA 3CYNA 3BJ5A 4FIWA 5ECHB 1SL1B 4N11A 4O7HA 3HVSA 5ELAA 3KCMA 3UVTA 1R7HA 3FR3A 3A2VA 4NHWA 1ZYEA 5LCZA 1MD4A 4JRRA 5LNKe 2VOCA 4IQAA 1E2YA 3GL3A 2PBJA 4MJAA 1A24A 2O85A 2OE0A 2VL2A 1WWJA 3HVXA 3GUSA 3TKSC 1A23A 3DMLA 3IPZA 1XWAA 4NXIA 3DEXA 1TRUA 2I3YA 1U87A 4KNDA 4JR4A 4P3YB 3N9JA 2GZPA 5CO3A 4H86A 2H66A 3VWXA 1GWCA 5IO2A 3E0UA 4NV2A 5CYYA 1M2AA 2QGVA 2PMTA 5D96A 4D73A
chains in the Genus database with same CATH superfamily
2NPBA 3N5OA 2MMZA 2YNXA 1ZYPA 1V9WA 2H6YA 3FR6A 2H73A 1WJKA 2O7KA 2C3TA 3APOA 2N5FA 3P7XA 1O8WA 3HCZA 4IS0A 3TOTA 1FHEA 3QDNA 2HRAA 1K0MA 1T7PB 2ES7A 2YOIA 2F51A 2E7PA 3EINA 4OFMA 4O32A 5DQSA 1M3IA 3C1RA 2HSYA 2VD1A 1GLQA 2FWEA 3FW2A 3ZIVA 1GRXA 1WPIA 1ON4A 2K8VA 4CY6A 2XBIA 4K0GA 4I97A 3S9FA 1KNGA 1FVJA 5ELGA 1BYEA 1K0DA 1O7UA 2VM2A 5GSTA 3IXRA 1G0TA 2OE1A 1TW9A 1R4WA 1YJ6A 4L0WA 2QKEA 4ZXGA 1VF4A 4BPYA 4HSCX 4L8EA 4MK3A 1SJ6A 1J0FA 10GSA 3L9UA 4YH2A 1SKSB 3MNGA 1ZGNA 4OCFA 2GDRA 4GTUA 3IK7A 1OC9A 4KB3A 5H5RA 5EY6A 2ZCTA 4GWRA 5G1KA 4HU7A 4DSQA 1PN9A 2BJXA 2X49A 4J57E 1TK8B 1BQ7A 1M99A 1O6JA 4L0UA 3CRTA 2H1GA 4G0KA 3HVVA 5FT3A 3BCIA 3SWLA 2C80A 1ILOA 2JU5A 2CAQA 2QC7A 5CRDA 4X1UA 3HKRA 2L5OA 3P90A 2DJJA 2MMNA 3TJBA 1WP0A 1S3RA 2GSSA 3GMFA 5INYA 4GSSA 2IWTA 4BVYA 1UVZA 4KAEA 4NHZA 5J41A 4XTSA 4OD7A 5IIZA 1TI1A 2DC5A 4GCIA 4O92A 4POLA 2AAWA 2RM6A 2VCXA 4GLTA 1WMJA 1EOGA 2PPTA 2JSZA 1OC8A 2PWJA 3KTLA 2MYGA 3PR8A 4D73B 1HYUA 5CAXA 1W89A 2CQ9A 1U88A 4OFTA 3ZZXA 2FWFA 2DBCA 2M46A 2FWHA 2AUVA 3KH7A 5CNWA 2NDOA 4XS4B 1XG8A 5ECIB 1LU4A 1T8EB 4OO5A 3AY8A 4I6XA 3CTFA 5B6NA 2VCZA 1F3BA 4LMWA 2YPMA 2DJ1A 3A3TA 1J08A 1ACVA 1TU7A 3KJYA 3TOUA 5KN1A 2PN8A 3DVXA 4G10A 2YWMA 3QAGA 1XIYA 5J5NA 4HEA2 4K2XA 2YWOA 5JCGA 1O81A 2CZ3A 2VL3A 3TKRA 1X5CA 4MA9A 5IO0A 5G2ZA 3DD3A 3Q6OA 5ECRB 4K7NA 2GLRA 3C71A 3E9JB 4WXTA 2HSHA 1ST9A 3LGCA 4I5QA 4PUFC 3TUEA 3FR9A 6GSYA 3FK8A 3KXOA 1V98A 3BD2A 2P31A 3DVWA 12GSA 5AGYA 4GSTA 4EKZA 2LQQA 4XRDA 1M7TA 1ZMAA 22GSA 4AJ7A 2L6DA 1SD9A 1WE0A 2C0DA 4F0CA 3APSA 1OC9B 1TDIA 3UBKA 3A2XA 1N2AA 2V2GA 1SKWB 1I9DA 3TCOA 1XFLA 4K7IA 2DJ3A 2IMFA 2BMXA 2KHPA 4YQMA 2KP2A 2H1BA 5J9CA 1V2AA 4ISDA 2JSYA 3MYDA 2VCWA 3FY7A 2H0GA 3K8NA 1Z7PA 3ERFA 2AV4A 3DKSA 3RHBA 2IN3A 4ZL8A 4NMUA 1GSYA 1PGTA 17GSA 5KN2A 2H75A 4KW6A 2R6KA 4YKFA 1TP9A 3GKXA 4WF4A 4BVYB 1AC1A 1SYXA 1B9XC 4FQUA 4WETA 1PFOA 2VO4A 4IGJA 2VLVA 3HZ4A 3IBHA 1PRXA 4TN8A 3CBUA 1TJDA 5HFGA 2JACA 3TJGA 2YV7A 1PKWA 1T1VA 5CRWA 1AXDA 5DQYA 2K8SA 1EV9A 6GSTA 3F63A 4NPBA 1ZZYA 5E4WA 3GX8A 2ON7A 3ZYWA 2YZUA 1AIUA 3BCKA 4WF5A 3WD6A 2CV4A 2L4QA 3IAS2 3TJKA 1OKDA 2VL2C 4J56E 2R5GA 3G7JA 4G0IA 1TOFA 4O5RA 3MAKA 1M0UA 2NVLA 5B6MA 3RPPA 2LJRA 1TRWA 2R0PA 5A5KA 1XVQA 2KLXA 5HQPA 1AQVA 2LKUA 2MZCA 4PX1A 1TI3A 4MH3A 1XWCA 4YAVA 4WR4A 3IHQA 2G0FA 5F06A 3HXSA 5B8BA 1ML6A 2RLIA 4HI7A 5AN1A 1EZKA 5IOXA 3GRXA 4TKYA 1M9BA 2V1MA 1GL8A 1BEDA 2IMKA 4DSRA 1JZWA 4OFNA 3F4TA 5ECNB 1GH2A 5AIVA 2O8VB 1E6BA 4I8BA 1V57A 2E0QA 1XOAA 4GXZA 4DEJA 1GP1A 3D0ZA 2WULA 2I81A 4BIKA 4N0VA 2DMMA 4AJ8A 1THXA 4ECBA 2YWIA 4YQUA 3EE2A 1VF1A 3MIXA 1RW1A 1SD8A 3PINA 2X8HA 2TRXA 2I1UA 2QSIA 1TU8A 2V6OA 1OE7A 4MF5A 3M9KA 3WGEA 1K3LA 2ALBA 2XHFA 2TIRA 5J4UA 3DXBA 3HJOA 2VCQA 1PKZA 4KA0A 3D4TA 2IMDA 1AAZA 3EC3A 2HRFA 1YDKA 3PGTA 4XS1A 1S3AA 1PX6A 3DWVA 3FKFA 1PL2A 1HD2A 2HLSA 4TVEA 1GUKA 3IR4A 3KD0A 1YF1A 5F0GA 2DSAA 3D4MA 3QD9A 1N8JA 2YN1A 2H0HA 3GSSA 1PN0A 4GRFA 1IYHA 1BJXA 5KOXA 3GN3A 1U6TA 3SBCA 4EC0A 5A4VA 4HZ4A 3KM6A 4FYUA 5KN0A 4G19A 2YWNA 3A5WA 2GGTA 2IPAA 1SKRB 4FYBA 4AGSA 4DVCA 1U3AA 1PA3A 2WRTA 3I6AA 1LBKA 6GSXA 5DVBA 3M3MA 1YZXA 1QGVA 2O89A 4MZCA 3ZVJA 3GHAA 3F6FA 1T4ZA 5G30A 5F07A 3LFLA 3IHGA 3H1NA 3EWLA 3FHKA 4WKWA 5JCUA 2FLSA 5HFKA 3TKQA 4TR0A 3ZFLA 1TK5B 3LG6A 2I9HA 1QXHA 2K6VA 3R3EA 5HR1A 2WDUA 2MBSA 4QL7A 5HR0A 4GSNA 3EMXA 3VPTA 1EEMA 4EIQA 4IP1A 3UJ1A 2H1DA 4USSA 1USBA 3PH9A 3M8NA 4ID0A 4ZBBA 1G6YA 1GLPA 2B7JA 2CX4A 1XXUA 3TRPA 7GSSA 1XOBA 5COHA 1IYIA 4TXOA 4OWYA 4J2FA 1V58A 1WOUA 2H72A 1B4QA 4POBA 2HRNA 4FH8A 2LRCA 3GURA 2FNOA 2A4VA 3HD5A 5JWRB 1X5EA 4JEDA 1OAZA 5IMDA 1K0CA 2MMOA 1GSFA 4KGIA 1F2EA 1GUHA 16GSA 1QQ2A 3IV4A 2EIOA 3QFBC 2CT6A 2V6KA 1JLWA 2C3QA 2HYXA 3ZL5A 4RQXA 4TW5A 2GTUA 4YKGA 2ZNMA 1A0FA 1FG4A 2LRTA 3HJMA 4E8EA 5HR3A 3F9UA 2LNSA 1XW9A 4Q5QA 4RI6A 2LSTA 4BL7B 5D93A 2OA7A 3VK9A 5IMVA 1QK8A 3GL5A 2PU9C 1YF0A 1XVWA 3ZLPA 4EUYA 1GSDA 2WS2A 4IQ1A 5FHIA 2MBTA 5G5FA 5CP1A 2KOKA 1PSQA 3ZITA 4KUNA 2FD3A 4PURA 2GVPA 1YKCA 2DLXA 3KTBA 4ACSA 3KMOA 1R5PA 3F4RA 3DGQA 2B1KA 3G9BA 3EYTA 4NAXA 5CRHA 4KSMA 5C04A 5IM9A 3TKSA 2WFCA 4Z7XA 1EGOA 3EURA 5KN3A 4ECJA 1B48A 1FOHA 1A2LA 4X4JA 2OKAA 3RPNA 3A2WA 3TB2A 3HA9A 2XC2A 1GNEA 1GUMA 4RUVA 3CSJA 4ZIJA 2V32A 3QCPA 1PQNA 1HNBA 2WB9A 5IPGA 2GSRA 5F05A 4F0BA 1F9MA 2FA4A 4XCSA 3IRAA 3KH9A 3GH9A 2VIMA 3H93A 5G5EA 3UAPA 5D9XA 3RDWA 1SK0A 1U3IA 2L6CA 4GF0A 1OC3A 2EC4A 2YJ7A 1Z7RA 2Z9SA 5L71A 1XCCA 4OMVA 4PGTA 3FYGA 4Z2UA 1H75A 3C8EA 2HT9A 1ZCPA 1TRSA 2GSTA 1S3DA 1SL0B 1T4YA 5CRGA 3APQA 2JZRA 2JL4A 1DE1A 5KOWA 2N5BA 5AIXA 3QMXA 1DBYA 3LYPA 2G2QA 2DKHA 4L5OA 1EP8A 2LUSA 2H76A 3RBTA 3VFIA 2CVKA 2RUFA 5E59A 3KP9A 2RM5A 5IMCA 1VRSD 3FEUA 4BA7A 4KSOA 3R2QA 1X0RA 4TXOB 1THOA 4V1Ag 2GT5A 3QR6A 3UOMA 3ZRDA 3FZ9A 4EIPA 11GSA 5ID2A 4WBRD 5ECKB 2DIZA 2B6MA 2LNTA 1Y25A 2K18A 3ZMKA 3FZAA 1XWKA 4MZWA 4EL1A 2L5LA 4TOPA 3QAWA 1X9SB 3NZNA 1ERTA 1O73A 3ME8A 4TR4A 3VI7A 2C0FA 1Z9HA 1FVKA 2L59A 1A0RP 1B4PA 4N30A 2H71A 2E2MA 4JE1A 4MNNA 1K0AA 4CHSA 4K0NA 1Y6EA 1WIKA 2PUKC 4MPGA 2R4VA 1TKDB 3M9JA 2FA8A 3LSZA 4MH2A 3I69A 3MWHA 1JZRA 2XPDA 4ZB9A 1SJZA 1I5GA 2LTKA 3GTUA 5DALA 2H6ZA 2DMLA 1FO5A 3KIJA 2C3NA 3J7Yb 5B8AA 2PGTA 3ZIJA 1EP7A 3LJRA 2LJAA 1F37A 3L4NA 3I43A 2B3SA 18GSA 4KDXA 2AJQB 4K8MA 3GA4A 2B1LA 4IVFA 5A4WA 2QA1A 2KUCA 4EDYA 3JCML 4PNGA 3HHVA 1QUWA 3V1WA 2OADA 3LW9A 1ABAA 3GFKA 4KX4A 4EVMA 1G7EA 3ED3A 2OBKA 1F6MC 3D6IA 2HXKA 2P0GA 1R5AA 2AHEA 2E2GA 4MF6A 3TDGA 4HDEA 3QAVA 3ZTLA 3H4KA 2CX3A 4ZL7A 4LA1A 1O8XA 2JZSA 4N10A 4KDUA 2PVQA 1JZOA 5DBQA 6GSSA 4ML6A 4AF2A 3F0IA 2IMEA 2WGRA 2DJ0A 2F8FA 3WT1A 2LRNA 2VLTA 2H70A 1YQ1A 4YQVA 3UL3A 3IC4A 4MLYA 1GSEA 2CVBA 3KZQA 2WJUA 4NV5A 3GYKA 2C0GA 2H1AA 3J7Yk 1HNCA 1NW2A 2LQOA 5G1LA 4KE3A 2KP1A 3VPQA 3IE3A 4ECCA 1S3CA 4Z2TA 3ME7A 4OCEA 4WR5A 5IPHA 1VF2A 3HYPA 1XW6A 4O5UA 3HJPA 1RK4A 2ON5A 4XS6A 4N0ZA 3PPUA 1A2JA 1K0NA 1JFUA 3Q18A 3H8QA 1VF3A 2VM1A 1FOVA 2CA8A 2H6XA 2YCDA 4KCEA 5IMAA 2H01A 3P8WA 4LL1B 5G31A 2YANA 3C7MA 2NBSA 1SYRA 3W6GA 1SJIA 2VCVA 5HR2A 5GAND 4IJ3A 3D21A 1DSBA 3GTUB 5DALB 4TR3A 5H5QA 3CXGA 2CVDA 14GSA 2FY6A 4E8HA 4TRXA 4IJIA 2YZHA 4K9ZA 3OR5A 1OE8A 3NIVA 1B9YC 5GSSA 5GZZB 4V2NA 4CY8A 5GAPD 3MSZA 3QPMA 3CMIA 4I2UA 3EVIA 3Q19A 3M0FA 2K9FA 1T3BA 3CSIA 2VAFA 1HQOA 4JZQA 1GTAA 3BBYA 2N5AA 1HNAA 5DJLA 5BMUA 4HU9A 2LJKA 5DDLA 5IMFA 1OYJA 3TKPA 4V2LA 2YJHA 3FMWA 1A2MA 2CAIA 4EXJA 3DRNA 2F3MA 1X9WB 4PQ1A 1GSSA 1EWXA 3WT2A 1NHYA 4A5PA 4WEYA 2H0IA 3IK9A 3IDVA 4TXVA 1G7OA 4X43A 1K0OA 1CQGA 2X8CA 1B8XA 1MDIA 4MABA 5D73A 4HQSA 4MF7A 5ABRA 2LEGA 2WZ9A 4RQRA 5EVOA 5IQYA 2R2JA 2BTOT 4F82A 3GV1A 2C8UA 2XPEA 4IELA 3L9VA 3VWVA 3GKKA 1O85A 4PTSA 4RI7A 1FAAA 2IL3A 4XHMA 4V1Ap 5J3RA 2P5QA 1Z6MA 4PQHA 5LD0A 4EDZA 3US3A 1Q4JA 4XS4A 4GQCA 5DJMA 5ECSA 1XWBA 2H74A 1W4VA 1GNWA 3KGKA 2R37A 1X5DA 4PXOA 3EMPA 3ZFBA 4L5LA 2F9SA 1KEBA 4MCUA 2JZTA 1YKAA 1TRVA 2HE3A 5KEJA 1SK1A 5DCGA 3FZ4A 2DJKA 5D9WA 1ZOFA 4HQZA 3BOAA 3LWAA 3C73A 4EF0A 6GSVA 2CZ2A 1VGLA 2DIYA 4ML1A 3GKMA 3D5JA 2YV9A 1TK0B 3FZ5A 4MP4A 3ISOA 2WCIA 1YEXA 4G9HA 2A4HA 6GSWA 3QFAC 2LV3A 1K0BA 3EU4A 4LL4B 1LJRA 1CQHA 2HNLA 2M72A 3ZMLA 4ZBDA 3UARA 3VURA 2J9HA 2VD0A 3FRCA 1ERVA 2A2RA 4KH7A 2PERA 5J9BA 1NM3A 4K2DA 2FHEA 2H19A 4HJ2A 3ERWA 3F8UA 1MTCA 1A8LA 1GTUA 1UN2A 1A8YA 2J23A 1YY7A 1TXXA 4KDYA 2X64A 3F3QA 3G7YA 2P5RA 4WBJA 1DUGA 1SL2B 2IJYA 5C00A 2C1YA 3G7IA 4Q5RA 2HZEA 4K5RA 2MMAA 3F3RA 2HFDA 3HY2A 1H4OA 2AB6A 4ZBAA 1JLVA 4LMVA 4ZB6A 4I2TA 4K6XA 2HZFA 3VI5A 4FO5A 4IHUA 3WYWA 2ZUPA 8GSSA 3ZREA 1M9AA 20GSA 4K7OA 4F9ZA 2O87A 2PVOC 4EO3A 3GSTA 4F2IA 1GTBA 4V2MA 3P2AA 1GULA 2YP6A 3DIEA 3L78A 5JWQB 2X4AA 2RUEA 2X99A 1RQMA 2REMA 1YEPA 2V41A 4MJEA 2H30A 3MDKA 4JR6A 2GSQA 2HI7A 3UMAA 4Q5FA 5DCHA 5D9VA 1WRYA 1AQXA 2LS5A 2QA2A 4TR1A 1GSUA 4ZB8A 4HOJA 3GH6A 3UVHA 3NOFA 3I9V2 4IN0A 2B5XA 3LORA 1JHBA 2XBQA 4K1FA 2I4AA 4KCAA 4JBBA 3U6VA 4IKHA 5ECMB 2OJLA 3HVNA 3H79A 3LEFA 5H5SA 4LLRA 2X8GA 3CQFA 1OKTA 1JZDA 4XRAA 2EIQA 4NWYA 2HSMA 1EOHA 19GSA 5DAKA 3HZ8A 4BVXA 5D9TA 2B7KA 1BX9A 1FB6A 3KEBA 2R3XA 2GQLA 1Z6NA 4ZILA 4ICYA 5F8BA 1Z5YE 1GTIA 1SK2A 3RAZA 2OACA 1UC7A 2OE3A 2FGXA 5ECPB 1KBNA 13GSA 5EPFA 4IW9A 4YAPA 5JCWA 3TGZA 1M2BA 3CRUA 4K5SA 2R0CA 3QOUA 4IP6A 4ZL9A 3GNJA 3IAM2 5IOWA 4CW9A 4BWQA 1ZYQB 3HDCA 1GSQA 4CDOA 4DSSA 2VCTA 1URMA 3TJFA 1KTEA 4HZ2A 2TRCP 3RHCA 1EV4A 3GKNA 4MPFA 2EIRA 2IFQA 2OBIA 3TRQA 2A2SA 1TTZA 3IOSA 1ERUA 1ZYNA 2IMIA 2JADA 1XBSA 1NHOA 3TJJA 1MD3A 5AISA 3W8SA 1XW5A 1ERWA 1BAYA 4MDCA 3D22A 3LQ7A 4FYCA 3WGXA 1FB0A 3C1SA 3VLNA 2HRKA 1PX7A 4Q5NA 3VWWA 2UZ8A 1DE2A 5BRTA 3F4SA 1XPVA 3WGDA 2HZEB 1AW9A 3W8JA 4OO4A 4IBPA 4MZBA 4ULXA 3LXTA 1QMVA 2GQMA 3F6DA 4MJCA 2B5YA 3CSHA 1Q98A 1MEKA 4QL9A 1Z3EA 6GSUA 4HS1A 4F03A 5JWOB 2FUG2 4ILFA 4G2EA 4HUAA 3E3EA 4PNFA 5HFIA 4HJMA 2A2PA 1XZOA 1F3AA 2IIYA 3LYKA 5A4UA 5ECOB 1G6WA 2C0EA 3LXZA 4Z2RA 3EPTA 3ZVJD 4TR1B 3UBLA 1X9MB 2RIIA 5ENUA 1AUCA 2GQKA 2VL9A 5ID2B 1T00A 3Q74A 4BWSA 2AYTA 1K3YA 2DJ2A 3CTGA 4O5QA 1PMTA 5FWGA 2VLUA 2FWGA 5IMZA 3DYRA 3O76A 2C4JA 1XWGA 4ECIA 5CREA 2FCHA 1QFNA 3O6TA 5DAKB 1V40A 2GS3A 4BVXB 5B7CA 2L4CA 2L57A 1MDJA 4MMMA 5ECLB 4QQ7A 3A5IA 3KP8A 4AJ6A 3M1GA 1ZL9A 1J9BA 2B5EA 1UA5A 2NTOA 1FW1A 3L9SA 2GZYA 3IA1A 4X0XA 1AQWA 3ERGA 4PQIA 3TKSE 1OVNA 2H8LA 1EEJA 3TRXA 9GSSA 2GZZA 3L0HA 1EGRA 5EL8A 5ECQB 3UIWA 4DSSB 4BL7A 2F8AA 1PL1A 1SENA 3O3TA 1C72A 4EE0A 3GX0A 4XIHA 4MJBA 1BG5A 3U5RE 1MDKA 3EU3A 4G0LA 2R0GA 4POKA 1R26A 2IFQB 4PUAA 5D8IA 3VWUA 1M2DA 1K3OA 4POMA 3GIXA 4GQFA 1SU9A 2GT6A 4JU5A 3KMNA 2D2ZA 1NSWA 2M80A 1PD21 3UEMA 2VUPA 3CYNA 3BJ5A 3IC8A 4FIWA 5ECHB 1SL1B 4N11A 4O7HA 3HVSA 5ELAA 3KCMA 3UVTA 1R7HA 3FR3A 3A2VA 4NHWA 1ZYEA 5LCZA 1MD4A 4JRRA 5LNKe 2VOCA 4IQAA 1E2YA 3GL3A 2PBJA 4MJAA 1A24A 2O85A 2OE0A 2VL2A 1WWJA 3HVXA 3GUSA 3TKSC 1M3JA 1A23A 3DMLA 3IPZA 1XWAA 4NXIA 3DEXA 1TRUA 2DKIA 2I3YA 1U87A 4KNDA 4JR4A 4P3YB 3N9JA 2GZPA 5CO3A 4H86A 4KF9A 2H66A 3VWXA 1GWCA 5IO2A 3E0UA 4NV2A 5CYYA 1M2AA 2QGVA 2PMTA 5D96A 4D73A
chains in the Genus database with same CATH topology
2NPBA 3N5OA 2MMZA 2YNXA 1ZYPA 1V9WA 2H6YA 3FR6A 2H73A 1WJKA 2O7KA 2C3TA 3APOA 2N5FA 3P7XA 1O8WA 3HCZA 4IS0A 3TOTA 1FHEA 3QDNA 2HRAA 1K0MA 1T7PB 2ES7A 2YOIA 2F51A 2E7PA 3EINA 4OFMA 4O32A 5DQSA 3C1RA 2HSYA 2VD1A 1GLQA 2FWEA 3FW2A 3ZIVA 1GRXA 1WPIA 1ON4A 2K8VA 4CY6A 2XBIA 4K0GA 4I97A 3S9FA 1KNGA 1FVJA 5ELGA 1BYEA 1K0DA 1O7UA 2VM2A 5GSTA 3IXRA 1G0TA 2OE1A 1TW9A 1R4WA 1YJ6A 4L0WA 2QKEA 4ZXGA 1VF4A 4BPYA 4L8EA 4MK3A 1SJ6A 1J0FA 10GSA 3L9UA 4YH2A 1SKSB 3MNGA 1ZGNA 4OCFA 2GDRA 4GTUA 3IK7A 1OC9A 4KB3A 5H5RA 5EY6A 2ZCTA 4GWRA 5G1KA 4HU7A 4DSQA 1PN9A 2BJXA 2X49A 4J57E 1TK8B 1BQ7A 1M99A 1O6JA 4L0UA 3CRTA 2H1GA 4G0KA 3HVVA 5FT3A 3BCIA 3SWLA 2C80A 1ILOA 2JU5A 2CAQA 2QC7A 5CRDA 4X1UA 3HKRA 2L5OA 3P90A 2DJJA 2MMNA 3TJBA 1WP0A 2GSSA 3GMFA 5INYA 4GSSA 2IWTA 4BVYA 1UVZA 4KAEA 4NHZA 5J41A 4XTSA 4OD7A 5IIZA 1TI1A 2DC5A 4GCIA 4O92A 4POLA 2AAWA 2RM6A 2VCXA 4GLTA 1WMJA 1EOGA 2PPTA 2JSZA 1OC8A 2PWJA 3KTLA 2MYGA 3PR8A 4D73B 1HYUA 5CAXA 1W89A 2CQ9A 1U88A 4OFTA 3ZZXA 2FWFA 2DBCA 2M46A 2FWHA 2AUVA 3KH7A 5CNWA 2NDOA 4XS4B 5ECIB 1LU4A 1T8EB 4OO5A 3AY8A 4I6XA 3CTFA 5B6NA 2VCZA 1F3BA 4LMWA 2YPMA 2DJ1A 3A3TA 1J08A 1ACVA 1TU7A 3KJYA 3TOUA 5KN1A 2PN8A 3DVXA 4G10A 2YWMA 3QAGA 1XIYA 5J5NA 4HEA2 4K2XA 2YWOA 5JCGA 1O81A 2CZ3A 2VL3A 3TKRA 1X5CA 4MA9A 5IO0A 5G2ZA 3DD3A 3Q6OA 5ECRB 4K7NA 2GLRA 3C71A 3E9JB 4WXTA 2HSHA 1ST9A 3LGCA 4I5QA 4PUFC 3TUEA 3FR9A 6GSYA 3FK8A 3KXOA 1V98A 3BD2A 2P31A 3DVWA 12GSA 5AGYA 4GSTA 4EKZA 2LQQA 4XRDA 1M7TA 1ZMAA 22GSA 4AJ7A 2L6DA 1SD9A 1WE0A 2C0DA 4F0CA 3APSA 1OC9B 1TDIA 3UBKA 3A2XA 1N2AA 2V2GA 1SKWB 1I9DA 3TCOA 1XFLA 4K7IA 2DJ3A 2IMFA 2BMXA 2KHPA 4YQMA 2KP2A 2H1BA 5J9CA 1V2AA 4ISDA 2JSYA 3MYDA 2VCWA 3FY7A 2H0GA 3K8NA 1Z7PA 3ERFA 2AV4A 3DKSA 3RHBA 2IN3A 4ZL8A 4NMUA 1GSYA 1PGTA 17GSA 5KN2A 2H75A 4KW6A 2R6KA 4YKFA 1TP9A 3GKXA 4WF4A 4BVYB 1AC1A 1SYXA 1B9XC 4FQUA 4WETA 2VO4A 4IGJA 2VLVA 3HZ4A 3IBHA 1PRXA 4TN8A 3CBUA 1TJDA 5HFGA 2JACA 3TJGA 2YV7A 1PKWA 1T1VA 5CRWA 1AXDA 5DQYA 2K8SA 1EV9A 6GSTA 3F63A 4NPBA 1ZZYA 5E4WA 3GX8A 2ON7A 3ZYWA 2YZUA 1AIUA 3BCKA 4WF5A 3WD6A 2CV4A 2L4QA 3IAS2 3TJKA 1OKDA 2VL2C 4J56E 2R5GA 3G7JA 4G0IA 1TOFA 4O5RA 3MAKA 1M0UA 2NVLA 5B6MA 3RPPA 2LJRA 1TRWA 2R0PA 5A5KA 1XVQA 2KLXA 5HQPA 1AQVA 2LKUA 2MZCA 4PX1A 1TI3A 4MH3A 1XWCA 4YAVA 4WR4A 3IHQA 2G0FA 5F06A 3HXSA 5B8BA 1ML6A 2RLIA 4HI7A 5AN1A 1EZKA 5IOXA 3GRXA 4TKYA 1M9BA 2V1MA 1GL8A 1BEDA 2IMKA 4DSRA 1JZWA 4OFNA 3F4TA 5ECNB 1GH2A 5AIVA 2O8VB 1E6BA 4I8BA 1V57A 2E0QA 1XOAA 4GXZA 4DEJA 1GP1A 3D0ZA 2WULA 2I81A 4N0VA 2DMMA 4AJ8A 1THXA 4ECBA 2YWIA 4YQUA 3EE2A 1VF1A 3MIXA 1RW1A 1SD8A 3PINA 2X8HA 2TRXA 2I1UA 2QSIA 1TU8A 2V6OA 1OE7A 4MF5A 3M9KA 3WGEA 1K3LA 2ALBA 2XHFA 2TIRA 5J4UA 3DXBA 3HJOA 2VCQA 1PKZA 4KA0A 3D4TA 2IMDA 1AAZA 3EC3A 2HRFA 1YDKA 3PGTA 4XS1A 1S3AA 1PX6A 3DWVA 3FKFA 1PL2A 1HD2A 2HLSA 4TVEA 1GUKA 3IR4A 3KD0A 1YF1A 5F0GA 2DSAA 3D4MA 3QD9A 1N8JA 2YN1A 2H0HA 3GSSA 1PN0A 4GRFA 1IYHA 1BJXA 5KOXA 3GN3A 1U6TA 3SBCA 4EC0A 5A4VA 4HZ4A 3KM6A 4FYUA 5KN0A 4G19A 2YWNA 3A5WA 2GGTA 2IPAA 1SKRB 4FYBA 4AGSA 4DVCA 1U3AA 1PA3A 2WRTA 3I6AA 1LBKA 6GSXA 5DVBA 3M3MA 1YZXA 1QGVA 2O89A 4MZCA 3ZVJA 3GHAA 3F6FA 1T4ZA 5G30A 5F07A 3LFLA 3IHGA 3H1NA 3EWLA 3FHKA 4WKWA 5JCUA 2FLSA 5HFKA 3TKQA 4TR0A 3ZFLA 1TK5B 3LG6A 2I9HA 1QXHA 2K6VA 3R3EA 5HR1A 2WDUA 2MBSA 4QL7A 5HR0A 4GSNA 3EMXA 3VPTA 1EEMA 4EIQA 4IP1A 3UJ1A 2H1DA 4USSA 1USBA 3PH9A 3M8NA 4ID0A 4ZBBA 1G6YA 1GLPA 2B7JA 2CX4A 1XXUA 3TRPA 7GSSA 1XOBA 5COHA 1IYIA 4TXOA 4OWYA 4J2FA 1V58A 1WOUA 2H72A 1B4QA 4POBA 2HRNA 4FH8A 2LRCA 3GURA 2FNOA 2A4VA 3HD5A 5JWRB 1X5EA 4JEDA 1OAZA 5IMDA 1K0CA 2MMOA 1GSFA 4KGIA 1F2EA 1GUHA 16GSA 1QQ2A 3IV4A 2EIOA 3QFBC 2CT6A 2V6KA 1JLWA 2C3QA 2HYXA 3ZL5A 4RQXA 4TW5A 2GTUA 4YKGA 2ZNMA 1A0FA 1FG4A 2LRTA 3HJMA 4E8EA 5HR3A 3F9UA 2LNSA 1XW9A 4Q5QA 4RI6A 2LSTA 4BL7B 5D93A 2OA7A 3VK9A 5IMVA 1QK8A 3GL5A 2PU9C 1YF0A 1XVWA 3ZLPA 4EUYA 1GSDA 2WS2A 4IQ1A 5FHIA 2MBTA 5G5FA 5CP1A 2KOKA 1PSQA 3ZITA 4KUNA 2FD3A 4PURA 2GVPA 1YKCA 2DLXA 3KTBA 4ACSA 3KMOA 1R5PA 3F4RA 3DGQA 2B1KA 3G9BA 3EYTA 4NAXA 5CRHA 4KSMA 5C04A 5IM9A 3TKSA 2WFCA 4Z7XA 1EGOA 3EURA 5KN3A 4ECJA 1B48A 1FOHA 1A2LA 4X4JA 2OKAA 3RPNA 3A2WA 3TB2A 3HA9A 2XC2A 1GNEA 1GUMA 4RUVA 3CSJA 4ZIJA 2V32A 3QCPA 1PQNA 1HNBA 2WB9A 5IPGA 2GSRA 5F05A 4F0BA 1F9MA 2FA4A 4XCSA 3IRAA 3KH9A 3GH9A 2VIMA 3H93A 5G5EA 3UAPA 5D9XA 3RDWA 1SK0A 1U3IA 2L6CA 4GF0A 1OC3A 2EC4A 2YJ7A 1Z7RA 2Z9SA 5L71A 1XCCA 4OMVA 4PGTA 3FYGA 4Z2UA 1H75A 3C8EA 2HT9A 1ZCPA 1TRSA 2GSTA 1S3DA 1SL0B 1T4YA 5CRGA 3APQA 2JZRA 2JL4A 1DE1A 5KOWA 2N5BA 5AIXA 3QMXA 1DBYA 3LYPA 2G2QA 2DKHA 4L5OA 1EP8A 2LUSA 2H76A 3RBTA 3VFIA 2CVKA 2RUFA 5E59A 3KP9A 2RM5A 5IMCA 1VRSD 3FEUA 4BA7A 4KSOA 3R2QA 1X0RA 4TXOB 1THOA 4V1Ag 2GT5A 3QR6A 3UOMA 3ZRDA 3FZ9A 4EIPA 11GSA 5ID2A 4WBRD 5ECKB 2DIZA 2B6MA 2LNTA 1Y25A 2K18A 3ZMKA 3FZAA 1XWKA 4MZWA 4EL1A 2L5LA 4TOPA 3QAWA 1X9SB 3NZNA 1ERTA 1O73A 3ME8A 4TR4A 3VI7A 2C0FA 1Z9HA 1FVKA 2L59A 1A0RP 1B4PA 4N30A 2H71A 2E2MA 4JE1A 4MNNA 1K0AA 4CHSA 4K0NA 1Y6EA 1WIKA 2PUKC 4MPGA 2R4VA 1TKDB 3M9JA 2FA8A 3LSZA 4MH2A 3I69A 3MWHA 1JZRA 2XPDA 4ZB9A 1SJZA 1I5GA 2LTKA 3GTUA 5DALA 2H6ZA 2DMLA 1FO5A 3KIJA 2C3NA 3J7Yb 5B8AA 2PGTA 3ZIJA 1EP7A 3LJRA 2LJAA 1F37A 3L4NA 3I43A 2B3SA 18GSA 4KDXA 2AJQB 4K8MA 3GA4A 2B1LA 4IVFA 5A4WA 2QA1A 2KUCA 4EDYA 3JCML 4PNGA 3HHVA 1QUWA 3V1WA 2OADA 3LW9A 1ABAA 3GFKA 4KX4A 4EVMA 1G7EA 3ED3A 2OBKA 1F6MC 3D6IA 2HXKA 2P0GA 1R5AA 2AHEA 2E2GA 4MF6A 3TDGA 4HDEA 3QAVA 3ZTLA 3H4KA 2CX3A 4ZL7A 4LA1A 1O8XA 2JZSA 4N10A 4KDUA 2PVQA 1JZOA 5DBQA 6GSSA 4ML6A 4AF2A 3F0IA 2IMEA 2WGRA 2DJ0A 2F8FA 3WT1A 2LRNA 2VLTA 2H70A 1YQ1A 4YQVA 3UL3A 3IC4A 4MLYA 1GSEA 2CVBA 3KZQA 2WJUA 4NV5A 3GYKA 2C0GA 2H1AA 3J7Yk 1HNCA 1NW2A 2LQOA 5G1LA 4KE3A 2KP1A 3VPQA 3IE3A 4ECCA 1S3CA 4Z2TA 3ME7A 4OCEA 4WR5A 5IPHA 1VF2A 3HYPA 1XW6A 4O5UA 3HJPA 1RK4A 2ON5A 4XS6A 4N0ZA 3PPUA 1A2JA 1K0NA 1JFUA 3Q18A 3H8QA 1VF3A 2VM1A 1FOVA 2CA8A 2H6XA 2YCDA 4KCEA 5IMAA 2H01A 3P8WA 4LL1B 5G31A 2YANA 3C7MA 2NBSA 1SYRA 3W6GA 1SJIA 2VCVA 5HR2A 5GAND 4IJ3A 3D21A 1DSBA 3GTUB 5DALB 4TR3A 5H5QA 3CXGA 2CVDA 14GSA 2FY6A 4E8HA 4TRXA 4IJIA 2YZHA 4K9ZA 3OR5A 1OE8A 3NIVA 1B9YC 5GSSA 5GZZB 4V2NA 4CY8A 5GAPD 3MSZA 3QPMA 3CMIA 4I2UA 3EVIA 3Q19A 3M0FA 2K9FA 1T3BA 3CSIA 2VAFA 1HQOA 4JZQA 1GTAA 3BBYA 2N5AA 1HNAA 5DJLA 5BMUA 4HU9A 2LJKA 5DDLA 5IMFA 1OYJA 3TKPA 4V2LA 2YJHA 3FMWA 1A2MA 2CAIA 4EXJA 3DRNA 2F3MA 1X9WB 4PQ1A 1GSSA 1EWXA 3WT2A 1NHYA 4A5PA 4WEYA 2H0IA 3IK9A 3IDVA 4TXVA 1G7OA 4X43A 1K0OA 1CQGA 2X8CA 1B8XA 1MDIA 4MABA 5D73A 4HQSA 4MF7A 5ABRA 2LEGA 2WZ9A 4RQRA 5EVOA 5IQYA 2R2JA 2BTOT 4F82A 3GV1A 2C8UA 2XPEA 4IELA 3L9VA 3VWVA 3GKKA 1O85A 4PTSA 4RI7A 1FAAA 2IL3A 4XHMA 4V1Ap 5J3RA 2P5QA 1Z6MA 4PQHA 5LD0A 4EDZA 3US3A 1Q4JA 4XS4A 4GQCA 5DJMA 5ECSA 1XWBA 2H74A 1W4VA 1GNWA 3KGKA 2R37A 1X5DA 4PXOA 3EMPA 3ZFBA 4L5LA 2F9SA 1KEBA 4MCUA 2JZTA 1YKAA 1TRVA 2HE3A 5KEJA 1SK1A 5DCGA 3FZ4A 2DJKA 5D9WA 1ZOFA 4HQZA 3BOAA 3LWAA 3C73A 4EF0A 6GSVA 2CZ2A 1VGLA 2DIYA 4ML1A 3GKMA 3D5JA 2YV9A 1TK0B 3FZ5A 4MP4A 3ISOA 2WCIA 1YEXA 4G9HA 2A4HA 6GSWA 3QFAC 2LV3A 1K0BA 3EU4A 4LL4B 1LJRA 1CQHA 2HNLA 2M72A 3ZMLA 4ZBDA 3UARA 3VURA 2J9HA 2VD0A 3FRCA 1ERVA 2A2RA 4KH7A 2PERA 5J9BA 1NM3A 4K2DA 2FHEA 2H19A 4HJ2A 3ERWA 3F8UA 1MTCA 1A8LA 1GTUA 1UN2A 1A8YA 2J23A 1YY7A 1TXXA 4KDYA 2X64A 3F3QA 3G7YA 2P5RA 4WBJA 1DUGA 1SL2B 2IJYA 5C00A 2C1YA 3G7IA 4Q5RA 2HZEA 4K5RA 2MMAA 3F3RA 2HFDA 3HY2A 1H4OA 2AB6A 4ZBAA 1JLVA 4LMVA 4ZB6A 4I2TA 4K6XA 2HZFA 3VI5A 4FO5A 4IHUA 3WYWA 2ZUPA 8GSSA 3ZREA 1M9AA 20GSA 4K7OA 4F9ZA 2O87A 2PVOC 4EO3A 3GSTA 4F2IA 1GTBA 4V2MA 3P2AA 1GULA 2YP6A 3DIEA 3L78A 5JWQB 2X4AA 2RUEA 2X99A 1RQMA 2REMA 1YEPA 2V41A 4MJEA 2H30A 3MDKA 4JR6A 2GSQA 2HI7A 3UMAA 4Q5FA 5DCHA 5D9VA 1WRYA 1AQXA 2LS5A 2QA2A 4TR1A 1GSUA 4ZB8A 4HOJA 3GH6A 3UVHA 3NOFA 3I9V2 4IN0A 2B5XA 3LORA 1JHBA 2XBQA 4K1FA 2I4AA 4KCAA 4JBBA 3U6VA 4IKHA 5ECMB 2OJLA 3H79A 3LEFA 5H5SA 4LLRA 2X8GA 1OKTA 1JZDA 4XRAA 2EIQA 4NWYA 2HSMA 1EOHA 19GSA 5DAKA 3HZ8A 4BVXA 5D9TA 2B7KA 1BX9A 1FB6A 3KEBA 2R3XA 2GQLA 1Z6NA 4ZILA 4ICYA 5F8BA 1Z5YE 1GTIA 1SK2A 3RAZA 2OACA 1UC7A 2OE3A 2FGXA 5ECPB 1KBNA 13GSA 5EPFA 4IW9A 4YAPA 5JCWA 3TGZA 1M2BA 3CRUA 4K5SA 2R0CA 3QOUA 4IP6A 4ZL9A 3GNJA 3IAM2 5IOWA 4CW9A 4BWQA 1ZYQB 3HDCA 1GSQA 4CDOA 4DSSA 2VCTA 1URMA 3TJFA 1KTEA 4HZ2A 2TRCP 3RHCA 1EV4A 3GKNA 4MPFA 2EIRA 2IFQA 2OBIA 3TRQA 2A2SA 1TTZA 3IOSA 1ERUA 1ZYNA 2IMIA 2JADA 1XBSA 1NHOA 3TJJA 1MD3A 5AISA 3W8SA 1XW5A 1ERWA 1BAYA 4MDCA 3D22A 3LQ7A 4FYCA 3WGXA 1FB0A 3C1SA 3VLNA 2HRKA 1PX7A 4Q5NA 3VWWA 2UZ8A 1DE2A 5BRTA 3F4SA 1XPVA 3WGDA 2HZEB 1AW9A 3W8JA 4OO4A 4IBPA 4MZBA 4ULXA 3LXTA 1QMVA 2GQMA 3F6DA 4MJCA 2B5YA 3CSHA 1Q98A 1MEKA 4QL9A 1Z3EA 6GSUA 4HS1A 4F03A 5JWOB 2FUG2 4ILFA 4G2EA 4HUAA 3E3EA 4PNFA 5HFIA 4HJMA 2A2PA 1XZOA 1F3AA 2IIYA 3LYKA 5A4UA 5ECOB 1G6WA 2C0EA 3LXZA 4Z2RA 3EPTA 3ZVJD 4TR1B 3UBLA 1X9MB 2RIIA 5ENUA 1AUCA 2GQKA 2VL9A 5ID2B 1T00A 3Q74A 4BWSA 2AYTA 1K3YA 2DJ2A 3CTGA 4O5QA 1PMTA 5FWGA 2VLUA 2FWGA 5IMZA 3DYRA 3O76A 2C4JA 1XWGA 4ECIA 5CREA 2FCHA 1QFNA 3O6TA 5DAKB 1V40A 2GS3A 4BVXB 5B7CA 2L4CA 2L57A 1MDJA 4MMMA 5ECLB 4QQ7A 3A5IA 3KP8A 4AJ6A 3M1GA 1ZL9A 1J9BA 2B5EA 1UA5A 2NTOA 1FW1A 3L9SA 2GZYA 3IA1A 4X0XA 1AQWA 3ERGA 4PQIA 3TKSE 1OVNA 2H8LA 1EEJA 3TRXA 9GSSA 2GZZA 3L0HA 1EGRA 5EL8A 5ECQB 3UIWA 4DSSB 4BL7A 2F8AA 1PL1A 1SENA 3O3TA 1C72A 4EE0A 3GX0A 4XIHA 4MJBA 1BG5A 3U5RE 1MDKA 3EU3A 4G0LA 2R0GA 4POKA 1R26A 2IFQB 4PUAA 5D8IA 3VWUA 1M2DA 1K3OA 4POMA 3GIXA 4GQFA 1SU9A 2GT6A 4JU5A 3KMNA 2D2ZA 1NSWA 2M80A 1PD21 3UEMA 2VUPA 3CYNA 3BJ5A 3IC8A 4FIWA 5ECHB 1SL1B 4N11A 4O7HA 3HVSA 5ELAA 3KCMA 3UVTA 1R7HA 3FR3A 3A2VA 4NHWA 1ZYEA 5LCZA 1MD4A 4JRRA 5LNKe 2VOCA 4IQAA 1E2YA 3GL3A 2PBJA 4MJAA 1A24A 2O85A 2OE0A 2VL2A 1WWJA 3HVXA 3GUSA 3TKSC 1A23A 3DMLA 3IPZA 1XWAA 4NXIA 3DEXA 1TRUA 2DKIA 2I3YA 1U87A 4KNDA 4JR4A 4P3YB 3N9JA 2GZPA 5CO3A 4H86A 4KF9A 2H66A 3VWXA 1GWCA 5IO2A 3E0UA 4NV2A 5CYYA 1M2AA 2QGVA 2PMTA 5D96A 4D73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPB A;  3N5O A;  2MMZ A;  2YNX A;  1V9W A;  2H6Y A;  3FR6 A;  2H73 A;  1WJK A;  2O7K A;  2C3T A;  3APO A;  2N5F A;  3P7X A;  1O8W A;  3HCZ A;  4IS0 A;  3TOT A;  1FHE A;  3QDN A;  1K0M A;  1T7P B;  2ES7 A;  2YOI A;  2F51 A;  2E7P A;  3EIN A;  4OFM A;  4O32 A;  5DQS A;  3C1R A;  2HSY A;  2VD1 A;  1GLQ A;  2FWE A;  3FW2 A;  3ZIV A;  1GRX A;  1WPI A;  1ON4 A;  2K8V A;  2XBI A;  4K0G A;  4I97 A;  3S9F A;  1KNG A;  1FVJ A;  5ELG A;  1BYE A;  1K0D A;  1O7U A;  2VM2 A;  5GST A;  3IXR A;  1G0T A;  2OE1 A;  1TW9 A;  1R4W A;  1YJ6 A;  4L0W A;  2QKE A;  4ZXG A;  1VF4 A;  4BPY A;  4L8E A;  4MK3 A;  1SJ6 A;  1J0F A;  10GS A;  3L9U A;  4YH2 A;  1SKS B;  3MNG A;  1ZGN A;  4OCF A;  2GDR A;  4GTU A;  3IK7 A;  1OC9 A;  4KB3 A;  5H5R A;  5EY6 A;  2ZCT A;  4GWR A;  5G1K A;  4HU7 A;  4DSQ A;  1PN9 A;  2BJX A;  4J57 E;  1TK8 B;  1BQ7 A;  1M99 A;  1O6J A;  4L0U A;  3CRT A;  2H1G A;  3HVV A;  5FT3 A;  3BCI A;  3SWL A;  2C80 A;  1ILO A;  2JU5 A;  2CAQ A;  2QC7 A;  5CRD A;  4X1U A;  3HKR A;  2L5O A;  3P90 A;  2DJJ A;  2MMN A;  3TJB A;  1WP0 A;  2GSS A;  3GMF A;  5INY A;  4GSS A;  2IWT A;  4BVY A;  1UVZ A;  4KAE A;  4NHZ A;  5J41 A;  4XTS A;  4OD7 A;  5IIZ A;  1TI1 A;  2DC5 A;  4GCI A;  4O92 A;  4POL A;  2AAW A;  2RM6 A;  2VCX A;  4GLT A;  1WMJ A;  1EOG A;  2PPT A;  2JSZ A;  1OC8 A;  2PWJ A;  3KTL A;  2MYG A;  3PR8 A;  4D73 B;  1HYU A;  5CAX A;  1W89 A;  2CQ9 A;  1U88 A;  4OFT A;  3ZZX A;  2FWF A;  2DBC A;  2M46 A;  2FWH A;  2AUV A;  3KH7 A;  5CNW A;  2NDO A;  4XS4 B;  5ECI B;  1LU4 A;  1T8E B;  4OO5 A;  3AY8 A;  4I6X A;  3CTF A;  5B6N A;  2VCZ A;  1F3B A;  4LMW A;  2YPM A;  2DJ1 A;  3A3T A;  1J08 A;  1ACV A;  1TU7 A;  3KJY A;  3TOU A;  5KN1 A;  2PN8 A;  3DVX A;  4G10 A;  2YWM A;  3QAG A;  1XIY A;  5J5N A;  4HEA 2;  2YWO A;  5JCG A;  1O81 A;  2CZ3 A;  2VL3 A;  3TKR A;  1X5C A;  4MA9 A;  5IO0 A;  5G2Z A;  3DD3 A;  3Q6O A;  5ECR B;  4K7N A;  2GLR A;  3C71 A;  3E9J B;  4WXT A;  2HSH A;  1ST9 A;  3LGC A;  4I5Q A;  4PUF C;  3TUE A;  3FR9 A;  6GSY A;  3FK8 A;  3KXO A;  1V98 A;  3BD2 A;  2P31 A;  3DVW A;  12GS A;  5AGY A;  4GST A;  4EKZ A;  2LQQ A;  4XRD A;  1M7T A;  1ZMA A;  22GS A;  4AJ7 A;  2L6D A;  1SD9 A;  1WE0 A;  2C0D A;  4F0C A;  3APS A;  1OC9 B;  1TDI A;  3UBK A;  3A2X A;  1N2A A;  2V2G A;  1SKW B;  1I9D A;  3TCO A;  1XFL A;  4K7I A;  2DJ3 A;  2IMF A;  2BMX A;  2KHP A;  4YQM A;  2KP2 A;  2H1B A;  5J9C A;  1V2A A;  4ISD A;  2JSY A;  2VCW A;  3FY7 A;  2H0G A;  3K8N A;  1Z7P A;  3ERF A;  2AV4 A;  3DKS A;  3RHB A;  2IN3 A;  4ZL8 A;  4NMU A;  1GSY A;  1PGT A;  17GS A;  5KN2 A;  2H75 A;  4KW6 A;  2R6K A;  1TP9 A;  3GKX A;  4WF4 A;  1AC1 A;  1SYX A;  1B9X C;  4WET A;  2VO4 A;  4IGJ A;  2VLV A;  3HZ4 A;  3IBH A;  1PRX A;  4TN8 A;  3CBU A;  1TJD A;  5HFG A;  2JAC A;  3TJG A;  2YV7 A;  1PKW A;  1T1V A;  5CRW A;  1AXD A;  5DQY A;  2K8S A;  1EV9 A;  6GST A;  3F63 A;  4NPB A;  1ZZY A;  5E4W A;  3GX8 A;  2ON7 A;  3ZYW A;  2YZU A;  1AIU A;  3BCK A;  4WF5 A;  3WD6 A;  2CV4 A;  2L4Q A;  3IAS 2;  3TJK A;  1OKD A;  2VL2 C;  4J56 E;  2R5G A;  3G7J A;  1TOF A;  4O5R A;  3MAK A;  1M0U A;  2NVL A;  5B6M A;  3RPP A;  2LJR A;  1TRW A;  5A5K A;  1XVQ A;  2KLX A;  5HQP A;  1AQV A;  2LKU A;  2MZC A;  4PX1 A;  1TI3 A;  4MH3 A;  1XWC A;  4YAV A;  4WR4 A;  3IHQ A;  2G0F A;  5F06 A;  3HXS A;  5B8B A;  1ML6 A;  2RLI A;  4HI7 A;  5AN1 A;  1EZK A;  5IOX A;  3GRX A;  4TKY A;  1M9B A;  2V1M A;  1GL8 A;  1BED A;  2IMK A;  4DSR A;  1JZW A;  4OFN A;  3F4T A;  5ECN B;  1GH2 A;  5AIV A;  2O8V B;  1E6B A;  4I8B A;  1V57 A;  2E0Q A;  1XOA A;  4GXZ A;  4DEJ A;  1GP1 A;  3D0Z A;  2WUL A;  2I81 A;  4N0V A;  2DMM A;  4AJ8 A;  1THX A;  4ECB A;  2YWI A;  4YQU A;  3EE2 A;  1VF1 A;  1RW1 A;  1SD8 A;  3PIN A;  2X8H A;  2TRX A;  2I1U A;  2QSI A;  1TU8 A;  2V6O A;  1OE7 A;  4MF5 A;  3M9K A;  3WGE A;  1K3L A;  2ALB A;  2XHF A;  2TIR A;  5J4U A;  3DXB A;  3HJO A;  2VCQ A;  1PKZ A;  4KA0 A;  3D4T A;  2IMD A;  1AAZ A;  3EC3 A;  2HRF A;  1YDK A;  3PGT A;  4XS1 A;  1S3A A;  1PX6 A;  3DWV A;  3FKF A;  1PL2 A;  1HD2 A;  2HLS A;  4TVE A;  1GUK A;  3IR4 A;  3KD0 A;  1YF1 A;  5F0G A;  2DSA A;  3D4M A;  3QD9 A;  1N8J A;  2YN1 A;  2H0H A;  3GSS A;  4GRF A;  1IYH A;  1BJX A;  3GN3 A;  1U6T A;  3SBC A;  4EC0 A;  5A4V A;  4HZ4 A;  3KM6 A;  4FYU A;  5KN0 A;  4G19 A;  2YWN A;  3A5W A;  2GGT A;  2IPA A;  1SKR B;  4FYB A;  4AGS A;  4DVC A;  1U3A A;  1PA3 A;  2WRT A;  3I6A A;  1LBK A;  6GSX A;  5DVB A;  3M3M A;  1YZX A;  1QGV A;  2O89 A;  4MZC A;  3ZVJ A;  3GHA A;  3F6F A;  1T4Z A;  5G30 A;  5F07 A;  3LFL A;  3H1N A;  3EWL A;  3FHK A;  4WKW A;  5JCU A;  2FLS A;  5HFK A;  3TKQ A;  4TR0 A;  3ZFL A;  1TK5 B;  3LG6 A;  2I9H A;  1QXH A;  2K6V A;  5HR1 A;  2WDU A;  2MBS A;  4QL7 A;  5HR0 A;  4GSN A;  3EMX A;  3VPT A;  1EEM A;  4IP1 A;  3UJ1 A;  2H1D A;  1USB A;  3PH9 A;  3M8N A;  4ID0 A;  4ZBB A;  1G6Y A;  1GLP A;  2B7J A;  2CX4 A;  1XXU A;  3TRP A;  7GSS A;  1XOB A;  5COH A;  1IYI A;  4TXO A;  4OWY A;  4J2F A;  1V58 A;  1WOU A;  2H72 A;  1B4Q A;  4POB A;  2HRN A;  4FH8 A;  2LRC A;  3GUR A;  2FNO A;  2A4V A;  3HD5 A;  5JWR B;  1X5E A;  4JED A;  1OAZ A;  5IMD A;  1K0C A;  2MMO A;  1GSF A;  4KGI A;  1F2E A;  1GUH A;  16GS A;  1QQ2 A;  3IV4 A;  2EIO A;  3QFB C;  2CT6 A;  2V6K A;  1JLW A;  2C3Q A;  2HYX A;  3ZL5 A;  4RQX A;  4TW5 A;  2GTU A;  2ZNM A;  1A0F A;  1FG4 A;  2LRT A;  3HJM A;  4E8E A;  5HR3 A;  3F9U A;  2LNS A;  1XW9 A;  4Q5Q A;  4RI6 A;  2LST A;  5D93 A;  2OA7 A;  3VK9 A;  5IMV A;  1QK8 A;  3GL5 A;  2PU9 C;  1YF0 A;  1XVW A;  3ZLP A;  4EUY A;  1GSD A;  2WS2 A;  4IQ1 A;  5FHI A;  2MBT A;  5G5F A;  5CP1 A;  2KOK A;  1PSQ A;  3ZIT A;  4KUN A;  2FD3 A;  4PUR A;  2GVP A;  1YKC A;  2DLX A;  3KTB A;  4ACS A;  3KMO A;  1R5P A;  3F4R A;  3DGQ A;  2B1K A;  3G9B A;  3EYT A;  4NAX A;  5CRH A;  4KSM A;  5C04 A;  5IM9 A;  3TKS A;  2WFC A;  4Z7X A;  1EGO A;  3EUR A;  5KN3 A;  4ECJ A;  1B48 A;  1A2L A;  2OKA A;  3RPN A;  3A2W A;  3TB2 A;  3HA9 A;  2XC2 A;  1GNE A;  1GUM A;  4RUV A;  3CSJ A;  4ZIJ A;  2V32 A;  3QCP A;  1PQN A;  1HNB A;  2WB9 A;  5IPG A;  2GSR A;  5F05 A;  4F0B A;  1F9M A;  2FA4 A;  4XCS A;  3IRA A;  3KH9 A;  3GH9 A;  2VIM A;  3H93 A;  5G5E A;  3UAP A;  5D9X A;  3RDW A;  1SK0 A;  1U3I A;  2L6C A;  4GF0 A;  1OC3 A;  2EC4 A;  2YJ7 A;  1Z7R A;  2Z9S A;  5L71 A;  1XCC A;  4OMV A;  4PGT A;  3FYG A;  1H75 A;  3C8E A;  2HT9 A;  1ZCP A;  1TRS A;  2GST A;  1S3D A;  1SL0 B;  1T4Y A;  5CRG A;  3APQ A;  2JZR A;  2JL4 A;  1DE1 A;  2N5B A;  5AIX A;  3QMX A;  1DBY A;  3LYP A;  2G2Q A;  4L5O A;  1EP8 A;  2LUS A;  2H76 A;  3RBT A;  3VFI A;  2CVK A;  2RUF A;  5E59 A;  3KP9 A;  2RM5 A;  5IMC A;  1VRS D;  3FEU A;  4BA7 A;  4KSO A;  3R2Q A;  1X0R A;  4TXO B;  1THO A;  4V1A g;  2GT5 A;  3QR6 A;  3UOM A;  3ZRD A;  3FZ9 A;  11GS A;  5ID2 A;  4WBR D;  5ECK B;  2DIZ A;  2B6M A;  2LNT A;  1Y25 A;  2K18 A;  3ZMK A;  3FZA A;  1XWK A;  4MZW A;  4EL1 A;  2L5L A;  4TOP A;  3QAW A;  1X9S B;  3NZN A;  1ERT A;  1O73 A;  3ME8 A;  4TR4 A;  3VI7 A;  2C0F A;  1Z9H A;  1FVK A;  2L59 A;  1A0R P;  1B4P A;  4N30 A;  2H71 A;  2E2M A;  4JE1 A;  1K0A A;  4CHS A;  4K0N A;  1Y6E A;  1WIK A;  2PUK C;  4MPG A;  2R4V A;  1TKD B;  3M9J A;  2FA8 A;  3LSZ A;  4MH2 A;  3I69 A;  3MWH A;  1JZR A;  2XPD A;  4ZB9 A;  1SJZ A;  1I5G A;  2LTK A;  3GTU A;  5DAL A;  2H6Z A;  2DML A;  1FO5 A;  3KIJ A;  2C3N A;  3J7Y b;  5B8A A;  2PGT A;  3ZIJ A;  1EP7 A;  3LJR A;  2LJA A;  1F37 A;  3L4N A;  3I43 A;  2B3S A;  18GS A;  4KDX A;  2AJQ B;  4K8M A;  3GA4 A;  2B1L A;  4IVF A;  5A4W A;  2KUC A;  4EDY A;  3JCM L;  4PNG A;  3HHV A;  1QUW A;  3V1W A;  2OAD A;  1ABA A;  3GFK A;  4KX4 A;  4EVM A;  1G7E A;  3ED3 A;  2OBK A;  1F6M C;  3D6I A;  2HXK A;  2P0G A;  1R5A A;  2AHE A;  2E2G A;  4MF6 A;  3TDG A;  4HDE A;  3QAV A;  3ZTL A;  3H4K A;  2CX3 A;  4ZL7 A;  4LA1 A;  1O8X A;  2JZS A;  4N10 A;  4KDU A;  2PVQ A;  1JZO A;  5DBQ A;  6GSS A;  4ML6 A;  4AF2 A;  3F0I A;  2IME A;  2WGR A;  2DJ0 A;  2F8F A;  3WT1 A;  2LRN A;  2VLT A;  2H70 A;  1YQ1 A;  4YQV A;  3UL3 A;  3IC4 A;  4MLY A;  1GSE A;  2CVB A;  3KZQ A;  2WJU A;  4NV5 A;  3GYK A;  2C0G A;  2H1A A;  3J7Y k;  1HNC A;  1NW2 A;  2LQO A;  5G1L A;  4KE3 A;  2KP1 A;  3VPQ A;  3IE3 A;  4ECC A;  1S3C A;  3ME7 A;  4OCE A;  4WR5 A;  5IPH A;  1VF2 A;  3HYP A;  1XW6 A;  3HJP A;  1RK4 A;  2ON5 A;  4XS6 A;  4N0Z A;  1A2J A;  1K0N A;  1JFU A;  3Q18 A;  3H8Q A;  1VF3 A;  2VM1 A;  1FOV A;  2CA8 A;  2H6X A;  2YCD A;  4KCE A;  5IMA A;  2H01 A;  3P8W A;  4LL1 B;  5G31 A;  2YAN A;  3C7M A;  2NBS A;  1SYR A;  3W6G A;  1SJI A;  2VCV A;  5HR2 A;  5GAN D;  4IJ3 A;  3D21 A;  1DSB A;  3GTU B;  5DAL B;  4TR3 A;  5H5Q A;  3CXG A;  2CVD A;  14GS A;  2FY6 A;  4E8H A;  4TRX A;  4IJI A;  2YZH A;  4K9Z A;  3OR5 A;  1OE8 A;  3NIV A;  1B9Y C;  5GSS A;  5GZZ B;  4V2N A;  5GAP D;  3MSZ A;  3QPM A;  3CMI A;  4I2U A;  3EVI A;  3Q19 A;  3M0F A;  2K9F A;  1T3B A;  3CSI A;  2VAF A;  1HQO A;  4JZQ A;  1GTA A;  3BBY A;  2N5A A;  1HNA A;  5DJL A;  4HU9 A;  2LJK A;  5DDL A;  5IMF A;  1OYJ A;  3TKP A;  4V2L A;  2YJH A;  1A2M A;  2CAI A;  4EXJ A;  3DRN A;  2F3M A;  1X9W B;  4PQ1 A;  1GSS A;  1EWX A;  3WT2 A;  1NHY A;  4WEY A;  2H0I A;  3IK9 A;  3IDV A;  4TXV A;  1G7O A;  4X43 A;  1K0O A;  1CQG A;  2X8C A;  1B8X A;  1MDI A;  4MAB A;  5D73 A;  4HQS A;  4MF7 A;  5ABR A;  2LEG A;  2WZ9 A;  4RQR A;  5EVO A;  5IQY A;  2R2J A;  2BTO T;  4F82 A;  3GV1 A;  2C8U A;  2XPE A;  4IEL A;  3L9V A;  3VWV A;  3GKK A;  1O85 A;  4RI7 A;  1FAA A;  2IL3 A;  4XHM A;  4V1A p;  5J3R A;  2P5Q A;  1Z6M A;  4PQH A;  5LD0 A;  4EDZ A;  3US3 A;  1Q4J A;  4XS4 A;  4GQC A;  5DJM A;  5ECS A;  1XWB A;  2H74 A;  1W4V A;  1GNW A;  3KGK A;  2R37 A;  1X5D A;  4PXO A;  3EMP A;  3ZFB A;  4L5L A;  2F9S A;  1KEB A;  4MCU A;  2JZT A;  1YKA A;  1TRV A;  2HE3 A;  5KEJ A;  1SK1 A;  5DCG A;  3FZ4 A;  2DJK A;  5D9W A;  1ZOF A;  4HQZ A;  3BOA A;  3LWA A;  3C73 A;  4EF0 A;  6GSV A;  2CZ2 A;  1VGL A;  2DIY A;  4ML1 A;  3GKM A;  3D5J A;  2YV9 A;  1TK0 B;  3FZ5 A;  4MP4 A;  3ISO A;  2WCI A;  1YEX A;  4G9H A;  6GSW A;  3QFA C;  2LV3 A;  1K0B A;  3EU4 A;  4LL4 B;  1LJR A;  1CQH A;  2HNL A;  2M72 A;  3ZML A;  4ZBD A;  3UAR A;  3VUR A;  2J9H A;  2VD0 A;  3FRC A;  1ERV A;  2A2R A;  4KH7 A;  2PER A;  5J9B A;  1NM3 A;  2FHE A;  2H19 A;  4K2D A;  4HJ2 A;  3ERW A;  3F8U A;  1MTC A;  1A8L A;  1GTU A;  1UN2 A;  1A8Y A;  2J23 A;  1YY7 A;  1TXX A;  4KDY A;  2X64 A;  3F3Q A;  3G7Y A;  2P5R A;  4WBJ A;  1DUG A;  1SL2 B;  2IJY A;  5C00 A;  2C1Y A;  3G7I A;  4Q5R A;  2HZE A;  2MMA A;  3F3R A;  2HFD A;  3HY2 A;  1H4O A;  2AB6 A;  4ZBA A;  1JLV A;  4LMV A;  4ZB6 A;  4I2T A;  4K6X A;  2HZF A;  3VI5 A;  4FO5 A;  4IHU A;  3WYW A;  2ZUP A;  8GSS A;  3ZRE A;  1M9A A;  20GS A;  4K7O A;  4F9Z A;  2O87 A;  2PVO C;  4EO3 A;  3GST A;  4F2I A;  1GTB A;  4V2M A;  3P2A A;  1GUL A;  2YP6 A;  3DIE A;  3L78 A;  5JWQ B;  2X99 A;  2RUE A;  1RQM A;  2REM A;  1YEP A;  2V41 A;  4MJE A;  2H30 A;  3MDK A;  4JR6 A;  2GSQ A;  2HI7 A;  3UMA A;  4Q5F A;  5DCH A;  5D9V A;  1WRY A;  1AQX A;  2LS5 A;  4TR1 A;  1GSU A;  4ZB8 A;  4HOJ A;  3GH6 A;  3UVH A;  3NOF A;  3I9V 2;  4IN0 A;  2B5X A;  3LOR A;  1JHB A;  2XBQ A;  4K1F A;  2I4A A;  4KCA A;  4JBB A;  3U6V A;  4IKH A;  5ECM B;  2OJL A;  3H79 A;  3LEF A;  5H5S A;  4LLR A;  2X8G A;  1OKT A;  1JZD A;  4XRA A;  2EIQ A;  4NWY A;  1EOH A;  19GS A;  5DAK A;  3HZ8 A;  4BVX A;  5D9T A;  2B7K A;  1BX9 A;  1FB6 A;  3KEB A;  2R3X A;  2GQL A;  1Z6N A;  4ZIL A;  5F8B A;  1Z5Y E;  1GTI A;  1SK2 A;  3RAZ A;  2OAC A;  1UC7 A;  2OE3 A;  2FGX A;  5ECP B;  1KBN A;  13GS A;  5EPF A;  4IW9 A;  4YAP A;  5JCW A;  3TGZ A;  1M2B A;  3CRU A;  3QOU A;  4IP6 A;  4ZL9 A;  3GNJ A;  3IAM 2;  5IOW A;  4CW9 A;  4BWQ A;  1ZYQ B;  3HDC A;  1GSQ A;  4CDO A;  4DSS A;  2VCT A;  1URM A;  3TJF A;  1KTE A;  4HZ2 A;  2TRC P;  3RHC A;  1EV4 A;  3GKN A;  4MPF A;  2EIR A;  2IFQ A;  2OBI A;  3TRQ A;  2A2S A;  1TTZ A;  3IOS A;  1ERU A;  2IMI A;  2JAD A;  1XBS A;  1NHO A;  3TJJ A;  1MD3 A;  5AIS A;  3W8S A;  1XW5 A;  1ERW A;  1BAY A;  4MDC A;  3D22 A;  3LQ7 A;  4FYC A;  3WGX A;  1FB0 A;  3C1S A;  3VLN A;  1PX7 A;  4Q5N A;  3VWW A;  1DE2 A;  3F4S A;  1XPV A;  3WGD A;  2HZE B;  1AW9 A;  3W8J A;  4OO4 A;  4IBP A;  4MZB A;  4ULX A;  3LXT A;  1QMV A;  2GQM A;  3F6D A;  4MJC A;  2B5Y A;  3CSH A;  1Q98 A;  1MEK A;  4QL9 A;  1Z3E A;  6GSU A;  4HS1 A;  4F03 A;  5JWO B;  2FUG 2;  4ILF A;  4G2E A;  4HUA A;  3E3E A;  4PNF A;  5HFI A;  4HJM A;  1XZO A;  1F3A A;  2IIY A;  3LYK A;  5A4U A;  5ECO B;  1G6W A;  2C0E A;  3LXZ A;  3ZVJ D;  4TR1 B;  3UBL A;  1X9M B;  2RII A;  5ENU A;  1AUC A;  2GQK A;  2VL9 A;  5ID2 B;  1T00 A;  3Q74 A;  4BWS A;  2AYT A;  1K3Y A;  2DJ2 A;  3CTG A;  1PMT A;  5FWG A;  2VLU A;  2FWG A;  5IMZ A;  3DYR A;  3O76 A;  2C4J A;  1XWG A;  4ECI A;  5CRE A;  2FCH A;  1QFN A;  3O6T A;  5DAK B;  1V40 A;  2GS3 A;  5B7C A;  2L4C A;  2L57 A;  1MDJ A;  4MMM A;  5ECL B;  4QQ7 A;  3KP8 A;  4AJ6 A;  3M1G A;  1ZL9 A;  1J9B A;  2B5E A;  1UA5 A;  2NTO A;  1FW1 A;  3L9S A;  2GZY A;  3IA1 A;  4X0X A;  1AQW A;  3ERG A;  4PQI A;  3TKS E;  1OVN A;  2H8L A;  1EEJ A;  3TRX A;  9GSS A;  2GZZ A;  3L0H A;  1EGR A;  5EL8 A;  5ECQ B;  3UIW A;  4DSS B;  4BL7 A;  2F8A A;  1PL1 A;  1SEN A;  3O3T A;  1C72 A;  4EE0 A;  3GX0 A;  4XIH A;  4MJB A;  1BG5 A;  3U5R E;  1MDK A;  3EU3 A;  4POK A;  1R26 A;  2IFQ B;  4PUA A;  5D8I A;  3VWU A;  1M2D A;  1K3O A;  4POM A;  3GIX A;  4GQF A;  1SU9 A;  2GT6 A;  4JU5 A;  3KMN A;  2D2Z A;  1NSW A;  2M80 A;  1PD2 1;  3UEM A;  2VUP A;  3CYN A;  3BJ5 A;  4FIW A;  5ECH B;  1SL1 B;  4N11 A;  4O7H A;  3HVS A;  5ELA A;  3KCM A;  3UVT A;  1R7H A;  3FR3 A;  3A2V A;  4NHW A;  1ZYE A;  5LCZ A;  1MD4 A;  4JRR A;  5LNK e;  2VOC A;  4IQA A;  1E2Y A;  3GL3 A;  2PBJ A;  4MJA A;  1A24 A;  2O85 A;  2OE0 A;  2VL2 A;  1WWJ A;  3HVX A;  3GUS A;  3TKS C;  1A23 A;  3DML A;  3IPZ A;  1XWA A;  4NXI A;  3DEX A;  1TRU A;  2I3Y A;  1U87 A;  4KND A;  4JR4 A;  4P3Y B;  3N9J A;  2GZP A;  5CO3 A;  4H86 A;  2H66 A;  3VWX A;  1GWC A;  5IO2 A;  3E0U A;  4NV2 A;  5CYY A;  1M2A A;  2QGV A;  2PMT A;  5D96 A;  4D73 A; 
#chains in the Genus database with same CATH topology
 2NPB A;  3N5O A;  2MMZ A;  2YNX A;  1ZYP A;  1V9W A;  2H6Y A;  3FR6 A;  2H73 A;  1WJK A;  2O7K A;  2C3T A;  3APO A;  2N5F A;  3P7X A;  1O8W A;  3HCZ A;  4IS0 A;  3TOT A;  1FHE A;  3QDN A;  2HRA A;  1K0M A;  1T7P B;  2ES7 A;  2YOI A;  2F51 A;  2E7P A;  3EIN A;  4OFM A;  4O32 A;  5DQS A;  1M3I A;  3C1R A;  2HSY A;  2VD1 A;  1GLQ A;  2FWE A;  3FW2 A;  3ZIV A;  1GRX A;  1WPI A;  1ON4 A;  2K8V A;  4CY6 A;  2XBI A;  4K0G A;  4I97 A;  3S9F A;  1KNG A;  1FVJ A;  5ELG A;  1BYE A;  1K0D A;  1O7U A;  2VM2 A;  5GST A;  3IXR A;  1G0T A;  2OE1 A;  1TW9 A;  1R4W A;  1YJ6 A;  4L0W A;  2QKE A;  4ZXG A;  1VF4 A;  4BPY A;  4HSC X;  4L8E A;  4MK3 A;  1SJ6 A;  1J0F A;  10GS A;  3L9U A;  4YH2 A;  1SKS B;  3MNG A;  1ZGN A;  4OCF A;  2GDR A;  4GTU A;  3IK7 A;  1OC9 A;  4KB3 A;  5H5R A;  5EY6 A;  2ZCT A;  4GWR A;  5G1K A;  4HU7 A;  4DSQ A;  1PN9 A;  2BJX A;  2X49 A;  4J57 E;  1TK8 B;  1BQ7 A;  1M99 A;  1O6J A;  4L0U A;  3CRT A;  2H1G A;  4G0K A;  3HVV A;  5FT3 A;  3BCI A;  3SWL A;  2C80 A;  1ILO A;  2JU5 A;  2CAQ A;  2QC7 A;  5CRD A;  4X1U A;  3HKR A;  2L5O A;  3P90 A;  2DJJ A;  2MMN A;  3TJB A;  1WP0 A;  1S3R A;  2GSS A;  3GMF A;  5INY A;  4GSS A;  2IWT A;  4BVY A;  1UVZ A;  4KAE A;  4NHZ A;  5J41 A;  4XTS A;  4OD7 A;  5IIZ A;  1TI1 A;  2DC5 A;  4GCI A;  4O92 A;  4POL A;  2AAW A;  2RM6 A;  2VCX A;  4GLT A;  1WMJ A;  1EOG A;  2PPT A;  2JSZ A;  1OC8 A;  2PWJ A;  3KTL A;  2MYG A;  3PR8 A;  4D73 B;  1HYU A;  5CAX A;  1W89 A;  2CQ9 A;  1U88 A;  4OFT A;  3ZZX A;  2FWF A;  2DBC A;  2M46 A;  2FWH A;  2AUV A;  3KH7 A;  5CNW A;  2NDO A;  4XS4 B;  1XG8 A;  5ECI B;  1LU4 A;  1T8E B;  4OO5 A;  3AY8 A;  4I6X A;  3CTF A;  5B6N A;  2VCZ A;  1F3B A;  4LMW A;  2YPM A;  2DJ1 A;  3A3T A;  1J08 A;  1ACV A;  1TU7 A;  3KJY A;  3TOU A;  5KN1 A;  2PN8 A;  3DVX A;  4G10 A;  2YWM A;  3QAG A;  1XIY A;  5J5N A;  4HEA 2;  4K2X A;  2YWO A;  5JCG A;  1O81 A;  2CZ3 A;  2VL3 A;  3TKR A;  1X5C A;  4MA9 A;  5IO0 A;  5G2Z A;  3DD3 A;  3Q6O A;  5ECR B;  4K7N A;  2GLR A;  3C71 A;  3E9J B;  4WXT A;  2HSH A;  1ST9 A;  3LGC A;  4I5Q A;  4PUF C;  3TUE A;  3FR9 A;  6GSY A;  3FK8 A;  3KXO A;  1V98 A;  3BD2 A;  2P31 A;  3DVW A;  12GS A;  5AGY A;  4GST A;  4EKZ A;  2LQQ A;  4XRD A;  1M7T A;  1ZMA A;  22GS A;  4AJ7 A;  2L6D A;  1SD9 A;  1WE0 A;  2C0D A;  4F0C A;  3APS A;  1OC9 B;  1TDI A;  3UBK A;  3A2X A;  1N2A A;  2V2G A;  1SKW B;  1I9D A;  3TCO A;  1XFL A;  4K7I A;  2DJ3 A;  2IMF A;  2BMX A;  2KHP A;  4YQM A;  2KP2 A;  2H1B A;  5J9C A;  1V2A A;  4ISD A;  2JSY A;  3MYD A;  2VCW A;  3FY7 A;  2H0G A;  3K8N A;  1Z7P A;  3ERF A;  2AV4 A;  3DKS A;  3RHB A;  2IN3 A;  4ZL8 A;  4NMU A;  1GSY A;  1PGT A;  17GS A;  5KN2 A;  2H75 A;  4KW6 A;  2R6K A;  4YKF A;  1TP9 A;  3GKX A;  4WF4 A;  4BVY B;  1AC1 A;  1SYX A;  1B9X C;  4FQU A;  4WET A;  1PFO A;  2VO4 A;  4IGJ A;  2VLV A;  3HZ4 A;  3IBH A;  1PRX A;  4TN8 A;  3CBU A;  1TJD A;  5HFG A;  2JAC A;  3TJG A;  2YV7 A;  1PKW A;  1T1V A;  5CRW A;  1AXD A;  5DQY A;  2K8S A;  1EV9 A;  6GST A;  3F63 A;  4NPB A;  1ZZY A;  5E4W A;  3GX8 A;  2ON7 A;  3ZYW A;  2YZU A;  1AIU A;  3BCK A;  4WF5 A;  3WD6 A;  2CV4 A;  2L4Q A;  3IAS 2;  3TJK A;  1OKD A;  2VL2 C;  4J56 E;  2R5G A;  3G7J A;  4G0I A;  1TOF A;  4O5R A;  3MAK A;  1M0U A;  2NVL A;  5B6M A;  3RPP A;  2LJR A;  1TRW A;  2R0P A;  5A5K A;  1XVQ A;  2KLX A;  5HQP A;  1AQV A;  2LKU A;  2MZC A;  4PX1 A;  1TI3 A;  4MH3 A;  1XWC A;  4YAV A;  4WR4 A;  3IHQ A;  2G0F A;  5F06 A;  3HXS A;  5B8B A;  1ML6 A;  2RLI A;  4HI7 A;  5AN1 A;  1EZK A;  5IOX A;  3GRX A;  4TKY A;  1M9B A;  2V1M A;  1GL8 A;  1BED A;  2IMK A;  4DSR A;  1JZW A;  4OFN A;  3F4T A;  5ECN B;  1GH2 A;  5AIV A;  2O8V B;  1E6B A;  4I8B A;  1V57 A;  2E0Q A;  1XOA A;  4GXZ A;  4DEJ A;  1GP1 A;  3D0Z A;  2WUL A;  2I81 A;  4BIK A;  4N0V A;  2DMM A;  4AJ8 A;  1THX A;  4ECB A;  2YWI A;  4YQU A;  3EE2 A;  1VF1 A;  3MIX A;  1RW1 A;  1SD8 A;  3PIN A;  2X8H A;  2TRX A;  2I1U A;  2QSI A;  1TU8 A;  2V6O A;  1OE7 A;  4MF5 A;  3M9K A;  3WGE A;  1K3L A;  2ALB A;  2XHF A;  2TIR A;  5J4U A;  3DXB A;  3HJO A;  2VCQ A;  1PKZ A;  4KA0 A;  3D4T A;  2IMD A;  1AAZ A;  3EC3 A;  2HRF A;  1YDK A;  3PGT A;  4XS1 A;  1S3A A;  1PX6 A;  3DWV A;  3FKF A;  1PL2 A;  1HD2 A;  2HLS A;  4TVE A;  1GUK A;  3IR4 A;  3KD0 A;  1YF1 A;  5F0G A;  2DSA A;  3D4M A;  3QD9 A;  1N8J A;  2YN1 A;  2H0H A;  3GSS A;  1PN0 A;  4GRF A;  1IYH A;  1BJX A;  5KOX A;  3GN3 A;  1U6T A;  3SBC A;  4EC0 A;  5A4V A;  4HZ4 A;  3KM6 A;  4FYU A;  5KN0 A;  4G19 A;  2YWN A;  3A5W A;  2GGT A;  2IPA A;  1SKR B;  4FYB A;  4AGS A;  4DVC A;  1U3A A;  1PA3 A;  2WRT A;  3I6A A;  1LBK A;  6GSX A;  5DVB A;  3M3M A;  1YZX A;  1QGV A;  2O89 A;  4MZC A;  3ZVJ A;  3GHA A;  3F6F A;  1T4Z A;  5G30 A;  5F07 A;  3LFL A;  3IHG A;  3H1N A;  3EWL A;  3FHK A;  4WKW A;  5JCU A;  2FLS A;  5HFK A;  3TKQ A;  4TR0 A;  3ZFL A;  1TK5 B;  3LG6 A;  2I9H A;  1QXH A;  2K6V A;  3R3E A;  5HR1 A;  2WDU A;  2MBS A;  4QL7 A;  5HR0 A;  4GSN A;  3EMX A;  3VPT A;  1EEM A;  4EIQ A;  4IP1 A;  3UJ1 A;  2H1D A;  4USS A;  1USB A;  3PH9 A;  3M8N A;  4ID0 A;  4ZBB A;  1G6Y A;  1GLP A;  2B7J A;  2CX4 A;  1XXU A;  3TRP A;  7GSS A;  1XOB A;  5COH A;  1IYI A;  4TXO A;  4OWY A;  4J2F A;  1V58 A;  1WOU A;  2H72 A;  1B4Q A;  4POB A;  2HRN A;  4FH8 A;  2LRC A;  3GUR A;  2FNO A;  2A4V A;  3HD5 A;  5JWR B;  1X5E A;  4JED A;  1OAZ A;  5IMD A;  1K0C A;  2MMO A;  1GSF A;  4KGI A;  1F2E A;  1GUH A;  16GS A;  1QQ2 A;  3IV4 A;  2EIO A;  3QFB C;  2CT6 A;  2V6K A;  1JLW A;  2C3Q A;  2HYX A;  3ZL5 A;  4RQX A;  4TW5 A;  2GTU A;  4YKG A;  2ZNM A;  1A0F A;  1FG4 A;  2LRT A;  3HJM A;  4E8E A;  5HR3 A;  3F9U A;  2LNS A;  1XW9 A;  4Q5Q A;  4RI6 A;  2LST A;  4BL7 B;  5D93 A;  2OA7 A;  3VK9 A;  5IMV A;  1QK8 A;  3GL5 A;  2PU9 C;  1YF0 A;  1XVW A;  3ZLP A;  4EUY A;  1GSD A;  2WS2 A;  4IQ1 A;  5FHI A;  2MBT A;  5G5F A;  5CP1 A;  2KOK A;  1PSQ A;  3ZIT A;  4KUN A;  2FD3 A;  4PUR A;  2GVP A;  1YKC A;  2DLX A;  3KTB A;  4ACS A;  3KMO A;  1R5P A;  3F4R A;  3DGQ A;  2B1K A;  3G9B A;  3EYT A;  4NAX A;  5CRH A;  4KSM A;  5C04 A;  5IM9 A;  3TKS A;  2WFC A;  4Z7X A;  1EGO A;  3EUR A;  5KN3 A;  4ECJ A;  1B48 A;  1FOH A;  1A2L A;  4X4J A;  2OKA A;  3RPN A;  3A2W A;  3TB2 A;  3HA9 A;  2XC2 A;  1GNE A;  1GUM A;  4RUV A;  3CSJ A;  4ZIJ A;  2V32 A;  3QCP A;  1PQN A;  1HNB A;  2WB9 A;  5IPG A;  2GSR A;  5F05 A;  4F0B A;  1F9M A;  2FA4 A;  4XCS A;  3IRA A;  3KH9 A;  3GH9 A;  2VIM A;  3H93 A;  5G5E A;  3UAP A;  5D9X A;  3RDW A;  1SK0 A;  1U3I A;  2L6C A;  4GF0 A;  1OC3 A;  2EC4 A;  2YJ7 A;  1Z7R A;  2Z9S A;  5L71 A;  1XCC A;  4OMV A;  4PGT A;  3FYG A;  4Z2U A;  1H75 A;  3C8E A;  2HT9 A;  1ZCP A;  1TRS A;  2GST A;  1S3D A;  1SL0 B;  1T4Y A;  5CRG A;  3APQ A;  2JZR A;  2JL4 A;  1DE1 A;  5KOW A;  2N5B A;  5AIX A;  3QMX A;  1DBY A;  3LYP A;  2G2Q A;  2DKH A;  4L5O A;  1EP8 A;  2LUS A;  2H76 A;  3RBT A;  3VFI A;  2CVK A;  2RUF A;  5E59 A;  3KP9 A;  2RM5 A;  5IMC A;  1VRS D;  3FEU A;  4BA7 A;  4KSO A;  3R2Q A;  1X0R A;  4TXO B;  1THO A;  4V1A g;  2GT5 A;  3QR6 A;  3UOM A;  3ZRD A;  3FZ9 A;  4EIP A;  11GS A;  5ID2 A;  4WBR D;  5ECK B;  2DIZ A;  2B6M A;  2LNT A;  1Y25 A;  2K18 A;  3ZMK A;  3FZA A;  1XWK A;  4MZW A;  4EL1 A;  2L5L A;  4TOP A;  3QAW A;  1X9S B;  3NZN A;  1ERT A;  1O73 A;  3ME8 A;  4TR4 A;  3VI7 A;  2C0F A;  1Z9H A;  1FVK A;  2L59 A;  1A0R P;  1B4P A;  4N30 A;  2H71 A;  2E2M A;  4JE1 A;  4MNN A;  1K0A A;  4CHS A;  4K0N A;  1Y6E A;  1WIK A;  2PUK C;  4MPG A;  2R4V A;  1TKD B;  3M9J A;  2FA8 A;  3LSZ A;  4MH2 A;  3I69 A;  3MWH A;  1JZR A;  2XPD A;  4ZB9 A;  1SJZ A;  1I5G A;  2LTK A;  3GTU A;  5DAL A;  2H6Z A;  2DML A;  1FO5 A;  3KIJ A;  2C3N A;  3J7Y b;  5B8A A;  2PGT A;  3ZIJ A;  1EP7 A;  3LJR A;  2LJA A;  1F37 A;  3L4N A;  3I43 A;  2B3S A;  18GS A;  4KDX A;  2AJQ B;  4K8M A;  3GA4 A;  2B1L A;  4IVF A;  5A4W A;  2QA1 A;  2KUC A;  4EDY A;  3JCM L;  4PNG A;  3HHV A;  1QUW A;  3V1W A;  2OAD A;  3LW9 A;  1ABA A;  3GFK A;  4KX4 A;  4EVM A;  1G7E A;  3ED3 A;  2OBK A;  1F6M C;  3D6I A;  2HXK A;  2P0G A;  1R5A A;  2AHE A;  2E2G A;  4MF6 A;  3TDG A;  4HDE A;  3QAV A;  3ZTL A;  3H4K A;  2CX3 A;  4ZL7 A;  4LA1 A;  1O8X A;  2JZS A;  4N10 A;  4KDU A;  2PVQ A;  1JZO A;  5DBQ A;  6GSS A;  4ML6 A;  4AF2 A;  3F0I A;  2IME A;  2WGR A;  2DJ0 A;  2F8F A;  3WT1 A;  2LRN A;  2VLT A;  2H70 A;  1YQ1 A;  4YQV A;  3UL3 A;  3IC4 A;  4MLY A;  1GSE A;  2CVB A;  3KZQ A;  2WJU A;  4NV5 A;  3GYK A;  2C0G A;  2H1A A;  3J7Y k;  1HNC A;  1NW2 A;  2LQO A;  5G1L A;  4KE3 A;  2KP1 A;  3VPQ A;  3IE3 A;  4ECC A;  1S3C A;  4Z2T A;  3ME7 A;  4OCE A;  4WR5 A;  5IPH A;  1VF2 A;  3HYP A;  1XW6 A;  4O5U A;  3HJP A;  1RK4 A;  2ON5 A;  4XS6 A;  4N0Z A;  3PPU A;  1A2J A;  1K0N A;  1JFU A;  3Q18 A;  3H8Q A;  1VF3 A;  2VM1 A;  1FOV A;  2CA8 A;  2H6X A;  2YCD A;  4KCE A;  5IMA A;  2H01 A;  3P8W A;  4LL1 B;  5G31 A;  2YAN A;  3C7M A;  2NBS A;  1SYR A;  3W6G A;  1SJI A;  2VCV A;  5HR2 A;  5GAN D;  4IJ3 A;  3D21 A;  1DSB A;  3GTU B;  5DAL B;  4TR3 A;  5H5Q A;  3CXG A;  2CVD A;  14GS A;  2FY6 A;  4E8H A;  4TRX A;  4IJI A;  2YZH A;  4K9Z A;  3OR5 A;  1OE8 A;  3NIV A;  1B9Y C;  5GSS A;  5GZZ B;  4V2N A;  4CY8 A;  5GAP D;  3MSZ A;  3QPM A;  3CMI A;  4I2U A;  3EVI A;  3Q19 A;  3M0F A;  2K9F A;  1T3B A;  3CSI A;  2VAF A;  1HQO A;  4JZQ A;  1GTA A;  3BBY A;  2N5A A;  1HNA A;  5DJL A;  5BMU A;  4HU9 A;  2LJK A;  5DDL A;  5IMF A;  1OYJ A;  3TKP A;  4V2L A;  2YJH A;  3FMW A;  1A2M A;  2CAI A;  4EXJ A;  3DRN A;  2F3M A;  1X9W B;  4PQ1 A;  1GSS A;  1EWX A;  3WT2 A;  1NHY A;  4A5P A;  4WEY A;  2H0I A;  3IK9 A;  3IDV A;  4TXV A;  1G7O A;  4X43 A;  1K0O A;  1CQG A;  2X8C A;  1B8X A;  1MDI A;  4MAB A;  5D73 A;  4HQS A;  4MF7 A;  5ABR A;  2LEG A;  2WZ9 A;  4RQR A;  5EVO A;  5IQY A;  2R2J A;  2BTO T;  4F82 A;  3GV1 A;  2C8U A;  2XPE A;  4IEL A;  3L9V A;  3VWV A;  3GKK A;  1O85 A;  4PTS A;  4RI7 A;  1FAA A;  2IL3 A;  4XHM A;  4V1A p;  5J3R A;  2P5Q A;  1Z6M A;  4PQH A;  5LD0 A;  4EDZ A;  3US3 A;  1Q4J A;  4XS4 A;  4GQC A;  5DJM A;  5ECS A;  1XWB A;  2H74 A;  1W4V A;  1GNW A;  3KGK A;  2R37 A;  1X5D A;  4PXO A;  3EMP A;  3ZFB A;  4L5L A;  2F9S A;  1KEB A;  4MCU A;  2JZT A;  1YKA A;  1TRV A;  2HE3 A;  5KEJ A;  1SK1 A;  5DCG A;  3FZ4 A;  2DJK A;  5D9W A;  1ZOF A;  4HQZ A;  3BOA A;  3LWA A;  3C73 A;  4EF0 A;  6GSV A;  2CZ2 A;  1VGL A;  2DIY A;  4ML1 A;  3GKM A;  3D5J A;  2YV9 A;  1TK0 B;  3FZ5 A;  4MP4 A;  3ISO A;  2WCI A;  1YEX A;  4G9H A;  2A4H A;  6GSW A;  3QFA C;  2LV3 A;  1K0B A;  3EU4 A;  4LL4 B;  1LJR A;  1CQH A;  2HNL A;  2M72 A;  3ZML A;  4ZBD A;  3UAR A;  3VUR A;  2J9H A;  2VD0 A;  3FRC A;  1ERV A;  2A2R A;  4KH7 A;  2PER A;  5J9B A;  1NM3 A;  4K2D A;  2FHE A;  2H19 A;  4HJ2 A;  3ERW A;  3F8U A;  1MTC A;  1A8L A;  1GTU A;  1UN2 A;  1A8Y A;  2J23 A;  1YY7 A;  1TXX A;  4KDY A;  2X64 A;  3F3Q A;  3G7Y A;  2P5R A;  4WBJ A;  1DUG A;  1SL2 B;  2IJY A;  5C00 A;  2C1Y A;  3G7I A;  4Q5R A;  2HZE A;  4K5R A;  2MMA A;  3F3R A;  2HFD A;  3HY2 A;  1H4O A;  2AB6 A;  4ZBA A;  1JLV A;  4LMV A;  4ZB6 A;  4I2T A;  4K6X A;  2HZF A;  3VI5 A;  4FO5 A;  4IHU A;  3WYW A;  2ZUP A;  8GSS A;  3ZRE A;  1M9A A;  20GS A;  4K7O A;  4F9Z A;  2O87 A;  2PVO C;  4EO3 A;  3GST A;  4F2I A;  1GTB A;  4V2M A;  3P2A A;  1GUL A;  2YP6 A;  3DIE A;  3L78 A;  5JWQ B;  2X4A A;  2RUE A;  2X99 A;  1RQM A;  2REM A;  1YEP A;  2V41 A;  4MJE A;  2H30 A;  3MDK A;  4JR6 A;  2GSQ A;  2HI7 A;  3UMA A;  4Q5F A;  5DCH A;  5D9V A;  1WRY A;  1AQX A;  2LS5 A;  2QA2 A;  4TR1 A;  1GSU A;  4ZB8 A;  4HOJ A;  3GH6 A;  3UVH A;  3NOF A;  3I9V 2;  4IN0 A;  2B5X A;  3LOR A;  1JHB A;  2XBQ A;  4K1F A;  2I4A A;  4KCA A;  4JBB A;  3U6V A;  4IKH A;  5ECM B;  2OJL A;  3HVN A;  3H79 A;  3LEF A;  5H5S A;  4LLR A;  2X8G A;  3CQF A;  1OKT A;  1JZD A;  4XRA A;  2EIQ A;  4NWY A;  2HSM A;  1EOH A;  19GS A;  5DAK A;  3HZ8 A;  4BVX A;  5D9T A;  2B7K A;  1BX9 A;  1FB6 A;  3KEB A;  2R3X A;  2GQL A;  1Z6N A;  4ZIL A;  4ICY A;  5F8B A;  1Z5Y E;  1GTI A;  1SK2 A;  3RAZ A;  2OAC A;  1UC7 A;  2OE3 A;  2FGX A;  5ECP B;  1KBN A;  13GS A;  5EPF A;  4IW9 A;  4YAP A;  5JCW A;  3TGZ A;  1M2B A;  3CRU A;  4K5S A;  2R0C A;  3QOU A;  4IP6 A;  4ZL9 A;  3GNJ A;  3IAM 2;  5IOW A;  4CW9 A;  4BWQ A;  1ZYQ B;  3HDC A;  1GSQ A;  4CDO A;  4DSS A;  2VCT A;  1URM A;  3TJF A;  1KTE A;  4HZ2 A;  2TRC P;  3RHC A;  1EV4 A;  3GKN A;  4MPF A;  2EIR A;  2IFQ A;  2OBI A;  3TRQ A;  2A2S A;  1TTZ A;  3IOS A;  1ERU A;  1ZYN A;  2IMI A;  2JAD A;  1XBS A;  1NHO A;  3TJJ A;  1MD3 A;  5AIS A;  3W8S A;  1XW5 A;  1ERW A;  1BAY A;  4MDC A;  3D22 A;  3LQ7 A;  4FYC A;  3WGX A;  1FB0 A;  3C1S A;  3VLN A;  2HRK A;  1PX7 A;  4Q5N A;  3VWW A;  2UZ8 A;  1DE2 A;  5BRT A;  3F4S A;  1XPV A;  3WGD A;  2HZE B;  1AW9 A;  3W8J A;  4OO4 A;  4IBP A;  4MZB A;  4ULX A;  3LXT A;  1QMV A;  2GQM A;  3F6D A;  4MJC A;  2B5Y A;  3CSH A;  1Q98 A;  1MEK A;  4QL9 A;  1Z3E A;  6GSU A;  4HS1 A;  4F03 A;  5JWO B;  2FUG 2;  4ILF A;  4G2E A;  4HUA A;  3E3E A;  4PNF A;  5HFI A;  4HJM A;  2A2P A;  1XZO A;  1F3A A;  2IIY A;  3LYK A;  5A4U A;  5ECO B;  1G6W A;  2C0E A;  3LXZ A;  4Z2R A;  3EPT A;  3ZVJ D;  4TR1 B;  3UBL A;  1X9M B;  2RII A;  5ENU A;  1AUC A;  2GQK A;  2VL9 A;  5ID2 B;  1T00 A;  3Q74 A;  4BWS A;  2AYT A;  1K3Y A;  2DJ2 A;  3CTG A;  4O5Q A;  1PMT A;  5FWG A;  2VLU A;  2FWG A;  5IMZ A;  3DYR A;  3O76 A;  2C4J A;  1XWG A;  4ECI A;  5CRE A;  2FCH A;  1QFN A;  3O6T A;  5DAK B;  1V40 A;  2GS3 A;  4BVX B;  5B7C A;  2L4C A;  2L57 A;  1MDJ A;  4MMM A;  5ECL B;  4QQ7 A;  3A5I A;  3KP8 A;  4AJ6 A;  3M1G A;  1ZL9 A;  1J9B A;  2B5E A;  1UA5 A;  2NTO A;  1FW1 A;  3L9S A;  2GZY A;  3IA1 A;  4X0X A;  1AQW A;  3ERG A;  4PQI A;  3TKS E;  1OVN A;  2H8L A;  1EEJ A;  3TRX A;  9GSS A;  2GZZ A;  3L0H A;  1EGR A;  5EL8 A;  5ECQ B;  3UIW A;  4DSS B;  4BL7 A;  2F8A A;  1PL1 A;  1SEN A;  3O3T A;  1C72 A;  4EE0 A;  3GX0 A;  4XIH A;  4MJB A;  1BG5 A;  3U5R E;  1MDK A;  3EU3 A;  4G0L A;  2R0G A;  4POK A;  1R26 A;  2IFQ B;  4PUA A;  5D8I A;  3VWU A;  1M2D A;  1K3O A;  4POM A;  3GIX A;  4GQF A;  1SU9 A;  2GT6 A;  4JU5 A;  3KMN A;  2D2Z A;  1NSW A;  2M80 A;  1PD2 1;  3UEM A;  2VUP A;  3CYN A;  3BJ5 A;  3IC8 A;  4FIW A;  5ECH B;  1SL1 B;  4N11 A;  4O7H A;  3HVS A;  5ELA A;  3KCM A;  3UVT A;  1R7H A;  3FR3 A;  3A2V A;  4NHW A;  1ZYE A;  5LCZ A;  1MD4 A;  4JRR A;  5LNK e;  2VOC A;  4IQA A;  1E2Y A;  3GL3 A;  2PBJ A;  4MJA A;  1A24 A;  2O85 A;  2OE0 A;  2VL2 A;  1WWJ A;  3HVX A;  3GUS A;  3TKS C;  1M3J A;  1A23 A;  3DML A;  3IPZ A;  1XWA A;  4NXI A;  3DEX A;  1TRU A;  2DKI A;  2I3Y A;  1U87 A;  4KND A;  4JR4 A;  4P3Y B;  3N9J A;  2GZP A;  5CO3 A;  4H86 A;  4KF9 A;  2H66 A;  3VWX A;  1GWC A;  5IO2 A;  3E0U A;  4NV2 A;  5CYY A;  1M2A A;  2QGV A;  2PMT A;  5D96 A;  4D73 A; 
#chains in the Genus database with same CATH homology
 2NPB A;  3N5O A;  2MMZ A;  2YNX A;  1ZYP A;  1V9W A;  2H6Y A;  3FR6 A;  2H73 A;  1WJK A;  2O7K A;  2C3T A;  3APO A;  2N5F A;  3P7X A;  1O8W A;  3HCZ A;  4IS0 A;  3TOT A;  1FHE A;  3QDN A;  2HRA A;  1K0M A;  1T7P B;  2ES7 A;  2YOI A;  2F51 A;  2E7P A;  3EIN A;  4OFM A;  4O32 A;  5DQS A;  3C1R A;  2HSY A;  2VD1 A;  1GLQ A;  2FWE A;  3FW2 A;  3ZIV A;  1GRX A;  1WPI A;  1ON4 A;  2K8V A;  4CY6 A;  2XBI A;  4K0G A;  4I97 A;  3S9F A;  1KNG A;  1FVJ A;  5ELG A;  1BYE A;  1K0D A;  1O7U A;  2VM2 A;  5GST A;  3IXR A;  1G0T A;  2OE1 A;  1TW9 A;  1R4W A;  1YJ6 A;  4L0W A;  2QKE A;  4ZXG A;  1VF4 A;  4BPY A;  4L8E A;  4MK3 A;  1SJ6 A;  1J0F A;  10GS A;  3L9U A;  4YH2 A;  1SKS B;  3MNG A;  1ZGN A;  4OCF A;  2GDR A;  4GTU A;  3IK7 A;  1OC9 A;  4KB3 A;  5H5R A;  5EY6 A;  2ZCT A;  4GWR A;  5G1K A;  4HU7 A;  4DSQ A;  1PN9 A;  2BJX A;  2X49 A;  4J57 E;  1TK8 B;  1BQ7 A;  1M99 A;  1O6J A;  4L0U A;  3CRT A;  2H1G A;  4G0K A;  3HVV A;  5FT3 A;  3BCI A;  3SWL A;  2C80 A;  1ILO A;  2JU5 A;  2CAQ A;  2QC7 A;  5CRD A;  4X1U A;  3HKR A;  2L5O A;  3P90 A;  2DJJ A;  2MMN A;  3TJB A;  1WP0 A;  2GSS A;  3GMF A;  5INY A;  4GSS A;  2IWT A;  4BVY A;  1UVZ A;  4KAE A;  4NHZ A;  5J41 A;  4XTS A;  4OD7 A;  5IIZ A;  1TI1 A;  2DC5 A;  4GCI A;  4O92 A;  4POL A;  2AAW A;  2RM6 A;  2VCX A;  4GLT A;  1WMJ A;  1EOG A;  2PPT A;  2JSZ A;  1OC8 A;  2PWJ A;  3KTL A;  2MYG A;  3PR8 A;  4D73 B;  1HYU A;  5CAX A;  1W89 A;  2CQ9 A;  1U88 A;  4OFT A;  3ZZX A;  2FWF A;  2DBC A;  2M46 A;  2FWH A;  2AUV A;  3KH7 A;  5CNW A;  2NDO A;  4XS4 B;  5ECI B;  1LU4 A;  1T8E B;  4OO5 A;  3AY8 A;  4I6X A;  3CTF A;  5B6N A;  2VCZ A;  1F3B A;  4LMW A;  2YPM A;  2DJ1 A;  3A3T A;  1J08 A;  1ACV A;  1TU7 A;  3KJY A;  3TOU A;  5KN1 A;  2PN8 A;  3DVX A;  4G10 A;  2YWM A;  3QAG A;  1XIY A;  5J5N A;  4HEA 2;  4K2X A;  2YWO A;  5JCG A;  1O81 A;  2CZ3 A;  2VL3 A;  3TKR A;  1X5C A;  4MA9 A;  5IO0 A;  5G2Z A;  3DD3 A;  3Q6O A;  5ECR B;  4K7N A;  2GLR A;  3C71 A;  3E9J B;  4WXT A;  2HSH A;  1ST9 A;  3LGC A;  4I5Q A;  4PUF C;  3TUE A;  3FR9 A;  6GSY A;  3FK8 A;  3KXO A;  1V98 A;  3BD2 A;  2P31 A;  3DVW A;  12GS A;  5AGY A;  4GST A;  4EKZ A;  2LQQ A;  4XRD A;  1M7T A;  1ZMA A;  22GS A;  4AJ7 A;  2L6D A;  1SD9 A;  1WE0 A;  2C0D A;  4F0C A;  3APS A;  1OC9 B;  1TDI A;  3UBK A;  3A2X A;  1N2A A;  2V2G A;  1SKW B;  1I9D A;  3TCO A;  1XFL A;  4K7I A;  2DJ3 A;  2IMF A;  2BMX A;  2KHP A;  4YQM A;  2KP2 A;  2H1B A;  5J9C A;  1V2A A;  4ISD A;  2JSY A;  3MYD A;  2VCW A;  3FY7 A;  2H0G A;  3K8N A;  1Z7P A;  3ERF A;  2AV4 A;  3DKS A;  3RHB A;  2IN3 A;  4ZL8 A;  4NMU A;  1GSY A;  1PGT A;  17GS A;  5KN2 A;  2H75 A;  4KW6 A;  2R6K A;  4YKF A;  1TP9 A;  3GKX A;  4WF4 A;  4BVY B;  1AC1 A;  1SYX A;  1B9X C;  4FQU A;  4WET A;  2VO4 A;  4IGJ A;  2VLV A;  3HZ4 A;  3IBH A;  1PRX A;  4TN8 A;  3CBU A;  1TJD A;  5HFG A;  2JAC A;  3TJG A;  2YV7 A;  1PKW A;  1T1V A;  5CRW A;  1AXD A;  5DQY A;  2K8S A;  1EV9 A;  6GST A;  3F63 A;  4NPB A;  1ZZY A;  5E4W A;  3GX8 A;  2ON7 A;  3ZYW A;  2YZU A;  1AIU A;  3BCK A;  4WF5 A;  3WD6 A;  2CV4 A;  2L4Q A;  3IAS 2;  3TJK A;  1OKD A;  2VL2 C;  4J56 E;  2R5G A;  3G7J A;  4G0I A;  1TOF A;  4O5R A;  3MAK A;  1M0U A;  2NVL A;  5B6M A;  3RPP A;  2LJR A;  1TRW A;  2R0P A;  5A5K A;  1XVQ A;  2KLX A;  5HQP A;  1AQV A;  2LKU A;  2MZC A;  4PX1 A;  1TI3 A;  4MH3 A;  1XWC A;  4YAV A;  4WR4 A;  3IHQ A;  2G0F A;  5F06 A;  3HXS A;  5B8B A;  1ML6 A;  2RLI A;  4HI7 A;  5AN1 A;  1EZK A;  5IOX A;  3GRX A;  4TKY A;  1M9B A;  2V1M A;  1GL8 A;  1BED A;  2IMK A;  4DSR A;  1JZW A;  4OFN A;  3F4T A;  5ECN B;  1GH2 A;  5AIV A;  2O8V B;  1E6B A;  4I8B A;  1V57 A;  2E0Q A;  1XOA A;  4GXZ A;  4DEJ A;  1GP1 A;  3D0Z A;  2WUL A;  2I81 A;  4N0V A;  2DMM A;  4AJ8 A;  1THX A;  4ECB A;  2YWI A;  4YQU A;  3EE2 A;  1VF1 A;  3MIX A;  1RW1 A;  1SD8 A;  3PIN A;  2X8H A;  2TRX A;  2I1U A;  2QSI A;  1TU8 A;  2V6O A;  1OE7 A;  4MF5 A;  3M9K A;  3WGE A;  1K3L A;  2ALB A;  2XHF A;  2TIR A;  5J4U A;  3DXB A;  3HJO A;  2VCQ A;  1PKZ A;  4KA0 A;  3D4T A;  2IMD A;  1AAZ A;  3EC3 A;  2HRF A;  1YDK A;  3PGT A;  4XS1 A;  1S3A A;  1PX6 A;  3DWV A;  3FKF A;  1PL2 A;  1HD2 A;  2HLS A;  4TVE A;  1GUK A;  3IR4 A;  3KD0 A;  1YF1 A;  5F0G A;  2DSA A;  3D4M A;  3QD9 A;  1N8J A;  2YN1 A;  2H0H A;  3GSS A;  1PN0 A;  4GRF A;  1IYH A;  1BJX A;  5KOX A;  3GN3 A;  1U6T A;  3SBC A;  4EC0 A;  5A4V A;  4HZ4 A;  3KM6 A;  4FYU A;  5KN0 A;  4G19 A;  2YWN A;  3A5W A;  2GGT A;  2IPA A;  1SKR B;  4FYB A;  4AGS A;  4DVC A;  1U3A A;  1PA3 A;  2WRT A;  3I6A A;  1LBK A;  6GSX A;  5DVB A;  3M3M A;  1YZX A;  1QGV A;  2O89 A;  4MZC A;  3ZVJ A;  3GHA A;  3F6F A;  1T4Z A;  5G30 A;  5F07 A;  3LFL A;  3IHG A;  3H1N A;  3EWL A;  3FHK A;  4WKW A;  5JCU A;  2FLS A;  5HFK A;  3TKQ A;  4TR0 A;  3ZFL A;  1TK5 B;  3LG6 A;  2I9H A;  1QXH A;  2K6V A;  3R3E A;  5HR1 A;  2WDU A;  2MBS A;  4QL7 A;  5HR0 A;  4GSN A;  3EMX A;  3VPT A;  1EEM A;  4EIQ A;  4IP1 A;  3UJ1 A;  2H1D A;  4USS A;  1USB A;  3PH9 A;  3M8N A;  4ID0 A;  4ZBB A;  1G6Y A;  1GLP A;  2B7J A;  2CX4 A;  1XXU A;  3TRP A;  7GSS A;  1XOB A;  5COH A;  1IYI A;  4TXO A;  4OWY A;  4J2F A;  1V58 A;  1WOU A;  2H72 A;  1B4Q A;  4POB A;  2HRN A;  4FH8 A;  2LRC A;  3GUR A;  2FNO A;  2A4V A;  3HD5 A;  5JWR B;  1X5E A;  4JED A;  1OAZ A;  5IMD A;  1K0C A;  2MMO A;  1GSF A;  4KGI A;  1F2E A;  1GUH A;  16GS A;  1QQ2 A;  3IV4 A;  2EIO A;  3QFB C;  2CT6 A;  2V6K A;  1JLW A;  2C3Q A;  2HYX A;  3ZL5 A;  4RQX A;  4TW5 A;  2GTU A;  4YKG A;  2ZNM A;  1A0F A;  1FG4 A;  2LRT A;  3HJM A;  4E8E A;  5HR3 A;  3F9U A;  2LNS A;  1XW9 A;  4Q5Q A;  4RI6 A;  2LST A;  4BL7 B;  5D93 A;  2OA7 A;  3VK9 A;  5IMV A;  1QK8 A;  3GL5 A;  2PU9 C;  1YF0 A;  1XVW A;  3ZLP A;  4EUY A;  1GSD A;  2WS2 A;  4IQ1 A;  5FHI A;  2MBT A;  5G5F A;  5CP1 A;  2KOK A;  1PSQ A;  3ZIT A;  4KUN A;  2FD3 A;  4PUR A;  2GVP A;  1YKC A;  2DLX A;  3KTB A;  4ACS A;  3KMO A;  1R5P A;  3F4R A;  3DGQ A;  2B1K A;  3G9B A;  3EYT A;  4NAX A;  5CRH A;  4KSM A;  5C04 A;  5IM9 A;  3TKS A;  2WFC A;  4Z7X A;  1EGO A;  3EUR A;  5KN3 A;  4ECJ A;  1B48 A;  1FOH A;  1A2L A;  4X4J A;  2OKA A;  3RPN A;  3A2W A;  3TB2 A;  3HA9 A;  2XC2 A;  1GNE A;  1GUM A;  4RUV A;  3CSJ A;  4ZIJ A;  2V32 A;  3QCP A;  1PQN A;  1HNB A;  2WB9 A;  5IPG A;  2GSR A;  5F05 A;  4F0B A;  1F9M A;  2FA4 A;  4XCS A;  3IRA A;  3KH9 A;  3GH9 A;  2VIM A;  3H93 A;  5G5E A;  3UAP A;  5D9X A;  3RDW A;  1SK0 A;  1U3I A;  2L6C A;  4GF0 A;  1OC3 A;  2EC4 A;  2YJ7 A;  1Z7R A;  2Z9S A;  5L71 A;  1XCC A;  4OMV A;  4PGT A;  3FYG A;  4Z2U A;  1H75 A;  3C8E A;  2HT9 A;  1ZCP A;  1TRS A;  2GST A;  1S3D A;  1SL0 B;  1T4Y A;  5CRG A;  3APQ A;  2JZR A;  2JL4 A;  1DE1 A;  5KOW A;  2N5B A;  5AIX A;  3QMX A;  1DBY A;  3LYP A;  2G2Q A;  2DKH A;  4L5O A;  1EP8 A;  2LUS A;  2H76 A;  3RBT A;  3VFI A;  2CVK A;  2RUF A;  5E59 A;  3KP9 A;  2RM5 A;  5IMC A;  1VRS D;  3FEU A;  4BA7 A;  4KSO A;  3R2Q A;  1X0R A;  4TXO B;  1THO A;  4V1A g;  2GT5 A;  3QR6 A;  3UOM A;  3ZRD A;  3FZ9 A;  4EIP A;  11GS A;  5ID2 A;  4WBR D;  5ECK B;  2DIZ A;  2B6M A;  2LNT A;  1Y25 A;  2K18 A;  3ZMK A;  3FZA A;  1XWK A;  4MZW A;  4EL1 A;  2L5L A;  4TOP A;  3QAW A;  1X9S B;  3NZN A;  1ERT A;  1O73 A;  3ME8 A;  4TR4 A;  3VI7 A;  2C0F A;  1Z9H A;  1FVK A;  2L59 A;  1A0R P;  1B4P A;  4N30 A;  2H71 A;  2E2M A;  4JE1 A;  4MNN A;  1K0A A;  4CHS A;  4K0N A;  1Y6E A;  1WIK A;  2PUK C;  4MPG A;  2R4V A;  1TKD B;  3M9J A;  2FA8 A;  3LSZ A;  4MH2 A;  3I69 A;  3MWH A;  1JZR A;  2XPD A;  4ZB9 A;  1SJZ A;  1I5G A;  2LTK A;  3GTU A;  5DAL A;  2H6Z A;  2DML A;  1FO5 A;  3KIJ A;  2C3N A;  3J7Y b;  5B8A A;  2PGT A;  3ZIJ A;  1EP7 A;  3LJR A;  2LJA A;  1F37 A;  3L4N A;  3I43 A;  2B3S A;  18GS A;  4KDX A;  2AJQ B;  4K8M A;  3GA4 A;  2B1L A;  4IVF A;  5A4W A;  2QA1 A;  2KUC A;  4EDY A;  3JCM L;  4PNG A;  3HHV A;  1QUW A;  3V1W A;  2OAD A;  3LW9 A;  1ABA A;  3GFK A;  4KX4 A;  4EVM A;  1G7E A;  3ED3 A;  2OBK A;  1F6M C;  3D6I A;  2HXK A;  2P0G A;  1R5A A;  2AHE A;  2E2G A;  4MF6 A;  3TDG A;  4HDE A;  3QAV A;  3ZTL A;  3H4K A;  2CX3 A;  4ZL7 A;  4LA1 A;  1O8X A;  2JZS A;  4N10 A;  4KDU A;  2PVQ A;  1JZO A;  5DBQ A;  6GSS A;  4ML6 A;  4AF2 A;  3F0I A;  2IME A;  2WGR A;  2DJ0 A;  2F8F A;  3WT1 A;  2LRN A;  2VLT A;  2H70 A;  1YQ1 A;  4YQV A;  3UL3 A;  3IC4 A;  4MLY A;  1GSE A;  2CVB A;  3KZQ A;  2WJU A;  4NV5 A;  3GYK A;  2C0G A;  2H1A A;  3J7Y k;  1HNC A;  1NW2 A;  2LQO A;  5G1L A;  4KE3 A;  2KP1 A;  3VPQ A;  3IE3 A;  4ECC A;  1S3C A;  4Z2T A;  3ME7 A;  4OCE A;  4WR5 A;  5IPH A;  1VF2 A;  3HYP A;  1XW6 A;  4O5U A;  3HJP A;  1RK4 A;  2ON5 A;  4XS6 A;  4N0Z A;  3PPU A;  1A2J A;  1K0N A;  1JFU A;  3Q18 A;  3H8Q A;  1VF3 A;  2VM1 A;  1FOV A;  2CA8 A;  2H6X A;  2YCD A;  4KCE A;  5IMA A;  2H01 A;  3P8W A;  4LL1 B;  5G31 A;  2YAN A;  3C7M A;  2NBS A;  1SYR A;  3W6G A;  1SJI A;  2VCV A;  5HR2 A;  5GAN D;  4IJ3 A;  3D21 A;  1DSB A;  3GTU B;  5DAL B;  4TR3 A;  5H5Q A;  3CXG A;  2CVD A;  14GS A;  2FY6 A;  4E8H A;  4TRX A;  4IJI A;  2YZH A;  4K9Z A;  3OR5 A;  1OE8 A;  3NIV A;  1B9Y C;  5GSS A;  5GZZ B;  4V2N A;  4CY8 A;  5GAP D;  3MSZ A;  3QPM A;  3CMI A;  4I2U A;  3EVI A;  3Q19 A;  3M0F A;  2K9F A;  1T3B A;  3CSI A;  2VAF A;  1HQO A;  4JZQ A;  1GTA A;  3BBY A;  2N5A A;  1HNA A;  5DJL A;  5BMU A;  4HU9 A;  2LJK A;  5DDL A;  5IMF A;  1OYJ A;  3TKP A;  4V2L A;  2YJH A;  3FMW A;  1A2M A;  2CAI A;  4EXJ A;  3DRN A;  2F3M A;  1X9W B;  4PQ1 A;  1GSS A;  1EWX A;  3WT2 A;  1NHY A;  4A5P A;  4WEY A;  2H0I A;  3IK9 A;  3IDV A;  4TXV A;  1G7O A;  4X43 A;  1K0O A;  1CQG A;  2X8C A;  1B8X A;  1MDI A;  4MAB A;  5D73 A;  4HQS A;  4MF7 A;  5ABR A;  2LEG A;  2WZ9 A;  4RQR A;  5EVO A;  5IQY A;  2R2J A;  2BTO T;  4F82 A;  3GV1 A;  2C8U A;  2XPE A;  4IEL A;  3L9V A;  3VWV A;  3GKK A;  1O85 A;  4PTS A;  4RI7 A;  1FAA A;  2IL3 A;  4XHM A;  4V1A p;  5J3R A;  2P5Q A;  1Z6M A;  4PQH A;  5LD0 A;  4EDZ A;  3US3 A;  1Q4J A;  4XS4 A;  4GQC A;  5DJM A;  5ECS A;  1XWB A;  2H74 A;  1W4V A;  1GNW A;  3KGK A;  2R37 A;  1X5D A;  4PXO A;  3EMP A;  3ZFB A;  4L5L A;  2F9S A;  1KEB A;  4MCU A;  2JZT A;  1YKA A;  1TRV A;  2HE3 A;  5KEJ A;  1SK1 A;  5DCG A;  3FZ4 A;  2DJK A;  5D9W A;  1ZOF A;  4HQZ A;  3BOA A;  3LWA A;  3C73 A;  4EF0 A;  6GSV A;  2CZ2 A;  1VGL A;  2DIY A;  4ML1 A;  3GKM A;  3D5J A;  2YV9 A;  1TK0 B;  3FZ5 A;  4MP4 A;  3ISO A;  2WCI A;  1YEX A;  4G9H A;  2A4H A;  6GSW A;  3QFA C;  2LV3 A;  1K0B A;  3EU4 A;  4LL4 B;  1LJR A;  1CQH A;  2HNL A;  2M72 A;  3ZML A;  4ZBD A;  3UAR A;  3VUR A;  2J9H A;  2VD0 A;  3FRC A;  1ERV A;  2A2R A;  4KH7 A;  2PER A;  5J9B A;  1NM3 A;  4K2D A;  2FHE A;  2H19 A;  4HJ2 A;  3ERW A;  3F8U A;  1MTC A;  1A8L A;  1GTU A;  1UN2 A;  1A8Y A;  2J23 A;  1YY7 A;  1TXX A;  4KDY A;  2X64 A;  3F3Q A;  3G7Y A;  2P5R A;  4WBJ A;  1DUG A;  1SL2 B;  2IJY A;  5C00 A;  2C1Y A;  3G7I A;  4Q5R A;  2HZE A;  4K5R A;  2MMA A;  3F3R A;  2HFD A;  3HY2 A;  1H4O A;  2AB6 A;  4ZBA A;  1JLV A;  4LMV A;  4ZB6 A;  4I2T A;  4K6X A;  2HZF A;  3VI5 A;  4FO5 A;  4IHU A;  3WYW A;  2ZUP A;  8GSS A;  3ZRE A;  1M9A A;  20GS A;  4K7O A;  4F9Z A;  2O87 A;  2PVO C;  4EO3 A;  3GST A;  4F2I A;  1GTB A;  4V2M A;  3P2A A;  1GUL A;  2YP6 A;  3DIE A;  3L78 A;  5JWQ B;  2X4A A;  2RUE A;  2X99 A;  1RQM A;  2REM A;  1YEP A;  2V41 A;  4MJE A;  2H30 A;  3MDK A;  4JR6 A;  2GSQ A;  2HI7 A;  3UMA A;  4Q5F A;  5DCH A;  5D9V A;  1WRY A;  1AQX A;  2LS5 A;  2QA2 A;  4TR1 A;  1GSU A;  4ZB8 A;  4HOJ A;  3GH6 A;  3UVH A;  3NOF A;  3I9V 2;  4IN0 A;  2B5X A;  3LOR A;  1JHB A;  2XBQ A;  4K1F A;  2I4A A;  4KCA A;  4JBB A;  3U6V A;  4IKH A;  5ECM B;  2OJL A;  3H79 A;  3LEF A;  5H5S A;  4LLR A;  2X8G A;  1OKT A;  1JZD A;  4XRA A;  2EIQ A;  4NWY A;  2HSM A;  1EOH A;  19GS A;  5DAK A;  3HZ8 A;  4BVX A;  5D9T A;  2B7K A;  1BX9 A;  1FB6 A;  3KEB A;  2R3X A;  2GQL A;  1Z6N A;  4ZIL A;  4ICY A;  5F8B A;  1Z5Y E;  1GTI A;  1SK2 A;  3RAZ A;  2OAC A;  1UC7 A;  2OE3 A;  2FGX A;  5ECP B;  1KBN A;  13GS A;  5EPF A;  4IW9 A;  4YAP A;  5JCW A;  3TGZ A;  1M2B A;  3CRU A;  4K5S A;  2R0C A;  3QOU A;  4IP6 A;  4ZL9 A;  3GNJ A;  3IAM 2;  5IOW A;  4CW9 A;  4BWQ A;  1ZYQ B;  3HDC A;  1GSQ A;  4CDO A;  4DSS A;  2VCT A;  1URM A;  3TJF A;  1KTE A;  4HZ2 A;  2TRC P;  3RHC A;  1EV4 A;  3GKN A;  4MPF A;  2EIR A;  2IFQ A;  2OBI A;  3TRQ A;  2A2S A;  1TTZ A;  3IOS A;  1ERU A;  1ZYN A;  2IMI A;  2JAD A;  1XBS A;  1NHO A;  3TJJ A;  1MD3 A;  5AIS A;  3W8S A;  1XW5 A;  1ERW A;  1BAY A;  4MDC A;  3D22 A;  3LQ7 A;  4FYC A;  3WGX A;  1FB0 A;  3C1S A;  3VLN A;  2HRK A;  1PX7 A;  4Q5N A;  3VWW A;  2UZ8 A;  1DE2 A;  5BRT A;  3F4S A;  1XPV A;  3WGD A;  2HZE B;  1AW9 A;  3W8J A;  4OO4 A;  4IBP A;  4MZB A;  4ULX A;  3LXT A;  1QMV A;  2GQM A;  3F6D A;  4MJC A;  2B5Y A;  3CSH A;  1Q98 A;  1MEK A;  4QL9 A;  1Z3E A;  6GSU A;  4HS1 A;  4F03 A;  5JWO B;  2FUG 2;  4ILF A;  4G2E A;  4HUA A;  3E3E A;  4PNF A;  5HFI A;  4HJM A;  2A2P A;  1XZO A;  1F3A A;  2IIY A;  3LYK A;  5A4U A;  5ECO B;  1G6W A;  2C0E A;  3LXZ A;  4Z2R A;  3EPT A;  3ZVJ D;  4TR1 B;  3UBL A;  1X9M B;  2RII A;  5ENU A;  1AUC A;  2GQK A;  2VL9 A;  5ID2 B;  1T00 A;  3Q74 A;  4BWS A;  2AYT A;  1K3Y A;  2DJ2 A;  3CTG A;  4O5Q A;  1PMT A;  5FWG A;  2VLU A;  2FWG A;  5IMZ A;  3DYR A;  3O76 A;  2C4J A;  1XWG A;  4ECI A;  5CRE A;  2FCH A;  1QFN A;  3O6T A;  5DAK B;  1V40 A;  2GS3 A;  4BVX B;  5B7C A;  2L4C A;  2L57 A;  1MDJ A;  4MMM A;  5ECL B;  4QQ7 A;  3A5I A;  3KP8 A;  4AJ6 A;  3M1G A;  1ZL9 A;  1J9B A;  2B5E A;  1UA5 A;  2NTO A;  1FW1 A;  3L9S A;  2GZY A;  3IA1 A;  4X0X A;  1AQW A;  3ERG A;  4PQI A;  3TKS E;  1OVN A;  2H8L A;  1EEJ A;  3TRX A;  9GSS A;  2GZZ A;  3L0H A;  1EGR A;  5EL8 A;  5ECQ B;  3UIW A;  4DSS B;  4BL7 A;  2F8A A;  1PL1 A;  1SEN A;  3O3T A;  1C72 A;  4EE0 A;  3GX0 A;  4XIH A;  4MJB A;  1BG5 A;  3U5R E;  1MDK A;  3EU3 A;  4G0L A;  2R0G A;  4POK A;  1R26 A;  2IFQ B;  4PUA A;  5D8I A;  3VWU A;  1M2D A;  1K3O A;  4POM A;  3GIX A;  4GQF A;  1SU9 A;  2GT6 A;  4JU5 A;  3KMN A;  2D2Z A;  1NSW A;  2M80 A;  1PD2 1;  3UEM A;  2VUP A;  3CYN A;  3BJ5 A;  3IC8 A;  4FIW A;  5ECH B;  1SL1 B;  4N11 A;  4O7H A;  3HVS A;  5ELA A;  3KCM A;  3UVT A;  1R7H A;  3FR3 A;  3A2V A;  4NHW A;  1ZYE A;  5LCZ A;  1MD4 A;  4JRR A;  5LNK e;  2VOC A;  4IQA A;  1E2Y A;  3GL3 A;  2PBJ A;  4MJA A;  1A24 A;  2O85 A;  2OE0 A;  2VL2 A;  1WWJ A;  3HVX A;  3GUS A;  3TKS C;  1A23 A;  3DML A;  3IPZ A;  1XWA A;  4NXI A;  3DEX A;  1TRU A;  2DKI A;  2I3Y A;  1U87 A;  4KND A;  4JR4 A;  4P3Y B;  3N9J A;  2GZP A;  5CO3 A;  4H86 A;  4KF9 A;  2H66 A;  3VWX A;  1GWC A;  5IO2 A;  3E0U A;  4NV2 A;  5CYY A;  1M2A A;  2QGV A;  2PMT A;  5D96 A;  4D73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...