3ZYWA

Crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
108
structure length
108
Chain Sequence
DLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLUTAREDOXIN-3
publication title Crystal Structure of the First Glutaredoxin Domain of Human Glutaredoxin 3 (Glrx3)
rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 37
structure length 108
sequence length 108
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zywA01
5KN0A 3CXGA 5D9TA 3DRNA 2FY6A 2X64A 2JL4A 3R2QA 2C4JA 1SD9A 2LRNA 4E8EA 5ENUA 2E0QA 2FD3A 4MLYA 5EL8A 9GSSA 2OACA 3CSJA 2HLSA 3D4MA 4WR4A 5E59A 4KE3A 1HQOA 2IMKA 3CTFA 4BPYA 3ME7A 2WGRA 4PGTA 3GKMA 1O8XA 1YZXA 3HJMA 5CREA 5IOWA 4TXOA 2OBKA 5CRWA 4KW6A 4N10A 3A2VA 3HJPA 1EOGA 2C80A 2IMEA 2ALBA 4PQIA 2PBJA 1PL2A 2B5YA 4ECBA 4IHUA 3E3EA 4XS4A 3A5WA 1XCCA 1B4QA 2DIZA 5A4UA 3ED3A 1TU8A 3IPZA 3KM6A 4GSNA 2H1AA 3KGKA 1YEXA 1NSWA 2CAQA 1TRVA 3P90A 2VCWA 1T00A 2M46A 2H30A 4AGSA 3LYPA 1YF1A 1XW6A 1WIKA 1HNAA 2BJXA 2GQLA 2LUSA 3M8NA 2LEGA 3G7YA 1VF1A 4XHMA 5ECOB 1XWAA 5IMFA 2L5OA 5EPFA 3FR3A 1SU9A 4OD7A 4MZWA 4Q5RA 1W89A 2H6YA 1EEJA 4KDYA 3C1RA 2MBSA 1SKRB 4RQRA 3IDVA 4AJ8A 2J9HA 1JLVA 1PKWA 2YWNA 1M99A 1A0RP 3I69A 5ECNB 1TDIA 2PWJA 4L5LA 2GLRA 1WWJA 4GCIA 4RI6A 3QMXA 1EGRA 4OWYA 2PU9C 4ECIA 2DJJA 2IFQB 2H01A 1AXDA 1G0TA 3GRXA 3W8SA 4GWRA 3EURA 1KTEA 1IYHA 4PXOA 2DMLA 5DALA 2GSRA 1PSQA 1V98A 3C71A 4OCEA 3Q6OA 1JZWA 3UMAA 3QFAC 3MDKA 1TK0B 4KGIA 1QUWA 5ECRB 4O32A 4FYCA 3MAKA 3VLNA 4D73B 4OO5A 4TR0A 4FYBA 1C72A 5ECLB 1EV4A 22GSA 2CA8A 4N0ZA 4TR4A 2IMFA 4P3YB 2H66A 4K8MA 1TJDA 3HZ4A 3F4RA 4HOJA 5FT3A 5CO3A 5CRDA 6GSWA 1MTCA 5ECMB 3FZ5A 2WFCA 5LD0A 1JZDA 1WE0A 2TRXA 3OR5A 2F51A 3M9KA 2YWMA 4MF5A 3A3TA 3VWWA 2QSIA 1URMA 5D9VA 5COHA 3E9JB 2H1BA 1X5DA 5A5KA 4OFNA 3FHKA 3L9VA 1BYEA 4KAEA 1I9DA 1R7HA 3QFBC 3KIJA 4DEJA 2FCHA 4ZB6A 1S3DA 2LRTA 1EZKA 4IN0A 5IM9A 2AB6A 2D2ZA 2LJKA 3DVWA 4HJ2A 2HT9A 4GQCA 5EY6A 1MEKA 5D93A 4ZBAA 3WD6A 6GSUA 2K18A 2GVPA 2R6KA 5B6MA 1HD2A 3APOA 1Q98A 2JSYA 3D4TA 1ZYEA 3ZMLA 4WEYA 2F9SA 2XPEA 4WBJA 2XHFA 4CDOA 3DGQA 1BG5A 14GSA 3I6AA 1M2BA 2OA7A 2O89A 5F0GA 2H1GA 1M9AA 4XS1A 2IIYA 1A2JA 5J9CA 4L0UA 4G2EA 4PUAA 3HZ8A 2N5BA 1MD3A 2MMAA 3ERWA 1ZZYA 4K7OA 2LJAA 2NDOA 1AQVA 3FZAA 3E0UA 3UOMA 1XWKA 1THOA 4XS4B 4X43A 1ON4A 4BL7A 1BAYA 3GKXA 3KMOA 2CVKA 5IMCA 5AGYA 4IELA 5DQSA 3DEXA 4BVXA 3NZNA 4ILFA 1JLWA 4IQ1A 4FYUA 5D9XA 1ACVA 3S9FA 1XIYA 2DLXA 1EP8A 2DJ2A 2YPMA 2WB9A 5IOXA 2KUCA 3G7IA 4IS0A 4EKZA 4OCFA 1A0FA 3PINA 2JSZA 5ECSA 4HI7A 5JCWA 1Z6NA 1LU4A 4MDCA 4QL9A 3HD5A 1GSYA 4YQVA 2YN1A 3O3TA 2Z9SA 1SENA 4ZBBA 3ZIJA 3I43A 4HZ4A 4AJ6A 4ML6A 3IOSA 4JE1A 1QFNA 4EF0A 5B7CA 3VURA 3O6TA 1Z3EA 1PMTA 1PA3A 6GSSA 5JWQB 4F9ZA 1VF4A 5CAXA 3IR4A 2P5QA 2AV4A 2F8FA 2GZPA 1TKDB 1QXHA 2LSTA 1OE7A 1RK4A 1OC3A 3WYWA 5IMAA 2YWIA 3P7XA 1T8EB 1USBA 3QAVA 2HFDA 3DD3A 2L59A 1YKCA 3GKKA 5JCGA 2HE3A 2MMNA 3Q74A 4AJ7A 4V1Ag 2H8LA 4PX1A 1XOAA 4MZBA 1SYXA 1SKSB 2X99A 4JR6A 3GH6A 2VL2A 3GTUA 4QQ7A 2YZUA 5AIXA 3VFIA 4I6XA 1FOVA 3F0IA 4OMVA 3VK9A 1YF0A 4I2UA 1Z5YE 4WKWA 2ES7A 1I5GA 3FR9A 1MDKA 2L5LA 4I97A 4TR1A 1AW9A 4EE0A 3J7Yb 1R26A 5D8IA 1OKTA 1QK8A 1SKWB 3TCOA 1B8XA 1HNCA 2HSYA 1T7PB 4JRRA 1K3OA 2X8CA 5JWRB 1H4OA 1TK5B 3VI7A 3BOAA 4BA7A 2XPDA 3EMXA 6GSYA 1XZOA 2IJYA 4GLTA 2O87A 2R37A 1ERVA 1BX9A 2VM1A 3U5RE 2RUEA 3LWAA 4ULXA 1YJ6A 3IXRA 3M1GA 4EDZA 5GAND 2DC5A 3RPPA 3L78A 2HZFA 1AQWA 2GGTA 5GAPD 1G6WA 2RIIA 2HXKA 1K3LA 5G5FA 5F07A 1XBSA 1X9MB 2QC7A 4K7NA 2GQMA 4F03A 1B9YC 1OYJA 2L57A 1GTUA 1M9BA 7GSSA 2F3MA 4X1UA 2H73A 4MJEA 1YY7A 2H72A 4KCEA 2JZSA 2AJQB 5LNKe 4YQUA 5E4WA 5F8BA 4K1FA 3BBYA 3FK8A 2NBSA 3GSTA 4K9ZA 2V2GA 2E7PA 2ON5A 3KMNA 1BQ7A 4ZL8A 1X0RA 4AF2A 4IVFA 4DSSB 3TRPA 1TRWA 1PX7A 2QGVA 4F0BA 1ABAA 2P5RA 3HJOA 3SBCA 1F2EA 4PNGA 1XWBA 2CAIA 3RAZA 2B1KA 3LXTA 1A2MA 2IMDA 1TOFA 1KNGA 2LS5A 5HQPA 5L71A 1GNEA 1A8YA 3GX8A 1ZYQB 4ZB9A 1S3AA 2VM2A 1YQ1A 3HA9A 3LEFA 4KH7A 1PX6A 5D96A 3ZZXA 2CX3A 1O73A 3IAS2 5G30A 3D6IA 2B7KA 2FGXA 1XXUA 3CRUA 3M9JA 4K7IA 5IPGA 3TKQA 1TW9A 2O7KA 16GSA 3LXZA 1WRYA 1ML6A 4N30A 1SL2B 4PNFA 4BWQA 3KD0A 1XW9A 1GUKA 2PERA 1GULA 3ZREA 1PN9A 2OE0A 5HR0A 3Q18A 5HR3A 2PUKC 5DAKB 5ABRA 3RPNA 2H6ZA 4HZ2A 4OO4A 4LL4B 4MJBA 1LBKA 1YKAA 2N5AA 5G31A 1M2AA 4IGJA 4MABA 4H86A 2FWEA 4PURA 4EL1A 1X5CA 5GZZB 4NAXA 4OFMA 3UIWA 2EIQA 3V1WA 3F3QA 2O8VB 2LQOA 5F06A 4F2IA 2YP6A 2N5FA 2G2QA 3HVVA 1ERTA 2E2GA 5D73A 2JZRA 2REMA 2TRCP 1NM3A 2L6DA 2NVLA 2CVDA 2VLUA 1TTZA 5DDLA 2M80A 2P0GA 4XIHA 4IJ3A 2CZ3A 5CYYA 3ZRDA 2RM6A 3TJKA 4YH2A 3RDWA 1GSFA 3LORA 2GZZA 2MYGA 5DJLA 1AUCA 3GH9A 2LRCA 2K6VA 5LCZA 2R4VA 4PQ1A 3F4TA 2IPAA 4OFTA 3WT2A 2B3SA 4POKA 2WDUA 2C3TA 4NV5A 2V41A 3GL5A 3GURA 5ID2B 2KHPA 1X9WB 2K9FA 4KDUA 2ZNMA 1FAAA 5GSTA 2V32A 2DIYA 4HDEA 3HVXA 1V9WA 1U6TA 2A2SA 2XBQA 4MH3A 4WR5A 1GUMA 1OC9A 4KCAA 1X9SB 2C0DA 1FHEA 3LSZA 1F37A 4RI7A 3AY8A 3A2XA 2VCZA 3F63A 3RBTA 4FH8A 1QQ2A 4MPFA 3VPQA 3G7JA 3UARA 4J56E 1XPVA 1GSUA 5DBQA 2VIMA 5H5QA 2R2JA 4NWYA 3N9JA 2B1LA 1GRXA 4V2LA 1F3BA 4QL7A 1AAZA 2GQKA 4XTSA 3LQ7A 3CMIA 4Z7XA 1OE8A 2GS3A 4GF0A 2CX4A 4ZL7A 3MNGA 2LKUA 3GFKA 4IKHA 3ZYWA 1PRXA 3EU4A 3APSA 2I9HA 3F4SA 5ECHB 3DYRA 3TOUA 4IJIA 4PUFC 1JFUA 3VWUA 2WRTA 4EDYA 2H19A 3LJRA 4J2FA 3M0FA 2DJ1A 4TXOB 2RM5A 3L4NA 5IQYA 1U3AA 3UAPA 18GSA 1GLQA 3C7MA 1Z7PA 3UBLA 1TRSA 2VCXA 3KH7A 2MZCA 2VCTA 4IBPA 1BEDA 2GSQA 1ZMAA 4F82A 2H0IA 2DJ3A 5FHIA 4V2NA 2MMOA 1T1VA 5H5RA 4PQHA 1WJKA 4TVEA 5DVBA 4F0CA 1J08A 4WETA 2H6XA 4JBBA 2WZ9A 2C8UA 1GP1A 2JZTA 4O92A 1VF2A 1THXA 4TR3A 1PGTA 1J0FA 2K8SA 3IE3A 1J9BA 3TKSE 4BWSA 2MBTA 4GSSA 3GYKA 1SL1B 4YAVA 1EOHA 2AUVA 4EC0A 2H76A 2GT6A 2R5GA 3KH9A 1GLPA 1G6YA 1N8JA 2OE3A 8GSSA 1XOBA 3GN3A 3HVSA 2F8AA 2ZUPA 4G19A 2R3XA 4XCSA 1TU7A 2L4QA 4O7HA 4WBRD 1Q4JA 4WF4A 5FWGA 3TGZA 4ZILA 2BMXA 2GT5A 3D22A 1K0BA 1IYIA 2O85A 5DCGA 3HDCA 3TRXA 1K0MA 3D21A 4IP1A 3KP8A 4I8BA 1SK0A 1FVJA 5CP1A 19GSA 2FNOA 4ISDA 4X0XA 2OBIA 1M2DA 1Y6EA 5IMVA 1K3YA 1VRSD 2ZCTA 3H79A 5DALB 2PVOC 3NOFA 3RHCA 4NV2A 3LGCA 1JZRA 2GTUA 2IFQA 1SJ6A 3ZFLA 3DVXA 4LLRA 2AYTA 2H75A 3CTGA 1RW1A 5J4UA 1TI1A 1JZOA 3WGEA 1K0AA 2YWOA 3KP9A 4GSTA 5IPHA 2CT6A 1FG4A 5F05A 4K6XA 3EWLA 3SWLA 1ZCPA 1XVWA 2KP2A 1GWCA 3GSSA 2YOIA 3UVTA 2EC4A 5IMDA 2CVBA 5C04A 2NTOA 4D73A 3IAM2 4NMUA 2HRFA 3QD9A 1O7UA 3BJ5A 3C73A 6GSVA 1XW5A 3TB2A 1EEMA 1V58A 5ECQB 4ACSA 1KBNA 4JEDA 3I9V2 2MMZA 2FWFA 2VL2C 4RUVA 3VWXA 4DSQA 2BTOT 3UVHA 2JADA 4NPBA 2H0HA 3PGTA 1V57A 4ML1A 4XRDA 4IW9A 3ZITA 4ZIJA 3HHVA 2M72A 2WJUA 1V2AA 3GV1A 2I3YA 2VUPA 5KN3A 2HI7A 5ELAA 4KB3A 1PQNA 5ECKB 1Z6MA 5ECIB 4EXJA 2A2RA 3GNJA 13GSA 3KCMA 2H0GA 5CRGA 1R5PA 3F6FA 4LMVA 3M3MA 2RUFA 3C8EA 1UVZA 2HYXA 2CZ2A 3A2WA 2AHEA 1PKZA 2ON7A 2CV4A 2YJ7A 1PD21 2GSTA 1A23A 4JU5A 3LFLA 2C1YA 3QDNA 3ERFA 4LL1B 2LJRA 3GUSA 3FZ4A 5G1LA 2VLTA 5B8AA 1MDIA 2C3NA 2VD0A 4TKYA 4MJCA 3TKPA 1BJXA 1T4ZA 2IN3A 1OVNA 2PVQA 1EGOA 3FEUA 5A4WA 5IO2A 1WOUA 1YEPA 2YV7A 1EWXA 3TJGA 1ERWA 1VGLA 2LTKA 1SJZA 2HNLA 2VAFA 4MF7A 4MZCA 5JCUA 2B5EA 4JZQA 1GH2A 2G0FA 2VL9A 4WF5A 3GMFA 3L9UA 2OKAA 4EO3A 1SJIA 5JWOB 2H1DA 2H71A 4TW5A 4ECCA 4NHWA 4I2TA 5INYA 3DMLA 1A8LA 1F3AA 3GIXA 5HFGA 4MJAA 1K0OA 5J3RA 2C0FA 3ME8A 1HYUA 1HNBA 5KN2A 3J7Yk 4EVMA 1K0CA 1XFLA 4NHZA 4N0VA 5HFIA 1GNWA 3UJ1A 2DMMA 1U87A 2FA4A 4KSOA 4ID0A 5H5SA 4LA1A 1R5AA 2VLVA 4Q5QA 2L6CA 2VCQA 3FY7A 3TJBA 3PH9A 4HQSA 1ZL9A 1GUHA 4V1Ap 4J57E 2CQ9A 5J5NA 3APQA 4TN8A 4ZBDA 1DE1A 1MD4A 1R4WA 2E2MA 1GTAA 6GSXA 4K0GA 1ZOFA 3IHQA 3KZQA 2V6OA 3GKNA 2B7JA 1WMJA 5KEJA 3QPMA 2LQQA 3UBKA 1DBYA 3JCML 5IIZA 1S3CA 2FWHA 2X8HA 2YV9A 1OKDA 4HS1A 2FA8A 1X5EA 2IL3A 2IMIA 5EVOA 4Q5NA 3FRCA 2AAWA 3HKRA 3HYPA 1FVKA 3D5JA 4HEA2 2X8GA 3TDGA 3IBHA 1FB6A 4EUYA 3CYNA 4I5QA 1UC7A 2FLSA 1U3IA 4O5RA 1GSEA 2DJ0A 2YCDA 1FW1A 3CBUA 1Z7RA 3GTUB 4DVCA 4KNDA 4KX4A 5IMZA 3F9UA 1U88A 1WPIA 4CHSA 2VOCA 2H70A 3L0HA 4TR1B 5G5EA 3KJYA 1GSQA 2J23A 2HZEA 3EU3A 2L4CA 4L8EA 3O76A 2XC2A 1B4PA 5DJMA 3ZLPA 5G2ZA 1SYRA 2PMTA 4TOPA 3GX0A 4K2DA 3GA4A 1WP0A 2IWTA 5B6NA 2V1MA 3ZIVA 1CQHA 3ERGA 1ST9A 1B9XC 3ZFBA 1K0NA 1EV9A 3D0ZA 3NIVA 1GTBA 4MA9A 3EVIA 2FUG2 2OADA 3US3A 3BCKA 2I81A 3QOUA 1UA5A 1YDKA 3DIEA 4BVYA 3IA1A 4POMA 1XWCA 4MP4A 2YZHA 10GSA 3IK7A 2XBIA 4YQMA 5KN1A 3KXOA 2JACA 1H75A 3TUEA 2VO4A 1LJRA 3DWVA 1RQMA 3CRTA 2QKEA 2RLIA 1F6MC 1QGVA 3WGXA 5HFKA 3KTBA 3RHBA 4NXIA 4KUNA 3L9SA 4G10A 4MPGA 2I1UA 1T3BA 3W6GA 2I4AA 1GSDA 4POBA 4YAPA 2A4VA 3FYGA 3TKSA 1W4VA 3EINA 1F9MA 3TJJA 5AN1A 2B6MA 3P8WA 5J9BA 1ERUA 4LMWA 2TIRA 5AISA 2WCIA 1O81A 4MK3A 3WGDA 1Z9HA 1V40A 1A2LA 2VL3A 4ZB8A 4MF6A 1SK2A 3TOTA 5DCHA 2OJLA 2FHEA 5C00A 3HXSA 4ZL9A 2LNTA 5HR1A 3TKSC 2WULA 4L0WA 2C0EA 3MSZA 3ISOA 2YJHA 2GZYA 4Q5FA 3BCIA 4DSSA 1T4YA 2V6KA 1FO5A 4GQFA 3VPTA 4ECJA 1VF3A 1XWGA 2KOKA 20GSA 1G7OA 3P2AA 3VI5A 4POLA 3KEBA 2HSHA 2PGTA 5GSSA 1K0DA 1Y25A 2PN8A 1TK8B 4IP6A 1JHBA 1SK1A 3FW2A 3TKRA 4KSMA 4N11A 1OC8A 3U6VA 3QCPA 5IO0A 3CSIA 3TJFA 3QAGA 4GRFA 5DQYA 3DXBA 2HRNA 4TXVA 4E8HA 4K0NA 3IV4A 4MCUA 1AQXA 5CNWA 1UN2A 1O85A 3ZVJD 1DUGA 1E6BA 3F6DA 3ZVJA 1O8WA 5DAKA 4ZXGA 4HJMA 3MWHA 2LV3A 3FR6A 3QR6A 1QMVA 1TRUA 3GL3A 1GTIA 11GSA 5B8BA 5A4VA 2YNXA 5ECPB 3K8NA 3F3RA 4L5OA 1DE2A 5G1KA 3HY2A 1TXXA 3H8QA 3G9BA 3PR8A 2PPTA 3W8JA 3ZTLA 2DSAA 1E2YA 3ZL5A 4GTUA 6GSTA 3ZMKA 2GDRA 3C1SA 2FWGA 3IRAA 2H74A 1DSBA 3H4KA 4JR4A 1EP7A 2NPBA 2B5XA 2JU5A 1ZGNA 2K8VA 3IC4A 4KA0A 3EC3A 4GXZA 1PL1A 1MDJA 3FZ9A 1A24A 1M0UA 3VWVA 17GSA 1NHOA 3LYKA 3WT1A 3CSHA 1SL0B 2EIOA 4FIWA 3QAWA 4XS6A 1G7EA 3IK9A 5AIVA 3DKSA 2KP1A 3GHAA 1TP9A 4HU9A 4MH2A 2HZEB 3BD2A 4G9HA 4HUAA 1GSSA 4FO5A 1TI3A 4CW9A 4TRXA 3KTLA 12GSA 5HR2A 1XVQA 3HCZA 1B48A 3EMPA 5ID2A 1FB0A 1OC9B 4XRAA 2EIRA 1NHYA 1OAZA 3UEMA 4DSRA 5CRHA 3UL3A 4IQAA 2C3QA 3TRQA 4RQXA 2OE1A 3EE2A 4V2MA 2KLXA 1GL8A 1CQGA 1N2AA 3H1NA 2C0GA 4WXTA 2DJKA 3F8UA 3EYTA 1M7TA 5D9WA 3LG6A 2VD1A 2YANA 1NW2A 3N5OA 3FKFA 4KDXA 3Q19A 1AIUA 2P31A 1O6JA 2GSSA 2LNSA 1KEBA 4HQZA 3H93A 2WS2A 1ILOA 1SD8A 4HU7A 1AC1A 2DBCA 5ELGA 2VCVA 5J41A 4MMMA
chains in the Genus database with same CATH superfamily
5KN0A 3CXGA 5D9TA 3DRNA 2FY6A 2X64A 2JL4A 3R2QA 2C4JA 1SD9A 2LRNA 4E8EA 5ENUA 2E0QA 2FD3A 4MLYA 5EL8A 9GSSA 2OACA 3CSJA 2HLSA 3D4MA 4WR4A 5E59A 4KE3A 1HQOA 2IMKA 3CTFA 4BPYA 3ME7A 2WGRA 4PGTA 3GKMA 1O8XA 1YZXA 3HJMA 5CREA 5IOWA 3A5IA 4TXOA 2OBKA 5CRWA 4KW6A 4N10A 3A2VA 3HJPA 1EOGA 2C80A 2IMEA 2ALBA 4PQIA 1S3RA 2PBJA 4FQUA 1PL2A 2B5YA 4ECBA 1M3IA 4IHUA 3E3EA 4XS4A 3A5WA 1XCCA 1B4QA 2DIZA 5A4UA 3ED3A 1TU8A 3IPZA 3KM6A 4GSNA 2H1AA 3KGKA 1YEXA 1NSWA 2CAQA 1TRVA 3P90A 2VCWA 1T00A 4G0IA 2M46A 2H30A 4AGSA 3LYPA 1YF1A 1XW6A 1WIKA 1HNAA 2BJXA 2GQLA 2LUSA 3M8NA 2LEGA 3G7YA 1VF1A 4XHMA 5ECOB 1XWAA 5IMFA 2L5OA 5EPFA 3FR3A 4HSCX 1SU9A 4OD7A 4MZWA 4Q5RA 1W89A 2H6YA 1EEJA 4EIQA 4KDYA 1PFOA 3C1RA 2MBSA 1SKRB 4RQRA 3IDVA 4AJ8A 2J9HA 1JLVA 1PKWA 2YWNA 1M99A 1A0RP 3I69A 5ECNB 1TDIA 2PWJA 4L5LA 2GLRA 1WWJA 4GCIA 4RI6A 3QMXA 1EGRA 4OWYA 2PU9C 4ECIA 2DJJA 2IFQB 2H01A 1AXDA 1G0TA 3GRXA 3W8SA 4GWRA 3EURA 1KTEA 1IYHA 4PXOA 2DMLA 5DALA 2GSRA 1PSQA 1V98A 3C71A 4OCEA 3Q6OA 1JZWA 3UMAA 3QFAC 3MDKA 1TK0B 4KGIA 1QUWA 5ECRB 4O32A 4FYCA 3MAKA 3VLNA 4D73B 4OO5A 4TR0A 4FYBA 1C72A 1EV4A 22GSA 2CA8A 5ECLB 4N0ZA 4TR4A 2IMFA 4P3YB 2H66A 4K8MA 1TJDA 4YKFA 3HZ4A 3F4RA 4HOJA 5FT3A 4Z2UA 5CO3A 5CRDA 6GSWA 1MTCA 5ECMB 3LW9A 4KF9A 3FZ5A 2WFCA 5LD0A 1JZDA 1WE0A 2TRXA 3OR5A 2F51A 3M9KA 2YWMA 4MF5A 3A3TA 3VWWA 2QSIA 1FOHA 1URMA 5D9VA 5COHA 3E9JB 2H1BA 1X5DA 5A5KA 3CQFA 4OFNA 3FHKA 3L9VA 1BYEA 2QA2A 4KAEA 1I9DA 1R7HA 3QFBC 3KIJA 4DEJA 2FCHA 4ZB6A 1S3DA 2LRTA 1EZKA 4IN0A 5IM9A 2AB6A 4G0LA 2D2ZA 2LJKA 3DVWA 4HJ2A 2HT9A 4GQCA 5EY6A 1MEKA 5D93A 4ZBAA 3WD6A 6GSUA 2K18A 2GVPA 2R6KA 5B6MA 1HD2A 3APOA 1Q98A 2JSYA 3D4TA 1ZYEA 3ZMLA 4WEYA 2UZ8A 2F9SA 2XPEA 4WBJA 2XHFA 4CDOA 3DGQA 1BG5A 14GSA 3I6AA 1M2BA 2OA7A 2O89A 5F0GA 2H1GA 1M9AA 4XS1A 2IIYA 1A2JA 5J9CA 4L0UA 4G2EA 4PUAA 3HZ8A 2N5BA 1MD3A 2MMAA 2A2PA 3ERWA 1ZZYA 4K7OA 2LJAA 2NDOA 1AQVA 2HRAA 3FZAA 3E0UA 3UOMA 1XWKA 1THOA 4XS4B 4X43A 1ON4A 4BL7A 1BAYA 3GKXA 4EIPA 3KMOA 2CVKA 5IMCA 5AGYA 4IELA 5DQSA 3DEXA 4Z2RA 4BVXA 3NZNA 4ILFA 1JLWA 4IQ1A 4FYUA 5D9XA 1ACVA 3S9FA 1XIYA 2DLXA 1EP8A 2DJ2A 2YPMA 2WB9A 5IOXA 3R3EA 2KUCA 3G7IA 4IS0A 4EKZA 4OCFA 1A0FA 3PINA 2JSZA 5ECSA 4HI7A 5JCWA 1Z6NA 1LU4A 4MDCA 4QL9A 3HD5A 1GSYA 4YQVA 2YN1A 3O3TA 2Z9SA 1SENA 3IHGA 4ZBBA 3ZIJA 3I43A 4HZ4A 4AJ6A 4ML6A 3IOSA 4JE1A 1QFNA 4EF0A 5B7CA 3VURA 3O6TA 1Z3EA 1PMTA 1PA3A 6GSSA 5JWQB 4F9ZA 1VF4A 5CAXA 3IR4A 2P5QA 2AV4A 2F8FA 2GZPA 1TKDB 1QXHA 2LSTA 1OE7A 1RK4A 1OC3A 3WYWA 5IMAA 2YWIA 3P7XA 4PTSA 1T8EB 1USBA 3QAVA 2HFDA 3DD3A 2L59A 1YKCA 3GKKA 5JCGA 2HE3A 2MMNA 3Q74A 4AJ7A 4V1Ag 2H8LA 4PX1A 1XOAA 4MZBA 1SYXA 1SKSB 2X99A 4JR6A 3GH6A 3HVNA 2VL2A 3GTUA 4QQ7A 2YZUA 5AIXA 3VFIA 4I6XA 1FOVA 3F0IA 4OMVA 3VK9A 1YF0A 4I2UA 1Z5YE 4WKWA 2ES7A 1I5GA 3FR9A 1MDKA 2L5LA 4I97A 4TR1A 1ZYPA 1AW9A 4EE0A 3J7Yb 1R26A 5D8IA 1OKTA 1QK8A 1SKWB 3TCOA 1B8XA 1HNCA 2HSYA 1T7PB 4JRRA 1K3OA 2X8CA 4BVYB 5JWRB 1H4OA 1TK5B 3VI7A 3BOAA 4BA7A 2XPDA 3EMXA 6GSYA 1XZOA 2IJYA 4GLTA 2O87A 2R37A 1ERVA 1BX9A 2VM1A 3U5RE 2RUEA 3LWAA 4ULXA 1YJ6A 2X49A 3IXRA 3M1GA 4EDZA 5GAND 2DC5A 3RPPA 3L78A 2HZFA 2X4AA 1AQWA 2GGTA 4YKGA 5GAPD 1G6WA 2RIIA 2HXKA 1K3LA 5G5FA 5F07A 1XBSA 1X9MB 2QC7A 4K7NA 2GQMA 4F03A 1B9YC 1OYJA 2L57A 1GTUA 1M9BA 7GSSA 2F3MA 4X1UA 2H73A 4MJEA 1YY7A 2H72A 4KCEA 2JZSA 2AJQB 2QA1A 5LNKe 4YQUA 5E4WA 5F8BA 4K1FA 3BBYA 3FK8A 2NBSA 3GSTA 4K9ZA 2V2GA 2E7PA 2ON5A 3KMNA 1BQ7A 4ZL8A 1X0RA 4AF2A 4IVFA 4DSSB 3TRPA 1TRWA 1PX7A 2QGVA 4F0BA 1ABAA 2P5RA 3HJOA 3SBCA 1F2EA 4PNGA 1XWBA 2CAIA 3RAZA 2B1KA 3LXTA 1A2MA 2IMDA 1TOFA 1KNGA 2LS5A 5HQPA 5L71A 4BVXB 1GNEA 1A8YA 3GX8A 1ZYQB 4ZB9A 5BRTA 1S3AA 2VM2A 1YQ1A 3HA9A 3LEFA 4KH7A 1PX6A 5D96A 3ZZXA 3MIXA 2CX3A 1O73A 3IAS2 5G30A 3D6IA 2B7KA 2FGXA 1XXUA 3CRUA 3M9JA 4K7IA 5IPGA 3TKQA 1TW9A 2O7KA 16GSA 3LXZA 1WRYA 1ML6A 4A5PA 4N30A 1SL2B 4PNFA 4BWQA 3KD0A 1XW9A 1GUKA 2PERA 1GULA 3ZREA 1PN9A 2OE0A 5HR0A 3Q18A 5HR3A 2PUKC 5DAKB 5ABRA 3RPNA 2H6ZA 4HZ2A 4OO4A 4LL4B 4MJBA 1LBKA 1YKAA 2N5AA 5G31A 1M2AA 4IGJA 4MABA 4H86A 2FWEA 4PURA 4EL1A 1X5CA 5GZZB 4NAXA 4OFMA 3UIWA 4USSA 2EIQA 3V1WA 3F3QA 2O8VB 2LQOA 5F06A 4F2IA 2YP6A 2N5FA 2G2QA 3HVVA 1ERTA 2E2GA 5D73A 2JZRA 2REMA 2TRCP 1NM3A 3PPUA 2L6DA 2NVLA 2CVDA 2VLUA 1TTZA 5DDLA 2M80A 2P0GA 4XIHA 4IJ3A 2CZ3A 5CYYA 3ZRDA 2RM6A 3TJKA 4YH2A 3RDWA 1GSFA 3LORA 2GZZA 2MYGA 5DJLA 1AUCA 3GH9A 2LRCA 2K6VA 5LCZA 2R4VA 4PQ1A 3F4TA 2IPAA 4OFTA 3WT2A 2B3SA 4POKA 2WDUA 2C3TA 4NV5A 2V41A 3GL5A 3GURA 5ID2B 2KHPA 1X9WB 2K9FA 4KDUA 2ZNMA 1FAAA 5GSTA 2V32A 2DIYA 4HDEA 3HVXA 1XG8A 1V9WA 1U6TA 2A2SA 2XBQA 4MH3A 4WR5A 1GUMA 1OC9A 4KCAA 1X9SB 2C0DA 1FHEA 3LSZA 1F37A 4RI7A 3AY8A 3A2XA 2VCZA 3F63A 3RBTA 4FH8A 1QQ2A 4MPFA 3VPQA 3G7JA 3UARA 4J56E 1XPVA 1GSUA 5DBQA 2VIMA 5H5QA 2R2JA 4NWYA 3N9JA 2B1LA 1GRXA 4V2LA 1F3BA 4QL7A 1AAZA 2GQKA 4XTSA 3LQ7A 3CMIA 4Z7XA 1OE8A 2GS3A 4GF0A 2CX4A 4ZL7A 3MNGA 2LKUA 3GFKA 4IKHA 3ZYWA 1PRXA 3EU4A 2DKIA 3APSA 2I9HA 2HSMA 3F4SA 5ECHB 3DYRA 3TOUA 4IJIA 4PUFC 1JFUA 5BMUA 3VWUA 2WRTA 4EDYA 2H19A 3LJRA 4J2FA 3M0FA 2DJ1A 4TXOB 2RM5A 3L4NA 5IQYA 1U3AA 3UAPA 18GSA 1GLQA 3C7MA 1Z7PA 3UBLA 1TRSA 2VCXA 3KH7A 2MZCA 4MNNA 2VCTA 4IBPA 1BEDA 2GSQA 1ZMAA 4F82A 2H0IA 2DJ3A 5FHIA 4V2NA 2MMOA 1T1VA 5H5RA 4PQHA 1WJKA 4TVEA 5DVBA 4F0CA 1J08A 4WETA 2H6XA 4JBBA 2WZ9A 2C8UA 1GP1A 2JZTA 4O92A 1VF2A 1THXA 4TR3A 1PGTA 1J0FA 2K8SA 3IE3A 1J9BA 4K5RA 3TKSE 4BWSA 2MBTA 4GSSA 3GYKA 1SL1B 4YAVA 4O5QA 1EOHA 2AUVA 2HRKA 4EC0A 2H76A 2GT6A 2R5GA 3KH9A 1GLPA 1G6YA 1N8JA 2OE3A 8GSSA 1XOBA 3GN3A 3HVSA 2F8AA 2ZUPA 4G19A 2R3XA 4XCSA 1TU7A 2L4QA 4O7HA 4WBRD 1Q4JA 4WF4A 5FWGA 3TGZA 4ZILA 2BMXA 2GT5A 3D22A 1K0BA 1IYIA 2O85A 5DCGA 3HDCA 3TRXA 1K0MA 3D21A 4IP1A 3KP8A 4I8BA 1SK0A 1FVJA 5CP1A 19GSA 2FNOA 4ISDA 4X0XA 2OBIA 1M2DA 1Y6EA 5IMVA 1K3YA 1VRSD 2ZCTA 3H79A 5DALB 2DKHA 2PVOC 2R0PA 3NOFA 3RHCA 4NV2A 3LGCA 1JZRA 4G0KA 2GTUA 2IFQA 1SJ6A 3ZFLA 3DVXA 4LLRA 2AYTA 2H75A 3CTGA 1RW1A 5J4UA 1TI1A 1JZOA 3WGEA 1K0AA 2YWOA 3KP9A 4GSTA 5IPHA 2CT6A 1FG4A 5F05A 4K6XA 3EWLA 3SWLA 1ZCPA 1XVWA 2KP2A 1GWCA 3GSSA 2YOIA 3UVTA 2EC4A 5IMDA 2CVBA 5C04A 2NTOA 4D73A 3IAM2 4NMUA 2HRFA 3QD9A 2R0GA 1O7UA 3BJ5A 3C73A 6GSVA 1XW5A 3TB2A 1EEMA 1V58A 5ECQB 4ACSA 1KBNA 4JEDA 3I9V2 2MMZA 2R0CA 2FWFA 2VL2C 4RUVA 3VWXA 4DSQA 2BTOT 3UVHA 2JADA 4NPBA 2H0HA 3PGTA 1V57A 4ML1A 4XRDA 4IW9A 3ZITA 4ZIJA 3HHVA 2M72A 2WJUA 1V2AA 3GV1A 2I3YA 2VUPA 5KN3A 2HI7A 5ELAA 4KB3A 1PQNA 5ECKB 1Z6MA 5ECIB 4EXJA 2A2RA 3GNJA 13GSA 3KCMA 2H0GA 3FMWA 5CRGA 1R5PA 3F6FA 4LMVA 3M3MA 2RUFA 3C8EA 1UVZA 2HYXA 2CZ2A 3A2WA 2AHEA 1PKZA 2ON7A 2CV4A 2YJ7A 1PD21 2GSTA 1A23A 4JU5A 3LFLA 2C1YA 3QDNA 3ERFA 4LL1B 1ZYNA 2LJRA 3GUSA 3FZ4A 5G1LA 2VLTA 5B8AA 1MDIA 2C3NA 2VD0A 4TKYA 4MJCA 3TKPA 1BJXA 1T4ZA 2IN3A 1OVNA 2PVQA 4K5SA 1EGOA 5KOXA 3FEUA 5A4WA 5IO2A 1WOUA 1YEPA 2YV7A 1EWXA 3TJGA 1ERWA 1VGLA 2LTKA 1SJZA 2HNLA 2VAFA 4MF7A 4MZCA 5JCUA 2B5EA 4JZQA 4BL7B 1GH2A 2A4HA 2G0FA 2VL9A 4WF5A 4K2XA 3GMFA 3L9UA 2OKAA 4EO3A 1SJIA 5JWOB 2H1DA 2H71A 4TW5A 4ECCA 4NHWA 4I2TA 5INYA 3DMLA 4Z2TA 1A8LA 1F3AA 3GIXA 5HFGA 4MJAA 1K0OA 5J3RA 2C0FA 3ME8A 1HYUA 1HNBA 5KN2A 3J7Yk 4EVMA 1K0CA 1XFLA 4NHZA 4N0VA 5HFIA 1GNWA 3UJ1A 2DMMA 1U87A 2FA4A 4KSOA 4ID0A 5H5SA 4LA1A 1R5AA 2VLVA 4Q5QA 2L6CA 2VCQA 3FY7A 3TJBA 3EPTA 3PH9A 4HQSA 1ZL9A 1GUHA 4V1Ap 4J57E 2CQ9A 5J5NA 3APQA 4TN8A 4ZBDA 1DE1A 1MD4A 1R4WA 2E2MA 1GTAA 6GSXA 4K0GA 1ZOFA 3IHQA 3KZQA 2V6OA 3GKNA 2B7JA 1WMJA 5KEJA 3QPMA 2LQQA 3UBKA 1DBYA 3JCML 5IIZA 1S3CA 2FWHA 2X8HA 2YV9A 1OKDA 4HS1A 2FA8A 1X5EA 2IL3A 2IMIA 5EVOA 4Q5NA 3FRCA 2AAWA 3HKRA 3HYPA 1FVKA 3D5JA 4HEA2 2X8GA 3TDGA 3IBHA 1FB6A 4EUYA 3CYNA 4I5QA 1UC7A 2FLSA 1U3IA 4O5RA 4ICYA 1GSEA 2DJ0A 2YCDA 1FW1A 3CBUA 1Z7RA 3GTUB 4DVCA 4KNDA 4KX4A 5IMZA 3MYDA 3F9UA 1U88A 1WPIA 4CHSA 2VOCA 2H70A 3L0HA 4TR1B 5G5EA 3KJYA 1GSQA 2J23A 2HZEA 3EU3A 2L4CA 4L8EA 3O76A 2XC2A 1B4PA 5DJMA 3ZLPA 5G2ZA 1SYRA 2PMTA 4TOPA 3GX0A 4K2DA 3GA4A 1WP0A 2IWTA 5B6NA 2V1MA 3ZIVA 1CQHA 3ERGA 1ST9A 1B9XC 3ZFBA 1K0NA 1EV9A 3D0ZA 3NIVA 1GTBA 4MA9A 3EVIA 2FUG2 2OADA 3US3A 3BCKA 2I81A 3QOUA 1UA5A 4O5UA 1YDKA 3DIEA 4BVYA 3IA1A 4POMA 1XWCA 4MP4A 2YZHA 10GSA 3IK7A 2XBIA 4YQMA 5KN1A 3KXOA 2JACA 1H75A 3TUEA 2VO4A 1LJRA 3DWVA 1RQMA 3CRTA 2QKEA 2RLIA 1F6MC 1QGVA 3WGXA 5HFKA 3KTBA 1M3JA 3RHBA 4NXIA 3IC8A 4KUNA 3L9SA 4G10A 4MPGA 2I1UA 1T3BA 3W6GA 2I4AA 1GSDA 4POBA 4YAPA 2A4VA 3FYGA 5KOWA 3TKSA 1W4VA 3EINA 1F9MA 3TJJA 5AN1A 2B6MA 3P8WA 4CY6A 5J9BA 1ERUA 4LMWA 2TIRA 5AISA 2WCIA 1O81A 4MK3A 3WGDA 1Z9HA 1V40A 1A2LA 2VL3A 4ZB8A 4MF6A 1SK2A 3TOTA 5DCHA 2OJLA 2FHEA 5C00A 3HXSA 4ZL9A 2LNTA 5HR1A 3TKSC 2WULA 4L0WA 2C0EA 3MSZA 3ISOA 2YJHA 2GZYA 4Q5FA 3BCIA 4DSSA 1T4YA 2V6KA 1FO5A 4GQFA 3VPTA 4ECJA 1VF3A 1XWGA 2KOKA 20GSA 1G7OA 3P2AA 3VI5A 4POLA 3KEBA 2HSHA 2PGTA 5GSSA 1K0DA 1Y25A 2PN8A 1TK8B 4IP6A 1JHBA 1SK1A 3FW2A 3TKRA 4KSMA 4N11A 1OC8A 3U6VA 3QCPA 5IO0A 3CSIA 3TJFA 3QAGA 4GRFA 5DQYA 3DXBA 2HRNA 4TXVA 4E8HA 4K0NA 3IV4A 4MCUA 1AQXA 5CNWA 1UN2A 1O85A 3ZVJD 1DUGA 1E6BA 3F6DA 3ZVJA 1O8WA 5DAKA 4ZXGA 4HJMA 3MWHA 2LV3A 3FR6A 3QR6A 1QMVA 1TRUA 3GL3A 1GTIA 11GSA 5B8BA 5A4VA 2YNXA 5ECPB 3K8NA 3F3RA 4L5OA 1DE2A 5G1KA 3HY2A 1TXXA 3H8QA 3G9BA 3PR8A 2PPTA 3W8JA 3ZTLA 2DSAA 1E2YA 3ZL5A 4GTUA 6GSTA 3ZMKA 2GDRA 3C1SA 2FWGA 3IRAA 2H74A 1DSBA 3H4KA 4JR4A 1EP7A 2NPBA 2B5XA 2JU5A 1ZGNA 2K8VA 3IC4A 4KA0A 3EC3A 4GXZA 1PL1A 1MDJA 3FZ9A 1A24A 1M0UA 3VWVA 17GSA 1NHOA 3LYKA 3WT1A 3CSHA 1SL0B 2EIOA 4FIWA 1PN0A 3QAWA 4XS6A 1G7EA 3IK9A 5AIVA 3DKSA 2KP1A 3GHAA 1TP9A 4HU9A 4MH2A 2HZEB 3BD2A 4G9HA 4HUAA 1GSSA 4FO5A 1TI3A 4CW9A 4TRXA 3KTLA 12GSA 5HR2A 1XVQA 3HCZA 1B48A 3EMPA 5ID2A 1FB0A 1OC9B 4XRAA 2EIRA 1NHYA 1OAZA 3UEMA 4DSRA 4CY8A 5CRHA 3UL3A 4IQAA 2C3QA 3TRQA 4RQXA 2OE1A 3EE2A 4V2MA 2KLXA 1GL8A 1CQGA 1N2AA 3H1NA 2C0GA 4WXTA 2DJKA 3F8UA 3EYTA 1M7TA 5D9WA 3LG6A 2VD1A 2YANA 1NW2A 3N5OA 3FKFA 4KDXA 3Q19A 1AIUA 2P31A 1O6JA 2GSSA 2LNSA 1KEBA 4HQZA 3H93A 4X4JA 2WS2A 1ILOA 1SD8A 4BIKA 4HU7A 1AC1A 2DBCA 5ELGA 2VCVA 5J41A 4MMMA
chains in the Genus database with same CATH topology
5KN0A 3CXGA 5D9TA 3DRNA 2FY6A 2X64A 2JL4A 3R2QA 2C4JA 1SD9A 2LRNA 4E8EA 5ENUA 2E0QA 2FD3A 4MLYA 5EL8A 9GSSA 2OACA 3CSJA 2HLSA 3D4MA 4WR4A 5E59A 4KE3A 1HQOA 2IMKA 3CTFA 4BPYA 3ME7A 2WGRA 4PGTA 3GKMA 1O8XA 1YZXA 3HJMA 5CREA 5IOWA 3A5IA 4TXOA 2OBKA 5CRWA 4KW6A 4N10A 3A2VA 3HJPA 1EOGA 2C80A 2IMEA 2ALBA 4PQIA 2PBJA 4FQUA 1PL2A 2B5YA 4ECBA 4IHUA 3E3EA 4XS4A 3A5WA 1XCCA 1B4QA 2DIZA 5A4UA 3ED3A 1TU8A 3IPZA 3KM6A 4GSNA 2H1AA 3KGKA 1YEXA 1NSWA 2CAQA 1TRVA 3P90A 2VCWA 1T00A 4G0IA 2M46A 2H30A 4AGSA 3LYPA 1YF1A 1XW6A 1WIKA 1HNAA 2BJXA 2GQLA 2LUSA 3M8NA 2LEGA 3G7YA 1VF1A 4XHMA 5ECOB 1XWAA 5IMFA 2L5OA 5EPFA 3FR3A 1SU9A 4OD7A 4MZWA 4Q5RA 1W89A 2H6YA 1EEJA 4EIQA 4KDYA 3C1RA 2MBSA 1SKRB 4RQRA 3IDVA 4AJ8A 2J9HA 1JLVA 1PKWA 2YWNA 1M99A 1A0RP 3I69A 5ECNB 1TDIA 2PWJA 4L5LA 2GLRA 1WWJA 4GCIA 4RI6A 3QMXA 1EGRA 4OWYA 2PU9C 4ECIA 2DJJA 2IFQB 2H01A 1AXDA 1G0TA 3GRXA 3W8SA 4GWRA 3EURA 1KTEA 1IYHA 4PXOA 2DMLA 5DALA 2GSRA 1PSQA 1V98A 3C71A 4OCEA 3Q6OA 1JZWA 3UMAA 3QFAC 3MDKA 1TK0B 4KGIA 1QUWA 5ECRB 4O32A 4FYCA 3MAKA 3VLNA 4D73B 4OO5A 4TR0A 4FYBA 1C72A 1EV4A 22GSA 2CA8A 5ECLB 4N0ZA 4TR4A 2IMFA 4P3YB 2H66A 4K8MA 1TJDA 4YKFA 3HZ4A 3F4RA 4HOJA 5FT3A 4Z2UA 5CO3A 5CRDA 6GSWA 1MTCA 5ECMB 3LW9A 4KF9A 3FZ5A 2WFCA 5LD0A 1JZDA 1WE0A 2TRXA 3OR5A 2F51A 3M9KA 2YWMA 4MF5A 3A3TA 3VWWA 2QSIA 1FOHA 1URMA 5D9VA 5COHA 3E9JB 2H1BA 1X5DA 5A5KA 4OFNA 3FHKA 3L9VA 1BYEA 2QA2A 4KAEA 1I9DA 1R7HA 3QFBC 3KIJA 4DEJA 2FCHA 4ZB6A 1S3DA 2LRTA 1EZKA 4IN0A 5IM9A 2AB6A 4G0LA 2D2ZA 2LJKA 3DVWA 4HJ2A 2HT9A 4GQCA 5EY6A 1MEKA 5D93A 4ZBAA 3WD6A 6GSUA 2K18A 2GVPA 2R6KA 5B6MA 1HD2A 3APOA 1Q98A 2JSYA 3D4TA 1ZYEA 3ZMLA 4WEYA 2UZ8A 2F9SA 2XPEA 4WBJA 2XHFA 4CDOA 3DGQA 1BG5A 14GSA 3I6AA 1M2BA 2OA7A 2O89A 5F0GA 2H1GA 1M9AA 4XS1A 2IIYA 1A2JA 5J9CA 4L0UA 4G2EA 4PUAA 3HZ8A 2N5BA 1MD3A 2MMAA 2A2PA 3ERWA 1ZZYA 4K7OA 2LJAA 2NDOA 1AQVA 2HRAA 3FZAA 3E0UA 3UOMA 1XWKA 1THOA 4XS4B 4X43A 1ON4A 4BL7A 1BAYA 3GKXA 4EIPA 3KMOA 2CVKA 5IMCA 5AGYA 4IELA 5DQSA 3DEXA 4Z2RA 4BVXA 3NZNA 4ILFA 1JLWA 4IQ1A 4FYUA 5D9XA 1ACVA 3S9FA 1XIYA 2DLXA 1EP8A 2DJ2A 2YPMA 2WB9A 5IOXA 3R3EA 2KUCA 3G7IA 4IS0A 4EKZA 4OCFA 1A0FA 3PINA 2JSZA 5ECSA 4HI7A 5JCWA 1Z6NA 1LU4A 4MDCA 4QL9A 3HD5A 1GSYA 4YQVA 2YN1A 3O3TA 2Z9SA 1SENA 3IHGA 4ZBBA 3ZIJA 3I43A 4HZ4A 4AJ6A 4ML6A 3IOSA 4JE1A 1QFNA 4EF0A 5B7CA 3VURA 3O6TA 1Z3EA 1PMTA 1PA3A 6GSSA 5JWQB 4F9ZA 1VF4A 5CAXA 3IR4A 2P5QA 2AV4A 2F8FA 2GZPA 1TKDB 1QXHA 2LSTA 1OE7A 1RK4A 1OC3A 3WYWA 5IMAA 2YWIA 3P7XA 4PTSA 1T8EB 1USBA 3QAVA 2HFDA 3DD3A 2L59A 1YKCA 3GKKA 5JCGA 2HE3A 2MMNA 3Q74A 4AJ7A 4V1Ag 2H8LA 4PX1A 1XOAA 4MZBA 1SYXA 1SKSB 2X99A 4JR6A 3GH6A 2VL2A 3GTUA 4QQ7A 2YZUA 5AIXA 3VFIA 4I6XA 1FOVA 3F0IA 4OMVA 3VK9A 1YF0A 4I2UA 1Z5YE 4WKWA 2ES7A 1I5GA 3FR9A 1MDKA 2L5LA 4I97A 4TR1A 1ZYPA 1AW9A 4EE0A 3J7Yb 1R26A 5D8IA 1OKTA 1QK8A 1SKWB 3TCOA 1B8XA 1HNCA 2HSYA 1T7PB 4JRRA 1K3OA 2X8CA 4BVYB 5JWRB 1H4OA 1TK5B 3VI7A 3BOAA 4BA7A 2XPDA 3EMXA 6GSYA 1XZOA 2IJYA 4GLTA 2O87A 2R37A 1ERVA 1BX9A 2VM1A 3U5RE 2RUEA 3LWAA 4ULXA 1YJ6A 2X49A 3IXRA 3M1GA 4EDZA 5GAND 2DC5A 3RPPA 3L78A 2HZFA 2X4AA 1AQWA 2GGTA 4YKGA 5GAPD 1G6WA 2RIIA 2HXKA 1K3LA 5G5FA 5F07A 1XBSA 1X9MB 2QC7A 4K7NA 2GQMA 4F03A 1B9YC 1OYJA 2L57A 1GTUA 1M9BA 7GSSA 2F3MA 4X1UA 2H73A 4MJEA 1YY7A 2H72A 4KCEA 2JZSA 2AJQB 2QA1A 5LNKe 4YQUA 5E4WA 5F8BA 4K1FA 3BBYA 3FK8A 2NBSA 3GSTA 4K9ZA 2V2GA 2E7PA 2ON5A 3KMNA 1BQ7A 4ZL8A 1X0RA 4AF2A 4IVFA 4DSSB 3TRPA 1TRWA 1PX7A 2QGVA 4F0BA 1ABAA 2P5RA 3HJOA 3SBCA 1F2EA 4PNGA 1XWBA 2CAIA 3RAZA 2B1KA 3LXTA 1A2MA 2IMDA 1TOFA 1KNGA 2LS5A 5HQPA 5L71A 4BVXB 1GNEA 1A8YA 3GX8A 1ZYQB 4ZB9A 5BRTA 1S3AA 2VM2A 1YQ1A 3HA9A 3LEFA 4KH7A 1PX6A 5D96A 3ZZXA 3MIXA 2CX3A 1O73A 3IAS2 5G30A 3D6IA 2B7KA 2FGXA 1XXUA 3CRUA 3M9JA 4K7IA 5IPGA 3TKQA 1TW9A 2O7KA 16GSA 3LXZA 1WRYA 1ML6A 4A5PA 4N30A 1SL2B 4PNFA 4BWQA 3KD0A 1XW9A 1GUKA 2PERA 1GULA 3ZREA 1PN9A 2OE0A 5HR0A 3Q18A 5HR3A 2PUKC 5DAKB 5ABRA 3RPNA 2H6ZA 4HZ2A 4OO4A 4LL4B 4MJBA 1LBKA 1YKAA 2N5AA 5G31A 1M2AA 4IGJA 4MABA 4H86A 2FWEA 4PURA 4EL1A 1X5CA 5GZZB 4NAXA 4OFMA 3UIWA 4USSA 2EIQA 3V1WA 3F3QA 2O8VB 2LQOA 5F06A 4F2IA 2YP6A 2N5FA 2G2QA 3HVVA 1ERTA 2E2GA 5D73A 2JZRA 2REMA 2TRCP 1NM3A 3PPUA 2L6DA 2NVLA 2CVDA 2VLUA 1TTZA 5DDLA 2M80A 2P0GA 4XIHA 4IJ3A 2CZ3A 5CYYA 3ZRDA 2RM6A 3TJKA 4YH2A 3RDWA 1GSFA 3LORA 2GZZA 2MYGA 5DJLA 1AUCA 3GH9A 2LRCA 2K6VA 5LCZA 2R4VA 4PQ1A 3F4TA 2IPAA 4OFTA 3WT2A 2B3SA 4POKA 2WDUA 2C3TA 4NV5A 2V41A 3GL5A 3GURA 5ID2B 2KHPA 1X9WB 2K9FA 4KDUA 2ZNMA 1FAAA 5GSTA 2V32A 2DIYA 4HDEA 3HVXA 1V9WA 1U6TA 2A2SA 2XBQA 4MH3A 4WR5A 1GUMA 1OC9A 4KCAA 1X9SB 2C0DA 1FHEA 3LSZA 1F37A 4RI7A 3AY8A 3A2XA 2VCZA 3F63A 3RBTA 4FH8A 1QQ2A 4MPFA 3VPQA 3G7JA 3UARA 4J56E 1XPVA 1GSUA 5DBQA 2VIMA 5H5QA 2R2JA 4NWYA 3N9JA 2B1LA 1GRXA 4V2LA 1F3BA 4QL7A 1AAZA 2GQKA 4XTSA 3LQ7A 3CMIA 4Z7XA 1OE8A 2GS3A 4GF0A 2CX4A 4ZL7A 3MNGA 2LKUA 3GFKA 4IKHA 3ZYWA 1PRXA 3EU4A 2DKIA 3APSA 2I9HA 2HSMA 3F4SA 5ECHB 3DYRA 3TOUA 4IJIA 4PUFC 1JFUA 5BMUA 3VWUA 2WRTA 4EDYA 2H19A 3LJRA 4J2FA 3M0FA 2DJ1A 4TXOB 2RM5A 3L4NA 5IQYA 1U3AA 3UAPA 18GSA 1GLQA 3C7MA 1Z7PA 3UBLA 1TRSA 2VCXA 3KH7A 2MZCA 4MNNA 2VCTA 4IBPA 1BEDA 2GSQA 1ZMAA 4F82A 2H0IA 2DJ3A 5FHIA 4V2NA 2MMOA 1T1VA 5H5RA 4PQHA 1WJKA 4TVEA 5DVBA 4F0CA 1J08A 4WETA 2H6XA 4JBBA 2WZ9A 2C8UA 1GP1A 2JZTA 4O92A 1VF2A 1THXA 4TR3A 1PGTA 1J0FA 2K8SA 3IE3A 1J9BA 4K5RA 3TKSE 4BWSA 2MBTA 4GSSA 3GYKA 1SL1B 4YAVA 4O5QA 1EOHA 2AUVA 2HRKA 4EC0A 2H76A 2GT6A 2R5GA 3KH9A 1GLPA 1G6YA 1N8JA 2OE3A 8GSSA 1XOBA 3GN3A 3HVSA 2F8AA 2ZUPA 4G19A 2R3XA 4XCSA 1TU7A 2L4QA 4O7HA 4WBRD 1Q4JA 4WF4A 5FWGA 3TGZA 4ZILA 2BMXA 2GT5A 3D22A 1K0BA 1IYIA 2O85A 5DCGA 3HDCA 3TRXA 1K0MA 3D21A 4IP1A 3KP8A 4I8BA 1SK0A 1FVJA 5CP1A 19GSA 2FNOA 4ISDA 4X0XA 2OBIA 1M2DA 1Y6EA 5IMVA 1K3YA 1VRSD 2ZCTA 3H79A 5DALB 2DKHA 2PVOC 2R0PA 3NOFA 3RHCA 4NV2A 3LGCA 1JZRA 4G0KA 2GTUA 2IFQA 1SJ6A 3ZFLA 3DVXA 4LLRA 2AYTA 2H75A 3CTGA 1RW1A 5J4UA 1TI1A 1JZOA 3WGEA 1K0AA 2YWOA 3KP9A 4GSTA 5IPHA 2CT6A 1FG4A 5F05A 4K6XA 3EWLA 3SWLA 1ZCPA 1XVWA 2KP2A 1GWCA 3GSSA 2YOIA 3UVTA 2EC4A 5IMDA 2CVBA 5C04A 2NTOA 4D73A 3IAM2 4NMUA 2HRFA 3QD9A 2R0GA 1O7UA 3BJ5A 3C73A 6GSVA 1XW5A 3TB2A 1EEMA 1V58A 5ECQB 4ACSA 1KBNA 4JEDA 3I9V2 2MMZA 2R0CA 2FWFA 2VL2C 4RUVA 3VWXA 4DSQA 2BTOT 3UVHA 2JADA 4NPBA 2H0HA 3PGTA 1V57A 4ML1A 4XRDA 4IW9A 3ZITA 4ZIJA 3HHVA 2M72A 2WJUA 1V2AA 3GV1A 2I3YA 2VUPA 5KN3A 2HI7A 5ELAA 4KB3A 1PQNA 5ECKB 1Z6MA 5ECIB 4EXJA 2A2RA 3GNJA 13GSA 3KCMA 2H0GA 3FMWA 5CRGA 1R5PA 3F6FA 4LMVA 3M3MA 2RUFA 3C8EA 1UVZA 2HYXA 2CZ2A 3A2WA 2AHEA 1PKZA 2ON7A 2CV4A 2YJ7A 1PD21 2GSTA 1A23A 4JU5A 3LFLA 2C1YA 3QDNA 3ERFA 4LL1B 1ZYNA 2LJRA 3GUSA 3FZ4A 5G1LA 2VLTA 5B8AA 1MDIA 2C3NA 2VD0A 4TKYA 4MJCA 3TKPA 1BJXA 1T4ZA 2IN3A 1OVNA 2PVQA 4K5SA 1EGOA 5KOXA 3FEUA 5A4WA 5IO2A 1WOUA 1YEPA 2YV7A 1EWXA 3TJGA 1ERWA 1VGLA 2LTKA 1SJZA 2HNLA 2VAFA 4MF7A 4MZCA 5JCUA 2B5EA 4JZQA 4BL7B 1GH2A 2A4HA 2G0FA 2VL9A 4WF5A 4K2XA 3GMFA 3L9UA 2OKAA 4EO3A 1SJIA 5JWOB 2H1DA 2H71A 4TW5A 4ECCA 4NHWA 4I2TA 5INYA 3DMLA 4Z2TA 1A8LA 1F3AA 3GIXA 5HFGA 4MJAA 1K0OA 5J3RA 2C0FA 3ME8A 1HYUA 1HNBA 5KN2A 3J7Yk 4EVMA 1K0CA 1XFLA 4NHZA 4N0VA 5HFIA 1GNWA 3UJ1A 2DMMA 1U87A 2FA4A 4KSOA 4ID0A 5H5SA 4LA1A 1R5AA 2VLVA 4Q5QA 2L6CA 2VCQA 3FY7A 3TJBA 3EPTA 3PH9A 4HQSA 1ZL9A 1GUHA 4V1Ap 4J57E 2CQ9A 5J5NA 3APQA 4TN8A 4ZBDA 1DE1A 1MD4A 1R4WA 2E2MA 1GTAA 6GSXA 4K0GA 1ZOFA 3IHQA 3KZQA 2V6OA 3GKNA 2B7JA 1WMJA 5KEJA 3QPMA 2LQQA 3UBKA 1DBYA 3JCML 5IIZA 1S3CA 2FWHA 2X8HA 2YV9A 1OKDA 4HS1A 2FA8A 1X5EA 2IL3A 2IMIA 5EVOA 4Q5NA 3FRCA 2AAWA 3HKRA 3HYPA 1FVKA 3D5JA 4HEA2 2X8GA 3TDGA 3IBHA 1FB6A 4EUYA 3CYNA 4I5QA 1UC7A 2FLSA 1U3IA 4O5RA 4ICYA 1GSEA 2DJ0A 2YCDA 1FW1A 3CBUA 1Z7RA 3GTUB 4DVCA 4KNDA 4KX4A 5IMZA 3MYDA 3F9UA 1U88A 1WPIA 4CHSA 2VOCA 2H70A 3L0HA 4TR1B 5G5EA 3KJYA 1GSQA 2J23A 2HZEA 3EU3A 2L4CA 4L8EA 3O76A 2XC2A 1B4PA 5DJMA 3ZLPA 5G2ZA 1SYRA 2PMTA 4TOPA 3GX0A 4K2DA 3GA4A 1WP0A 2IWTA 5B6NA 2V1MA 3ZIVA 1CQHA 3ERGA 1ST9A 1B9XC 3ZFBA 1K0NA 1EV9A 3D0ZA 3NIVA 1GTBA 4MA9A 3EVIA 2FUG2 2OADA 3US3A 3BCKA 2I81A 3QOUA 1UA5A 4O5UA 1YDKA 3DIEA 4BVYA 3IA1A 4POMA 1XWCA 4MP4A 2YZHA 10GSA 3IK7A 2XBIA 4YQMA 5KN1A 3KXOA 2JACA 1H75A 3TUEA 2VO4A 1LJRA 3DWVA 1RQMA 3CRTA 2QKEA 2RLIA 1F6MC 1QGVA 3WGXA 5HFKA 3KTBA 3RHBA 4NXIA 3IC8A 4KUNA 3L9SA 4G10A 4MPGA 2I1UA 1T3BA 3W6GA 2I4AA 1GSDA 4POBA 4YAPA 2A4VA 3FYGA 5KOWA 3TKSA 1W4VA 3EINA 1F9MA 3TJJA 5AN1A 2B6MA 3P8WA 4CY6A 5J9BA 1ERUA 4LMWA 2TIRA 5AISA 2WCIA 1O81A 4MK3A 3WGDA 1Z9HA 1V40A 1A2LA 2VL3A 4ZB8A 4MF6A 1SK2A 3TOTA 5DCHA 2OJLA 2FHEA 5C00A 3HXSA 4ZL9A 2LNTA 5HR1A 3TKSC 2WULA 4L0WA 2C0EA 3MSZA 3ISOA 2YJHA 2GZYA 4Q5FA 3BCIA 4DSSA 1T4YA 2V6KA 1FO5A 4GQFA 3VPTA 4ECJA 1VF3A 1XWGA 2KOKA 20GSA 1G7OA 3P2AA 3VI5A 4POLA 3KEBA 2HSHA 2PGTA 5GSSA 1K0DA 1Y25A 2PN8A 1TK8B 4IP6A 1JHBA 1SK1A 3FW2A 3TKRA 4KSMA 4N11A 1OC8A 3U6VA 3QCPA 5IO0A 3CSIA 3TJFA 3QAGA 4GRFA 5DQYA 3DXBA 2HRNA 4TXVA 4E8HA 4K0NA 3IV4A 4MCUA 1AQXA 5CNWA 1UN2A 1O85A 3ZVJD 1DUGA 1E6BA 3F6DA 3ZVJA 1O8WA 5DAKA 4ZXGA 4HJMA 3MWHA 2LV3A 3FR6A 3QR6A 1QMVA 1TRUA 3GL3A 1GTIA 11GSA 5B8BA 5A4VA 2YNXA 5ECPB 3K8NA 3F3RA 4L5OA 1DE2A 5G1KA 3HY2A 1TXXA 3H8QA 3G9BA 3PR8A 2PPTA 3W8JA 3ZTLA 2DSAA 1E2YA 3ZL5A 4GTUA 6GSTA 3ZMKA 2GDRA 3C1SA 2FWGA 3IRAA 2H74A 1DSBA 3H4KA 4JR4A 1EP7A 2NPBA 2B5XA 2JU5A 1ZGNA 2K8VA 3IC4A 4KA0A 3EC3A 4GXZA 1PL1A 1MDJA 3FZ9A 1A24A 1M0UA 3VWVA 17GSA 1NHOA 3LYKA 3WT1A 3CSHA 1SL0B 2EIOA 4FIWA 1PN0A 3QAWA 4XS6A 1G7EA 3IK9A 5AIVA 3DKSA 2KP1A 3GHAA 1TP9A 4HU9A 4MH2A 2HZEB 3BD2A 4G9HA 4HUAA 1GSSA 4FO5A 1TI3A 4CW9A 4TRXA 3KTLA 12GSA 5HR2A 1XVQA 3HCZA 1B48A 3EMPA 5ID2A 1FB0A 1OC9B 4XRAA 2EIRA 1NHYA 1OAZA 3UEMA 4DSRA 4CY8A 5CRHA 3UL3A 4IQAA 2C3QA 3TRQA 4RQXA 2OE1A 3EE2A 4V2MA 2KLXA 1GL8A 1CQGA 1N2AA 3H1NA 2C0GA 4WXTA 2DJKA 3F8UA 3EYTA 1M7TA 5D9WA 3LG6A 2VD1A 2YANA 1NW2A 3N5OA 3FKFA 4KDXA 3Q19A 1AIUA 2P31A 1O6JA 2GSSA 2LNSA 1KEBA 4HQZA 3H93A 4X4JA 2WS2A 1ILOA 1SD8A 4HU7A 1AC1A 2DBCA 5ELGA 2VCVA 5J41A 4MMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KN0 A;  3CXG A;  5D9T A;  3DRN A;  2FY6 A;  2X64 A;  2JL4 A;  3R2Q A;  2C4J A;  1SD9 A;  2LRN A;  4E8E A;  5ENU A;  2E0Q A;  2FD3 A;  4MLY A;  5EL8 A;  9GSS A;  2OAC A;  3CSJ A;  2HLS A;  3D4M A;  4WR4 A;  5E59 A;  4KE3 A;  1HQO A;  2IMK A;  3CTF A;  4BPY A;  3ME7 A;  2WGR A;  4PGT A;  3GKM A;  1O8X A;  1YZX A;  3HJM A;  5CRE A;  5IOW A;  4TXO A;  2OBK A;  5CRW A;  4KW6 A;  4N10 A;  3A2V A;  3HJP A;  1EOG A;  2C80 A;  2IME A;  2ALB A;  4PQI A;  2PBJ A;  1PL2 A;  2B5Y A;  4ECB A;  4IHU A;  3E3E A;  4XS4 A;  3A5W A;  1XCC A;  1B4Q A;  2DIZ A;  5A4U A;  3ED3 A;  1TU8 A;  3IPZ A;  3KM6 A;  4GSN A;  2H1A A;  3KGK A;  1YEX A;  1NSW A;  2CAQ A;  1TRV A;  3P90 A;  2VCW A;  1T00 A;  2M46 A;  2H30 A;  4AGS A;  3LYP A;  1YF1 A;  1XW6 A;  1WIK A;  1HNA A;  2BJX A;  2GQL A;  2LUS A;  3M8N A;  2LEG A;  3G7Y A;  1VF1 A;  4XHM A;  5ECO B;  1XWA A;  5IMF A;  2L5O A;  5EPF A;  3FR3 A;  1SU9 A;  4OD7 A;  4MZW A;  4Q5R A;  1W89 A;  2H6Y A;  1EEJ A;  4KDY A;  3C1R A;  2MBS A;  1SKR B;  4RQR A;  3IDV A;  4AJ8 A;  2J9H A;  1JLV A;  1PKW A;  2YWN A;  1M99 A;  1A0R P;  3I69 A;  5ECN B;  1TDI A;  2PWJ A;  4L5L A;  2GLR A;  1WWJ A;  4GCI A;  4RI6 A;  3QMX A;  1EGR A;  4OWY A;  2PU9 C;  4ECI A;  2DJJ A;  2IFQ B;  2H01 A;  1AXD A;  1G0T A;  3GRX A;  3W8S A;  4GWR A;  3EUR A;  1KTE A;  1IYH A;  4PXO A;  2DML A;  5DAL A;  2GSR A;  1PSQ A;  1V98 A;  3C71 A;  4OCE A;  3Q6O A;  1JZW A;  3UMA A;  3QFA C;  3MDK A;  1TK0 B;  4KGI A;  1QUW A;  5ECR B;  4O32 A;  4FYC A;  3MAK A;  3VLN A;  4D73 B;  4OO5 A;  4TR0 A;  4FYB A;  1C72 A;  5ECL B;  1EV4 A;  22GS A;  2CA8 A;  4N0Z A;  4TR4 A;  2IMF A;  4P3Y B;  2H66 A;  4K8M A;  1TJD A;  3HZ4 A;  3F4R A;  4HOJ A;  5FT3 A;  5CO3 A;  5CRD A;  6GSW A;  1MTC A;  5ECM B;  3FZ5 A;  2WFC A;  5LD0 A;  1JZD A;  1WE0 A;  2TRX A;  3OR5 A;  2F51 A;  3M9K A;  2YWM A;  4MF5 A;  3A3T A;  3VWW A;  2QSI A;  1URM A;  5D9V A;  5COH A;  3E9J B;  2H1B A;  1X5D A;  5A5K A;  4OFN A;  3FHK A;  3L9V A;  1BYE A;  4KAE A;  1I9D A;  1R7H A;  3QFB C;  3KIJ A;  4DEJ A;  2FCH A;  4ZB6 A;  1S3D A;  2LRT A;  1EZK A;  4IN0 A;  5IM9 A;  2AB6 A;  2D2Z A;  2LJK A;  3DVW A;  4HJ2 A;  2HT9 A;  4GQC A;  5EY6 A;  1MEK A;  5D93 A;  4ZBA A;  3WD6 A;  6GSU A;  2K18 A;  2GVP A;  2R6K A;  5B6M A;  1HD2 A;  3APO A;  1Q98 A;  2JSY A;  3D4T A;  1ZYE A;  3ZML A;  4WEY A;  2F9S A;  2XPE A;  4WBJ A;  2XHF A;  4CDO A;  3DGQ A;  1BG5 A;  14GS A;  3I6A A;  1M2B A;  2OA7 A;  2O89 A;  5F0G A;  2H1G A;  1M9A A;  4XS1 A;  2IIY A;  1A2J A;  5J9C A;  4L0U A;  4G2E A;  4PUA A;  3HZ8 A;  2N5B A;  1MD3 A;  2MMA A;  3ERW A;  1ZZY A;  4K7O A;  2LJA A;  2NDO A;  1AQV A;  3FZA A;  3E0U A;  3UOM A;  1XWK A;  1THO A;  4XS4 B;  4X43 A;  1ON4 A;  4BL7 A;  1BAY A;  3GKX A;  3KMO A;  2CVK A;  5IMC A;  5AGY A;  4IEL A;  5DQS A;  3DEX A;  4BVX A;  3NZN A;  4ILF A;  1JLW A;  4IQ1 A;  4FYU A;  5D9X A;  1ACV A;  3S9F A;  1XIY A;  2DLX A;  1EP8 A;  2DJ2 A;  2YPM A;  2WB9 A;  5IOX A;  2KUC A;  3G7I A;  4IS0 A;  4EKZ A;  4OCF A;  1A0F A;  3PIN A;  2JSZ A;  5ECS A;  4HI7 A;  5JCW A;  1Z6N A;  1LU4 A;  4MDC A;  4QL9 A;  3HD5 A;  1GSY A;  4YQV A;  2YN1 A;  3O3T A;  2Z9S A;  1SEN A;  4ZBB A;  3ZIJ A;  3I43 A;  4HZ4 A;  4AJ6 A;  4ML6 A;  3IOS A;  4JE1 A;  1QFN A;  4EF0 A;  5B7C A;  3VUR A;  3O6T A;  1Z3E A;  1PMT A;  1PA3 A;  6GSS A;  5JWQ B;  4F9Z A;  1VF4 A;  5CAX A;  3IR4 A;  2P5Q A;  2AV4 A;  2F8F A;  2GZP A;  1TKD B;  1QXH A;  2LST A;  1OE7 A;  1RK4 A;  1OC3 A;  3WYW A;  5IMA A;  2YWI A;  3P7X A;  1T8E B;  1USB A;  3QAV A;  2HFD A;  3DD3 A;  2L59 A;  1YKC A;  3GKK A;  5JCG A;  2HE3 A;  2MMN A;  3Q74 A;  4AJ7 A;  4V1A g;  2H8L A;  4PX1 A;  1XOA A;  4MZB A;  1SYX A;  1SKS B;  2X99 A;  4JR6 A;  3GH6 A;  2VL2 A;  3GTU A;  4QQ7 A;  2YZU A;  5AIX A;  3VFI A;  4I6X A;  1FOV A;  3F0I A;  4OMV A;  3VK9 A;  1YF0 A;  4I2U A;  1Z5Y E;  4WKW A;  2ES7 A;  1I5G A;  3FR9 A;  1MDK A;  2L5L A;  4I97 A;  4TR1 A;  1AW9 A;  4EE0 A;  3J7Y b;  1R26 A;  5D8I A;  1OKT A;  1QK8 A;  1SKW B;  3TCO A;  1B8X A;  1HNC A;  2HSY A;  1T7P B;  4JRR A;  1K3O A;  2X8C A;  5JWR B;  1H4O A;  1TK5 B;  3VI7 A;  3BOA A;  4BA7 A;  2XPD A;  3EMX A;  6GSY A;  1XZO A;  2IJY A;  4GLT A;  2O87 A;  2R37 A;  1ERV A;  1BX9 A;  2VM1 A;  3U5R E;  2RUE A;  3LWA A;  4ULX A;  1YJ6 A;  3IXR A;  3M1G A;  4EDZ A;  5GAN D;  2DC5 A;  3RPP A;  3L78 A;  2HZF A;  1AQW A;  2GGT A;  5GAP D;  1G6W A;  2RII A;  2HXK A;  1K3L A;  5G5F A;  5F07 A;  1XBS A;  1X9M B;  2QC7 A;  4K7N A;  2GQM A;  4F03 A;  1B9Y C;  1OYJ A;  2L57 A;  1GTU A;  1M9B A;  7GSS A;  2F3M A;  4X1U A;  2H73 A;  4MJE A;  1YY7 A;  2H72 A;  4KCE A;  2JZS A;  2AJQ B;  5LNK e;  4YQU A;  5E4W A;  5F8B A;  4K1F A;  3BBY A;  3FK8 A;  2NBS A;  3GST A;  4K9Z A;  2V2G A;  2E7P A;  2ON5 A;  3KMN A;  1BQ7 A;  4ZL8 A;  1X0R A;  4AF2 A;  4IVF A;  4DSS B;  3TRP A;  1TRW A;  1PX7 A;  2QGV A;  4F0B A;  1ABA A;  2P5R A;  3HJO A;  3SBC A;  1F2E A;  4PNG A;  1XWB A;  2CAI A;  3RAZ A;  2B1K A;  3LXT A;  1A2M A;  2IMD A;  1TOF A;  1KNG A;  2LS5 A;  5HQP A;  5L71 A;  1GNE A;  1A8Y A;  3GX8 A;  1ZYQ B;  4ZB9 A;  1S3A A;  2VM2 A;  1YQ1 A;  3HA9 A;  3LEF A;  4KH7 A;  1PX6 A;  5D96 A;  3ZZX A;  2CX3 A;  1O73 A;  3IAS 2;  5G30 A;  3D6I A;  2B7K A;  2FGX A;  1XXU A;  3CRU A;  3M9J A;  4K7I A;  5IPG A;  3TKQ A;  1TW9 A;  2O7K A;  16GS A;  3LXZ A;  1WRY A;  1ML6 A;  4N30 A;  1SL2 B;  4PNF A;  4BWQ A;  3KD0 A;  1XW9 A;  1GUK A;  2PER A;  1GUL A;  3ZRE A;  1PN9 A;  2OE0 A;  5HR0 A;  3Q18 A;  5HR3 A;  2PUK C;  5DAK B;  5ABR A;  3RPN A;  2H6Z A;  4HZ2 A;  4OO4 A;  4LL4 B;  4MJB A;  1LBK A;  1YKA A;  2N5A A;  5G31 A;  1M2A A;  4IGJ A;  4MAB A;  4H86 A;  2FWE A;  4PUR A;  4EL1 A;  1X5C A;  5GZZ B;  4NAX A;  4OFM A;  3UIW A;  2EIQ A;  3V1W A;  3F3Q A;  2O8V B;  2LQO A;  5F06 A;  4F2I A;  2YP6 A;  2N5F A;  2G2Q A;  3HVV A;  1ERT A;  2E2G A;  5D73 A;  2JZR A;  2REM A;  2TRC P;  1NM3 A;  2L6D A;  2NVL A;  2CVD A;  2VLU A;  1TTZ A;  5DDL A;  2M80 A;  2P0G A;  4XIH A;  4IJ3 A;  2CZ3 A;  5CYY A;  3ZRD A;  2RM6 A;  3TJK A;  4YH2 A;  3RDW A;  1GSF A;  3LOR A;  2GZZ A;  2MYG A;  5DJL A;  1AUC A;  3GH9 A;  2LRC A;  2K6V A;  5LCZ A;  2R4V A;  4PQ1 A;  3F4T A;  2IPA A;  4OFT A;  3WT2 A;  2B3S A;  4POK A;  2WDU A;  2C3T A;  4NV5 A;  2V41 A;  3GL5 A;  3GUR A;  5ID2 B;  2KHP A;  1X9W B;  2K9F A;  4KDU A;  2ZNM A;  1FAA A;  5GST A;  2V32 A;  2DIY A;  4HDE A;  3HVX A;  1V9W A;  1U6T A;  2A2S A;  2XBQ A;  4MH3 A;  4WR5 A;  1GUM A;  1OC9 A;  4KCA A;  1X9S B;  2C0D A;  1FHE A;  3LSZ A;  1F37 A;  4RI7 A;  3AY8 A;  3A2X A;  2VCZ A;  3F63 A;  3RBT A;  4FH8 A;  1QQ2 A;  4MPF A;  3VPQ A;  3G7J A;  3UAR A;  4J56 E;  1XPV A;  1GSU A;  5DBQ A;  2VIM A;  5H5Q A;  2R2J A;  4NWY A;  3N9J A;  2B1L A;  1GRX A;  4V2L A;  1F3B A;  4QL7 A;  1AAZ A;  2GQK A;  4XTS A;  3LQ7 A;  3CMI A;  4Z7X A;  1OE8 A;  2GS3 A;  4GF0 A;  2CX4 A;  4ZL7 A;  3MNG A;  2LKU A;  3GFK A;  4IKH A;  3ZYW A;  1PRX A;  3EU4 A;  3APS A;  2I9H A;  3F4S A;  5ECH B;  3DYR A;  3TOU A;  4IJI A;  4PUF C;  1JFU A;  3VWU A;  2WRT A;  4EDY A;  2H19 A;  3LJR A;  4J2F A;  3M0F A;  2DJ1 A;  4TXO B;  2RM5 A;  3L4N A;  5IQY A;  1U3A A;  3UAP A;  18GS A;  1GLQ A;  3C7M A;  1Z7P A;  3UBL A;  1TRS A;  2VCX A;  3KH7 A;  2MZC A;  2VCT A;  4IBP A;  1BED A;  2GSQ A;  1ZMA A;  4F82 A;  2H0I A;  2DJ3 A;  5FHI A;  4V2N A;  2MMO A;  1T1V A;  5H5R A;  4PQH A;  1WJK A;  4TVE A;  5DVB A;  4F0C A;  1J08 A;  4WET A;  2H6X A;  4JBB A;  2WZ9 A;  2C8U A;  1GP1 A;  2JZT A;  4O92 A;  1VF2 A;  1THX A;  4TR3 A;  1PGT A;  1J0F A;  2K8S A;  3IE3 A;  1J9B A;  3TKS E;  4BWS A;  2MBT A;  4GSS A;  3GYK A;  1SL1 B;  4YAV A;  1EOH A;  2AUV A;  4EC0 A;  2H76 A;  2GT6 A;  2R5G A;  3KH9 A;  1GLP A;  1G6Y A;  1N8J A;  2OE3 A;  8GSS A;  1XOB A;  3GN3 A;  3HVS A;  2F8A A;  2ZUP A;  4G19 A;  2R3X A;  4XCS A;  1TU7 A;  2L4Q A;  4O7H A;  4WBR D;  1Q4J A;  4WF4 A;  5FWG A;  3TGZ A;  4ZIL A;  2BMX A;  2GT5 A;  3D22 A;  1K0B A;  1IYI A;  2O85 A;  5DCG A;  3HDC A;  3TRX A;  1K0M A;  3D21 A;  4IP1 A;  3KP8 A;  4I8B A;  1SK0 A;  1FVJ A;  5CP1 A;  19GS A;  2FNO A;  4ISD A;  4X0X A;  2OBI A;  1M2D A;  1Y6E A;  5IMV A;  1K3Y A;  1VRS D;  2ZCT A;  3H79 A;  5DAL B;  2PVO C;  3NOF A;  3RHC A;  4NV2 A;  3LGC A;  1JZR A;  2GTU A;  2IFQ A;  1SJ6 A;  3ZFL A;  3DVX A;  4LLR A;  2AYT A;  2H75 A;  3CTG A;  1RW1 A;  5J4U A;  1TI1 A;  1JZO A;  3WGE A;  1K0A A;  2YWO A;  3KP9 A;  4GST A;  5IPH A;  2CT6 A;  1FG4 A;  5F05 A;  4K6X A;  3EWL A;  3SWL A;  1ZCP A;  1XVW A;  2KP2 A;  1GWC A;  3GSS A;  2YOI A;  3UVT A;  2EC4 A;  5IMD A;  2CVB A;  5C04 A;  2NTO A;  4D73 A;  3IAM 2;  4NMU A;  2HRF A;  3QD9 A;  1O7U A;  3BJ5 A;  3C73 A;  6GSV A;  1XW5 A;  3TB2 A;  1EEM A;  1V58 A;  5ECQ B;  4ACS A;  1KBN A;  4JED A;  3I9V 2;  2MMZ A;  2FWF A;  2VL2 C;  4RUV A;  3VWX A;  4DSQ A;  2BTO T;  3UVH A;  2JAD A;  4NPB A;  2H0H A;  3PGT A;  1V57 A;  4ML1 A;  4XRD A;  4IW9 A;  3ZIT A;  4ZIJ A;  3HHV A;  2M72 A;  2WJU A;  1V2A A;  3GV1 A;  2I3Y A;  2VUP A;  5KN3 A;  2HI7 A;  5ELA A;  4KB3 A;  1PQN A;  5ECK B;  1Z6M A;  5ECI B;  4EXJ A;  2A2R A;  3GNJ A;  13GS A;  3KCM A;  2H0G A;  5CRG A;  1R5P A;  3F6F A;  4LMV A;  3M3M A;  2RUF A;  3C8E A;  1UVZ A;  2HYX A;  2CZ2 A;  3A2W A;  2AHE A;  1PKZ A;  2ON7 A;  2CV4 A;  2YJ7 A;  1PD2 1;  2GST A;  1A23 A;  4JU5 A;  3LFL A;  2C1Y A;  3QDN A;  3ERF A;  4LL1 B;  2LJR A;  3GUS A;  3FZ4 A;  5G1L A;  2VLT A;  5B8A A;  1MDI A;  2C3N A;  2VD0 A;  4TKY A;  4MJC A;  3TKP A;  1BJX A;  1T4Z A;  2IN3 A;  1OVN A;  2PVQ A;  1EGO A;  3FEU A;  5A4W A;  5IO2 A;  1WOU A;  1YEP A;  2YV7 A;  1EWX A;  3TJG A;  1ERW A;  1VGL A;  2LTK A;  1SJZ A;  2HNL A;  2VAF A;  4MF7 A;  4MZC A;  5JCU A;  2B5E A;  4JZQ A;  1GH2 A;  2G0F A;  2VL9 A;  4WF5 A;  3GMF A;  3L9U A;  2OKA A;  4EO3 A;  1SJI A;  5JWO B;  2H1D A;  2H71 A;  4TW5 A;  4ECC A;  4NHW A;  4I2T A;  5INY A;  3DML A;  1A8L A;  1F3A A;  3GIX A;  5HFG A;  4MJA A;  1K0O A;  5J3R A;  2C0F A;  3ME8 A;  1HYU A;  1HNB A;  5KN2 A;  3J7Y k;  4EVM A;  1K0C A;  1XFL A;  4NHZ A;  4N0V A;  5HFI A;  1GNW A;  3UJ1 A;  2DMM A;  1U87 A;  2FA4 A;  4KSO A;  4ID0 A;  5H5S A;  4LA1 A;  1R5A A;  2VLV A;  4Q5Q A;  2L6C A;  2VCQ A;  3FY7 A;  3TJB A;  3PH9 A;  4HQS A;  1ZL9 A;  1GUH A;  4V1A p;  4J57 E;  2CQ9 A;  5J5N A;  3APQ A;  4TN8 A;  4ZBD A;  1DE1 A;  1MD4 A;  1R4W A;  2E2M A;  1GTA A;  6GSX A;  4K0G A;  1ZOF A;  3IHQ A;  3KZQ A;  2V6O A;  3GKN A;  2B7J A;  1WMJ A;  5KEJ A;  3QPM A;  2LQQ A;  3UBK A;  1DBY A;  3JCM L;  5IIZ A;  1S3C A;  2FWH A;  2X8H A;  2YV9 A;  1OKD A;  4HS1 A;  2FA8 A;  1X5E A;  2IL3 A;  2IMI A;  5EVO A;  4Q5N A;  3FRC A;  2AAW A;  3HKR A;  3HYP A;  1FVK A;  3D5J A;  4HEA 2;  2X8G A;  3TDG A;  3IBH A;  1FB6 A;  4EUY A;  3CYN A;  4I5Q A;  1UC7 A;  2FLS A;  1U3I A;  4O5R A;  1GSE A;  2DJ0 A;  2YCD A;  1FW1 A;  3CBU A;  1Z7R A;  3GTU B;  4DVC A;  4KND A;  4KX4 A;  5IMZ A;  3F9U A;  1U88 A;  1WPI A;  4CHS A;  2VOC A;  2H70 A;  3L0H A;  4TR1 B;  5G5E A;  3KJY A;  1GSQ A;  2J23 A;  2HZE A;  3EU3 A;  2L4C A;  4L8E A;  3O76 A;  2XC2 A;  1B4P A;  5DJM A;  3ZLP A;  5G2Z A;  1SYR A;  2PMT A;  4TOP A;  3GX0 A;  4K2D A;  3GA4 A;  1WP0 A;  2IWT A;  5B6N A;  2V1M A;  3ZIV A;  1CQH A;  3ERG A;  1ST9 A;  1B9X C;  3ZFB A;  1K0N A;  1EV9 A;  3D0Z A;  3NIV A;  1GTB A;  4MA9 A;  3EVI A;  2FUG 2;  2OAD A;  3US3 A;  3BCK A;  2I81 A;  3QOU A;  1UA5 A;  1YDK A;  3DIE A;  4BVY A;  3IA1 A;  4POM A;  1XWC A;  4MP4 A;  2YZH A;  10GS A;  3IK7 A;  2XBI A;  4YQM A;  5KN1 A;  3KXO A;  2JAC A;  1H75 A;  3TUE A;  2VO4 A;  1LJR A;  3DWV A;  1RQM A;  3CRT A;  2QKE A;  2RLI A;  1F6M C;  1QGV A;  3WGX A;  5HFK A;  3KTB A;  3RHB A;  4NXI A;  4KUN A;  3L9S A;  4G10 A;  4MPG A;  2I1U A;  1T3B A;  3W6G A;  2I4A A;  1GSD A;  4POB A;  4YAP A;  2A4V A;  3FYG A;  3TKS A;  1W4V A;  3EIN A;  1F9M A;  3TJJ A;  5AN1 A;  2B6M A;  3P8W A;  5J9B A;  1ERU A;  4LMW A;  2TIR A;  5AIS A;  2WCI A;  1O81 A;  4MK3 A;  3WGD A;  1Z9H A;  1V40 A;  1A2L A;  2VL3 A;  4ZB8 A;  4MF6 A;  1SK2 A;  3TOT A;  5DCH A;  2OJL A;  2FHE A;  5C00 A;  3HXS A;  4ZL9 A;  2LNT A;  5HR1 A;  3TKS C;  2WUL A;  4L0W A;  2C0E A;  3MSZ A;  3ISO A;  2YJH A;  2GZY A;  4Q5F A;  3BCI A;  4DSS A;  1T4Y A;  2V6K A;  1FO5 A;  4GQF A;  3VPT A;  4ECJ A;  1VF3 A;  1XWG A;  2KOK A;  20GS A;  1G7O A;  3P2A A;  3VI5 A;  4POL A;  3KEB A;  2HSH A;  2PGT A;  5GSS A;  1K0D A;  1Y25 A;  2PN8 A;  1TK8 B;  4IP6 A;  1JHB A;  1SK1 A;  3FW2 A;  3TKR A;  4KSM A;  4N11 A;  1OC8 A;  3U6V A;  3QCP A;  5IO0 A;  3CSI A;  3TJF A;  3QAG A;  4GRF A;  5DQY A;  3DXB A;  2HRN A;  4TXV A;  4E8H A;  4K0N A;  3IV4 A;  4MCU A;  1AQX A;  5CNW A;  1UN2 A;  1O85 A;  3ZVJ D;  1DUG A;  1E6B A;  3F6D A;  3ZVJ A;  1O8W A;  5DAK A;  4ZXG A;  4HJM A;  3MWH A;  2LV3 A;  3FR6 A;  3QR6 A;  1QMV A;  1TRU A;  3GL3 A;  1GTI A;  11GS A;  5B8B A;  5A4V A;  2YNX A;  5ECP B;  3K8N A;  3F3R A;  4L5O A;  1DE2 A;  5G1K A;  3HY2 A;  1TXX A;  3H8Q A;  3G9B A;  3PR8 A;  2PPT A;  3W8J A;  3ZTL A;  2DSA A;  1E2Y A;  3ZL5 A;  4GTU A;  6GST A;  3ZMK A;  2GDR A;  3C1S A;  2FWG A;  3IRA A;  2H74 A;  1DSB A;  3H4K A;  4JR4 A;  1EP7 A;  2NPB A;  2B5X A;  2JU5 A;  1ZGN A;  2K8V A;  3IC4 A;  4KA0 A;  3EC3 A;  4GXZ A;  1PL1 A;  1MDJ A;  3FZ9 A;  1A24 A;  1M0U A;  3VWV A;  17GS A;  1NHO A;  3LYK A;  3WT1 A;  3CSH A;  1SL0 B;  2EIO A;  4FIW A;  3QAW A;  4XS6 A;  1G7E A;  3IK9 A;  5AIV A;  3DKS A;  2KP1 A;  3GHA A;  1TP9 A;  4HU9 A;  4MH2 A;  2HZE B;  3BD2 A;  4G9H A;  4HUA A;  1GSS A;  4FO5 A;  1TI3 A;  4CW9 A;  4TRX A;  3KTL A;  12GS A;  5HR2 A;  1XVQ A;  3HCZ A;  1B48 A;  3EMP A;  5ID2 A;  1FB0 A;  1OC9 B;  4XRA A;  2EIR A;  1NHY A;  1OAZ A;  3UEM A;  4DSR A;  5CRH A;  3UL3 A;  4IQA A;  2C3Q A;  3TRQ A;  4RQX A;  2OE1 A;  3EE2 A;  4V2M A;  2KLX A;  1GL8 A;  1CQG A;  1N2A A;  3H1N A;  2C0G A;  4WXT A;  2DJK A;  3F8U A;  3EYT A;  1M7T A;  5D9W A;  3LG6 A;  2VD1 A;  2YAN A;  1NW2 A;  3N5O A;  3FKF A;  4KDX A;  3Q19 A;  1AIU A;  2P31 A;  1O6J A;  2GSS A;  2LNS A;  1KEB A;  4HQZ A;  3H93 A;  2WS2 A;  1ILO A;  1SD8 A;  4HU7 A;  1AC1 A;  2DBC A;  5ELG A;  2VCV A;  5J41 A;  4MMM A; 
#chains in the Genus database with same CATH topology
 5KN0 A;  3CXG A;  5D9T A;  3DRN A;  2FY6 A;  2X64 A;  2JL4 A;  3R2Q A;  2C4J A;  1SD9 A;  2LRN A;  4E8E A;  5ENU A;  2E0Q A;  2FD3 A;  4MLY A;  5EL8 A;  9GSS A;  2OAC A;  3CSJ A;  2HLS A;  3D4M A;  4WR4 A;  5E59 A;  4KE3 A;  1HQO A;  2IMK A;  3CTF A;  4BPY A;  3ME7 A;  2WGR A;  4PGT A;  3GKM A;  1O8X A;  1YZX A;  3HJM A;  5CRE A;  5IOW A;  3A5I A;  4TXO A;  2OBK A;  5CRW A;  4KW6 A;  4N10 A;  3A2V A;  3HJP A;  1EOG A;  2C80 A;  2IME A;  2ALB A;  4PQI A;  1S3R A;  2PBJ A;  4FQU A;  1PL2 A;  2B5Y A;  4ECB A;  1M3I A;  4IHU A;  3E3E A;  4XS4 A;  3A5W A;  1XCC A;  1B4Q A;  2DIZ A;  5A4U A;  3ED3 A;  1TU8 A;  3IPZ A;  3KM6 A;  4GSN A;  2H1A A;  3KGK A;  1YEX A;  1NSW A;  2CAQ A;  1TRV A;  3P90 A;  2VCW A;  1T00 A;  4G0I A;  2M46 A;  2H30 A;  4AGS A;  3LYP A;  1YF1 A;  1XW6 A;  1WIK A;  1HNA A;  2BJX A;  2GQL A;  2LUS A;  3M8N A;  2LEG A;  3G7Y A;  1VF1 A;  4XHM A;  5ECO B;  1XWA A;  5IMF A;  2L5O A;  5EPF A;  3FR3 A;  4HSC X;  1SU9 A;  4OD7 A;  4MZW A;  4Q5R A;  1W89 A;  2H6Y A;  1EEJ A;  4EIQ A;  4KDY A;  1PFO A;  3C1R A;  2MBS A;  1SKR B;  4RQR A;  3IDV A;  4AJ8 A;  2J9H A;  1JLV A;  1PKW A;  2YWN A;  1M99 A;  1A0R P;  3I69 A;  5ECN B;  1TDI A;  2PWJ A;  4L5L A;  2GLR A;  1WWJ A;  4GCI A;  4RI6 A;  3QMX A;  1EGR A;  4OWY A;  2PU9 C;  4ECI A;  2DJJ A;  2IFQ B;  2H01 A;  1AXD A;  1G0T A;  3GRX A;  3W8S A;  4GWR A;  3EUR A;  1KTE A;  1IYH A;  4PXO A;  2DML A;  5DAL A;  2GSR A;  1PSQ A;  1V98 A;  3C71 A;  4OCE A;  3Q6O A;  1JZW A;  3UMA A;  3QFA C;  3MDK A;  1TK0 B;  4KGI A;  1QUW A;  5ECR B;  4O32 A;  4FYC A;  3MAK A;  3VLN A;  4D73 B;  4OO5 A;  4TR0 A;  4FYB A;  1C72 A;  1EV4 A;  22GS A;  2CA8 A;  5ECL B;  4N0Z A;  4TR4 A;  2IMF A;  4P3Y B;  2H66 A;  4K8M A;  1TJD A;  4YKF A;  3HZ4 A;  3F4R A;  4HOJ A;  5FT3 A;  4Z2U A;  5CO3 A;  5CRD A;  6GSW A;  1MTC A;  5ECM B;  3LW9 A;  4KF9 A;  3FZ5 A;  2WFC A;  5LD0 A;  1JZD A;  1WE0 A;  2TRX A;  3OR5 A;  2F51 A;  3M9K A;  2YWM A;  4MF5 A;  3A3T A;  3VWW A;  2QSI A;  1FOH A;  1URM A;  5D9V A;  5COH A;  3E9J B;  2H1B A;  1X5D A;  5A5K A;  3CQF A;  4OFN A;  3FHK A;  3L9V A;  1BYE A;  2QA2 A;  4KAE A;  1I9D A;  1R7H A;  3QFB C;  3KIJ A;  4DEJ A;  2FCH A;  4ZB6 A;  1S3D A;  2LRT A;  1EZK A;  4IN0 A;  5IM9 A;  2AB6 A;  4G0L A;  2D2Z A;  2LJK A;  3DVW A;  4HJ2 A;  2HT9 A;  4GQC A;  5EY6 A;  1MEK A;  5D93 A;  4ZBA A;  3WD6 A;  6GSU A;  2K18 A;  2GVP A;  2R6K A;  5B6M A;  1HD2 A;  3APO A;  1Q98 A;  2JSY A;  3D4T A;  1ZYE A;  3ZML A;  4WEY A;  2UZ8 A;  2F9S A;  2XPE A;  4WBJ A;  2XHF A;  4CDO A;  3DGQ A;  1BG5 A;  14GS A;  3I6A A;  1M2B A;  2OA7 A;  2O89 A;  5F0G A;  2H1G A;  1M9A A;  4XS1 A;  2IIY A;  1A2J A;  5J9C A;  4L0U A;  4G2E A;  4PUA A;  3HZ8 A;  2N5B A;  1MD3 A;  2MMA A;  2A2P A;  3ERW A;  1ZZY A;  4K7O A;  2LJA A;  2NDO A;  1AQV A;  2HRA A;  3FZA A;  3E0U A;  3UOM A;  1XWK A;  1THO A;  4XS4 B;  4X43 A;  1ON4 A;  4BL7 A;  1BAY A;  3GKX A;  4EIP A;  3KMO A;  2CVK A;  5IMC A;  5AGY A;  4IEL A;  5DQS A;  3DEX A;  4Z2R A;  4BVX A;  3NZN A;  4ILF A;  1JLW A;  4IQ1 A;  4FYU A;  5D9X A;  1ACV A;  3S9F A;  1XIY A;  2DLX A;  1EP8 A;  2DJ2 A;  2YPM A;  2WB9 A;  5IOX A;  3R3E A;  2KUC A;  3G7I A;  4IS0 A;  4EKZ A;  4OCF A;  1A0F A;  3PIN A;  2JSZ A;  5ECS A;  4HI7 A;  5JCW A;  1Z6N A;  1LU4 A;  4MDC A;  4QL9 A;  3HD5 A;  1GSY A;  4YQV A;  2YN1 A;  3O3T A;  2Z9S A;  1SEN A;  3IHG A;  4ZBB A;  3ZIJ A;  3I43 A;  4HZ4 A;  4AJ6 A;  4ML6 A;  3IOS A;  4JE1 A;  1QFN A;  4EF0 A;  5B7C A;  3VUR A;  3O6T A;  1Z3E A;  1PMT A;  1PA3 A;  6GSS A;  5JWQ B;  4F9Z A;  1VF4 A;  5CAX A;  3IR4 A;  2P5Q A;  2AV4 A;  2F8F A;  2GZP A;  1TKD B;  1QXH A;  2LST A;  1OE7 A;  1RK4 A;  1OC3 A;  3WYW A;  5IMA A;  2YWI A;  3P7X A;  4PTS A;  1T8E B;  1USB A;  3QAV A;  2HFD A;  3DD3 A;  2L59 A;  1YKC A;  3GKK A;  5JCG A;  2HE3 A;  2MMN A;  3Q74 A;  4AJ7 A;  4V1A g;  2H8L A;  4PX1 A;  1XOA A;  4MZB A;  1SYX A;  1SKS B;  2X99 A;  4JR6 A;  3GH6 A;  3HVN A;  2VL2 A;  3GTU A;  4QQ7 A;  2YZU A;  5AIX A;  3VFI A;  4I6X A;  1FOV A;  3F0I A;  4OMV A;  3VK9 A;  1YF0 A;  4I2U A;  1Z5Y E;  4WKW A;  2ES7 A;  1I5G A;  3FR9 A;  1MDK A;  2L5L A;  4I97 A;  4TR1 A;  1ZYP A;  1AW9 A;  4EE0 A;  3J7Y b;  1R26 A;  5D8I A;  1OKT A;  1QK8 A;  1SKW B;  3TCO A;  1B8X A;  1HNC A;  2HSY A;  1T7P B;  4JRR A;  1K3O A;  2X8C A;  4BVY B;  5JWR B;  1H4O A;  1TK5 B;  3VI7 A;  3BOA A;  4BA7 A;  2XPD A;  3EMX A;  6GSY A;  1XZO A;  2IJY A;  4GLT A;  2O87 A;  2R37 A;  1ERV A;  1BX9 A;  2VM1 A;  3U5R E;  2RUE A;  3LWA A;  4ULX A;  1YJ6 A;  2X49 A;  3IXR A;  3M1G A;  4EDZ A;  5GAN D;  2DC5 A;  3RPP A;  3L78 A;  2HZF A;  2X4A A;  1AQW A;  2GGT A;  4YKG A;  5GAP D;  1G6W A;  2RII A;  2HXK A;  1K3L A;  5G5F A;  5F07 A;  1XBS A;  1X9M B;  2QC7 A;  4K7N A;  2GQM A;  4F03 A;  1B9Y C;  1OYJ A;  2L57 A;  1GTU A;  1M9B A;  7GSS A;  2F3M A;  4X1U A;  2H73 A;  4MJE A;  1YY7 A;  2H72 A;  4KCE A;  2JZS A;  2AJQ B;  2QA1 A;  5LNK e;  4YQU A;  5E4W A;  5F8B A;  4K1F A;  3BBY A;  3FK8 A;  2NBS A;  3GST A;  4K9Z A;  2V2G A;  2E7P A;  2ON5 A;  3KMN A;  1BQ7 A;  4ZL8 A;  1X0R A;  4AF2 A;  4IVF A;  4DSS B;  3TRP A;  1TRW A;  1PX7 A;  2QGV A;  4F0B A;  1ABA A;  2P5R A;  3HJO A;  3SBC A;  1F2E A;  4PNG A;  1XWB A;  2CAI A;  3RAZ A;  2B1K A;  3LXT A;  1A2M A;  2IMD A;  1TOF A;  1KNG A;  2LS5 A;  5HQP A;  5L71 A;  4BVX B;  1GNE A;  1A8Y A;  3GX8 A;  1ZYQ B;  4ZB9 A;  5BRT A;  1S3A A;  2VM2 A;  1YQ1 A;  3HA9 A;  3LEF A;  4KH7 A;  1PX6 A;  5D96 A;  3ZZX A;  3MIX A;  2CX3 A;  1O73 A;  3IAS 2;  5G30 A;  3D6I A;  2B7K A;  2FGX A;  1XXU A;  3CRU A;  3M9J A;  4K7I A;  5IPG A;  3TKQ A;  1TW9 A;  2O7K A;  16GS A;  3LXZ A;  1WRY A;  1ML6 A;  4A5P A;  4N30 A;  1SL2 B;  4PNF A;  4BWQ A;  3KD0 A;  1XW9 A;  1GUK A;  2PER A;  1GUL A;  3ZRE A;  1PN9 A;  2OE0 A;  5HR0 A;  3Q18 A;  5HR3 A;  2PUK C;  5DAK B;  5ABR A;  3RPN A;  2H6Z A;  4HZ2 A;  4OO4 A;  4LL4 B;  4MJB A;  1LBK A;  1YKA A;  2N5A A;  5G31 A;  1M2A A;  4IGJ A;  4MAB A;  4H86 A;  2FWE A;  4PUR A;  4EL1 A;  1X5C A;  5GZZ B;  4NAX A;  4OFM A;  3UIW A;  4USS A;  2EIQ A;  3V1W A;  3F3Q A;  2O8V B;  2LQO A;  5F06 A;  4F2I A;  2YP6 A;  2N5F A;  2G2Q A;  3HVV A;  1ERT A;  2E2G A;  5D73 A;  2JZR A;  2REM A;  2TRC P;  1NM3 A;  3PPU A;  2L6D A;  2NVL A;  2CVD A;  2VLU A;  1TTZ A;  5DDL A;  2M80 A;  2P0G A;  4XIH A;  4IJ3 A;  2CZ3 A;  5CYY A;  3ZRD A;  2RM6 A;  3TJK A;  4YH2 A;  3RDW A;  1GSF A;  3LOR A;  2GZZ A;  2MYG A;  5DJL A;  1AUC A;  3GH9 A;  2LRC A;  2K6V A;  5LCZ A;  2R4V A;  4PQ1 A;  3F4T A;  2IPA A;  4OFT A;  3WT2 A;  2B3S A;  4POK A;  2WDU A;  2C3T A;  4NV5 A;  2V41 A;  3GL5 A;  3GUR A;  5ID2 B;  2KHP A;  1X9W B;  2K9F A;  4KDU A;  2ZNM A;  1FAA A;  5GST A;  2V32 A;  2DIY A;  4HDE A;  3HVX A;  1XG8 A;  1V9W A;  1U6T A;  2A2S A;  2XBQ A;  4MH3 A;  4WR5 A;  1GUM A;  1OC9 A;  4KCA A;  1X9S B;  2C0D A;  1FHE A;  3LSZ A;  1F37 A;  4RI7 A;  3AY8 A;  3A2X A;  2VCZ A;  3F63 A;  3RBT A;  4FH8 A;  1QQ2 A;  4MPF A;  3VPQ A;  3G7J A;  3UAR A;  4J56 E;  1XPV A;  1GSU A;  5DBQ A;  2VIM A;  5H5Q A;  2R2J A;  4NWY A;  3N9J A;  2B1L A;  1GRX A;  4V2L A;  1F3B A;  4QL7 A;  1AAZ A;  2GQK A;  4XTS A;  3LQ7 A;  3CMI A;  4Z7X A;  1OE8 A;  2GS3 A;  4GF0 A;  2CX4 A;  4ZL7 A;  3MNG A;  2LKU A;  3GFK A;  4IKH A;  3ZYW A;  1PRX A;  3EU4 A;  2DKI A;  3APS A;  2I9H A;  2HSM A;  3F4S A;  5ECH B;  3DYR A;  3TOU A;  4IJI A;  4PUF C;  1JFU A;  5BMU A;  3VWU A;  2WRT A;  4EDY A;  2H19 A;  3LJR A;  4J2F A;  3M0F A;  2DJ1 A;  4TXO B;  2RM5 A;  3L4N A;  5IQY A;  1U3A A;  3UAP A;  18GS A;  1GLQ A;  3C7M A;  1Z7P A;  3UBL A;  1TRS A;  2VCX A;  3KH7 A;  2MZC A;  4MNN A;  2VCT A;  4IBP A;  1BED A;  2GSQ A;  1ZMA A;  4F82 A;  2H0I A;  2DJ3 A;  5FHI A;  4V2N A;  2MMO A;  1T1V A;  5H5R A;  4PQH A;  1WJK A;  4TVE A;  5DVB A;  4F0C A;  1J08 A;  4WET A;  2H6X A;  4JBB A;  2WZ9 A;  2C8U A;  1GP1 A;  2JZT A;  4O92 A;  1VF2 A;  1THX A;  4TR3 A;  1PGT A;  1J0F A;  2K8S A;  3IE3 A;  1J9B A;  4K5R A;  3TKS E;  4BWS A;  2MBT A;  4GSS A;  3GYK A;  1SL1 B;  4YAV A;  4O5Q A;  1EOH A;  2AUV A;  2HRK A;  4EC0 A;  2H76 A;  2GT6 A;  2R5G A;  3KH9 A;  1GLP A;  1G6Y A;  1N8J A;  2OE3 A;  8GSS A;  1XOB A;  3GN3 A;  3HVS A;  2F8A A;  2ZUP A;  4G19 A;  2R3X A;  4XCS A;  1TU7 A;  2L4Q A;  4O7H A;  4WBR D;  1Q4J A;  4WF4 A;  5FWG A;  3TGZ A;  4ZIL A;  2BMX A;  2GT5 A;  3D22 A;  1K0B A;  1IYI A;  2O85 A;  5DCG A;  3HDC A;  3TRX A;  1K0M A;  3D21 A;  4IP1 A;  3KP8 A;  4I8B A;  1SK0 A;  1FVJ A;  5CP1 A;  19GS A;  2FNO A;  4ISD A;  4X0X A;  2OBI A;  1M2D A;  1Y6E A;  5IMV A;  1K3Y A;  1VRS D;  2ZCT A;  3H79 A;  5DAL B;  2DKH A;  2PVO C;  2R0P A;  3NOF A;  3RHC A;  4NV2 A;  3LGC A;  1JZR A;  4G0K A;  2GTU A;  2IFQ A;  1SJ6 A;  3ZFL A;  3DVX A;  4LLR A;  2AYT A;  2H75 A;  3CTG A;  1RW1 A;  5J4U A;  1TI1 A;  1JZO A;  3WGE A;  1K0A A;  2YWO A;  3KP9 A;  4GST A;  5IPH A;  2CT6 A;  1FG4 A;  5F05 A;  4K6X A;  3EWL A;  3SWL A;  1ZCP A;  1XVW A;  2KP2 A;  1GWC A;  3GSS A;  2YOI A;  3UVT A;  2EC4 A;  5IMD A;  2CVB A;  5C04 A;  2NTO A;  4D73 A;  3IAM 2;  4NMU A;  2HRF A;  3QD9 A;  2R0G A;  1O7U A;  3BJ5 A;  3C73 A;  6GSV A;  1XW5 A;  3TB2 A;  1EEM A;  1V58 A;  5ECQ B;  4ACS A;  1KBN A;  4JED A;  3I9V 2;  2MMZ A;  2R0C A;  2FWF A;  2VL2 C;  4RUV A;  3VWX A;  4DSQ A;  2BTO T;  3UVH A;  2JAD A;  4NPB A;  2H0H A;  3PGT A;  1V57 A;  4ML1 A;  4XRD A;  4IW9 A;  3ZIT A;  4ZIJ A;  3HHV A;  2M72 A;  2WJU A;  1V2A A;  3GV1 A;  2I3Y A;  2VUP A;  5KN3 A;  2HI7 A;  5ELA A;  4KB3 A;  1PQN A;  5ECK B;  1Z6M A;  5ECI B;  4EXJ A;  2A2R A;  3GNJ A;  13GS A;  3KCM A;  2H0G A;  3FMW A;  5CRG A;  1R5P A;  3F6F A;  4LMV A;  3M3M A;  2RUF A;  3C8E A;  1UVZ A;  2HYX A;  2CZ2 A;  3A2W A;  2AHE A;  1PKZ A;  2ON7 A;  2CV4 A;  2YJ7 A;  1PD2 1;  2GST A;  1A23 A;  4JU5 A;  3LFL A;  2C1Y A;  3QDN A;  3ERF A;  4LL1 B;  1ZYN A;  2LJR A;  3GUS A;  3FZ4 A;  5G1L A;  2VLT A;  5B8A A;  1MDI A;  2C3N A;  2VD0 A;  4TKY A;  4MJC A;  3TKP A;  1BJX A;  1T4Z A;  2IN3 A;  1OVN A;  2PVQ A;  4K5S A;  1EGO A;  5KOX A;  3FEU A;  5A4W A;  5IO2 A;  1WOU A;  1YEP A;  2YV7 A;  1EWX A;  3TJG A;  1ERW A;  1VGL A;  2LTK A;  1SJZ A;  2HNL A;  2VAF A;  4MF7 A;  4MZC A;  5JCU A;  2B5E A;  4JZQ A;  4BL7 B;  1GH2 A;  2A4H A;  2G0F A;  2VL9 A;  4WF5 A;  4K2X A;  3GMF A;  3L9U A;  2OKA A;  4EO3 A;  1SJI A;  5JWO B;  2H1D A;  2H71 A;  4TW5 A;  4ECC A;  4NHW A;  4I2T A;  5INY A;  3DML A;  4Z2T A;  1A8L A;  1F3A A;  3GIX A;  5HFG A;  4MJA A;  1K0O A;  5J3R A;  2C0F A;  3ME8 A;  1HYU A;  1HNB A;  5KN2 A;  3J7Y k;  4EVM A;  1K0C A;  1XFL A;  4NHZ A;  4N0V A;  5HFI A;  1GNW A;  3UJ1 A;  2DMM A;  1U87 A;  2FA4 A;  4KSO A;  4ID0 A;  5H5S A;  4LA1 A;  1R5A A;  2VLV A;  4Q5Q A;  2L6C A;  2VCQ A;  3FY7 A;  3TJB A;  3EPT A;  3PH9 A;  4HQS A;  1ZL9 A;  1GUH A;  4V1A p;  4J57 E;  2CQ9 A;  5J5N A;  3APQ A;  4TN8 A;  4ZBD A;  1DE1 A;  1MD4 A;  1R4W A;  2E2M A;  1GTA A;  6GSX A;  4K0G A;  1ZOF A;  3IHQ A;  3KZQ A;  2V6O A;  3GKN A;  2B7J A;  1WMJ A;  5KEJ A;  3QPM A;  2LQQ A;  3UBK A;  1DBY A;  3JCM L;  5IIZ A;  1S3C A;  2FWH A;  2X8H A;  2YV9 A;  1OKD A;  4HS1 A;  2FA8 A;  1X5E A;  2IL3 A;  2IMI A;  5EVO A;  4Q5N A;  3FRC A;  2AAW A;  3HKR A;  3HYP A;  1FVK A;  3D5J A;  4HEA 2;  2X8G A;  3TDG A;  3IBH A;  1FB6 A;  4EUY A;  3CYN A;  4I5Q A;  1UC7 A;  2FLS A;  1U3I A;  4O5R A;  4ICY A;  1GSE A;  2DJ0 A;  2YCD A;  1FW1 A;  3CBU A;  1Z7R A;  3GTU B;  4DVC A;  4KND A;  4KX4 A;  5IMZ A;  3MYD A;  3F9U A;  1U88 A;  1WPI A;  4CHS A;  2VOC A;  2H70 A;  3L0H A;  4TR1 B;  5G5E A;  3KJY A;  1GSQ A;  2J23 A;  2HZE A;  3EU3 A;  2L4C A;  4L8E A;  3O76 A;  2XC2 A;  1B4P A;  5DJM A;  3ZLP A;  5G2Z A;  1SYR A;  2PMT A;  4TOP A;  3GX0 A;  4K2D A;  3GA4 A;  1WP0 A;  2IWT A;  5B6N A;  2V1M A;  3ZIV A;  1CQH A;  3ERG A;  1ST9 A;  1B9X C;  3ZFB A;  1K0N A;  1EV9 A;  3D0Z A;  3NIV A;  1GTB A;  4MA9 A;  3EVI A;  2FUG 2;  2OAD A;  3US3 A;  3BCK A;  2I81 A;  3QOU A;  1UA5 A;  4O5U A;  1YDK A;  3DIE A;  4BVY A;  3IA1 A;  4POM A;  1XWC A;  4MP4 A;  2YZH A;  10GS A;  3IK7 A;  2XBI A;  4YQM A;  5KN1 A;  3KXO A;  2JAC A;  1H75 A;  3TUE A;  2VO4 A;  1LJR A;  3DWV A;  1RQM A;  3CRT A;  2QKE A;  2RLI A;  1F6M C;  1QGV A;  3WGX A;  5HFK A;  3KTB A;  1M3J A;  3RHB A;  4NXI A;  3IC8 A;  4KUN A;  3L9S A;  4G10 A;  4MPG A;  2I1U A;  1T3B A;  3W6G A;  2I4A A;  1GSD A;  4POB A;  4YAP A;  2A4V A;  3FYG A;  5KOW A;  3TKS A;  1W4V A;  3EIN A;  1F9M A;  3TJJ A;  5AN1 A;  2B6M A;  3P8W A;  4CY6 A;  5J9B A;  1ERU A;  4LMW A;  2TIR A;  5AIS A;  2WCI A;  1O81 A;  4MK3 A;  3WGD A;  1Z9H A;  1V40 A;  1A2L A;  2VL3 A;  4ZB8 A;  4MF6 A;  1SK2 A;  3TOT A;  5DCH A;  2OJL A;  2FHE A;  5C00 A;  3HXS A;  4ZL9 A;  2LNT A;  5HR1 A;  3TKS C;  2WUL A;  4L0W A;  2C0E A;  3MSZ A;  3ISO A;  2YJH A;  2GZY A;  4Q5F A;  3BCI A;  4DSS A;  1T4Y A;  2V6K A;  1FO5 A;  4GQF A;  3VPT A;  4ECJ A;  1VF3 A;  1XWG A;  2KOK A;  20GS A;  1G7O A;  3P2A A;  3VI5 A;  4POL A;  3KEB A;  2HSH A;  2PGT A;  5GSS A;  1K0D A;  1Y25 A;  2PN8 A;  1TK8 B;  4IP6 A;  1JHB A;  1SK1 A;  3FW2 A;  3TKR A;  4KSM A;  4N11 A;  1OC8 A;  3U6V A;  3QCP A;  5IO0 A;  3CSI A;  3TJF A;  3QAG A;  4GRF A;  5DQY A;  3DXB A;  2HRN A;  4TXV A;  4E8H A;  4K0N A;  3IV4 A;  4MCU A;  1AQX A;  5CNW A;  1UN2 A;  1O85 A;  3ZVJ D;  1DUG A;  1E6B A;  3F6D A;  3ZVJ A;  1O8W A;  5DAK A;  4ZXG A;  4HJM A;  3MWH A;  2LV3 A;  3FR6 A;  3QR6 A;  1QMV A;  1TRU A;  3GL3 A;  1GTI A;  11GS A;  5B8B A;  5A4V A;  2YNX A;  5ECP B;  3K8N A;  3F3R A;  4L5O A;  1DE2 A;  5G1K A;  3HY2 A;  1TXX A;  3H8Q A;  3G9B A;  3PR8 A;  2PPT A;  3W8J A;  3ZTL A;  2DSA A;  1E2Y A;  3ZL5 A;  4GTU A;  6GST A;  3ZMK A;  2GDR A;  3C1S A;  2FWG A;  3IRA A;  2H74 A;  1DSB A;  3H4K A;  4JR4 A;  1EP7 A;  2NPB A;  2B5X A;  2JU5 A;  1ZGN A;  2K8V A;  3IC4 A;  4KA0 A;  3EC3 A;  4GXZ A;  1PL1 A;  1MDJ A;  3FZ9 A;  1A24 A;  1M0U A;  3VWV A;  17GS A;  1NHO A;  3LYK A;  3WT1 A;  3CSH A;  1SL0 B;  2EIO A;  4FIW A;  1PN0 A;  3QAW A;  4XS6 A;  1G7E A;  3IK9 A;  5AIV A;  3DKS A;  2KP1 A;  3GHA A;  1TP9 A;  4HU9 A;  4MH2 A;  2HZE B;  3BD2 A;  4G9H A;  4HUA A;  1GSS A;  4FO5 A;  1TI3 A;  4CW9 A;  4TRX A;  3KTL A;  12GS A;  5HR2 A;  1XVQ A;  3HCZ A;  1B48 A;  3EMP A;  5ID2 A;  1FB0 A;  1OC9 B;  4XRA A;  2EIR A;  1NHY A;  1OAZ A;  3UEM A;  4DSR A;  4CY8 A;  5CRH A;  3UL3 A;  4IQA A;  2C3Q A;  3TRQ A;  4RQX A;  2OE1 A;  3EE2 A;  4V2M A;  2KLX A;  1GL8 A;  1CQG A;  1N2A A;  3H1N A;  2C0G A;  4WXT A;  2DJK A;  3F8U A;  3EYT A;  1M7T A;  5D9W A;  3LG6 A;  2VD1 A;  2YAN A;  1NW2 A;  3N5O A;  3FKF A;  4KDX A;  3Q19 A;  1AIU A;  2P31 A;  1O6J A;  2GSS A;  2LNS A;  1KEB A;  4HQZ A;  3H93 A;  4X4J A;  2WS2 A;  1ILO A;  1SD8 A;  4BIK A;  4HU7 A;  1AC1 A;  2DBC A;  5ELG A;  2VCV A;  5J41 A;  4MMM A; 
#chains in the Genus database with same CATH homology
 5KN0 A;  3CXG A;  5D9T A;  3DRN A;  2FY6 A;  2X64 A;  2JL4 A;  3R2Q A;  2C4J A;  1SD9 A;  2LRN A;  4E8E A;  5ENU A;  2E0Q A;  2FD3 A;  4MLY A;  5EL8 A;  9GSS A;  2OAC A;  3CSJ A;  2HLS A;  3D4M A;  4WR4 A;  5E59 A;  4KE3 A;  1HQO A;  2IMK A;  3CTF A;  4BPY A;  3ME7 A;  2WGR A;  4PGT A;  3GKM A;  1O8X A;  1YZX A;  3HJM A;  5CRE A;  5IOW A;  3A5I A;  4TXO A;  2OBK A;  5CRW A;  4KW6 A;  4N10 A;  3A2V A;  3HJP A;  1EOG A;  2C80 A;  2IME A;  2ALB A;  4PQI A;  2PBJ A;  4FQU A;  1PL2 A;  2B5Y A;  4ECB A;  4IHU A;  3E3E A;  4XS4 A;  3A5W A;  1XCC A;  1B4Q A;  2DIZ A;  5A4U A;  3ED3 A;  1TU8 A;  3IPZ A;  3KM6 A;  4GSN A;  2H1A A;  3KGK A;  1YEX A;  1NSW A;  2CAQ A;  1TRV A;  3P90 A;  2VCW A;  1T00 A;  4G0I A;  2M46 A;  2H30 A;  4AGS A;  3LYP A;  1YF1 A;  1XW6 A;  1WIK A;  1HNA A;  2BJX A;  2GQL A;  2LUS A;  3M8N A;  2LEG A;  3G7Y A;  1VF1 A;  4XHM A;  5ECO B;  1XWA A;  5IMF A;  2L5O A;  5EPF A;  3FR3 A;  1SU9 A;  4OD7 A;  4MZW A;  4Q5R A;  1W89 A;  2H6Y A;  1EEJ A;  4EIQ A;  4KDY A;  3C1R A;  2MBS A;  1SKR B;  4RQR A;  3IDV A;  4AJ8 A;  2J9H A;  1JLV A;  1PKW A;  2YWN A;  1M99 A;  1A0R P;  3I69 A;  5ECN B;  1TDI A;  2PWJ A;  4L5L A;  2GLR A;  1WWJ A;  4GCI A;  4RI6 A;  3QMX A;  1EGR A;  4OWY A;  2PU9 C;  4ECI A;  2DJJ A;  2IFQ B;  2H01 A;  1AXD A;  1G0T A;  3GRX A;  3W8S A;  4GWR A;  3EUR A;  1KTE A;  1IYH A;  4PXO A;  2DML A;  5DAL A;  2GSR A;  1PSQ A;  1V98 A;  3C71 A;  4OCE A;  3Q6O A;  1JZW A;  3UMA A;  3QFA C;  3MDK A;  1TK0 B;  4KGI A;  1QUW A;  5ECR B;  4O32 A;  4FYC A;  3MAK A;  3VLN A;  4D73 B;  4OO5 A;  4TR0 A;  4FYB A;  1C72 A;  1EV4 A;  22GS A;  2CA8 A;  5ECL B;  4N0Z A;  4TR4 A;  2IMF A;  4P3Y B;  2H66 A;  4K8M A;  1TJD A;  4YKF A;  3HZ4 A;  3F4R A;  4HOJ A;  5FT3 A;  4Z2U A;  5CO3 A;  5CRD A;  6GSW A;  1MTC A;  5ECM B;  3LW9 A;  4KF9 A;  3FZ5 A;  2WFC A;  5LD0 A;  1JZD A;  1WE0 A;  2TRX A;  3OR5 A;  2F51 A;  3M9K A;  2YWM A;  4MF5 A;  3A3T A;  3VWW A;  2QSI A;  1FOH A;  1URM A;  5D9V A;  5COH A;  3E9J B;  2H1B A;  1X5D A;  5A5K A;  4OFN A;  3FHK A;  3L9V A;  1BYE A;  2QA2 A;  4KAE A;  1I9D A;  1R7H A;  3QFB C;  3KIJ A;  4DEJ A;  2FCH A;  4ZB6 A;  1S3D A;  2LRT A;  1EZK A;  4IN0 A;  5IM9 A;  2AB6 A;  4G0L A;  2D2Z A;  2LJK A;  3DVW A;  4HJ2 A;  2HT9 A;  4GQC A;  5EY6 A;  1MEK A;  5D93 A;  4ZBA A;  3WD6 A;  6GSU A;  2K18 A;  2GVP A;  2R6K A;  5B6M A;  1HD2 A;  3APO A;  1Q98 A;  2JSY A;  3D4T A;  1ZYE A;  3ZML A;  4WEY A;  2UZ8 A;  2F9S A;  2XPE A;  4WBJ A;  2XHF A;  4CDO A;  3DGQ A;  1BG5 A;  14GS A;  3I6A A;  1M2B A;  2OA7 A;  2O89 A;  5F0G A;  2H1G A;  1M9A A;  4XS1 A;  2IIY A;  1A2J A;  5J9C A;  4L0U A;  4G2E A;  4PUA A;  3HZ8 A;  2N5B A;  1MD3 A;  2MMA A;  2A2P A;  3ERW A;  1ZZY A;  4K7O A;  2LJA A;  2NDO A;  1AQV A;  2HRA A;  3FZA A;  3E0U A;  3UOM A;  1XWK A;  1THO A;  4XS4 B;  4X43 A;  1ON4 A;  4BL7 A;  1BAY A;  3GKX A;  4EIP A;  3KMO A;  2CVK A;  5IMC A;  5AGY A;  4IEL A;  5DQS A;  3DEX A;  4Z2R A;  4BVX A;  3NZN A;  4ILF A;  1JLW A;  4IQ1 A;  4FYU A;  5D9X A;  1ACV A;  3S9F A;  1XIY A;  2DLX A;  1EP8 A;  2DJ2 A;  2YPM A;  2WB9 A;  5IOX A;  3R3E A;  2KUC A;  3G7I A;  4IS0 A;  4EKZ A;  4OCF A;  1A0F A;  3PIN A;  2JSZ A;  5ECS A;  4HI7 A;  5JCW A;  1Z6N A;  1LU4 A;  4MDC A;  4QL9 A;  3HD5 A;  1GSY A;  4YQV A;  2YN1 A;  3O3T A;  2Z9S A;  1SEN A;  3IHG A;  4ZBB A;  3ZIJ A;  3I43 A;  4HZ4 A;  4AJ6 A;  4ML6 A;  3IOS A;  4JE1 A;  1QFN A;  4EF0 A;  5B7C A;  3VUR A;  3O6T A;  1Z3E A;  1PMT A;  1PA3 A;  6GSS A;  5JWQ B;  4F9Z A;  1VF4 A;  5CAX A;  3IR4 A;  2P5Q A;  2AV4 A;  2F8F A;  2GZP A;  1TKD B;  1QXH A;  2LST A;  1OE7 A;  1RK4 A;  1OC3 A;  3WYW A;  5IMA A;  2YWI A;  3P7X A;  4PTS A;  1T8E B;  1USB A;  3QAV A;  2HFD A;  3DD3 A;  2L59 A;  1YKC A;  3GKK A;  5JCG A;  2HE3 A;  2MMN A;  3Q74 A;  4AJ7 A;  4V1A g;  2H8L A;  4PX1 A;  1XOA A;  4MZB A;  1SYX A;  1SKS B;  2X99 A;  4JR6 A;  3GH6 A;  2VL2 A;  3GTU A;  4QQ7 A;  2YZU A;  5AIX A;  3VFI A;  4I6X A;  1FOV A;  3F0I A;  4OMV A;  3VK9 A;  1YF0 A;  4I2U A;  1Z5Y E;  4WKW A;  2ES7 A;  1I5G A;  3FR9 A;  1MDK A;  2L5L A;  4I97 A;  4TR1 A;  1ZYP A;  1AW9 A;  4EE0 A;  3J7Y b;  1R26 A;  5D8I A;  1OKT A;  1QK8 A;  1SKW B;  3TCO A;  1B8X A;  1HNC A;  2HSY A;  1T7P B;  4JRR A;  1K3O A;  2X8C A;  4BVY B;  5JWR B;  1H4O A;  1TK5 B;  3VI7 A;  3BOA A;  4BA7 A;  2XPD A;  3EMX A;  6GSY A;  1XZO A;  2IJY A;  4GLT A;  2O87 A;  2R37 A;  1ERV A;  1BX9 A;  2VM1 A;  3U5R E;  2RUE A;  3LWA A;  4ULX A;  1YJ6 A;  2X49 A;  3IXR A;  3M1G A;  4EDZ A;  5GAN D;  2DC5 A;  3RPP A;  3L78 A;  2HZF A;  2X4A A;  1AQW A;  2GGT A;  4YKG A;  5GAP D;  1G6W A;  2RII A;  2HXK A;  1K3L A;  5G5F A;  5F07 A;  1XBS A;  1X9M B;  2QC7 A;  4K7N A;  2GQM A;  4F03 A;  1B9Y C;  1OYJ A;  2L57 A;  1GTU A;  1M9B A;  7GSS A;  2F3M A;  4X1U A;  2H73 A;  4MJE A;  1YY7 A;  2H72 A;  4KCE A;  2JZS A;  2AJQ B;  2QA1 A;  5LNK e;  4YQU A;  5E4W A;  5F8B A;  4K1F A;  3BBY A;  3FK8 A;  2NBS A;  3GST A;  4K9Z A;  2V2G A;  2E7P A;  2ON5 A;  3KMN A;  1BQ7 A;  4ZL8 A;  1X0R A;  4AF2 A;  4IVF A;  4DSS B;  3TRP A;  1TRW A;  1PX7 A;  2QGV A;  4F0B A;  1ABA A;  2P5R A;  3HJO A;  3SBC A;  1F2E A;  4PNG A;  1XWB A;  2CAI A;  3RAZ A;  2B1K A;  3LXT A;  1A2M A;  2IMD A;  1TOF A;  1KNG A;  2LS5 A;  5HQP A;  5L71 A;  4BVX B;  1GNE A;  1A8Y A;  3GX8 A;  1ZYQ B;  4ZB9 A;  5BRT A;  1S3A A;  2VM2 A;  1YQ1 A;  3HA9 A;  3LEF A;  4KH7 A;  1PX6 A;  5D96 A;  3ZZX A;  3MIX A;  2CX3 A;  1O73 A;  3IAS 2;  5G30 A;  3D6I A;  2B7K A;  2FGX A;  1XXU A;  3CRU A;  3M9J A;  4K7I A;  5IPG A;  3TKQ A;  1TW9 A;  2O7K A;  16GS A;  3LXZ A;  1WRY A;  1ML6 A;  4A5P A;  4N30 A;  1SL2 B;  4PNF A;  4BWQ A;  3KD0 A;  1XW9 A;  1GUK A;  2PER A;  1GUL A;  3ZRE A;  1PN9 A;  2OE0 A;  5HR0 A;  3Q18 A;  5HR3 A;  2PUK C;  5DAK B;  5ABR A;  3RPN A;  2H6Z A;  4HZ2 A;  4OO4 A;  4LL4 B;  4MJB A;  1LBK A;  1YKA A;  2N5A A;  5G31 A;  1M2A A;  4IGJ A;  4MAB A;  4H86 A;  2FWE A;  4PUR A;  4EL1 A;  1X5C A;  5GZZ B;  4NAX A;  4OFM A;  3UIW A;  4USS A;  2EIQ A;  3V1W A;  3F3Q A;  2O8V B;  2LQO A;  5F06 A;  4F2I A;  2YP6 A;  2N5F A;  2G2Q A;  3HVV A;  1ERT A;  2E2G A;  5D73 A;  2JZR A;  2REM A;  2TRC P;  1NM3 A;  3PPU A;  2L6D A;  2NVL A;  2CVD A;  2VLU A;  1TTZ A;  5DDL A;  2M80 A;  2P0G A;  4XIH A;  4IJ3 A;  2CZ3 A;  5CYY A;  3ZRD A;  2RM6 A;  3TJK A;  4YH2 A;  3RDW A;  1GSF A;  3LOR A;  2GZZ A;  2MYG A;  5DJL A;  1AUC A;  3GH9 A;  2LRC A;  2K6V A;  5LCZ A;  2R4V A;  4PQ1 A;  3F4T A;  2IPA A;  4OFT A;  3WT2 A;  2B3S A;  4POK A;  2WDU A;  2C3T A;  4NV5 A;  2V41 A;  3GL5 A;  3GUR A;  5ID2 B;  2KHP A;  1X9W B;  2K9F A;  4KDU A;  2ZNM A;  1FAA A;  5GST A;  2V32 A;  2DIY A;  4HDE A;  3HVX A;  1V9W A;  1U6T A;  2A2S A;  2XBQ A;  4MH3 A;  4WR5 A;  1GUM A;  1OC9 A;  4KCA A;  1X9S B;  2C0D A;  1FHE A;  3LSZ A;  1F37 A;  4RI7 A;  3AY8 A;  3A2X A;  2VCZ A;  3F63 A;  3RBT A;  4FH8 A;  1QQ2 A;  4MPF A;  3VPQ A;  3G7J A;  3UAR A;  4J56 E;  1XPV A;  1GSU A;  5DBQ A;  2VIM A;  5H5Q A;  2R2J A;  4NWY A;  3N9J A;  2B1L A;  1GRX A;  4V2L A;  1F3B A;  4QL7 A;  1AAZ A;  2GQK A;  4XTS A;  3LQ7 A;  3CMI A;  4Z7X A;  1OE8 A;  2GS3 A;  4GF0 A;  2CX4 A;  4ZL7 A;  3MNG A;  2LKU A;  3GFK A;  4IKH A;  3ZYW A;  1PRX A;  3EU4 A;  2DKI A;  3APS A;  2I9H A;  2HSM A;  3F4S A;  5ECH B;  3DYR A;  3TOU A;  4IJI A;  4PUF C;  1JFU A;  5BMU A;  3VWU A;  2WRT A;  4EDY A;  2H19 A;  3LJR A;  4J2F A;  3M0F A;  2DJ1 A;  4TXO B;  2RM5 A;  3L4N A;  5IQY A;  1U3A A;  3UAP A;  18GS A;  1GLQ A;  3C7M A;  1Z7P A;  3UBL A;  1TRS A;  2VCX A;  3KH7 A;  2MZC A;  4MNN A;  2VCT A;  4IBP A;  1BED A;  2GSQ A;  1ZMA A;  4F82 A;  2H0I A;  2DJ3 A;  5FHI A;  4V2N A;  2MMO A;  1T1V A;  5H5R A;  4PQH A;  1WJK A;  4TVE A;  5DVB A;  4F0C A;  1J08 A;  4WET A;  2H6X A;  4JBB A;  2WZ9 A;  2C8U A;  1GP1 A;  2JZT A;  4O92 A;  1VF2 A;  1THX A;  4TR3 A;  1PGT A;  1J0F A;  2K8S A;  3IE3 A;  1J9B A;  4K5R A;  3TKS E;  4BWS A;  2MBT A;  4GSS A;  3GYK A;  1SL1 B;  4YAV A;  4O5Q A;  1EOH A;  2AUV A;  2HRK A;  4EC0 A;  2H76 A;  2GT6 A;  2R5G A;  3KH9 A;  1GLP A;  1G6Y A;  1N8J A;  2OE3 A;  8GSS A;  1XOB A;  3GN3 A;  3HVS A;  2F8A A;  2ZUP A;  4G19 A;  2R3X A;  4XCS A;  1TU7 A;  2L4Q A;  4O7H A;  4WBR D;  1Q4J A;  4WF4 A;  5FWG A;  3TGZ A;  4ZIL A;  2BMX A;  2GT5 A;  3D22 A;  1K0B A;  1IYI A;  2O85 A;  5DCG A;  3HDC A;  3TRX A;  1K0M A;  3D21 A;  4IP1 A;  3KP8 A;  4I8B A;  1SK0 A;  1FVJ A;  5CP1 A;  19GS A;  2FNO A;  4ISD A;  4X0X A;  2OBI A;  1M2D A;  1Y6E A;  5IMV A;  1K3Y A;  1VRS D;  2ZCT A;  3H79 A;  5DAL B;  2DKH A;  2PVO C;  2R0P A;  3NOF A;  3RHC A;  4NV2 A;  3LGC A;  1JZR A;  4G0K A;  2GTU A;  2IFQ A;  1SJ6 A;  3ZFL A;  3DVX A;  4LLR A;  2AYT A;  2H75 A;  3CTG A;  1RW1 A;  5J4U A;  1TI1 A;  1JZO A;  3WGE A;  1K0A A;  2YWO A;  3KP9 A;  4GST A;  5IPH A;  2CT6 A;  1FG4 A;  5F05 A;  4K6X A;  3EWL A;  3SWL A;  1ZCP A;  1XVW A;  2KP2 A;  1GWC A;  3GSS A;  2YOI A;  3UVT A;  2EC4 A;  5IMD A;  2CVB A;  5C04 A;  2NTO A;  4D73 A;  3IAM 2;  4NMU A;  2HRF A;  3QD9 A;  2R0G A;  1O7U A;  3BJ5 A;  3C73 A;  6GSV A;  1XW5 A;  3TB2 A;  1EEM A;  1V58 A;  5ECQ B;  4ACS A;  1KBN A;  4JED A;  3I9V 2;  2MMZ A;  2R0C A;  2FWF A;  2VL2 C;  4RUV A;  3VWX A;  4DSQ A;  2BTO T;  3UVH A;  2JAD A;  4NPB A;  2H0H A;  3PGT A;  1V57 A;  4ML1 A;  4XRD A;  4IW9 A;  3ZIT A;  4ZIJ A;  3HHV A;  2M72 A;  2WJU A;  1V2A A;  3GV1 A;  2I3Y A;  2VUP A;  5KN3 A;  2HI7 A;  5ELA A;  4KB3 A;  1PQN A;  5ECK B;  1Z6M A;  5ECI B;  4EXJ A;  2A2R A;  3GNJ A;  13GS A;  3KCM A;  2H0G A;  3FMW A;  5CRG A;  1R5P A;  3F6F A;  4LMV A;  3M3M A;  2RUF A;  3C8E A;  1UVZ A;  2HYX A;  2CZ2 A;  3A2W A;  2AHE A;  1PKZ A;  2ON7 A;  2CV4 A;  2YJ7 A;  1PD2 1;  2GST A;  1A23 A;  4JU5 A;  3LFL A;  2C1Y A;  3QDN A;  3ERF A;  4LL1 B;  1ZYN A;  2LJR A;  3GUS A;  3FZ4 A;  5G1L A;  2VLT A;  5B8A A;  1MDI A;  2C3N A;  2VD0 A;  4TKY A;  4MJC A;  3TKP A;  1BJX A;  1T4Z A;  2IN3 A;  1OVN A;  2PVQ A;  4K5S A;  1EGO A;  5KOX A;  3FEU A;  5A4W A;  5IO2 A;  1WOU A;  1YEP A;  2YV7 A;  1EWX A;  3TJG A;  1ERW A;  1VGL A;  2LTK A;  1SJZ A;  2HNL A;  2VAF A;  4MF7 A;  4MZC A;  5JCU A;  2B5E A;  4JZQ A;  4BL7 B;  1GH2 A;  2A4H A;  2G0F A;  2VL9 A;  4WF5 A;  4K2X A;  3GMF A;  3L9U A;  2OKA A;  4EO3 A;  1SJI A;  5JWO B;  2H1D A;  2H71 A;  4TW5 A;  4ECC A;  4NHW A;  4I2T A;  5INY A;  3DML A;  4Z2T A;  1A8L A;  1F3A A;  3GIX A;  5HFG A;  4MJA A;  1K0O A;  5J3R A;  2C0F A;  3ME8 A;  1HYU A;  1HNB A;  5KN2 A;  3J7Y k;  4EVM A;  1K0C A;  1XFL A;  4NHZ A;  4N0V A;  5HFI A;  1GNW A;  3UJ1 A;  2DMM A;  1U87 A;  2FA4 A;  4KSO A;  4ID0 A;  5H5S A;  4LA1 A;  1R5A A;  2VLV A;  4Q5Q A;  2L6C A;  2VCQ A;  3FY7 A;  3TJB A;  3EPT A;  3PH9 A;  4HQS A;  1ZL9 A;  1GUH A;  4V1A p;  4J57 E;  2CQ9 A;  5J5N A;  3APQ A;  4TN8 A;  4ZBD A;  1DE1 A;  1MD4 A;  1R4W A;  2E2M A;  1GTA A;  6GSX A;  4K0G A;  1ZOF A;  3IHQ A;  3KZQ A;  2V6O A;  3GKN A;  2B7J A;  1WMJ A;  5KEJ A;  3QPM A;  2LQQ A;  3UBK A;  1DBY A;  3JCM L;  5IIZ A;  1S3C A;  2FWH A;  2X8H A;  2YV9 A;  1OKD A;  4HS1 A;  2FA8 A;  1X5E A;  2IL3 A;  2IMI A;  5EVO A;  4Q5N A;  3FRC A;  2AAW A;  3HKR A;  3HYP A;  1FVK A;  3D5J A;  4HEA 2;  2X8G A;  3TDG A;  3IBH A;  1FB6 A;  4EUY A;  3CYN A;  4I5Q A;  1UC7 A;  2FLS A;  1U3I A;  4O5R A;  4ICY A;  1GSE A;  2DJ0 A;  2YCD A;  1FW1 A;  3CBU A;  1Z7R A;  3GTU B;  4DVC A;  4KND A;  4KX4 A;  5IMZ A;  3MYD A;  3F9U A;  1U88 A;  1WPI A;  4CHS A;  2VOC A;  2H70 A;  3L0H A;  4TR1 B;  5G5E A;  3KJY A;  1GSQ A;  2J23 A;  2HZE A;  3EU3 A;  2L4C A;  4L8E A;  3O76 A;  2XC2 A;  1B4P A;  5DJM A;  3ZLP A;  5G2Z A;  1SYR A;  2PMT A;  4TOP A;  3GX0 A;  4K2D A;  3GA4 A;  1WP0 A;  2IWT A;  5B6N A;  2V1M A;  3ZIV A;  1CQH A;  3ERG A;  1ST9 A;  1B9X C;  3ZFB A;  1K0N A;  1EV9 A;  3D0Z A;  3NIV A;  1GTB A;  4MA9 A;  3EVI A;  2FUG 2;  2OAD A;  3US3 A;  3BCK A;  2I81 A;  3QOU A;  1UA5 A;  4O5U A;  1YDK A;  3DIE A;  4BVY A;  3IA1 A;  4POM A;  1XWC A;  4MP4 A;  2YZH A;  10GS A;  3IK7 A;  2XBI A;  4YQM A;  5KN1 A;  3KXO A;  2JAC A;  1H75 A;  3TUE A;  2VO4 A;  1LJR A;  3DWV A;  1RQM A;  3CRT A;  2QKE A;  2RLI A;  1F6M C;  1QGV A;  3WGX A;  5HFK A;  3KTB A;  3RHB A;  4NXI A;  3IC8 A;  4KUN A;  3L9S A;  4G10 A;  4MPG A;  2I1U A;  1T3B A;  3W6G A;  2I4A A;  1GSD A;  4POB A;  4YAP A;  2A4V A;  3FYG A;  5KOW A;  3TKS A;  1W4V A;  3EIN A;  1F9M A;  3TJJ A;  5AN1 A;  2B6M A;  3P8W A;  4CY6 A;  5J9B A;  1ERU A;  4LMW A;  2TIR A;  5AIS A;  2WCI A;  1O81 A;  4MK3 A;  3WGD A;  1Z9H A;  1V40 A;  1A2L A;  2VL3 A;  4ZB8 A;  4MF6 A;  1SK2 A;  3TOT A;  5DCH A;  2OJL A;  2FHE A;  5C00 A;  3HXS A;  4ZL9 A;  2LNT A;  5HR1 A;  3TKS C;  2WUL A;  4L0W A;  2C0E A;  3MSZ A;  3ISO A;  2YJH A;  2GZY A;  4Q5F A;  3BCI A;  4DSS A;  1T4Y A;  2V6K A;  1FO5 A;  4GQF A;  3VPT A;  4ECJ A;  1VF3 A;  1XWG A;  2KOK A;  20GS A;  1G7O A;  3P2A A;  3VI5 A;  4POL A;  3KEB A;  2HSH A;  2PGT A;  5GSS A;  1K0D A;  1Y25 A;  2PN8 A;  1TK8 B;  4IP6 A;  1JHB A;  1SK1 A;  3FW2 A;  3TKR A;  4KSM A;  4N11 A;  1OC8 A;  3U6V A;  3QCP A;  5IO0 A;  3CSI A;  3TJF A;  3QAG A;  4GRF A;  5DQY A;  3DXB A;  2HRN A;  4TXV A;  4E8H A;  4K0N A;  3IV4 A;  4MCU A;  1AQX A;  5CNW A;  1UN2 A;  1O85 A;  3ZVJ D;  1DUG A;  1E6B A;  3F6D A;  3ZVJ A;  1O8W A;  5DAK A;  4ZXG A;  4HJM A;  3MWH A;  2LV3 A;  3FR6 A;  3QR6 A;  1QMV A;  1TRU A;  3GL3 A;  1GTI A;  11GS A;  5B8B A;  5A4V A;  2YNX A;  5ECP B;  3K8N A;  3F3R A;  4L5O A;  1DE2 A;  5G1K A;  3HY2 A;  1TXX A;  3H8Q A;  3G9B A;  3PR8 A;  2PPT A;  3W8J A;  3ZTL A;  2DSA A;  1E2Y A;  3ZL5 A;  4GTU A;  6GST A;  3ZMK A;  2GDR A;  3C1S A;  2FWG A;  3IRA A;  2H74 A;  1DSB A;  3H4K A;  4JR4 A;  1EP7 A;  2NPB A;  2B5X A;  2JU5 A;  1ZGN A;  2K8V A;  3IC4 A;  4KA0 A;  3EC3 A;  4GXZ A;  1PL1 A;  1MDJ A;  3FZ9 A;  1A24 A;  1M0U A;  3VWV A;  17GS A;  1NHO A;  3LYK A;  3WT1 A;  3CSH A;  1SL0 B;  2EIO A;  4FIW A;  1PN0 A;  3QAW A;  4XS6 A;  1G7E A;  3IK9 A;  5AIV A;  3DKS A;  2KP1 A;  3GHA A;  1TP9 A;  4HU9 A;  4MH2 A;  2HZE B;  3BD2 A;  4G9H A;  4HUA A;  1GSS A;  4FO5 A;  1TI3 A;  4CW9 A;  4TRX A;  3KTL A;  12GS A;  5HR2 A;  1XVQ A;  3HCZ A;  1B48 A;  3EMP A;  5ID2 A;  1FB0 A;  1OC9 B;  4XRA A;  2EIR A;  1NHY A;  1OAZ A;  3UEM A;  4DSR A;  4CY8 A;  5CRH A;  3UL3 A;  4IQA A;  2C3Q A;  3TRQ A;  4RQX A;  2OE1 A;  3EE2 A;  4V2M A;  2KLX A;  1GL8 A;  1CQG A;  1N2A A;  3H1N A;  2C0G A;  4WXT A;  2DJK A;  3F8U A;  3EYT A;  1M7T A;  5D9W A;  3LG6 A;  2VD1 A;  2YAN A;  1NW2 A;  3N5O A;  3FKF A;  4KDX A;  3Q19 A;  1AIU A;  2P31 A;  1O6J A;  2GSS A;  2LNS A;  1KEB A;  4HQZ A;  3H93 A;  4X4J A;  2WS2 A;  1ILO A;  1SD8 A;  4HU7 A;  1AC1 A;  2DBC A;  5ELG A;  2VCV A;  5J41 A;  4MMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...