2K8SA

Solution nmr structure of dimeric thioredoxin-like protein ne0084 from nitrosomonas europea: northeast structural genomics target net6
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
80
structure length
80
Chain Sequence
VASKAIFYHAGCPVCVSAEQAVANAIDPSKYTVEIVHLGTDKARIAEAEKAGVKSVPALVIDGAAFHINFGAGIDDLKGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin
publication title Solution NMR structure of dimeric thioredoxin-like protein NE0084 from Nitrosomonas europea: Northeast Structural Genomics Target NeT6
rcsb
source organism Nitrosomonas europaea
total genus 18
structure length 80
sequence length 80
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13192 Thioredoxin_3 Thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2k8sA00
3KH9A 3LGCA 2HI7A 6GSWA 2LEGA 3GH6A 3TCOA 2WFCA 1NW2A 1K0DA 5D9XA 1IYIA 3GNJA 1QQ2A 4HEA2 3VPTA 4XS6A 3FZAA 1K3OA 1Z6MA 2H71A 2YWIA 1N2AA 4IHUA 3QPMA 2H1BA 2H6ZA 2MYGA 1DE2A 3BJ5A 5ENUA 4WXTA 2YANA 3TKSC 1UC7A 1OC8A 4OFNA 3FEUA 1USBA 1F37A 3LXZA 1F3AA 2P5QA 2OACA 4TXOB 4G10A 4F03A 2B3SA 2LJKA 2R3XA 2EIQA 3TKQA 5INYA 2F8FA 3F8UA 5DQSA 5J9CA 4D73A 2TRCP 1EV9A 3LQ7A 5D9WA 2HRFA 2IWTA 4WF4A 3M0FA 2KLXA 1TOFA 3ERGA 1X5DA 4OO5A 4F0BA 2HZFA 3G7IA 2DMLA 1K0OA 2O7KA 3HVVA 2VM2A 5DCHA 3F9UA 4AGSA 1YQ1A 1V57A 2VCZA 2VLTA 3TOTA 3GTUB 1A0FA 3HXSA 1Z5YE 2H66A 3IV4A 1GL8A 3GUSA 2GGTA 2LTKA 3GL3A 2GS3A 2P5RA 2VCXA 4IW9A 3J7Yk 1WPIA 3FHKA 3LYKA 1GWCA 4KGIA 5IQYA 3TJJA 4F0CA 2IL3A 2J9HA 2H19A 2H1DA 2K8SA 1BG5A 4GF0A 2XPEA 2WZ9A 3TRQA 4GSSA 4ZL8A 2L5OA 1OKDA 5B6NA 2C0DA 3DVXA 4MH2A 3QFBC 4NHWA 4GSNA 3Q19A 1EWXA 2NDOA 4WETA 1RK4A 3PGTA 2R4VA 1PKZA 4MF7A 3KP8A 5F06A 3ZL5A 2ON5A 1OKTA 1O6JA 4X1UA 2CAQA 2FA4A 4YAPA 3LJRA 1TRSA 1HQOA 3VFIA 2R5GA 4EF0A 5A4UA 1FG4A 5IO2A 2OJLA 5KEJA 2KUCA 5IMZA 3GA4A 3M3MA 4WR5A 3F4RA 1TDIA 1O8WA 2VO4A 3VWUA 2FA8A 1EEJA 3F4SA 2H1AA 3MNGA 4IJIA 5L71A 4MABA 4CHSA 1GLPA 1MDIA 2NVLA 1HNCA 2LNTA 4EO3A 2LSTA 3F4TA 1GUMA 2O89A 4PX1A 4I6XA 3WGEA 2I1UA 3D21A 1X5EA 2XBIA 19GSA 5DDLA 3TKSA 1U3AA 3FY7A 4K9ZA 2A2RA 3OR5A 3TJBA 1ZOFA 3APSA 5J3RA 1SK2A 1OC3A 3CTGA 4IQAA 5ECIB 3HZ8A 3F0IA 1ZCPA 3HJPA 2ON7A 4IVFA 4ZB9A 1XOBA 1X5CA 2OE0A 3DXBA 22GSA 3ZYWA 2DLXA 4POMA 4KSMA 1W4VA 2BJXA 4TR1B 1R4WA 2R37A 3I69A 4HUAA 1SD8A 3UVHA 5EVOA 4FYUA 3NOFA 3UMAA 2A4VA 3UBLA 1XFLA 5AISA 2DSAA 3L0HA 4I8BA 3L9UA 4GWRA 1AQXA 1JLWA 2RM5A 1GTUA 4EKZA 5G5FA 2FNOA 4OD7A 5C00A 3GMFA 1GP1A 1Y25A 1XW6A 3EU4A 2C80A 4MZWA 5IPHA 3C1SA 1TU7A 1G0TA 3GIXA 4IN0A 1EP7A 3EE2A 3IXRA 1G6YA 2TRXA 3FRCA 3GHAA 1O85A 1TK0B 4K6XA 4KSOA 4KX4A 1U3IA 2F8AA 2VL3A 2LQQA 5GZZB 1VRSD 4JU5A 4HS1A 2WCIA 1ON4A 3GKXA 1GTIA 1T3BA 3C7MA 5G31A 1AUCA 6GSUA 2PERA 3TKRA 1M99A 2HNLA 1KBNA 2XC2A 4MCUA 3KP9A 3HVSA 3A3TA 4ZXGA 4HU7A 4IJ3A 4AJ6A 4LA1A 1TK8B 2YP6A 2I81A 4PUFC 5HFGA 5D93A 1Z9HA 2H76A 5JWOB 3CYNA 4ML1A 1X9WB 4O7HA 2R6KA 1O73A 3HDCA 5KN0A 4IKHA 2B5EA 4G2EA 1MD4A 1B48A 3H4KA 4K7IA 4NAXA 5IM9A 4MF6A 4RQXA 2H6YA 2H1GA 4RI7A 4G9HA 3RPPA 4KUNA 5A4VA 1AXDA 3Q74A 2OKAA 4FIWA 1SKRB 3GFKA 4QL9A 1BEDA 4TKYA 1A23A 5IOWA 5CYYA 2CZ3A 4HU9A 1YY7A 1T00A 3CRUA 5ID2A 4L5OA 3JCML 3GX0A 2GSTA 4J2FA 1YKCA 4OCFA 3HY2A 2HFDA 5IMAA 1T8EB 3ISOA 4F9ZA 2E2MA 2PWJA 5COHA 3HVXA 1F9MA 4XIHA 1ZYQB 4MZBA 3BCIA 1PN9A 4PXOA 1Y6EA 1TI1A 3EYTA 3FZ9A 1PL1A 2B6MA 3FR9A 5ECNB 1TKDB 2FY6A 3W8JA 1XXUA 3Q6OA 4KDXA 2HT9A 5F8BA 4P3YB 4ECJA 1SL0B 4HQZA 4N11A 3W8SA 1NSWA 3N9JA 3H79A 4HZ2A 3TB2A 1I5GA 1B4QA 1QXHA 4I2TA 1FVKA 1YDKA 4L8EA 2GDRA 2F3MA 3A2WA 4OMVA 3KTBA 2PUKC 1ML6A 2G0FA 1EOGA 2C0GA 1K3YA 2PPTA 1K0BA 2MMZA 1SK0A 5HQPA 4AF2A 2KOKA 3DRNA 4GCIA 1MDKA 5D9VA 2DIYA 3FKFA 3ME8A 1GSYA 2H74A 2A2SA 3VWVA 1Q4JA 2V6KA 3RBTA 3L78A 1ZZYA 5A4WA 3L9SA 2VCWA 3EMXA 4E8HA 3IDVA 5DAKB 1S3AA 3VURA 1TK5B 1EP8A 5D73A 2X99A 9GSSA 4K0NA 4MF5A 1SK1A 2RLIA 1PX6A 1GTBA 1NHYA 1XWCA 1B4PA 1OC9A 2YV7A 4BL7A 2X64A 1FO5A 2C3QA 1V9WA 3FK8A 2JZRA 4JRRA 4OFMA 3M9KA 3IE3A 4EDYA 3GSTA 4DVCA 10GSA 2VCTA 1YF1A 3TGZA 2GQKA 1TJDA 1JHBA 3HCZA 1MEKA 4MDCA 3DMLA 1ERWA 4V2LA 3ERWA 4ZILA 2LUSA 2PGTA 4ML6A 1GTAA 1FB0A 1CQHA 3APOA 4XRAA 4PQIA 2LV3A 3GRXA 2B7JA 1PRXA 5F0GA 3PINA 1WRYA 3TJGA 2CX3A 2ZCTA 4DSSB 4MK3A 1SENA 4Q5RA 2IFQB 3SBCA 5ECKB 1M2DA 4ULXA 1WJKA 2PU9C 5C04A 1FVJA 2V1MA 2N5FA 2YWMA 1AQWA 1BX9A 2IMIA 2C8UA 2LRCA 1PMTA 4V2NA 3GYKA 2M46A 1F2EA 1Z7RA 2JSZA 1O7UA 2DJ3A 2YJHA 1U88A 2D2ZA 1ILOA 1T4ZA 3H93A 4L5LA 2IN3A 4O32A 5ECOB 4DSQA 4JR6A 3K8NA 4XS4B 1ZL9A 4POKA 4PGTA 1TRWA 5JWRB 4ZL9A 3QFAC 2IJYA 5IMFA 16GSA 2VCVA 3QAGA 4KDYA 4N0ZA 3ZIVA 3CSHA 3IAM2 4PQ1A 3S9FA 4X0XA 4F2IA 2OBKA 5D9TA 2WB9A 2OE3A 1LU4A 2I3YA 2OBIA 3UBKA 2FCHA 1YJ6A 3I9V2 3BD2A 4ECCA 1B9XC 2HXKA 4PNFA 2HSYA 3LFLA 3DEXA 2E0QA 3VK9A 4NPBA 2GVPA 3ZMLA 3FZ4A 4NXIA 5DJLA 4PQHA 4EDZA 1M0UA 1XPVA 4GXZA 4KCEA 5LD0A 5F05A 4KAEA 4MJAA 1G6WA 2CX4A 2H0IA 1PSQA 4RQRA 5AIVA 3F6FA 2H6XA 3GSSA 4FH8A 3C71A 3F3RA 2G2QA 4V1Ap 5HR2A 3APQA 3WGXA 2FWGA 5CP1A 4LMVA 1XWGA 4WBJA 2ZNMA 2CVDA 1XW5A 3UARA 2LJRA 3L4NA 5G2ZA 3V1WA 2YOIA 2AYTA 3CBUA 3EURA 4JZQA 2HZEB 2ALBA 3HHVA 2YZUA 1GLQA 2B1KA 2JADA 3VPQA 3FR6A 2CAIA 1FHEA 1WE0A 1Q98A 5DALA 4K2DA 2YJ7A 5B8AA 1AC1A 4EXJA 3H1NA 1O8XA 3DIEA 2NPBA 2K6VA 4MPGA 4CW9A 4NWYA 1T1VA 4HI7A 2H75A 1XOAA 2LKUA 4MP4A 4X43A 4NMUA 5ECQB 2AV4A 1A2MA 14GSA 1LJRA 2LNSA 5IIZA 1S3CA 1VF3A 1XWAA 4EUYA 1SJZA 4HDEA 2ES7A 1X0RA 2F51A 1A0RP 1HNAA 1UA5A 5G5EA 2DJ1A 1GSQA 4KNDA 4MLYA 3HZ4A 2V32A 3KZQA 2FGXA 5CRGA 12GSA 1FW1A 3ZTLA 1K0MA 2RIIA 4TXVA 4XTSA 1SL1B 5ECMB 4DEJA 5A5KA 4FYCA 3IAS2 4K0GA 4XHMA 1UVZA 3QAVA 1ERUA 5HR3A 1TRUA 1SKWB 3RPNA 3HJOA 1ERTA 1A2LA 3E9JB 3FYGA 5EY6A 2HSHA 1XZOA 2H8LA 2QGVA 3DKSA 4XRDA 3KM6A 3TDGA 4TXOA 5ECLB 5ECPB 2OA7A 3I6AA 3SWLA 2K8VA 5ECRB 3IOSA 2XPDA 4ZIJA 4TR4A 3DYRA 3CMIA 2L5LA 3G7YA 2C4JA 2JZSA 4MZCA 3C8EA 5CRHA 4N10A 3UOMA 4EVMA 1J9BA 1SD9A 2CVKA 2K18A 2H72A 5J41A 1B9YC 3E0UA 5JWQB 1GRXA 1M2BA 1H75A 2FWEA 2X8HA 3HA9A 5D8IA 3MDKA 2IPAA 3DVWA 4OWYA 6GSTA 2DJJA 2X8GA 4BVXA 1FAAA 1BQ7A 4D73B 2B1LA 1QMVA 2EC4A 3GTUA 1SJ6A 3UVTA 2FLSA 2GLRA 4MJEA 2JSYA 3TUEA 4GTUA 1AIUA 1SL2B 3KIJA 4ZB6A 13GSA 2HLSA 3N5OA 2F9SA 4IGJA 5GAND 3LSZA 3R2QA 2YCDA 3GN3A 3P7XA 5IMDA 3DD3A 2PVOC 2LRTA 2E2GA 3EVIA 2L6CA 2MBTA 5KN1A 1UN2A 5DJMA 5HR1A 1TRVA 2GTUA 2REMA 1V40A 4TN8A 3P2AA 1PA3A 2H0HA 5EPFA 2M80A 1QGVA 1FOVA 2JU5A 4EL1A 3ZVJA 3IBHA 2QC7A 2V2GA 4OCEA 3EC3A 1OAZA 2BTOT 2DJ0A 2OE1A 4AJ8A 1M9BA 5LNKe 3ZZXA 4JE1A 1ACVA 3CRTA 3QR6A 4HQSA 3BBYA 1TU8A 3ZIJA 4TRXA 4BPYA 2MMAA 1E6BA 2C0FA 2H01A 4BVYA 1TI3A 3WT1A 5D96A 1GUHA 1PL2A 3WT2A 2GT5A 3D22A 3BOAA 2VD1A 2PN8A 2JL4A 1HYUA 2DJ2A 5DCGA 2E7PA 4H86A 1ABAA 3ZFLA 3M1GA 4RI6A 2O8VB 2FWFA 1GUKA 2P0GA 2IIYA 2B7KA 4KA0A 1GSUA 5FHIA 1PGTA 2Z9SA 1V98A 1G7EA 3CTFA 2LS5A 3MSZA 5ECSA 2PBJA 3BCKA 3D4MA 5EL8A 3LXTA 3IHQA 1NHOA 2WJUA 4O5RA 1YZXA 2VAFA 4FYBA 3J7Yb 4K1FA 3IK9A 4IBPA 11GSA 5GAPD 2DBCA 1M7TA 4CDOA 1GSDA 2GT6A 1MTCA 1VF4A 4IQ1A 3C73A 4KDUA 3O6TA 1XVQA 1WWJA 3O3TA 4TR1A 3UEMA 4WF5A 2L4QA 5LCZA 1PD21 4POLA 5KN3A 1V2AA 1R7HA 4IELA 4IP6A 1U6TA 1WOUA 3U6VA 3ZMKA 1A24A 1JZRA 2HYXA 1AAZA 4N0VA 3QDNA 1YF0A 3ZVJD 3VWWA 5B8BA 3LYPA 3M9JA 3QD9A 1HNBA 1THOA 2VCQA 5IPGA 4ZB8A 3TRPA 5CRDA 3KEBA 2FUG2 3WGDA 1W89A 3MAKA 1YEXA 4XCSA 1QFNA 1OE8A 3F3QA 3A2VA 3TKPA 4TW5A 3GV1A 4MJCA 4NV5A 4K7NA 1DSBA 3A5WA 2CV4A 1J0FA 1JZDA 1JFUA 4BA7A 3H8QA 1DBYA 2DMMA 1AQVA 2IMEA 4AJ7A 1F3BA 2K9FA 3VI7A 4JR4A 4HJ2A 1A2JA 3D6IA 3KGKA 1T7PB 1QUWA 3NZNA 1DUGA 3US3A 1PX7A 1SJIA 3VLNA 3GURA 1GNWA 4G19A 3QOUA 3LWAA 2QKEA 4ID0A 1BJXA 5DQYA 1WIKA 1DE1A 2YWNA 5CNWA 4ZBDA 2AAWA 2MMOA 2I9HA 2YZHA 2AHEA 5FWGA 1XWKA 3VI5A 5ELAA 2YPMA 1A8LA 4YAVA 3TRXA 2VIMA 1XIYA 4O92A 6GSSA 1O81A 1RQMA 1S3DA 1B8XA 1Z6NA 4LLRA 2V6OA 2VLVA 4IP1A 2PMTA 4ISDA 2ZUPA 1MD3A 2VOCA 4EC0A 4Q5FA 3P90A 5G1KA 1ZYEA 5FT3A 4YQMA 3KMOA 5J9BA 3PH9A 1ST9A 4GSTA 5CRWA 2LQOA 1WP0A 1VF1A 5E4WA 3GKKA 2N5BA 3UAPA 2IMDA 3D5JA 1A8YA 3TKSE 5ID2B 3GX8A 3DGQA 4NHZA 2CVBA 4ECIA 2AJQB 3ED3A 1URMA 3KTLA 3TJKA 1SYRA 4KH7A 2GSQA 3KJYA 2NBSA 5E59A 3E3EA 2AUVA 3EU3A 4L0UA 1K0AA 1F6MC 4GLTA 4DSRA 3RHCA 5B7CA 3VWXA 3UJ1A 3A2XA 1YEPA 2YWOA 3P8WA 1SYXA 2KP2A 5IMVA 1GNEA 2HE3A 3KH7A 2B5YA 3KCMA 4QQ7A 1Z7PA 1J08A 2GSRA 1BAYA 1K0NA 3UL3A 1KNGA 1TTZA 3DWVA 3F6DA 2IMFA 2R2JA 2I4AA 2CT6A 5IOXA 2L59A 1K3LA 3U5RE 4K8MA 3NIVA 4MJBA 4BWSA 3CXGA 17GSA 3Q18A 5DAKA 3QCPA 2FWHA 3LORA 2O87A 2M72A 1EOHA 3RDWA 2H30A 4PURA 4ZL7A 2VL9A 4K7OA 4MMMA 1TW9A 3LG6A 4PUAA 3RHBA 3HYPA 3MWHA 3AY8A 5AGYA 1JZOA 2GQLA 2CZ2A 2YNXA 3W6GA 4KB3A 5HFKA 5ECHB 4NV2A 5ABRA 2X8CA 4ILFA 4LMWA 4EE0A 2LRNA 1XBSA 5JCUA 5HR0A 2VL2C 2AB6A 2C1YA 2J23A 1OC9B 3UIWA 2YN1A 2QSIA 5JCGA 4PNGA 3FZ5A 1BYEA 2YV9A 4OFTA 4Q5QA 4YH2A 4FO5A 3HKRA 1THXA 1ZMAA 2KHPA 1SKSB 1GULA 5CAXA 4N30A 2GZZA 7GSSA 5H5QA 3ME7A 2MMNA 2RUFA 1EV4A 1E2YA 5IO0A 5H5SA 3ZREA 1OYJA 2P31A 4DSSA 2V41A 5H5RA 4OO4A 2IFQA 3F63A 20GSA 4RUVA 4JEDA 5IMCA 2KP1A 6GSXA 3O76A 5HFIA 1H4OA 3KMNA 2DC5A 4HZ4A 1PQNA 2CA8A 5KN2A 5GSSA 1M9AA 4MA9A 1C72A 2GQMA 3WD6A 1LBKA 2FD3A 2EIRA 1R26A 3IA1A 3CSJA 4L0WA 3IRAA 3QMXA 2RM6A 2RUEA 4XS4A 2CQ9A 1AW9A 2C0EA 3WYWA 3KD0A 4E8EA 1M2AA 3GL5A 4IS0A 4I97A 4HOJA 6GSVA 1X9SB 3CSIA 1GH2A 1R5AA 2EIOA 2B5XA 1V58A 18GSA 5JCWA 4MPFA 1IYHA 2MZCA 1PKWA 1G7OA 1MDJA 4ECBA 1SU9A 4KCAA 1EGOA 1JZWA 4LL4B 3G7JA 4TR0A 1VF2A 4YQVA 5B6MA 2MBSA 2IMKA 2PVQA 4KE3A 4YQUA 2LJAA 3D4TA 3TOUA 1NM3A 2FHEA 3LEFA 4ACSA 4XS1A 4WR4A 3IC4A 2DIZA 4JBBA 4J57E 3HJMA 2GZPA 5AIXA 3ZITA 3IR4A 4TOPA 1KEBA 1WMJA 2H73A 5DBQA 3D0ZA 4J56E 3QAWA 1HD2A 1YKAA 3GH9A 1R5PA 2OADA 2H0GA 3EMPA 3EWLA 1CQGA 4GRFA 1KTEA 1TXXA 2O85A 1RW1A 2VL2A 1EEMA 5CO3A 2HRNA 2L57A 4ZBAA 2C3NA 2JACA 3ZFBA 1EGRA 4V2MA 1I9DA 2L6DA 1TP9A 4GQCA 5F07A 5G30A 2HZEA 3IK7A 6GSYA 1K0CA 4WEYA 5J4UA 1XW9A 1GSFA 1ERVA 2VUPA 5DVBA 2VLUA 4POBA 5J5NA 4V1Ag 5ELGA 4WKWA 2TIRA 3GKMA 3PR8A 1X9MB 5AN1A 1Z3EA 4I5QA 3RAZA 5CREA 1GSSA 2L4CA 3FR3A 3EINA 1FB6A 2JZTA 2VM1A 4TVEA 1OE7A 2VD0A 2WULA 1T4YA 2XHFA 3ERFA 4HJMA 4Q5NA 3HD5A 2GZYA 3L9VA 1QK8A 2WGRA 3ZRDA 5DALB 1XVWA 1XWBA 2BMXA 2WDUA 4F82A 1XCCA 4LL1B 4GQFA 2DJKA 2C3TA 2NTOA 1EZKA 4TR3A 5G1LA 8GSSA 3ZLPA 2GSSA 2WRTA 4BWQA 4WBRD 3KXOA 4QL7A 3C1RA 4ZBBA 3G9BA 4KW6A 1OVNA 1U87A 4Z7XA 3I43A 3IPZA 3FW2A 2H70A 5GSTA 1ZGNA 1VGLA 2WS2A 3M8NA 1JLVA 3TJFA 1N8JA 1GSEA 3GKNA 2N5AA 4I2UA 4MH3A 2XBQA
chains in the Genus database with same CATH superfamily
4G0LA 3KH9A 3LGCA 2HI7A 6GSWA 5BRTA 2LEGA 3GH6A 3TCOA 2WFCA 1NW2A 1K0DA 5D9XA 1IYIA 3GNJA 1QQ2A 4HEA2 3VPTA 4XS6A 3FZAA 1K3OA 1Z6MA 2H71A 2YWIA 1N2AA 4IHUA 3QPMA 2H1BA 2H6ZA 2MYGA 1DE2A 3BJ5A 5ENUA 4WXTA 2YANA 3TKSC 1UC7A 1OC8A 4OFNA 3FEUA 1USBA 1F37A 3LXZA 1F3AA 2P5QA 2OACA 4TXOB 4G10A 4F03A 2B3SA 2LJKA 2R3XA 2EIQA 3TKQA 5INYA 2F8FA 3F8UA 5DQSA 5J9CA 4D73A 2TRCP 1EV9A 3LQ7A 5D9WA 2HRFA 2IWTA 4WF4A 3M0FA 2KLXA 1TOFA 3ERGA 1X5DA 4OO5A 4F0BA 2HZFA 3G7IA 2DMLA 1K0OA 2O7KA 3HVVA 2VM2A 5DCHA 3F9UA 4AGSA 1YQ1A 4BVXB 1V57A 2VCZA 2VLTA 3TOTA 3GTUB 1A0FA 3HXSA 1Z5YE 2H66A 3IV4A 1GL8A 3GUSA 2GGTA 2LTKA 3GL3A 2GS3A 2P5RA 2VCXA 4IW9A 3J7Yk 1WPIA 3FHKA 3LYKA 1GWCA 4KGIA 5IQYA 3TJJA 4F0CA 2IL3A 2J9HA 2H19A 2H1DA 2K8SA 1BG5A 4GF0A 2XPEA 2WZ9A 3TRQA 4GSSA 4ZL8A 2L5OA 1OKDA 5B6NA 2C0DA 3DVXA 2QA1A 4MH2A 3QFBC 4NHWA 4GSNA 3Q19A 1EWXA 2NDOA 4WETA 1RK4A 3PGTA 2R4VA 1PKZA 4MF7A 3KP8A 5F06A 3ZL5A 2ON5A 1OKTA 1O6JA 4X1UA 2CAQA 2FA4A 4YAPA 3LJRA 1TRSA 1HQOA 3VFIA 2R5GA 4EF0A 5A4UA 1FG4A 5IO2A 2OJLA 5KEJA 2KUCA 5IMZA 3GA4A 3M3MA 4WR5A 1ZYPA 3F4RA 1TDIA 1O8WA 2VO4A 3VWUA 4BVYB 2FA8A 1EEJA 3F4SA 2H1AA 3MNGA 4IJIA 5L71A 4MABA 4CHSA 1GLPA 1MDIA 2NVLA 1HNCA 2LNTA 4EO3A 2LSTA 3F4TA 1GUMA 2O89A 4PX1A 4I6XA 3WGEA 2I1UA 3D21A 1X5EA 2XBIA 19GSA 5DDLA 3TKSA 1U3AA 3FY7A 4K9ZA 2A2RA 3OR5A 3TJBA 1ZOFA 3APSA 5J3RA 1SK2A 1OC3A 3CTGA 4IQAA 5ECIB 3HZ8A 3F0IA 1ZCPA 3HJPA 2ON7A 4IVFA 4ZB9A 1XOBA 1X5CA 2OE0A 3DXBA 22GSA 3ZYWA 2DLXA 4POMA 4KSMA 1W4VA 2BJXA 4TR1B 1R4WA 2R37A 3I69A 4HUAA 1SD8A 3UVHA 5EVOA 4FYUA 3NOFA 3UMAA 2A4VA 3UBLA 1XFLA 5AISA 2DSAA 3L0HA 4I8BA 3L9UA 4GWRA 1AQXA 1JLWA 2RM5A 1GTUA 4EKZA 5G5FA 2FNOA 4OD7A 5C00A 3GMFA 1GP1A 1Y25A 1XW6A 3EU4A 2C80A 4MZWA 5IPHA 3C1SA 1TU7A 1G0TA 3GIXA 4IN0A 1EP7A 3EE2A 3IXRA 1G6YA 2TRXA 3FRCA 3GHAA 1O85A 1TK0B 4K6XA 4KSOA 4KX4A 1U3IA 2F8AA 2VL3A 2LQQA 5GZZB 1VRSD 4JU5A 4HS1A 2WCIA 1ON4A 3GKXA 1GTIA 1T3BA 3C7MA 5G31A 1AUCA 6GSUA 2PERA 3TKRA 1M99A 2HNLA 1KBNA 2XC2A 3MYDA 4MCUA 3KP9A 3HVSA 3A3TA 4ZXGA 4HU7A 4IJ3A 4AJ6A 4LA1A 1TK8B 2YP6A 2I81A 4PUFC 5HFGA 5D93A 1Z9HA 2H76A 5JWOB 3CYNA 4ML1A 1X9WB 4O7HA 2R6KA 1O73A 2R0CA 3HDCA 5KN0A 4IKHA 2B5EA 4G2EA 1MD4A 1B48A 3H4KA 4K7IA 4NAXA 5IM9A 4MF6A 4RQXA 2H6YA 2H1GA 4RI7A 4G9HA 3RPPA 4KUNA 5A4VA 1AXDA 3Q74A 2OKAA 4FIWA 1SKRB 3GFKA 4QL9A 1BEDA 4TKYA 1A23A 5IOWA 5CYYA 2CZ3A 4HU9A 1YY7A 1T00A 3CRUA 5ID2A 4L5OA 3JCML 3GX0A 2GSTA 4J2FA 1YKCA 4OCFA 3HY2A 2HFDA 5IMAA 1T8EB 3ISOA 4F9ZA 2E2MA 2PWJA 5COHA 3HVXA 1F9MA 3IHGA 4XIHA 1ZYQB 4MZBA 3BCIA 1PN9A 4PXOA 1Y6EA 1M3JA 1TI1A 3EYTA 3FZ9A 1PL1A 2B6MA 3FR9A 5ECNB 1TKDB 2FY6A 3W8JA 1XXUA 3Q6OA 4KDXA 2HT9A 5F8BA 4P3YB 4ECJA 1SL0B 4HQZA 4N11A 3W8SA 1NSWA 3N9JA 3H79A 4HZ2A 3TB2A 1I5GA 1B4QA 1QXHA 4I2TA 1FVKA 1YDKA 4HSCX 4L8EA 2GDRA 2F3MA 3A2WA 4OMVA 3KTBA 2PUKC 1ML6A 2G0FA 1EOGA 2C0GA 1K3YA 2PPTA 1K0BA 2MMZA 1SK0A 5HQPA 4AF2A 2KOKA 1S3RA 3DRNA 4GCIA 1MDKA 5D9VA 2DIYA 3FKFA 3ME8A 1GSYA 2H74A 2A2SA 3VWVA 1Q4JA 2V6KA 3RBTA 3L78A 1ZZYA 5A4WA 3L9SA 4USSA 2VCWA 3EMXA 4E8HA 3IDVA 5DAKB 1S3AA 3VURA 1TK5B 1EP8A 2X99A 5D73A 9GSSA 4K0NA 4MF5A 1SK1A 2RLIA 2HRKA 1PX6A 1GTBA 1NHYA 1XWCA 1B4PA 1OC9A 2YV7A 4BL7A 2X64A 1FO5A 2C3QA 1V9WA 3FK8A 2JZRA 4JRRA 4OFMA 3M9KA 3IE3A 4EDYA 3GSTA 4DVCA 10GSA 2VCTA 1YF1A 3TGZA 2GQKA 1TJDA 1JHBA 2A2PA 3HCZA 1MEKA 4MDCA 3DMLA 1ERWA 4V2LA 3ERWA 4ZILA 2LUSA 2PGTA 4ML6A 1GTAA 1FB0A 1CQHA 3APOA 4XRAA 4PQIA 2LV3A 3GRXA 2B7JA 1PRXA 5F0GA 3PINA 1WRYA 3TJGA 2CX3A 2ZCTA 3A5IA 4DSSB 4MK3A 1SENA 4Q5RA 2IFQB 3SBCA 5ECKB 1M2DA 4ULXA 1WJKA 2PU9C 4K2XA 5C04A 1FVJA 2V1MA 2N5FA 2YWMA 1AQWA 1BX9A 2IMIA 2C8UA 2LRCA 1PMTA 4V2NA 3GYKA 2M46A 1F2EA 2UZ8A 1Z7RA 2JSZA 1O7UA 2DJ3A 2YJHA 1U88A 2D2ZA 1ILOA 1T4ZA 3H93A 4ICYA 4Z2RA 4L5LA 2IN3A 4O32A 5ECOB 4DSQA 4JR6A 3K8NA 4XS4B 1ZL9A 4POKA 4PGTA 1TRWA 5JWRB 4ZL9A 3QFAC 2IJYA 5IMFA 16GSA 2VCVA 3QAGA 4KDYA 4N0ZA 3ZIVA 3CSHA 3IAM2 4PQ1A 3S9FA 4X0XA 4F2IA 2OBKA 5D9TA 2WB9A 2OE3A 1LU4A 2I3YA 2OBIA 3UBKA 2FCHA 1YJ6A 3I9V2 3BD2A 4ECCA 1B9XC 2HXKA 4PNFA 2HSYA 3LFLA 3DEXA 2E0QA 3VK9A 4NPBA 2GVPA 3ZMLA 3FZ4A 4NXIA 5DJLA 4PQHA 4EDZA 1M0UA 1XPVA 4GXZA 4KCEA 5LD0A 5F05A 4KAEA 4MJAA 1G6WA 2CX4A 1FOHA 2H0IA 1PSQA 4RQRA 5AIVA 3F6FA 2H6XA 3GSSA 4FH8A 3C71A 3F3RA 4YKGA 2G2QA 4V1Ap 5HR2A 3APQA 3WGXA 2FWGA 5CP1A 4LMVA 1XWGA 4WBJA 2ZNMA 2CVDA 1XW5A 3UARA 2LJRA 4K5RA 3L4NA 5G2ZA 3V1WA 2YOIA 2AYTA 3CBUA 3EURA 4JZQA 2HZEB 2ALBA 3HHVA 2YZUA 1GLQA 2B1KA 2JADA 3VPQA 3FR6A 2CAIA 1FHEA 1WE0A 1Q98A 5DALA 4FQUA 4K2DA 2YJ7A 5B8AA 1AC1A 4EXJA 3H1NA 1O8XA 3DIEA 2NPBA 2K6VA 4MPGA 4CW9A 4NWYA 1T1VA 4HI7A 2H75A 1XOAA 2LKUA 4MP4A 4X43A 4NMUA 5ECQB 2AV4A 1A2MA 14GSA 1LJRA 2LNSA 5IIZA 1S3CA 1VF3A 1XWAA 4EUYA 1SJZA 4HDEA 2ES7A 1X0RA 2F51A 1A0RP 1HNAA 1UA5A 5G5EA 2DJ1A 1GSQA 4KNDA 4MLYA 3HZ4A 2V32A 3KZQA 2FGXA 5CRGA 12GSA 1FW1A 3ZTLA 1K0MA 2RIIA 4TXVA 4XTSA 1SL1B 5ECMB 4YKFA 4DEJA 5A5KA 4FYCA 3IAS2 4K0GA 4XHMA 1UVZA 3QAVA 1ERUA 5HR3A 1TRUA 1SKWB 3RPNA 3HJOA 1ERTA 1A2LA 3E9JB 3FYGA 5EY6A 4BIKA 2HSHA 1XZOA 2H8LA 2QGVA 3DKSA 4XRDA 3KM6A 3TDGA 4TXOA 5ECLB 5ECPB 2OA7A 3I6AA 3SWLA 2K8VA 5ECRB 3IOSA 3HVNA 2XPDA 4ZIJA 4TR4A 3DYRA 3CMIA 2L5LA 3G7YA 3R3EA 2C4JA 2JZSA 4MZCA 3C8EA 5CRHA 4N10A 3UOMA 4EVMA 1J9BA 1SD9A 2CVKA 2K18A 2H72A 5J41A 1B9YC 3E0UA 5JWQB 2X49A 1GRXA 1M2BA 1H75A 2FWEA 2X8HA 3HA9A 5D8IA 3MDKA 2IPAA 3DVWA 4OWYA 6GSTA 2DJJA 2X8GA 4BVXA 1FAAA 1BQ7A 4D73B 2B1LA 1QMVA 2EC4A 3GTUA 1SJ6A 3UVTA 2FLSA 2GLRA 4MJEA 2JSYA 3TUEA 4GTUA 4CY6A 1AIUA 1SL2B 3KIJA 4ZB6A 13GSA 2HLSA 3N5OA 2F9SA 4IGJA 5GAND 2QA2A 3LSZA 3R2QA 2YCDA 3GN3A 3P7XA 5IMDA 4G0KA 3DD3A 2PVOC 2LRTA 2E2GA 3EVIA 2L6CA 2MBTA 5KN1A 1UN2A 5DJMA 5HR1A 1TRVA 2GTUA 2REMA 1V40A 4TN8A 3P2AA 1PA3A 2H0HA 5EPFA 2A4HA 2M80A 1QGVA 1FOVA 2JU5A 4EL1A 3ZVJA 3EPTA 3IBHA 2QC7A 2V2GA 4OCEA 3EC3A 1OAZA 2BTOT 2DJ0A 2OE1A 4AJ8A 1M9BA 4K5SA 5LNKe 3ZZXA 4JE1A 1ACVA 3CRTA 3QR6A 4HQSA 3BBYA 3LW9A 1TU8A 3ZIJA 4TRXA 4BPYA 2MMAA 1E6BA 2C0FA 2H01A 4BVYA 1TI3A 3WT1A 5D96A 4Z2TA 1GUHA 1PL2A 3WT2A 2GT5A 3D22A 3BOAA 2VD1A 2PN8A 2JL4A 1HYUA 2DJ2A 5DCGA 2E7PA 4H86A 1ABAA 3ZFLA 3M1GA 4RI6A 2O8VB 2FWFA 1GUKA 2P0GA 2IIYA 2B7KA 4KA0A 1GSUA 5FHIA 1PGTA 2Z9SA 1V98A 1G7EA 3CTFA 2LS5A 3MSZA 5ECSA 2PBJA 3BCKA 3D4MA 5EL8A 3LXTA 3IHQA 1NHOA 2WJUA 4O5RA 1YZXA 2VAFA 4FYBA 3J7Yb 4K1FA 3IK9A 4IBPA 11GSA 5GAPD 2DBCA 1M7TA 4CDOA 1GSDA 2GT6A 1MTCA 1VF4A 4IQ1A 3C73A 4KDUA 3O6TA 1XVQA 1WWJA 3O3TA 4TR1A 3PPUA 3UEMA 4WF5A 2L4QA 5LCZA 1PD21 4POLA 5KN3A 1V2AA 1R7HA 4IELA 4IP6A 4CY8A 1U6TA 1WOUA 3U6VA 3ZMKA 1A24A 1JZRA 2HYXA 1AAZA 4N0VA 3QDNA 1YF0A 3ZVJD 3VWWA 5B8BA 3LYPA 3M9JA 3QD9A 1HNBA 1THOA 2VCQA 5IPGA 4ZB8A 3TRPA 5CRDA 3KEBA 2FUG2 3WGDA 1W89A 3MAKA 1YEXA 4XCSA 1QFNA 1OE8A 3F3QA 3A2VA 3TKPA 4TW5A 4MNNA 3GV1A 4MJCA 4NV5A 4K7NA 1DSBA 3A5WA 2CV4A 1J0FA 1JZDA 1JFUA 4BA7A 3H8QA 1DBYA 2DMMA 1AQVA 2IMEA 4AJ7A 1F3BA 2K9FA 3VI7A 4JR4A 4HJ2A 1A2JA 3D6IA 3KGKA 1T7PB 1QUWA 3NZNA 1DUGA 3US3A 1PX7A 1SJIA 3VLNA 3GURA 1GNWA 4G19A 3QOUA 3LWAA 2QKEA 4ID0A 1BJXA 1M3IA 5DQYA 1WIKA 1DE1A 2YWNA 5CNWA 4ZBDA 2AAWA 2MMOA 2I9HA 2YZHA 2AHEA 5FWGA 1XWKA 3VI5A 5ELAA 2YPMA 1A8LA 4YAVA 3TRXA 2VIMA 1XIYA 4O92A 6GSSA 1O81A 1RQMA 1S3DA 1B8XA 1Z6NA 4LLRA 2V6OA 2VLVA 4IP1A 2PMTA 4ISDA 2ZUPA 1MD3A 2VOCA 4EC0A 4Q5FA 3P90A 5G1KA 1ZYEA 5FT3A 4YQMA 3KMOA 5J9BA 3PH9A 1ST9A 4GSTA 5CRWA 2LQOA 1WP0A 1VF1A 5E4WA 3GKKA 2N5BA 3UAPA 2IMDA 3D5JA 1A8YA 3TKSE 5ID2B 3GX8A 3DGQA 4NHZA 2CVBA 4ECIA 2AJQB 3ED3A 1URMA 3KTLA 3TJKA 1SYRA 4KH7A 2GSQA 3KJYA 2NBSA 5E59A 3E3EA 2AUVA 3EU3A 4L0UA 1K0AA 1F6MC 4GLTA 4DSRA 3RHCA 5B7CA 3VWXA 3UJ1A 3A2XA 2DKIA 1YEPA 2YWOA 3P8WA 1SYXA 2KP2A 5IMVA 1GNEA 2HE3A 3KH7A 2B5YA 3KCMA 4QQ7A 1Z7PA 1J08A 2GSRA 1BAYA 1K0NA 3UL3A 1KNGA 1TTZA 3DWVA 3F6DA 2IMFA 2R2JA 2I4AA 2CT6A 5IOXA 2L59A 1K3LA 3U5RE 4K8MA 3NIVA 4MJBA 4BWSA 3CXGA 17GSA 3Q18A 5DAKA 3QCPA 2FWHA 3CQFA 2X4AA 3LORA 2O87A 2M72A 1EOHA 4Z2UA 3RDWA 2H30A 4PURA 4ZL7A 2VL9A 4K7OA 4MMMA 1TW9A 3LG6A 4PUAA 3RHBA 3HYPA 3MWHA 3AY8A 5AGYA 1JZOA 2GQLA 2CZ2A 2YNXA 3W6GA 4KB3A 5HFKA 5ECHB 4NV2A 5ABRA 2X8CA 4ILFA 4LMWA 4EE0A 2LRNA 1XBSA 5JCUA 4EIPA 5HR0A 2VL2C 2AB6A 2C1YA 2J23A 1OC9B 3UIWA 4BL7B 2YN1A 2QSIA 5JCGA 4PNGA 3FZ5A 1BYEA 2YV9A 4OFTA 4Q5QA 4YH2A 4FO5A 3HKRA 1THXA 1ZMAA 2KHPA 3IC8A 1SKSB 1GULA 5CAXA 4N30A 2GZZA 7GSSA 4X4JA 5H5QA 3ME7A 2MMNA 2RUFA 1EV4A 1E2YA 5BMUA 5IO0A 5H5SA 3ZREA 1OYJA 2P31A 4DSSA 2V41A 5KOXA 5H5RA 4OO4A 2IFQA 3F63A 20GSA 4RUVA 4JEDA 5IMCA 2KP1A 6GSXA 3O76A 5HFIA 1H4OA 3KMNA 2DC5A 4HZ4A 1PQNA 2CA8A 3FMWA 5KN2A 5GSSA 1M9AA 2HRAA 4MA9A 1C72A 2GQMA 4PTSA 3WD6A 1LBKA 2FD3A 2EIRA 1R26A 3IA1A 3CSJA 4L0WA 3IRAA 3QMXA 2RM6A 2RUEA 4XS4A 2CQ9A 1AW9A 2C0EA 3WYWA 3KD0A 4E8EA 5KOWA 1M2AA 3GL5A 4IS0A 4I97A 4HOJA 6GSVA 1X9SB 3CSIA 1GH2A 1R5AA 2EIOA 4O5QA 2B5XA 1V58A 4KF9A 18GSA 1PN0A 5JCWA 4MPFA 1IYHA 2MZCA 1PKWA 1G7OA 1MDJA 4ECBA 1SU9A 4KCAA 1EGOA 1JZWA 4LL4B 3G7JA 4TR0A 1VF2A 4YQVA 5B6MA 2MBSA 2IMKA 2PVQA 4KE3A 4YQUA 2LJAA 3D4TA 1XG8A 3TOUA 4A5PA 1NM3A 2FHEA 4O5UA 3LEFA 2DKHA 4ACSA 4XS1A 4WR4A 3IC4A 2DIZA 4JBBA 4J57E 3HJMA 2GZPA 5AIXA 3ZITA 3IR4A 4TOPA 1KEBA 1WMJA 2H73A 5DBQA 3D0ZA 4J56E 3QAWA 1HD2A 1YKAA 3GH9A 1R5PA 2OADA 2H0GA 3EMPA 3EWLA 1CQGA 4GRFA 1KTEA 1TXXA 2O85A 1RW1A 2VL2A 4EIQA 1EEMA 5CO3A 2HRNA 2L57A 4ZBAA 2C3NA 2JACA 3ZFBA 1EGRA 4V2MA 1I9DA 2L6DA 1TP9A 4GQCA 5F07A 5G30A 2HZEA 3IK7A 6GSYA 1K0CA 4WEYA 5J4UA 1XW9A 1GSFA 1ERVA 2VUPA 5DVBA 2VLUA 4POBA 5J5NA 4V1Ag 5ELGA 4WKWA 2TIRA 3GKMA 3PR8A 1X9MB 5AN1A 1Z3EA 4I5QA 3RAZA 5CREA 1GSSA 2L4CA 3FR3A 3EINA 1FB6A 2JZTA 2R0PA 2VM1A 4TVEA 1OE7A 2VD0A 2WULA 1T4YA 2XHFA 3ERFA 4HJMA 4Q5NA 3HD5A 1PFOA 2GZYA 3L9VA 1QK8A 2WGRA 2HSMA 3ZRDA 5DALB 1XVWA 3MIXA 1XWBA 2BMXA 2WDUA 4F82A 1XCCA 4LL1B 2R0GA 4GQFA 2DJKA 2C3TA 2NTOA 1EZKA 4TR3A 5G1LA 8GSSA 3ZLPA 2GSSA 2WRTA 4BWQA 4WBRD 3KXOA 4QL7A 1ZYNA 3C1RA 4ZBBA 3G9BA 4KW6A 1OVNA 1U87A 4Z7XA 3I43A 3IPZA 3FW2A 2H70A 5GSTA 1ZGNA 1VGLA 2WS2A 3M8NA 1JLVA 3TJFA 1N8JA 1GSEA 3GKNA 4G0IA 2N5AA 4I2UA 4MH3A 2XBQA
chains in the Genus database with same CATH topology
4G0LA 3KH9A 3LGCA 2HI7A 6GSWA 5BRTA 2LEGA 3GH6A 3TCOA 2WFCA 1NW2A 1K0DA 5D9XA 1IYIA 3GNJA 1QQ2A 4HEA2 3VPTA 4XS6A 3FZAA 1K3OA 1Z6MA 2H71A 2YWIA 1N2AA 4IHUA 3QPMA 2H1BA 2H6ZA 2MYGA 1DE2A 3BJ5A 5ENUA 4WXTA 2YANA 3TKSC 1UC7A 1OC8A 4OFNA 3FEUA 1USBA 1F37A 3LXZA 1F3AA 2P5QA 2OACA 4TXOB 4G10A 4F03A 2B3SA 2LJKA 2R3XA 2EIQA 3TKQA 5INYA 2F8FA 3F8UA 5DQSA 5J9CA 4D73A 2TRCP 1EV9A 3LQ7A 5D9WA 2HRFA 2IWTA 4WF4A 3M0FA 2KLXA 1TOFA 3ERGA 1X5DA 4OO5A 4F0BA 2HZFA 3G7IA 2DMLA 1K0OA 2O7KA 3HVVA 2VM2A 5DCHA 3F9UA 4AGSA 1YQ1A 4BVXB 1V57A 2VCZA 2VLTA 3TOTA 3GTUB 1A0FA 3HXSA 1Z5YE 2H66A 3IV4A 1GL8A 3GUSA 2GGTA 2LTKA 3GL3A 2GS3A 2P5RA 2VCXA 4IW9A 3J7Yk 1WPIA 3FHKA 3LYKA 1GWCA 4KGIA 5IQYA 3TJJA 4F0CA 2IL3A 2J9HA 2H19A 2H1DA 2K8SA 1BG5A 4GF0A 2XPEA 2WZ9A 3TRQA 4GSSA 4ZL8A 2L5OA 1OKDA 5B6NA 2C0DA 3DVXA 2QA1A 4MH2A 3QFBC 4NHWA 4GSNA 3Q19A 1EWXA 2NDOA 4WETA 1RK4A 3PGTA 2R4VA 1PKZA 4MF7A 3KP8A 5F06A 3ZL5A 2ON5A 1OKTA 1O6JA 4X1UA 2CAQA 2FA4A 4YAPA 3LJRA 1TRSA 1HQOA 3VFIA 2R5GA 4EF0A 5A4UA 1FG4A 5IO2A 2OJLA 5KEJA 2KUCA 5IMZA 3GA4A 3M3MA 4WR5A 1ZYPA 3F4RA 1TDIA 1O8WA 2VO4A 3VWUA 4BVYB 2FA8A 1EEJA 3F4SA 2H1AA 3MNGA 4IJIA 5L71A 4MABA 4CHSA 1GLPA 1MDIA 2NVLA 1HNCA 2LNTA 4EO3A 2LSTA 3F4TA 1GUMA 2O89A 4PX1A 4I6XA 3WGEA 2I1UA 3D21A 1X5EA 2XBIA 19GSA 5DDLA 3TKSA 1U3AA 3FY7A 4K9ZA 2A2RA 3OR5A 3TJBA 1ZOFA 3APSA 5J3RA 1SK2A 1OC3A 3CTGA 4IQAA 5ECIB 3HZ8A 3F0IA 1ZCPA 3HJPA 2ON7A 4IVFA 4ZB9A 1XOBA 1X5CA 2OE0A 3DXBA 22GSA 3ZYWA 2DLXA 4POMA 4KSMA 1W4VA 2BJXA 4TR1B 1R4WA 2R37A 3I69A 4HUAA 1SD8A 3UVHA 5EVOA 4FYUA 3NOFA 3UMAA 2A4VA 3UBLA 1XFLA 5AISA 2DSAA 3L0HA 4I8BA 3L9UA 4GWRA 1AQXA 1JLWA 2RM5A 1GTUA 4EKZA 5G5FA 2FNOA 4OD7A 5C00A 3GMFA 1GP1A 1Y25A 1XW6A 3EU4A 2C80A 4MZWA 5IPHA 3C1SA 1TU7A 1G0TA 3GIXA 4IN0A 1EP7A 3EE2A 3IXRA 1G6YA 2TRXA 3FRCA 3GHAA 1O85A 1TK0B 4K6XA 4KSOA 4KX4A 1U3IA 2F8AA 2VL3A 2LQQA 5GZZB 1VRSD 4JU5A 4HS1A 2WCIA 1ON4A 3GKXA 1GTIA 1T3BA 3C7MA 5G31A 1AUCA 6GSUA 2PERA 3TKRA 1M99A 2HNLA 1KBNA 2XC2A 3MYDA 4MCUA 3KP9A 3HVSA 3A3TA 4ZXGA 4HU7A 4IJ3A 4AJ6A 4LA1A 1TK8B 2YP6A 2I81A 4PUFC 5HFGA 5D93A 1Z9HA 2H76A 5JWOB 3CYNA 4ML1A 1X9WB 4O7HA 2R6KA 1O73A 2R0CA 3HDCA 5KN0A 4IKHA 2B5EA 4G2EA 1MD4A 1B48A 3H4KA 4K7IA 4NAXA 5IM9A 4MF6A 4RQXA 2H6YA 2H1GA 4RI7A 4G9HA 3RPPA 4KUNA 5A4VA 1AXDA 3Q74A 2OKAA 4FIWA 1SKRB 3GFKA 4QL9A 1BEDA 4TKYA 1A23A 5IOWA 5CYYA 2CZ3A 4HU9A 1YY7A 1T00A 3CRUA 5ID2A 4L5OA 3JCML 3GX0A 2GSTA 4J2FA 1YKCA 4OCFA 3HY2A 2HFDA 5IMAA 1T8EB 3ISOA 4F9ZA 2E2MA 2PWJA 5COHA 3HVXA 1F9MA 3IHGA 4XIHA 1ZYQB 4MZBA 3BCIA 1PN9A 4PXOA 1Y6EA 1TI1A 3EYTA 3FZ9A 1PL1A 2B6MA 3FR9A 5ECNB 1TKDB 2FY6A 3W8JA 1XXUA 3Q6OA 4KDXA 2HT9A 5F8BA 4P3YB 4ECJA 1SL0B 4HQZA 4N11A 3W8SA 1NSWA 3N9JA 3H79A 4HZ2A 3TB2A 1I5GA 1B4QA 1QXHA 4I2TA 1FVKA 1YDKA 4L8EA 2GDRA 2F3MA 3A2WA 4OMVA 3KTBA 2PUKC 1ML6A 2G0FA 1EOGA 2C0GA 1K3YA 2PPTA 1K0BA 2MMZA 1SK0A 5HQPA 4AF2A 2KOKA 3DRNA 4GCIA 1MDKA 5D9VA 2DIYA 3FKFA 3ME8A 1GSYA 2H74A 2A2SA 3VWVA 1Q4JA 2V6KA 3RBTA 3L78A 1ZZYA 5A4WA 3L9SA 4USSA 2VCWA 3EMXA 4E8HA 3IDVA 5DAKB 1S3AA 3VURA 1TK5B 1EP8A 5D73A 2X99A 9GSSA 4K0NA 4MF5A 1SK1A 2RLIA 2HRKA 1PX6A 1GTBA 1NHYA 1XWCA 1B4PA 1OC9A 2YV7A 4BL7A 2X64A 1FO5A 2C3QA 1V9WA 3FK8A 2JZRA 4JRRA 4OFMA 3M9KA 3IE3A 4EDYA 3GSTA 4DVCA 10GSA 2VCTA 1YF1A 3TGZA 2GQKA 1TJDA 1JHBA 2A2PA 3HCZA 1MEKA 4MDCA 3DMLA 1ERWA 4V2LA 3ERWA 4ZILA 2LUSA 2PGTA 4ML6A 1GTAA 1FB0A 1CQHA 3APOA 4XRAA 4PQIA 2LV3A 3GRXA 2B7JA 1PRXA 5F0GA 3PINA 1WRYA 3TJGA 2CX3A 2ZCTA 3A5IA 4DSSB 4MK3A 1SENA 4Q5RA 2IFQB 3SBCA 5ECKB 1M2DA 4ULXA 1WJKA 2PU9C 4K2XA 5C04A 1FVJA 2V1MA 2N5FA 2YWMA 1AQWA 1BX9A 2IMIA 2C8UA 2LRCA 1PMTA 4V2NA 3GYKA 2M46A 1F2EA 2UZ8A 1Z7RA 2JSZA 1O7UA 2DJ3A 2YJHA 1U88A 2D2ZA 1ILOA 1T4ZA 3H93A 4ICYA 4Z2RA 4L5LA 2IN3A 4O32A 5ECOB 4DSQA 4JR6A 3K8NA 4XS4B 1ZL9A 4POKA 4PGTA 1TRWA 5JWRB 4ZL9A 3QFAC 2IJYA 5IMFA 16GSA 2VCVA 3QAGA 4KDYA 4N0ZA 3ZIVA 3CSHA 3IAM2 4PQ1A 3S9FA 4X0XA 4F2IA 2OBKA 5D9TA 2WB9A 2OE3A 1LU4A 2I3YA 2OBIA 3UBKA 2FCHA 1YJ6A 3I9V2 3BD2A 4ECCA 1B9XC 2HXKA 4PNFA 2HSYA 3LFLA 3DEXA 2E0QA 3VK9A 4NPBA 2GVPA 3ZMLA 3FZ4A 4NXIA 5DJLA 4PQHA 4EDZA 1M0UA 1XPVA 4GXZA 4KCEA 5LD0A 5F05A 4KAEA 4MJAA 1G6WA 2CX4A 1FOHA 2H0IA 1PSQA 4RQRA 5AIVA 3F6FA 2H6XA 3GSSA 4FH8A 3C71A 3F3RA 4YKGA 2G2QA 4V1Ap 5HR2A 3APQA 3WGXA 2FWGA 5CP1A 4LMVA 1XWGA 4WBJA 2ZNMA 2CVDA 1XW5A 3UARA 2LJRA 4K5RA 3L4NA 5G2ZA 3V1WA 2YOIA 2AYTA 3CBUA 3EURA 4JZQA 2HZEB 2ALBA 3HHVA 2YZUA 1GLQA 2B1KA 2JADA 3VPQA 3FR6A 2CAIA 1FHEA 1WE0A 1Q98A 5DALA 4FQUA 4K2DA 2YJ7A 5B8AA 1AC1A 4EXJA 3H1NA 1O8XA 3DIEA 2NPBA 2K6VA 4MPGA 4CW9A 4NWYA 1T1VA 4HI7A 2H75A 1XOAA 2LKUA 4MP4A 4X43A 4NMUA 5ECQB 2AV4A 1A2MA 14GSA 1LJRA 2LNSA 5IIZA 1S3CA 1VF3A 1XWAA 4EUYA 1SJZA 4HDEA 2ES7A 1X0RA 2F51A 1A0RP 1HNAA 1UA5A 5G5EA 2DJ1A 1GSQA 4KNDA 4MLYA 3HZ4A 2V32A 3KZQA 2FGXA 5CRGA 12GSA 1FW1A 3ZTLA 1K0MA 2RIIA 4TXVA 4XTSA 1SL1B 5ECMB 4YKFA 4DEJA 5A5KA 4FYCA 3IAS2 4K0GA 4XHMA 1UVZA 3QAVA 1ERUA 5HR3A 1TRUA 1SKWB 3RPNA 3HJOA 1ERTA 1A2LA 3E9JB 3FYGA 5EY6A 2HSHA 1XZOA 2H8LA 2QGVA 3DKSA 4XRDA 3KM6A 3TDGA 4TXOA 5ECLB 5ECPB 2OA7A 3I6AA 3SWLA 2K8VA 5ECRB 3IOSA 2XPDA 4ZIJA 4TR4A 3DYRA 3CMIA 2L5LA 3G7YA 3R3EA 2C4JA 2JZSA 4MZCA 3C8EA 5CRHA 4N10A 3UOMA 4EVMA 1J9BA 1SD9A 2CVKA 2K18A 2H72A 5J41A 1B9YC 3E0UA 5JWQB 2X49A 1GRXA 1M2BA 1H75A 2FWEA 2X8HA 3HA9A 5D8IA 3MDKA 2IPAA 3DVWA 4OWYA 6GSTA 2DJJA 2X8GA 4BVXA 1FAAA 1BQ7A 4D73B 2B1LA 1QMVA 2EC4A 3GTUA 1SJ6A 3UVTA 2FLSA 2GLRA 4MJEA 2JSYA 3TUEA 4GTUA 4CY6A 1AIUA 1SL2B 3KIJA 4ZB6A 13GSA 2HLSA 3N5OA 2F9SA 4IGJA 5GAND 2QA2A 3LSZA 3R2QA 2YCDA 3GN3A 3P7XA 5IMDA 4G0KA 3DD3A 2PVOC 2LRTA 2E2GA 3EVIA 2L6CA 2MBTA 5KN1A 1UN2A 5DJMA 5HR1A 1TRVA 2GTUA 2REMA 1V40A 4TN8A 3P2AA 1PA3A 2H0HA 5EPFA 2A4HA 2M80A 1QGVA 1FOVA 2JU5A 4EL1A 3ZVJA 3EPTA 3IBHA 2QC7A 2V2GA 4OCEA 3EC3A 1OAZA 2BTOT 2DJ0A 2OE1A 4AJ8A 1M9BA 4K5SA 5LNKe 3ZZXA 4JE1A 1ACVA 3CRTA 3QR6A 4HQSA 3BBYA 3LW9A 1TU8A 3ZIJA 4TRXA 4BPYA 2MMAA 1E6BA 2C0FA 2H01A 4BVYA 1TI3A 3WT1A 5D96A 4Z2TA 1GUHA 1PL2A 3WT2A 2GT5A 3D22A 3BOAA 2VD1A 2PN8A 2JL4A 1HYUA 2DJ2A 5DCGA 2E7PA 4H86A 1ABAA 3ZFLA 3M1GA 4RI6A 2O8VB 2FWFA 1GUKA 2P0GA 2IIYA 2B7KA 4KA0A 1GSUA 5FHIA 1PGTA 2Z9SA 1V98A 1G7EA 3CTFA 2LS5A 3MSZA 5ECSA 2PBJA 3BCKA 3D4MA 5EL8A 3LXTA 3IHQA 1NHOA 2WJUA 4O5RA 1YZXA 2VAFA 4FYBA 3J7Yb 4K1FA 3IK9A 4IBPA 11GSA 5GAPD 2DBCA 1M7TA 4CDOA 1GSDA 2GT6A 1MTCA 1VF4A 4IQ1A 3C73A 4KDUA 3O6TA 1XVQA 1WWJA 3O3TA 4TR1A 3PPUA 3UEMA 4WF5A 2L4QA 5LCZA 1PD21 4POLA 5KN3A 1V2AA 1R7HA 4IELA 4IP6A 4CY8A 1U6TA 1WOUA 3U6VA 3ZMKA 1A24A 1JZRA 2HYXA 1AAZA 4N0VA 3QDNA 1YF0A 3ZVJD 3VWWA 5B8BA 3LYPA 3M9JA 3QD9A 1HNBA 1THOA 2VCQA 5IPGA 4ZB8A 3TRPA 5CRDA 3KEBA 2FUG2 3WGDA 1W89A 3MAKA 1YEXA 4XCSA 1QFNA 1OE8A 3F3QA 3A2VA 3TKPA 4TW5A 4MNNA 3GV1A 4MJCA 4NV5A 4K7NA 1DSBA 3A5WA 2CV4A 1J0FA 1JZDA 1JFUA 4BA7A 3H8QA 1DBYA 2DMMA 1AQVA 2IMEA 4AJ7A 1F3BA 2K9FA 3VI7A 4JR4A 4HJ2A 1A2JA 3D6IA 3KGKA 1T7PB 1QUWA 3NZNA 1DUGA 3US3A 1PX7A 1SJIA 3VLNA 3GURA 1GNWA 4G19A 3QOUA 3LWAA 2QKEA 4ID0A 1BJXA 5DQYA 1WIKA 1DE1A 2YWNA 5CNWA 4ZBDA 2AAWA 2MMOA 2I9HA 2YZHA 2AHEA 5FWGA 1XWKA 3VI5A 5ELAA 2YPMA 1A8LA 4YAVA 3TRXA 2VIMA 1XIYA 4O92A 6GSSA 1O81A 1RQMA 1S3DA 1B8XA 1Z6NA 4LLRA 2V6OA 2VLVA 4IP1A 2PMTA 4ISDA 2ZUPA 1MD3A 2VOCA 4EC0A 4Q5FA 3P90A 5G1KA 1ZYEA 5FT3A 4YQMA 3KMOA 5J9BA 3PH9A 1ST9A 4GSTA 5CRWA 2LQOA 1WP0A 1VF1A 5E4WA 3GKKA 2N5BA 3UAPA 2IMDA 3D5JA 1A8YA 3TKSE 5ID2B 3GX8A 3DGQA 4NHZA 2CVBA 4ECIA 2AJQB 3ED3A 1URMA 3KTLA 3TJKA 1SYRA 4KH7A 2GSQA 3KJYA 2NBSA 5E59A 3E3EA 2AUVA 3EU3A 4L0UA 1K0AA 1F6MC 4GLTA 4DSRA 3RHCA 5B7CA 3VWXA 3UJ1A 3A2XA 2DKIA 1YEPA 2YWOA 3P8WA 1SYXA 2KP2A 5IMVA 1GNEA 2HE3A 3KH7A 2B5YA 3KCMA 4QQ7A 1Z7PA 1J08A 2GSRA 1BAYA 1K0NA 3UL3A 1KNGA 1TTZA 3DWVA 3F6DA 2IMFA 2R2JA 2I4AA 2CT6A 5IOXA 2L59A 1K3LA 3U5RE 4K8MA 3NIVA 4MJBA 4BWSA 3CXGA 17GSA 3Q18A 5DAKA 3QCPA 2FWHA 2X4AA 3LORA 2O87A 2M72A 1EOHA 4Z2UA 3RDWA 2H30A 4PURA 4ZL7A 2VL9A 4K7OA 4MMMA 1TW9A 3LG6A 4PUAA 3RHBA 3HYPA 3MWHA 3AY8A 5AGYA 1JZOA 2GQLA 2CZ2A 2YNXA 3W6GA 4KB3A 5HFKA 5ECHB 4NV2A 5ABRA 2X8CA 4ILFA 4LMWA 4EE0A 2LRNA 1XBSA 5JCUA 4EIPA 5HR0A 2VL2C 2AB6A 2C1YA 2J23A 1OC9B 3UIWA 4BL7B 2YN1A 2QSIA 5JCGA 4PNGA 3FZ5A 1BYEA 2YV9A 4OFTA 4Q5QA 4YH2A 4FO5A 3HKRA 1THXA 1ZMAA 2KHPA 3IC8A 1SKSB 1GULA 5CAXA 4N30A 2GZZA 7GSSA 4X4JA 5H5QA 3ME7A 2MMNA 2RUFA 1EV4A 1E2YA 5BMUA 5IO0A 5H5SA 3ZREA 1OYJA 2P31A 4DSSA 2V41A 5KOXA 5H5RA 4OO4A 2IFQA 3F63A 20GSA 4RUVA 4JEDA 5IMCA 2KP1A 6GSXA 3O76A 5HFIA 1H4OA 3KMNA 2DC5A 4HZ4A 1PQNA 2CA8A 3FMWA 5KN2A 5GSSA 1M9AA 2HRAA 4MA9A 1C72A 2GQMA 4PTSA 3WD6A 1LBKA 2FD3A 2EIRA 1R26A 3IA1A 3CSJA 4L0WA 3IRAA 3QMXA 2RM6A 2RUEA 4XS4A 2CQ9A 1AW9A 2C0EA 3WYWA 3KD0A 4E8EA 5KOWA 1M2AA 3GL5A 4IS0A 4I97A 4HOJA 6GSVA 1X9SB 3CSIA 1GH2A 1R5AA 2EIOA 4O5QA 2B5XA 1V58A 4KF9A 18GSA 1PN0A 5JCWA 4MPFA 1IYHA 2MZCA 1PKWA 1G7OA 1MDJA 4ECBA 1SU9A 4KCAA 1EGOA 1JZWA 4LL4B 3G7JA 4TR0A 1VF2A 4YQVA 5B6MA 2MBSA 2IMKA 2PVQA 4KE3A 4YQUA 2LJAA 3D4TA 3TOUA 4A5PA 1NM3A 2FHEA 4O5UA 3LEFA 2DKHA 4ACSA 4XS1A 4WR4A 3IC4A 2DIZA 4JBBA 4J57E 3HJMA 2GZPA 5AIXA 3ZITA 3IR4A 4TOPA 1KEBA 1WMJA 2H73A 5DBQA 3D0ZA 4J56E 3QAWA 1HD2A 1YKAA 3GH9A 1R5PA 2OADA 2H0GA 3EMPA 3EWLA 1CQGA 4GRFA 1KTEA 1TXXA 2O85A 1RW1A 2VL2A 4EIQA 1EEMA 5CO3A 2HRNA 2L57A 4ZBAA 2C3NA 2JACA 3ZFBA 1EGRA 4V2MA 1I9DA 2L6DA 1TP9A 4GQCA 5F07A 5G30A 2HZEA 3IK7A 6GSYA 1K0CA 4WEYA 5J4UA 1XW9A 1GSFA 1ERVA 2VUPA 5DVBA 2VLUA 4POBA 5J5NA 4V1Ag 5ELGA 4WKWA 2TIRA 3GKMA 3PR8A 1X9MB 5AN1A 1Z3EA 4I5QA 3RAZA 5CREA 1GSSA 2L4CA 3FR3A 3EINA 1FB6A 2JZTA 2R0PA 2VM1A 4TVEA 1OE7A 2VD0A 2WULA 1T4YA 2XHFA 3ERFA 4HJMA 4Q5NA 3HD5A 2GZYA 3L9VA 1QK8A 2WGRA 2HSMA 3ZRDA 5DALB 1XVWA 3MIXA 1XWBA 2BMXA 2WDUA 4F82A 1XCCA 4LL1B 2R0GA 4GQFA 2DJKA 2C3TA 2NTOA 1EZKA 4TR3A 5G1LA 8GSSA 3ZLPA 2GSSA 2WRTA 4BWQA 4WBRD 3KXOA 4QL7A 1ZYNA 3C1RA 4ZBBA 3G9BA 4KW6A 1OVNA 1U87A 4Z7XA 3I43A 3IPZA 3FW2A 2H70A 5GSTA 1ZGNA 1VGLA 2WS2A 3M8NA 1JLVA 3TJFA 1N8JA 1GSEA 3GKNA 4G0IA 2N5AA 4I2UA 4MH3A 2XBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KH9 A;  3LGC A;  2HI7 A;  6GSW A;  2LEG A;  3GH6 A;  3TCO A;  2WFC A;  1NW2 A;  1K0D A;  5D9X A;  1IYI A;  3GNJ A;  1QQ2 A;  4HEA 2;  3VPT A;  4XS6 A;  3FZA A;  1K3O A;  1Z6M A;  2H71 A;  2YWI A;  1N2A A;  4IHU A;  3QPM A;  2H1B A;  2H6Z A;  2MYG A;  1DE2 A;  3BJ5 A;  5ENU A;  4WXT A;  2YAN A;  3TKS C;  1UC7 A;  1OC8 A;  4OFN A;  3FEU A;  1USB A;  1F37 A;  3LXZ A;  1F3A A;  2P5Q A;  2OAC A;  4TXO B;  4G10 A;  4F03 A;  2B3S A;  2LJK A;  2R3X A;  2EIQ A;  3TKQ A;  5INY A;  2F8F A;  3F8U A;  5DQS A;  5J9C A;  4D73 A;  2TRC P;  1EV9 A;  3LQ7 A;  5D9W A;  2HRF A;  2IWT A;  4WF4 A;  3M0F A;  2KLX A;  1TOF A;  3ERG A;  1X5D A;  4OO5 A;  4F0B A;  2HZF A;  3G7I A;  2DML A;  1K0O A;  2O7K A;  3HVV A;  2VM2 A;  5DCH A;  3F9U A;  4AGS A;  1YQ1 A;  1V57 A;  2VCZ A;  2VLT A;  3TOT A;  3GTU B;  1A0F A;  3HXS A;  1Z5Y E;  2H66 A;  3IV4 A;  1GL8 A;  3GUS A;  2GGT A;  2LTK A;  3GL3 A;  2GS3 A;  2P5R A;  2VCX A;  4IW9 A;  3J7Y k;  1WPI A;  3FHK A;  3LYK A;  1GWC A;  4KGI A;  5IQY A;  3TJJ A;  4F0C A;  2IL3 A;  2J9H A;  2H19 A;  2H1D A;  2K8S A;  1BG5 A;  4GF0 A;  2XPE A;  2WZ9 A;  3TRQ A;  4GSS A;  4ZL8 A;  2L5O A;  1OKD A;  5B6N A;  2C0D A;  3DVX A;  4MH2 A;  3QFB C;  4NHW A;  4GSN A;  3Q19 A;  1EWX A;  2NDO A;  4WET A;  1RK4 A;  3PGT A;  2R4V A;  1PKZ A;  4MF7 A;  3KP8 A;  5F06 A;  3ZL5 A;  2ON5 A;  1OKT A;  1O6J A;  4X1U A;  2CAQ A;  2FA4 A;  4YAP A;  3LJR A;  1TRS A;  1HQO A;  3VFI A;  2R5G A;  4EF0 A;  5A4U A;  1FG4 A;  5IO2 A;  2OJL A;  5KEJ A;  2KUC A;  5IMZ A;  3GA4 A;  3M3M A;  4WR5 A;  3F4R A;  1TDI A;  1O8W A;  2VO4 A;  3VWU A;  2FA8 A;  1EEJ A;  3F4S A;  2H1A A;  3MNG A;  4IJI A;  5L71 A;  4MAB A;  4CHS A;  1GLP A;  1MDI A;  2NVL A;  1HNC A;  2LNT A;  4EO3 A;  2LST A;  3F4T A;  1GUM A;  2O89 A;  4PX1 A;  4I6X A;  3WGE A;  2I1U A;  3D21 A;  1X5E A;  2XBI A;  19GS A;  5DDL A;  3TKS A;  1U3A A;  3FY7 A;  4K9Z A;  2A2R A;  3OR5 A;  3TJB A;  1ZOF A;  3APS A;  5J3R A;  1SK2 A;  1OC3 A;  3CTG A;  4IQA A;  5ECI B;  3HZ8 A;  3F0I A;  1ZCP A;  3HJP A;  2ON7 A;  4IVF A;  4ZB9 A;  1XOB A;  1X5C A;  2OE0 A;  3DXB A;  22GS A;  3ZYW A;  2DLX A;  4POM A;  4KSM A;  1W4V A;  2BJX A;  4TR1 B;  1R4W A;  2R37 A;  3I69 A;  4HUA A;  1SD8 A;  3UVH A;  5EVO A;  4FYU A;  3NOF A;  3UMA A;  2A4V A;  3UBL A;  1XFL A;  5AIS A;  2DSA A;  3L0H A;  4I8B A;  3L9U A;  4GWR A;  1AQX A;  1JLW A;  2RM5 A;  1GTU A;  4EKZ A;  5G5F A;  2FNO A;  4OD7 A;  5C00 A;  3GMF A;  1GP1 A;  1Y25 A;  1XW6 A;  3EU4 A;  2C80 A;  4MZW A;  5IPH A;  3C1S A;  1TU7 A;  1G0T A;  3GIX A;  4IN0 A;  1EP7 A;  3EE2 A;  3IXR A;  1G6Y A;  2TRX A;  3FRC A;  3GHA A;  1O85 A;  1TK0 B;  4K6X A;  4KSO A;  4KX4 A;  1U3I A;  2F8A A;  2VL3 A;  2LQQ A;  5GZZ B;  1VRS D;  4JU5 A;  4HS1 A;  2WCI A;  1ON4 A;  3GKX A;  1GTI A;  1T3B A;  3C7M A;  5G31 A;  1AUC A;  6GSU A;  2PER A;  3TKR A;  1M99 A;  2HNL A;  1KBN A;  2XC2 A;  4MCU A;  3KP9 A;  3HVS A;  3A3T A;  4ZXG A;  4HU7 A;  4IJ3 A;  4AJ6 A;  4LA1 A;  1TK8 B;  2YP6 A;  2I81 A;  4PUF C;  5HFG A;  5D93 A;  1Z9H A;  2H76 A;  5JWO B;  3CYN A;  4ML1 A;  1X9W B;  4O7H A;  2R6K A;  1O73 A;  3HDC A;  5KN0 A;  4IKH A;  2B5E A;  4G2E A;  1MD4 A;  1B48 A;  3H4K A;  4K7I A;  4NAX A;  5IM9 A;  4MF6 A;  4RQX A;  2H6Y A;  2H1G A;  4RI7 A;  4G9H A;  3RPP A;  4KUN A;  5A4V A;  1AXD A;  3Q74 A;  2OKA A;  4FIW A;  1SKR B;  3GFK A;  4QL9 A;  1BED A;  4TKY A;  1A23 A;  5IOW A;  5CYY A;  2CZ3 A;  4HU9 A;  1YY7 A;  1T00 A;  3CRU A;  5ID2 A;  4L5O A;  3JCM L;  3GX0 A;  2GST A;  4J2F A;  1YKC A;  4OCF A;  3HY2 A;  2HFD A;  5IMA A;  1T8E B;  3ISO A;  4F9Z A;  2E2M A;  2PWJ A;  5COH A;  3HVX A;  1F9M A;  4XIH A;  1ZYQ B;  4MZB A;  3BCI A;  1PN9 A;  4PXO A;  1Y6E A;  1TI1 A;  3EYT A;  3FZ9 A;  1PL1 A;  2B6M A;  3FR9 A;  5ECN B;  1TKD B;  2FY6 A;  3W8J A;  1XXU A;  3Q6O A;  4KDX A;  2HT9 A;  5F8B A;  4P3Y B;  4ECJ A;  1SL0 B;  4HQZ A;  4N11 A;  3W8S A;  1NSW A;  3N9J A;  3H79 A;  4HZ2 A;  3TB2 A;  1I5G A;  1B4Q A;  1QXH A;  4I2T A;  1FVK A;  1YDK A;  4L8E A;  2GDR A;  2F3M A;  3A2W A;  4OMV A;  3KTB A;  2PUK C;  1ML6 A;  2G0F A;  1EOG A;  2C0G A;  1K3Y A;  2PPT A;  1K0B A;  2MMZ A;  1SK0 A;  5HQP A;  4AF2 A;  2KOK A;  3DRN A;  4GCI A;  1MDK A;  5D9V A;  2DIY A;  3FKF A;  3ME8 A;  1GSY A;  2H74 A;  2A2S A;  3VWV A;  1Q4J A;  2V6K A;  3RBT A;  3L78 A;  1ZZY A;  5A4W A;  3L9S A;  2VCW A;  3EMX A;  4E8H A;  3IDV A;  5DAK B;  1S3A A;  3VUR A;  1TK5 B;  1EP8 A;  5D73 A;  2X99 A;  9GSS A;  4K0N A;  4MF5 A;  1SK1 A;  2RLI A;  1PX6 A;  1GTB A;  1NHY A;  1XWC A;  1B4P A;  1OC9 A;  2YV7 A;  4BL7 A;  2X64 A;  1FO5 A;  2C3Q A;  1V9W A;  3FK8 A;  2JZR A;  4JRR A;  4OFM A;  3M9K A;  3IE3 A;  4EDY A;  3GST A;  4DVC A;  10GS A;  2VCT A;  1YF1 A;  3TGZ A;  2GQK A;  1TJD A;  1JHB A;  3HCZ A;  1MEK A;  4MDC A;  3DML A;  1ERW A;  4V2L A;  3ERW A;  4ZIL A;  2LUS A;  2PGT A;  4ML6 A;  1GTA A;  1FB0 A;  1CQH A;  3APO A;  4XRA A;  4PQI A;  2LV3 A;  3GRX A;  2B7J A;  1PRX A;  5F0G A;  3PIN A;  1WRY A;  3TJG A;  2CX3 A;  2ZCT A;  4DSS B;  4MK3 A;  1SEN A;  4Q5R A;  2IFQ B;  3SBC A;  5ECK B;  1M2D A;  4ULX A;  1WJK A;  2PU9 C;  5C04 A;  1FVJ A;  2V1M A;  2N5F A;  2YWM A;  1AQW A;  1BX9 A;  2IMI A;  2C8U A;  2LRC A;  1PMT A;  4V2N A;  3GYK A;  2M46 A;  1F2E A;  1Z7R A;  2JSZ A;  1O7U A;  2DJ3 A;  2YJH A;  1U88 A;  2D2Z A;  1ILO A;  1T4Z A;  3H93 A;  4L5L A;  2IN3 A;  4O32 A;  5ECO B;  4DSQ A;  4JR6 A;  3K8N A;  4XS4 B;  1ZL9 A;  4POK A;  4PGT A;  1TRW A;  5JWR B;  4ZL9 A;  3QFA C;  2IJY A;  5IMF A;  16GS A;  2VCV A;  3QAG A;  4KDY A;  4N0Z A;  3ZIV A;  3CSH A;  3IAM 2;  4PQ1 A;  3S9F A;  4X0X A;  4F2I A;  2OBK A;  5D9T A;  2WB9 A;  2OE3 A;  1LU4 A;  2I3Y A;  2OBI A;  3UBK A;  2FCH A;  1YJ6 A;  3I9V 2;  3BD2 A;  4ECC A;  1B9X C;  2HXK A;  4PNF A;  2HSY A;  3LFL A;  3DEX A;  2E0Q A;  3VK9 A;  4NPB A;  2GVP A;  3ZML A;  3FZ4 A;  4NXI A;  5DJL A;  4PQH A;  4EDZ A;  1M0U A;  1XPV A;  4GXZ A;  4KCE A;  5LD0 A;  5F05 A;  4KAE A;  4MJA A;  1G6W A;  2CX4 A;  2H0I A;  1PSQ A;  4RQR A;  5AIV A;  3F6F A;  2H6X A;  3GSS A;  4FH8 A;  3C71 A;  3F3R A;  2G2Q A;  4V1A p;  5HR2 A;  3APQ A;  3WGX A;  2FWG A;  5CP1 A;  4LMV A;  1XWG A;  4WBJ A;  2ZNM A;  2CVD A;  1XW5 A;  3UAR A;  2LJR A;  3L4N A;  5G2Z A;  3V1W A;  2YOI A;  2AYT A;  3CBU A;  3EUR A;  4JZQ A;  2HZE B;  2ALB A;  3HHV A;  2YZU A;  1GLQ A;  2B1K A;  2JAD A;  3VPQ A;  3FR6 A;  2CAI A;  1FHE A;  1WE0 A;  1Q98 A;  5DAL A;  4K2D A;  2YJ7 A;  5B8A A;  1AC1 A;  4EXJ A;  3H1N A;  1O8X A;  3DIE A;  2NPB A;  2K6V A;  4MPG A;  4CW9 A;  4NWY A;  1T1V A;  4HI7 A;  2H75 A;  1XOA A;  2LKU A;  4MP4 A;  4X43 A;  4NMU A;  5ECQ B;  2AV4 A;  1A2M A;  14GS A;  1LJR A;  2LNS A;  5IIZ A;  1S3C A;  1VF3 A;  1XWA A;  4EUY A;  1SJZ A;  4HDE A;  2ES7 A;  1X0R A;  2F51 A;  1A0R P;  1HNA A;  1UA5 A;  5G5E A;  2DJ1 A;  1GSQ A;  4KND A;  4MLY A;  3HZ4 A;  2V32 A;  3KZQ A;  2FGX A;  5CRG A;  12GS A;  1FW1 A;  3ZTL A;  1K0M A;  2RII A;  4TXV A;  4XTS A;  1SL1 B;  5ECM B;  4DEJ A;  5A5K A;  4FYC A;  3IAS 2;  4K0G A;  4XHM A;  1UVZ A;  3QAV A;  1ERU A;  5HR3 A;  1TRU A;  1SKW B;  3RPN A;  3HJO A;  1ERT A;  1A2L A;  3E9J B;  3FYG A;  5EY6 A;  2HSH A;  1XZO A;  2H8L A;  2QGV A;  3DKS A;  4XRD A;  3KM6 A;  3TDG A;  4TXO A;  5ECL B;  5ECP B;  2OA7 A;  3I6A A;  3SWL A;  2K8V A;  5ECR B;  3IOS A;  2XPD A;  4ZIJ A;  4TR4 A;  3DYR A;  3CMI A;  2L5L A;  3G7Y A;  2C4J A;  2JZS A;  4MZC A;  3C8E A;  5CRH A;  4N10 A;  3UOM A;  4EVM A;  1J9B A;  1SD9 A;  2CVK A;  2K18 A;  2H72 A;  5J41 A;  1B9Y C;  3E0U A;  5JWQ B;  1GRX A;  1M2B A;  1H75 A;  2FWE A;  2X8H A;  3HA9 A;  5D8I A;  3MDK A;  2IPA A;  3DVW A;  4OWY A;  6GST A;  2DJJ A;  2X8G A;  4BVX A;  1FAA A;  1BQ7 A;  4D73 B;  2B1L A;  1QMV A;  2EC4 A;  3GTU A;  1SJ6 A;  3UVT A;  2FLS A;  2GLR A;  4MJE A;  2JSY A;  3TUE A;  4GTU A;  1AIU A;  1SL2 B;  3KIJ A;  4ZB6 A;  13GS A;  2HLS A;  3N5O A;  2F9S A;  4IGJ A;  5GAN D;  3LSZ A;  3R2Q A;  2YCD A;  3GN3 A;  3P7X A;  5IMD A;  3DD3 A;  2PVO C;  2LRT A;  2E2G A;  3EVI A;  2L6C A;  2MBT A;  5KN1 A;  1UN2 A;  5DJM A;  5HR1 A;  1TRV A;  2GTU A;  2REM A;  1V40 A;  4TN8 A;  3P2A A;  1PA3 A;  2H0H A;  5EPF A;  2M80 A;  1QGV A;  1FOV A;  2JU5 A;  4EL1 A;  3ZVJ A;  3IBH A;  2QC7 A;  2V2G A;  4OCE A;  3EC3 A;  1OAZ A;  2BTO T;  2DJ0 A;  2OE1 A;  4AJ8 A;  1M9B A;  5LNK e;  3ZZX A;  4JE1 A;  1ACV A;  3CRT A;  3QR6 A;  4HQS A;  3BBY A;  1TU8 A;  3ZIJ A;  4TRX A;  4BPY A;  2MMA A;  1E6B A;  2C0F A;  2H01 A;  4BVY A;  1TI3 A;  3WT1 A;  5D96 A;  1GUH A;  1PL2 A;  3WT2 A;  2GT5 A;  3D22 A;  3BOA A;  2VD1 A;  2PN8 A;  2JL4 A;  1HYU A;  2DJ2 A;  5DCG A;  2E7P A;  4H86 A;  1ABA A;  3ZFL A;  3M1G A;  4RI6 A;  2O8V B;  2FWF A;  1GUK A;  2P0G A;  2IIY A;  2B7K A;  4KA0 A;  1GSU A;  5FHI A;  1PGT A;  2Z9S A;  1V98 A;  1G7E A;  3CTF A;  2LS5 A;  3MSZ A;  5ECS A;  2PBJ A;  3BCK A;  3D4M A;  5EL8 A;  3LXT A;  3IHQ A;  1NHO A;  2WJU A;  4O5R A;  1YZX A;  2VAF A;  4FYB A;  3J7Y b;  4K1F A;  3IK9 A;  4IBP A;  11GS A;  5GAP D;  2DBC A;  1M7T A;  4CDO A;  1GSD A;  2GT6 A;  1MTC A;  1VF4 A;  4IQ1 A;  3C73 A;  4KDU A;  3O6T A;  1XVQ A;  1WWJ A;  3O3T A;  4TR1 A;  3UEM A;  4WF5 A;  2L4Q A;  5LCZ A;  1PD2 1;  4POL A;  5KN3 A;  1V2A A;  1R7H A;  4IEL A;  4IP6 A;  1U6T A;  1WOU A;  3U6V A;  3ZMK A;  1A24 A;  1JZR A;  2HYX A;  1AAZ A;  4N0V A;  3QDN A;  1YF0 A;  3ZVJ D;  3VWW A;  5B8B A;  3LYP A;  3M9J A;  3QD9 A;  1HNB A;  1THO A;  2VCQ A;  5IPG A;  4ZB8 A;  3TRP A;  5CRD A;  3KEB A;  2FUG 2;  3WGD A;  1W89 A;  3MAK A;  1YEX A;  4XCS A;  1QFN A;  1OE8 A;  3F3Q A;  3A2V A;  3TKP A;  4TW5 A;  3GV1 A;  4MJC A;  4NV5 A;  4K7N A;  1DSB A;  3A5W A;  2CV4 A;  1J0F A;  1JZD A;  1JFU A;  4BA7 A;  3H8Q A;  1DBY A;  2DMM A;  1AQV A;  2IME A;  4AJ7 A;  1F3B A;  2K9F A;  3VI7 A;  4JR4 A;  4HJ2 A;  1A2J A;  3D6I A;  3KGK A;  1T7P B;  1QUW A;  3NZN A;  1DUG A;  3US3 A;  1PX7 A;  1SJI A;  3VLN A;  3GUR A;  1GNW A;  4G19 A;  3QOU A;  3LWA A;  2QKE A;  4ID0 A;  1BJX A;  5DQY A;  1WIK A;  1DE1 A;  2YWN A;  5CNW A;  4ZBD A;  2AAW A;  2MMO A;  2I9H A;  2YZH A;  2AHE A;  5FWG A;  1XWK A;  3VI5 A;  5ELA A;  2YPM A;  1A8L A;  4YAV A;  3TRX A;  2VIM A;  1XIY A;  4O92 A;  6GSS A;  1O81 A;  1RQM A;  1S3D A;  1B8X A;  1Z6N A;  4LLR A;  2V6O A;  2VLV A;  4IP1 A;  2PMT A;  4ISD A;  2ZUP A;  1MD3 A;  2VOC A;  4EC0 A;  4Q5F A;  3P90 A;  5G1K A;  1ZYE A;  5FT3 A;  4YQM A;  3KMO A;  5J9B A;  3PH9 A;  1ST9 A;  4GST A;  5CRW A;  2LQO A;  1WP0 A;  1VF1 A;  5E4W A;  3GKK A;  2N5B A;  3UAP A;  2IMD A;  3D5J A;  1A8Y A;  3TKS E;  5ID2 B;  3GX8 A;  3DGQ A;  4NHZ A;  2CVB A;  4ECI A;  2AJQ B;  3ED3 A;  1URM A;  3KTL A;  3TJK A;  1SYR A;  4KH7 A;  2GSQ A;  3KJY A;  2NBS A;  5E59 A;  3E3E A;  2AUV A;  3EU3 A;  4L0U A;  1K0A A;  1F6M C;  4GLT A;  4DSR A;  3RHC A;  5B7C A;  3VWX A;  3UJ1 A;  3A2X A;  1YEP A;  2YWO A;  3P8W A;  1SYX A;  2KP2 A;  5IMV A;  1GNE A;  2HE3 A;  3KH7 A;  2B5Y A;  3KCM A;  4QQ7 A;  1Z7P A;  1J08 A;  2GSR A;  1BAY A;  1K0N A;  3UL3 A;  1KNG A;  1TTZ A;  3DWV A;  3F6D A;  2IMF A;  2R2J A;  2I4A A;  2CT6 A;  5IOX A;  2L59 A;  1K3L A;  3U5R E;  4K8M A;  3NIV A;  4MJB A;  4BWS A;  3CXG A;  17GS A;  3Q18 A;  5DAK A;  3QCP A;  2FWH A;  3LOR A;  2O87 A;  2M72 A;  1EOH A;  3RDW A;  2H30 A;  4PUR A;  4ZL7 A;  2VL9 A;  4K7O A;  4MMM A;  1TW9 A;  3LG6 A;  4PUA A;  3RHB A;  3HYP A;  3MWH A;  3AY8 A;  5AGY A;  1JZO A;  2GQL A;  2CZ2 A;  2YNX A;  3W6G A;  4KB3 A;  5HFK A;  5ECH B;  4NV2 A;  5ABR A;  2X8C A;  4ILF A;  4LMW A;  4EE0 A;  2LRN A;  1XBS A;  5JCU A;  5HR0 A;  2VL2 C;  2AB6 A;  2C1Y A;  2J23 A;  1OC9 B;  3UIW A;  2YN1 A;  2QSI A;  5JCG A;  4PNG A;  3FZ5 A;  1BYE A;  2YV9 A;  4OFT A;  4Q5Q A;  4YH2 A;  4FO5 A;  3HKR A;  1THX A;  1ZMA A;  2KHP A;  1SKS B;  1GUL A;  5CAX A;  4N30 A;  2GZZ A;  7GSS A;  5H5Q A;  3ME7 A;  2MMN A;  2RUF A;  1EV4 A;  1E2Y A;  5IO0 A;  5H5S A;  3ZRE A;  1OYJ A;  2P31 A;  4DSS A;  2V41 A;  5H5R A;  4OO4 A;  2IFQ A;  3F63 A;  20GS A;  4RUV A;  4JED A;  5IMC A;  2KP1 A;  6GSX A;  3O76 A;  5HFI A;  1H4O A;  3KMN A;  2DC5 A;  4HZ4 A;  1PQN A;  2CA8 A;  5KN2 A;  5GSS A;  1M9A A;  4MA9 A;  1C72 A;  2GQM A;  3WD6 A;  1LBK A;  2FD3 A;  2EIR A;  1R26 A;  3IA1 A;  3CSJ A;  4L0W A;  3IRA A;  3QMX A;  2RM6 A;  2RUE A;  4XS4 A;  2CQ9 A;  1AW9 A;  2C0E A;  3WYW A;  3KD0 A;  4E8E A;  1M2A A;  3GL5 A;  4IS0 A;  4I97 A;  4HOJ A;  6GSV A;  1X9S B;  3CSI A;  1GH2 A;  1R5A A;  2EIO A;  2B5X A;  1V58 A;  18GS A;  5JCW A;  4MPF A;  1IYH A;  2MZC A;  1PKW A;  1G7O A;  1MDJ A;  4ECB A;  1SU9 A;  4KCA A;  1EGO A;  1JZW A;  4LL4 B;  3G7J A;  4TR0 A;  1VF2 A;  4YQV A;  5B6M A;  2MBS A;  2IMK A;  2PVQ A;  4KE3 A;  4YQU A;  2LJA A;  3D4T A;  3TOU A;  1NM3 A;  2FHE A;  3LEF A;  4ACS A;  4XS1 A;  4WR4 A;  3IC4 A;  2DIZ A;  4JBB A;  4J57 E;  3HJM A;  2GZP A;  5AIX A;  3ZIT A;  3IR4 A;  4TOP A;  1KEB A;  1WMJ A;  2H73 A;  5DBQ A;  3D0Z A;  4J56 E;  3QAW A;  1HD2 A;  1YKA A;  3GH9 A;  1R5P A;  2OAD A;  2H0G A;  3EMP A;  3EWL A;  1CQG A;  4GRF A;  1KTE A;  1TXX A;  2O85 A;  1RW1 A;  2VL2 A;  1EEM A;  5CO3 A;  2HRN A;  2L57 A;  4ZBA A;  2C3N A;  2JAC A;  3ZFB A;  1EGR A;  4V2M A;  1I9D A;  2L6D A;  1TP9 A;  4GQC A;  5F07 A;  5G30 A;  2HZE A;  3IK7 A;  6GSY A;  1K0C A;  4WEY A;  5J4U A;  1XW9 A;  1GSF A;  1ERV A;  2VUP A;  5DVB A;  2VLU A;  4POB A;  5J5N A;  4V1A g;  5ELG A;  4WKW A;  2TIR A;  3GKM A;  3PR8 A;  1X9M B;  5AN1 A;  1Z3E A;  4I5Q A;  3RAZ A;  5CRE A;  1GSS A;  2L4C A;  3FR3 A;  3EIN A;  1FB6 A;  2JZT A;  2VM1 A;  4TVE A;  1OE7 A;  2VD0 A;  2WUL A;  1T4Y A;  2XHF A;  3ERF A;  4HJM A;  4Q5N A;  3HD5 A;  2GZY A;  3L9V A;  1QK8 A;  2WGR A;  3ZRD A;  5DAL B;  1XVW A;  1XWB A;  2BMX A;  2WDU A;  4F82 A;  1XCC A;  4LL1 B;  4GQF A;  2DJK A;  2C3T A;  2NTO A;  1EZK A;  4TR3 A;  5G1L A;  8GSS A;  3ZLP A;  2GSS A;  2WRT A;  4BWQ A;  4WBR D;  3KXO A;  4QL7 A;  3C1R A;  4ZBB A;  3G9B A;  4KW6 A;  1OVN A;  1U87 A;  4Z7X A;  3I43 A;  3IPZ A;  3FW2 A;  2H70 A;  5GST A;  1ZGN A;  1VGL A;  2WS2 A;  3M8N A;  1JLV A;  3TJF A;  1N8J A;  1GSE A;  3GKN A;  2N5A A;  4I2U A;  4MH3 A;  2XBQ A; 
#chains in the Genus database with same CATH topology
 4G0L A;  3KH9 A;  3LGC A;  2HI7 A;  6GSW A;  5BRT A;  2LEG A;  3GH6 A;  3TCO A;  2WFC A;  1NW2 A;  1K0D A;  5D9X A;  1IYI A;  3GNJ A;  1QQ2 A;  4HEA 2;  3VPT A;  4XS6 A;  3FZA A;  1K3O A;  1Z6M A;  2H71 A;  2YWI A;  1N2A A;  4IHU A;  3QPM A;  2H1B A;  2H6Z A;  2MYG A;  1DE2 A;  3BJ5 A;  5ENU A;  4WXT A;  2YAN A;  3TKS C;  1UC7 A;  1OC8 A;  4OFN A;  3FEU A;  1USB A;  1F37 A;  3LXZ A;  1F3A A;  2P5Q A;  2OAC A;  4TXO B;  4G10 A;  4F03 A;  2B3S A;  2LJK A;  2R3X A;  2EIQ A;  3TKQ A;  5INY A;  2F8F A;  3F8U A;  5DQS A;  5J9C A;  4D73 A;  2TRC P;  1EV9 A;  3LQ7 A;  5D9W A;  2HRF A;  2IWT A;  4WF4 A;  3M0F A;  2KLX A;  1TOF A;  3ERG A;  1X5D A;  4OO5 A;  4F0B A;  2HZF A;  3G7I A;  2DML A;  1K0O A;  2O7K A;  3HVV A;  2VM2 A;  5DCH A;  3F9U A;  4AGS A;  1YQ1 A;  4BVX B;  1V57 A;  2VCZ A;  2VLT A;  3TOT A;  3GTU B;  1A0F A;  3HXS A;  1Z5Y E;  2H66 A;  3IV4 A;  1GL8 A;  3GUS A;  2GGT A;  2LTK A;  3GL3 A;  2GS3 A;  2P5R A;  2VCX A;  4IW9 A;  3J7Y k;  1WPI A;  3FHK A;  3LYK A;  1GWC A;  4KGI A;  5IQY A;  3TJJ A;  4F0C A;  2IL3 A;  2J9H A;  2H19 A;  2H1D A;  2K8S A;  1BG5 A;  4GF0 A;  2XPE A;  2WZ9 A;  3TRQ A;  4GSS A;  4ZL8 A;  2L5O A;  1OKD A;  5B6N A;  2C0D A;  3DVX A;  2QA1 A;  4MH2 A;  3QFB C;  4NHW A;  4GSN A;  3Q19 A;  1EWX A;  2NDO A;  4WET A;  1RK4 A;  3PGT A;  2R4V A;  1PKZ A;  4MF7 A;  3KP8 A;  5F06 A;  3ZL5 A;  2ON5 A;  1OKT A;  1O6J A;  4X1U A;  2CAQ A;  2FA4 A;  4YAP A;  3LJR A;  1TRS A;  1HQO A;  3VFI A;  2R5G A;  4EF0 A;  5A4U A;  1FG4 A;  5IO2 A;  2OJL A;  5KEJ A;  2KUC A;  5IMZ A;  3GA4 A;  3M3M A;  4WR5 A;  1ZYP A;  3F4R A;  1TDI A;  1O8W A;  2VO4 A;  3VWU A;  4BVY B;  2FA8 A;  1EEJ A;  3F4S A;  2H1A A;  3MNG A;  4IJI A;  5L71 A;  4MAB A;  4CHS A;  1GLP A;  1MDI A;  2NVL A;  1HNC A;  2LNT A;  4EO3 A;  2LST A;  3F4T A;  1GUM A;  2O89 A;  4PX1 A;  4I6X A;  3WGE A;  2I1U A;  3D21 A;  1X5E A;  2XBI A;  19GS A;  5DDL A;  3TKS A;  1U3A A;  3FY7 A;  4K9Z A;  2A2R A;  3OR5 A;  3TJB A;  1ZOF A;  3APS A;  5J3R A;  1SK2 A;  1OC3 A;  3CTG A;  4IQA A;  5ECI B;  3HZ8 A;  3F0I A;  1ZCP A;  3HJP A;  2ON7 A;  4IVF A;  4ZB9 A;  1XOB A;  1X5C A;  2OE0 A;  3DXB A;  22GS A;  3ZYW A;  2DLX A;  4POM A;  4KSM A;  1W4V A;  2BJX A;  4TR1 B;  1R4W A;  2R37 A;  3I69 A;  4HUA A;  1SD8 A;  3UVH A;  5EVO A;  4FYU A;  3NOF A;  3UMA A;  2A4V A;  3UBL A;  1XFL A;  5AIS A;  2DSA A;  3L0H A;  4I8B A;  3L9U A;  4GWR A;  1AQX A;  1JLW A;  2RM5 A;  1GTU A;  4EKZ A;  5G5F A;  2FNO A;  4OD7 A;  5C00 A;  3GMF A;  1GP1 A;  1Y25 A;  1XW6 A;  3EU4 A;  2C80 A;  4MZW A;  5IPH A;  3C1S A;  1TU7 A;  1G0T A;  3GIX A;  4IN0 A;  1EP7 A;  3EE2 A;  3IXR A;  1G6Y A;  2TRX A;  3FRC A;  3GHA A;  1O85 A;  1TK0 B;  4K6X A;  4KSO A;  4KX4 A;  1U3I A;  2F8A A;  2VL3 A;  2LQQ A;  5GZZ B;  1VRS D;  4JU5 A;  4HS1 A;  2WCI A;  1ON4 A;  3GKX A;  1GTI A;  1T3B A;  3C7M A;  5G31 A;  1AUC A;  6GSU A;  2PER A;  3TKR A;  1M99 A;  2HNL A;  1KBN A;  2XC2 A;  3MYD A;  4MCU A;  3KP9 A;  3HVS A;  3A3T A;  4ZXG A;  4HU7 A;  4IJ3 A;  4AJ6 A;  4LA1 A;  1TK8 B;  2YP6 A;  2I81 A;  4PUF C;  5HFG A;  5D93 A;  1Z9H A;  2H76 A;  5JWO B;  3CYN A;  4ML1 A;  1X9W B;  4O7H A;  2R6K A;  1O73 A;  2R0C A;  3HDC A;  5KN0 A;  4IKH A;  2B5E A;  4G2E A;  1MD4 A;  1B48 A;  3H4K A;  4K7I A;  4NAX A;  5IM9 A;  4MF6 A;  4RQX A;  2H6Y A;  2H1G A;  4RI7 A;  4G9H A;  3RPP A;  4KUN A;  5A4V A;  1AXD A;  3Q74 A;  2OKA A;  4FIW A;  1SKR B;  3GFK A;  4QL9 A;  1BED A;  4TKY A;  1A23 A;  5IOW A;  5CYY A;  2CZ3 A;  4HU9 A;  1YY7 A;  1T00 A;  3CRU A;  5ID2 A;  4L5O A;  3JCM L;  3GX0 A;  2GST A;  4J2F A;  1YKC A;  4OCF A;  3HY2 A;  2HFD A;  5IMA A;  1T8E B;  3ISO A;  4F9Z A;  2E2M A;  2PWJ A;  5COH A;  3HVX A;  1F9M A;  3IHG A;  4XIH A;  1ZYQ B;  4MZB A;  3BCI A;  1PN9 A;  4PXO A;  1Y6E A;  1M3J A;  1TI1 A;  3EYT A;  3FZ9 A;  1PL1 A;  2B6M A;  3FR9 A;  5ECN B;  1TKD B;  2FY6 A;  3W8J A;  1XXU A;  3Q6O A;  4KDX A;  2HT9 A;  5F8B A;  4P3Y B;  4ECJ A;  1SL0 B;  4HQZ A;  4N11 A;  3W8S A;  1NSW A;  3N9J A;  3H79 A;  4HZ2 A;  3TB2 A;  1I5G A;  1B4Q A;  1QXH A;  4I2T A;  1FVK A;  1YDK A;  4HSC X;  4L8E A;  2GDR A;  2F3M A;  3A2W A;  4OMV A;  3KTB A;  2PUK C;  1ML6 A;  2G0F A;  1EOG A;  2C0G A;  1K3Y A;  2PPT A;  1K0B A;  2MMZ A;  1SK0 A;  5HQP A;  4AF2 A;  2KOK A;  1S3R A;  3DRN A;  4GCI A;  1MDK A;  5D9V A;  2DIY A;  3FKF A;  3ME8 A;  1GSY A;  2H74 A;  2A2S A;  3VWV A;  1Q4J A;  2V6K A;  3RBT A;  3L78 A;  1ZZY A;  5A4W A;  3L9S A;  4USS A;  2VCW A;  3EMX A;  4E8H A;  3IDV A;  5DAK B;  1S3A A;  3VUR A;  1TK5 B;  1EP8 A;  2X99 A;  5D73 A;  9GSS A;  4K0N A;  4MF5 A;  1SK1 A;  2RLI A;  2HRK A;  1PX6 A;  1GTB A;  1NHY A;  1XWC A;  1B4P A;  1OC9 A;  2YV7 A;  4BL7 A;  2X64 A;  1FO5 A;  2C3Q A;  1V9W A;  3FK8 A;  2JZR A;  4JRR A;  4OFM A;  3M9K A;  3IE3 A;  4EDY A;  3GST A;  4DVC A;  10GS A;  2VCT A;  1YF1 A;  3TGZ A;  2GQK A;  1TJD A;  1JHB A;  2A2P A;  3HCZ A;  1MEK A;  4MDC A;  3DML A;  1ERW A;  4V2L A;  3ERW A;  4ZIL A;  2LUS A;  2PGT A;  4ML6 A;  1GTA A;  1FB0 A;  1CQH A;  3APO A;  4XRA A;  4PQI A;  2LV3 A;  3GRX A;  2B7J A;  1PRX A;  5F0G A;  3PIN A;  1WRY A;  3TJG A;  2CX3 A;  2ZCT A;  3A5I A;  4DSS B;  4MK3 A;  1SEN A;  4Q5R A;  2IFQ B;  3SBC A;  5ECK B;  1M2D A;  4ULX A;  1WJK A;  2PU9 C;  4K2X A;  5C04 A;  1FVJ A;  2V1M A;  2N5F A;  2YWM A;  1AQW A;  1BX9 A;  2IMI A;  2C8U A;  2LRC A;  1PMT A;  4V2N A;  3GYK A;  2M46 A;  1F2E A;  2UZ8 A;  1Z7R A;  2JSZ A;  1O7U A;  2DJ3 A;  2YJH A;  1U88 A;  2D2Z A;  1ILO A;  1T4Z A;  3H93 A;  4ICY A;  4Z2R A;  4L5L A;  2IN3 A;  4O32 A;  5ECO B;  4DSQ A;  4JR6 A;  3K8N A;  4XS4 B;  1ZL9 A;  4POK A;  4PGT A;  1TRW A;  5JWR B;  4ZL9 A;  3QFA C;  2IJY A;  5IMF A;  16GS A;  2VCV A;  3QAG A;  4KDY A;  4N0Z A;  3ZIV A;  3CSH A;  3IAM 2;  4PQ1 A;  3S9F A;  4X0X A;  4F2I A;  2OBK A;  5D9T A;  2WB9 A;  2OE3 A;  1LU4 A;  2I3Y A;  2OBI A;  3UBK A;  2FCH A;  1YJ6 A;  3I9V 2;  3BD2 A;  4ECC A;  1B9X C;  2HXK A;  4PNF A;  2HSY A;  3LFL A;  3DEX A;  2E0Q A;  3VK9 A;  4NPB A;  2GVP A;  3ZML A;  3FZ4 A;  4NXI A;  5DJL A;  4PQH A;  4EDZ A;  1M0U A;  1XPV A;  4GXZ A;  4KCE A;  5LD0 A;  5F05 A;  4KAE A;  4MJA A;  1G6W A;  2CX4 A;  1FOH A;  2H0I A;  1PSQ A;  4RQR A;  5AIV A;  3F6F A;  2H6X A;  3GSS A;  4FH8 A;  3C71 A;  3F3R A;  4YKG A;  2G2Q A;  4V1A p;  5HR2 A;  3APQ A;  3WGX A;  2FWG A;  5CP1 A;  4LMV A;  1XWG A;  4WBJ A;  2ZNM A;  2CVD A;  1XW5 A;  3UAR A;  2LJR A;  4K5R A;  3L4N A;  5G2Z A;  3V1W A;  2YOI A;  2AYT A;  3CBU A;  3EUR A;  4JZQ A;  2HZE B;  2ALB A;  3HHV A;  2YZU A;  1GLQ A;  2B1K A;  2JAD A;  3VPQ A;  3FR6 A;  2CAI A;  1FHE A;  1WE0 A;  1Q98 A;  5DAL A;  4FQU A;  4K2D A;  2YJ7 A;  5B8A A;  1AC1 A;  4EXJ A;  3H1N A;  1O8X A;  3DIE A;  2NPB A;  2K6V A;  4MPG A;  4CW9 A;  4NWY A;  1T1V A;  4HI7 A;  2H75 A;  1XOA A;  2LKU A;  4MP4 A;  4X43 A;  4NMU A;  5ECQ B;  2AV4 A;  1A2M A;  14GS A;  1LJR A;  2LNS A;  5IIZ A;  1S3C A;  1VF3 A;  1XWA A;  4EUY A;  1SJZ A;  4HDE A;  2ES7 A;  1X0R A;  2F51 A;  1A0R P;  1HNA A;  1UA5 A;  5G5E A;  2DJ1 A;  1GSQ A;  4KND A;  4MLY A;  3HZ4 A;  2V32 A;  3KZQ A;  2FGX A;  5CRG A;  12GS A;  1FW1 A;  3ZTL A;  1K0M A;  2RII A;  4TXV A;  4XTS A;  1SL1 B;  5ECM B;  4YKF A;  4DEJ A;  5A5K A;  4FYC A;  3IAS 2;  4K0G A;  4XHM A;  1UVZ A;  3QAV A;  1ERU A;  5HR3 A;  1TRU A;  1SKW B;  3RPN A;  3HJO A;  1ERT A;  1A2L A;  3E9J B;  3FYG A;  5EY6 A;  4BIK A;  2HSH A;  1XZO A;  2H8L A;  2QGV A;  3DKS A;  4XRD A;  3KM6 A;  3TDG A;  4TXO A;  5ECL B;  5ECP B;  2OA7 A;  3I6A A;  3SWL A;  2K8V A;  5ECR B;  3IOS A;  3HVN A;  2XPD A;  4ZIJ A;  4TR4 A;  3DYR A;  3CMI A;  2L5L A;  3G7Y A;  3R3E A;  2C4J A;  2JZS A;  4MZC A;  3C8E A;  5CRH A;  4N10 A;  3UOM A;  4EVM A;  1J9B A;  1SD9 A;  2CVK A;  2K18 A;  2H72 A;  5J41 A;  1B9Y C;  3E0U A;  5JWQ B;  2X49 A;  1GRX A;  1M2B A;  1H75 A;  2FWE A;  2X8H A;  3HA9 A;  5D8I A;  3MDK A;  2IPA A;  3DVW A;  4OWY A;  6GST A;  2DJJ A;  2X8G A;  4BVX A;  1FAA A;  1BQ7 A;  4D73 B;  2B1L A;  1QMV A;  2EC4 A;  3GTU A;  1SJ6 A;  3UVT A;  2FLS A;  2GLR A;  4MJE A;  2JSY A;  3TUE A;  4GTU A;  4CY6 A;  1AIU A;  1SL2 B;  3KIJ A;  4ZB6 A;  13GS A;  2HLS A;  3N5O A;  2F9S A;  4IGJ A;  5GAN D;  2QA2 A;  3LSZ A;  3R2Q A;  2YCD A;  3GN3 A;  3P7X A;  5IMD A;  4G0K A;  3DD3 A;  2PVO C;  2LRT A;  2E2G A;  3EVI A;  2L6C A;  2MBT A;  5KN1 A;  1UN2 A;  5DJM A;  5HR1 A;  1TRV A;  2GTU A;  2REM A;  1V40 A;  4TN8 A;  3P2A A;  1PA3 A;  2H0H A;  5EPF A;  2A4H A;  2M80 A;  1QGV A;  1FOV A;  2JU5 A;  4EL1 A;  3ZVJ A;  3EPT A;  3IBH A;  2QC7 A;  2V2G A;  4OCE A;  3EC3 A;  1OAZ A;  2BTO T;  2DJ0 A;  2OE1 A;  4AJ8 A;  1M9B A;  4K5S A;  5LNK e;  3ZZX A;  4JE1 A;  1ACV A;  3CRT A;  3QR6 A;  4HQS A;  3BBY A;  3LW9 A;  1TU8 A;  3ZIJ A;  4TRX A;  4BPY A;  2MMA A;  1E6B A;  2C0F A;  2H01 A;  4BVY A;  1TI3 A;  3WT1 A;  5D96 A;  4Z2T A;  1GUH A;  1PL2 A;  3WT2 A;  2GT5 A;  3D22 A;  3BOA A;  2VD1 A;  2PN8 A;  2JL4 A;  1HYU A;  2DJ2 A;  5DCG A;  2E7P A;  4H86 A;  1ABA A;  3ZFL A;  3M1G A;  4RI6 A;  2O8V B;  2FWF A;  1GUK A;  2P0G A;  2IIY A;  2B7K A;  4KA0 A;  1GSU A;  5FHI A;  1PGT A;  2Z9S A;  1V98 A;  1G7E A;  3CTF A;  2LS5 A;  3MSZ A;  5ECS A;  2PBJ A;  3BCK A;  3D4M A;  5EL8 A;  3LXT A;  3IHQ A;  1NHO A;  2WJU A;  4O5R A;  1YZX A;  2VAF A;  4FYB A;  3J7Y b;  4K1F A;  3IK9 A;  4IBP A;  11GS A;  5GAP D;  2DBC A;  1M7T A;  4CDO A;  1GSD A;  2GT6 A;  1MTC A;  1VF4 A;  4IQ1 A;  3C73 A;  4KDU A;  3O6T A;  1XVQ A;  1WWJ A;  3O3T A;  4TR1 A;  3PPU A;  3UEM A;  4WF5 A;  2L4Q A;  5LCZ A;  1PD2 1;  4POL A;  5KN3 A;  1V2A A;  1R7H A;  4IEL A;  4IP6 A;  4CY8 A;  1U6T A;  1WOU A;  3U6V A;  3ZMK A;  1A24 A;  1JZR A;  2HYX A;  1AAZ A;  4N0V A;  3QDN A;  1YF0 A;  3ZVJ D;  3VWW A;  5B8B A;  3LYP A;  3M9J A;  3QD9 A;  1HNB A;  1THO A;  2VCQ A;  5IPG A;  4ZB8 A;  3TRP A;  5CRD A;  3KEB A;  2FUG 2;  3WGD A;  1W89 A;  3MAK A;  1YEX A;  4XCS A;  1QFN A;  1OE8 A;  3F3Q A;  3A2V A;  3TKP A;  4TW5 A;  4MNN A;  3GV1 A;  4MJC A;  4NV5 A;  4K7N A;  1DSB A;  3A5W A;  2CV4 A;  1J0F A;  1JZD A;  1JFU A;  4BA7 A;  3H8Q A;  1DBY A;  2DMM A;  1AQV A;  2IME A;  4AJ7 A;  1F3B A;  2K9F A;  3VI7 A;  4JR4 A;  4HJ2 A;  1A2J A;  3D6I A;  3KGK A;  1T7P B;  1QUW A;  3NZN A;  1DUG A;  3US3 A;  1PX7 A;  1SJI A;  3VLN A;  3GUR A;  1GNW A;  4G19 A;  3QOU A;  3LWA A;  2QKE A;  4ID0 A;  1BJX A;  1M3I A;  5DQY A;  1WIK A;  1DE1 A;  2YWN A;  5CNW A;  4ZBD A;  2AAW A;  2MMO A;  2I9H A;  2YZH A;  2AHE A;  5FWG A;  1XWK A;  3VI5 A;  5ELA A;  2YPM A;  1A8L A;  4YAV A;  3TRX A;  2VIM A;  1XIY A;  4O92 A;  6GSS A;  1O81 A;  1RQM A;  1S3D A;  1B8X A;  1Z6N A;  4LLR A;  2V6O A;  2VLV A;  4IP1 A;  2PMT A;  4ISD A;  2ZUP A;  1MD3 A;  2VOC A;  4EC0 A;  4Q5F A;  3P90 A;  5G1K A;  1ZYE A;  5FT3 A;  4YQM A;  3KMO A;  5J9B A;  3PH9 A;  1ST9 A;  4GST A;  5CRW A;  2LQO A;  1WP0 A;  1VF1 A;  5E4W A;  3GKK A;  2N5B A;  3UAP A;  2IMD A;  3D5J A;  1A8Y A;  3TKS E;  5ID2 B;  3GX8 A;  3DGQ A;  4NHZ A;  2CVB A;  4ECI A;  2AJQ B;  3ED3 A;  1URM A;  3KTL A;  3TJK A;  1SYR A;  4KH7 A;  2GSQ A;  3KJY A;  2NBS A;  5E59 A;  3E3E A;  2AUV A;  3EU3 A;  4L0U A;  1K0A A;  1F6M C;  4GLT A;  4DSR A;  3RHC A;  5B7C A;  3VWX A;  3UJ1 A;  3A2X A;  2DKI A;  1YEP A;  2YWO A;  3P8W A;  1SYX A;  2KP2 A;  5IMV A;  1GNE A;  2HE3 A;  3KH7 A;  2B5Y A;  3KCM A;  4QQ7 A;  1Z7P A;  1J08 A;  2GSR A;  1BAY A;  1K0N A;  3UL3 A;  1KNG A;  1TTZ A;  3DWV A;  3F6D A;  2IMF A;  2R2J A;  2I4A A;  2CT6 A;  5IOX A;  2L59 A;  1K3L A;  3U5R E;  4K8M A;  3NIV A;  4MJB A;  4BWS A;  3CXG A;  17GS A;  3Q18 A;  5DAK A;  3QCP A;  2FWH A;  3CQF A;  2X4A A;  3LOR A;  2O87 A;  2M72 A;  1EOH A;  4Z2U A;  3RDW A;  2H30 A;  4PUR A;  4ZL7 A;  2VL9 A;  4K7O A;  4MMM A;  1TW9 A;  3LG6 A;  4PUA A;  3RHB A;  3HYP A;  3MWH A;  3AY8 A;  5AGY A;  1JZO A;  2GQL A;  2CZ2 A;  2YNX A;  3W6G A;  4KB3 A;  5HFK A;  5ECH B;  4NV2 A;  5ABR A;  2X8C A;  4ILF A;  4LMW A;  4EE0 A;  2LRN A;  1XBS A;  5JCU A;  4EIP A;  5HR0 A;  2VL2 C;  2AB6 A;  2C1Y A;  2J23 A;  1OC9 B;  3UIW A;  4BL7 B;  2YN1 A;  2QSI A;  5JCG A;  4PNG A;  3FZ5 A;  1BYE A;  2YV9 A;  4OFT A;  4Q5Q A;  4YH2 A;  4FO5 A;  3HKR A;  1THX A;  1ZMA A;  2KHP A;  3IC8 A;  1SKS B;  1GUL A;  5CAX A;  4N30 A;  2GZZ A;  7GSS A;  4X4J A;  5H5Q A;  3ME7 A;  2MMN A;  2RUF A;  1EV4 A;  1E2Y A;  5BMU A;  5IO0 A;  5H5S A;  3ZRE A;  1OYJ A;  2P31 A;  4DSS A;  2V41 A;  5KOX A;  5H5R A;  4OO4 A;  2IFQ A;  3F63 A;  20GS A;  4RUV A;  4JED A;  5IMC A;  2KP1 A;  6GSX A;  3O76 A;  5HFI A;  1H4O A;  3KMN A;  2DC5 A;  4HZ4 A;  1PQN A;  2CA8 A;  3FMW A;  5KN2 A;  5GSS A;  1M9A A;  2HRA A;  4MA9 A;  1C72 A;  2GQM A;  4PTS A;  3WD6 A;  1LBK A;  2FD3 A;  2EIR A;  1R26 A;  3IA1 A;  3CSJ A;  4L0W A;  3IRA A;  3QMX A;  2RM6 A;  2RUE A;  4XS4 A;  2CQ9 A;  1AW9 A;  2C0E A;  3WYW A;  3KD0 A;  4E8E A;  5KOW A;  1M2A A;  3GL5 A;  4IS0 A;  4I97 A;  4HOJ A;  6GSV A;  1X9S B;  3CSI A;  1GH2 A;  1R5A A;  2EIO A;  4O5Q A;  2B5X A;  1V58 A;  4KF9 A;  18GS A;  1PN0 A;  5JCW A;  4MPF A;  1IYH A;  2MZC A;  1PKW A;  1G7O A;  1MDJ A;  4ECB A;  1SU9 A;  4KCA A;  1EGO A;  1JZW A;  4LL4 B;  3G7J A;  4TR0 A;  1VF2 A;  4YQV A;  5B6M A;  2MBS A;  2IMK A;  2PVQ A;  4KE3 A;  4YQU A;  2LJA A;  3D4T A;  1XG8 A;  3TOU A;  4A5P A;  1NM3 A;  2FHE A;  4O5U A;  3LEF A;  2DKH A;  4ACS A;  4XS1 A;  4WR4 A;  3IC4 A;  2DIZ A;  4JBB A;  4J57 E;  3HJM A;  2GZP A;  5AIX A;  3ZIT A;  3IR4 A;  4TOP A;  1KEB A;  1WMJ A;  2H73 A;  5DBQ A;  3D0Z A;  4J56 E;  3QAW A;  1HD2 A;  1YKA A;  3GH9 A;  1R5P A;  2OAD A;  2H0G A;  3EMP A;  3EWL A;  1CQG A;  4GRF A;  1KTE A;  1TXX A;  2O85 A;  1RW1 A;  2VL2 A;  4EIQ A;  1EEM A;  5CO3 A;  2HRN A;  2L57 A;  4ZBA A;  2C3N A;  2JAC A;  3ZFB A;  1EGR A;  4V2M A;  1I9D A;  2L6D A;  1TP9 A;  4GQC A;  5F07 A;  5G30 A;  2HZE A;  3IK7 A;  6GSY A;  1K0C A;  4WEY A;  5J4U A;  1XW9 A;  1GSF A;  1ERV A;  2VUP A;  5DVB A;  2VLU A;  4POB A;  5J5N A;  4V1A g;  5ELG A;  4WKW A;  2TIR A;  3GKM A;  3PR8 A;  1X9M B;  5AN1 A;  1Z3E A;  4I5Q A;  3RAZ A;  5CRE A;  1GSS A;  2L4C A;  3FR3 A;  3EIN A;  1FB6 A;  2JZT A;  2R0P A;  2VM1 A;  4TVE A;  1OE7 A;  2VD0 A;  2WUL A;  1T4Y A;  2XHF A;  3ERF A;  4HJM A;  4Q5N A;  3HD5 A;  1PFO A;  2GZY A;  3L9V A;  1QK8 A;  2WGR A;  2HSM A;  3ZRD A;  5DAL B;  1XVW A;  3MIX A;  1XWB A;  2BMX A;  2WDU A;  4F82 A;  1XCC A;  4LL1 B;  2R0G A;  4GQF A;  2DJK A;  2C3T A;  2NTO A;  1EZK A;  4TR3 A;  5G1L A;  8GSS A;  3ZLP A;  2GSS A;  2WRT A;  4BWQ A;  4WBR D;  3KXO A;  4QL7 A;  1ZYN A;  3C1R A;  4ZBB A;  3G9B A;  4KW6 A;  1OVN A;  1U87 A;  4Z7X A;  3I43 A;  3IPZ A;  3FW2 A;  2H70 A;  5GST A;  1ZGN A;  1VGL A;  2WS2 A;  3M8N A;  1JLV A;  3TJF A;  1N8J A;  1GSE A;  3GKN A;  4G0I A;  2N5A A;  4I2U A;  4MH3 A;  2XBQ A; 
#chains in the Genus database with same CATH homology
 4G0L A;  3KH9 A;  3LGC A;  2HI7 A;  6GSW A;  5BRT A;  2LEG A;  3GH6 A;  3TCO A;  2WFC A;  1NW2 A;  1K0D A;  5D9X A;  1IYI A;  3GNJ A;  1QQ2 A;  4HEA 2;  3VPT A;  4XS6 A;  3FZA A;  1K3O A;  1Z6M A;  2H71 A;  2YWI A;  1N2A A;  4IHU A;  3QPM A;  2H1B A;  2H6Z A;  2MYG A;  1DE2 A;  3BJ5 A;  5ENU A;  4WXT A;  2YAN A;  3TKS C;  1UC7 A;  1OC8 A;  4OFN A;  3FEU A;  1USB A;  1F37 A;  3LXZ A;  1F3A A;  2P5Q A;  2OAC A;  4TXO B;  4G10 A;  4F03 A;  2B3S A;  2LJK A;  2R3X A;  2EIQ A;  3TKQ A;  5INY A;  2F8F A;  3F8U A;  5DQS A;  5J9C A;  4D73 A;  2TRC P;  1EV9 A;  3LQ7 A;  5D9W A;  2HRF A;  2IWT A;  4WF4 A;  3M0F A;  2KLX A;  1TOF A;  3ERG A;  1X5D A;  4OO5 A;  4F0B A;  2HZF A;  3G7I A;  2DML A;  1K0O A;  2O7K A;  3HVV A;  2VM2 A;  5DCH A;  3F9U A;  4AGS A;  1YQ1 A;  4BVX B;  1V57 A;  2VCZ A;  2VLT A;  3TOT A;  3GTU B;  1A0F A;  3HXS A;  1Z5Y E;  2H66 A;  3IV4 A;  1GL8 A;  3GUS A;  2GGT A;  2LTK A;  3GL3 A;  2GS3 A;  2P5R A;  2VCX A;  4IW9 A;  3J7Y k;  1WPI A;  3FHK A;  3LYK A;  1GWC A;  4KGI A;  5IQY A;  3TJJ A;  4F0C A;  2IL3 A;  2J9H A;  2H19 A;  2H1D A;  2K8S A;  1BG5 A;  4GF0 A;  2XPE A;  2WZ9 A;  3TRQ A;  4GSS A;  4ZL8 A;  2L5O A;  1OKD A;  5B6N A;  2C0D A;  3DVX A;  2QA1 A;  4MH2 A;  3QFB C;  4NHW A;  4GSN A;  3Q19 A;  1EWX A;  2NDO A;  4WET A;  1RK4 A;  3PGT A;  2R4V A;  1PKZ A;  4MF7 A;  3KP8 A;  5F06 A;  3ZL5 A;  2ON5 A;  1OKT A;  1O6J A;  4X1U A;  2CAQ A;  2FA4 A;  4YAP A;  3LJR A;  1TRS A;  1HQO A;  3VFI A;  2R5G A;  4EF0 A;  5A4U A;  1FG4 A;  5IO2 A;  2OJL A;  5KEJ A;  2KUC A;  5IMZ A;  3GA4 A;  3M3M A;  4WR5 A;  1ZYP A;  3F4R A;  1TDI A;  1O8W A;  2VO4 A;  3VWU A;  4BVY B;  2FA8 A;  1EEJ A;  3F4S A;  2H1A A;  3MNG A;  4IJI A;  5L71 A;  4MAB A;  4CHS A;  1GLP A;  1MDI A;  2NVL A;  1HNC A;  2LNT A;  4EO3 A;  2LST A;  3F4T A;  1GUM A;  2O89 A;  4PX1 A;  4I6X A;  3WGE A;  2I1U A;  3D21 A;  1X5E A;  2XBI A;  19GS A;  5DDL A;  3TKS A;  1U3A A;  3FY7 A;  4K9Z A;  2A2R A;  3OR5 A;  3TJB A;  1ZOF A;  3APS A;  5J3R A;  1SK2 A;  1OC3 A;  3CTG A;  4IQA A;  5ECI B;  3HZ8 A;  3F0I A;  1ZCP A;  3HJP A;  2ON7 A;  4IVF A;  4ZB9 A;  1XOB A;  1X5C A;  2OE0 A;  3DXB A;  22GS A;  3ZYW A;  2DLX A;  4POM A;  4KSM A;  1W4V A;  2BJX A;  4TR1 B;  1R4W A;  2R37 A;  3I69 A;  4HUA A;  1SD8 A;  3UVH A;  5EVO A;  4FYU A;  3NOF A;  3UMA A;  2A4V A;  3UBL A;  1XFL A;  5AIS A;  2DSA A;  3L0H A;  4I8B A;  3L9U A;  4GWR A;  1AQX A;  1JLW A;  2RM5 A;  1GTU A;  4EKZ A;  5G5F A;  2FNO A;  4OD7 A;  5C00 A;  3GMF A;  1GP1 A;  1Y25 A;  1XW6 A;  3EU4 A;  2C80 A;  4MZW A;  5IPH A;  3C1S A;  1TU7 A;  1G0T A;  3GIX A;  4IN0 A;  1EP7 A;  3EE2 A;  3IXR A;  1G6Y A;  2TRX A;  3FRC A;  3GHA A;  1O85 A;  1TK0 B;  4K6X A;  4KSO A;  4KX4 A;  1U3I A;  2F8A A;  2VL3 A;  2LQQ A;  5GZZ B;  1VRS D;  4JU5 A;  4HS1 A;  2WCI A;  1ON4 A;  3GKX A;  1GTI A;  1T3B A;  3C7M A;  5G31 A;  1AUC A;  6GSU A;  2PER A;  3TKR A;  1M99 A;  2HNL A;  1KBN A;  2XC2 A;  3MYD A;  4MCU A;  3KP9 A;  3HVS A;  3A3T A;  4ZXG A;  4HU7 A;  4IJ3 A;  4AJ6 A;  4LA1 A;  1TK8 B;  2YP6 A;  2I81 A;  4PUF C;  5HFG A;  5D93 A;  1Z9H A;  2H76 A;  5JWO B;  3CYN A;  4ML1 A;  1X9W B;  4O7H A;  2R6K A;  1O73 A;  2R0C A;  3HDC A;  5KN0 A;  4IKH A;  2B5E A;  4G2E A;  1MD4 A;  1B48 A;  3H4K A;  4K7I A;  4NAX A;  5IM9 A;  4MF6 A;  4RQX A;  2H6Y A;  2H1G A;  4RI7 A;  4G9H A;  3RPP A;  4KUN A;  5A4V A;  1AXD A;  3Q74 A;  2OKA A;  4FIW A;  1SKR B;  3GFK A;  4QL9 A;  1BED A;  4TKY A;  1A23 A;  5IOW A;  5CYY A;  2CZ3 A;  4HU9 A;  1YY7 A;  1T00 A;  3CRU A;  5ID2 A;  4L5O A;  3JCM L;  3GX0 A;  2GST A;  4J2F A;  1YKC A;  4OCF A;  3HY2 A;  2HFD A;  5IMA A;  1T8E B;  3ISO A;  4F9Z A;  2E2M A;  2PWJ A;  5COH A;  3HVX A;  1F9M A;  3IHG A;  4XIH A;  1ZYQ B;  4MZB A;  3BCI A;  1PN9 A;  4PXO A;  1Y6E A;  1TI1 A;  3EYT A;  3FZ9 A;  1PL1 A;  2B6M A;  3FR9 A;  5ECN B;  1TKD B;  2FY6 A;  3W8J A;  1XXU A;  3Q6O A;  4KDX A;  2HT9 A;  5F8B A;  4P3Y B;  4ECJ A;  1SL0 B;  4HQZ A;  4N11 A;  3W8S A;  1NSW A;  3N9J A;  3H79 A;  4HZ2 A;  3TB2 A;  1I5G A;  1B4Q A;  1QXH A;  4I2T A;  1FVK A;  1YDK A;  4L8E A;  2GDR A;  2F3M A;  3A2W A;  4OMV A;  3KTB A;  2PUK C;  1ML6 A;  2G0F A;  1EOG A;  2C0G A;  1K3Y A;  2PPT A;  1K0B A;  2MMZ A;  1SK0 A;  5HQP A;  4AF2 A;  2KOK A;  3DRN A;  4GCI A;  1MDK A;  5D9V A;  2DIY A;  3FKF A;  3ME8 A;  1GSY A;  2H74 A;  2A2S A;  3VWV A;  1Q4J A;  2V6K A;  3RBT A;  3L78 A;  1ZZY A;  5A4W A;  3L9S A;  4USS A;  2VCW A;  3EMX A;  4E8H A;  3IDV A;  5DAK B;  1S3A A;  3VUR A;  1TK5 B;  1EP8 A;  5D73 A;  2X99 A;  9GSS A;  4K0N A;  4MF5 A;  1SK1 A;  2RLI A;  2HRK A;  1PX6 A;  1GTB A;  1NHY A;  1XWC A;  1B4P A;  1OC9 A;  2YV7 A;  4BL7 A;  2X64 A;  1FO5 A;  2C3Q A;  1V9W A;  3FK8 A;  2JZR A;  4JRR A;  4OFM A;  3M9K A;  3IE3 A;  4EDY A;  3GST A;  4DVC A;  10GS A;  2VCT A;  1YF1 A;  3TGZ A;  2GQK A;  1TJD A;  1JHB A;  2A2P A;  3HCZ A;  1MEK A;  4MDC A;  3DML A;  1ERW A;  4V2L A;  3ERW A;  4ZIL A;  2LUS A;  2PGT A;  4ML6 A;  1GTA A;  1FB0 A;  1CQH A;  3APO A;  4XRA A;  4PQI A;  2LV3 A;  3GRX A;  2B7J A;  1PRX A;  5F0G A;  3PIN A;  1WRY A;  3TJG A;  2CX3 A;  2ZCT A;  3A5I A;  4DSS B;  4MK3 A;  1SEN A;  4Q5R A;  2IFQ B;  3SBC A;  5ECK B;  1M2D A;  4ULX A;  1WJK A;  2PU9 C;  4K2X A;  5C04 A;  1FVJ A;  2V1M A;  2N5F A;  2YWM A;  1AQW A;  1BX9 A;  2IMI A;  2C8U A;  2LRC A;  1PMT A;  4V2N A;  3GYK A;  2M46 A;  1F2E A;  2UZ8 A;  1Z7R A;  2JSZ A;  1O7U A;  2DJ3 A;  2YJH A;  1U88 A;  2D2Z A;  1ILO A;  1T4Z A;  3H93 A;  4ICY A;  4Z2R A;  4L5L A;  2IN3 A;  4O32 A;  5ECO B;  4DSQ A;  4JR6 A;  3K8N A;  4XS4 B;  1ZL9 A;  4POK A;  4PGT A;  1TRW A;  5JWR B;  4ZL9 A;  3QFA C;  2IJY A;  5IMF A;  16GS A;  2VCV A;  3QAG A;  4KDY A;  4N0Z A;  3ZIV A;  3CSH A;  3IAM 2;  4PQ1 A;  3S9F A;  4X0X A;  4F2I A;  2OBK A;  5D9T A;  2WB9 A;  2OE3 A;  1LU4 A;  2I3Y A;  2OBI A;  3UBK A;  2FCH A;  1YJ6 A;  3I9V 2;  3BD2 A;  4ECC A;  1B9X C;  2HXK A;  4PNF A;  2HSY A;  3LFL A;  3DEX A;  2E0Q A;  3VK9 A;  4NPB A;  2GVP A;  3ZML A;  3FZ4 A;  4NXI A;  5DJL A;  4PQH A;  4EDZ A;  1M0U A;  1XPV A;  4GXZ A;  4KCE A;  5LD0 A;  5F05 A;  4KAE A;  4MJA A;  1G6W A;  2CX4 A;  1FOH A;  2H0I A;  1PSQ A;  4RQR A;  5AIV A;  3F6F A;  2H6X A;  3GSS A;  4FH8 A;  3C71 A;  3F3R A;  4YKG A;  2G2Q A;  4V1A p;  5HR2 A;  3APQ A;  3WGX A;  2FWG A;  5CP1 A;  4LMV A;  1XWG A;  4WBJ A;  2ZNM A;  2CVD A;  1XW5 A;  3UAR A;  2LJR A;  4K5R A;  3L4N A;  5G2Z A;  3V1W A;  2YOI A;  2AYT A;  3CBU A;  3EUR A;  4JZQ A;  2HZE B;  2ALB A;  3HHV A;  2YZU A;  1GLQ A;  2B1K A;  2JAD A;  3VPQ A;  3FR6 A;  2CAI A;  1FHE A;  1WE0 A;  1Q98 A;  5DAL A;  4FQU A;  4K2D A;  2YJ7 A;  5B8A A;  1AC1 A;  4EXJ A;  3H1N A;  1O8X A;  3DIE A;  2NPB A;  2K6V A;  4MPG A;  4CW9 A;  4NWY A;  1T1V A;  4HI7 A;  2H75 A;  1XOA A;  2LKU A;  4MP4 A;  4X43 A;  4NMU A;  5ECQ B;  2AV4 A;  1A2M A;  14GS A;  1LJR A;  2LNS A;  5IIZ A;  1S3C A;  1VF3 A;  1XWA A;  4EUY A;  1SJZ A;  4HDE A;  2ES7 A;  1X0R A;  2F51 A;  1A0R P;  1HNA A;  1UA5 A;  5G5E A;  2DJ1 A;  1GSQ A;  4KND A;  4MLY A;  3HZ4 A;  2V32 A;  3KZQ A;  2FGX A;  5CRG A;  12GS A;  1FW1 A;  3ZTL A;  1K0M A;  2RII A;  4TXV A;  4XTS A;  1SL1 B;  5ECM B;  4YKF A;  4DEJ A;  5A5K A;  4FYC A;  3IAS 2;  4K0G A;  4XHM A;  1UVZ A;  3QAV A;  1ERU A;  5HR3 A;  1TRU A;  1SKW B;  3RPN A;  3HJO A;  1ERT A;  1A2L A;  3E9J B;  3FYG A;  5EY6 A;  2HSH A;  1XZO A;  2H8L A;  2QGV A;  3DKS A;  4XRD A;  3KM6 A;  3TDG A;  4TXO A;  5ECL B;  5ECP B;  2OA7 A;  3I6A A;  3SWL A;  2K8V A;  5ECR B;  3IOS A;  2XPD A;  4ZIJ A;  4TR4 A;  3DYR A;  3CMI A;  2L5L A;  3G7Y A;  3R3E A;  2C4J A;  2JZS A;  4MZC A;  3C8E A;  5CRH A;  4N10 A;  3UOM A;  4EVM A;  1J9B A;  1SD9 A;  2CVK A;  2K18 A;  2H72 A;  5J41 A;  1B9Y C;  3E0U A;  5JWQ B;  2X49 A;  1GRX A;  1M2B A;  1H75 A;  2FWE A;  2X8H A;  3HA9 A;  5D8I A;  3MDK A;  2IPA A;  3DVW A;  4OWY A;  6GST A;  2DJJ A;  2X8G A;  4BVX A;  1FAA A;  1BQ7 A;  4D73 B;  2B1L A;  1QMV A;  2EC4 A;  3GTU A;  1SJ6 A;  3UVT A;  2FLS A;  2GLR A;  4MJE A;  2JSY A;  3TUE A;  4GTU A;  4CY6 A;  1AIU A;  1SL2 B;  3KIJ A;  4ZB6 A;  13GS A;  2HLS A;  3N5O A;  2F9S A;  4IGJ A;  5GAN D;  2QA2 A;  3LSZ A;  3R2Q A;  2YCD A;  3GN3 A;  3P7X A;  5IMD A;  4G0K A;  3DD3 A;  2PVO C;  2LRT A;  2E2G A;  3EVI A;  2L6C A;  2MBT A;  5KN1 A;  1UN2 A;  5DJM A;  5HR1 A;  1TRV A;  2GTU A;  2REM A;  1V40 A;  4TN8 A;  3P2A A;  1PA3 A;  2H0H A;  5EPF A;  2A4H A;  2M80 A;  1QGV A;  1FOV A;  2JU5 A;  4EL1 A;  3ZVJ A;  3EPT A;  3IBH A;  2QC7 A;  2V2G A;  4OCE A;  3EC3 A;  1OAZ A;  2BTO T;  2DJ0 A;  2OE1 A;  4AJ8 A;  1M9B A;  4K5S A;  5LNK e;  3ZZX A;  4JE1 A;  1ACV A;  3CRT A;  3QR6 A;  4HQS A;  3BBY A;  3LW9 A;  1TU8 A;  3ZIJ A;  4TRX A;  4BPY A;  2MMA A;  1E6B A;  2C0F A;  2H01 A;  4BVY A;  1TI3 A;  3WT1 A;  5D96 A;  4Z2T A;  1GUH A;  1PL2 A;  3WT2 A;  2GT5 A;  3D22 A;  3BOA A;  2VD1 A;  2PN8 A;  2JL4 A;  1HYU A;  2DJ2 A;  5DCG A;  2E7P A;  4H86 A;  1ABA A;  3ZFL A;  3M1G A;  4RI6 A;  2O8V B;  2FWF A;  1GUK A;  2P0G A;  2IIY A;  2B7K A;  4KA0 A;  1GSU A;  5FHI A;  1PGT A;  2Z9S A;  1V98 A;  1G7E A;  3CTF A;  2LS5 A;  3MSZ A;  5ECS A;  2PBJ A;  3BCK A;  3D4M A;  5EL8 A;  3LXT A;  3IHQ A;  1NHO A;  2WJU A;  4O5R A;  1YZX A;  2VAF A;  4FYB A;  3J7Y b;  4K1F A;  3IK9 A;  4IBP A;  11GS A;  5GAP D;  2DBC A;  1M7T A;  4CDO A;  1GSD A;  2GT6 A;  1MTC A;  1VF4 A;  4IQ1 A;  3C73 A;  4KDU A;  3O6T A;  1XVQ A;  1WWJ A;  3O3T A;  4TR1 A;  3PPU A;  3UEM A;  4WF5 A;  2L4Q A;  5LCZ A;  1PD2 1;  4POL A;  5KN3 A;  1V2A A;  1R7H A;  4IEL A;  4IP6 A;  4CY8 A;  1U6T A;  1WOU A;  3U6V A;  3ZMK A;  1A24 A;  1JZR A;  2HYX A;  1AAZ A;  4N0V A;  3QDN A;  1YF0 A;  3ZVJ D;  3VWW A;  5B8B A;  3LYP A;  3M9J A;  3QD9 A;  1HNB A;  1THO A;  2VCQ A;  5IPG A;  4ZB8 A;  3TRP A;  5CRD A;  3KEB A;  2FUG 2;  3WGD A;  1W89 A;  3MAK A;  1YEX A;  4XCS A;  1QFN A;  1OE8 A;  3F3Q A;  3A2V A;  3TKP A;  4TW5 A;  4MNN A;  3GV1 A;  4MJC A;  4NV5 A;  4K7N A;  1DSB A;  3A5W A;  2CV4 A;  1J0F A;  1JZD A;  1JFU A;  4BA7 A;  3H8Q A;  1DBY A;  2DMM A;  1AQV A;  2IME A;  4AJ7 A;  1F3B A;  2K9F A;  3VI7 A;  4JR4 A;  4HJ2 A;  1A2J A;  3D6I A;  3KGK A;  1T7P B;  1QUW A;  3NZN A;  1DUG A;  3US3 A;  1PX7 A;  1SJI A;  3VLN A;  3GUR A;  1GNW A;  4G19 A;  3QOU A;  3LWA A;  2QKE A;  4ID0 A;  1BJX A;  5DQY A;  1WIK A;  1DE1 A;  2YWN A;  5CNW A;  4ZBD A;  2AAW A;  2MMO A;  2I9H A;  2YZH A;  2AHE A;  5FWG A;  1XWK A;  3VI5 A;  5ELA A;  2YPM A;  1A8L A;  4YAV A;  3TRX A;  2VIM A;  1XIY A;  4O92 A;  6GSS A;  1O81 A;  1RQM A;  1S3D A;  1B8X A;  1Z6N A;  4LLR A;  2V6O A;  2VLV A;  4IP1 A;  2PMT A;  4ISD A;  2ZUP A;  1MD3 A;  2VOC A;  4EC0 A;  4Q5F A;  3P90 A;  5G1K A;  1ZYE A;  5FT3 A;  4YQM A;  3KMO A;  5J9B A;  3PH9 A;  1ST9 A;  4GST A;  5CRW A;  2LQO A;  1WP0 A;  1VF1 A;  5E4W A;  3GKK A;  2N5B A;  3UAP A;  2IMD A;  3D5J A;  1A8Y A;  3TKS E;  5ID2 B;  3GX8 A;  3DGQ A;  4NHZ A;  2CVB A;  4ECI A;  2AJQ B;  3ED3 A;  1URM A;  3KTL A;  3TJK A;  1SYR A;  4KH7 A;  2GSQ A;  3KJY A;  2NBS A;  5E59 A;  3E3E A;  2AUV A;  3EU3 A;  4L0U A;  1K0A A;  1F6M C;  4GLT A;  4DSR A;  3RHC A;  5B7C A;  3VWX A;  3UJ1 A;  3A2X A;  2DKI A;  1YEP A;  2YWO A;  3P8W A;  1SYX A;  2KP2 A;  5IMV A;  1GNE A;  2HE3 A;  3KH7 A;  2B5Y A;  3KCM A;  4QQ7 A;  1Z7P A;  1J08 A;  2GSR A;  1BAY A;  1K0N A;  3UL3 A;  1KNG A;  1TTZ A;  3DWV A;  3F6D A;  2IMF A;  2R2J A;  2I4A A;  2CT6 A;  5IOX A;  2L59 A;  1K3L A;  3U5R E;  4K8M A;  3NIV A;  4MJB A;  4BWS A;  3CXG A;  17GS A;  3Q18 A;  5DAK A;  3QCP A;  2FWH A;  2X4A A;  3LOR A;  2O87 A;  2M72 A;  1EOH A;  4Z2U A;  3RDW A;  2H30 A;  4PUR A;  4ZL7 A;  2VL9 A;  4K7O A;  4MMM A;  1TW9 A;  3LG6 A;  4PUA A;  3RHB A;  3HYP A;  3MWH A;  3AY8 A;  5AGY A;  1JZO A;  2GQL A;  2CZ2 A;  2YNX A;  3W6G A;  4KB3 A;  5HFK A;  5ECH B;  4NV2 A;  5ABR A;  2X8C A;  4ILF A;  4LMW A;  4EE0 A;  2LRN A;  1XBS A;  5JCU A;  4EIP A;  5HR0 A;  2VL2 C;  2AB6 A;  2C1Y A;  2J23 A;  1OC9 B;  3UIW A;  4BL7 B;  2YN1 A;  2QSI A;  5JCG A;  4PNG A;  3FZ5 A;  1BYE A;  2YV9 A;  4OFT A;  4Q5Q A;  4YH2 A;  4FO5 A;  3HKR A;  1THX A;  1ZMA A;  2KHP A;  3IC8 A;  1SKS B;  1GUL A;  5CAX A;  4N30 A;  2GZZ A;  7GSS A;  4X4J A;  5H5Q A;  3ME7 A;  2MMN A;  2RUF A;  1EV4 A;  1E2Y A;  5BMU A;  5IO0 A;  5H5S A;  3ZRE A;  1OYJ A;  2P31 A;  4DSS A;  2V41 A;  5KOX A;  5H5R A;  4OO4 A;  2IFQ A;  3F63 A;  20GS A;  4RUV A;  4JED A;  5IMC A;  2KP1 A;  6GSX A;  3O76 A;  5HFI A;  1H4O A;  3KMN A;  2DC5 A;  4HZ4 A;  1PQN A;  2CA8 A;  3FMW A;  5KN2 A;  5GSS A;  1M9A A;  2HRA A;  4MA9 A;  1C72 A;  2GQM A;  4PTS A;  3WD6 A;  1LBK A;  2FD3 A;  2EIR A;  1R26 A;  3IA1 A;  3CSJ A;  4L0W A;  3IRA A;  3QMX A;  2RM6 A;  2RUE A;  4XS4 A;  2CQ9 A;  1AW9 A;  2C0E A;  3WYW A;  3KD0 A;  4E8E A;  5KOW A;  1M2A A;  3GL5 A;  4IS0 A;  4I97 A;  4HOJ A;  6GSV A;  1X9S B;  3CSI A;  1GH2 A;  1R5A A;  2EIO A;  4O5Q A;  2B5X A;  1V58 A;  4KF9 A;  18GS A;  1PN0 A;  5JCW A;  4MPF A;  1IYH A;  2MZC A;  1PKW A;  1G7O A;  1MDJ A;  4ECB A;  1SU9 A;  4KCA A;  1EGO A;  1JZW A;  4LL4 B;  3G7J A;  4TR0 A;  1VF2 A;  4YQV A;  5B6M A;  2MBS A;  2IMK A;  2PVQ A;  4KE3 A;  4YQU A;  2LJA A;  3D4T A;  3TOU A;  4A5P A;  1NM3 A;  2FHE A;  4O5U A;  3LEF A;  2DKH A;  4ACS A;  4XS1 A;  4WR4 A;  3IC4 A;  2DIZ A;  4JBB A;  4J57 E;  3HJM A;  2GZP A;  5AIX A;  3ZIT A;  3IR4 A;  4TOP A;  1KEB A;  1WMJ A;  2H73 A;  5DBQ A;  3D0Z A;  4J56 E;  3QAW A;  1HD2 A;  1YKA A;  3GH9 A;  1R5P A;  2OAD A;  2H0G A;  3EMP A;  3EWL A;  1CQG A;  4GRF A;  1KTE A;  1TXX A;  2O85 A;  1RW1 A;  2VL2 A;  4EIQ A;  1EEM A;  5CO3 A;  2HRN A;  2L57 A;  4ZBA A;  2C3N A;  2JAC A;  3ZFB A;  1EGR A;  4V2M A;  1I9D A;  2L6D A;  1TP9 A;  4GQC A;  5F07 A;  5G30 A;  2HZE A;  3IK7 A;  6GSY A;  1K0C A;  4WEY A;  5J4U A;  1XW9 A;  1GSF A;  1ERV A;  2VUP A;  5DVB A;  2VLU A;  4POB A;  5J5N A;  4V1A g;  5ELG A;  4WKW A;  2TIR A;  3GKM A;  3PR8 A;  1X9M B;  5AN1 A;  1Z3E A;  4I5Q A;  3RAZ A;  5CRE A;  1GSS A;  2L4C A;  3FR3 A;  3EIN A;  1FB6 A;  2JZT A;  2R0P A;  2VM1 A;  4TVE A;  1OE7 A;  2VD0 A;  2WUL A;  1T4Y A;  2XHF A;  3ERF A;  4HJM A;  4Q5N A;  3HD5 A;  2GZY A;  3L9V A;  1QK8 A;  2WGR A;  2HSM A;  3ZRD A;  5DAL B;  1XVW A;  3MIX A;  1XWB A;  2BMX A;  2WDU A;  4F82 A;  1XCC A;  4LL1 B;  2R0G A;  4GQF A;  2DJK A;  2C3T A;  2NTO A;  1EZK A;  4TR3 A;  5G1L A;  8GSS A;  3ZLP A;  2GSS A;  2WRT A;  4BWQ A;  4WBR D;  3KXO A;  4QL7 A;  1ZYN A;  3C1R A;  4ZBB A;  3G9B A;  4KW6 A;  1OVN A;  1U87 A;  4Z7X A;  3I43 A;  3IPZ A;  3FW2 A;  2H70 A;  5GST A;  1ZGN A;  1VGL A;  2WS2 A;  3M8N A;  1JLV A;  3TJF A;  1N8J A;  1GSE A;  3GKN A;  4G0I A;  2N5A A;  4I2U A;  4MH3 A;  2XBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...