2K9FA

Structural features of the complex between the dsbd n-terminal and the pilb n-terminal domains from neisseria meningitidis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
144
structure length
144
Chain Sequence
MVPHTLSTLKTADNRPASVYLKKDKPTLIKFWASWCPLCLSELGQTEKWAQDAKFSSANLITVASPGFLHEKKDGDFQKWYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKDGDVQRIVKGSINEAQALALIRDPNADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Formation of the complex between DsbD and PilB N-terminal domains from Neisseria meningitidis necessitates an adaptability of nDsbD.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup a
molecule tags Oxidoreductase
total genus 40
structure length 144
sequence length 144
ec nomenclature ec 1.8.4.11: Peptide-methionine (S)-S-oxide reductase.
pdb deposition date 2008-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2k9fA00
3HJOA 1FAAA 4XHMA 3LEFA 5EPFA 2NTOA 2O8VB 2QKEA 2B6MA 1GSUA 2H30A 3VK9A 3HYPA 4PX1A 4ZL9A 2YP6A 1PX7A 2HLSA 5IPGA 3ERWA 3HXSA 1W4VA 2XBIA 2G0FA 1PSQA 3L0HA 2AJQB 3WD6A 1X5CA 3MSZA 1E6BA 4TW5A 2FA8A 1GTBA 1SJIA 4RI7A 3RPPA 2YJHA 3ZIJA 2FCHA 2GT5A 2CZ3A 1T3BA 1CQHA 3LORA 3LXTA 3VI7A 3HKRA 3DWVA 1PD21 1W89A 4P3YB 1O8XA 1J0FA 5G1LA 4Q5QA 3LSZA 1PL2A 1SYXA 3ZITA 4QQ7A 4V1Ap 1O85A 1G6YA 2L4CA 4WBJA 1AUCA 2PMTA 3TJFA 1WMJA 2C0DA 3A3TA 3QAWA 3ZMLA 2G2QA 5DCHA 4WBRD 2FWHA 2VD1A 4QL9A 1JZRA 1BX9A 3APOA 1XOAA 3MNGA 3VPTA 3DKSA 8GSSA 1H75A 2BMXA 2MYGA 4KH7A 5G31A 1F3AA 2OE0A 1DUGA 2FY6A 1DE2A 3VI5A 4ZIJA 2V32A 1FO5A 2HZEB 5A4UA 1ML6A 1GUKA 2K9FA 1HNAA 2VCZA 3Q19A 3TGZA 2DMMA 4ECCA 1GTIA 3QOUA 2IWTA 2MBTA 5ECRB 1F9MA 2HRNA 4KA0A 4TRXA 2H72A 2B5XA 1GTUA 3LYKA 2PWJA 5B6NA 1DE1A 1QFNA 3HHVA 4PQIA 1B4PA 2IIYA 2PVQA 3Q6OA 3E9JB 2FUG2 3GN3A 4ZB6A 4G9HA 4TXOB 4TN8A 4BVXA 3L9VA 2N5AA 1WPIA 5LNKe 5DAKB 2GS3A 4YQUA 4D73A 1TTZA 1PN9A 3GTUB 2AHEA 3EMXA 4FYBA 1XW5A 2VCQA 5CO3A 2R4VA 3W6GA 2YANA 2DJ1A 1SJ6A 4ID0A 5ECMB 2BTOT 1KNGA 4KX4A 4MABA 5B7CA 2PU9C 4HJMA 4XRDA 3HCZA 1GLPA 4WKWA 2F51A 2E7PA 5IQYA 1V9WA 1O73A 3HJPA 18GSA 3TKSC 3ZMKA 2OE3A 2CX3A 4WXTA 4XRAA 2L4QA 2L5OA 4YAVA 1T4ZA 1N2AA 3UAPA 4JR4A 1XW6A 4TXOA 2CVDA 1GTAA 3KP9A 2WB9A 2LUSA 5DAKA 2VL3A 7GSSA 2F8FA 1K3YA 2H75A 2JSZA 1A2MA 1YEPA 2B5YA 2C0FA 1SKSB 1B8XA 2E0QA 4OFNA 2M46A 5G1KA 1TJDA 3D21A 1XPVA 4F82A 2H1AA 3DRNA 4TR1B 2CAIA 2TIRA 1BEDA 1DBYA 2CX4A 3KGKA 4KDUA 3M9JA 4JEDA 4OWYA 3TB2A 1G7OA 4N0VA 3A2XA 1SL1B 1E2YA 4TKYA 1ERWA 3ZVJA 3H4KA 5ECPB 4AJ6A 2DLXA 2FHEA 3BCIA 2L59A 3HJMA 3GH6A 2FWEA 4GXZA 1O81A 2R37A 1NHYA 4FYUA 2ZCTA 2EIRA 2FGXA 2H6YA 2H73A 4V1Ag 3F3QA 1BQ7A 1EOGA 1RW1A 2VL2C 3VPQA 1XWAA 3KP8A 1A2JA 1QXHA 3TJBA 3UIWA 3BCKA 3J7Yb 3UBKA 2VUPA 5CRDA 6GSWA 1A8LA 3GKMA 3GSSA 3VWVA 3EINA 1TK0B 1Z6NA 4N0ZA 2DC5A 3BOAA 1A2LA 2H66A 1TU7A 3M3MA 4TR1A 4H86A 1SU9A 1SK1A 2RLIA 5G30A 2K8SA 1FW1A 1M2DA 1O8WA 4XS4B 4ULXA 3RHBA 5JWRB 2C3TA 2I3YA 4ECIA 5HFIA 3ISOA 3E0UA 5ECKB 1AQXA 2YZHA 4V2MA 2GDRA 2K6VA 3F3RA 3L4NA 3APQA 2PERA 2GQMA 5E59A 2JADA 3F4TA 3D5JA 2VCWA 4L0WA 3VURA 5DCGA 2HE3A 1MDKA 1ZCPA 1BYEA 4GF0A 5AIVA 1VF2A 1PQNA 3QFAC 4WF5A 4NAXA 2OBKA 4OFTA 1XVQA 2VLVA 1YDKA 6GSUA 3WGDA 2IN3A 2X8CA 3UARA 1YJ6A 2NVLA 3EE2A 4WEYA 4XS4A 1XWKA 4TOPA 1SENA 3GX0A 1TK8B 4BWQA 1ERUA 4X0XA 3NZNA 2MMAA 3OR5A 4LL1B 3RHCA 4JRRA 2DIYA 1GSSA 5LD0A 5D8IA 1OKTA 2V6KA 1ILOA 2CV4A 3FEUA 2VM1A 2O87A 3HVSA 3BJ5A 2HNLA 2YN1A 1ERTA 3F6FA 2GTUA 1YF1A 1SL2B 2KP1A 3DVWA 4XTSA 3VWWA 4LLRA 5JCUA 2DJ0A 3QPMA 5CREA 4ZL7A 1G7EA 2VCTA 4AGSA 3F6DA 4ZBBA 3R2QA 4CDOA 3ZZXA 1K0AA 2XC2A 2IPAA 2B7JA 3FR6A 2MMZA 1FB0A 3KM6A 5GSSA 1UA5A 3ED3A 2X99A 1SKRB 2KUCA 5DVBA 1QQ2A 1H4OA 3FZ5A 4I6XA 4GQCA 1WWJA 1YKCA 4XS6A 1TW9A 2CVKA 3APSA 1SK0A 2R6KA 4BWSA 4EVMA 1XFLA 4NV2A 5HR1A 3J7Yk 4XIHA 5C04A 1PGTA 4NHZA 1UC7A 3BD2A 2I81A 3ME7A 3DYRA 3IRAA 2K18A 2B3SA 3GL3A 1K0NA 4ZBAA 3TJGA 1HD2A 2LNSA 4V2NA 1SK2A 3E3EA 3F9UA 4RQRA 5JCGA 2V1MA 1K0OA 4ILFA 4O7HA 2R3XA 2YPMA 2WZ9A 1ZL9A 1NW2A 5C00A 1Z5YE 5DBQA 5F8BA 3IV4A 4JZQA 4KE3A 3IDVA 4Q5FA 3I9V2 3QAVA 1K3LA 4NHWA 1YKAA 3M0FA 4DSSB 2HZFA 3P2AA 2AB6A 2NPBA 5KN0A 4MMMA 3GKNA 1BJXA 2VCVA 5ID2A 5F07A 2I1UA 2JZRA 2O7KA 1GWCA 1EV9A 5CYYA 1PMTA 2FWGA 4RI6A 2FLSA 1R5PA 3LYPA 4X43A 3BBYA 3KCMA 3I69A 4F2IA 1WE0A 2EC4A 4MP4A 3GX8A 2EIOA 4IBPA 2D2ZA 3DXBA 2RUFA 4YQVA 5JWOB 2WDUA 3GKKA 3CMIA 3I6AA 4ZXGA 4KUNA 4MF5A 1Q4JA 4F03A 3UBLA 2H1GA 2HSHA 1WJKA 1EGOA 4G2EA 4FH8A 1LJRA 5G5FA 4YH2A 3IK9A 4EKZA 4TR0A 3WYWA 2J9HA 3GFKA 4LMWA 3FY7A 3EC3A 5B6MA 3P8WA 3H8QA 6GSSA 2OACA 5DQYA 3TKQA 2IMFA 1OC8A 1M9BA 5ELGA 4HDEA 1K0CA 3O76A 1AW9A 3UJ1A 4KDXA 4KNDA 5JCWA 3IE3A 4MJCA 4I5QA 4PUFC 4ACSA 5IMCA 2H1DA 1X9SB 1XVWA 4MLYA 2VLUA 3KTBA 2HSYA 3H79A 3GNJA 1EWXA 1X5DA 1FHEA 3A2VA 2GQKA 5DALB 3ZFBA 4WETA 3F4SA 2A4VA 5J4UA 2CZ2A 5AGYA 3RBTA 1EP7A 5AIXA 4F0CA 2I4AA 3CSHA 2OKAA 2H71A 2TRCP 4PNFA 5IM9A 4JU5A 1JHBA 1U3AA 1XWBA 3ME8A 4KAEA 4KSOA 3ZTLA 1MTCA 1SJZA 2R2JA 3TOTA 3DVXA 2B5EA 1TRSA 2C1YA 4E8EA 6GSXA 1X0RA 2LS5A 2P0GA 2VL2A 3TUEA 2V6OA 3FKFA 4ZB8A 4KSMA 2HZEA 4Z7XA 5KN2A 3FHKA 3AY8A 2H01A 4FO5A 1T8EB 2FNOA 2HFDA 2DSAA 2VO4A 3L9UA 5DALA 2M80A 3EWLA 1M2AA 3LJRA 2N5FA 1Z7RA 2V2GA 2X64A 5IOWA 1TK5B 2OJLA 2C80A 5HQPA 2R5GA 6GSYA 3H93A 4ZL8A 1SYRA 4TVEA 1J08A 1EEMA 2LQOA 3GHAA 5D9WA 11GSA 3CXGA 3GTUA 3PINA 3CSJA 3U6VA 2IMIA 2L6CA 3DGQA 4N10A 4OO4A 3WT2A 5ECOB 4G10A 4K2DA 4TR4A 1JFUA 2DBCA 1M0UA 1PKZA 4EXJA 5G5EA 3C73A 3TRQA 4OFMA 1J9BA 2MBSA 1ACVA 2RUEA 5ECHB 3GMFA 1TI1A 1TXXA 2RM5A 3A2WA 4O32A 4OMVA 4GSSA 5HR3A 2IMEA 1OKDA 3GRXA 4IQ1A 1S3CA 5ELAA 1T4YA 4K7NA 2JZTA 2YNXA 2WCIA 4NMUA 2TRXA 3VWXA 1OC9B 4BA7A 1MDJA 3IHQA 1QGVA 1TOFA 1URMA 3HVVA 1TP9A 2H6ZA 4MJAA 5G2ZA 4MF7A 3K8NA 1S3DA 1YZXA 1V40A 3C1SA 3GIXA 3G9BA 2JSYA 4K8MA 4KDYA 2JU5A 2F3MA 2VL9A 5CRWA 1EGRA 1FVJA 3LXZA 4QL7A 3F63A 3UEMA 4HJ2A 1MEKA 2HI7A 5IPHA 3ZYWA 3FR3A 2ALBA 4GCIA 2VD0A 4N30A 2XPDA 4YQMA 4HU9A 2LEGA 3H1NA 4MJBA 2YWMA 1NSWA 4O92A 1ZOFA 1RQMA 2OA7A 5GSTA 2GSRA 1B48A 4IGJA 1OC3A 1XWGA 4HEA2 5ECLB 5DDLA 1G0TA 2YV9A 2OE1A 2X8HA 1BAYA 4IN0A 5CP1A 3D4MA 1PL1A 4HUAA 4PUAA 1OE8A 4JR6A 2VLTA 5HR0A 2VIMA 2IMDA 1VF1A 2WULA 5DJMA 4AJ8A 1XWCA 4LL4B 4EE0A 4K0GA 5AN1A 1A24A 3Q74A 3KH9A 3D6IA 4ECBA 3L78A 3VLNA 4PGTA 3MWHA 2QC7A 2KP2A 3ERFA 1VF3A 1YF0A 5J3RA 1K0MA 4JBBA 3FYGA 1ZYQB 2M72A 2LSTA 3EU3A 4TXVA 1A8YA 3VWUA 3D4TA 2JACA 5LCZA 4GSNA 5A4VA 1FOVA 3PH9A 2C8UA 3F8UA 1F37A 2GQLA 4MF6A 5EL8A 3FZ4A 1AC1A 2PPTA 3KIJA 2GLRA 2YJ7A 5GAND 1WIKA 1IYHA 1JLVA 1USBA 4MPGA 1GNWA 3NOFA 1T00A 2PN8A 3SWLA 3CRTA 2WS2A 2YWNA 9GSSA 2I9HA 2AYTA 2B7KA 3EVIA 3FR9A 1DSBA 1GL8A 5D9TA 5D93A 1EV4A 2REMA 6GSVA 3LG6A 1U88A 3W8SA 4BL7A 1YY7A 2YWIA 4K7OA 3ZL5A 3TKRA 1V57A 3LQ7A 3C1RA 2DMLA 4I8BA 4HZ4A 1XBSA 3LFLA 5D73A 4IHUA 4LMVA 3PGTA 1O7UA 4XCSA 1TRVA 1PKWA 5F0GA 5F05A 3KMOA 5H5SA 3U5RE 1Q98A 1OAZA 4ML6A 2A2RA 5KEJA 2H1BA 2ON5A 4ZILA 3DD3A 4GQFA 4J56E 3UOMA 2C3QA 3M1GA 2HRFA 1V2AA 3QCPA 4I97A 3TOUA 1HYUA 1YEXA 2ZUPA 2WJUA 4MDCA 2FA4A 4K6XA 1HQOA 2HT9A 1NHOA 2YV7A 1B4QA 5IMZA 14GSA 2C0EA 2V41A 2IJYA 3TCOA 2OADA 5COHA 2P31A 3KJYA 3CYNA 5GAPD 2LNTA 3W8JA 2H0IA 4EC0A 5IMFA 1I9DA 4HQSA 3D0ZA 4DEJA 1XZOA 1TU8A 5CAXA 4I2UA 3IAS2 1ZYEA 5IMVA 3IPZA 4FYCA 4MA9A 4AF2A 1TKDB 2DIZA 4CHSA 2DJJA 4ECJA 2C3NA 5FT3A 4EDZA 3KTLA 4PXOA 1AXDA 2GGTA 4OD7A 4PNGA 2A2SA 1JZOA 4WR4A 1FB6A 3IOSA 1PRXA 5J9CA 5JWQB 4MH2A 3QDNA 1GUMA 13GSA 3NIVA 4F0BA 4XS1A 4K7IA 2GVPA 3FZ9A 2LRTA 5ABRA 2YWOA 4GSTA 3QFBC 4EDYA 2IL3A 2BJXA 3G7JA 4FIWA 2VAFA 3SBCA 2B1KA 4DSSA 5ECNB 5IMAA 5CNWA 3TKSA 3KEBA 3C8EA 1EZKA 1ERVA 3RPNA 3UVTA 1GNEA 2E2GA 1QUWA 1IYIA 1GH2A 3CTGA 1R26A 4X1UA 1A23A 3IAM2 1C72A 4IJIA 1X5EA 5INYA 4J2FA 2KLXA 1F2EA 2GZZA 3KD0A 10GSA 2LKUA 2XBQA 4POLA 2N5BA 2IFQB 2PVOC 2KOKA 2NBSA 1ABAA 5D9XA 1U87A 1XIYA 4D73B 3QAGA 3HZ4A 5EVOA 4V2LA 3LGCA 4JE1A 1X9MB 3ZFLA 4PURA 1ON4A 3IA1A 3V1WA 2L5LA 2F9SA 3MDKA 1ZZYA 4IELA 3M8NA 3HY2A 2C0GA 4E8HA 3DMLA 4RUVA 3TKSE 1LBKA 2QSIA 4HS1A 1GRXA 3VFIA 2H0HA 4POBA 1F6MC 3O6TA 3GYKA 2E2MA 2H19A 3ZRDA 1HNCA 2EIQA 1JLWA 2GSTA 1GLQA 1EOHA 1Z7PA 2IFQA 1Z3EA 1Y25A 4Q5NA 1U6TA 2GZYA 3TRPA 2H70A 3WT1A 5ECIB 6GSTA 1SL0B 4IKHA 2VOCA 5CRGA 2GT6A 5IMDA 4PQHA 4EO3A 2Z9SA 2PUKC 4IJ3A 16GSA 2H6XA 1HNBA 1CQGA 4HU7A 2B1LA 4NWYA 3UVHA 2VM2A 4GWRA 3EURA 1XW9A 1BG5A 4K0NA 5DJLA 1GSFA 4L8EA 4IQAA 4NV5A 4DSRA 5A4WA 1GSDA 4WR5A 3F0IA 4POKA 20GSA 1GSYA 3UL3A 3P7XA 5HR2A 2VCXA 2PBJA 3TKPA 4DSQA 1SD8A 4NPBA 1XCCA 5J9BA 1GSEA 3HZ8A 2LJAA 5IO2A 5B8BA 1WP0A 4L5LA 2XPEA 3D22A 4BPYA 1VRSD 1KBNA 3G7IA 1S3AA 5H5RA 1B9XC 1G6WA 3M9KA 3I43A 4PQ1A 2LJKA 1AQWA 1FVKA 3O3TA 2LRNA 5ECSA 1TDIA 2AAWA 5D96A 1AIUA 3GKXA 3GUSA 4GTUA 4ISDA 1Z6MA 3RDWA 3UMAA 3CBUA 3GH9A 4MK3A 1UVZA 1GULA 2P5RA 1EEJA 4J57E 1VGLA 3ZVJD 5IOXA 3KZQA 1GSQA 3IK7A 4G19A 5A5KA 17GSA 1O6JA 2GZPA 5GZZB 1M99A 2RIIA 3EYTA 1TRUA 4MJEA 2WRTA 2MZCA 1THOA 1AAZA 4EF0A 1ZGNA 1T1VA 3GA4A 2J23A 1GUHA 4I2TA 1OVNA 5J41A 4IVFA 4KGIA 3GURA 1PX6A 2AUVA 3CSIA 4MZCA 1K0BA 3GSTA 2O89A 3DIEA 2WFCA 2MMOA 5ECQB 3HD5A 1WOUA 3G7YA 1QMVA 2MMNA 3P90A 4RQXA 5D9VA 3IR4A 2GSQA 4LA1A 3TJJA 1MD4A 4AJ7A 1TRWA 1QK8A 4EL1A 1LU4A 2FWFA 3EMPA 2CA8A 3MAKA 1OC9A 4MZBA 4KB3A 4NXIA 2DJ3A 5DQSA 4HZ2A 3WGXA 3FRCA 22GSA 1GP1A 4MZWA 1R4WA 4WF4A 2DJKA 4OCEA 1M9AA 5FHIA 3FW2A 2YZUA 1TI3A 2X8GA 2KHPA 1R5AA 5HFGA 1PA3A 2FD3A 1MDIA 1F3BA 4BVYA 1M2BA 2DJ2A 1FG4A 1T7PB 2QGVA 1UN2A 12GSA 3HA9A 5FWGA 4POMA 2H76A 2PGTA 2ES7A 1K0DA 4MH3A 2HYXA 2L6DA 2NDOA 4HI7A 1X9WB 2IMKA 3CRUA 2CT6A 3JCML 3L9SA 2JL4A 1V58A 3QR6A 3IC4A 4N11A 2YOIA 3GL5A 4OCFA 2H74A 1V98A 5AISA 4CW9A 4DVCA 4KCEA 1ST9A 1JZDA 2JZSA 2ON7A 3KXOA 4ZBDA 3Q18A 5B8AA 1JZWA 2HXKA 2L57A 1RK4A 2LV3A 1Z9HA 3DEXA 3F4RA 2H0GA 3ZLPA 2CAQA 1YQ1A 5J5NA 3PR8A 2YCDA 2K8VA 3TRXA 3KH7A 4KW6A 3QMXA 1Y6EA 4O5RA 3TJKA 3HVXA 4OO5A 3QD9A 4K9ZA 1N8JA 2CQ9A 4YAPA 4HQZA 1EP8A 2O85A 1K3OA 1NM3A 2LRCA 3C7MA 3EU4A 3IXRA 1R7HA 3FZAA 3N9JA 3WGEA 4GLTA 3FK8A 3ZREA 3A5WA 5KN1A 4IS0A 1ZMAA 2P5QA 5CRHA 1THXA 3N5OA 4HOJA 3HDCA 3IBHA 1SKWB 4MCUA 3S9FA 1KTEA 1WRYA 4ZB9A 2AV4A 2GSSA 2LJRA 5IO0A 3C71A 1OYJA 5KN3A 2H8LA 3GV1A 2F8AA 5H5QA 4L5OA 1I5GA 4Q5RA 4EUYA 3LWAA 1KEBA 1SD9A 1A0RP 4GRFA 1U3IA 2XHFA 19GSA 5F06A 5IIZA 2LTKA 2LQQA 3ZIVA 4TR3A 5ENUA 5ID2B 2WGRA 1B9YC 2CVBA 4KCAA 1XOBA 2OBIA 2C4JA 1M7TA 4IP6A 5L71A 2ZNMA 4F9ZA 3RAZA 2RM6A 5E4WA 4IW9A 5HFKA 3CTFA 4ML1A 1VF4A 1AQVA 5EY6A 4IP1A 3TDGA 1OE7A 1XXUA 1MD3A 4MPFA 4K1FA 3KMNA 3ERGA 4L0UA 1A0FA 3US3A
chains in the Genus database with same CATH superfamily
3HJOA 1FAAA 4XHMA 3LEFA 5EPFA 2NTOA 2O8VB 2QKEA 2B6MA 1GSUA 2H30A 3VK9A 3HYPA 4PX1A 4ZL9A 2YP6A 1PX7A 2HLSA 5IPGA 3ERWA 4Z2TA 3HXSA 1W4VA 2XBIA 2G0FA 1PSQA 3L0HA 2AJQB 3WD6A 1X5CA 3MSZA 1E6BA 4TW5A 2FA8A 1GTBA 1SJIA 4RI7A 3RPPA 2YJHA 3ZIJA 2FCHA 2GT5A 2CZ3A 1T3BA 1CQHA 3LORA 3LXTA 3VI7A 3HKRA 3DWVA 1PD21 1W89A 4P3YB 1O8XA 1J0FA 5G1LA 4Q5QA 3LSZA 1PL2A 1SYXA 3ZITA 4QQ7A 4V1Ap 1O85A 1G6YA 2L4CA 4WBJA 1AUCA 2PMTA 3TJFA 1WMJA 2C0DA 3A3TA 3QAWA 3HVNA 3ZMLA 2G2QA 4BVXB 5DCHA 4WBRD 2FWHA 2VD1A 4QL9A 1JZRA 1BX9A 3APOA 1XOAA 3MNGA 3VPTA 3DKSA 8GSSA 1H75A 2BMXA 2MYGA 4KH7A 5G31A 1F3AA 2OE0A 1DUGA 2FY6A 1DE2A 3VI5A 4ZIJA 2V32A 1FO5A 2HZEB 5A4UA 1ML6A 1GUKA 2K9FA 1HNAA 1XG8A 2VCZA 4CY8A 3Q19A 3TGZA 2DMMA 4ECCA 1GTIA 3QOUA 2IWTA 2MBTA 5ECRB 1F9MA 2HRNA 4KA0A 4TRXA 2H72A 2B5XA 1GTUA 3LYKA 2PWJA 4PTSA 5B6NA 1DE1A 1QFNA 3HHVA 4PQIA 1B4PA 2IIYA 2PVQA 3Q6OA 3E9JB 2FUG2 3GN3A 4ZB6A 4G9HA 4TXOB 4TN8A 4BVXA 3L9VA 2N5AA 1WPIA 5LNKe 5DAKB 2GS3A 4YQUA 4D73A 1TTZA 1PN9A 3GTUB 2AHEA 3EMXA 4FYBA 1ZYPA 1XW5A 2VCQA 5CO3A 2R4VA 3W6GA 2YANA 2DJ1A 1SJ6A 4ID0A 5ECMB 2BTOT 4EIQA 1KNGA 1M3JA 4KX4A 4MABA 5B7CA 2PU9C 4HJMA 4XRDA 3HCZA 1GLPA 4EIPA 4WKWA 2F51A 2E7PA 5IQYA 1V9WA 1O73A 3HJPA 18GSA 3TKSC 3ZMKA 2OE3A 2CX3A 4WXTA 4XRAA 2L4QA 2L5OA 4YAVA 1T4ZA 1N2AA 3UAPA 4JR4A 1XW6A 4TXOA 2CVDA 1GTAA 3KP9A 2WB9A 2LUSA 5DAKA 2VL3A 7GSSA 2F8FA 1K3YA 2H75A 2JSZA 1A2MA 1YEPA 2B5YA 2C0FA 1SKSB 1B8XA 2E0QA 4OFNA 2M46A 5G1KA 1TJDA 3D21A 2QA2A 1XPVA 4F82A 2H1AA 3DRNA 4TR1B 2CAIA 2TIRA 1BEDA 1DBYA 2CX4A 3KGKA 4KDUA 3M9JA 4JEDA 4OWYA 3TB2A 1G7OA 4N0VA 3A2XA 1SL1B 1E2YA 4TKYA 2HSMA 1ERWA 3ZVJA 3H4KA 5ECPB 4AJ6A 2DLXA 2FHEA 3BCIA 2L59A 3HJMA 3GH6A 2FWEA 4GXZA 1O81A 2R37A 1NHYA 4FYUA 2ZCTA 2EIRA 2FGXA 2H6YA 2H73A 4V1Ag 4CY6A 3F3QA 1BQ7A 1EOGA 1RW1A 2VL2C 3VPQA 1XWAA 3KP8A 1A2JA 1QXHA 3TJBA 3UIWA 3BCKA 3J7Yb 3UBKA 2VUPA 5CRDA 6GSWA 1A8LA 3GKMA 3GSSA 3VWVA 3EINA 1TK0B 1Z6NA 4N0ZA 2DC5A 3BOAA 1A2LA 4O5UA 2H66A 1TU7A 3M3MA 4TR1A 4H86A 1SU9A 1SK1A 2X49A 3CQFA 2RLIA 5G30A 2K8SA 1FW1A 1M2DA 1O8WA 4XS4B 4ULXA 3RHBA 5JWRB 2C3TA 2I3YA 4ECIA 5HFIA 3ISOA 3E0UA 5ECKB 1AQXA 2YZHA 4V2MA 2GDRA 2K6VA 3F3RA 3L4NA 3APQA 2PERA 2GQMA 5E59A 2JADA 3F4TA 3D5JA 2VCWA 4L0WA 3VURA 5DCGA 2HE3A 4YKGA 1MDKA 1ZCPA 1BYEA 4GF0A 5AIVA 1VF2A 1PQNA 3QFAC 4WF5A 4NAXA 2OBKA 4OFTA 1XVQA 2VLVA 1YDKA 6GSUA 3WGDA 2IN3A 2X8CA 3UARA 1YJ6A 2NVLA 3EE2A 4WEYA 4XS4A 1XWKA 4TOPA 1SENA 3GX0A 1TK8B 4BWQA 1ERUA 4X0XA 3NZNA 2MMAA 3OR5A 4LL1B 3RHCA 4JRRA 2DIYA 1GSSA 5LD0A 5D8IA 1OKTA 2V6KA 1ILOA 2CV4A 3FEUA 2VM1A 2O87A 3HVSA 4MNNA 3BJ5A 2HNLA 2YN1A 1ERTA 3F6FA 2GTUA 1YF1A 1SL2B 2KP1A 3DVWA 4XTSA 3VWWA 4LLRA 5JCUA 2DJ0A 3QPMA 5CREA 4ZL7A 1G7EA 2VCTA 4AGSA 3F6DA 4ZBBA 3R2QA 4CDOA 3ZZXA 1K0AA 1M3IA 2XC2A 2IPAA 2B7JA 3FR6A 2MMZA 1FB0A 3KM6A 5GSSA 1UA5A 3ED3A 2X99A 1SKRB 2KUCA 5DVBA 1QQ2A 1H4OA 2DKIA 3FZ5A 4I6XA 4GQCA 1WWJA 1YKCA 4XS6A 1TW9A 2CVKA 3APSA 1SK0A 2R6KA 4BWSA 4EVMA 1XFLA 4NV2A 5HR1A 3J7Yk 4XIHA 5C04A 1PGTA 4NHZA 1UC7A 3BD2A 2I81A 3ME7A 3DYRA 3IRAA 2K18A 2B3SA 3GL3A 1K0NA 4ZBAA 3TJGA 1HD2A 2LNSA 4V2NA 1SK2A 3E3EA 4G0IA 3F9UA 4RQRA 5JCGA 2V1MA 1K0OA 4ILFA 4O7HA 2R3XA 2YPMA 2WZ9A 1ZL9A 1NW2A 5C00A 2X4AA 1Z5YE 5DBQA 5F8BA 3IV4A 4JZQA 4KE3A 3IDVA 4Q5FA 3I9V2 3QAVA 1K3LA 4NHWA 1YKAA 3M0FA 4DSSB 2HZFA 3P2AA 2AB6A 2NPBA 5KN0A 4MMMA 3GKNA 1BJXA 2VCVA 5ID2A 5F07A 2I1UA 2JZRA 2O7KA 1GWCA 1EV9A 5CYYA 1PMTA 2FWGA 4RI6A 2FLSA 1R5PA 3LYPA 4X43A 2UZ8A 3BBYA 4BIKA 3KCMA 3I69A 4F2IA 1WE0A 2EC4A 4MP4A 3GX8A 2EIOA 4IBPA 2D2ZA 3DXBA 2RUFA 4YQVA 5JWOB 2WDUA 3GKKA 3CMIA 3I6AA 4ZXGA 4KUNA 4MF5A 1Q4JA 4F03A 3UBLA 2H1GA 2HSHA 1WJKA 1EGOA 4G2EA 4FH8A 1LJRA 5G5FA 4YH2A 3IK9A 4EKZA 4TR0A 3WYWA 2J9HA 3GFKA 4LMWA 3FY7A 3EC3A 5B6MA 3P8WA 3H8QA 6GSSA 2OACA 5DQYA 3TKQA 2IMFA 1OC8A 1M9BA 5ELGA 4HDEA 1K0CA 3O76A 1AW9A 3UJ1A 4KDXA 4KNDA 5JCWA 3IE3A 4MJCA 4I5QA 4PUFC 4ACSA 5IMCA 4USSA 2H1DA 1X9SB 1XVWA 4MLYA 4G0KA 2VLUA 3KTBA 2HSYA 3H79A 3GNJA 1EWXA 1X5DA 1FHEA 3A2VA 2GQKA 5DALB 3ZFBA 4WETA 3F4SA 2A4VA 5J4UA 2CZ2A 5AGYA 3RBTA 1EP7A 5AIXA 4F0CA 2I4AA 3CSHA 2OKAA 2H71A 2TRCP 4PNFA 5IM9A 4JU5A 1JHBA 1U3AA 1XWBA 3ME8A 4KAEA 4KSOA 3ZTLA 1MTCA 1SJZA 2R2JA 3TOTA 3DVXA 2B5EA 1TRSA 2C1YA 4E8EA 6GSXA 1X0RA 2LS5A 2P0GA 2VL2A 3TUEA 2V6OA 3FKFA 4ZB8A 4KSMA 2HZEA 4Z7XA 5KN2A 3FHKA 3AY8A 2H01A 4FO5A 1T8EB 2FNOA 2HFDA 2DSAA 2VO4A 3L9UA 5DALA 2M80A 3EWLA 4O5QA 1M2AA 3LJRA 2N5FA 1Z7RA 2V2GA 2X64A 5IOWA 1TK5B 2OJLA 2C80A 5HQPA 2R5GA 6GSYA 3H93A 4ZL8A 1SYRA 4TVEA 1J08A 1EEMA 2LQOA 3GHAA 5D9WA 11GSA 3CXGA 3GTUA 3PINA 3CSJA 3U6VA 2IMIA 2L6CA 3DGQA 4N10A 4OO4A 3WT2A 5ECOB 4G10A 4K2DA 4TR4A 1JFUA 2DBCA 1M0UA 1PKZA 4EXJA 5G5EA 3C73A 5KOXA 3TRQA 4OFMA 1J9BA 2MBSA 1ACVA 2RUEA 5ECHB 3GMFA 1TI1A 1TXXA 2RM5A 4A5PA 3A2WA 4O32A 4OMVA 4GSSA 5HR3A 2IMEA 1OKDA 3GRXA 4IQ1A 1S3CA 5ELAA 1T4YA 4ICYA 4K7NA 2JZTA 2YNXA 2WCIA 4NMUA 2TRXA 3VWXA 1OC9B 4BA7A 1MDJA 3IHQA 1QGVA 1TOFA 1URMA 3HVVA 1TP9A 3MIXA 2H6ZA 4MJAA 5G2ZA 4MF7A 3K8NA 1S3DA 2A4HA 1YZXA 1V40A 3C1SA 3GIXA 3G9BA 2A2PA 2JSYA 3EPTA 4K8MA 4KDYA 2JU5A 4BVYB 2F3MA 2VL9A 5CRWA 1EGRA 3A5IA 1FVJA 3LXZA 4Z2RA 4QL7A 3F63A 3UEMA 4HJ2A 1MEKA 2HI7A 5IPHA 3ZYWA 3FR3A 2ALBA 4GCIA 2VD0A 4N30A 2XPDA 4YQMA 4HU9A 2LEGA 3H1NA 4MJBA 2YWMA 1NSWA 4O92A 1ZOFA 1RQMA 2OA7A 5GSTA 2GSRA 1B48A 4IGJA 1OC3A 1XWGA 4HEA2 5ECLB 5DDLA 1G0TA 2YV9A 2OE1A 2X8HA 1BAYA 4IN0A 5CP1A 3D4MA 1PL1A 4HUAA 4PUAA 1OE8A 4JR6A 2VLTA 5HR0A 2VIMA 2IMDA 1VF1A 2WULA 5DJMA 4AJ8A 1XWCA 4LL4B 4EE0A 4K0GA 5AN1A 1A24A 3Q74A 3KH9A 3D6IA 1FOHA 4ECBA 3L78A 4BL7B 3VLNA 4PGTA 3MWHA 2QC7A 2KP2A 3ERFA 1VF3A 1YF0A 5J3RA 1K0MA 4JBBA 3FYGA 4G0LA 1ZYQB 2M72A 2LSTA 3EU3A 4TXVA 1A8YA 3VWUA 3D4TA 2JACA 5LCZA 4GSNA 5A4VA 1FOVA 3PH9A 2C8UA 3F8UA 1F37A 2GQLA 4MF6A 5EL8A 3FZ4A 1AC1A 2PPTA 3KIJA 2GLRA 2YJ7A 5GAND 1WIKA 1IYHA 1JLVA 1USBA 4MPGA 1GNWA 3NOFA 1T00A 2PN8A 3SWLA 3CRTA 4K2XA 2WS2A 2YWNA 9GSSA 2I9HA 2AYTA 2B7KA 3EVIA 3FR9A 1DSBA 1GL8A 5D9TA 5D93A 1EV4A 2REMA 6GSVA 3LG6A 4Z2UA 1U88A 3W8SA 4BL7A 1YY7A 2YWIA 4K7OA 3ZL5A 3TKRA 1V57A 3LQ7A 3C1RA 2DMLA 3MYDA 4I8BA 4HZ4A 2R0GA 1XBSA 3LFLA 5D73A 4IHUA 4LMVA 3PGTA 1O7UA 4XCSA 4X4JA 1TRVA 1PKWA 5F0GA 5F05A 3KMOA 5H5SA 3U5RE 1Q98A 1OAZA 4ML6A 2A2RA 5KEJA 3R3EA 2H1BA 2ON5A 4ZILA 3DD3A 4GQFA 4J56E 3UOMA 2C3QA 3M1GA 2HRFA 1V2AA 3QCPA 4I97A 3TOUA 1HYUA 1YEXA 2ZUPA 3FMWA 2WJUA 4MDCA 2FA4A 4K6XA 1HQOA 2HT9A 1NHOA 2YV7A 1B4QA 5IMZA 14GSA 2C0EA 2V41A 2IJYA 3TCOA 2OADA 5COHA 2P31A 3KJYA 3CYNA 5GAPD 2LNTA 3W8JA 2H0IA 4EC0A 5IMFA 1I9DA 4HQSA 3D0ZA 4DEJA 1XZOA 1TU8A 5CAXA 4I2UA 3IAS2 1ZYEA 5IMVA 3IPZA 4FYCA 4MA9A 4AF2A 1TKDB 2DIZA 4K5RA 4CHSA 2DJJA 4ECJA 2C3NA 5FT3A 4EDZA 3KTLA 4PXOA 1AXDA 2GGTA 4OD7A 4PNGA 2A2SA 1JZOA 4WR4A 1FB6A 3IOSA 1PRXA 5J9CA 5JWQB 4MH2A 3QDNA 1GUMA 13GSA 3NIVA 4F0BA 4XS1A 4K7IA 2GVPA 3IC8A 3FZ9A 2LRTA 5ABRA 2YWOA 4GSTA 3QFBC 4EDYA 2IL3A 2BJXA 3G7JA 4FIWA 2VAFA 3SBCA 2B1KA 4DSSA 5ECNB 5IMAA 5CNWA 3TKSA 3KEBA 3C8EA 1EZKA 1ERVA 3RPNA 3UVTA 1GNEA 4K5SA 2E2GA 1QUWA 1IYIA 1GH2A 3CTGA 1R26A 4X1UA 2HRKA 1A23A 3IAM2 1C72A 4IJIA 1X5EA 5INYA 4J2FA 2KLXA 1F2EA 2GZZA 3KD0A 10GSA 2LKUA 2XBQA 4POLA 2N5BA 2IFQB 2PVOC 2HRAA 2KOKA 2NBSA 1ABAA 5D9XA 1U87A 1XIYA 4D73B 3QAGA 3HZ4A 5EVOA 4V2LA 1PN0A 3LGCA 4JE1A 1X9MB 3ZFLA 4PURA 1ON4A 3IA1A 3V1WA 2L5LA 2F9SA 3MDKA 1ZZYA 4IELA 3M8NA 3HY2A 2C0GA 4E8HA 3DMLA 4RUVA 3TKSE 1LBKA 2QSIA 4HS1A 4YKFA 1GRXA 2DKHA 3VFIA 2H0HA 4POBA 1F6MC 3O6TA 3GYKA 2E2MA 2H19A 3ZRDA 1HNCA 2EIQA 1JLWA 2GSTA 1GLQA 1EOHA 1Z7PA 2IFQA 1Z3EA 1Y25A 4Q5NA 1U6TA 2GZYA 3TRPA 2H70A 3WT1A 5ECIB 6GSTA 1SL0B 4IKHA 2VOCA 5CRGA 4HSCX 2GT6A 5IMDA 4PQHA 4EO3A 2Z9SA 2PUKC 4IJ3A 16GSA 2H6XA 1HNBA 1CQGA 4HU7A 2B1LA 4NWYA 2R0PA 3UVHA 2VM2A 4GWRA 3EURA 1XW9A 1BG5A 4K0NA 5DJLA 1GSFA 4L8EA 4IQAA 4NV5A 4DSRA 5A4WA 1GSDA 4WR5A 3F0IA 4POKA 20GSA 1GSYA 3UL3A 3P7XA 5HR2A 2VCXA 2PBJA 1PFOA 3TKPA 4DSQA 1SD8A 4FQUA 4NPBA 1XCCA 5J9BA 1S3RA 1GSEA 3HZ8A 2LJAA 5IO2A 5B8BA 1WP0A 4L5LA 2XPEA 3D22A 4BPYA 1VRSD 1KBNA 3G7IA 1S3AA 5H5RA 1B9XC 1G6WA 3M9KA 3I43A 4PQ1A 2LJKA 1AQWA 1FVKA 3O3TA 2LRNA 5ECSA 1TDIA 2AAWA 5D96A 1AIUA 3GKXA 3GUSA 4GTUA 4ISDA 1Z6MA 3RDWA 3UMAA 3CBUA 3GH9A 4MK3A 1UVZA 1GULA 2P5RA 1EEJA 4J57E 1VGLA 3ZVJD 5IOXA 3KZQA 1GSQA 3IK7A 4G19A 5A5KA 2QA1A 17GSA 1O6JA 3LW9A 2GZPA 5GZZB 1M99A 2RIIA 3EYTA 1TRUA 4MJEA 2WRTA 2MZCA 1THOA 1AAZA 4EF0A 1ZGNA 1T1VA 3GA4A 2J23A 1GUHA 4I2TA 1OVNA 5J41A 4IVFA 4KGIA 3GURA 1PX6A 2AUVA 3CSIA 4MZCA 1K0BA 3GSTA 2O89A 3DIEA 2WFCA 2MMOA 5ECQB 3HD5A 1WOUA 3G7YA 1QMVA 3PPUA 2MMNA 3P90A 4RQXA 5D9VA 3IR4A 2GSQA 4LA1A 3TJJA 5KOWA 1ZYNA 1MD4A 4AJ7A 1TRWA 1QK8A 4EL1A 1LU4A 2FWFA 3EMPA 2CA8A 3MAKA 1OC9A 4MZBA 4KB3A 4NXIA 2DJ3A 5DQSA 4HZ2A 3WGXA 3FRCA 22GSA 1GP1A 4MZWA 1R4WA 4WF4A 2DJKA 4OCEA 1M9AA 5FHIA 3FW2A 5BMUA 2YZUA 1TI3A 2X8GA 2KHPA 1R5AA 5HFGA 1PA3A 2FD3A 1MDIA 1F3BA 2R0CA 4BVYA 1M2BA 2DJ2A 1FG4A 1T7PB 2QGVA 1UN2A 12GSA 3HA9A 5FWGA 4POMA 2H76A 2PGTA 2ES7A 1K0DA 4MH3A 2HYXA 2L6DA 2NDOA 4HI7A 1X9WB 2IMKA 3CRUA 2CT6A 3JCML 3L9SA 2JL4A 1V58A 3QR6A 3IC4A 4N11A 2YOIA 3GL5A 4OCFA 2H74A 1V98A 5AISA 4CW9A 4DVCA 4KCEA 1ST9A 1JZDA 2JZSA 2ON7A 3KXOA 4ZBDA 3Q18A 5B8AA 1JZWA 2HXKA 2L57A 1RK4A 2LV3A 1Z9HA 3DEXA 3F4RA 2H0GA 3ZLPA 2CAQA 1YQ1A 5J5NA 3PR8A 2YCDA 2K8VA 3TRXA 3KH7A 4KW6A 3QMXA 1Y6EA 4O5RA 3TJKA 3HVXA 4OO5A 3QD9A 4K9ZA 1N8JA 2CQ9A 4YAPA 4HQZA 1EP8A 2O85A 1K3OA 1NM3A 2LRCA 3C7MA 3EU4A 3IXRA 1R7HA 3FZAA 3N9JA 3WGEA 4GLTA 3FK8A 3ZREA 3A5WA 5KN1A 4IS0A 1ZMAA 2P5QA 5CRHA 1THXA 3N5OA 4HOJA 3HDCA 3IBHA 1SKWB 4MCUA 3S9FA 1KTEA 1WRYA 4ZB9A 2AV4A 2GSSA 2LJRA 5IO0A 3C71A 1OYJA 5KN3A 2H8LA 3GV1A 2F8AA 5H5QA 4L5OA 1I5GA 4Q5RA 5BRTA 4EUYA 3LWAA 1KEBA 1SD9A 1A0RP 4KF9A 4GRFA 3IHGA 1U3IA 2XHFA 19GSA 5F06A 5IIZA 2LTKA 2LQQA 3ZIVA 4TR3A 5ENUA 5ID2B 2WGRA 1B9YC 2CVBA 4KCAA 1XOBA 2OBIA 2C4JA 1M7TA 4IP6A 5L71A 2ZNMA 4F9ZA 3RAZA 2RM6A 5E4WA 4IW9A 5HFKA 3CTFA 4ML1A 1VF4A 1AQVA 5EY6A 4IP1A 3TDGA 1OE7A 1XXUA 1MD3A 4MPFA 4K1FA 3KMNA 3ERGA 4L0UA 1A0FA 3US3A
chains in the Genus database with same CATH topology
3HJOA 1FAAA 4XHMA 3LEFA 5EPFA 2NTOA 2O8VB 2QKEA 2B6MA 1GSUA 2H30A 3VK9A 3HYPA 4PX1A 4ZL9A 2YP6A 1PX7A 2HLSA 5IPGA 3ERWA 4Z2TA 3HXSA 1W4VA 2XBIA 2G0FA 1PSQA 3L0HA 2AJQB 3WD6A 1X5CA 3MSZA 1E6BA 4TW5A 2FA8A 1GTBA 1SJIA 4RI7A 3RPPA 2YJHA 3ZIJA 2FCHA 2GT5A 2CZ3A 1T3BA 1CQHA 3LORA 3LXTA 3VI7A 3HKRA 3DWVA 1PD21 1W89A 4P3YB 1O8XA 1J0FA 5G1LA 4Q5QA 3LSZA 1PL2A 1SYXA 3ZITA 4QQ7A 4V1Ap 1O85A 1G6YA 2L4CA 4WBJA 1AUCA 2PMTA 3TJFA 1WMJA 2C0DA 3A3TA 3QAWA 3ZMLA 2G2QA 4BVXB 5DCHA 4WBRD 2FWHA 2VD1A 4QL9A 1JZRA 1BX9A 3APOA 1XOAA 3MNGA 3VPTA 3DKSA 8GSSA 1H75A 2BMXA 2MYGA 4KH7A 5G31A 1F3AA 2OE0A 1DUGA 2FY6A 1DE2A 3VI5A 4ZIJA 2V32A 1FO5A 2HZEB 5A4UA 1ML6A 1GUKA 2K9FA 1HNAA 2VCZA 4CY8A 3Q19A 3TGZA 2DMMA 4ECCA 1GTIA 3QOUA 2IWTA 2MBTA 5ECRB 1F9MA 2HRNA 4KA0A 4TRXA 2H72A 2B5XA 1GTUA 3LYKA 2PWJA 4PTSA 5B6NA 1DE1A 1QFNA 3HHVA 4PQIA 1B4PA 2IIYA 2PVQA 3Q6OA 3E9JB 2FUG2 3GN3A 4ZB6A 4G9HA 4TXOB 4TN8A 4BVXA 3L9VA 2N5AA 1WPIA 5LNKe 5DAKB 2GS3A 4YQUA 4D73A 1TTZA 1PN9A 3GTUB 2AHEA 3EMXA 4FYBA 1ZYPA 1XW5A 2VCQA 5CO3A 2R4VA 3W6GA 2YANA 2DJ1A 1SJ6A 4ID0A 5ECMB 2BTOT 4EIQA 1KNGA 4KX4A 4MABA 5B7CA 2PU9C 4HJMA 4XRDA 3HCZA 1GLPA 4EIPA 4WKWA 2F51A 2E7PA 5IQYA 1V9WA 1O73A 3HJPA 18GSA 3TKSC 3ZMKA 2OE3A 2CX3A 4WXTA 4XRAA 2L4QA 2L5OA 4YAVA 1T4ZA 1N2AA 3UAPA 4JR4A 1XW6A 4TXOA 2CVDA 1GTAA 3KP9A 2WB9A 2LUSA 5DAKA 2VL3A 7GSSA 2F8FA 1K3YA 2H75A 2JSZA 1A2MA 1YEPA 2B5YA 2C0FA 1SKSB 1B8XA 2E0QA 4OFNA 2M46A 5G1KA 1TJDA 3D21A 2QA2A 1XPVA 4F82A 2H1AA 3DRNA 4TR1B 2CAIA 2TIRA 1BEDA 1DBYA 2CX4A 3KGKA 4KDUA 3M9JA 4JEDA 4OWYA 3TB2A 1G7OA 4N0VA 3A2XA 1SL1B 1E2YA 4TKYA 2HSMA 1ERWA 3ZVJA 3H4KA 5ECPB 4AJ6A 2DLXA 2FHEA 3BCIA 2L59A 3HJMA 3GH6A 2FWEA 4GXZA 1O81A 2R37A 1NHYA 4FYUA 2ZCTA 2EIRA 2FGXA 2H6YA 2H73A 4V1Ag 4CY6A 3F3QA 1BQ7A 1EOGA 1RW1A 2VL2C 3VPQA 1XWAA 3KP8A 1A2JA 1QXHA 3TJBA 3UIWA 3BCKA 3J7Yb 3UBKA 2VUPA 5CRDA 6GSWA 1A8LA 3GKMA 3GSSA 3VWVA 3EINA 1TK0B 1Z6NA 4N0ZA 2DC5A 3BOAA 1A2LA 4O5UA 2H66A 1TU7A 3M3MA 4TR1A 4H86A 1SU9A 1SK1A 2X49A 2RLIA 5G30A 2K8SA 1FW1A 1M2DA 1O8WA 4XS4B 4ULXA 3RHBA 5JWRB 2C3TA 2I3YA 4ECIA 5HFIA 3ISOA 3E0UA 5ECKB 1AQXA 2YZHA 4V2MA 2GDRA 2K6VA 3F3RA 3L4NA 3APQA 2PERA 2GQMA 5E59A 2JADA 3F4TA 3D5JA 2VCWA 4L0WA 3VURA 5DCGA 2HE3A 4YKGA 1MDKA 1ZCPA 1BYEA 4GF0A 5AIVA 1VF2A 1PQNA 3QFAC 4WF5A 4NAXA 2OBKA 4OFTA 1XVQA 2VLVA 1YDKA 6GSUA 3WGDA 2IN3A 2X8CA 3UARA 1YJ6A 2NVLA 3EE2A 4WEYA 4XS4A 1XWKA 4TOPA 1SENA 3GX0A 1TK8B 4BWQA 1ERUA 4X0XA 3NZNA 2MMAA 3OR5A 4LL1B 3RHCA 4JRRA 2DIYA 1GSSA 5LD0A 5D8IA 1OKTA 2V6KA 1ILOA 2CV4A 3FEUA 2VM1A 2O87A 3HVSA 4MNNA 3BJ5A 2HNLA 2YN1A 1ERTA 3F6FA 2GTUA 1YF1A 1SL2B 2KP1A 3DVWA 4XTSA 3VWWA 4LLRA 5JCUA 2DJ0A 3QPMA 5CREA 4ZL7A 1G7EA 2VCTA 4AGSA 3F6DA 4ZBBA 3R2QA 4CDOA 3ZZXA 1K0AA 2XC2A 2IPAA 2B7JA 3FR6A 2MMZA 1FB0A 3KM6A 5GSSA 1UA5A 3ED3A 2X99A 1SKRB 2KUCA 5DVBA 1QQ2A 1H4OA 2DKIA 3FZ5A 4I6XA 4GQCA 1WWJA 1YKCA 4XS6A 1TW9A 2CVKA 3APSA 1SK0A 2R6KA 4BWSA 4EVMA 1XFLA 4NV2A 5HR1A 3J7Yk 4XIHA 5C04A 1PGTA 4NHZA 1UC7A 3BD2A 2I81A 3ME7A 3DYRA 3IRAA 2K18A 2B3SA 3GL3A 1K0NA 4ZBAA 3TJGA 1HD2A 2LNSA 4V2NA 1SK2A 3E3EA 4G0IA 3F9UA 4RQRA 5JCGA 2V1MA 1K0OA 4ILFA 4O7HA 2R3XA 2YPMA 2WZ9A 1ZL9A 1NW2A 5C00A 2X4AA 1Z5YE 5DBQA 5F8BA 3IV4A 4JZQA 4KE3A 3IDVA 4Q5FA 3I9V2 3QAVA 1K3LA 4NHWA 1YKAA 3M0FA 4DSSB 2HZFA 3P2AA 2AB6A 2NPBA 5KN0A 4MMMA 3GKNA 1BJXA 2VCVA 5ID2A 5F07A 2I1UA 2JZRA 2O7KA 1GWCA 1EV9A 5CYYA 1PMTA 2FWGA 4RI6A 2FLSA 1R5PA 3LYPA 4X43A 2UZ8A 3BBYA 3KCMA 3I69A 4F2IA 1WE0A 2EC4A 4MP4A 3GX8A 2EIOA 4IBPA 2D2ZA 3DXBA 2RUFA 4YQVA 5JWOB 2WDUA 3GKKA 3CMIA 3I6AA 4ZXGA 4KUNA 4MF5A 1Q4JA 4F03A 3UBLA 2H1GA 2HSHA 1WJKA 1EGOA 4G2EA 4FH8A 1LJRA 5G5FA 4YH2A 3IK9A 4EKZA 4TR0A 3WYWA 2J9HA 3GFKA 4LMWA 3FY7A 3EC3A 5B6MA 3P8WA 3H8QA 6GSSA 2OACA 5DQYA 3TKQA 2IMFA 1OC8A 1M9BA 5ELGA 4HDEA 1K0CA 3O76A 1AW9A 3UJ1A 4KDXA 4KNDA 5JCWA 3IE3A 4MJCA 4I5QA 4PUFC 4ACSA 5IMCA 4USSA 2H1DA 1X9SB 1XVWA 4MLYA 4G0KA 2VLUA 3KTBA 2HSYA 3H79A 3GNJA 1EWXA 1X5DA 1FHEA 3A2VA 2GQKA 5DALB 3ZFBA 4WETA 3F4SA 2A4VA 5J4UA 2CZ2A 5AGYA 3RBTA 1EP7A 5AIXA 4F0CA 2I4AA 3CSHA 2OKAA 2H71A 2TRCP 4PNFA 5IM9A 4JU5A 1JHBA 1U3AA 1XWBA 3ME8A 4KAEA 4KSOA 3ZTLA 1MTCA 1SJZA 2R2JA 3TOTA 3DVXA 2B5EA 1TRSA 2C1YA 4E8EA 6GSXA 1X0RA 2LS5A 2P0GA 2VL2A 3TUEA 2V6OA 3FKFA 4ZB8A 4KSMA 2HZEA 4Z7XA 5KN2A 3FHKA 3AY8A 2H01A 4FO5A 1T8EB 2FNOA 2HFDA 2DSAA 2VO4A 3L9UA 5DALA 2M80A 3EWLA 4O5QA 1M2AA 3LJRA 2N5FA 1Z7RA 2V2GA 2X64A 5IOWA 1TK5B 2OJLA 2C80A 5HQPA 2R5GA 6GSYA 3H93A 4ZL8A 1SYRA 4TVEA 1J08A 1EEMA 2LQOA 3GHAA 5D9WA 11GSA 3CXGA 3GTUA 3PINA 3CSJA 3U6VA 2IMIA 2L6CA 3DGQA 4N10A 4OO4A 3WT2A 5ECOB 4G10A 4K2DA 4TR4A 1JFUA 2DBCA 1M0UA 1PKZA 4EXJA 5G5EA 3C73A 5KOXA 3TRQA 4OFMA 1J9BA 2MBSA 1ACVA 2RUEA 5ECHB 3GMFA 1TI1A 1TXXA 2RM5A 4A5PA 3A2WA 4O32A 4OMVA 4GSSA 5HR3A 2IMEA 1OKDA 3GRXA 4IQ1A 1S3CA 5ELAA 1T4YA 4ICYA 4K7NA 2JZTA 2YNXA 2WCIA 4NMUA 2TRXA 3VWXA 1OC9B 4BA7A 1MDJA 3IHQA 1QGVA 1TOFA 1URMA 3HVVA 1TP9A 3MIXA 2H6ZA 4MJAA 5G2ZA 4MF7A 3K8NA 1S3DA 2A4HA 1YZXA 1V40A 3C1SA 3GIXA 3G9BA 2A2PA 2JSYA 3EPTA 4K8MA 4KDYA 2JU5A 4BVYB 2F3MA 2VL9A 5CRWA 1EGRA 3A5IA 1FVJA 3LXZA 4Z2RA 4QL7A 3F63A 3UEMA 4HJ2A 1MEKA 2HI7A 5IPHA 3ZYWA 3FR3A 2ALBA 4GCIA 2VD0A 4N30A 2XPDA 4YQMA 4HU9A 2LEGA 3H1NA 4MJBA 2YWMA 1NSWA 4O92A 1ZOFA 1RQMA 2OA7A 5GSTA 2GSRA 1B48A 4IGJA 1OC3A 1XWGA 4HEA2 5ECLB 5DDLA 1G0TA 2YV9A 2OE1A 2X8HA 1BAYA 4IN0A 5CP1A 3D4MA 1PL1A 4HUAA 4PUAA 1OE8A 4JR6A 2VLTA 5HR0A 2VIMA 2IMDA 1VF1A 2WULA 5DJMA 4AJ8A 1XWCA 4LL4B 4EE0A 4K0GA 5AN1A 1A24A 3Q74A 3KH9A 3D6IA 1FOHA 4ECBA 3L78A 4BL7B 3VLNA 4PGTA 3MWHA 2QC7A 2KP2A 3ERFA 1VF3A 1YF0A 5J3RA 1K0MA 4JBBA 3FYGA 4G0LA 1ZYQB 2M72A 2LSTA 3EU3A 4TXVA 1A8YA 3VWUA 3D4TA 2JACA 5LCZA 4GSNA 5A4VA 1FOVA 3PH9A 2C8UA 3F8UA 1F37A 2GQLA 4MF6A 5EL8A 3FZ4A 1AC1A 2PPTA 3KIJA 2GLRA 2YJ7A 5GAND 1WIKA 1IYHA 1JLVA 1USBA 4MPGA 1GNWA 3NOFA 1T00A 2PN8A 3SWLA 3CRTA 4K2XA 2WS2A 2YWNA 9GSSA 2I9HA 2AYTA 2B7KA 3EVIA 3FR9A 1DSBA 1GL8A 5D9TA 5D93A 1EV4A 2REMA 6GSVA 3LG6A 4Z2UA 1U88A 3W8SA 4BL7A 1YY7A 2YWIA 4K7OA 3ZL5A 3TKRA 1V57A 3LQ7A 3C1RA 2DMLA 3MYDA 4I8BA 4HZ4A 2R0GA 1XBSA 3LFLA 5D73A 4IHUA 4LMVA 3PGTA 1O7UA 4XCSA 4X4JA 1TRVA 1PKWA 5F0GA 5F05A 3KMOA 5H5SA 3U5RE 1Q98A 1OAZA 4ML6A 2A2RA 5KEJA 3R3EA 2H1BA 2ON5A 4ZILA 3DD3A 4GQFA 4J56E 3UOMA 2C3QA 3M1GA 2HRFA 1V2AA 3QCPA 4I97A 3TOUA 1HYUA 1YEXA 2ZUPA 3FMWA 2WJUA 4MDCA 2FA4A 4K6XA 1HQOA 2HT9A 1NHOA 2YV7A 1B4QA 5IMZA 14GSA 2C0EA 2V41A 2IJYA 3TCOA 2OADA 5COHA 2P31A 3KJYA 3CYNA 5GAPD 2LNTA 3W8JA 2H0IA 4EC0A 5IMFA 1I9DA 4HQSA 3D0ZA 4DEJA 1XZOA 1TU8A 5CAXA 4I2UA 3IAS2 1ZYEA 5IMVA 3IPZA 4FYCA 4MA9A 4AF2A 1TKDB 2DIZA 4K5RA 4CHSA 2DJJA 4ECJA 2C3NA 5FT3A 4EDZA 3KTLA 4PXOA 1AXDA 2GGTA 4OD7A 4PNGA 2A2SA 1JZOA 4WR4A 1FB6A 3IOSA 1PRXA 5J9CA 5JWQB 4MH2A 3QDNA 1GUMA 13GSA 3NIVA 4F0BA 4XS1A 4K7IA 2GVPA 3IC8A 3FZ9A 2LRTA 5ABRA 2YWOA 4GSTA 3QFBC 4EDYA 2IL3A 2BJXA 3G7JA 4FIWA 2VAFA 3SBCA 2B1KA 4DSSA 5ECNB 5IMAA 5CNWA 3TKSA 3KEBA 3C8EA 1EZKA 1ERVA 3RPNA 3UVTA 1GNEA 4K5SA 2E2GA 1QUWA 1IYIA 1GH2A 3CTGA 1R26A 4X1UA 2HRKA 1A23A 3IAM2 1C72A 4IJIA 1X5EA 5INYA 4J2FA 2KLXA 1F2EA 2GZZA 3KD0A 10GSA 2LKUA 2XBQA 4POLA 2N5BA 2IFQB 2PVOC 2HRAA 2KOKA 2NBSA 1ABAA 5D9XA 1U87A 1XIYA 4D73B 3QAGA 3HZ4A 5EVOA 4V2LA 1PN0A 3LGCA 4JE1A 1X9MB 3ZFLA 4PURA 1ON4A 3IA1A 3V1WA 2L5LA 2F9SA 3MDKA 1ZZYA 4IELA 3M8NA 3HY2A 2C0GA 4E8HA 3DMLA 4RUVA 3TKSE 1LBKA 2QSIA 4HS1A 4YKFA 1GRXA 2DKHA 3VFIA 2H0HA 4POBA 1F6MC 3O6TA 3GYKA 2E2MA 2H19A 3ZRDA 1HNCA 2EIQA 1JLWA 2GSTA 1GLQA 1EOHA 1Z7PA 2IFQA 1Z3EA 1Y25A 4Q5NA 1U6TA 2GZYA 3TRPA 2H70A 3WT1A 5ECIB 6GSTA 1SL0B 4IKHA 2VOCA 5CRGA 2GT6A 5IMDA 4PQHA 4EO3A 2Z9SA 2PUKC 4IJ3A 16GSA 2H6XA 1HNBA 1CQGA 4HU7A 2B1LA 4NWYA 2R0PA 3UVHA 2VM2A 4GWRA 3EURA 1XW9A 1BG5A 4K0NA 5DJLA 1GSFA 4L8EA 4IQAA 4NV5A 4DSRA 5A4WA 1GSDA 4WR5A 3F0IA 4POKA 20GSA 1GSYA 3UL3A 3P7XA 5HR2A 2VCXA 2PBJA 3TKPA 4DSQA 1SD8A 4FQUA 4NPBA 1XCCA 5J9BA 1GSEA 3HZ8A 2LJAA 5IO2A 5B8BA 1WP0A 4L5LA 2XPEA 3D22A 4BPYA 1VRSD 1KBNA 3G7IA 1S3AA 5H5RA 1B9XC 1G6WA 3M9KA 3I43A 4PQ1A 2LJKA 1AQWA 1FVKA 3O3TA 2LRNA 5ECSA 1TDIA 2AAWA 5D96A 1AIUA 3GKXA 3GUSA 4GTUA 4ISDA 1Z6MA 3RDWA 3UMAA 3CBUA 3GH9A 4MK3A 1UVZA 1GULA 2P5RA 1EEJA 4J57E 1VGLA 3ZVJD 5IOXA 3KZQA 1GSQA 3IK7A 4G19A 5A5KA 2QA1A 17GSA 1O6JA 3LW9A 2GZPA 5GZZB 1M99A 2RIIA 3EYTA 1TRUA 4MJEA 2WRTA 2MZCA 1THOA 1AAZA 4EF0A 1ZGNA 1T1VA 3GA4A 2J23A 1GUHA 4I2TA 1OVNA 5J41A 4IVFA 4KGIA 3GURA 1PX6A 2AUVA 3CSIA 4MZCA 1K0BA 3GSTA 2O89A 3DIEA 2WFCA 2MMOA 5ECQB 3HD5A 1WOUA 3G7YA 1QMVA 3PPUA 2MMNA 3P90A 4RQXA 5D9VA 3IR4A 2GSQA 4LA1A 3TJJA 5KOWA 1ZYNA 1MD4A 4AJ7A 1TRWA 1QK8A 4EL1A 1LU4A 2FWFA 3EMPA 2CA8A 3MAKA 1OC9A 4MZBA 4KB3A 4NXIA 2DJ3A 5DQSA 4HZ2A 3WGXA 3FRCA 22GSA 1GP1A 4MZWA 1R4WA 4WF4A 2DJKA 4OCEA 1M9AA 5FHIA 3FW2A 5BMUA 2YZUA 1TI3A 2X8GA 2KHPA 1R5AA 5HFGA 1PA3A 2FD3A 1MDIA 1F3BA 2R0CA 4BVYA 1M2BA 2DJ2A 1FG4A 1T7PB 2QGVA 1UN2A 12GSA 3HA9A 5FWGA 4POMA 2H76A 2PGTA 2ES7A 1K0DA 4MH3A 2HYXA 2L6DA 2NDOA 4HI7A 1X9WB 2IMKA 3CRUA 2CT6A 3JCML 3L9SA 2JL4A 1V58A 3QR6A 3IC4A 4N11A 2YOIA 3GL5A 4OCFA 2H74A 1V98A 5AISA 4CW9A 4DVCA 4KCEA 1ST9A 1JZDA 2JZSA 2ON7A 3KXOA 4ZBDA 3Q18A 5B8AA 1JZWA 2HXKA 2L57A 1RK4A 2LV3A 1Z9HA 3DEXA 3F4RA 2H0GA 3ZLPA 2CAQA 1YQ1A 5J5NA 3PR8A 2YCDA 2K8VA 3TRXA 3KH7A 4KW6A 3QMXA 1Y6EA 4O5RA 3TJKA 3HVXA 4OO5A 3QD9A 4K9ZA 1N8JA 2CQ9A 4YAPA 4HQZA 1EP8A 2O85A 1K3OA 1NM3A 2LRCA 3C7MA 3EU4A 3IXRA 1R7HA 3FZAA 3N9JA 3WGEA 4GLTA 3FK8A 3ZREA 3A5WA 5KN1A 4IS0A 1ZMAA 2P5QA 5CRHA 1THXA 3N5OA 4HOJA 3HDCA 3IBHA 1SKWB 4MCUA 3S9FA 1KTEA 1WRYA 4ZB9A 2AV4A 2GSSA 2LJRA 5IO0A 3C71A 1OYJA 5KN3A 2H8LA 3GV1A 2F8AA 5H5QA 4L5OA 1I5GA 4Q5RA 5BRTA 4EUYA 3LWAA 1KEBA 1SD9A 1A0RP 4KF9A 4GRFA 3IHGA 1U3IA 2XHFA 19GSA 5F06A 5IIZA 2LTKA 2LQQA 3ZIVA 4TR3A 5ENUA 5ID2B 2WGRA 1B9YC 2CVBA 4KCAA 1XOBA 2OBIA 2C4JA 1M7TA 4IP6A 5L71A 2ZNMA 4F9ZA 3RAZA 2RM6A 5E4WA 4IW9A 5HFKA 3CTFA 4ML1A 1VF4A 1AQVA 5EY6A 4IP1A 3TDGA 1OE7A 1XXUA 1MD3A 4MPFA 4K1FA 3KMNA 3ERGA 4L0UA 1A0FA 3US3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HJO A;  1FAA A;  4XHM A;  3LEF A;  5EPF A;  2NTO A;  2O8V B;  2QKE A;  2B6M A;  1GSU A;  2H30 A;  3VK9 A;  3HYP A;  4PX1 A;  4ZL9 A;  2YP6 A;  1PX7 A;  2HLS A;  5IPG A;  3ERW A;  3HXS A;  1W4V A;  2XBI A;  2G0F A;  1PSQ A;  3L0H A;  2AJQ B;  3WD6 A;  1X5C A;  3MSZ A;  1E6B A;  4TW5 A;  2FA8 A;  1GTB A;  1SJI A;  4RI7 A;  3RPP A;  2YJH A;  3ZIJ A;  2FCH A;  2GT5 A;  2CZ3 A;  1T3B A;  1CQH A;  3LOR A;  3LXT A;  3VI7 A;  3HKR A;  3DWV A;  1PD2 1;  1W89 A;  4P3Y B;  1O8X A;  1J0F A;  5G1L A;  4Q5Q A;  3LSZ A;  1PL2 A;  1SYX A;  3ZIT A;  4QQ7 A;  4V1A p;  1O85 A;  1G6Y A;  2L4C A;  4WBJ A;  1AUC A;  2PMT A;  3TJF A;  1WMJ A;  2C0D A;  3A3T A;  3QAW A;  3ZML A;  2G2Q A;  5DCH A;  4WBR D;  2FWH A;  2VD1 A;  4QL9 A;  1JZR A;  1BX9 A;  3APO A;  1XOA A;  3MNG A;  3VPT A;  3DKS A;  8GSS A;  1H75 A;  2BMX A;  2MYG A;  4KH7 A;  5G31 A;  1F3A A;  2OE0 A;  1DUG A;  2FY6 A;  1DE2 A;  3VI5 A;  4ZIJ A;  2V32 A;  1FO5 A;  2HZE B;  5A4U A;  1ML6 A;  1GUK A;  2K9F A;  1HNA A;  2VCZ A;  3Q19 A;  3TGZ A;  2DMM A;  4ECC A;  1GTI A;  3QOU A;  2IWT A;  2MBT A;  5ECR B;  1F9M A;  2HRN A;  4KA0 A;  4TRX A;  2H72 A;  2B5X A;  1GTU A;  3LYK A;  2PWJ A;  5B6N A;  1DE1 A;  1QFN A;  3HHV A;  4PQI A;  1B4P A;  2IIY A;  2PVQ A;  3Q6O A;  3E9J B;  2FUG 2;  3GN3 A;  4ZB6 A;  4G9H A;  4TXO B;  4TN8 A;  4BVX A;  3L9V A;  2N5A A;  1WPI A;  5LNK e;  5DAK B;  2GS3 A;  4YQU A;  4D73 A;  1TTZ A;  1PN9 A;  3GTU B;  2AHE A;  3EMX A;  4FYB A;  1XW5 A;  2VCQ A;  5CO3 A;  2R4V A;  3W6G A;  2YAN A;  2DJ1 A;  1SJ6 A;  4ID0 A;  5ECM B;  2BTO T;  1KNG A;  4KX4 A;  4MAB A;  5B7C A;  2PU9 C;  4HJM A;  4XRD A;  3HCZ A;  1GLP A;  4WKW A;  2F51 A;  2E7P A;  5IQY A;  1V9W A;  1O73 A;  3HJP A;  18GS A;  3TKS C;  3ZMK A;  2OE3 A;  2CX3 A;  4WXT A;  4XRA A;  2L4Q A;  2L5O A;  4YAV A;  1T4Z A;  1N2A A;  3UAP A;  4JR4 A;  1XW6 A;  4TXO A;  2CVD A;  1GTA A;  3KP9 A;  2WB9 A;  2LUS A;  5DAK A;  2VL3 A;  7GSS A;  2F8F A;  1K3Y A;  2H75 A;  2JSZ A;  1A2M A;  1YEP A;  2B5Y A;  2C0F A;  1SKS B;  1B8X A;  2E0Q A;  4OFN A;  2M46 A;  5G1K A;  1TJD A;  3D21 A;  1XPV A;  4F82 A;  2H1A A;  3DRN A;  4TR1 B;  2CAI A;  2TIR A;  1BED A;  1DBY A;  2CX4 A;  3KGK A;  4KDU A;  3M9J A;  4JED A;  4OWY A;  3TB2 A;  1G7O A;  4N0V A;  3A2X A;  1SL1 B;  1E2Y A;  4TKY A;  1ERW A;  3ZVJ A;  3H4K A;  5ECP B;  4AJ6 A;  2DLX A;  2FHE A;  3BCI A;  2L59 A;  3HJM A;  3GH6 A;  2FWE A;  4GXZ A;  1O81 A;  2R37 A;  1NHY A;  4FYU A;  2ZCT A;  2EIR A;  2FGX A;  2H6Y A;  2H73 A;  4V1A g;  3F3Q A;  1BQ7 A;  1EOG A;  1RW1 A;  2VL2 C;  3VPQ A;  1XWA A;  3KP8 A;  1A2J A;  1QXH A;  3TJB A;  3UIW A;  3BCK A;  3J7Y b;  3UBK A;  2VUP A;  5CRD A;  6GSW A;  1A8L A;  3GKM A;  3GSS A;  3VWV A;  3EIN A;  1TK0 B;  1Z6N A;  4N0Z A;  2DC5 A;  3BOA A;  1A2L A;  2H66 A;  1TU7 A;  3M3M A;  4TR1 A;  4H86 A;  1SU9 A;  1SK1 A;  2RLI A;  5G30 A;  2K8S A;  1FW1 A;  1M2D A;  1O8W A;  4XS4 B;  4ULX A;  3RHB A;  5JWR B;  2C3T A;  2I3Y A;  4ECI A;  5HFI A;  3ISO A;  3E0U A;  5ECK B;  1AQX A;  2YZH A;  4V2M A;  2GDR A;  2K6V A;  3F3R A;  3L4N A;  3APQ A;  2PER A;  2GQM A;  5E59 A;  2JAD A;  3F4T A;  3D5J A;  2VCW A;  4L0W A;  3VUR A;  5DCG A;  2HE3 A;  1MDK A;  1ZCP A;  1BYE A;  4GF0 A;  5AIV A;  1VF2 A;  1PQN A;  3QFA C;  4WF5 A;  4NAX A;  2OBK A;  4OFT A;  1XVQ A;  2VLV A;  1YDK A;  6GSU A;  3WGD A;  2IN3 A;  2X8C A;  3UAR A;  1YJ6 A;  2NVL A;  3EE2 A;  4WEY A;  4XS4 A;  1XWK A;  4TOP A;  1SEN A;  3GX0 A;  1TK8 B;  4BWQ A;  1ERU A;  4X0X A;  3NZN A;  2MMA A;  3OR5 A;  4LL1 B;  3RHC A;  4JRR A;  2DIY A;  1GSS A;  5LD0 A;  5D8I A;  1OKT A;  2V6K A;  1ILO A;  2CV4 A;  3FEU A;  2VM1 A;  2O87 A;  3HVS A;  3BJ5 A;  2HNL A;  2YN1 A;  1ERT A;  3F6F A;  2GTU A;  1YF1 A;  1SL2 B;  2KP1 A;  3DVW A;  4XTS A;  3VWW A;  4LLR A;  5JCU A;  2DJ0 A;  3QPM A;  5CRE A;  4ZL7 A;  1G7E A;  2VCT A;  4AGS A;  3F6D A;  4ZBB A;  3R2Q A;  4CDO A;  3ZZX A;  1K0A A;  2XC2 A;  2IPA A;  2B7J A;  3FR6 A;  2MMZ A;  1FB0 A;  3KM6 A;  5GSS A;  1UA5 A;  3ED3 A;  2X99 A;  1SKR B;  2KUC A;  5DVB A;  1QQ2 A;  1H4O A;  3FZ5 A;  4I6X A;  4GQC A;  1WWJ A;  1YKC A;  4XS6 A;  1TW9 A;  2CVK A;  3APS A;  1SK0 A;  2R6K A;  4BWS A;  4EVM A;  1XFL A;  4NV2 A;  5HR1 A;  3J7Y k;  4XIH A;  5C04 A;  1PGT A;  4NHZ A;  1UC7 A;  3BD2 A;  2I81 A;  3ME7 A;  3DYR A;  3IRA A;  2K18 A;  2B3S A;  3GL3 A;  1K0N A;  4ZBA A;  3TJG A;  1HD2 A;  2LNS A;  4V2N A;  1SK2 A;  3E3E A;  3F9U A;  4RQR A;  5JCG A;  2V1M A;  1K0O A;  4ILF A;  4O7H A;  2R3X A;  2YPM A;  2WZ9 A;  1ZL9 A;  1NW2 A;  5C00 A;  1Z5Y E;  5DBQ A;  5F8B A;  3IV4 A;  4JZQ A;  4KE3 A;  3IDV A;  4Q5F A;  3I9V 2;  3QAV A;  1K3L A;  4NHW A;  1YKA A;  3M0F A;  4DSS B;  2HZF A;  3P2A A;  2AB6 A;  2NPB A;  5KN0 A;  4MMM A;  3GKN A;  1BJX A;  2VCV A;  5ID2 A;  5F07 A;  2I1U A;  2JZR A;  2O7K A;  1GWC A;  1EV9 A;  5CYY A;  1PMT A;  2FWG A;  4RI6 A;  2FLS A;  1R5P A;  3LYP A;  4X43 A;  3BBY A;  3KCM A;  3I69 A;  4F2I A;  1WE0 A;  2EC4 A;  4MP4 A;  3GX8 A;  2EIO A;  4IBP A;  2D2Z A;  3DXB A;  2RUF A;  4YQV A;  5JWO B;  2WDU A;  3GKK A;  3CMI A;  3I6A A;  4ZXG A;  4KUN A;  4MF5 A;  1Q4J A;  4F03 A;  3UBL A;  2H1G A;  2HSH A;  1WJK A;  1EGO A;  4G2E A;  4FH8 A;  1LJR A;  5G5F A;  4YH2 A;  3IK9 A;  4EKZ A;  4TR0 A;  3WYW A;  2J9H A;  3GFK A;  4LMW A;  3FY7 A;  3EC3 A;  5B6M A;  3P8W A;  3H8Q A;  6GSS A;  2OAC A;  5DQY A;  3TKQ A;  2IMF A;  1OC8 A;  1M9B A;  5ELG A;  4HDE A;  1K0C A;  3O76 A;  1AW9 A;  3UJ1 A;  4KDX A;  4KND A;  5JCW A;  3IE3 A;  4MJC A;  4I5Q A;  4PUF C;  4ACS A;  5IMC A;  2H1D A;  1X9S B;  1XVW A;  4MLY A;  2VLU A;  3KTB A;  2HSY A;  3H79 A;  3GNJ A;  1EWX A;  1X5D A;  1FHE A;  3A2V A;  2GQK A;  5DAL B;  3ZFB A;  4WET A;  3F4S A;  2A4V A;  5J4U A;  2CZ2 A;  5AGY A;  3RBT A;  1EP7 A;  5AIX A;  4F0C A;  2I4A A;  3CSH A;  2OKA A;  2H71 A;  2TRC P;  4PNF A;  5IM9 A;  4JU5 A;  1JHB A;  1U3A A;  1XWB A;  3ME8 A;  4KAE A;  4KSO A;  3ZTL A;  1MTC A;  1SJZ A;  2R2J A;  3TOT A;  3DVX A;  2B5E A;  1TRS A;  2C1Y A;  4E8E A;  6GSX A;  1X0R A;  2LS5 A;  2P0G A;  2VL2 A;  3TUE A;  2V6O A;  3FKF A;  4ZB8 A;  4KSM A;  2HZE A;  4Z7X A;  5KN2 A;  3FHK A;  3AY8 A;  2H01 A;  4FO5 A;  1T8E B;  2FNO A;  2HFD A;  2DSA A;  2VO4 A;  3L9U A;  5DAL A;  2M80 A;  3EWL A;  1M2A A;  3LJR A;  2N5F A;  1Z7R A;  2V2G A;  2X64 A;  5IOW A;  1TK5 B;  2OJL A;  2C80 A;  5HQP A;  2R5G A;  6GSY A;  3H93 A;  4ZL8 A;  1SYR A;  4TVE A;  1J08 A;  1EEM A;  2LQO A;  3GHA A;  5D9W A;  11GS A;  3CXG A;  3GTU A;  3PIN A;  3CSJ A;  3U6V A;  2IMI A;  2L6C A;  3DGQ A;  4N10 A;  4OO4 A;  3WT2 A;  5ECO B;  4G10 A;  4K2D A;  4TR4 A;  1JFU A;  2DBC A;  1M0U A;  1PKZ A;  4EXJ A;  5G5E A;  3C73 A;  3TRQ A;  4OFM A;  1J9B A;  2MBS A;  1ACV A;  2RUE A;  5ECH B;  3GMF A;  1TI1 A;  1TXX A;  2RM5 A;  3A2W A;  4O32 A;  4OMV A;  4GSS A;  5HR3 A;  2IME A;  1OKD A;  3GRX A;  4IQ1 A;  1S3C A;  5ELA A;  1T4Y A;  4K7N A;  2JZT A;  2YNX A;  2WCI A;  4NMU A;  2TRX A;  3VWX A;  1OC9 B;  4BA7 A;  1MDJ A;  3IHQ A;  1QGV A;  1TOF A;  1URM A;  3HVV A;  1TP9 A;  2H6Z A;  4MJA A;  5G2Z A;  4MF7 A;  3K8N A;  1S3D A;  1YZX A;  1V40 A;  3C1S A;  3GIX A;  3G9B A;  2JSY A;  4K8M A;  4KDY A;  2JU5 A;  2F3M A;  2VL9 A;  5CRW A;  1EGR A;  1FVJ A;  3LXZ A;  4QL7 A;  3F63 A;  3UEM A;  4HJ2 A;  1MEK A;  2HI7 A;  5IPH A;  3ZYW A;  3FR3 A;  2ALB A;  4GCI A;  2VD0 A;  4N30 A;  2XPD A;  4YQM A;  4HU9 A;  2LEG A;  3H1N A;  4MJB A;  2YWM A;  1NSW A;  4O92 A;  1ZOF A;  1RQM A;  2OA7 A;  5GST A;  2GSR A;  1B48 A;  4IGJ A;  1OC3 A;  1XWG A;  4HEA 2;  5ECL B;  5DDL A;  1G0T A;  2YV9 A;  2OE1 A;  2X8H A;  1BAY A;  4IN0 A;  5CP1 A;  3D4M A;  1PL1 A;  4HUA A;  4PUA A;  1OE8 A;  4JR6 A;  2VLT A;  5HR0 A;  2VIM A;  2IMD A;  1VF1 A;  2WUL A;  5DJM A;  4AJ8 A;  1XWC A;  4LL4 B;  4EE0 A;  4K0G A;  5AN1 A;  1A24 A;  3Q74 A;  3KH9 A;  3D6I A;  4ECB A;  3L78 A;  3VLN A;  4PGT A;  3MWH A;  2QC7 A;  2KP2 A;  3ERF A;  1VF3 A;  1YF0 A;  5J3R A;  1K0M A;  4JBB A;  3FYG A;  1ZYQ B;  2M72 A;  2LST A;  3EU3 A;  4TXV A;  1A8Y A;  3VWU A;  3D4T A;  2JAC A;  5LCZ A;  4GSN A;  5A4V A;  1FOV A;  3PH9 A;  2C8U A;  3F8U A;  1F37 A;  2GQL A;  4MF6 A;  5EL8 A;  3FZ4 A;  1AC1 A;  2PPT A;  3KIJ A;  2GLR A;  2YJ7 A;  5GAN D;  1WIK A;  1IYH A;  1JLV A;  1USB A;  4MPG A;  1GNW A;  3NOF A;  1T00 A;  2PN8 A;  3SWL A;  3CRT A;  2WS2 A;  2YWN A;  9GSS A;  2I9H A;  2AYT A;  2B7K A;  3EVI A;  3FR9 A;  1DSB A;  1GL8 A;  5D9T A;  5D93 A;  1EV4 A;  2REM A;  6GSV A;  3LG6 A;  1U88 A;  3W8S A;  4BL7 A;  1YY7 A;  2YWI A;  4K7O A;  3ZL5 A;  3TKR A;  1V57 A;  3LQ7 A;  3C1R A;  2DML A;  4I8B A;  4HZ4 A;  1XBS A;  3LFL A;  5D73 A;  4IHU A;  4LMV A;  3PGT A;  1O7U A;  4XCS A;  1TRV A;  1PKW A;  5F0G A;  5F05 A;  3KMO A;  5H5S A;  3U5R E;  1Q98 A;  1OAZ A;  4ML6 A;  2A2R A;  5KEJ A;  2H1B A;  2ON5 A;  4ZIL A;  3DD3 A;  4GQF A;  4J56 E;  3UOM A;  2C3Q A;  3M1G A;  2HRF A;  1V2A A;  3QCP A;  4I97 A;  3TOU A;  1HYU A;  1YEX A;  2ZUP A;  2WJU A;  4MDC A;  2FA4 A;  4K6X A;  1HQO A;  2HT9 A;  1NHO A;  2YV7 A;  1B4Q A;  5IMZ A;  14GS A;  2C0E A;  2V41 A;  2IJY A;  3TCO A;  2OAD A;  5COH A;  2P31 A;  3KJY A;  3CYN A;  5GAP D;  2LNT A;  3W8J A;  2H0I A;  4EC0 A;  5IMF A;  1I9D A;  4HQS A;  3D0Z A;  4DEJ A;  1XZO A;  1TU8 A;  5CAX A;  4I2U A;  3IAS 2;  1ZYE A;  5IMV A;  3IPZ A;  4FYC A;  4MA9 A;  4AF2 A;  1TKD B;  2DIZ A;  4CHS A;  2DJJ A;  4ECJ A;  2C3N A;  5FT3 A;  4EDZ A;  3KTL A;  4PXO A;  1AXD A;  2GGT A;  4OD7 A;  4PNG A;  2A2S A;  1JZO A;  4WR4 A;  1FB6 A;  3IOS A;  1PRX A;  5J9C A;  5JWQ B;  4MH2 A;  3QDN A;  1GUM A;  13GS A;  3NIV A;  4F0B A;  4XS1 A;  4K7I A;  2GVP A;  3FZ9 A;  2LRT A;  5ABR A;  2YWO A;  4GST A;  3QFB C;  4EDY A;  2IL3 A;  2BJX A;  3G7J A;  4FIW A;  2VAF A;  3SBC A;  2B1K A;  4DSS A;  5ECN B;  5IMA A;  5CNW A;  3TKS A;  3KEB A;  3C8E A;  1EZK A;  1ERV A;  3RPN A;  3UVT A;  1GNE A;  2E2G A;  1QUW A;  1IYI A;  1GH2 A;  3CTG A;  1R26 A;  4X1U A;  1A23 A;  3IAM 2;  1C72 A;  4IJI A;  1X5E A;  5INY A;  4J2F A;  2KLX A;  1F2E A;  2GZZ A;  3KD0 A;  10GS A;  2LKU A;  2XBQ A;  4POL A;  2N5B A;  2IFQ B;  2PVO C;  2KOK A;  2NBS A;  1ABA A;  5D9X A;  1U87 A;  1XIY A;  4D73 B;  3QAG A;  3HZ4 A;  5EVO A;  4V2L A;  3LGC A;  4JE1 A;  1X9M B;  3ZFL A;  4PUR A;  1ON4 A;  3IA1 A;  3V1W A;  2L5L A;  2F9S A;  3MDK A;  1ZZY A;  4IEL A;  3M8N A;  3HY2 A;  2C0G A;  4E8H A;  3DML A;  4RUV A;  3TKS E;  1LBK A;  2QSI A;  4HS1 A;  1GRX A;  3VFI A;  2H0H A;  4POB A;  1F6M C;  3O6T A;  3GYK A;  2E2M A;  2H19 A;  3ZRD A;  1HNC A;  2EIQ A;  1JLW A;  2GST A;  1GLQ A;  1EOH A;  1Z7P A;  2IFQ A;  1Z3E A;  1Y25 A;  4Q5N A;  1U6T A;  2GZY A;  3TRP A;  2H70 A;  3WT1 A;  5ECI B;  6GST A;  1SL0 B;  4IKH A;  2VOC A;  5CRG A;  2GT6 A;  5IMD A;  4PQH A;  4EO3 A;  2Z9S A;  2PUK C;  4IJ3 A;  16GS A;  2H6X A;  1HNB A;  1CQG A;  4HU7 A;  2B1L A;  4NWY A;  3UVH A;  2VM2 A;  4GWR A;  3EUR A;  1XW9 A;  1BG5 A;  4K0N A;  5DJL A;  1GSF A;  4L8E A;  4IQA A;  4NV5 A;  4DSR A;  5A4W A;  1GSD A;  4WR5 A;  3F0I A;  4POK A;  20GS A;  1GSY A;  3UL3 A;  3P7X A;  5HR2 A;  2VCX A;  2PBJ A;  3TKP A;  4DSQ A;  1SD8 A;  4NPB A;  1XCC A;  5J9B A;  1GSE A;  3HZ8 A;  2LJA A;  5IO2 A;  5B8B A;  1WP0 A;  4L5L A;  2XPE A;  3D22 A;  4BPY A;  1VRS D;  1KBN A;  3G7I A;  1S3A A;  5H5R A;  1B9X C;  1G6W A;  3M9K A;  3I43 A;  4PQ1 A;  2LJK A;  1AQW A;  1FVK A;  3O3T A;  2LRN A;  5ECS A;  1TDI A;  2AAW A;  5D96 A;  1AIU A;  3GKX A;  3GUS A;  4GTU A;  4ISD A;  1Z6M A;  3RDW A;  3UMA A;  3CBU A;  3GH9 A;  4MK3 A;  1UVZ A;  1GUL A;  2P5R A;  1EEJ A;  4J57 E;  1VGL A;  3ZVJ D;  5IOX A;  3KZQ A;  1GSQ A;  3IK7 A;  4G19 A;  5A5K A;  17GS A;  1O6J A;  2GZP A;  5GZZ B;  1M99 A;  2RII A;  3EYT A;  1TRU A;  4MJE A;  2WRT A;  2MZC A;  1THO A;  1AAZ A;  4EF0 A;  1ZGN A;  1T1V A;  3GA4 A;  2J23 A;  1GUH A;  4I2T A;  1OVN A;  5J41 A;  4IVF A;  4KGI A;  3GUR A;  1PX6 A;  2AUV A;  3CSI A;  4MZC A;  1K0B A;  3GST A;  2O89 A;  3DIE A;  2WFC A;  2MMO A;  5ECQ B;  3HD5 A;  1WOU A;  3G7Y A;  1QMV A;  2MMN A;  3P90 A;  4RQX A;  5D9V A;  3IR4 A;  2GSQ A;  4LA1 A;  3TJJ A;  1MD4 A;  4AJ7 A;  1TRW A;  1QK8 A;  4EL1 A;  1LU4 A;  2FWF A;  3EMP A;  2CA8 A;  3MAK A;  1OC9 A;  4MZB A;  4KB3 A;  4NXI A;  2DJ3 A;  5DQS A;  4HZ2 A;  3WGX A;  3FRC A;  22GS A;  1GP1 A;  4MZW A;  1R4W A;  4WF4 A;  2DJK A;  4OCE A;  1M9A A;  5FHI A;  3FW2 A;  2YZU A;  1TI3 A;  2X8G A;  2KHP A;  1R5A A;  5HFG A;  1PA3 A;  2FD3 A;  1MDI A;  1F3B A;  4BVY A;  1M2B A;  2DJ2 A;  1FG4 A;  1T7P B;  2QGV A;  1UN2 A;  12GS A;  3HA9 A;  5FWG A;  4POM A;  2H76 A;  2PGT A;  2ES7 A;  1K0D A;  4MH3 A;  2HYX A;  2L6D A;  2NDO A;  4HI7 A;  1X9W B;  2IMK A;  3CRU A;  2CT6 A;  3JCM L;  3L9S A;  2JL4 A;  1V58 A;  3QR6 A;  3IC4 A;  4N11 A;  2YOI A;  3GL5 A;  4OCF A;  2H74 A;  1V98 A;  5AIS A;  4CW9 A;  4DVC A;  4KCE A;  1ST9 A;  1JZD A;  2JZS A;  2ON7 A;  3KXO A;  4ZBD A;  3Q18 A;  5B8A A;  1JZW A;  2HXK A;  2L57 A;  1RK4 A;  2LV3 A;  1Z9H A;  3DEX A;  3F4R A;  2H0G A;  3ZLP A;  2CAQ A;  1YQ1 A;  5J5N A;  3PR8 A;  2YCD A;  2K8V A;  3TRX A;  3KH7 A;  4KW6 A;  3QMX A;  1Y6E A;  4O5R A;  3TJK A;  3HVX A;  4OO5 A;  3QD9 A;  4K9Z A;  1N8J A;  2CQ9 A;  4YAP A;  4HQZ A;  1EP8 A;  2O85 A;  1K3O A;  1NM3 A;  2LRC A;  3C7M A;  3EU4 A;  3IXR A;  1R7H A;  3FZA A;  3N9J A;  3WGE A;  4GLT A;  3FK8 A;  3ZRE A;  3A5W A;  5KN1 A;  4IS0 A;  1ZMA A;  2P5Q A;  5CRH A;  1THX A;  3N5O A;  4HOJ A;  3HDC A;  3IBH A;  1SKW B;  4MCU A;  3S9F A;  1KTE A;  1WRY A;  4ZB9 A;  2AV4 A;  2GSS A;  2LJR A;  5IO0 A;  3C71 A;  1OYJ A;  5KN3 A;  2H8L A;  3GV1 A;  2F8A A;  5H5Q A;  4L5O A;  1I5G A;  4Q5R A;  4EUY A;  3LWA A;  1KEB A;  1SD9 A;  1A0R P;  4GRF A;  1U3I A;  2XHF A;  19GS A;  5F06 A;  5IIZ A;  2LTK A;  2LQQ A;  3ZIV A;  4TR3 A;  5ENU A;  5ID2 B;  2WGR A;  1B9Y C;  2CVB A;  4KCA A;  1XOB A;  2OBI A;  2C4J A;  1M7T A;  4IP6 A;  5L71 A;  2ZNM A;  4F9Z A;  3RAZ A;  2RM6 A;  5E4W A;  4IW9 A;  5HFK A;  3CTF A;  4ML1 A;  1VF4 A;  1AQV A;  5EY6 A;  4IP1 A;  3TDG A;  1OE7 A;  1XXU A;  1MD3 A;  4MPF A;  4K1F A;  3KMN A;  3ERG A;  4L0U A;  1A0F A;  3US3 A; 
#chains in the Genus database with same CATH topology
 3HJO A;  1FAA A;  4XHM A;  3LEF A;  5EPF A;  2NTO A;  2O8V B;  2QKE A;  2B6M A;  1GSU A;  2H30 A;  3VK9 A;  3HYP A;  4PX1 A;  4ZL9 A;  2YP6 A;  1PX7 A;  2HLS A;  5IPG A;  3ERW A;  4Z2T A;  3HXS A;  1W4V A;  2XBI A;  2G0F A;  1PSQ A;  3L0H A;  2AJQ B;  3WD6 A;  1X5C A;  3MSZ A;  1E6B A;  4TW5 A;  2FA8 A;  1GTB A;  1SJI A;  4RI7 A;  3RPP A;  2YJH A;  3ZIJ A;  2FCH A;  2GT5 A;  2CZ3 A;  1T3B A;  1CQH A;  3LOR A;  3LXT A;  3VI7 A;  3HKR A;  3DWV A;  1PD2 1;  1W89 A;  4P3Y B;  1O8X A;  1J0F A;  5G1L A;  4Q5Q A;  3LSZ A;  1PL2 A;  1SYX A;  3ZIT A;  4QQ7 A;  4V1A p;  1O85 A;  1G6Y A;  2L4C A;  4WBJ A;  1AUC A;  2PMT A;  3TJF A;  1WMJ A;  2C0D A;  3A3T A;  3QAW A;  3HVN A;  3ZML A;  2G2Q A;  4BVX B;  5DCH A;  4WBR D;  2FWH A;  2VD1 A;  4QL9 A;  1JZR A;  1BX9 A;  3APO A;  1XOA A;  3MNG A;  3VPT A;  3DKS A;  8GSS A;  1H75 A;  2BMX A;  2MYG A;  4KH7 A;  5G31 A;  1F3A A;  2OE0 A;  1DUG A;  2FY6 A;  1DE2 A;  3VI5 A;  4ZIJ A;  2V32 A;  1FO5 A;  2HZE B;  5A4U A;  1ML6 A;  1GUK A;  2K9F A;  1HNA A;  1XG8 A;  2VCZ A;  4CY8 A;  3Q19 A;  3TGZ A;  2DMM A;  4ECC A;  1GTI A;  3QOU A;  2IWT A;  2MBT A;  5ECR B;  1F9M A;  2HRN A;  4KA0 A;  4TRX A;  2H72 A;  2B5X A;  1GTU A;  3LYK A;  2PWJ A;  4PTS A;  5B6N A;  1DE1 A;  1QFN A;  3HHV A;  4PQI A;  1B4P A;  2IIY A;  2PVQ A;  3Q6O A;  3E9J B;  2FUG 2;  3GN3 A;  4ZB6 A;  4G9H A;  4TXO B;  4TN8 A;  4BVX A;  3L9V A;  2N5A A;  1WPI A;  5LNK e;  5DAK B;  2GS3 A;  4YQU A;  4D73 A;  1TTZ A;  1PN9 A;  3GTU B;  2AHE A;  3EMX A;  4FYB A;  1ZYP A;  1XW5 A;  2VCQ A;  5CO3 A;  2R4V A;  3W6G A;  2YAN A;  2DJ1 A;  1SJ6 A;  4ID0 A;  5ECM B;  2BTO T;  4EIQ A;  1KNG A;  1M3J A;  4KX4 A;  4MAB A;  5B7C A;  2PU9 C;  4HJM A;  4XRD A;  3HCZ A;  1GLP A;  4EIP A;  4WKW A;  2F51 A;  2E7P A;  5IQY A;  1V9W A;  1O73 A;  3HJP A;  18GS A;  3TKS C;  3ZMK A;  2OE3 A;  2CX3 A;  4WXT A;  4XRA A;  2L4Q A;  2L5O A;  4YAV A;  1T4Z A;  1N2A A;  3UAP A;  4JR4 A;  1XW6 A;  4TXO A;  2CVD A;  1GTA A;  3KP9 A;  2WB9 A;  2LUS A;  5DAK A;  2VL3 A;  7GSS A;  2F8F A;  1K3Y A;  2H75 A;  2JSZ A;  1A2M A;  1YEP A;  2B5Y A;  2C0F A;  1SKS B;  1B8X A;  2E0Q A;  4OFN A;  2M46 A;  5G1K A;  1TJD A;  3D21 A;  2QA2 A;  1XPV A;  4F82 A;  2H1A A;  3DRN A;  4TR1 B;  2CAI A;  2TIR A;  1BED A;  1DBY A;  2CX4 A;  3KGK A;  4KDU A;  3M9J A;  4JED A;  4OWY A;  3TB2 A;  1G7O A;  4N0V A;  3A2X A;  1SL1 B;  1E2Y A;  4TKY A;  2HSM A;  1ERW A;  3ZVJ A;  3H4K A;  5ECP B;  4AJ6 A;  2DLX A;  2FHE A;  3BCI A;  2L59 A;  3HJM A;  3GH6 A;  2FWE A;  4GXZ A;  1O81 A;  2R37 A;  1NHY A;  4FYU A;  2ZCT A;  2EIR A;  2FGX A;  2H6Y A;  2H73 A;  4V1A g;  4CY6 A;  3F3Q A;  1BQ7 A;  1EOG A;  1RW1 A;  2VL2 C;  3VPQ A;  1XWA A;  3KP8 A;  1A2J A;  1QXH A;  3TJB A;  3UIW A;  3BCK A;  3J7Y b;  3UBK A;  2VUP A;  5CRD A;  6GSW A;  1A8L A;  3GKM A;  3GSS A;  3VWV A;  3EIN A;  1TK0 B;  1Z6N A;  4N0Z A;  2DC5 A;  3BOA A;  1A2L A;  4O5U A;  2H66 A;  1TU7 A;  3M3M A;  4TR1 A;  4H86 A;  1SU9 A;  1SK1 A;  2X49 A;  3CQF A;  2RLI A;  5G30 A;  2K8S A;  1FW1 A;  1M2D A;  1O8W A;  4XS4 B;  4ULX A;  3RHB A;  5JWR B;  2C3T A;  2I3Y A;  4ECI A;  5HFI A;  3ISO A;  3E0U A;  5ECK B;  1AQX A;  2YZH A;  4V2M A;  2GDR A;  2K6V A;  3F3R A;  3L4N A;  3APQ A;  2PER A;  2GQM A;  5E59 A;  2JAD A;  3F4T A;  3D5J A;  2VCW A;  4L0W A;  3VUR A;  5DCG A;  2HE3 A;  4YKG A;  1MDK A;  1ZCP A;  1BYE A;  4GF0 A;  5AIV A;  1VF2 A;  1PQN A;  3QFA C;  4WF5 A;  4NAX A;  2OBK A;  4OFT A;  1XVQ A;  2VLV A;  1YDK A;  6GSU A;  3WGD A;  2IN3 A;  2X8C A;  3UAR A;  1YJ6 A;  2NVL A;  3EE2 A;  4WEY A;  4XS4 A;  1XWK A;  4TOP A;  1SEN A;  3GX0 A;  1TK8 B;  4BWQ A;  1ERU A;  4X0X A;  3NZN A;  2MMA A;  3OR5 A;  4LL1 B;  3RHC A;  4JRR A;  2DIY A;  1GSS A;  5LD0 A;  5D8I A;  1OKT A;  2V6K A;  1ILO A;  2CV4 A;  3FEU A;  2VM1 A;  2O87 A;  3HVS A;  4MNN A;  3BJ5 A;  2HNL A;  2YN1 A;  1ERT A;  3F6F A;  2GTU A;  1YF1 A;  1SL2 B;  2KP1 A;  3DVW A;  4XTS A;  3VWW A;  4LLR A;  5JCU A;  2DJ0 A;  3QPM A;  5CRE A;  4ZL7 A;  1G7E A;  2VCT A;  4AGS A;  3F6D A;  4ZBB A;  3R2Q A;  4CDO A;  3ZZX A;  1K0A A;  1M3I A;  2XC2 A;  2IPA A;  2B7J A;  3FR6 A;  2MMZ A;  1FB0 A;  3KM6 A;  5GSS A;  1UA5 A;  3ED3 A;  2X99 A;  1SKR B;  2KUC A;  5DVB A;  1QQ2 A;  1H4O A;  2DKI A;  3FZ5 A;  4I6X A;  4GQC A;  1WWJ A;  1YKC A;  4XS6 A;  1TW9 A;  2CVK A;  3APS A;  1SK0 A;  2R6K A;  4BWS A;  4EVM A;  1XFL A;  4NV2 A;  5HR1 A;  3J7Y k;  4XIH A;  5C04 A;  1PGT A;  4NHZ A;  1UC7 A;  3BD2 A;  2I81 A;  3ME7 A;  3DYR A;  3IRA A;  2K18 A;  2B3S A;  3GL3 A;  1K0N A;  4ZBA A;  3TJG A;  1HD2 A;  2LNS A;  4V2N A;  1SK2 A;  3E3E A;  4G0I A;  3F9U A;  4RQR A;  5JCG A;  2V1M A;  1K0O A;  4ILF A;  4O7H A;  2R3X A;  2YPM A;  2WZ9 A;  1ZL9 A;  1NW2 A;  5C00 A;  2X4A A;  1Z5Y E;  5DBQ A;  5F8B A;  3IV4 A;  4JZQ A;  4KE3 A;  3IDV A;  4Q5F A;  3I9V 2;  3QAV A;  1K3L A;  4NHW A;  1YKA A;  3M0F A;  4DSS B;  2HZF A;  3P2A A;  2AB6 A;  2NPB A;  5KN0 A;  4MMM A;  3GKN A;  1BJX A;  2VCV A;  5ID2 A;  5F07 A;  2I1U A;  2JZR A;  2O7K A;  1GWC A;  1EV9 A;  5CYY A;  1PMT A;  2FWG A;  4RI6 A;  2FLS A;  1R5P A;  3LYP A;  4X43 A;  2UZ8 A;  3BBY A;  4BIK A;  3KCM A;  3I69 A;  4F2I A;  1WE0 A;  2EC4 A;  4MP4 A;  3GX8 A;  2EIO A;  4IBP A;  2D2Z A;  3DXB A;  2RUF A;  4YQV A;  5JWO B;  2WDU A;  3GKK A;  3CMI A;  3I6A A;  4ZXG A;  4KUN A;  4MF5 A;  1Q4J A;  4F03 A;  3UBL A;  2H1G A;  2HSH A;  1WJK A;  1EGO A;  4G2E A;  4FH8 A;  1LJR A;  5G5F A;  4YH2 A;  3IK9 A;  4EKZ A;  4TR0 A;  3WYW A;  2J9H A;  3GFK A;  4LMW A;  3FY7 A;  3EC3 A;  5B6M A;  3P8W A;  3H8Q A;  6GSS A;  2OAC A;  5DQY A;  3TKQ A;  2IMF A;  1OC8 A;  1M9B A;  5ELG A;  4HDE A;  1K0C A;  3O76 A;  1AW9 A;  3UJ1 A;  4KDX A;  4KND A;  5JCW A;  3IE3 A;  4MJC A;  4I5Q A;  4PUF C;  4ACS A;  5IMC A;  4USS A;  2H1D A;  1X9S B;  1XVW A;  4MLY A;  4G0K A;  2VLU A;  3KTB A;  2HSY A;  3H79 A;  3GNJ A;  1EWX A;  1X5D A;  1FHE A;  3A2V A;  2GQK A;  5DAL B;  3ZFB A;  4WET A;  3F4S A;  2A4V A;  5J4U A;  2CZ2 A;  5AGY A;  3RBT A;  1EP7 A;  5AIX A;  4F0C A;  2I4A A;  3CSH A;  2OKA A;  2H71 A;  2TRC P;  4PNF A;  5IM9 A;  4JU5 A;  1JHB A;  1U3A A;  1XWB A;  3ME8 A;  4KAE A;  4KSO A;  3ZTL A;  1MTC A;  1SJZ A;  2R2J A;  3TOT A;  3DVX A;  2B5E A;  1TRS A;  2C1Y A;  4E8E A;  6GSX A;  1X0R A;  2LS5 A;  2P0G A;  2VL2 A;  3TUE A;  2V6O A;  3FKF A;  4ZB8 A;  4KSM A;  2HZE A;  4Z7X A;  5KN2 A;  3FHK A;  3AY8 A;  2H01 A;  4FO5 A;  1T8E B;  2FNO A;  2HFD A;  2DSA A;  2VO4 A;  3L9U A;  5DAL A;  2M80 A;  3EWL A;  4O5Q A;  1M2A A;  3LJR A;  2N5F A;  1Z7R A;  2V2G A;  2X64 A;  5IOW A;  1TK5 B;  2OJL A;  2C80 A;  5HQP A;  2R5G A;  6GSY A;  3H93 A;  4ZL8 A;  1SYR A;  4TVE A;  1J08 A;  1EEM A;  2LQO A;  3GHA A;  5D9W A;  11GS A;  3CXG A;  3GTU A;  3PIN A;  3CSJ A;  3U6V A;  2IMI A;  2L6C A;  3DGQ A;  4N10 A;  4OO4 A;  3WT2 A;  5ECO B;  4G10 A;  4K2D A;  4TR4 A;  1JFU A;  2DBC A;  1M0U A;  1PKZ A;  4EXJ A;  5G5E A;  3C73 A;  5KOX A;  3TRQ A;  4OFM A;  1J9B A;  2MBS A;  1ACV A;  2RUE A;  5ECH B;  3GMF A;  1TI1 A;  1TXX A;  2RM5 A;  4A5P A;  3A2W A;  4O32 A;  4OMV A;  4GSS A;  5HR3 A;  2IME A;  1OKD A;  3GRX A;  4IQ1 A;  1S3C A;  5ELA A;  1T4Y A;  4ICY A;  4K7N A;  2JZT A;  2YNX A;  2WCI A;  4NMU A;  2TRX A;  3VWX A;  1OC9 B;  4BA7 A;  1MDJ A;  3IHQ A;  1QGV A;  1TOF A;  1URM A;  3HVV A;  1TP9 A;  3MIX A;  2H6Z A;  4MJA A;  5G2Z A;  4MF7 A;  3K8N A;  1S3D A;  2A4H A;  1YZX A;  1V40 A;  3C1S A;  3GIX A;  3G9B A;  2A2P A;  2JSY A;  3EPT A;  4K8M A;  4KDY A;  2JU5 A;  4BVY B;  2F3M A;  2VL9 A;  5CRW A;  1EGR A;  3A5I A;  1FVJ A;  3LXZ A;  4Z2R A;  4QL7 A;  3F63 A;  3UEM A;  4HJ2 A;  1MEK A;  2HI7 A;  5IPH A;  3ZYW A;  3FR3 A;  2ALB A;  4GCI A;  2VD0 A;  4N30 A;  2XPD A;  4YQM A;  4HU9 A;  2LEG A;  3H1N A;  4MJB A;  2YWM A;  1NSW A;  4O92 A;  1ZOF A;  1RQM A;  2OA7 A;  5GST A;  2GSR A;  1B48 A;  4IGJ A;  1OC3 A;  1XWG A;  4HEA 2;  5ECL B;  5DDL A;  1G0T A;  2YV9 A;  2OE1 A;  2X8H A;  1BAY A;  4IN0 A;  5CP1 A;  3D4M A;  1PL1 A;  4HUA A;  4PUA A;  1OE8 A;  4JR6 A;  2VLT A;  5HR0 A;  2VIM A;  2IMD A;  1VF1 A;  2WUL A;  5DJM A;  4AJ8 A;  1XWC A;  4LL4 B;  4EE0 A;  4K0G A;  5AN1 A;  1A24 A;  3Q74 A;  3KH9 A;  3D6I A;  1FOH A;  4ECB A;  3L78 A;  4BL7 B;  3VLN A;  4PGT A;  3MWH A;  2QC7 A;  2KP2 A;  3ERF A;  1VF3 A;  1YF0 A;  5J3R A;  1K0M A;  4JBB A;  3FYG A;  4G0L A;  1ZYQ B;  2M72 A;  2LST A;  3EU3 A;  4TXV A;  1A8Y A;  3VWU A;  3D4T A;  2JAC A;  5LCZ A;  4GSN A;  5A4V A;  1FOV A;  3PH9 A;  2C8U A;  3F8U A;  1F37 A;  2GQL A;  4MF6 A;  5EL8 A;  3FZ4 A;  1AC1 A;  2PPT A;  3KIJ A;  2GLR A;  2YJ7 A;  5GAN D;  1WIK A;  1IYH A;  1JLV A;  1USB A;  4MPG A;  1GNW A;  3NOF A;  1T00 A;  2PN8 A;  3SWL A;  3CRT A;  4K2X A;  2WS2 A;  2YWN A;  9GSS A;  2I9H A;  2AYT A;  2B7K A;  3EVI A;  3FR9 A;  1DSB A;  1GL8 A;  5D9T A;  5D93 A;  1EV4 A;  2REM A;  6GSV A;  3LG6 A;  4Z2U A;  1U88 A;  3W8S A;  4BL7 A;  1YY7 A;  2YWI A;  4K7O A;  3ZL5 A;  3TKR A;  1V57 A;  3LQ7 A;  3C1R A;  2DML A;  3MYD A;  4I8B A;  4HZ4 A;  2R0G A;  1XBS A;  3LFL A;  5D73 A;  4IHU A;  4LMV A;  3PGT A;  1O7U A;  4XCS A;  4X4J A;  1TRV A;  1PKW A;  5F0G A;  5F05 A;  3KMO A;  5H5S A;  3U5R E;  1Q98 A;  1OAZ A;  4ML6 A;  2A2R A;  5KEJ A;  3R3E A;  2H1B A;  2ON5 A;  4ZIL A;  3DD3 A;  4GQF A;  4J56 E;  3UOM A;  2C3Q A;  3M1G A;  2HRF A;  1V2A A;  3QCP A;  4I97 A;  3TOU A;  1HYU A;  1YEX A;  2ZUP A;  3FMW A;  2WJU A;  4MDC A;  2FA4 A;  4K6X A;  1HQO A;  2HT9 A;  1NHO A;  2YV7 A;  1B4Q A;  5IMZ A;  14GS A;  2C0E A;  2V41 A;  2IJY A;  3TCO A;  2OAD A;  5COH A;  2P31 A;  3KJY A;  3CYN A;  5GAP D;  2LNT A;  3W8J A;  2H0I A;  4EC0 A;  5IMF A;  1I9D A;  4HQS A;  3D0Z A;  4DEJ A;  1XZO A;  1TU8 A;  5CAX A;  4I2U A;  3IAS 2;  1ZYE A;  5IMV A;  3IPZ A;  4FYC A;  4MA9 A;  4AF2 A;  1TKD B;  2DIZ A;  4K5R A;  4CHS A;  2DJJ A;  4ECJ A;  2C3N A;  5FT3 A;  4EDZ A;  3KTL A;  4PXO A;  1AXD A;  2GGT A;  4OD7 A;  4PNG A;  2A2S A;  1JZO A;  4WR4 A;  1FB6 A;  3IOS A;  1PRX A;  5J9C A;  5JWQ B;  4MH2 A;  3QDN A;  1GUM A;  13GS A;  3NIV A;  4F0B A;  4XS1 A;  4K7I A;  2GVP A;  3IC8 A;  3FZ9 A;  2LRT A;  5ABR A;  2YWO A;  4GST A;  3QFB C;  4EDY A;  2IL3 A;  2BJX A;  3G7J A;  4FIW A;  2VAF A;  3SBC A;  2B1K A;  4DSS A;  5ECN B;  5IMA A;  5CNW A;  3TKS A;  3KEB A;  3C8E A;  1EZK A;  1ERV A;  3RPN A;  3UVT A;  1GNE A;  4K5S A;  2E2G A;  1QUW A;  1IYI A;  1GH2 A;  3CTG A;  1R26 A;  4X1U A;  2HRK A;  1A23 A;  3IAM 2;  1C72 A;  4IJI A;  1X5E A;  5INY A;  4J2F A;  2KLX A;  1F2E A;  2GZZ A;  3KD0 A;  10GS A;  2LKU A;  2XBQ A;  4POL A;  2N5B A;  2IFQ B;  2PVO C;  2HRA A;  2KOK A;  2NBS A;  1ABA A;  5D9X A;  1U87 A;  1XIY A;  4D73 B;  3QAG A;  3HZ4 A;  5EVO A;  4V2L A;  1PN0 A;  3LGC A;  4JE1 A;  1X9M B;  3ZFL A;  4PUR A;  1ON4 A;  3IA1 A;  3V1W A;  2L5L A;  2F9S A;  3MDK A;  1ZZY A;  4IEL A;  3M8N A;  3HY2 A;  2C0G A;  4E8H A;  3DML A;  4RUV A;  3TKS E;  1LBK A;  2QSI A;  4HS1 A;  4YKF A;  1GRX A;  2DKH A;  3VFI A;  2H0H A;  4POB A;  1F6M C;  3O6T A;  3GYK A;  2E2M A;  2H19 A;  3ZRD A;  1HNC A;  2EIQ A;  1JLW A;  2GST A;  1GLQ A;  1EOH A;  1Z7P A;  2IFQ A;  1Z3E A;  1Y25 A;  4Q5N A;  1U6T A;  2GZY A;  3TRP A;  2H70 A;  3WT1 A;  5ECI B;  6GST A;  1SL0 B;  4IKH A;  2VOC A;  5CRG A;  4HSC X;  2GT6 A;  5IMD A;  4PQH A;  4EO3 A;  2Z9S A;  2PUK C;  4IJ3 A;  16GS A;  2H6X A;  1HNB A;  1CQG A;  4HU7 A;  2B1L A;  4NWY A;  2R0P A;  3UVH A;  2VM2 A;  4GWR A;  3EUR A;  1XW9 A;  1BG5 A;  4K0N A;  5DJL A;  1GSF A;  4L8E A;  4IQA A;  4NV5 A;  4DSR A;  5A4W A;  1GSD A;  4WR5 A;  3F0I A;  4POK A;  20GS A;  1GSY A;  3UL3 A;  3P7X A;  5HR2 A;  2VCX A;  2PBJ A;  1PFO A;  3TKP A;  4DSQ A;  1SD8 A;  4FQU A;  4NPB A;  1XCC A;  5J9B A;  1S3R A;  1GSE A;  3HZ8 A;  2LJA A;  5IO2 A;  5B8B A;  1WP0 A;  4L5L A;  2XPE A;  3D22 A;  4BPY A;  1VRS D;  1KBN A;  3G7I A;  1S3A A;  5H5R A;  1B9X C;  1G6W A;  3M9K A;  3I43 A;  4PQ1 A;  2LJK A;  1AQW A;  1FVK A;  3O3T A;  2LRN A;  5ECS A;  1TDI A;  2AAW A;  5D96 A;  1AIU A;  3GKX A;  3GUS A;  4GTU A;  4ISD A;  1Z6M A;  3RDW A;  3UMA A;  3CBU A;  3GH9 A;  4MK3 A;  1UVZ A;  1GUL A;  2P5R A;  1EEJ A;  4J57 E;  1VGL A;  3ZVJ D;  5IOX A;  3KZQ A;  1GSQ A;  3IK7 A;  4G19 A;  5A5K A;  2QA1 A;  17GS A;  1O6J A;  3LW9 A;  2GZP A;  5GZZ B;  1M99 A;  2RII A;  3EYT A;  1TRU A;  4MJE A;  2WRT A;  2MZC A;  1THO A;  1AAZ A;  4EF0 A;  1ZGN A;  1T1V A;  3GA4 A;  2J23 A;  1GUH A;  4I2T A;  1OVN A;  5J41 A;  4IVF A;  4KGI A;  3GUR A;  1PX6 A;  2AUV A;  3CSI A;  4MZC A;  1K0B A;  3GST A;  2O89 A;  3DIE A;  2WFC A;  2MMO A;  5ECQ B;  3HD5 A;  1WOU A;  3G7Y A;  1QMV A;  3PPU A;  2MMN A;  3P90 A;  4RQX A;  5D9V A;  3IR4 A;  2GSQ A;  4LA1 A;  3TJJ A;  5KOW A;  1ZYN A;  1MD4 A;  4AJ7 A;  1TRW A;  1QK8 A;  4EL1 A;  1LU4 A;  2FWF A;  3EMP A;  2CA8 A;  3MAK A;  1OC9 A;  4MZB A;  4KB3 A;  4NXI A;  2DJ3 A;  5DQS A;  4HZ2 A;  3WGX A;  3FRC A;  22GS A;  1GP1 A;  4MZW A;  1R4W A;  4WF4 A;  2DJK A;  4OCE A;  1M9A A;  5FHI A;  3FW2 A;  5BMU A;  2YZU A;  1TI3 A;  2X8G A;  2KHP A;  1R5A A;  5HFG A;  1PA3 A;  2FD3 A;  1MDI A;  1F3B A;  2R0C A;  4BVY A;  1M2B A;  2DJ2 A;  1FG4 A;  1T7P B;  2QGV A;  1UN2 A;  12GS A;  3HA9 A;  5FWG A;  4POM A;  2H76 A;  2PGT A;  2ES7 A;  1K0D A;  4MH3 A;  2HYX A;  2L6D A;  2NDO A;  4HI7 A;  1X9W B;  2IMK A;  3CRU A;  2CT6 A;  3JCM L;  3L9S A;  2JL4 A;  1V58 A;  3QR6 A;  3IC4 A;  4N11 A;  2YOI A;  3GL5 A;  4OCF A;  2H74 A;  1V98 A;  5AIS A;  4CW9 A;  4DVC A;  4KCE A;  1ST9 A;  1JZD A;  2JZS A;  2ON7 A;  3KXO A;  4ZBD A;  3Q18 A;  5B8A A;  1JZW A;  2HXK A;  2L57 A;  1RK4 A;  2LV3 A;  1Z9H A;  3DEX A;  3F4R A;  2H0G A;  3ZLP A;  2CAQ A;  1YQ1 A;  5J5N A;  3PR8 A;  2YCD A;  2K8V A;  3TRX A;  3KH7 A;  4KW6 A;  3QMX A;  1Y6E A;  4O5R A;  3TJK A;  3HVX A;  4OO5 A;  3QD9 A;  4K9Z A;  1N8J A;  2CQ9 A;  4YAP A;  4HQZ A;  1EP8 A;  2O85 A;  1K3O A;  1NM3 A;  2LRC A;  3C7M A;  3EU4 A;  3IXR A;  1R7H A;  3FZA A;  3N9J A;  3WGE A;  4GLT A;  3FK8 A;  3ZRE A;  3A5W A;  5KN1 A;  4IS0 A;  1ZMA A;  2P5Q A;  5CRH A;  1THX A;  3N5O A;  4HOJ A;  3HDC A;  3IBH A;  1SKW B;  4MCU A;  3S9F A;  1KTE A;  1WRY A;  4ZB9 A;  2AV4 A;  2GSS A;  2LJR A;  5IO0 A;  3C71 A;  1OYJ A;  5KN3 A;  2H8L A;  3GV1 A;  2F8A A;  5H5Q A;  4L5O A;  1I5G A;  4Q5R A;  5BRT A;  4EUY A;  3LWA A;  1KEB A;  1SD9 A;  1A0R P;  4KF9 A;  4GRF A;  3IHG A;  1U3I A;  2XHF A;  19GS A;  5F06 A;  5IIZ A;  2LTK A;  2LQQ A;  3ZIV A;  4TR3 A;  5ENU A;  5ID2 B;  2WGR A;  1B9Y C;  2CVB A;  4KCA A;  1XOB A;  2OBI A;  2C4J A;  1M7T A;  4IP6 A;  5L71 A;  2ZNM A;  4F9Z A;  3RAZ A;  2RM6 A;  5E4W A;  4IW9 A;  5HFK A;  3CTF A;  4ML1 A;  1VF4 A;  1AQV A;  5EY6 A;  4IP1 A;  3TDG A;  1OE7 A;  1XXU A;  1MD3 A;  4MPF A;  4K1F A;  3KMN A;  3ERG A;  4L0U A;  1A0F A;  3US3 A; 
#chains in the Genus database with same CATH homology
 3HJO A;  1FAA A;  4XHM A;  3LEF A;  5EPF A;  2NTO A;  2O8V B;  2QKE A;  2B6M A;  1GSU A;  2H30 A;  3VK9 A;  3HYP A;  4PX1 A;  4ZL9 A;  2YP6 A;  1PX7 A;  2HLS A;  5IPG A;  3ERW A;  4Z2T A;  3HXS A;  1W4V A;  2XBI A;  2G0F A;  1PSQ A;  3L0H A;  2AJQ B;  3WD6 A;  1X5C A;  3MSZ A;  1E6B A;  4TW5 A;  2FA8 A;  1GTB A;  1SJI A;  4RI7 A;  3RPP A;  2YJH A;  3ZIJ A;  2FCH A;  2GT5 A;  2CZ3 A;  1T3B A;  1CQH A;  3LOR A;  3LXT A;  3VI7 A;  3HKR A;  3DWV A;  1PD2 1;  1W89 A;  4P3Y B;  1O8X A;  1J0F A;  5G1L A;  4Q5Q A;  3LSZ A;  1PL2 A;  1SYX A;  3ZIT A;  4QQ7 A;  4V1A p;  1O85 A;  1G6Y A;  2L4C A;  4WBJ A;  1AUC A;  2PMT A;  3TJF A;  1WMJ A;  2C0D A;  3A3T A;  3QAW A;  3ZML A;  2G2Q A;  4BVX B;  5DCH A;  4WBR D;  2FWH A;  2VD1 A;  4QL9 A;  1JZR A;  1BX9 A;  3APO A;  1XOA A;  3MNG A;  3VPT A;  3DKS A;  8GSS A;  1H75 A;  2BMX A;  2MYG A;  4KH7 A;  5G31 A;  1F3A A;  2OE0 A;  1DUG A;  2FY6 A;  1DE2 A;  3VI5 A;  4ZIJ A;  2V32 A;  1FO5 A;  2HZE B;  5A4U A;  1ML6 A;  1GUK A;  2K9F A;  1HNA A;  2VCZ A;  4CY8 A;  3Q19 A;  3TGZ A;  2DMM A;  4ECC A;  1GTI A;  3QOU A;  2IWT A;  2MBT A;  5ECR B;  1F9M A;  2HRN A;  4KA0 A;  4TRX A;  2H72 A;  2B5X A;  1GTU A;  3LYK A;  2PWJ A;  4PTS A;  5B6N A;  1DE1 A;  1QFN A;  3HHV A;  4PQI A;  1B4P A;  2IIY A;  2PVQ A;  3Q6O A;  3E9J B;  2FUG 2;  3GN3 A;  4ZB6 A;  4G9H A;  4TXO B;  4TN8 A;  4BVX A;  3L9V A;  2N5A A;  1WPI A;  5LNK e;  5DAK B;  2GS3 A;  4YQU A;  4D73 A;  1TTZ A;  1PN9 A;  3GTU B;  2AHE A;  3EMX A;  4FYB A;  1ZYP A;  1XW5 A;  2VCQ A;  5CO3 A;  2R4V A;  3W6G A;  2YAN A;  2DJ1 A;  1SJ6 A;  4ID0 A;  5ECM B;  2BTO T;  4EIQ A;  1KNG A;  4KX4 A;  4MAB A;  5B7C A;  2PU9 C;  4HJM A;  4XRD A;  3HCZ A;  1GLP A;  4EIP A;  4WKW A;  2F51 A;  2E7P A;  5IQY A;  1V9W A;  1O73 A;  3HJP A;  18GS A;  3TKS C;  3ZMK A;  2OE3 A;  2CX3 A;  4WXT A;  4XRA A;  2L4Q A;  2L5O A;  4YAV A;  1T4Z A;  1N2A A;  3UAP A;  4JR4 A;  1XW6 A;  4TXO A;  2CVD A;  1GTA A;  3KP9 A;  2WB9 A;  2LUS A;  5DAK A;  2VL3 A;  7GSS A;  2F8F A;  1K3Y A;  2H75 A;  2JSZ A;  1A2M A;  1YEP A;  2B5Y A;  2C0F A;  1SKS B;  1B8X A;  2E0Q A;  4OFN A;  2M46 A;  5G1K A;  1TJD A;  3D21 A;  2QA2 A;  1XPV A;  4F82 A;  2H1A A;  3DRN A;  4TR1 B;  2CAI A;  2TIR A;  1BED A;  1DBY A;  2CX4 A;  3KGK A;  4KDU A;  3M9J A;  4JED A;  4OWY A;  3TB2 A;  1G7O A;  4N0V A;  3A2X A;  1SL1 B;  1E2Y A;  4TKY A;  2HSM A;  1ERW A;  3ZVJ A;  3H4K A;  5ECP B;  4AJ6 A;  2DLX A;  2FHE A;  3BCI A;  2L59 A;  3HJM A;  3GH6 A;  2FWE A;  4GXZ A;  1O81 A;  2R37 A;  1NHY A;  4FYU A;  2ZCT A;  2EIR A;  2FGX A;  2H6Y A;  2H73 A;  4V1A g;  4CY6 A;  3F3Q A;  1BQ7 A;  1EOG A;  1RW1 A;  2VL2 C;  3VPQ A;  1XWA A;  3KP8 A;  1A2J A;  1QXH A;  3TJB A;  3UIW A;  3BCK A;  3J7Y b;  3UBK A;  2VUP A;  5CRD A;  6GSW A;  1A8L A;  3GKM A;  3GSS A;  3VWV A;  3EIN A;  1TK0 B;  1Z6N A;  4N0Z A;  2DC5 A;  3BOA A;  1A2L A;  4O5U A;  2H66 A;  1TU7 A;  3M3M A;  4TR1 A;  4H86 A;  1SU9 A;  1SK1 A;  2X49 A;  2RLI A;  5G30 A;  2K8S A;  1FW1 A;  1M2D A;  1O8W A;  4XS4 B;  4ULX A;  3RHB A;  5JWR B;  2C3T A;  2I3Y A;  4ECI A;  5HFI A;  3ISO A;  3E0U A;  5ECK B;  1AQX A;  2YZH A;  4V2M A;  2GDR A;  2K6V A;  3F3R A;  3L4N A;  3APQ A;  2PER A;  2GQM A;  5E59 A;  2JAD A;  3F4T A;  3D5J A;  2VCW A;  4L0W A;  3VUR A;  5DCG A;  2HE3 A;  4YKG A;  1MDK A;  1ZCP A;  1BYE A;  4GF0 A;  5AIV A;  1VF2 A;  1PQN A;  3QFA C;  4WF5 A;  4NAX A;  2OBK A;  4OFT A;  1XVQ A;  2VLV A;  1YDK A;  6GSU A;  3WGD A;  2IN3 A;  2X8C A;  3UAR A;  1YJ6 A;  2NVL A;  3EE2 A;  4WEY A;  4XS4 A;  1XWK A;  4TOP A;  1SEN A;  3GX0 A;  1TK8 B;  4BWQ A;  1ERU A;  4X0X A;  3NZN A;  2MMA A;  3OR5 A;  4LL1 B;  3RHC A;  4JRR A;  2DIY A;  1GSS A;  5LD0 A;  5D8I A;  1OKT A;  2V6K A;  1ILO A;  2CV4 A;  3FEU A;  2VM1 A;  2O87 A;  3HVS A;  4MNN A;  3BJ5 A;  2HNL A;  2YN1 A;  1ERT A;  3F6F A;  2GTU A;  1YF1 A;  1SL2 B;  2KP1 A;  3DVW A;  4XTS A;  3VWW A;  4LLR A;  5JCU A;  2DJ0 A;  3QPM A;  5CRE A;  4ZL7 A;  1G7E A;  2VCT A;  4AGS A;  3F6D A;  4ZBB A;  3R2Q A;  4CDO A;  3ZZX A;  1K0A A;  2XC2 A;  2IPA A;  2B7J A;  3FR6 A;  2MMZ A;  1FB0 A;  3KM6 A;  5GSS A;  1UA5 A;  3ED3 A;  2X99 A;  1SKR B;  2KUC A;  5DVB A;  1QQ2 A;  1H4O A;  2DKI A;  3FZ5 A;  4I6X A;  4GQC A;  1WWJ A;  1YKC A;  4XS6 A;  1TW9 A;  2CVK A;  3APS A;  1SK0 A;  2R6K A;  4BWS A;  4EVM A;  1XFL A;  4NV2 A;  5HR1 A;  3J7Y k;  4XIH A;  5C04 A;  1PGT A;  4NHZ A;  1UC7 A;  3BD2 A;  2I81 A;  3ME7 A;  3DYR A;  3IRA A;  2K18 A;  2B3S A;  3GL3 A;  1K0N A;  4ZBA A;  3TJG A;  1HD2 A;  2LNS A;  4V2N A;  1SK2 A;  3E3E A;  4G0I A;  3F9U A;  4RQR A;  5JCG A;  2V1M A;  1K0O A;  4ILF A;  4O7H A;  2R3X A;  2YPM A;  2WZ9 A;  1ZL9 A;  1NW2 A;  5C00 A;  2X4A A;  1Z5Y E;  5DBQ A;  5F8B A;  3IV4 A;  4JZQ A;  4KE3 A;  3IDV A;  4Q5F A;  3I9V 2;  3QAV A;  1K3L A;  4NHW A;  1YKA A;  3M0F A;  4DSS B;  2HZF A;  3P2A A;  2AB6 A;  2NPB A;  5KN0 A;  4MMM A;  3GKN A;  1BJX A;  2VCV A;  5ID2 A;  5F07 A;  2I1U A;  2JZR A;  2O7K A;  1GWC A;  1EV9 A;  5CYY A;  1PMT A;  2FWG A;  4RI6 A;  2FLS A;  1R5P A;  3LYP A;  4X43 A;  2UZ8 A;  3BBY A;  3KCM A;  3I69 A;  4F2I A;  1WE0 A;  2EC4 A;  4MP4 A;  3GX8 A;  2EIO A;  4IBP A;  2D2Z A;  3DXB A;  2RUF A;  4YQV A;  5JWO B;  2WDU A;  3GKK A;  3CMI A;  3I6A A;  4ZXG A;  4KUN A;  4MF5 A;  1Q4J A;  4F03 A;  3UBL A;  2H1G A;  2HSH A;  1WJK A;  1EGO A;  4G2E A;  4FH8 A;  1LJR A;  5G5F A;  4YH2 A;  3IK9 A;  4EKZ A;  4TR0 A;  3WYW A;  2J9H A;  3GFK A;  4LMW A;  3FY7 A;  3EC3 A;  5B6M A;  3P8W A;  3H8Q A;  6GSS A;  2OAC A;  5DQY A;  3TKQ A;  2IMF A;  1OC8 A;  1M9B A;  5ELG A;  4HDE A;  1K0C A;  3O76 A;  1AW9 A;  3UJ1 A;  4KDX A;  4KND A;  5JCW A;  3IE3 A;  4MJC A;  4I5Q A;  4PUF C;  4ACS A;  5IMC A;  4USS A;  2H1D A;  1X9S B;  1XVW A;  4MLY A;  4G0K A;  2VLU A;  3KTB A;  2HSY A;  3H79 A;  3GNJ A;  1EWX A;  1X5D A;  1FHE A;  3A2V A;  2GQK A;  5DAL B;  3ZFB A;  4WET A;  3F4S A;  2A4V A;  5J4U A;  2CZ2 A;  5AGY A;  3RBT A;  1EP7 A;  5AIX A;  4F0C A;  2I4A A;  3CSH A;  2OKA A;  2H71 A;  2TRC P;  4PNF A;  5IM9 A;  4JU5 A;  1JHB A;  1U3A A;  1XWB A;  3ME8 A;  4KAE A;  4KSO A;  3ZTL A;  1MTC A;  1SJZ A;  2R2J A;  3TOT A;  3DVX A;  2B5E A;  1TRS A;  2C1Y A;  4E8E A;  6GSX A;  1X0R A;  2LS5 A;  2P0G A;  2VL2 A;  3TUE A;  2V6O A;  3FKF A;  4ZB8 A;  4KSM A;  2HZE A;  4Z7X A;  5KN2 A;  3FHK A;  3AY8 A;  2H01 A;  4FO5 A;  1T8E B;  2FNO A;  2HFD A;  2DSA A;  2VO4 A;  3L9U A;  5DAL A;  2M80 A;  3EWL A;  4O5Q A;  1M2A A;  3LJR A;  2N5F A;  1Z7R A;  2V2G A;  2X64 A;  5IOW A;  1TK5 B;  2OJL A;  2C80 A;  5HQP A;  2R5G A;  6GSY A;  3H93 A;  4ZL8 A;  1SYR A;  4TVE A;  1J08 A;  1EEM A;  2LQO A;  3GHA A;  5D9W A;  11GS A;  3CXG A;  3GTU A;  3PIN A;  3CSJ A;  3U6V A;  2IMI A;  2L6C A;  3DGQ A;  4N10 A;  4OO4 A;  3WT2 A;  5ECO B;  4G10 A;  4K2D A;  4TR4 A;  1JFU A;  2DBC A;  1M0U A;  1PKZ A;  4EXJ A;  5G5E A;  3C73 A;  5KOX A;  3TRQ A;  4OFM A;  1J9B A;  2MBS A;  1ACV A;  2RUE A;  5ECH B;  3GMF A;  1TI1 A;  1TXX A;  2RM5 A;  4A5P A;  3A2W A;  4O32 A;  4OMV A;  4GSS A;  5HR3 A;  2IME A;  1OKD A;  3GRX A;  4IQ1 A;  1S3C A;  5ELA A;  1T4Y A;  4ICY A;  4K7N A;  2JZT A;  2YNX A;  2WCI A;  4NMU A;  2TRX A;  3VWX A;  1OC9 B;  4BA7 A;  1MDJ A;  3IHQ A;  1QGV A;  1TOF A;  1URM A;  3HVV A;  1TP9 A;  3MIX A;  2H6Z A;  4MJA A;  5G2Z A;  4MF7 A;  3K8N A;  1S3D A;  2A4H A;  1YZX A;  1V40 A;  3C1S A;  3GIX A;  3G9B A;  2A2P A;  2JSY A;  3EPT A;  4K8M A;  4KDY A;  2JU5 A;  4BVY B;  2F3M A;  2VL9 A;  5CRW A;  1EGR A;  3A5I A;  1FVJ A;  3LXZ A;  4Z2R A;  4QL7 A;  3F63 A;  3UEM A;  4HJ2 A;  1MEK A;  2HI7 A;  5IPH A;  3ZYW A;  3FR3 A;  2ALB A;  4GCI A;  2VD0 A;  4N30 A;  2XPD A;  4YQM A;  4HU9 A;  2LEG A;  3H1N A;  4MJB A;  2YWM A;  1NSW A;  4O92 A;  1ZOF A;  1RQM A;  2OA7 A;  5GST A;  2GSR A;  1B48 A;  4IGJ A;  1OC3 A;  1XWG A;  4HEA 2;  5ECL B;  5DDL A;  1G0T A;  2YV9 A;  2OE1 A;  2X8H A;  1BAY A;  4IN0 A;  5CP1 A;  3D4M A;  1PL1 A;  4HUA A;  4PUA A;  1OE8 A;  4JR6 A;  2VLT A;  5HR0 A;  2VIM A;  2IMD A;  1VF1 A;  2WUL A;  5DJM A;  4AJ8 A;  1XWC A;  4LL4 B;  4EE0 A;  4K0G A;  5AN1 A;  1A24 A;  3Q74 A;  3KH9 A;  3D6I A;  1FOH A;  4ECB A;  3L78 A;  4BL7 B;  3VLN A;  4PGT A;  3MWH A;  2QC7 A;  2KP2 A;  3ERF A;  1VF3 A;  1YF0 A;  5J3R A;  1K0M A;  4JBB A;  3FYG A;  4G0L A;  1ZYQ B;  2M72 A;  2LST A;  3EU3 A;  4TXV A;  1A8Y A;  3VWU A;  3D4T A;  2JAC A;  5LCZ A;  4GSN A;  5A4V A;  1FOV A;  3PH9 A;  2C8U A;  3F8U A;  1F37 A;  2GQL A;  4MF6 A;  5EL8 A;  3FZ4 A;  1AC1 A;  2PPT A;  3KIJ A;  2GLR A;  2YJ7 A;  5GAN D;  1WIK A;  1IYH A;  1JLV A;  1USB A;  4MPG A;  1GNW A;  3NOF A;  1T00 A;  2PN8 A;  3SWL A;  3CRT A;  4K2X A;  2WS2 A;  2YWN A;  9GSS A;  2I9H A;  2AYT A;  2B7K A;  3EVI A;  3FR9 A;  1DSB A;  1GL8 A;  5D9T A;  5D93 A;  1EV4 A;  2REM A;  6GSV A;  3LG6 A;  4Z2U A;  1U88 A;  3W8S A;  4BL7 A;  1YY7 A;  2YWI A;  4K7O A;  3ZL5 A;  3TKR A;  1V57 A;  3LQ7 A;  3C1R A;  2DML A;  3MYD A;  4I8B A;  4HZ4 A;  2R0G A;  1XBS A;  3LFL A;  5D73 A;  4IHU A;  4LMV A;  3PGT A;  1O7U A;  4XCS A;  4X4J A;  1TRV A;  1PKW A;  5F0G A;  5F05 A;  3KMO A;  5H5S A;  3U5R E;  1Q98 A;  1OAZ A;  4ML6 A;  2A2R A;  5KEJ A;  3R3E A;  2H1B A;  2ON5 A;  4ZIL A;  3DD3 A;  4GQF A;  4J56 E;  3UOM A;  2C3Q A;  3M1G A;  2HRF A;  1V2A A;  3QCP A;  4I97 A;  3TOU A;  1HYU A;  1YEX A;  2ZUP A;  3FMW A;  2WJU A;  4MDC A;  2FA4 A;  4K6X A;  1HQO A;  2HT9 A;  1NHO A;  2YV7 A;  1B4Q A;  5IMZ A;  14GS A;  2C0E A;  2V41 A;  2IJY A;  3TCO A;  2OAD A;  5COH A;  2P31 A;  3KJY A;  3CYN A;  5GAP D;  2LNT A;  3W8J A;  2H0I A;  4EC0 A;  5IMF A;  1I9D A;  4HQS A;  3D0Z A;  4DEJ A;  1XZO A;  1TU8 A;  5CAX A;  4I2U A;  3IAS 2;  1ZYE A;  5IMV A;  3IPZ A;  4FYC A;  4MA9 A;  4AF2 A;  1TKD B;  2DIZ A;  4K5R A;  4CHS A;  2DJJ A;  4ECJ A;  2C3N A;  5FT3 A;  4EDZ A;  3KTL A;  4PXO A;  1AXD A;  2GGT A;  4OD7 A;  4PNG A;  2A2S A;  1JZO A;  4WR4 A;  1FB6 A;  3IOS A;  1PRX A;  5J9C A;  5JWQ B;  4MH2 A;  3QDN A;  1GUM A;  13GS A;  3NIV A;  4F0B A;  4XS1 A;  4K7I A;  2GVP A;  3IC8 A;  3FZ9 A;  2LRT A;  5ABR A;  2YWO A;  4GST A;  3QFB C;  4EDY A;  2IL3 A;  2BJX A;  3G7J A;  4FIW A;  2VAF A;  3SBC A;  2B1K A;  4DSS A;  5ECN B;  5IMA A;  5CNW A;  3TKS A;  3KEB A;  3C8E A;  1EZK A;  1ERV A;  3RPN A;  3UVT A;  1GNE A;  4K5S A;  2E2G A;  1QUW A;  1IYI A;  1GH2 A;  3CTG A;  1R26 A;  4X1U A;  2HRK A;  1A23 A;  3IAM 2;  1C72 A;  4IJI A;  1X5E A;  5INY A;  4J2F A;  2KLX A;  1F2E A;  2GZZ A;  3KD0 A;  10GS A;  2LKU A;  2XBQ A;  4POL A;  2N5B A;  2IFQ B;  2PVO C;  2HRA A;  2KOK A;  2NBS A;  1ABA A;  5D9X A;  1U87 A;  1XIY A;  4D73 B;  3QAG A;  3HZ4 A;  5EVO A;  4V2L A;  1PN0 A;  3LGC A;  4JE1 A;  1X9M B;  3ZFL A;  4PUR A;  1ON4 A;  3IA1 A;  3V1W A;  2L5L A;  2F9S A;  3MDK A;  1ZZY A;  4IEL A;  3M8N A;  3HY2 A;  2C0G A;  4E8H A;  3DML A;  4RUV A;  3TKS E;  1LBK A;  2QSI A;  4HS1 A;  4YKF A;  1GRX A;  2DKH A;  3VFI A;  2H0H A;  4POB A;  1F6M C;  3O6T A;  3GYK A;  2E2M A;  2H19 A;  3ZRD A;  1HNC A;  2EIQ A;  1JLW A;  2GST A;  1GLQ A;  1EOH A;  1Z7P A;  2IFQ A;  1Z3E A;  1Y25 A;  4Q5N A;  1U6T A;  2GZY A;  3TRP A;  2H70 A;  3WT1 A;  5ECI B;  6GST A;  1SL0 B;  4IKH A;  2VOC A;  5CRG A;  2GT6 A;  5IMD A;  4PQH A;  4EO3 A;  2Z9S A;  2PUK C;  4IJ3 A;  16GS A;  2H6X A;  1HNB A;  1CQG A;  4HU7 A;  2B1L A;  4NWY A;  2R0P A;  3UVH A;  2VM2 A;  4GWR A;  3EUR A;  1XW9 A;  1BG5 A;  4K0N A;  5DJL A;  1GSF A;  4L8E A;  4IQA A;  4NV5 A;  4DSR A;  5A4W A;  1GSD A;  4WR5 A;  3F0I A;  4POK A;  20GS A;  1GSY A;  3UL3 A;  3P7X A;  5HR2 A;  2VCX A;  2PBJ A;  3TKP A;  4DSQ A;  1SD8 A;  4FQU A;  4NPB A;  1XCC A;  5J9B A;  1GSE A;  3HZ8 A;  2LJA A;  5IO2 A;  5B8B A;  1WP0 A;  4L5L A;  2XPE A;  3D22 A;  4BPY A;  1VRS D;  1KBN A;  3G7I A;  1S3A A;  5H5R A;  1B9X C;  1G6W A;  3M9K A;  3I43 A;  4PQ1 A;  2LJK A;  1AQW A;  1FVK A;  3O3T A;  2LRN A;  5ECS A;  1TDI A;  2AAW A;  5D96 A;  1AIU A;  3GKX A;  3GUS A;  4GTU A;  4ISD A;  1Z6M A;  3RDW A;  3UMA A;  3CBU A;  3GH9 A;  4MK3 A;  1UVZ A;  1GUL A;  2P5R A;  1EEJ A;  4J57 E;  1VGL A;  3ZVJ D;  5IOX A;  3KZQ A;  1GSQ A;  3IK7 A;  4G19 A;  5A5K A;  2QA1 A;  17GS A;  1O6J A;  3LW9 A;  2GZP A;  5GZZ B;  1M99 A;  2RII A;  3EYT A;  1TRU A;  4MJE A;  2WRT A;  2MZC A;  1THO A;  1AAZ A;  4EF0 A;  1ZGN A;  1T1V A;  3GA4 A;  2J23 A;  1GUH A;  4I2T A;  1OVN A;  5J41 A;  4IVF A;  4KGI A;  3GUR A;  1PX6 A;  2AUV A;  3CSI A;  4MZC A;  1K0B A;  3GST A;  2O89 A;  3DIE A;  2WFC A;  2MMO A;  5ECQ B;  3HD5 A;  1WOU A;  3G7Y A;  1QMV A;  3PPU A;  2MMN A;  3P90 A;  4RQX A;  5D9V A;  3IR4 A;  2GSQ A;  4LA1 A;  3TJJ A;  5KOW A;  1ZYN A;  1MD4 A;  4AJ7 A;  1TRW A;  1QK8 A;  4EL1 A;  1LU4 A;  2FWF A;  3EMP A;  2CA8 A;  3MAK A;  1OC9 A;  4MZB A;  4KB3 A;  4NXI A;  2DJ3 A;  5DQS A;  4HZ2 A;  3WGX A;  3FRC A;  22GS A;  1GP1 A;  4MZW A;  1R4W A;  4WF4 A;  2DJK A;  4OCE A;  1M9A A;  5FHI A;  3FW2 A;  5BMU A;  2YZU A;  1TI3 A;  2X8G A;  2KHP A;  1R5A A;  5HFG A;  1PA3 A;  2FD3 A;  1MDI A;  1F3B A;  2R0C A;  4BVY A;  1M2B A;  2DJ2 A;  1FG4 A;  1T7P B;  2QGV A;  1UN2 A;  12GS A;  3HA9 A;  5FWG A;  4POM A;  2H76 A;  2PGT A;  2ES7 A;  1K0D A;  4MH3 A;  2HYX A;  2L6D A;  2NDO A;  4HI7 A;  1X9W B;  2IMK A;  3CRU A;  2CT6 A;  3JCM L;  3L9S A;  2JL4 A;  1V58 A;  3QR6 A;  3IC4 A;  4N11 A;  2YOI A;  3GL5 A;  4OCF A;  2H74 A;  1V98 A;  5AIS A;  4CW9 A;  4DVC A;  4KCE A;  1ST9 A;  1JZD A;  2JZS A;  2ON7 A;  3KXO A;  4ZBD A;  3Q18 A;  5B8A A;  1JZW A;  2HXK A;  2L57 A;  1RK4 A;  2LV3 A;  1Z9H A;  3DEX A;  3F4R A;  2H0G A;  3ZLP A;  2CAQ A;  1YQ1 A;  5J5N A;  3PR8 A;  2YCD A;  2K8V A;  3TRX A;  3KH7 A;  4KW6 A;  3QMX A;  1Y6E A;  4O5R A;  3TJK A;  3HVX A;  4OO5 A;  3QD9 A;  4K9Z A;  1N8J A;  2CQ9 A;  4YAP A;  4HQZ A;  1EP8 A;  2O85 A;  1K3O A;  1NM3 A;  2LRC A;  3C7M A;  3EU4 A;  3IXR A;  1R7H A;  3FZA A;  3N9J A;  3WGE A;  4GLT A;  3FK8 A;  3ZRE A;  3A5W A;  5KN1 A;  4IS0 A;  1ZMA A;  2P5Q A;  5CRH A;  1THX A;  3N5O A;  4HOJ A;  3HDC A;  3IBH A;  1SKW B;  4MCU A;  3S9F A;  1KTE A;  1WRY A;  4ZB9 A;  2AV4 A;  2GSS A;  2LJR A;  5IO0 A;  3C71 A;  1OYJ A;  5KN3 A;  2H8L A;  3GV1 A;  2F8A A;  5H5Q A;  4L5O A;  1I5G A;  4Q5R A;  5BRT A;  4EUY A;  3LWA A;  1KEB A;  1SD9 A;  1A0R P;  4KF9 A;  4GRF A;  3IHG A;  1U3I A;  2XHF A;  19GS A;  5F06 A;  5IIZ A;  2LTK A;  2LQQ A;  3ZIV A;  4TR3 A;  5ENU A;  5ID2 B;  2WGR A;  1B9Y C;  2CVB A;  4KCA A;  1XOB A;  2OBI A;  2C4J A;  1M7T A;  4IP6 A;  5L71 A;  2ZNM A;  4F9Z A;  3RAZ A;  2RM6 A;  5E4W A;  4IW9 A;  5HFK A;  3CTF A;  4ML1 A;  1VF4 A;  1AQV A;  5EY6 A;  4IP1 A;  3TDG A;  1OE7 A;  1XXU A;  1MD3 A;  4MPF A;  4K1F A;  3KMN A;  3ERG A;  4L0U A;  1A0F A;  3US3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...