2K9FA

Structural features of the complex between the dsbd n-terminal and the pilb n-terminal domains from neisseria meningitidis
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
144
structure length
144
Chain Sequence
MVPHTLSTLKTADNRPASVYLKKDKPTLIKFWASWCPLCLSELGQTEKWAQDAKFSSANLITVASPGFLHEKKDGDFQKWYAGLNYPKLPVVTDNGGTIAQSLNISVYPSWALIGKDGDVQRIVKGSINEAQALALIRDPNADL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin
publication title Formation of the complex between DsbD and PilB N-terminal domains from Neisseria meningitidis necessitates an adaptability of nDsbD.
pubmed doi rcsb
source organism Neisseria meningitidis serogroup a
total genus 40
structure length 144
sequence length 144
ec nomenclature ec 1.8.4.11: Peptide-methionine (S)-S-oxide reductase.
pdb deposition date 2008-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2k9fA00
3DRNA 3LORA 2VL9A 2OKAA 4MJAA 1GTBA 2CVDA 1GTIA 5JCGA 1OC3A 3DWVA 3HZ4A 3N9JA 1FG4A 1MDJA 5DDLA 5G1LA 3ZREA 3ERFA 2JADA 2G0FA 2MMOA 4NV2A 5HR2A 2HI7A 3PR8A 1KTEA 1UA5A 1BEDA 3H4KA 3IE3A 3RDWA 7GSSA 4HUAA 2P0GA 1ERVA 4JZQA 4WF4A 5CNWA 2GDRA 4AJ7A 4K0GA 2OA7A 1GLQA 2LJRA 4Q5RA 3EU3A 2O89A 2HE3A 2DJ1A 3IHQA 4KCAA 4XS6A 1MD4A 5EPFA 4DEJA 5KEJA 3RHCA 3HJOA 1A2MA 2DJ0A 4N0ZA 1DE2A 1XWKA 4EXJA 1K0DA 2H1GA 1QQ2A 1OC9A 2RLIA 3C7MA 3CBUA 2FUG2 2VCXA 3ZFLA 2VAFA 2OBIA 3GX0A 4I5QA 1ZZYA 3KZQA 2FD3A 1XWGA 1TW9A 1ILOA 3HJPA 3LSZA 4TXOA 4ZL9A 2VO4A 4IVFA 1WIKA 2I4AA 5DBQA 11GSA 3TUEA 3LYKA 4OMVA 5HR3A 1V9WA 4KAEA 6GSYA 5E4WA 2C3TA 4WEYA 1NHOA 2IFQA 4MF5A 4NV5A 5J9CA 4ZBBA 5HFGA 5H5QA 5CRDA 1GTUA 4RI7A 3UL3A 5DQSA 4MJBA 2OE1A 3KTBA 1SU9A 1J0FA 10GSA 2FHEA 2H70A 4FH8A 3ZTLA 1F37A 3LFLA 4WETA 1QK8A 3O3TA 3GV1A 2JACA 3KTLA 1SENA 5IO2A 3VFIA 3Q74A 2QGVA 2HXKA 2NTOA 1MDKA 4OCEA 3F4SA 4OFTA 4F9ZA 2HT9A 2K8SA 1THOA 4HDEA 2K8VA 2CA8A 3APSA 1U88A 4MABA 5L71A 2GT5A 2H72A 3GNJA 3C8EA 4O7HA 4HS1A 4IP1A 5DQYA 1WMJA 5G31A 1X5EA 5G30A 5IMDA 3BCKA 4G10A 14GSA 2DSAA 1QUWA 2REMA 1T7PB 4WR4A 2P5RA 4IQAA 1T1VA 3ERWA 5G1KA 3FW2A 2CX3A 4AGSA 2LNSA 3QD9A 3KD0A 1FW1A 2B1LA 1EP8A 2OE0A 5KN0A 2FNOA 1SK1A 1BQ7A 4H86A 5ID2A 3HJMA 1GSFA 4L5LA 2I9HA 5HR1A 2JSYA 3H79A 3TKPA 4D73B 2H1DA 2EC4A 3U5RE 3O76A 3VK9A 1LU4A 3GUSA 3KP8A 5GSTA 2JZSA 2DMLA 4EC0A 1B8XA 2KHPA 4JR6A 3UIWA 4MMMA 2DIYA 5F06A 4ZL7A 5ABRA 1GSQA 3HKRA 4BVYA 1X0RA 2CQ9A 3KIJA 3HVSA 4XS1A 4AJ8A 1EV4A 1SKSB 4K7OA 4BL7A 1K0CA 4JU5A 1XVWA 4IBPA 5F07A 5AIXA 1SJ6A 3AY8A 2XC2A 1GSSA 2DIZA 2VL2A 2PERA 1VF4A 2IJYA 3SWLA 2QC7A 3GSSA 5IOXA 1OAZA 5ECQB 2LTKA 2CVBA 1Z6MA 3IR4A 3O6TA 3LQ7A 3I9V2 5IMAA 4I8BA 3DKSA 1PGTA 3IBHA 3DGQA 2MYGA 4OO4A 1PKWA 4O92A 1USBA 3IOSA 3HHVA 1X9WB 4GCIA 2VCWA 4TOPA 6GSWA 2L6CA 2WULA 1X5CA 3FZ4A 4N30A 1AQVA 1YF1A 3MWHA 1GNWA 2A2SA 4P3YB 5LCZA 1G6YA 1OYJA 2N5AA 3D21A 1SKRB 1AAZA 1O7UA 4G2EA 3Q19A 1PMTA 1T4ZA 3IA1A 2JZTA 3L0HA 2VM2A 3H93A 2R6KA 4WXTA 1YKCA 2AAWA 4GF0A 2C1YA 1M9BA 5INYA 2KP1A 4HU9A 1RK4A 20GSA 3QR6A 3GH6A 4HQZA 4NPBA 3ISOA 3ZMLA 2H1BA 2GZZA 1DBYA 1PA3A 3W6GA 3TB2A 2B5YA 5HFKA 4HZ4A 1GUMA 1SJIA 1B9YC 3TKSC 4J57E 3GX8A 5ECIB 1G0TA 2WJUA 4KNDA 3GKMA 1F2EA 3VWVA 2AHEA 2HZEA 1NSWA 2NPBA 3F4TA 4ZBDA 4ISDA 5G2ZA 3DYRA 5LNKe 3ZVJD 3GTUA 3Q18A 4GSNA 1G6WA 2PGTA 1Z6NA 1FAAA 2K9FA 2DJKA 4CHSA 3WT2A 4IQ1A 4EO3A 3A2VA 3IXRA 2LQQA 4X0XA 4TR0A 2WRTA 4PGTA 3C71A 1NHYA 2GZPA 3KP9A 3G9BA 1FB0A 2I81A 3ME8A 2X8CA 2MMZA 3GA4A 2C4JA 5C00A 3QAWA 2R37A 2V2GA 3H8QA 5DALB 1ZYQB 4I97A 3E0UA 2GTUA 3RAZA 2E2MA 1N2AA 12GSA 4D73A 2KLXA 2E2GA 1OVNA 4V1Ag 3F9UA 1SJZA 2V6OA 2HSYA 4PURA 5DJMA 3FRCA 5CP1A 4V2NA 4ECJA 1VF3A 1V57A 3VPTA 2JU5A 4K0NA 1GULA 1BG5A 4ULXA 2C0DA 2IMFA 2LRCA 1JLWA 4L0WA 4POLA 1SD9A 4BWSA 3ZFBA 3WGDA 2PN8A 5IO0A 4TR1B 2VD0A 19GSA 1ZMAA 5J41A 3KGKA 5D9VA 4KSMA 3ZZXA 1TRSA 2KP2A 4JE1A 4GLTA 4XIHA 1EWXA 3VWWA 1FHEA 5CRGA 1OE8A 5AN1A 4GWRA 4O32A 3EVIA 3U6VA 1T4YA 4MF7A 4GQCA 17GSA 2AUVA 2MZCA 3L9SA 4DSRA 6GSTA 2A2RA 1RW1A 1M2BA 1V2AA 1FVJA 3EU4A 1YF0A 3WT1A 5A4WA 1M9AA 1EEMA 4NHWA 2X8HA 2H01A 5J4UA 1AQWA 1AW9A 1ZGNA 1IYHA 2OE3A 2L57A 1GH2A 1XVQA 3S9FA 4KE3A 4K7NA 4YQMA 1J9BA 4DSQA 1JFUA 4POBA 4ZXGA 2ES7A 1GNEA 4FYUA 3APOA 4LA1A 2GLRA 3GL5A 3CSHA 4CW9A 2YWOA 2C0FA 4EDZA 2WFCA 3KH9A 4PQHA 4OFMA 6GSXA 2ZCTA 4PXOA 2N5FA 4Q5QA 2EIOA 1EZKA 4HJMA 4ML6A 4TXVA 3P90A 1YKAA 3KM6A 2YWMA 4CDOA 4ZIJA 1F3AA 2RUEA 4HOJA 2AB6A 3DIEA 3I6AA 3HD5A 3A5WA 3P8WA 2IMEA 2PUKC 5DCGA 2R3XA 2X99A 1Z7PA 1TXXA 1FO5A 1ERUA 1GL8A 2YNXA 2IMDA 2DBCA 4K6XA 4EL1A 5CAXA 1T8EB 3G7JA 2TRCP 3GKKA 5ELAA 1TK8B 1A24A 2GQKA 4GXZA 1V58A 5D9WA 5IQYA 3FR3A 1GTAA 2FWEA 1K0BA 1TJDA 2H0GA 2VCVA 5JWOB 5DAKB 2FA8A 3M3MA 1K0NA 2IWTA 1OKDA 3GHAA 3LGCA 3D5JA 5F0GA 5D9TA 3F3RA 2TRXA 5GAPD 3GKXA 3CXGA 3DVXA 1PL1A 3RHBA 3JCML 3MDKA 4WBRD 3TKSA 3C73A 3EMPA 1RQMA 1FOVA 2FWHA 4QL7A 5F8BA 1G7OA 2YZUA 3A3TA 4ID0A 4PNGA 2WGRA 1AC1A 1W89A 3LYPA 2DC5A 2DJ3A 3FY7A 2VIMA 3D4TA 2VLTA 1U87A 4K8MA 4KDYA 2BTOT 3D22A 3E9JB 3I69A 3KCMA 3WD6A 2HSHA 1K0OA 1Y25A 1I5GA 3LXZA 1ZL9A 2XBIA 4V2LA 2X8GA 1AQXA 18GSA 1GWCA 2H0HA 4KW6A 2FWFA 2WB9A 4TR1A 5ECKB 4GTUA 2LQOA 1V40A 1ERWA 4I2UA 5IMCA 1BJXA 3C1SA 4L5OA 3G7YA 4K7IA 2JL4A 5ECMB 1PSQA 3VURA 3QPMA 2JSZA 1H4OA 1YZXA 2K18A 4PUFC 3GFKA 3QFAC 5IIZA 2C80A 3VI7A 1Z3EA 5C04A 5IMZA 3QCPA 4XCSA 1YY7A 3KMNA 5CRWA 3DEXA 1F9MA 1YDKA 3DXBA 2ZNMA 2LS5A 3ZMKA 2LSTA 1K3YA 1O8XA 1Z9HA 5F05A 1JZDA 3EURA 2L59A 1SYXA 2MBTA 3FR6A 3UVHA 3F4RA 2YWNA 1R5PA 5CYYA 2RM5A 4LL1B 3KXOA 1AUCA 4AF2A 1BAYA 2PMTA 3K8NA 4YH2A 4F0BA 3TRPA 2LJAA 4GSSA 1ACVA 2L5LA 4KDUA 2H6ZA 3ZIVA 4MJEA 3GRXA 2H73A 4F0CA 22GSA 3TRQA 3M1GA 4HI7A 1IYIA 3IK9A 3EC3A 1TTZA 1S3DA 1WP0A 4F82A 2GSTA 3TKQA 3C1RA 1XFLA 1ABAA 2GS3A 3H1NA 3WYWA 1R5AA 3QAVA 5JCUA 3CSIA 1WPIA 1PKZA 4IJ3A 2R4VA 2YP6A 4MP4A 3TRXA 4V1Ap 2MMNA 3GYKA 2O7KA 3TJKA 5ECSA 1R7HA 4MPGA 5EL8A 3FEUA 4MPFA 5DAKA 1TP9A 5GSSA 3W8JA 3UAPA 4TRXA 3P7XA 1ON4A 4KDXA 1XW5A 1HQOA 3ZITA 2H75A 4OD7A 2V6KA 3CRTA 3CSJA 3BBYA 3UEMA 5ENUA 2YOIA 4G19A 2X64A 3W8SA 4N0VA 4QQ7A 2KOKA 3IAS2 1EV9A 2YCDA 1SK2A 3J7Yb 5H5RA 2H1AA 1A8YA 3ZYWA 4DVCA 1UVZA 2VM1A 3RPNA 2YN1A 2H19A 4EKZA 3D6IA 2YV7A 5J5NA 1GSYA 3ERGA 4KH7A 4WBJA 3FR9A 3WGXA 4OCFA 1U6TA 2C0EA 4MF6A 3PH9A 2HYXA 1W4VA 3EINA 1WE0A 3KMOA 1B48A 1GSEA 2M72A 4HQSA 2VLVA 1OC9B 2EIRA 2GSQA 2NVLA 4N11A 2RIIA 2Z9SA 4HZ2A 1F6MC 1J08A 2HLSA 4EE0A 4BA7A 1OC8A 4KX4A 2WZ9A 4FIWA 1ST9A 1NW2A 3ME7A 2VD1A 2VL3A 1R26A 3FK8A 3VPQA 2YPMA 4XRDA 4MZCA 4YQVA 1ZCPA 2PWJA 1SD8A 2E7PA 1XZOA 2IFQB 3VLNA 2LV3A 1DSBA 5D8IA 2XHFA 2LRTA 1U3AA 4KSOA 4AJ6A 5ECOB 2PPTA 3CTGA 2ZUPA 4PQ1A 1TDIA 2P31A 4MZBA 1ZYEA 2AYTA 4IW9A 1TOFA 4WKWA 4KUNA 5B6MA 2L6DA 3LEFA 2H30A 1TI3A 1TRUA 1QMVA 3D0ZA 1X9MB 4E8EA 5ECNB 3HYPA 3VWUA 1XWBA 1T3BA 1M2DA 4ECCA 3WGEA 3HA9A 3KJYA 1KBNA 3HVVA 1X9SB 4ECBA 1R4WA 5ECPB 2D2ZA 5FT3A 4ZILA 1SYRA 2LUSA 1QXHA 1TKDB 1WJKA 13GSA 1WRYA 2PVOC 2VCTA 3E3EA 2J23A 1GRXA 2XPEA 3GIXA 1LBKA 1XPVA 4LMWA 3M9KA 4J56E 3FZ9A 1UN2A 4L8EA 1A8LA 2CZ3A 3TJFA 5G5FA 6GSVA 1GP1A 3R2QA 2HRNA 3EWLA 4O5RA 2CV4A 2L4CA 3V1WA 2M80A 1Z7RA 3TKSE 4ML1A 4PQIA 1PX6A 4I6XA 3VWXA 4I2TA 3IV4A 3F0IA 1XOBA 4TVEA 4X43A 2AJQB 1PL2A 5ECHB 4ECIA 1PD21 1OE7A 2B7KA 4RI6A 5CREA 2R5GA 1B9XC 2CT6A 4RQXA 2B6MA 4XS4B 2CAIA 1XCCA 4IN0A 2DJJA 1GUKA 3DD3A 2XBQA 3TJBA 4L0UA 4N10A 4JRRA 1AIUA 5B6NA 1HNBA 4IP6A 1THXA 2HRFA 4DSSB 2WS2A 3MSZA 3N5OA 2I1UA 3A2XA 4KB3A 3GSTA 3HDCA 3TJJA 3CRUA 2H8LA 4X1UA 1V98A 4PX1A 2F51A 3HXSA 2YANA 1MEKA 1MTCA 1EOGA 3FKFA 2GSSA 4KGIA 3LG6A 4F03A 2H6YA 4IS0A 1K0MA 3FHKA 1E6BA 4JEDA 8GSSA 4F2IA 3HZ8A 2RUFA 3NOFA 1JHBA 2XPDA 1GLPA 1UC7A 6GSSA 2GT6A 3IAM2 2O8VB 3BOAA 3MNGA 2VCQA 1PN9A 3TJGA 3EE2A 4WR5A 1TI1A 4EF0A 1Q98A 5J9BA 3CTFA 1BX9A 3RBTA 5KN2A 1URMA 5IMFA 3I43A 1A2LA 1CQHA 4OO5A 4MCUA 3Q6OA 5D93A 5J3RA 1HNAA 1WWJA 5A4UA 4MZWA 5FHIA 4FO5A 3BJ5A 2YJHA 4TR3A 1XIYA 2CX4A 1BYEA 2FCHA 2FWGA 2GQLA 3FZ5A 2H74A 3FZAA 2H0IA 2F9SA 5DALA 1TK5B 3FYGA 1FVKA 4ZBAA 3ZIJA 4WF5A 1F3BA 2AV4A 3UARA 1EEJA 4ZL8A 2C0GA 5DJLA 1YQ1A 1MDIA 2PU9C 2HZEB 5HQPA 1JZWA 1YEXA 5EY6A 3NZNA 1O85A 1XOAA 1M99A 1T00A 3GTUB 4EDYA 4Z7XA 3APQA 3HVXA 1PX7A 4FYBA 1K3LA 4TR4A 5ELGA 1NM3A 2JZRA 4NXIA 3QMXA 2ON5A 5AIVA 2OACA 3UJ1A 2GQMA 4HU7A 3L78A 4JBBA 3UOMA 5D9XA 5IM9A 4IHUA 3UBKA 3CYNA 2B1KA 4HJ2A 5ECRB 3IC4A 2ALBA 2GGTA 5DCHA 2FLSA 4IGJA 4GSTA 2A4VA 3M9JA 4BWQA 2GVPA 2YV9A 2WCIA 2FA4A 4RUVA 1G7EA 4IJIA 3L9VA 1WOUA 5JWQB 3MAKA 1A0RP 2H6XA 3IRAA 4Q5NA 1DE1A 3GN3A 3L9UA 3BCIA 4ZB9A 4XHMA 1ML6A 5EVOA 3F3QA 2PBJA 2DJ2A 3ZRDA 2YJ7A 3LXTA 3NIVA 1JZRA 3F63A 5GZZB 4J2FA 2LEGA 2P5QA 4YQUA 5JWRB 3QDNA 4HEA2 4BPYA 1K0AA 1M0UA 5HR0A 1YJ6A 4IKHA 2J9HA 5COHA 4XS4A 4BVXA 2QSIA 2H66A 1PRXA 2IPAA 1KEBA 4QL9A 2O85A 2QKEA 4YAPA 1O73A 5D96A 4JR4A 5JCWA 2BJXA 2GZYA 2VCZA 3TDGA 3F8UA 2F8AA 3QFBC 4PNFA 5GAND 4DSSA 1VF2A 1B4PA 1Y6EA 3VI5A 1JZOA 2LKUA 3HCZA 3CMIA 6GSUA 3BD2A 5H5SA 1XXUA 2B3SA 2V1MA 3QAGA 1S3AA 2R2JA 5KN3A 1YEPA 2TIRA 5B8AA 5IPHA 5FWGA 1DUGA 2C3QA 4OWYA 1I9DA 3LWAA 4PUAA 4MLYA 1MD3A 3GURA 2F3MA 3PGTA 9GSSA 1VGLA 2IIYA 4EVMA 1SKWB 5ECLB 1XW9A 2M46A 3F6DA 3IK7A 3ZVJA 1XWAA 4LMVA 1SK0A 16GSA 4RQRA 3TKRA 3UMAA 2FGXA 2C8UA 1S3CA 2O87A 2E0QA 2HZFA 3ZL5A 1X5DA 2RM6A 1O81A 1QGVA 1KNGA 4TKYA 2B5EA 3ZLPA 1TK0B 3SBCA 4KCEA 4ZB8A 2VOCA 2G2QA 5IOWA 3IDVA 4K9ZA 2MMAA 1A0FA 2KUCA 2DLXA 2EIQA 5B8BA 3PINA 2CAQA 4POMA 2WDUA 2I3YA 4KA0A 2VLUA 5CO3A 3US3A 5A5KA 2K6VA 1C72A 2NBSA 2OJLA 2PVQA 4K1FA 3L4NA 4GQFA 2IMKA 2F8FA 1XW6A 3TOTA 3DVWA 4E8HA 2YZHA 2IL3A 2YWIA 1QFNA 4MH3A 5DVBA 3J7Yk 2L5OA 4MK3A 4FYCA 1GSDA 2DMMA 5AGYA 4NWYA 1FB6A 5HFIA 3G7IA 1GUHA 2IN3A 4MH2A 5B7CA 1VF1A 3ED3A 1HNCA 1JLVA 4NAXA 2HNLA 5IPGA 4YAVA 3UBLA 1ZOFA 1Q4JA 4MJCA 1M2AA 1EGOA 1E2YA 1AXDA 4Q5FA 1TU7A 3QOUA 2B7JA 5A4VA 1O8WA 1EOHA 2VUPA 2GSRA 2ON7A 5CRHA 1LJRA 4MA9A 1B4QA 1TRVA 4GRFA 1EP7A 4K2DA 4V2MA 4TXOB 3EMXA 5KN1A 3HY2A 4LLRA 3IPZA 1M7TA 4EUYA 2BMXA 3KH7A 1TU8A 1N8JA 2C3NA 4TW5A 3OR5A 1Z5YE 2CZ2A 3KEBA 1A2JA 2OADA 2H76A 3TOUA 4XTSA 5IMVA 4POKA 1A23A 3A2WA 1XWCA 2HFDA 3F6FA 2IMIA 2H71A 4G9HA 3GKNA 1O6JA 4ACSA 1TRWA 3DMLA 1SL1B 1HD2A 2V41A 1XBSA 1HYUA 2CVKA 4MDCA 3GMFA 2V32A 3UVTA 1SL0B 5LD0A 2N5BA 2LNTA 3GL3A 4ILFA 4XRAA 2NDOA 1VRSD 1ERTA 1PQNA 3LJRA 1OKTA 2LRNA 3P2AA 3D4MA 1U3IA 3M0FA 1H75A 5AISA 3RPPA 3TGZA 1K3OA 2VL2C 3GH9A 4ZB6A 4NMUA 5G5EA 2MBSA 1EGRA 4OFNA 2OBKA 5ID2B 3M8NA 5D73A 1GSUA 4LL4B 5E59A 2B5XA 1CQGA 2LJKA 4NHZA 4TN8A 2L4QA 3TCOA 1SL2B 2FY6A 4IELA 3EYTA
chains in the Genus database with same CATH superfamily
3DRNA 3LORA 2VL9A 2OKAA 4MJAA 1GTBA 2CVDA 1GTIA 5JCGA 4BVYB 1OC3A 3DWVA 3HZ4A 3N9JA 1FG4A 4BL7B 1MDJA 5DDLA 5G1LA 3ZREA 3ERFA 3IC8A 2JADA 2G0FA 2MMOA 4NV2A 5HR2A 2HI7A 3PR8A 1KTEA 1UA5A 1BEDA 3H4KA 3IE3A 3RDWA 7GSSA 4HUAA 2P0GA 1ERVA 4JZQA 4WF4A 5CNWA 2GDRA 4AJ7A 4K0GA 2OA7A 1GLQA 2LJRA 4Q5RA 3EU3A 2O89A 2HE3A 2DJ1A 3IHQA 4KCAA 4XS6A 1MD4A 5EPFA 4DEJA 5KEJA 3RHCA 3HJOA 1A2MA 2DJ0A 4N0ZA 1DE2A 1XWKA 4EXJA 1K0DA 2H1GA 1QQ2A 1OC9A 2RLIA 3C7MA 3CBUA 1M3IA 2FUG2 2VCXA 3ZFLA 2VAFA 2OBIA 3GX0A 4I5QA 2QA2A 1ZZYA 3KZQA 2FD3A 1XWGA 1TW9A 1ILOA 3HJPA 4G0KA 3LSZA 4TXOA 4ZL9A 2VO4A 4IVFA 1WIKA 2I4AA 5DBQA 11GSA 3TUEA 3LYKA 4OMVA 5HR3A 1V9WA 4KAEA 6GSYA 5E4WA 2C3TA 4WEYA 1NHOA 2IFQA 4MF5A 4NV5A 5J9CA 4ZBBA 5HFGA 5H5QA 5CRDA 1GTUA 4RI7A 3UL3A 5DQSA 4MJBA 2OE1A 3KTBA 1SU9A 1J0FA 10GSA 2FHEA 2H70A 4FH8A 3ZTLA 1F37A 3LFLA 4WETA 1QK8A 3O3TA 3GV1A 2JACA 3KTLA 1SENA 5IO2A 3VFIA 3Q74A 2QGVA 2HXKA 2NTOA 1MDKA 4OCEA 3F4SA 4OFTA 4F9ZA 2HT9A 2K8SA 1THOA 4HDEA 2K8VA 2CA8A 3APSA 1U88A 4MABA 5L71A 2GT5A 2H72A 3GNJA 3C8EA 4O7HA 4HS1A 4IP1A 5DQYA 1WMJA 5G31A 1X5EA 5G30A 5IMDA 3BCKA 4G10A 14GSA 2DSAA 1QUWA 2REMA 1T7PB 4WR4A 2P5RA 4IQAA 1T1VA 3ERWA 5G1KA 3FW2A 2CX3A 4AGSA 2LNSA 3QD9A 3KD0A 1FW1A 2B1LA 1EP8A 2OE0A 5KN0A 2FNOA 1SK1A 1BQ7A 4H86A 5ID2A 3HJMA 1GSFA 4L5LA 2I9HA 5HR1A 2JSYA 3H79A 3TKPA 4D73B 2H1DA 2EC4A 3U5RE 3O76A 3VK9A 1LU4A 3GUSA 3KP8A 3MYDA 5GSTA 2JZSA 2DMLA 4EC0A 1B8XA 2KHPA 4JR6A 3UIWA 4MMMA 2DIYA 5F06A 4ZL7A 5ABRA 1GSQA 3HKRA 2QA1A 4BVYA 1X0RA 2CQ9A 3KIJA 3HVSA 4XS1A 1S3RA 4AJ8A 1EV4A 1SKSB 4K7OA 4BL7A 1K0CA 4JU5A 1XVWA 4IBPA 5KOXA 5F07A 5AIXA 4ICYA 1SJ6A 3AY8A 2XC2A 1GSSA 2DIZA 3R3EA 2VL2A 2PERA 1VF4A 2IJYA 3SWLA 2QC7A 3GSSA 5IOXA 1OAZA 5ECQB 2LTKA 4Z2RA 2CVBA 1Z6MA 3IR4A 3CQFA 3O6TA 3FMWA 3LQ7A 3I9V2 5IMAA 4I8BA 3DKSA 1PGTA 3IBHA 3DGQA 2MYGA 4OO4A 1PKWA 4O92A 1USBA 3IOSA 3HHVA 1X9WB 4GCIA 2VCWA 4TOPA 6GSWA 2L6CA 2WULA 1X5CA 3FZ4A 4N30A 1AQVA 1YF1A 3MWHA 1GNWA 2A2SA 4P3YB 5LCZA 1G6YA 1OYJA 1PFOA 2DKHA 2N5AA 1ZYNA 3D21A 1SKRB 1AAZA 1O7UA 4G2EA 3Q19A 1PMTA 1T4ZA 3IA1A 2JZTA 3L0HA 2VM2A 3H93A 2R6KA 4A5PA 4WXTA 1YKCA 2AAWA 4GF0A 2C1YA 1M9BA 5INYA 2KP1A 4HU9A 1RK4A 20GSA 3QR6A 3GH6A 4HQZA 4NPBA 3ISOA 3ZMLA 2H1BA 2GZZA 1DBYA 1PA3A 3W6GA 3TB2A 2B5YA 5HFKA 4HZ4A 1GUMA 1SJIA 1B9YC 3TKSC 3IHGA 4J57E 3GX8A 5ECIB 1G0TA 2WJUA 4KNDA 3GKMA 1F2EA 3VWVA 2AHEA 2HZEA 1NSWA 2NPBA 3F4TA 4ZBDA 4ISDA 5G2ZA 3DYRA 5LNKe 3ZVJD 3GTUA 3Q18A 4GSNA 1G6WA 2PGTA 1Z6NA 1FAAA 2K9FA 4YKGA 2DJKA 4CHSA 3WT2A 4IQ1A 4EO3A 3A2VA 3IXRA 2LQQA 4MNNA 4X0XA 4TR0A 2WRTA 4PGTA 3C71A 1NHYA 2UZ8A 2GZPA 3KP9A 3G9BA 4G0IA 1FB0A 2I81A 3ME8A 2X8CA 2MMZA 3GA4A 2C4JA 5C00A 3QAWA 2R37A 2V2GA 3H8QA 5DALB 1ZYQB 4I97A 3E0UA 4PTSA 2GTUA 3RAZA 2E2MA 1N2AA 1PN0A 12GSA 4D73A 2KLXA 4G0LA 2E2GA 1OVNA 4V1Ag 3F9UA 1SJZA 2V6OA 2HSYA 4PURA 5DJMA 3FRCA 5CP1A 4V2NA 4ECJA 1VF3A 1V57A 3VPTA 2JU5A 4K0NA 1GULA 1BG5A 4ULXA 2C0DA 2IMFA 2LRCA 1JLWA 3A5IA 4L0WA 4POLA 1SD9A 4BWSA 3ZFBA 3WGDA 2PN8A 5IO0A 4TR1B 2VD0A 19GSA 1ZMAA 5J41A 3KGKA 5D9VA 4KSMA 3ZZXA 1TRSA 2KP2A 4JE1A 4GLTA 4XIHA 1EWXA 3VWWA 1FHEA 5CRGA 1OE8A 5AN1A 4GWRA 4O32A 3EVIA 3U6VA 1T4YA 4MF7A 4GQCA 17GSA 2AUVA 2MZCA 4HSCX 3L9SA 4DSRA 4KF9A 6GSTA 2A2RA 1RW1A 1M2BA 1V2AA 1FVJA 3EU4A 1YF0A 3WT1A 5A4WA 1M9AA 1EEMA 4NHWA 2X8HA 2H01A 5J4UA 1AQWA 1AW9A 1ZGNA 1IYHA 2OE3A 2L57A 1GH2A 1XVQA 3S9FA 4KE3A 4K7NA 4YQMA 1J9BA 4DSQA 1JFUA 4POBA 4ZXGA 2ES7A 1GNEA 4FYUA 3APOA 4LA1A 2GLRA 3GL5A 3CSHA 4CW9A 2YWOA 2C0FA 4EDZA 2WFCA 3KH9A 4PQHA 4OFMA 6GSXA 2ZCTA 4PXOA 2N5FA 4Q5QA 2EIOA 1EZKA 4HJMA 4ML6A 4TXVA 3P90A 1YKAA 3KM6A 2YWMA 4CDOA 4ZIJA 1F3AA 2RUEA 4HOJA 2AB6A 3DIEA 3I6AA 3HD5A 3A5WA 3P8WA 1XG8A 2IMEA 2PUKC 5DCGA 2R3XA 2X99A 1Z7PA 1TXXA 1FO5A 1ERUA 1GL8A 2YNXA 2IMDA 2DBCA 4K6XA 4EL1A 5CAXA 1T8EB 3G7JA 2TRCP 3GKKA 5ELAA 1TK8B 1A24A 2GQKA 4GXZA 1V58A 5D9WA 5IQYA 3FR3A 1GTAA 2FWEA 1K0BA 1TJDA 2H0GA 2VCVA 5JWOB 2X4AA 5DAKB 2FA8A 3M3MA 1ZYPA 1K0NA 2IWTA 1OKDA 3GHAA 3LGCA 3D5JA 5F0GA 5D9TA 3F3RA 2TRXA 5GAPD 3GKXA 3CXGA 3DVXA 1PL1A 3RHBA 3JCML 3MDKA 4WBRD 3TKSA 3C73A 3EMPA 1RQMA 1FOVA 2FWHA 4QL7A 5F8BA 1G7OA 2YZUA 3A3TA 4ID0A 4PNGA 2WGRA 1AC1A 1W89A 3LYPA 2DC5A 2DJ3A 3FY7A 2VIMA 3D4TA 2VLTA 1U87A 4K8MA 4KDYA 2BTOT 3D22A 3E9JB 3I69A 3KCMA 3WD6A 2HSHA 1K0OA 1Y25A 1I5GA 3LXZA 1ZL9A 2XBIA 4V2LA 2X8GA 1AQXA 18GSA 1GWCA 2H0HA 4K2XA 4KW6A 2FWFA 2WB9A 4TR1A 5ECKB 4GTUA 2LQOA 1V40A 1ERWA 4I2UA 5IMCA 1BJXA 3C1SA 4L5OA 3G7YA 4K7IA 2JL4A 5ECMB 1PSQA 3VURA 3QPMA 2JSZA 1H4OA 1YZXA 2K18A 4PUFC 3GFKA 3QFAC 5IIZA 2C80A 3VI7A 1Z3EA 5C04A 5IMZA 3QCPA 4XCSA 1YY7A 3KMNA 2A4HA 5CRWA 4K5RA 3DEXA 1F9MA 1YDKA 3DXBA 2ZNMA 2LS5A 3ZMKA 2LSTA 1K3YA 1O8XA 1Z9HA 5F05A 1JZDA 3EURA 2L59A 1SYXA 2MBTA 3FR6A 3UVHA 3F4RA 2YWNA 1R5PA 5CYYA 2RM5A 1M3JA 4LL1B 3KXOA 1AUCA 4AF2A 1BAYA 2PMTA 3K8NA 4YH2A 4F0BA 3TRPA 2LJAA 2R0PA 4GSSA 1ACVA 2L5LA 4KDUA 2H6ZA 3ZIVA 4MJEA 3GRXA 4O5UA 2H73A 4F0CA 22GSA 3TRQA 3M1GA 4HI7A 1IYIA 3IK9A 3EC3A 1TTZA 1S3DA 1WP0A 4F82A 2GSTA 3TKQA 3C1RA 1XFLA 1ABAA 2GS3A 3H1NA 3WYWA 1R5AA 3QAVA 5JCUA 2HSMA 3CSIA 1WPIA 4CY8A 1PKZA 4IJ3A 2R4VA 2YP6A 4MP4A 3TRXA 4V1Ap 2MMNA 3GYKA 2O7KA 3TJKA 5ECSA 1R7HA 4MPGA 5EL8A 3FEUA 3HVNA 4MPFA 5DAKA 1TP9A 5GSSA 3W8JA 3PPUA 3EPTA 3UAPA 4TRXA 3P7XA 1ON4A 4KDXA 1XW5A 1HQOA 3ZITA 2H75A 4OD7A 2V6KA 3CRTA 3CSJA 3BBYA 3UEMA 5ENUA 2YOIA 4G19A 2X64A 3W8SA 4N0VA 4QQ7A 2KOKA 3IAS2 1EV9A 2YCDA 1SK2A 3J7Yb 5H5RA 2H1AA 1A8YA 3ZYWA 4DVCA 1UVZA 2VM1A 3RPNA 2YN1A 2H19A 4EKZA 4YKFA 3D6IA 2YV7A 5J5NA 1GSYA 3ERGA 4KH7A 4WBJA 3FR9A 3WGXA 4OCFA 1U6TA 2C0EA 4FQUA 4EIPA 4MF6A 3PH9A 2HYXA 1W4VA 3EINA 1WE0A 3KMOA 1B48A 1GSEA 2M72A 4HQSA 2VLVA 1FOHA 1OC9B 2EIRA 2GSQA 2NVLA 4N11A 2RIIA 2Z9SA 4HZ2A 1F6MC 1J08A 2HLSA 4EE0A 4BA7A 1OC8A 4KX4A 2WZ9A 4FIWA 1ST9A 1NW2A 3ME7A 2VD1A 2VL3A 1R26A 3FK8A 3VPQA 2YPMA 4XRDA 4MZCA 4YQVA 1ZCPA 2PWJA 1SD8A 2E7PA 1XZOA 2IFQB 3VLNA 2LV3A 1DSBA 5D8IA 2XHFA 2LRTA 1U3AA 4KSOA 4AJ6A 5ECOB 2PPTA 3CTGA 2ZUPA 4PQ1A 1TDIA 2P31A 4MZBA 1ZYEA 2AYTA 4IW9A 1TOFA 4WKWA 4KUNA 5B6MA 2L6DA 3LEFA 2H30A 1TI3A 1TRUA 1QMVA 3D0ZA 1X9MB 4E8EA 5ECNB 3HYPA 3VWUA 1XWBA 1T3BA 1M2DA 4ECCA 3WGEA 3HA9A 3KJYA 1KBNA 3HVVA 1X9SB 4ECBA 1R4WA 5ECPB 2D2ZA 5FT3A 4ZILA 1SYRA 2LUSA 1QXHA 1TKDB 1WJKA 13GSA 1WRYA 2PVOC 2VCTA 3E3EA 2J23A 1GRXA 2XPEA 3GIXA 1LBKA 1XPVA 4LMWA 3M9KA 4J56E 3FZ9A 1UN2A 4L8EA 1A8LA 4X4JA 2CZ3A 3TJFA 5G5FA 4K5SA 6GSVA 1GP1A 3R2QA 2HRNA 3EWLA 4O5RA 2CV4A 2L4CA 3V1WA 2M80A 1Z7RA 3TKSE 4ML1A 4PQIA 1PX6A 4I6XA 3VWXA 4I2TA 3IV4A 3F0IA 2R0CA 1XOBA 4TVEA 4X43A 2AJQB 1PL2A 5ECHB 4ECIA 1PD21 1OE7A 2B7KA 4RI6A 5CREA 2R5GA 1B9XC 2CT6A 4RQXA 2B6MA 4XS4B 4BVXB 2CAIA 1XCCA 4IN0A 2DJJA 1GUKA 3DD3A 2XBQA 3TJBA 4L0UA 4N10A 4JRRA 1AIUA 5B6NA 1HNBA 4IP6A 1THXA 2HRFA 4DSSB 2WS2A 3MSZA 3N5OA 2I1UA 3A2XA 4KB3A 3GSTA 3HDCA 3TJJA 3CRUA 2H8LA 4X1UA 1V98A 4PX1A 2F51A 3HXSA 2YANA 1MEKA 1MTCA 1EOGA 3FKFA 2GSSA 4KGIA 3LG6A 4F03A 2H6YA 4IS0A 1K0MA 3FHKA 1E6BA 4CY6A 4JEDA 8GSSA 4F2IA 3HZ8A 2RUFA 3NOFA 1JHBA 2XPDA 1GLPA 1UC7A 6GSSA 2GT6A 3IAM2 2O8VB 3BOAA 3MNGA 2VCQA 1PN9A 3TJGA 3EE2A 4WR5A 1TI1A 4EF0A 1Q98A 5J9BA 3CTFA 1BX9A 3RBTA 5KN2A 4BIKA 1URMA 5IMFA 2HRAA 3I43A 1A2LA 1CQHA 4OO5A 4MCUA 3Q6OA 5D93A 5J3RA 1HNAA 1WWJA 5A4UA 4MZWA 5FHIA 4FO5A 3BJ5A 2YJHA 4TR3A 1XIYA 2CX4A 1BYEA 2FCHA 2FWGA 2GQLA 3FZ5A 2H74A 3FZAA 2H0IA 2F9SA 5DALA 1TK5B 3FYGA 1FVKA 4ZBAA 3ZIJA 4WF5A 1F3BA 2AV4A 3UARA 5BRTA 1EEJA 4ZL8A 2C0GA 5DJLA 1YQ1A 1MDIA 2PU9C 2HZEB 5HQPA 1JZWA 1YEXA 5EY6A 3NZNA 1O85A 1XOAA 1M99A 1T00A 3GTUB 4EDYA 4Z7XA 3APQA 3HVXA 1PX7A 4FYBA 1K3LA 4TR4A 5ELGA 1NM3A 2JZRA 4NXIA 3QMXA 2ON5A 5AIVA 2OACA 3UJ1A 2GQMA 4HU7A 3L78A 4JBBA 3UOMA 5D9XA 5IM9A 4IHUA 3UBKA 3CYNA 2B1KA 4HJ2A 2A2PA 5ECRB 3IC4A 2ALBA 2GGTA 5DCHA 2FLSA 4IGJA 4GSTA 2A4VA 3M9JA 4BWQA 2GVPA 2YV9A 2WCIA 2FA4A 4RUVA 1G7EA 3MIXA 4IJIA 3L9VA 1WOUA 5JWQB 4EIQA 2R0GA 3MAKA 1A0RP 2H6XA 3IRAA 2HRKA 4Q5NA 1DE1A 3GN3A 3L9UA 3BCIA 4ZB9A 4XHMA 1ML6A 5EVOA 3F3QA 2PBJA 3LW9A 2DJ2A 3ZRDA 2YJ7A 3LXTA 3NIVA 1JZRA 3F63A 5GZZB 4J2FA 2LEGA 2P5QA 4YQUA 5JWRB 3QDNA 4HEA2 4BPYA 2X49A 1K0AA 1M0UA 5HR0A 1YJ6A 4IKHA 2J9HA 5COHA 4XS4A 4BVXA 2QSIA 2H66A 1PRXA 2IPAA 1KEBA 4QL9A 2O85A 2QKEA 4YAPA 1O73A 5D96A 4JR4A 5JCWA 2BJXA 2GZYA 2VCZA 3TDGA 3F8UA 2F8AA 3QFBC 4PNFA 5GAND 4DSSA 1VF2A 1B4PA 1Y6EA 3VI5A 1JZOA 2LKUA 3HCZA 5BMUA 3CMIA 6GSUA 3BD2A 5H5SA 1XXUA 2B3SA 2V1MA 3QAGA 1S3AA 2R2JA 5KN3A 1YEPA 2TIRA 5B8AA 5IPHA 5FWGA 1DUGA 2C3QA 4OWYA 1I9DA 3LWAA 4PUAA 4MLYA 1MD3A 3GURA 2F3MA 3PGTA 9GSSA 1VGLA 2IIYA 4EVMA 1SKWB 5ECLB 1XW9A 2M46A 3F6DA 3IK7A 3ZVJA 1XWAA 4LMVA 1SK0A 16GSA 4RQRA 3TKRA 3UMAA 2FGXA 2C8UA 1S3CA 2O87A 2E0QA 2HZFA 3ZL5A 1X5DA 2RM6A 1O81A 1QGVA 1KNGA 4TKYA 2B5EA 3ZLPA 1TK0B 3SBCA 4KCEA 4ZB8A 2VOCA 2G2QA 5IOWA 4USSA 3IDVA 4K9ZA 2MMAA 1A0FA 2KUCA 2DLXA 2EIQA 5B8BA 3PINA 2CAQA 4POMA 2WDUA 2I3YA 4KA0A 2VLUA 5CO3A 3US3A 5A5KA 2K6VA 1C72A 2NBSA 2OJLA 2PVQA 4K1FA 3L4NA 4GQFA 2IMKA 2F8FA 1XW6A 3TOTA 3DVWA 4E8HA 2YZHA 2IL3A 2YWIA 1QFNA 4MH3A 5DVBA 3J7Yk 2L5OA 4MK3A 4FYCA 1GSDA 2DMMA 5AGYA 4NWYA 1FB6A 5HFIA 3G7IA 1GUHA 2IN3A 4MH2A 5B7CA 1VF1A 3ED3A 1HNCA 1JLVA 4NAXA 2HNLA 5IPGA 4YAVA 3UBLA 1ZOFA 1Q4JA 4MJCA 1M2AA 1EGOA 1E2YA 1AXDA 4Q5FA 1TU7A 3QOUA 2B7JA 5A4VA 1O8WA 1EOHA 2VUPA 2GSRA 4Z2UA 2ON7A 5CRHA 4Z2TA 1LJRA 4MA9A 1B4QA 1TRVA 4GRFA 1EP7A 4V2MA 4K2DA 4TXOB 3EMXA 5KN1A 3HY2A 4LLRA 3IPZA 1M7TA 4EUYA 2BMXA 3KH7A 1TU8A 1N8JA 2C3NA 4TW5A 3OR5A 1Z5YE 2CZ2A 3KEBA 1A2JA 2OADA 2H76A 3TOUA 4XTSA 5IMVA 4POKA 1A23A 3A2WA 1XWCA 2HFDA 3F6FA 2IMIA 2H71A 4G9HA 3GKNA 1O6JA 4ACSA 1TRWA 3DMLA 1SL1B 1HD2A 2V41A 1XBSA 5KOWA 4O5QA 1HYUA 2CVKA 4MDCA 3GMFA 2V32A 2DKIA 3UVTA 1SL0B 5LD0A 2N5BA 2LNTA 3GL3A 4ILFA 4XRAA 2NDOA 1VRSD 1ERTA 1PQNA 3LJRA 1OKTA 2LRNA 3P2AA 3D4MA 1U3IA 3M0FA 1H75A 5AISA 3RPPA 3TGZA 1K3OA 2VL2C 3GH9A 4ZB6A 4NMUA 5G5EA 2MBSA 1EGRA 4OFNA 2OBKA 5ID2B 3M8NA 5D73A 1GSUA 4LL4B 5E59A 2B5XA 1CQGA 2LJKA 4NHZA 4TN8A 2L4QA 3TCOA 1SL2B 2FY6A 4IELA 3EYTA
chains in the Genus database with same CATH topology
3DRNA 3LORA 2VL9A 2OKAA 4MJAA 1GTBA 2CVDA 1GTIA 5JCGA 4BVYB 1OC3A 3DWVA 3HZ4A 3N9JA 1FG4A 4BL7B 1MDJA 5DDLA 5G1LA 3ZREA 3ERFA 3IC8A 2JADA 2G0FA 2MMOA 4NV2A 5HR2A 2HI7A 3PR8A 1KTEA 1UA5A 1BEDA 3H4KA 3IE3A 3RDWA 7GSSA 4HUAA 2P0GA 1ERVA 4JZQA 4WF4A 5CNWA 2GDRA 4AJ7A 4K0GA 2OA7A 1GLQA 2LJRA 4Q5RA 3EU3A 2O89A 2HE3A 2DJ1A 3IHQA 4KCAA 4XS6A 1MD4A 5EPFA 4DEJA 5KEJA 3RHCA 3HJOA 1A2MA 2DJ0A 4N0ZA 1DE2A 1XWKA 4EXJA 1K0DA 2H1GA 1QQ2A 1OC9A 2RLIA 3C7MA 3CBUA 2FUG2 2VCXA 3ZFLA 2VAFA 2OBIA 3GX0A 4I5QA 2QA2A 1ZZYA 3KZQA 2FD3A 1XWGA 1TW9A 1ILOA 3HJPA 4G0KA 3LSZA 4TXOA 4ZL9A 2VO4A 4IVFA 1WIKA 2I4AA 5DBQA 11GSA 3TUEA 3LYKA 4OMVA 5HR3A 1V9WA 4KAEA 6GSYA 5E4WA 2C3TA 4WEYA 1NHOA 2IFQA 4MF5A 4NV5A 5J9CA 4ZBBA 5HFGA 5H5QA 5CRDA 1GTUA 4RI7A 3UL3A 5DQSA 4MJBA 2OE1A 3KTBA 1SU9A 1J0FA 10GSA 2FHEA 2H70A 4FH8A 3ZTLA 1F37A 3LFLA 4WETA 1QK8A 3O3TA 3GV1A 2JACA 3KTLA 1SENA 5IO2A 3VFIA 3Q74A 2QGVA 2HXKA 2NTOA 1MDKA 4OCEA 3F4SA 4OFTA 4F9ZA 2HT9A 2K8SA 1THOA 4HDEA 2K8VA 2CA8A 3APSA 1U88A 4MABA 5L71A 2GT5A 2H72A 3GNJA 3C8EA 4O7HA 4HS1A 4IP1A 5DQYA 1WMJA 5G31A 1X5EA 5G30A 5IMDA 3BCKA 4G10A 14GSA 2DSAA 1QUWA 2REMA 1T7PB 4WR4A 2P5RA 4IQAA 1T1VA 3ERWA 5G1KA 3FW2A 2CX3A 4AGSA 2LNSA 3QD9A 3KD0A 1FW1A 2B1LA 1EP8A 2OE0A 5KN0A 2FNOA 1SK1A 1BQ7A 4H86A 5ID2A 3HJMA 1GSFA 4L5LA 2I9HA 5HR1A 2JSYA 3H79A 3TKPA 4D73B 2H1DA 2EC4A 3U5RE 3O76A 3VK9A 1LU4A 3GUSA 3KP8A 3MYDA 5GSTA 2JZSA 2DMLA 4EC0A 1B8XA 2KHPA 4JR6A 3UIWA 4MMMA 2DIYA 5F06A 4ZL7A 5ABRA 1GSQA 3HKRA 2QA1A 4BVYA 1X0RA 2CQ9A 3KIJA 3HVSA 4XS1A 4AJ8A 1EV4A 1SKSB 4K7OA 4BL7A 1K0CA 4JU5A 1XVWA 4IBPA 5KOXA 5F07A 5AIXA 4ICYA 1SJ6A 3AY8A 2XC2A 1GSSA 2DIZA 3R3EA 2VL2A 2PERA 1VF4A 2IJYA 3SWLA 2QC7A 3GSSA 5IOXA 1OAZA 5ECQB 2LTKA 4Z2RA 2CVBA 1Z6MA 3IR4A 3O6TA 3FMWA 3LQ7A 3I9V2 5IMAA 4I8BA 3DKSA 1PGTA 3IBHA 3DGQA 2MYGA 4OO4A 1PKWA 4O92A 1USBA 3IOSA 3HHVA 1X9WB 4GCIA 2VCWA 4TOPA 6GSWA 2L6CA 2WULA 1X5CA 3FZ4A 4N30A 1AQVA 1YF1A 3MWHA 1GNWA 2A2SA 4P3YB 5LCZA 1G6YA 1OYJA 2DKHA 2N5AA 1ZYNA 3D21A 1SKRB 1AAZA 1O7UA 4G2EA 3Q19A 1PMTA 1T4ZA 3IA1A 2JZTA 3L0HA 2VM2A 3H93A 2R6KA 4A5PA 4WXTA 1YKCA 2AAWA 4GF0A 2C1YA 1M9BA 5INYA 2KP1A 4HU9A 1RK4A 20GSA 3QR6A 3GH6A 4HQZA 4NPBA 3ISOA 3ZMLA 2H1BA 2GZZA 1DBYA 1PA3A 3W6GA 3TB2A 2B5YA 5HFKA 4HZ4A 1GUMA 1SJIA 1B9YC 3TKSC 3IHGA 4J57E 3GX8A 5ECIB 1G0TA 2WJUA 4KNDA 3GKMA 1F2EA 3VWVA 2AHEA 2HZEA 1NSWA 2NPBA 3F4TA 4ZBDA 4ISDA 5G2ZA 3DYRA 5LNKe 3ZVJD 3GTUA 3Q18A 4GSNA 1G6WA 2PGTA 1Z6NA 1FAAA 2K9FA 4YKGA 2DJKA 4CHSA 3WT2A 4IQ1A 4EO3A 3A2VA 3IXRA 2LQQA 4MNNA 4X0XA 4TR0A 2WRTA 4PGTA 3C71A 1NHYA 2UZ8A 2GZPA 3KP9A 3G9BA 4G0IA 1FB0A 2I81A 3ME8A 2X8CA 2MMZA 3GA4A 2C4JA 5C00A 3QAWA 2R37A 2V2GA 3H8QA 5DALB 1ZYQB 4I97A 3E0UA 4PTSA 2GTUA 3RAZA 2E2MA 1N2AA 1PN0A 12GSA 4D73A 2KLXA 4G0LA 2E2GA 1OVNA 4V1Ag 3F9UA 1SJZA 2V6OA 2HSYA 4PURA 5DJMA 3FRCA 5CP1A 4V2NA 4ECJA 1VF3A 1V57A 3VPTA 2JU5A 4K0NA 1GULA 1BG5A 4ULXA 2C0DA 2IMFA 2LRCA 1JLWA 3A5IA 4L0WA 4POLA 1SD9A 4BWSA 3ZFBA 3WGDA 2PN8A 5IO0A 4TR1B 2VD0A 19GSA 1ZMAA 5J41A 3KGKA 5D9VA 4KSMA 3ZZXA 1TRSA 2KP2A 4JE1A 4GLTA 4XIHA 1EWXA 3VWWA 1FHEA 5CRGA 1OE8A 5AN1A 4GWRA 4O32A 3EVIA 3U6VA 1T4YA 4MF7A 4GQCA 17GSA 2AUVA 2MZCA 3L9SA 4DSRA 4KF9A 6GSTA 2A2RA 1RW1A 1M2BA 1V2AA 1FVJA 3EU4A 1YF0A 3WT1A 5A4WA 1M9AA 1EEMA 4NHWA 2X8HA 2H01A 5J4UA 1AQWA 1AW9A 1ZGNA 1IYHA 2OE3A 2L57A 1GH2A 1XVQA 3S9FA 4KE3A 4K7NA 4YQMA 1J9BA 4DSQA 1JFUA 4POBA 4ZXGA 2ES7A 1GNEA 4FYUA 3APOA 4LA1A 2GLRA 3GL5A 3CSHA 4CW9A 2YWOA 2C0FA 4EDZA 2WFCA 3KH9A 4PQHA 4OFMA 6GSXA 2ZCTA 4PXOA 2N5FA 4Q5QA 2EIOA 1EZKA 4HJMA 4ML6A 4TXVA 3P90A 1YKAA 3KM6A 2YWMA 4CDOA 4ZIJA 1F3AA 2RUEA 4HOJA 2AB6A 3DIEA 3I6AA 3HD5A 3A5WA 3P8WA 2IMEA 2PUKC 5DCGA 2R3XA 2X99A 1Z7PA 1TXXA 1FO5A 1ERUA 1GL8A 2YNXA 2IMDA 2DBCA 4K6XA 4EL1A 5CAXA 1T8EB 3G7JA 2TRCP 3GKKA 5ELAA 1TK8B 1A24A 2GQKA 4GXZA 1V58A 5D9WA 5IQYA 3FR3A 1GTAA 2FWEA 1K0BA 1TJDA 2H0GA 2VCVA 5JWOB 2X4AA 5DAKB 2FA8A 3M3MA 1ZYPA 1K0NA 2IWTA 1OKDA 3GHAA 3LGCA 3D5JA 5F0GA 5D9TA 3F3RA 2TRXA 5GAPD 3GKXA 3CXGA 3DVXA 1PL1A 3RHBA 3JCML 3MDKA 4WBRD 3TKSA 3C73A 3EMPA 1RQMA 1FOVA 2FWHA 4QL7A 5F8BA 1G7OA 2YZUA 3A3TA 4ID0A 4PNGA 2WGRA 1AC1A 1W89A 3LYPA 2DC5A 2DJ3A 3FY7A 2VIMA 3D4TA 2VLTA 1U87A 4K8MA 4KDYA 2BTOT 3D22A 3E9JB 3I69A 3KCMA 3WD6A 2HSHA 1K0OA 1Y25A 1I5GA 3LXZA 1ZL9A 2XBIA 4V2LA 2X8GA 1AQXA 18GSA 1GWCA 2H0HA 4K2XA 4KW6A 2FWFA 2WB9A 4TR1A 5ECKB 4GTUA 2LQOA 1V40A 1ERWA 4I2UA 5IMCA 1BJXA 3C1SA 4L5OA 3G7YA 4K7IA 2JL4A 5ECMB 1PSQA 3VURA 3QPMA 2JSZA 1H4OA 1YZXA 2K18A 4PUFC 3GFKA 3QFAC 5IIZA 2C80A 3VI7A 1Z3EA 5C04A 5IMZA 3QCPA 4XCSA 1YY7A 3KMNA 2A4HA 5CRWA 4K5RA 3DEXA 1F9MA 1YDKA 3DXBA 2ZNMA 2LS5A 3ZMKA 2LSTA 1K3YA 1O8XA 1Z9HA 5F05A 1JZDA 3EURA 2L59A 1SYXA 2MBTA 3FR6A 3UVHA 3F4RA 2YWNA 1R5PA 5CYYA 2RM5A 4LL1B 3KXOA 1AUCA 4AF2A 1BAYA 2PMTA 3K8NA 4YH2A 4F0BA 3TRPA 2LJAA 2R0PA 4GSSA 1ACVA 2L5LA 4KDUA 2H6ZA 3ZIVA 4MJEA 3GRXA 4O5UA 2H73A 4F0CA 22GSA 3TRQA 3M1GA 4HI7A 1IYIA 3IK9A 3EC3A 1TTZA 1S3DA 1WP0A 4F82A 2GSTA 3TKQA 3C1RA 1XFLA 1ABAA 2GS3A 3H1NA 3WYWA 1R5AA 3QAVA 5JCUA 2HSMA 3CSIA 1WPIA 4CY8A 1PKZA 4IJ3A 2R4VA 2YP6A 4MP4A 3TRXA 4V1Ap 2MMNA 3GYKA 2O7KA 3TJKA 5ECSA 1R7HA 4MPGA 5EL8A 3FEUA 4MPFA 5DAKA 1TP9A 5GSSA 3W8JA 3PPUA 3EPTA 3UAPA 4TRXA 3P7XA 1ON4A 4KDXA 1XW5A 1HQOA 3ZITA 2H75A 4OD7A 2V6KA 3CRTA 3CSJA 3BBYA 3UEMA 5ENUA 2YOIA 4G19A 2X64A 3W8SA 4N0VA 4QQ7A 2KOKA 3IAS2 1EV9A 2YCDA 1SK2A 3J7Yb 5H5RA 2H1AA 1A8YA 3ZYWA 4DVCA 1UVZA 2VM1A 3RPNA 2YN1A 2H19A 4EKZA 4YKFA 3D6IA 2YV7A 5J5NA 1GSYA 3ERGA 4KH7A 4WBJA 3FR9A 3WGXA 4OCFA 1U6TA 2C0EA 4FQUA 4EIPA 4MF6A 3PH9A 2HYXA 1W4VA 3EINA 1WE0A 3KMOA 1B48A 1GSEA 2M72A 4HQSA 2VLVA 1FOHA 1OC9B 2EIRA 2GSQA 2NVLA 4N11A 2RIIA 2Z9SA 4HZ2A 1F6MC 1J08A 2HLSA 4EE0A 4BA7A 1OC8A 4KX4A 2WZ9A 4FIWA 1ST9A 1NW2A 3ME7A 2VD1A 2VL3A 1R26A 3FK8A 3VPQA 2YPMA 4XRDA 4MZCA 4YQVA 1ZCPA 2PWJA 1SD8A 2E7PA 1XZOA 2IFQB 3VLNA 2LV3A 1DSBA 5D8IA 2XHFA 2LRTA 1U3AA 4KSOA 4AJ6A 5ECOB 2PPTA 3CTGA 2ZUPA 4PQ1A 1TDIA 2P31A 4MZBA 1ZYEA 2AYTA 4IW9A 1TOFA 4WKWA 4KUNA 5B6MA 2L6DA 3LEFA 2H30A 1TI3A 1TRUA 1QMVA 3D0ZA 1X9MB 4E8EA 5ECNB 3HYPA 3VWUA 1XWBA 1T3BA 1M2DA 4ECCA 3WGEA 3HA9A 3KJYA 1KBNA 3HVVA 1X9SB 4ECBA 1R4WA 5ECPB 2D2ZA 5FT3A 4ZILA 1SYRA 2LUSA 1QXHA 1TKDB 1WJKA 13GSA 1WRYA 2PVOC 2VCTA 3E3EA 2J23A 1GRXA 2XPEA 3GIXA 1LBKA 1XPVA 4LMWA 3M9KA 4J56E 3FZ9A 1UN2A 4L8EA 1A8LA 4X4JA 2CZ3A 3TJFA 5G5FA 4K5SA 6GSVA 1GP1A 3R2QA 2HRNA 3EWLA 4O5RA 2CV4A 2L4CA 3V1WA 2M80A 1Z7RA 3TKSE 4ML1A 4PQIA 1PX6A 4I6XA 3VWXA 4I2TA 3IV4A 3F0IA 2R0CA 1XOBA 4TVEA 4X43A 2AJQB 1PL2A 5ECHB 4ECIA 1PD21 1OE7A 2B7KA 4RI6A 5CREA 2R5GA 1B9XC 2CT6A 4RQXA 2B6MA 4XS4B 4BVXB 2CAIA 1XCCA 4IN0A 2DJJA 1GUKA 3DD3A 2XBQA 3TJBA 4L0UA 4N10A 4JRRA 1AIUA 5B6NA 1HNBA 4IP6A 1THXA 2HRFA 4DSSB 2WS2A 3MSZA 3N5OA 2I1UA 3A2XA 4KB3A 3GSTA 3HDCA 3TJJA 3CRUA 2H8LA 4X1UA 1V98A 4PX1A 2F51A 3HXSA 2YANA 1MEKA 1MTCA 1EOGA 3FKFA 2GSSA 4KGIA 3LG6A 4F03A 2H6YA 4IS0A 1K0MA 3FHKA 1E6BA 4CY6A 4JEDA 8GSSA 4F2IA 3HZ8A 2RUFA 3NOFA 1JHBA 2XPDA 1GLPA 1UC7A 6GSSA 2GT6A 3IAM2 2O8VB 3BOAA 3MNGA 2VCQA 1PN9A 3TJGA 3EE2A 4WR5A 1TI1A 4EF0A 1Q98A 5J9BA 3CTFA 1BX9A 3RBTA 5KN2A 1URMA 5IMFA 2HRAA 3I43A 1A2LA 1CQHA 4OO5A 4MCUA 3Q6OA 5D93A 5J3RA 1HNAA 1WWJA 5A4UA 4MZWA 5FHIA 4FO5A 3BJ5A 2YJHA 4TR3A 1XIYA 2CX4A 1BYEA 2FCHA 2FWGA 2GQLA 3FZ5A 2H74A 3FZAA 2H0IA 2F9SA 5DALA 1TK5B 3FYGA 1FVKA 4ZBAA 3ZIJA 4WF5A 1F3BA 2AV4A 3UARA 5BRTA 1EEJA 4ZL8A 2C0GA 5DJLA 1YQ1A 1MDIA 2PU9C 2HZEB 5HQPA 1JZWA 1YEXA 5EY6A 3NZNA 1O85A 1XOAA 1M99A 1T00A 3GTUB 4EDYA 4Z7XA 3APQA 3HVXA 1PX7A 4FYBA 1K3LA 4TR4A 5ELGA 1NM3A 2JZRA 4NXIA 3QMXA 2ON5A 5AIVA 2OACA 3UJ1A 2GQMA 4HU7A 3L78A 4JBBA 3UOMA 5D9XA 5IM9A 4IHUA 3UBKA 3CYNA 2B1KA 4HJ2A 2A2PA 5ECRB 3IC4A 2ALBA 2GGTA 5DCHA 2FLSA 4IGJA 4GSTA 2A4VA 3M9JA 4BWQA 2GVPA 2YV9A 2WCIA 2FA4A 4RUVA 1G7EA 3MIXA 4IJIA 3L9VA 1WOUA 5JWQB 4EIQA 2R0GA 3MAKA 1A0RP 2H6XA 3IRAA 2HRKA 4Q5NA 1DE1A 3GN3A 3L9UA 3BCIA 4ZB9A 4XHMA 1ML6A 5EVOA 3F3QA 2PBJA 3LW9A 2DJ2A 3ZRDA 2YJ7A 3LXTA 3NIVA 1JZRA 3F63A 5GZZB 4J2FA 2LEGA 2P5QA 4YQUA 5JWRB 3QDNA 4HEA2 4BPYA 2X49A 1K0AA 1M0UA 5HR0A 1YJ6A 4IKHA 2J9HA 5COHA 4XS4A 4BVXA 2QSIA 2H66A 1PRXA 2IPAA 1KEBA 4QL9A 2O85A 2QKEA 4YAPA 1O73A 5D96A 4JR4A 5JCWA 2BJXA 2GZYA 2VCZA 3TDGA 3F8UA 2F8AA 3QFBC 4PNFA 5GAND 4DSSA 1VF2A 1B4PA 1Y6EA 3VI5A 1JZOA 2LKUA 3HCZA 5BMUA 3CMIA 6GSUA 3BD2A 5H5SA 1XXUA 2B3SA 2V1MA 3QAGA 1S3AA 2R2JA 5KN3A 1YEPA 2TIRA 5B8AA 5IPHA 5FWGA 1DUGA 2C3QA 4OWYA 1I9DA 3LWAA 4PUAA 4MLYA 1MD3A 3GURA 2F3MA 3PGTA 9GSSA 1VGLA 2IIYA 4EVMA 1SKWB 5ECLB 1XW9A 2M46A 3F6DA 3IK7A 3ZVJA 1XWAA 4LMVA 1SK0A 16GSA 4RQRA 3TKRA 3UMAA 2FGXA 2C8UA 1S3CA 2O87A 2E0QA 2HZFA 3ZL5A 1X5DA 2RM6A 1O81A 1QGVA 1KNGA 4TKYA 2B5EA 3ZLPA 1TK0B 3SBCA 4KCEA 4ZB8A 2VOCA 2G2QA 5IOWA 4USSA 3IDVA 4K9ZA 2MMAA 1A0FA 2KUCA 2DLXA 2EIQA 5B8BA 3PINA 2CAQA 4POMA 2WDUA 2I3YA 4KA0A 2VLUA 5CO3A 3US3A 5A5KA 2K6VA 1C72A 2NBSA 2OJLA 2PVQA 4K1FA 3L4NA 4GQFA 2IMKA 2F8FA 1XW6A 3TOTA 3DVWA 4E8HA 2YZHA 2IL3A 2YWIA 1QFNA 4MH3A 5DVBA 3J7Yk 2L5OA 4MK3A 4FYCA 1GSDA 2DMMA 5AGYA 4NWYA 1FB6A 5HFIA 3G7IA 1GUHA 2IN3A 4MH2A 5B7CA 1VF1A 3ED3A 1HNCA 1JLVA 4NAXA 2HNLA 5IPGA 4YAVA 3UBLA 1ZOFA 1Q4JA 4MJCA 1M2AA 1EGOA 1E2YA 1AXDA 4Q5FA 1TU7A 3QOUA 2B7JA 5A4VA 1O8WA 1EOHA 2VUPA 2GSRA 4Z2UA 2ON7A 5CRHA 4Z2TA 1LJRA 4MA9A 1B4QA 1TRVA 4GRFA 1EP7A 4V2MA 4K2DA 4TXOB 3EMXA 5KN1A 3HY2A 4LLRA 3IPZA 1M7TA 4EUYA 2BMXA 3KH7A 1TU8A 1N8JA 2C3NA 4TW5A 3OR5A 1Z5YE 2CZ2A 3KEBA 1A2JA 2OADA 2H76A 3TOUA 4XTSA 5IMVA 4POKA 1A23A 3A2WA 1XWCA 2HFDA 3F6FA 2IMIA 2H71A 4G9HA 3GKNA 1O6JA 4ACSA 1TRWA 3DMLA 1SL1B 1HD2A 2V41A 1XBSA 5KOWA 4O5QA 1HYUA 2CVKA 4MDCA 3GMFA 2V32A 2DKIA 3UVTA 1SL0B 5LD0A 2N5BA 2LNTA 3GL3A 4ILFA 4XRAA 2NDOA 1VRSD 1ERTA 1PQNA 3LJRA 1OKTA 2LRNA 3P2AA 3D4MA 1U3IA 3M0FA 1H75A 5AISA 3RPPA 3TGZA 1K3OA 2VL2C 3GH9A 4ZB6A 4NMUA 5G5EA 2MBSA 1EGRA 4OFNA 2OBKA 5ID2B 3M8NA 5D73A 1GSUA 4LL4B 5E59A 2B5XA 1CQGA 2LJKA 4NHZA 4TN8A 2L4QA 3TCOA 1SL2B 2FY6A 4IELA 3EYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DRN A;  3LOR A;  2VL9 A;  2OKA A;  4MJA A;  1GTB A;  2CVD A;  1GTI A;  5JCG A;  1OC3 A;  3DWV A;  3HZ4 A;  3N9J A;  1FG4 A;  1MDJ A;  5DDL A;  5G1L A;  3ZRE A;  3ERF A;  2JAD A;  2G0F A;  2MMO A;  4NV2 A;  5HR2 A;  2HI7 A;  3PR8 A;  1KTE A;  1UA5 A;  1BED A;  3H4K A;  3IE3 A;  3RDW A;  7GSS A;  4HUA A;  2P0G A;  1ERV A;  4JZQ A;  4WF4 A;  5CNW A;  2GDR A;  4AJ7 A;  4K0G A;  2OA7 A;  1GLQ A;  2LJR A;  4Q5R A;  3EU3 A;  2O89 A;  2HE3 A;  2DJ1 A;  3IHQ A;  4KCA A;  4XS6 A;  1MD4 A;  5EPF A;  4DEJ A;  5KEJ A;  3RHC A;  3HJO A;  1A2M A;  2DJ0 A;  4N0Z A;  1DE2 A;  1XWK A;  4EXJ A;  1K0D A;  2H1G A;  1QQ2 A;  1OC9 A;  2RLI A;  3C7M A;  3CBU A;  2FUG 2;  2VCX A;  3ZFL A;  2VAF A;  2OBI A;  3GX0 A;  4I5Q A;  1ZZY A;  3KZQ A;  2FD3 A;  1XWG A;  1TW9 A;  1ILO A;  3HJP A;  3LSZ A;  4TXO A;  4ZL9 A;  2VO4 A;  4IVF A;  1WIK A;  2I4A A;  5DBQ A;  11GS A;  3TUE A;  3LYK A;  4OMV A;  5HR3 A;  1V9W A;  4KAE A;  6GSY A;  5E4W A;  2C3T A;  4WEY A;  1NHO A;  2IFQ A;  4MF5 A;  4NV5 A;  5J9C A;  4ZBB A;  5HFG A;  5H5Q A;  5CRD A;  1GTU A;  4RI7 A;  3UL3 A;  5DQS A;  4MJB A;  2OE1 A;  3KTB A;  1SU9 A;  1J0F A;  10GS A;  2FHE A;  2H70 A;  4FH8 A;  3ZTL A;  1F37 A;  3LFL A;  4WET A;  1QK8 A;  3O3T A;  3GV1 A;  2JAC A;  3KTL A;  1SEN A;  5IO2 A;  3VFI A;  3Q74 A;  2QGV A;  2HXK A;  2NTO A;  1MDK A;  4OCE A;  3F4S A;  4OFT A;  4F9Z A;  2HT9 A;  2K8S A;  1THO A;  4HDE A;  2K8V A;  2CA8 A;  3APS A;  1U88 A;  4MAB A;  5L71 A;  2GT5 A;  2H72 A;  3GNJ A;  3C8E A;  4O7H A;  4HS1 A;  4IP1 A;  5DQY A;  1WMJ A;  5G31 A;  1X5E A;  5G30 A;  5IMD A;  3BCK A;  4G10 A;  14GS A;  2DSA A;  1QUW A;  2REM A;  1T7P B;  4WR4 A;  2P5R A;  4IQA A;  1T1V A;  3ERW A;  5G1K A;  3FW2 A;  2CX3 A;  4AGS A;  2LNS A;  3QD9 A;  3KD0 A;  1FW1 A;  2B1L A;  1EP8 A;  2OE0 A;  5KN0 A;  2FNO A;  1SK1 A;  1BQ7 A;  4H86 A;  5ID2 A;  3HJM A;  1GSF A;  4L5L A;  2I9H A;  5HR1 A;  2JSY A;  3H79 A;  3TKP A;  4D73 B;  2H1D A;  2EC4 A;  3U5R E;  3O76 A;  3VK9 A;  1LU4 A;  3GUS A;  3KP8 A;  5GST A;  2JZS A;  2DML A;  4EC0 A;  1B8X A;  2KHP A;  4JR6 A;  3UIW A;  4MMM A;  2DIY A;  5F06 A;  4ZL7 A;  5ABR A;  1GSQ A;  3HKR A;  4BVY A;  1X0R A;  2CQ9 A;  3KIJ A;  3HVS A;  4XS1 A;  4AJ8 A;  1EV4 A;  1SKS B;  4K7O A;  4BL7 A;  1K0C A;  4JU5 A;  1XVW A;  4IBP A;  5F07 A;  5AIX A;  1SJ6 A;  3AY8 A;  2XC2 A;  1GSS A;  2DIZ A;  2VL2 A;  2PER A;  1VF4 A;  2IJY A;  3SWL A;  2QC7 A;  3GSS A;  5IOX A;  1OAZ A;  5ECQ B;  2LTK A;  2CVB A;  1Z6M A;  3IR4 A;  3O6T A;  3LQ7 A;  3I9V 2;  5IMA A;  4I8B A;  3DKS A;  1PGT A;  3IBH A;  3DGQ A;  2MYG A;  4OO4 A;  1PKW A;  4O92 A;  1USB A;  3IOS A;  3HHV A;  1X9W B;  4GCI A;  2VCW A;  4TOP A;  6GSW A;  2L6C A;  2WUL A;  1X5C A;  3FZ4 A;  4N30 A;  1AQV A;  1YF1 A;  3MWH A;  1GNW A;  2A2S A;  4P3Y B;  5LCZ A;  1G6Y A;  1OYJ A;  2N5A A;  3D21 A;  1SKR B;  1AAZ A;  1O7U A;  4G2E A;  3Q19 A;  1PMT A;  1T4Z A;  3IA1 A;  2JZT A;  3L0H A;  2VM2 A;  3H93 A;  2R6K A;  4WXT A;  1YKC A;  2AAW A;  4GF0 A;  2C1Y A;  1M9B A;  5INY A;  2KP1 A;  4HU9 A;  1RK4 A;  20GS A;  3QR6 A;  3GH6 A;  4HQZ A;  4NPB A;  3ISO A;  3ZML A;  2H1B A;  2GZZ A;  1DBY A;  1PA3 A;  3W6G A;  3TB2 A;  2B5Y A;  5HFK A;  4HZ4 A;  1GUM A;  1SJI A;  1B9Y C;  3TKS C;  4J57 E;  3GX8 A;  5ECI B;  1G0T A;  2WJU A;  4KND A;  3GKM A;  1F2E A;  3VWV A;  2AHE A;  2HZE A;  1NSW A;  2NPB A;  3F4T A;  4ZBD A;  4ISD A;  5G2Z A;  3DYR A;  5LNK e;  3ZVJ D;  3GTU A;  3Q18 A;  4GSN A;  1G6W A;  2PGT A;  1Z6N A;  1FAA A;  2K9F A;  2DJK A;  4CHS A;  3WT2 A;  4IQ1 A;  4EO3 A;  3A2V A;  3IXR A;  2LQQ A;  4X0X A;  4TR0 A;  2WRT A;  4PGT A;  3C71 A;  1NHY A;  2GZP A;  3KP9 A;  3G9B A;  1FB0 A;  2I81 A;  3ME8 A;  2X8C A;  2MMZ A;  3GA4 A;  2C4J A;  5C00 A;  3QAW A;  2R37 A;  2V2G A;  3H8Q A;  5DAL B;  1ZYQ B;  4I97 A;  3E0U A;  2GTU A;  3RAZ A;  2E2M A;  1N2A A;  12GS A;  4D73 A;  2KLX A;  2E2G A;  1OVN A;  4V1A g;  3F9U A;  1SJZ A;  2V6O A;  2HSY A;  4PUR A;  5DJM A;  3FRC A;  5CP1 A;  4V2N A;  4ECJ A;  1VF3 A;  1V57 A;  3VPT A;  2JU5 A;  4K0N A;  1GUL A;  1BG5 A;  4ULX A;  2C0D A;  2IMF A;  2LRC A;  1JLW A;  4L0W A;  4POL A;  1SD9 A;  4BWS A;  3ZFB A;  3WGD A;  2PN8 A;  5IO0 A;  4TR1 B;  2VD0 A;  19GS A;  1ZMA A;  5J41 A;  3KGK A;  5D9V A;  4KSM A;  3ZZX A;  1TRS A;  2KP2 A;  4JE1 A;  4GLT A;  4XIH A;  1EWX A;  3VWW A;  1FHE A;  5CRG A;  1OE8 A;  5AN1 A;  4GWR A;  4O32 A;  3EVI A;  3U6V A;  1T4Y A;  4MF7 A;  4GQC A;  17GS A;  2AUV A;  2MZC A;  3L9S A;  4DSR A;  6GST A;  2A2R A;  1RW1 A;  1M2B A;  1V2A A;  1FVJ A;  3EU4 A;  1YF0 A;  3WT1 A;  5A4W A;  1M9A A;  1EEM A;  4NHW A;  2X8H A;  2H01 A;  5J4U A;  1AQW A;  1AW9 A;  1ZGN A;  1IYH A;  2OE3 A;  2L57 A;  1GH2 A;  1XVQ A;  3S9F A;  4KE3 A;  4K7N A;  4YQM A;  1J9B A;  4DSQ A;  1JFU A;  4POB A;  4ZXG A;  2ES7 A;  1GNE A;  4FYU A;  3APO A;  4LA1 A;  2GLR A;  3GL5 A;  3CSH A;  4CW9 A;  2YWO A;  2C0F A;  4EDZ A;  2WFC A;  3KH9 A;  4PQH A;  4OFM A;  6GSX A;  2ZCT A;  4PXO A;  2N5F A;  4Q5Q A;  2EIO A;  1EZK A;  4HJM A;  4ML6 A;  4TXV A;  3P90 A;  1YKA A;  3KM6 A;  2YWM A;  4CDO A;  4ZIJ A;  1F3A A;  2RUE A;  4HOJ A;  2AB6 A;  3DIE A;  3I6A A;  3HD5 A;  3A5W A;  3P8W A;  2IME A;  2PUK C;  5DCG A;  2R3X A;  2X99 A;  1Z7P A;  1TXX A;  1FO5 A;  1ERU A;  1GL8 A;  2YNX A;  2IMD A;  2DBC A;  4K6X A;  4EL1 A;  5CAX A;  1T8E B;  3G7J A;  2TRC P;  3GKK A;  5ELA A;  1TK8 B;  1A24 A;  2GQK A;  4GXZ A;  1V58 A;  5D9W A;  5IQY A;  3FR3 A;  1GTA A;  2FWE A;  1K0B A;  1TJD A;  2H0G A;  2VCV A;  5JWO B;  5DAK B;  2FA8 A;  3M3M A;  1K0N A;  2IWT A;  1OKD A;  3GHA A;  3LGC A;  3D5J A;  5F0G A;  5D9T A;  3F3R A;  2TRX A;  5GAP D;  3GKX A;  3CXG A;  3DVX A;  1PL1 A;  3RHB A;  3JCM L;  3MDK A;  4WBR D;  3TKS A;  3C73 A;  3EMP A;  1RQM A;  1FOV A;  2FWH A;  4QL7 A;  5F8B A;  1G7O A;  2YZU A;  3A3T A;  4ID0 A;  4PNG A;  2WGR A;  1AC1 A;  1W89 A;  3LYP A;  2DC5 A;  2DJ3 A;  3FY7 A;  2VIM A;  3D4T A;  2VLT A;  1U87 A;  4K8M A;  4KDY A;  2BTO T;  3D22 A;  3E9J B;  3I69 A;  3KCM A;  3WD6 A;  2HSH A;  1K0O A;  1Y25 A;  1I5G A;  3LXZ A;  1ZL9 A;  2XBI A;  4V2L A;  2X8G A;  1AQX A;  18GS A;  1GWC A;  2H0H A;  4KW6 A;  2FWF A;  2WB9 A;  4TR1 A;  5ECK B;  4GTU A;  2LQO A;  1V40 A;  1ERW A;  4I2U A;  5IMC A;  1BJX A;  3C1S A;  4L5O A;  3G7Y A;  4K7I A;  2JL4 A;  5ECM B;  1PSQ A;  3VUR A;  3QPM A;  2JSZ A;  1H4O A;  1YZX A;  2K18 A;  4PUF C;  3GFK A;  3QFA C;  5IIZ A;  2C80 A;  3VI7 A;  1Z3E A;  5C04 A;  5IMZ A;  3QCP A;  4XCS A;  1YY7 A;  3KMN A;  5CRW A;  3DEX A;  1F9M A;  1YDK A;  3DXB A;  2ZNM A;  2LS5 A;  3ZMK A;  2LST A;  1K3Y A;  1O8X A;  1Z9H A;  5F05 A;  1JZD A;  3EUR A;  2L59 A;  1SYX A;  2MBT A;  3FR6 A;  3UVH A;  3F4R A;  2YWN A;  1R5P A;  5CYY A;  2RM5 A;  4LL1 B;  3KXO A;  1AUC A;  4AF2 A;  1BAY A;  2PMT A;  3K8N A;  4YH2 A;  4F0B A;  3TRP A;  2LJA A;  4GSS A;  1ACV A;  2L5L A;  4KDU A;  2H6Z A;  3ZIV A;  4MJE A;  3GRX A;  2H73 A;  4F0C A;  22GS A;  3TRQ A;  3M1G A;  4HI7 A;  1IYI A;  3IK9 A;  3EC3 A;  1TTZ A;  1S3D A;  1WP0 A;  4F82 A;  2GST A;  3TKQ A;  3C1R A;  1XFL A;  1ABA A;  2GS3 A;  3H1N A;  3WYW A;  1R5A A;  3QAV A;  5JCU A;  3CSI A;  1WPI A;  1PKZ A;  4IJ3 A;  2R4V A;  2YP6 A;  4MP4 A;  3TRX A;  4V1A p;  2MMN A;  3GYK A;  2O7K A;  3TJK A;  5ECS A;  1R7H A;  4MPG A;  5EL8 A;  3FEU A;  4MPF A;  5DAK A;  1TP9 A;  5GSS A;  3W8J A;  3UAP A;  4TRX A;  3P7X A;  1ON4 A;  4KDX A;  1XW5 A;  1HQO A;  3ZIT A;  2H75 A;  4OD7 A;  2V6K A;  3CRT A;  3CSJ A;  3BBY A;  3UEM A;  5ENU A;  2YOI A;  4G19 A;  2X64 A;  3W8S A;  4N0V A;  4QQ7 A;  2KOK A;  3IAS 2;  1EV9 A;  2YCD A;  1SK2 A;  3J7Y b;  5H5R A;  2H1A A;  1A8Y A;  3ZYW A;  4DVC A;  1UVZ A;  2VM1 A;  3RPN A;  2YN1 A;  2H19 A;  4EKZ A;  3D6I A;  2YV7 A;  5J5N A;  1GSY A;  3ERG A;  4KH7 A;  4WBJ A;  3FR9 A;  3WGX A;  4OCF A;  1U6T A;  2C0E A;  4MF6 A;  3PH9 A;  2HYX A;  1W4V A;  3EIN A;  1WE0 A;  3KMO A;  1B48 A;  1GSE A;  2M72 A;  4HQS A;  2VLV A;  1OC9 B;  2EIR A;  2GSQ A;  2NVL A;  4N11 A;  2RII A;  2Z9S A;  4HZ2 A;  1F6M C;  1J08 A;  2HLS A;  4EE0 A;  4BA7 A;  1OC8 A;  4KX4 A;  2WZ9 A;  4FIW A;  1ST9 A;  1NW2 A;  3ME7 A;  2VD1 A;  2VL3 A;  1R26 A;  3FK8 A;  3VPQ A;  2YPM A;  4XRD A;  4MZC A;  4YQV A;  1ZCP A;  2PWJ A;  1SD8 A;  2E7P A;  1XZO A;  2IFQ B;  3VLN A;  2LV3 A;  1DSB A;  5D8I A;  2XHF A;  2LRT A;  1U3A A;  4KSO A;  4AJ6 A;  5ECO B;  2PPT A;  3CTG A;  2ZUP A;  4PQ1 A;  1TDI A;  2P31 A;  4MZB A;  1ZYE A;  2AYT A;  4IW9 A;  1TOF A;  4WKW A;  4KUN A;  5B6M A;  2L6D A;  3LEF A;  2H30 A;  1TI3 A;  1TRU A;  1QMV A;  3D0Z A;  1X9M B;  4E8E A;  5ECN B;  3HYP A;  3VWU A;  1XWB A;  1T3B A;  1M2D A;  4ECC A;  3WGE A;  3HA9 A;  3KJY A;  1KBN A;  3HVV A;  1X9S B;  4ECB A;  1R4W A;  5ECP B;  2D2Z A;  5FT3 A;  4ZIL A;  1SYR A;  2LUS A;  1QXH A;  1TKD B;  1WJK A;  13GS A;  1WRY A;  2PVO C;  2VCT A;  3E3E A;  2J23 A;  1GRX A;  2XPE A;  3GIX A;  1LBK A;  1XPV A;  4LMW A;  3M9K A;  4J56 E;  3FZ9 A;  1UN2 A;  4L8E A;  1A8L A;  2CZ3 A;  3TJF A;  5G5F A;  6GSV A;  1GP1 A;  3R2Q A;  2HRN A;  3EWL A;  4O5R A;  2CV4 A;  2L4C A;  3V1W A;  2M80 A;  1Z7R A;  3TKS E;  4ML1 A;  4PQI A;  1PX6 A;  4I6X A;  3VWX A;  4I2T A;  3IV4 A;  3F0I A;  1XOB A;  4TVE A;  4X43 A;  2AJQ B;  1PL2 A;  5ECH B;  4ECI A;  1PD2 1;  1OE7 A;  2B7K A;  4RI6 A;  5CRE A;  2R5G A;  1B9X C;  2CT6 A;  4RQX A;  2B6M A;  4XS4 B;  2CAI A;  1XCC A;  4IN0 A;  2DJJ A;  1GUK A;  3DD3 A;  2XBQ A;  3TJB A;  4L0U A;  4N10 A;  4JRR A;  1AIU A;  5B6N A;  1HNB A;  4IP6 A;  1THX A;  2HRF A;  4DSS B;  2WS2 A;  3MSZ A;  3N5O A;  2I1U A;  3A2X A;  4KB3 A;  3GST A;  3HDC A;  3TJJ A;  3CRU A;  2H8L A;  4X1U A;  1V98 A;  4PX1 A;  2F51 A;  3HXS A;  2YAN A;  1MEK A;  1MTC A;  1EOG A;  3FKF A;  2GSS A;  4KGI A;  3LG6 A;  4F03 A;  2H6Y A;  4IS0 A;  1K0M A;  3FHK A;  1E6B A;  4JED A;  8GSS A;  4F2I A;  3HZ8 A;  2RUF A;  3NOF A;  1JHB A;  2XPD A;  1GLP A;  1UC7 A;  6GSS A;  2GT6 A;  3IAM 2;  2O8V B;  3BOA A;  3MNG A;  2VCQ A;  1PN9 A;  3TJG A;  3EE2 A;  4WR5 A;  1TI1 A;  4EF0 A;  1Q98 A;  5J9B A;  3CTF A;  1BX9 A;  3RBT A;  5KN2 A;  1URM A;  5IMF A;  3I43 A;  1A2L A;  1CQH A;  4OO5 A;  4MCU A;  3Q6O A;  5D93 A;  5J3R A;  1HNA A;  1WWJ A;  5A4U A;  4MZW A;  5FHI A;  4FO5 A;  3BJ5 A;  2YJH A;  4TR3 A;  1XIY A;  2CX4 A;  1BYE A;  2FCH A;  2FWG A;  2GQL A;  3FZ5 A;  2H74 A;  3FZA A;  2H0I A;  2F9S A;  5DAL A;  1TK5 B;  3FYG A;  1FVK A;  4ZBA A;  3ZIJ A;  4WF5 A;  1F3B A;  2AV4 A;  3UAR A;  1EEJ A;  4ZL8 A;  2C0G A;  5DJL A;  1YQ1 A;  1MDI A;  2PU9 C;  2HZE B;  5HQP A;  1JZW A;  1YEX A;  5EY6 A;  3NZN A;  1O85 A;  1XOA A;  1M99 A;  1T00 A;  3GTU B;  4EDY A;  4Z7X A;  3APQ A;  3HVX A;  1PX7 A;  4FYB A;  1K3L A;  4TR4 A;  5ELG A;  1NM3 A;  2JZR A;  4NXI A;  3QMX A;  2ON5 A;  5AIV A;  2OAC A;  3UJ1 A;  2GQM A;  4HU7 A;  3L78 A;  4JBB A;  3UOM A;  5D9X A;  5IM9 A;  4IHU A;  3UBK A;  3CYN A;  2B1K A;  4HJ2 A;  5ECR B;  3IC4 A;  2ALB A;  2GGT A;  5DCH A;  2FLS A;  4IGJ A;  4GST A;  2A4V A;  3M9J A;  4BWQ A;  2GVP A;  2YV9 A;  2WCI A;  2FA4 A;  4RUV A;  1G7E A;  4IJI A;  3L9V A;  1WOU A;  5JWQ B;  3MAK A;  1A0R P;  2H6X A;  3IRA A;  4Q5N A;  1DE1 A;  3GN3 A;  3L9U A;  3BCI A;  4ZB9 A;  4XHM A;  1ML6 A;  5EVO A;  3F3Q A;  2PBJ A;  2DJ2 A;  3ZRD A;  2YJ7 A;  3LXT A;  3NIV A;  1JZR A;  3F63 A;  5GZZ B;  4J2F A;  2LEG A;  2P5Q A;  4YQU A;  5JWR B;  3QDN A;  4HEA 2;  4BPY A;  1K0A A;  1M0U A;  5HR0 A;  1YJ6 A;  4IKH A;  2J9H A;  5COH A;  4XS4 A;  4BVX A;  2QSI A;  2H66 A;  1PRX A;  2IPA A;  1KEB A;  4QL9 A;  2O85 A;  2QKE A;  4YAP A;  1O73 A;  5D96 A;  4JR4 A;  5JCW A;  2BJX A;  2GZY A;  2VCZ A;  3TDG A;  3F8U A;  2F8A A;  3QFB C;  4PNF A;  5GAN D;  4DSS A;  1VF2 A;  1B4P A;  1Y6E A;  3VI5 A;  1JZO A;  2LKU A;  3HCZ A;  3CMI A;  6GSU A;  3BD2 A;  5H5S A;  1XXU A;  2B3S A;  2V1M A;  3QAG A;  1S3A A;  2R2J A;  5KN3 A;  1YEP A;  2TIR A;  5B8A A;  5IPH A;  5FWG A;  1DUG A;  2C3Q A;  4OWY A;  1I9D A;  3LWA A;  4PUA A;  4MLY A;  1MD3 A;  3GUR A;  2F3M A;  3PGT A;  9GSS A;  1VGL A;  2IIY A;  4EVM A;  1SKW B;  5ECL B;  1XW9 A;  2M46 A;  3F6D A;  3IK7 A;  3ZVJ A;  1XWA A;  4LMV A;  1SK0 A;  16GS A;  4RQR A;  3TKR A;  3UMA A;  2FGX A;  2C8U A;  1S3C A;  2O87 A;  2E0Q A;  2HZF A;  3ZL5 A;  1X5D A;  2RM6 A;  1O81 A;  1QGV A;  1KNG A;  4TKY A;  2B5E A;  3ZLP A;  1TK0 B;  3SBC A;  4KCE A;  4ZB8 A;  2VOC A;  2G2Q A;  5IOW A;  3IDV A;  4K9Z A;  2MMA A;  1A0F A;  2KUC A;  2DLX A;  2EIQ A;  5B8B A;  3PIN A;  2CAQ A;  4POM A;  2WDU A;  2I3Y A;  4KA0 A;  2VLU A;  5CO3 A;  3US3 A;  5A5K A;  2K6V A;  1C72 A;  2NBS A;  2OJL A;  2PVQ A;  4K1F A;  3L4N A;  4GQF A;  2IMK A;  2F8F A;  1XW6 A;  3TOT A;  3DVW A;  4E8H A;  2YZH A;  2IL3 A;  2YWI A;  1QFN A;  4MH3 A;  5DVB A;  3J7Y k;  2L5O A;  4MK3 A;  4FYC A;  1GSD A;  2DMM A;  5AGY A;  4NWY A;  1FB6 A;  5HFI A;  3G7I A;  1GUH A;  2IN3 A;  4MH2 A;  5B7C A;  1VF1 A;  3ED3 A;  1HNC A;  1JLV A;  4NAX A;  2HNL A;  5IPG A;  4YAV A;  3UBL A;  1ZOF A;  1Q4J A;  4MJC A;  1M2A A;  1EGO A;  1E2Y A;  1AXD A;  4Q5F A;  1TU7 A;  3QOU A;  2B7J A;  5A4V A;  1O8W A;  1EOH A;  2VUP A;  2GSR A;  2ON7 A;  5CRH A;  1LJR A;  4MA9 A;  1B4Q A;  1TRV A;  4GRF A;  1EP7 A;  4K2D A;  4V2M A;  4TXO B;  3EMX A;  5KN1 A;  3HY2 A;  4LLR A;  3IPZ A;  1M7T A;  4EUY A;  2BMX A;  3KH7 A;  1TU8 A;  1N8J A;  2C3N A;  4TW5 A;  3OR5 A;  1Z5Y E;  2CZ2 A;  3KEB A;  1A2J A;  2OAD A;  2H76 A;  3TOU A;  4XTS A;  5IMV A;  4POK A;  1A23 A;  3A2W A;  1XWC A;  2HFD A;  3F6F A;  2IMI A;  2H71 A;  4G9H A;  3GKN A;  1O6J A;  4ACS A;  1TRW A;  3DML A;  1SL1 B;  1HD2 A;  2V41 A;  1XBS A;  1HYU A;  2CVK A;  4MDC A;  3GMF A;  2V32 A;  3UVT A;  1SL0 B;  5LD0 A;  2N5B A;  2LNT A;  3GL3 A;  4ILF A;  4XRA A;  2NDO A;  1VRS D;  1ERT A;  1PQN A;  3LJR A;  1OKT A;  2LRN A;  3P2A A;  3D4M A;  1U3I A;  3M0F A;  1H75 A;  5AIS A;  3RPP A;  3TGZ A;  1K3O A;  2VL2 C;  3GH9 A;  4ZB6 A;  4NMU A;  5G5E A;  2MBS A;  1EGR A;  4OFN A;  2OBK A;  5ID2 B;  3M8N A;  5D73 A;  1GSU A;  4LL4 B;  5E59 A;  2B5X A;  1CQG A;  2LJK A;  4NHZ A;  4TN8 A;  2L4Q A;  3TCO A;  1SL2 B;  2FY6 A;  4IEL A;  3EYT A; 
#chains in the Genus database with same CATH topology
 3DRN A;  3LOR A;  2VL9 A;  2OKA A;  4MJA A;  1GTB A;  2CVD A;  1GTI A;  5JCG A;  4BVY B;  1OC3 A;  3DWV A;  3HZ4 A;  3N9J A;  1FG4 A;  4BL7 B;  1MDJ A;  5DDL A;  5G1L A;  3ZRE A;  3ERF A;  3IC8 A;  2JAD A;  2G0F A;  2MMO A;  4NV2 A;  5HR2 A;  2HI7 A;  3PR8 A;  1KTE A;  1UA5 A;  1BED A;  3H4K A;  3IE3 A;  3RDW A;  7GSS A;  4HUA A;  2P0G A;  1ERV A;  4JZQ A;  4WF4 A;  5CNW A;  2GDR A;  4AJ7 A;  4K0G A;  2OA7 A;  1GLQ A;  2LJR A;  4Q5R A;  3EU3 A;  2O89 A;  2HE3 A;  2DJ1 A;  3IHQ A;  4KCA A;  4XS6 A;  1MD4 A;  5EPF A;  4DEJ A;  5KEJ A;  3RHC A;  3HJO A;  1A2M A;  2DJ0 A;  4N0Z A;  1DE2 A;  1XWK A;  4EXJ A;  1K0D A;  2H1G A;  1QQ2 A;  1OC9 A;  2RLI A;  3C7M A;  3CBU A;  1M3I A;  2FUG 2;  2VCX A;  3ZFL A;  2VAF A;  2OBI A;  3GX0 A;  4I5Q A;  2QA2 A;  1ZZY A;  3KZQ A;  2FD3 A;  1XWG A;  1TW9 A;  1ILO A;  3HJP A;  4G0K A;  3LSZ A;  4TXO A;  4ZL9 A;  2VO4 A;  4IVF A;  1WIK A;  2I4A A;  5DBQ A;  11GS A;  3TUE A;  3LYK A;  4OMV A;  5HR3 A;  1V9W A;  4KAE A;  6GSY A;  5E4W A;  2C3T A;  4WEY A;  1NHO A;  2IFQ A;  4MF5 A;  4NV5 A;  5J9C A;  4ZBB A;  5HFG A;  5H5Q A;  5CRD A;  1GTU A;  4RI7 A;  3UL3 A;  5DQS A;  4MJB A;  2OE1 A;  3KTB A;  1SU9 A;  1J0F A;  10GS A;  2FHE A;  2H70 A;  4FH8 A;  3ZTL A;  1F37 A;  3LFL A;  4WET A;  1QK8 A;  3O3T A;  3GV1 A;  2JAC A;  3KTL A;  1SEN A;  5IO2 A;  3VFI A;  3Q74 A;  2QGV A;  2HXK A;  2NTO A;  1MDK A;  4OCE A;  3F4S A;  4OFT A;  4F9Z A;  2HT9 A;  2K8S A;  1THO A;  4HDE A;  2K8V A;  2CA8 A;  3APS A;  1U88 A;  4MAB A;  5L71 A;  2GT5 A;  2H72 A;  3GNJ A;  3C8E A;  4O7H A;  4HS1 A;  4IP1 A;  5DQY A;  1WMJ A;  5G31 A;  1X5E A;  5G30 A;  5IMD A;  3BCK A;  4G10 A;  14GS A;  2DSA A;  1QUW A;  2REM A;  1T7P B;  4WR4 A;  2P5R A;  4IQA A;  1T1V A;  3ERW A;  5G1K A;  3FW2 A;  2CX3 A;  4AGS A;  2LNS A;  3QD9 A;  3KD0 A;  1FW1 A;  2B1L A;  1EP8 A;  2OE0 A;  5KN0 A;  2FNO A;  1SK1 A;  1BQ7 A;  4H86 A;  5ID2 A;  3HJM A;  1GSF A;  4L5L A;  2I9H A;  5HR1 A;  2JSY A;  3H79 A;  3TKP A;  4D73 B;  2H1D A;  2EC4 A;  3U5R E;  3O76 A;  3VK9 A;  1LU4 A;  3GUS A;  3KP8 A;  3MYD A;  5GST A;  2JZS A;  2DML A;  4EC0 A;  1B8X A;  2KHP A;  4JR6 A;  3UIW A;  4MMM A;  2DIY A;  5F06 A;  4ZL7 A;  5ABR A;  1GSQ A;  3HKR A;  2QA1 A;  4BVY A;  1X0R A;  2CQ9 A;  3KIJ A;  3HVS A;  4XS1 A;  1S3R A;  4AJ8 A;  1EV4 A;  1SKS B;  4K7O A;  4BL7 A;  1K0C A;  4JU5 A;  1XVW A;  4IBP A;  5KOX A;  5F07 A;  5AIX A;  4ICY A;  1SJ6 A;  3AY8 A;  2XC2 A;  1GSS A;  2DIZ A;  3R3E A;  2VL2 A;  2PER A;  1VF4 A;  2IJY A;  3SWL A;  2QC7 A;  3GSS A;  5IOX A;  1OAZ A;  5ECQ B;  2LTK A;  4Z2R A;  2CVB A;  1Z6M A;  3IR4 A;  3CQF A;  3O6T A;  3FMW A;  3LQ7 A;  3I9V 2;  5IMA A;  4I8B A;  3DKS A;  1PGT A;  3IBH A;  3DGQ A;  2MYG A;  4OO4 A;  1PKW A;  4O92 A;  1USB A;  3IOS A;  3HHV A;  1X9W B;  4GCI A;  2VCW A;  4TOP A;  6GSW A;  2L6C A;  2WUL A;  1X5C A;  3FZ4 A;  4N30 A;  1AQV A;  1YF1 A;  3MWH A;  1GNW A;  2A2S A;  4P3Y B;  5LCZ A;  1G6Y A;  1OYJ A;  1PFO A;  2DKH A;  2N5A A;  1ZYN A;  3D21 A;  1SKR B;  1AAZ A;  1O7U A;  4G2E A;  3Q19 A;  1PMT A;  1T4Z A;  3IA1 A;  2JZT A;  3L0H A;  2VM2 A;  3H93 A;  2R6K A;  4A5P A;  4WXT A;  1YKC A;  2AAW A;  4GF0 A;  2C1Y A;  1M9B A;  5INY A;  2KP1 A;  4HU9 A;  1RK4 A;  20GS A;  3QR6 A;  3GH6 A;  4HQZ A;  4NPB A;  3ISO A;  3ZML A;  2H1B A;  2GZZ A;  1DBY A;  1PA3 A;  3W6G A;  3TB2 A;  2B5Y A;  5HFK A;  4HZ4 A;  1GUM A;  1SJI A;  1B9Y C;  3TKS C;  3IHG A;  4J57 E;  3GX8 A;  5ECI B;  1G0T A;  2WJU A;  4KND A;  3GKM A;  1F2E A;  3VWV A;  2AHE A;  2HZE A;  1NSW A;  2NPB A;  3F4T A;  4ZBD A;  4ISD A;  5G2Z A;  3DYR A;  5LNK e;  3ZVJ D;  3GTU A;  3Q18 A;  4GSN A;  1G6W A;  2PGT A;  1Z6N A;  1FAA A;  2K9F A;  4YKG A;  2DJK A;  4CHS A;  3WT2 A;  4IQ1 A;  4EO3 A;  3A2V A;  3IXR A;  2LQQ A;  4MNN A;  4X0X A;  4TR0 A;  2WRT A;  4PGT A;  3C71 A;  1NHY A;  2UZ8 A;  2GZP A;  3KP9 A;  3G9B A;  4G0I A;  1FB0 A;  2I81 A;  3ME8 A;  2X8C A;  2MMZ A;  3GA4 A;  2C4J A;  5C00 A;  3QAW A;  2R37 A;  2V2G A;  3H8Q A;  5DAL B;  1ZYQ B;  4I97 A;  3E0U A;  4PTS A;  2GTU A;  3RAZ A;  2E2M A;  1N2A A;  1PN0 A;  12GS A;  4D73 A;  2KLX A;  4G0L A;  2E2G A;  1OVN A;  4V1A g;  3F9U A;  1SJZ A;  2V6O A;  2HSY A;  4PUR A;  5DJM A;  3FRC A;  5CP1 A;  4V2N A;  4ECJ A;  1VF3 A;  1V57 A;  3VPT A;  2JU5 A;  4K0N A;  1GUL A;  1BG5 A;  4ULX A;  2C0D A;  2IMF A;  2LRC A;  1JLW A;  3A5I A;  4L0W A;  4POL A;  1SD9 A;  4BWS A;  3ZFB A;  3WGD A;  2PN8 A;  5IO0 A;  4TR1 B;  2VD0 A;  19GS A;  1ZMA A;  5J41 A;  3KGK A;  5D9V A;  4KSM A;  3ZZX A;  1TRS A;  2KP2 A;  4JE1 A;  4GLT A;  4XIH A;  1EWX A;  3VWW A;  1FHE A;  5CRG A;  1OE8 A;  5AN1 A;  4GWR A;  4O32 A;  3EVI A;  3U6V A;  1T4Y A;  4MF7 A;  4GQC A;  17GS A;  2AUV A;  2MZC A;  4HSC X;  3L9S A;  4DSR A;  4KF9 A;  6GST A;  2A2R A;  1RW1 A;  1M2B A;  1V2A A;  1FVJ A;  3EU4 A;  1YF0 A;  3WT1 A;  5A4W A;  1M9A A;  1EEM A;  4NHW A;  2X8H A;  2H01 A;  5J4U A;  1AQW A;  1AW9 A;  1ZGN A;  1IYH A;  2OE3 A;  2L57 A;  1GH2 A;  1XVQ A;  3S9F A;  4KE3 A;  4K7N A;  4YQM A;  1J9B A;  4DSQ A;  1JFU A;  4POB A;  4ZXG A;  2ES7 A;  1GNE A;  4FYU A;  3APO A;  4LA1 A;  2GLR A;  3GL5 A;  3CSH A;  4CW9 A;  2YWO A;  2C0F A;  4EDZ A;  2WFC A;  3KH9 A;  4PQH A;  4OFM A;  6GSX A;  2ZCT A;  4PXO A;  2N5F A;  4Q5Q A;  2EIO A;  1EZK A;  4HJM A;  4ML6 A;  4TXV A;  3P90 A;  1YKA A;  3KM6 A;  2YWM A;  4CDO A;  4ZIJ A;  1F3A A;  2RUE A;  4HOJ A;  2AB6 A;  3DIE A;  3I6A A;  3HD5 A;  3A5W A;  3P8W A;  1XG8 A;  2IME A;  2PUK C;  5DCG A;  2R3X A;  2X99 A;  1Z7P A;  1TXX A;  1FO5 A;  1ERU A;  1GL8 A;  2YNX A;  2IMD A;  2DBC A;  4K6X A;  4EL1 A;  5CAX A;  1T8E B;  3G7J A;  2TRC P;  3GKK A;  5ELA A;  1TK8 B;  1A24 A;  2GQK A;  4GXZ A;  1V58 A;  5D9W A;  5IQY A;  3FR3 A;  1GTA A;  2FWE A;  1K0B A;  1TJD A;  2H0G A;  2VCV A;  5JWO B;  2X4A A;  5DAK B;  2FA8 A;  3M3M A;  1ZYP A;  1K0N A;  2IWT A;  1OKD A;  3GHA A;  3LGC A;  3D5J A;  5F0G A;  5D9T A;  3F3R A;  2TRX A;  5GAP D;  3GKX A;  3CXG A;  3DVX A;  1PL1 A;  3RHB A;  3JCM L;  3MDK A;  4WBR D;  3TKS A;  3C73 A;  3EMP A;  1RQM A;  1FOV A;  2FWH A;  4QL7 A;  5F8B A;  1G7O A;  2YZU A;  3A3T A;  4ID0 A;  4PNG A;  2WGR A;  1AC1 A;  1W89 A;  3LYP A;  2DC5 A;  2DJ3 A;  3FY7 A;  2VIM A;  3D4T A;  2VLT A;  1U87 A;  4K8M A;  4KDY A;  2BTO T;  3D22 A;  3E9J B;  3I69 A;  3KCM A;  3WD6 A;  2HSH A;  1K0O A;  1Y25 A;  1I5G A;  3LXZ A;  1ZL9 A;  2XBI A;  4V2L A;  2X8G A;  1AQX A;  18GS A;  1GWC A;  2H0H A;  4K2X A;  4KW6 A;  2FWF A;  2WB9 A;  4TR1 A;  5ECK B;  4GTU A;  2LQO A;  1V40 A;  1ERW A;  4I2U A;  5IMC A;  1BJX A;  3C1S A;  4L5O A;  3G7Y A;  4K7I A;  2JL4 A;  5ECM B;  1PSQ A;  3VUR A;  3QPM A;  2JSZ A;  1H4O A;  1YZX A;  2K18 A;  4PUF C;  3GFK A;  3QFA C;  5IIZ A;  2C80 A;  3VI7 A;  1Z3E A;  5C04 A;  5IMZ A;  3QCP A;  4XCS A;  1YY7 A;  3KMN A;  2A4H A;  5CRW A;  4K5R A;  3DEX A;  1F9M A;  1YDK A;  3DXB A;  2ZNM A;  2LS5 A;  3ZMK A;  2LST A;  1K3Y A;  1O8X A;  1Z9H A;  5F05 A;  1JZD A;  3EUR A;  2L59 A;  1SYX A;  2MBT A;  3FR6 A;  3UVH A;  3F4R A;  2YWN A;  1R5P A;  5CYY A;  2RM5 A;  1M3J A;  4LL1 B;  3KXO A;  1AUC A;  4AF2 A;  1BAY A;  2PMT A;  3K8N A;  4YH2 A;  4F0B A;  3TRP A;  2LJA A;  2R0P A;  4GSS A;  1ACV A;  2L5L A;  4KDU A;  2H6Z A;  3ZIV A;  4MJE A;  3GRX A;  4O5U A;  2H73 A;  4F0C A;  22GS A;  3TRQ A;  3M1G A;  4HI7 A;  1IYI A;  3IK9 A;  3EC3 A;  1TTZ A;  1S3D A;  1WP0 A;  4F82 A;  2GST A;  3TKQ A;  3C1R A;  1XFL A;  1ABA A;  2GS3 A;  3H1N A;  3WYW A;  1R5A A;  3QAV A;  5JCU A;  2HSM A;  3CSI A;  1WPI A;  4CY8 A;  1PKZ A;  4IJ3 A;  2R4V A;  2YP6 A;  4MP4 A;  3TRX A;  4V1A p;  2MMN A;  3GYK A;  2O7K A;  3TJK A;  5ECS A;  1R7H A;  4MPG A;  5EL8 A;  3FEU A;  3HVN A;  4MPF A;  5DAK A;  1TP9 A;  5GSS A;  3W8J A;  3PPU A;  3EPT A;  3UAP A;  4TRX A;  3P7X A;  1ON4 A;  4KDX A;  1XW5 A;  1HQO A;  3ZIT A;  2H75 A;  4OD7 A;  2V6K A;  3CRT A;  3CSJ A;  3BBY A;  3UEM A;  5ENU A;  2YOI A;  4G19 A;  2X64 A;  3W8S A;  4N0V A;  4QQ7 A;  2KOK A;  3IAS 2;  1EV9 A;  2YCD A;  1SK2 A;  3J7Y b;  5H5R A;  2H1A A;  1A8Y A;  3ZYW A;  4DVC A;  1UVZ A;  2VM1 A;  3RPN A;  2YN1 A;  2H19 A;  4EKZ A;  4YKF A;  3D6I A;  2YV7 A;  5J5N A;  1GSY A;  3ERG A;  4KH7 A;  4WBJ A;  3FR9 A;  3WGX A;  4OCF A;  1U6T A;  2C0E A;  4FQU A;  4EIP A;  4MF6 A;  3PH9 A;  2HYX A;  1W4V A;  3EIN A;  1WE0 A;  3KMO A;  1B48 A;  1GSE A;  2M72 A;  4HQS A;  2VLV A;  1FOH A;  1OC9 B;  2EIR A;  2GSQ A;  2NVL A;  4N11 A;  2RII A;  2Z9S A;  4HZ2 A;  1F6M C;  1J08 A;  2HLS A;  4EE0 A;  4BA7 A;  1OC8 A;  4KX4 A;  2WZ9 A;  4FIW A;  1ST9 A;  1NW2 A;  3ME7 A;  2VD1 A;  2VL3 A;  1R26 A;  3FK8 A;  3VPQ A;  2YPM A;  4XRD A;  4MZC A;  4YQV A;  1ZCP A;  2PWJ A;  1SD8 A;  2E7P A;  1XZO A;  2IFQ B;  3VLN A;  2LV3 A;  1DSB A;  5D8I A;  2XHF A;  2LRT A;  1U3A A;  4KSO A;  4AJ6 A;  5ECO B;  2PPT A;  3CTG A;  2ZUP A;  4PQ1 A;  1TDI A;  2P31 A;  4MZB A;  1ZYE A;  2AYT A;  4IW9 A;  1TOF A;  4WKW A;  4KUN A;  5B6M A;  2L6D A;  3LEF A;  2H30 A;  1TI3 A;  1TRU A;  1QMV A;  3D0Z A;  1X9M B;  4E8E A;  5ECN B;  3HYP A;  3VWU A;  1XWB A;  1T3B A;  1M2D A;  4ECC A;  3WGE A;  3HA9 A;  3KJY A;  1KBN A;  3HVV A;  1X9S B;  4ECB A;  1R4W A;  5ECP B;  2D2Z A;  5FT3 A;  4ZIL A;  1SYR A;  2LUS A;  1QXH A;  1TKD B;  1WJK A;  13GS A;  1WRY A;  2PVO C;  2VCT A;  3E3E A;  2J23 A;  1GRX A;  2XPE A;  3GIX A;  1LBK A;  1XPV A;  4LMW A;  3M9K A;  4J56 E;  3FZ9 A;  1UN2 A;  4L8E A;  1A8L A;  4X4J A;  2CZ3 A;  3TJF A;  5G5F A;  4K5S A;  6GSV A;  1GP1 A;  3R2Q A;  2HRN A;  3EWL A;  4O5R A;  2CV4 A;  2L4C A;  3V1W A;  2M80 A;  1Z7R A;  3TKS E;  4ML1 A;  4PQI A;  1PX6 A;  4I6X A;  3VWX A;  4I2T A;  3IV4 A;  3F0I A;  2R0C A;  1XOB A;  4TVE A;  4X43 A;  2AJQ B;  1PL2 A;  5ECH B;  4ECI A;  1PD2 1;  1OE7 A;  2B7K A;  4RI6 A;  5CRE A;  2R5G A;  1B9X C;  2CT6 A;  4RQX A;  2B6M A;  4XS4 B;  4BVX B;  2CAI A;  1XCC A;  4IN0 A;  2DJJ A;  1GUK A;  3DD3 A;  2XBQ A;  3TJB A;  4L0U A;  4N10 A;  4JRR A;  1AIU A;  5B6N A;  1HNB A;  4IP6 A;  1THX A;  2HRF A;  4DSS B;  2WS2 A;  3MSZ A;  3N5O A;  2I1U A;  3A2X A;  4KB3 A;  3GST A;  3HDC A;  3TJJ A;  3CRU A;  2H8L A;  4X1U A;  1V98 A;  4PX1 A;  2F51 A;  3HXS A;  2YAN A;  1MEK A;  1MTC A;  1EOG A;  3FKF A;  2GSS A;  4KGI A;  3LG6 A;  4F03 A;  2H6Y A;  4IS0 A;  1K0M A;  3FHK A;  1E6B A;  4CY6 A;  4JED A;  8GSS A;  4F2I A;  3HZ8 A;  2RUF A;  3NOF A;  1JHB A;  2XPD A;  1GLP A;  1UC7 A;  6GSS A;  2GT6 A;  3IAM 2;  2O8V B;  3BOA A;  3MNG A;  2VCQ A;  1PN9 A;  3TJG A;  3EE2 A;  4WR5 A;  1TI1 A;  4EF0 A;  1Q98 A;  5J9B A;  3CTF A;  1BX9 A;  3RBT A;  5KN2 A;  4BIK A;  1URM A;  5IMF A;  2HRA A;  3I43 A;  1A2L A;  1CQH A;  4OO5 A;  4MCU A;  3Q6O A;  5D93 A;  5J3R A;  1HNA A;  1WWJ A;  5A4U A;  4MZW A;  5FHI A;  4FO5 A;  3BJ5 A;  2YJH A;  4TR3 A;  1XIY A;  2CX4 A;  1BYE A;  2FCH A;  2FWG A;  2GQL A;  3FZ5 A;  2H74 A;  3FZA A;  2H0I A;  2F9S A;  5DAL A;  1TK5 B;  3FYG A;  1FVK A;  4ZBA A;  3ZIJ A;  4WF5 A;  1F3B A;  2AV4 A;  3UAR A;  5BRT A;  1EEJ A;  4ZL8 A;  2C0G A;  5DJL A;  1YQ1 A;  1MDI A;  2PU9 C;  2HZE B;  5HQP A;  1JZW A;  1YEX A;  5EY6 A;  3NZN A;  1O85 A;  1XOA A;  1M99 A;  1T00 A;  3GTU B;  4EDY A;  4Z7X A;  3APQ A;  3HVX A;  1PX7 A;  4FYB A;  1K3L A;  4TR4 A;  5ELG A;  1NM3 A;  2JZR A;  4NXI A;  3QMX A;  2ON5 A;  5AIV A;  2OAC A;  3UJ1 A;  2GQM A;  4HU7 A;  3L78 A;  4JBB A;  3UOM A;  5D9X A;  5IM9 A;  4IHU A;  3UBK A;  3CYN A;  2B1K A;  4HJ2 A;  2A2P A;  5ECR B;  3IC4 A;  2ALB A;  2GGT A;  5DCH A;  2FLS A;  4IGJ A;  4GST A;  2A4V A;  3M9J A;  4BWQ A;  2GVP A;  2YV9 A;  2WCI A;  2FA4 A;  4RUV A;  1G7E A;  3MIX A;  4IJI A;  3L9V A;  1WOU A;  5JWQ B;  4EIQ A;  2R0G A;  3MAK A;  1A0R P;  2H6X A;  3IRA A;  2HRK A;  4Q5N A;  1DE1 A;  3GN3 A;  3L9U A;  3BCI A;  4ZB9 A;  4XHM A;  1ML6 A;  5EVO A;  3F3Q A;  2PBJ A;  3LW9 A;  2DJ2 A;  3ZRD A;  2YJ7 A;  3LXT A;  3NIV A;  1JZR A;  3F63 A;  5GZZ B;  4J2F A;  2LEG A;  2P5Q A;  4YQU A;  5JWR B;  3QDN A;  4HEA 2;  4BPY A;  2X49 A;  1K0A A;  1M0U A;  5HR0 A;  1YJ6 A;  4IKH A;  2J9H A;  5COH A;  4XS4 A;  4BVX A;  2QSI A;  2H66 A;  1PRX A;  2IPA A;  1KEB A;  4QL9 A;  2O85 A;  2QKE A;  4YAP A;  1O73 A;  5D96 A;  4JR4 A;  5JCW A;  2BJX A;  2GZY A;  2VCZ A;  3TDG A;  3F8U A;  2F8A A;  3QFB C;  4PNF A;  5GAN D;  4DSS A;  1VF2 A;  1B4P A;  1Y6E A;  3VI5 A;  1JZO A;  2LKU A;  3HCZ A;  5BMU A;  3CMI A;  6GSU A;  3BD2 A;  5H5S A;  1XXU A;  2B3S A;  2V1M A;  3QAG A;  1S3A A;  2R2J A;  5KN3 A;  1YEP A;  2TIR A;  5B8A A;  5IPH A;  5FWG A;  1DUG A;  2C3Q A;  4OWY A;  1I9D A;  3LWA A;  4PUA A;  4MLY A;  1MD3 A;  3GUR A;  2F3M A;  3PGT A;  9GSS A;  1VGL A;  2IIY A;  4EVM A;  1SKW B;  5ECL B;  1XW9 A;  2M46 A;  3F6D A;  3IK7 A;  3ZVJ A;  1XWA A;  4LMV A;  1SK0 A;  16GS A;  4RQR A;  3TKR A;  3UMA A;  2FGX A;  2C8U A;  1S3C A;  2O87 A;  2E0Q A;  2HZF A;  3ZL5 A;  1X5D A;  2RM6 A;  1O81 A;  1QGV A;  1KNG A;  4TKY A;  2B5E A;  3ZLP A;  1TK0 B;  3SBC A;  4KCE A;  4ZB8 A;  2VOC A;  2G2Q A;  5IOW A;  4USS A;  3IDV A;  4K9Z A;  2MMA A;  1A0F A;  2KUC A;  2DLX A;  2EIQ A;  5B8B A;  3PIN A;  2CAQ A;  4POM A;  2WDU A;  2I3Y A;  4KA0 A;  2VLU A;  5CO3 A;  3US3 A;  5A5K A;  2K6V A;  1C72 A;  2NBS A;  2OJL A;  2PVQ A;  4K1F A;  3L4N A;  4GQF A;  2IMK A;  2F8F A;  1XW6 A;  3TOT A;  3DVW A;  4E8H A;  2YZH A;  2IL3 A;  2YWI A;  1QFN A;  4MH3 A;  5DVB A;  3J7Y k;  2L5O A;  4MK3 A;  4FYC A;  1GSD A;  2DMM A;  5AGY A;  4NWY A;  1FB6 A;  5HFI A;  3G7I A;  1GUH A;  2IN3 A;  4MH2 A;  5B7C A;  1VF1 A;  3ED3 A;  1HNC A;  1JLV A;  4NAX A;  2HNL A;  5IPG A;  4YAV A;  3UBL A;  1ZOF A;  1Q4J A;  4MJC A;  1M2A A;  1EGO A;  1E2Y A;  1AXD A;  4Q5F A;  1TU7 A;  3QOU A;  2B7J A;  5A4V A;  1O8W A;  1EOH A;  2VUP A;  2GSR A;  4Z2U A;  2ON7 A;  5CRH A;  4Z2T A;  1LJR A;  4MA9 A;  1B4Q A;  1TRV A;  4GRF A;  1EP7 A;  4V2M A;  4K2D A;  4TXO B;  3EMX A;  5KN1 A;  3HY2 A;  4LLR A;  3IPZ A;  1M7T A;  4EUY A;  2BMX A;  3KH7 A;  1TU8 A;  1N8J A;  2C3N A;  4TW5 A;  3OR5 A;  1Z5Y E;  2CZ2 A;  3KEB A;  1A2J A;  2OAD A;  2H76 A;  3TOU A;  4XTS A;  5IMV A;  4POK A;  1A23 A;  3A2W A;  1XWC A;  2HFD A;  3F6F A;  2IMI A;  2H71 A;  4G9H A;  3GKN A;  1O6J A;  4ACS A;  1TRW A;  3DML A;  1SL1 B;  1HD2 A;  2V41 A;  1XBS A;  5KOW A;  4O5Q A;  1HYU A;  2CVK A;  4MDC A;  3GMF A;  2V32 A;  2DKI A;  3UVT A;  1SL0 B;  5LD0 A;  2N5B A;  2LNT A;  3GL3 A;  4ILF A;  4XRA A;  2NDO A;  1VRS D;  1ERT A;  1PQN A;  3LJR A;  1OKT A;  2LRN A;  3P2A A;  3D4M A;  1U3I A;  3M0F A;  1H75 A;  5AIS A;  3RPP A;  3TGZ A;  1K3O A;  2VL2 C;  3GH9 A;  4ZB6 A;  4NMU A;  5G5E A;  2MBS A;  1EGR A;  4OFN A;  2OBK A;  5ID2 B;  3M8N A;  5D73 A;  1GSU A;  4LL4 B;  5E59 A;  2B5X A;  1CQG A;  2LJK A;  4NHZ A;  4TN8 A;  2L4Q A;  3TCO A;  1SL2 B;  2FY6 A;  4IEL A;  3EYT A; 
#chains in the Genus database with same CATH homology
 3DRN A;  3LOR A;  2VL9 A;  2OKA A;  4MJA A;  1GTB A;  2CVD A;  1GTI A;  5JCG A;  4BVY B;  1OC3 A;  3DWV A;  3HZ4 A;  3N9J A;  1FG4 A;  4BL7 B;  1MDJ A;  5DDL A;  5G1L A;  3ZRE A;  3ERF A;  3IC8 A;  2JAD A;  2G0F A;  2MMO A;  4NV2 A;  5HR2 A;  2HI7 A;  3PR8 A;  1KTE A;  1UA5 A;  1BED A;  3H4K A;  3IE3 A;  3RDW A;  7GSS A;  4HUA A;  2P0G A;  1ERV A;  4JZQ A;  4WF4 A;  5CNW A;  2GDR A;  4AJ7 A;  4K0G A;  2OA7 A;  1GLQ A;  2LJR A;  4Q5R A;  3EU3 A;  2O89 A;  2HE3 A;  2DJ1 A;  3IHQ A;  4KCA A;  4XS6 A;  1MD4 A;  5EPF A;  4DEJ A;  5KEJ A;  3RHC A;  3HJO A;  1A2M A;  2DJ0 A;  4N0Z A;  1DE2 A;  1XWK A;  4EXJ A;  1K0D A;  2H1G A;  1QQ2 A;  1OC9 A;  2RLI A;  3C7M A;  3CBU A;  2FUG 2;  2VCX A;  3ZFL A;  2VAF A;  2OBI A;  3GX0 A;  4I5Q A;  2QA2 A;  1ZZY A;  3KZQ A;  2FD3 A;  1XWG A;  1TW9 A;  1ILO A;  3HJP A;  4G0K A;  3LSZ A;  4TXO A;  4ZL9 A;  2VO4 A;  4IVF A;  1WIK A;  2I4A A;  5DBQ A;  11GS A;  3TUE A;  3LYK A;  4OMV A;  5HR3 A;  1V9W A;  4KAE A;  6GSY A;  5E4W A;  2C3T A;  4WEY A;  1NHO A;  2IFQ A;  4MF5 A;  4NV5 A;  5J9C A;  4ZBB A;  5HFG A;  5H5Q A;  5CRD A;  1GTU A;  4RI7 A;  3UL3 A;  5DQS A;  4MJB A;  2OE1 A;  3KTB A;  1SU9 A;  1J0F A;  10GS A;  2FHE A;  2H70 A;  4FH8 A;  3ZTL A;  1F37 A;  3LFL A;  4WET A;  1QK8 A;  3O3T A;  3GV1 A;  2JAC A;  3KTL A;  1SEN A;  5IO2 A;  3VFI A;  3Q74 A;  2QGV A;  2HXK A;  2NTO A;  1MDK A;  4OCE A;  3F4S A;  4OFT A;  4F9Z A;  2HT9 A;  2K8S A;  1THO A;  4HDE A;  2K8V A;  2CA8 A;  3APS A;  1U88 A;  4MAB A;  5L71 A;  2GT5 A;  2H72 A;  3GNJ A;  3C8E A;  4O7H A;  4HS1 A;  4IP1 A;  5DQY A;  1WMJ A;  5G31 A;  1X5E A;  5G30 A;  5IMD A;  3BCK A;  4G10 A;  14GS A;  2DSA A;  1QUW A;  2REM A;  1T7P B;  4WR4 A;  2P5R A;  4IQA A;  1T1V A;  3ERW A;  5G1K A;  3FW2 A;  2CX3 A;  4AGS A;  2LNS A;  3QD9 A;  3KD0 A;  1FW1 A;  2B1L A;  1EP8 A;  2OE0 A;  5KN0 A;  2FNO A;  1SK1 A;  1BQ7 A;  4H86 A;  5ID2 A;  3HJM A;  1GSF A;  4L5L A;  2I9H A;  5HR1 A;  2JSY A;  3H79 A;  3TKP A;  4D73 B;  2H1D A;  2EC4 A;  3U5R E;  3O76 A;  3VK9 A;  1LU4 A;  3GUS A;  3KP8 A;  3MYD A;  5GST A;  2JZS A;  2DML A;  4EC0 A;  1B8X A;  2KHP A;  4JR6 A;  3UIW A;  4MMM A;  2DIY A;  5F06 A;  4ZL7 A;  5ABR A;  1GSQ A;  3HKR A;  2QA1 A;  4BVY A;  1X0R A;  2CQ9 A;  3KIJ A;  3HVS A;  4XS1 A;  4AJ8 A;  1EV4 A;  1SKS B;  4K7O A;  4BL7 A;  1K0C A;  4JU5 A;  1XVW A;  4IBP A;  5KOX A;  5F07 A;  5AIX A;  4ICY A;  1SJ6 A;  3AY8 A;  2XC2 A;  1GSS A;  2DIZ A;  3R3E A;  2VL2 A;  2PER A;  1VF4 A;  2IJY A;  3SWL A;  2QC7 A;  3GSS A;  5IOX A;  1OAZ A;  5ECQ B;  2LTK A;  4Z2R A;  2CVB A;  1Z6M A;  3IR4 A;  3O6T A;  3FMW A;  3LQ7 A;  3I9V 2;  5IMA A;  4I8B A;  3DKS A;  1PGT A;  3IBH A;  3DGQ A;  2MYG A;  4OO4 A;  1PKW A;  4O92 A;  1USB A;  3IOS A;  3HHV A;  1X9W B;  4GCI A;  2VCW A;  4TOP A;  6GSW A;  2L6C A;  2WUL A;  1X5C A;  3FZ4 A;  4N30 A;  1AQV A;  1YF1 A;  3MWH A;  1GNW A;  2A2S A;  4P3Y B;  5LCZ A;  1G6Y A;  1OYJ A;  2DKH A;  2N5A A;  1ZYN A;  3D21 A;  1SKR B;  1AAZ A;  1O7U A;  4G2E A;  3Q19 A;  1PMT A;  1T4Z A;  3IA1 A;  2JZT A;  3L0H A;  2VM2 A;  3H93 A;  2R6K A;  4A5P A;  4WXT A;  1YKC A;  2AAW A;  4GF0 A;  2C1Y A;  1M9B A;  5INY A;  2KP1 A;  4HU9 A;  1RK4 A;  20GS A;  3QR6 A;  3GH6 A;  4HQZ A;  4NPB A;  3ISO A;  3ZML A;  2H1B A;  2GZZ A;  1DBY A;  1PA3 A;  3W6G A;  3TB2 A;  2B5Y A;  5HFK A;  4HZ4 A;  1GUM A;  1SJI A;  1B9Y C;  3TKS C;  3IHG A;  4J57 E;  3GX8 A;  5ECI B;  1G0T A;  2WJU A;  4KND A;  3GKM A;  1F2E A;  3VWV A;  2AHE A;  2HZE A;  1NSW A;  2NPB A;  3F4T A;  4ZBD A;  4ISD A;  5G2Z A;  3DYR A;  5LNK e;  3ZVJ D;  3GTU A;  3Q18 A;  4GSN A;  1G6W A;  2PGT A;  1Z6N A;  1FAA A;  2K9F A;  4YKG A;  2DJK A;  4CHS A;  3WT2 A;  4IQ1 A;  4EO3 A;  3A2V A;  3IXR A;  2LQQ A;  4MNN A;  4X0X A;  4TR0 A;  2WRT A;  4PGT A;  3C71 A;  1NHY A;  2UZ8 A;  2GZP A;  3KP9 A;  3G9B A;  4G0I A;  1FB0 A;  2I81 A;  3ME8 A;  2X8C A;  2MMZ A;  3GA4 A;  2C4J A;  5C00 A;  3QAW A;  2R37 A;  2V2G A;  3H8Q A;  5DAL B;  1ZYQ B;  4I97 A;  3E0U A;  4PTS A;  2GTU A;  3RAZ A;  2E2M A;  1N2A A;  1PN0 A;  12GS A;  4D73 A;  2KLX A;  4G0L A;  2E2G A;  1OVN A;  4V1A g;  3F9U A;  1SJZ A;  2V6O A;  2HSY A;  4PUR A;  5DJM A;  3FRC A;  5CP1 A;  4V2N A;  4ECJ A;  1VF3 A;  1V57 A;  3VPT A;  2JU5 A;  4K0N A;  1GUL A;  1BG5 A;  4ULX A;  2C0D A;  2IMF A;  2LRC A;  1JLW A;  3A5I A;  4L0W A;  4POL A;  1SD9 A;  4BWS A;  3ZFB A;  3WGD A;  2PN8 A;  5IO0 A;  4TR1 B;  2VD0 A;  19GS A;  1ZMA A;  5J41 A;  3KGK A;  5D9V A;  4KSM A;  3ZZX A;  1TRS A;  2KP2 A;  4JE1 A;  4GLT A;  4XIH A;  1EWX A;  3VWW A;  1FHE A;  5CRG A;  1OE8 A;  5AN1 A;  4GWR A;  4O32 A;  3EVI A;  3U6V A;  1T4Y A;  4MF7 A;  4GQC A;  17GS A;  2AUV A;  2MZC A;  3L9S A;  4DSR A;  4KF9 A;  6GST A;  2A2R A;  1RW1 A;  1M2B A;  1V2A A;  1FVJ A;  3EU4 A;  1YF0 A;  3WT1 A;  5A4W A;  1M9A A;  1EEM A;  4NHW A;  2X8H A;  2H01 A;  5J4U A;  1AQW A;  1AW9 A;  1ZGN A;  1IYH A;  2OE3 A;  2L57 A;  1GH2 A;  1XVQ A;  3S9F A;  4KE3 A;  4K7N A;  4YQM A;  1J9B A;  4DSQ A;  1JFU A;  4POB A;  4ZXG A;  2ES7 A;  1GNE A;  4FYU A;  3APO A;  4LA1 A;  2GLR A;  3GL5 A;  3CSH A;  4CW9 A;  2YWO A;  2C0F A;  4EDZ A;  2WFC A;  3KH9 A;  4PQH A;  4OFM A;  6GSX A;  2ZCT A;  4PXO A;  2N5F A;  4Q5Q A;  2EIO A;  1EZK A;  4HJM A;  4ML6 A;  4TXV A;  3P90 A;  1YKA A;  3KM6 A;  2YWM A;  4CDO A;  4ZIJ A;  1F3A A;  2RUE A;  4HOJ A;  2AB6 A;  3DIE A;  3I6A A;  3HD5 A;  3A5W A;  3P8W A;  2IME A;  2PUK C;  5DCG A;  2R3X A;  2X99 A;  1Z7P A;  1TXX A;  1FO5 A;  1ERU A;  1GL8 A;  2YNX A;  2IMD A;  2DBC A;  4K6X A;  4EL1 A;  5CAX A;  1T8E B;  3G7J A;  2TRC P;  3GKK A;  5ELA A;  1TK8 B;  1A24 A;  2GQK A;  4GXZ A;  1V58 A;  5D9W A;  5IQY A;  3FR3 A;  1GTA A;  2FWE A;  1K0B A;  1TJD A;  2H0G A;  2VCV A;  5JWO B;  2X4A A;  5DAK B;  2FA8 A;  3M3M A;  1ZYP A;  1K0N A;  2IWT A;  1OKD A;  3GHA A;  3LGC A;  3D5J A;  5F0G A;  5D9T A;  3F3R A;  2TRX A;  5GAP D;  3GKX A;  3CXG A;  3DVX A;  1PL1 A;  3RHB A;  3JCM L;  3MDK A;  4WBR D;  3TKS A;  3C73 A;  3EMP A;  1RQM A;  1FOV A;  2FWH A;  4QL7 A;  5F8B A;  1G7O A;  2YZU A;  3A3T A;  4ID0 A;  4PNG A;  2WGR A;  1AC1 A;  1W89 A;  3LYP A;  2DC5 A;  2DJ3 A;  3FY7 A;  2VIM A;  3D4T A;  2VLT A;  1U87 A;  4K8M A;  4KDY A;  2BTO T;  3D22 A;  3E9J B;  3I69 A;  3KCM A;  3WD6 A;  2HSH A;  1K0O A;  1Y25 A;  1I5G A;  3LXZ A;  1ZL9 A;  2XBI A;  4V2L A;  2X8G A;  1AQX A;  18GS A;  1GWC A;  2H0H A;  4K2X A;  4KW6 A;  2FWF A;  2WB9 A;  4TR1 A;  5ECK B;  4GTU A;  2LQO A;  1V40 A;  1ERW A;  4I2U A;  5IMC A;  1BJX A;  3C1S A;  4L5O A;  3G7Y A;  4K7I A;  2JL4 A;  5ECM B;  1PSQ A;  3VUR A;  3QPM A;  2JSZ A;  1H4O A;  1YZX A;  2K18 A;  4PUF C;  3GFK A;  3QFA C;  5IIZ A;  2C80 A;  3VI7 A;  1Z3E A;  5C04 A;  5IMZ A;  3QCP A;  4XCS A;  1YY7 A;  3KMN A;  2A4H A;  5CRW A;  4K5R A;  3DEX A;  1F9M A;  1YDK A;  3DXB A;  2ZNM A;  2LS5 A;  3ZMK A;  2LST A;  1K3Y A;  1O8X A;  1Z9H A;  5F05 A;  1JZD A;  3EUR A;  2L59 A;  1SYX A;  2MBT A;  3FR6 A;  3UVH A;  3F4R A;  2YWN A;  1R5P A;  5CYY A;  2RM5 A;  4LL1 B;  3KXO A;  1AUC A;  4AF2 A;  1BAY A;  2PMT A;  3K8N A;  4YH2 A;  4F0B A;  3TRP A;  2LJA A;  2R0P A;  4GSS A;  1ACV A;  2L5L A;  4KDU A;  2H6Z A;  3ZIV A;  4MJE A;  3GRX A;  4O5U A;  2H73 A;  4F0C A;  22GS A;  3TRQ A;  3M1G A;  4HI7 A;  1IYI A;  3IK9 A;  3EC3 A;  1TTZ A;  1S3D A;  1WP0 A;  4F82 A;  2GST A;  3TKQ A;  3C1R A;  1XFL A;  1ABA A;  2GS3 A;  3H1N A;  3WYW A;  1R5A A;  3QAV A;  5JCU A;  2HSM A;  3CSI A;  1WPI A;  4CY8 A;  1PKZ A;  4IJ3 A;  2R4V A;  2YP6 A;  4MP4 A;  3TRX A;  4V1A p;  2MMN A;  3GYK A;  2O7K A;  3TJK A;  5ECS A;  1R7H A;  4MPG A;  5EL8 A;  3FEU A;  4MPF A;  5DAK A;  1TP9 A;  5GSS A;  3W8J A;  3PPU A;  3EPT A;  3UAP A;  4TRX A;  3P7X A;  1ON4 A;  4KDX A;  1XW5 A;  1HQO A;  3ZIT A;  2H75 A;  4OD7 A;  2V6K A;  3CRT A;  3CSJ A;  3BBY A;  3UEM A;  5ENU A;  2YOI A;  4G19 A;  2X64 A;  3W8S A;  4N0V A;  4QQ7 A;  2KOK A;  3IAS 2;  1EV9 A;  2YCD A;  1SK2 A;  3J7Y b;  5H5R A;  2H1A A;  1A8Y A;  3ZYW A;  4DVC A;  1UVZ A;  2VM1 A;  3RPN A;  2YN1 A;  2H19 A;  4EKZ A;  4YKF A;  3D6I A;  2YV7 A;  5J5N A;  1GSY A;  3ERG A;  4KH7 A;  4WBJ A;  3FR9 A;  3WGX A;  4OCF A;  1U6T A;  2C0E A;  4FQU A;  4EIP A;  4MF6 A;  3PH9 A;  2HYX A;  1W4V A;  3EIN A;  1WE0 A;  3KMO A;  1B48 A;  1GSE A;  2M72 A;  4HQS A;  2VLV A;  1FOH A;  1OC9 B;  2EIR A;  2GSQ A;  2NVL A;  4N11 A;  2RII A;  2Z9S A;  4HZ2 A;  1F6M C;  1J08 A;  2HLS A;  4EE0 A;  4BA7 A;  1OC8 A;  4KX4 A;  2WZ9 A;  4FIW A;  1ST9 A;  1NW2 A;  3ME7 A;  2VD1 A;  2VL3 A;  1R26 A;  3FK8 A;  3VPQ A;  2YPM A;  4XRD A;  4MZC A;  4YQV A;  1ZCP A;  2PWJ A;  1SD8 A;  2E7P A;  1XZO A;  2IFQ B;  3VLN A;  2LV3 A;  1DSB A;  5D8I A;  2XHF A;  2LRT A;  1U3A A;  4KSO A;  4AJ6 A;  5ECO B;  2PPT A;  3CTG A;  2ZUP A;  4PQ1 A;  1TDI A;  2P31 A;  4MZB A;  1ZYE A;  2AYT A;  4IW9 A;  1TOF A;  4WKW A;  4KUN A;  5B6M A;  2L6D A;  3LEF A;  2H30 A;  1TI3 A;  1TRU A;  1QMV A;  3D0Z A;  1X9M B;  4E8E A;  5ECN B;  3HYP A;  3VWU A;  1XWB A;  1T3B A;  1M2D A;  4ECC A;  3WGE A;  3HA9 A;  3KJY A;  1KBN A;  3HVV A;  1X9S B;  4ECB A;  1R4W A;  5ECP B;  2D2Z A;  5FT3 A;  4ZIL A;  1SYR A;  2LUS A;  1QXH A;  1TKD B;  1WJK A;  13GS A;  1WRY A;  2PVO C;  2VCT A;  3E3E A;  2J23 A;  1GRX A;  2XPE A;  3GIX A;  1LBK A;  1XPV A;  4LMW A;  3M9K A;  4J56 E;  3FZ9 A;  1UN2 A;  4L8E A;  1A8L A;  4X4J A;  2CZ3 A;  3TJF A;  5G5F A;  4K5S A;  6GSV A;  1GP1 A;  3R2Q A;  2HRN A;  3EWL A;  4O5R A;  2CV4 A;  2L4C A;  3V1W A;  2M80 A;  1Z7R A;  3TKS E;  4ML1 A;  4PQI A;  1PX6 A;  4I6X A;  3VWX A;  4I2T A;  3IV4 A;  3F0I A;  2R0C A;  1XOB A;  4TVE A;  4X43 A;  2AJQ B;  1PL2 A;  5ECH B;  4ECI A;  1PD2 1;  1OE7 A;  2B7K A;  4RI6 A;  5CRE A;  2R5G A;  1B9X C;  2CT6 A;  4RQX A;  2B6M A;  4XS4 B;  4BVX B;  2CAI A;  1XCC A;  4IN0 A;  2DJJ A;  1GUK A;  3DD3 A;  2XBQ A;  3TJB A;  4L0U A;  4N10 A;  4JRR A;  1AIU A;  5B6N A;  1HNB A;  4IP6 A;  1THX A;  2HRF A;  4DSS B;  2WS2 A;  3MSZ A;  3N5O A;  2I1U A;  3A2X A;  4KB3 A;  3GST A;  3HDC A;  3TJJ A;  3CRU A;  2H8L A;  4X1U A;  1V98 A;  4PX1 A;  2F51 A;  3HXS A;  2YAN A;  1MEK A;  1MTC A;  1EOG A;  3FKF A;  2GSS A;  4KGI A;  3LG6 A;  4F03 A;  2H6Y A;  4IS0 A;  1K0M A;  3FHK A;  1E6B A;  4CY6 A;  4JED A;  8GSS A;  4F2I A;  3HZ8 A;  2RUF A;  3NOF A;  1JHB A;  2XPD A;  1GLP A;  1UC7 A;  6GSS A;  2GT6 A;  3IAM 2;  2O8V B;  3BOA A;  3MNG A;  2VCQ A;  1PN9 A;  3TJG A;  3EE2 A;  4WR5 A;  1TI1 A;  4EF0 A;  1Q98 A;  5J9B A;  3CTF A;  1BX9 A;  3RBT A;  5KN2 A;  1URM A;  5IMF A;  2HRA A;  3I43 A;  1A2L A;  1CQH A;  4OO5 A;  4MCU A;  3Q6O A;  5D93 A;  5J3R A;  1HNA A;  1WWJ A;  5A4U A;  4MZW A;  5FHI A;  4FO5 A;  3BJ5 A;  2YJH A;  4TR3 A;  1XIY A;  2CX4 A;  1BYE A;  2FCH A;  2FWG A;  2GQL A;  3FZ5 A;  2H74 A;  3FZA A;  2H0I A;  2F9S A;  5DAL A;  1TK5 B;  3FYG A;  1FVK A;  4ZBA A;  3ZIJ A;  4WF5 A;  1F3B A;  2AV4 A;  3UAR A;  5BRT A;  1EEJ A;  4ZL8 A;  2C0G A;  5DJL A;  1YQ1 A;  1MDI A;  2PU9 C;  2HZE B;  5HQP A;  1JZW A;  1YEX A;  5EY6 A;  3NZN A;  1O85 A;  1XOA A;  1M99 A;  1T00 A;  3GTU B;  4EDY A;  4Z7X A;  3APQ A;  3HVX A;  1PX7 A;  4FYB A;  1K3L A;  4TR4 A;  5ELG A;  1NM3 A;  2JZR A;  4NXI A;  3QMX A;  2ON5 A;  5AIV A;  2OAC A;  3UJ1 A;  2GQM A;  4HU7 A;  3L78 A;  4JBB A;  3UOM A;  5D9X A;  5IM9 A;  4IHU A;  3UBK A;  3CYN A;  2B1K A;  4HJ2 A;  2A2P A;  5ECR B;  3IC4 A;  2ALB A;  2GGT A;  5DCH A;  2FLS A;  4IGJ A;  4GST A;  2A4V A;  3M9J A;  4BWQ A;  2GVP A;  2YV9 A;  2WCI A;  2FA4 A;  4RUV A;  1G7E A;  3MIX A;  4IJI A;  3L9V A;  1WOU A;  5JWQ B;  4EIQ A;  2R0G A;  3MAK A;  1A0R P;  2H6X A;  3IRA A;  2HRK A;  4Q5N A;  1DE1 A;  3GN3 A;  3L9U A;  3BCI A;  4ZB9 A;  4XHM A;  1ML6 A;  5EVO A;  3F3Q A;  2PBJ A;  3LW9 A;  2DJ2 A;  3ZRD A;  2YJ7 A;  3LXT A;  3NIV A;  1JZR A;  3F63 A;  5GZZ B;  4J2F A;  2LEG A;  2P5Q A;  4YQU A;  5JWR B;  3QDN A;  4HEA 2;  4BPY A;  2X49 A;  1K0A A;  1M0U A;  5HR0 A;  1YJ6 A;  4IKH A;  2J9H A;  5COH A;  4XS4 A;  4BVX A;  2QSI A;  2H66 A;  1PRX A;  2IPA A;  1KEB A;  4QL9 A;  2O85 A;  2QKE A;  4YAP A;  1O73 A;  5D96 A;  4JR4 A;  5JCW A;  2BJX A;  2GZY A;  2VCZ A;  3TDG A;  3F8U A;  2F8A A;  3QFB C;  4PNF A;  5GAN D;  4DSS A;  1VF2 A;  1B4P A;  1Y6E A;  3VI5 A;  1JZO A;  2LKU A;  3HCZ A;  5BMU A;  3CMI A;  6GSU A;  3BD2 A;  5H5S A;  1XXU A;  2B3S A;  2V1M A;  3QAG A;  1S3A A;  2R2J A;  5KN3 A;  1YEP A;  2TIR A;  5B8A A;  5IPH A;  5FWG A;  1DUG A;  2C3Q A;  4OWY A;  1I9D A;  3LWA A;  4PUA A;  4MLY A;  1MD3 A;  3GUR A;  2F3M A;  3PGT A;  9GSS A;  1VGL A;  2IIY A;  4EVM A;  1SKW B;  5ECL B;  1XW9 A;  2M46 A;  3F6D A;  3IK7 A;  3ZVJ A;  1XWA A;  4LMV A;  1SK0 A;  16GS A;  4RQR A;  3TKR A;  3UMA A;  2FGX A;  2C8U A;  1S3C A;  2O87 A;  2E0Q A;  2HZF A;  3ZL5 A;  1X5D A;  2RM6 A;  1O81 A;  1QGV A;  1KNG A;  4TKY A;  2B5E A;  3ZLP A;  1TK0 B;  3SBC A;  4KCE A;  4ZB8 A;  2VOC A;  2G2Q A;  5IOW A;  4USS A;  3IDV A;  4K9Z A;  2MMA A;  1A0F A;  2KUC A;  2DLX A;  2EIQ A;  5B8B A;  3PIN A;  2CAQ A;  4POM A;  2WDU A;  2I3Y A;  4KA0 A;  2VLU A;  5CO3 A;  3US3 A;  5A5K A;  2K6V A;  1C72 A;  2NBS A;  2OJL A;  2PVQ A;  4K1F A;  3L4N A;  4GQF A;  2IMK A;  2F8F A;  1XW6 A;  3TOT A;  3DVW A;  4E8H A;  2YZH A;  2IL3 A;  2YWI A;  1QFN A;  4MH3 A;  5DVB A;  3J7Y k;  2L5O A;  4MK3 A;  4FYC A;  1GSD A;  2DMM A;  5AGY A;  4NWY A;  1FB6 A;  5HFI A;  3G7I A;  1GUH A;  2IN3 A;  4MH2 A;  5B7C A;  1VF1 A;  3ED3 A;  1HNC A;  1JLV A;  4NAX A;  2HNL A;  5IPG A;  4YAV A;  3UBL A;  1ZOF A;  1Q4J A;  4MJC A;  1M2A A;  1EGO A;  1E2Y A;  1AXD A;  4Q5F A;  1TU7 A;  3QOU A;  2B7J A;  5A4V A;  1O8W A;  1EOH A;  2VUP A;  2GSR A;  4Z2U A;  2ON7 A;  5CRH A;  4Z2T A;  1LJR A;  4MA9 A;  1B4Q A;  1TRV A;  4GRF A;  1EP7 A;  4V2M A;  4K2D A;  4TXO B;  3EMX A;  5KN1 A;  3HY2 A;  4LLR A;  3IPZ A;  1M7T A;  4EUY A;  2BMX A;  3KH7 A;  1TU8 A;  1N8J A;  2C3N A;  4TW5 A;  3OR5 A;  1Z5Y E;  2CZ2 A;  3KEB A;  1A2J A;  2OAD A;  2H76 A;  3TOU A;  4XTS A;  5IMV A;  4POK A;  1A23 A;  3A2W A;  1XWC A;  2HFD A;  3F6F A;  2IMI A;  2H71 A;  4G9H A;  3GKN A;  1O6J A;  4ACS A;  1TRW A;  3DML A;  1SL1 B;  1HD2 A;  2V41 A;  1XBS A;  5KOW A;  4O5Q A;  1HYU A;  2CVK A;  4MDC A;  3GMF A;  2V32 A;  2DKI A;  3UVT A;  1SL0 B;  5LD0 A;  2N5B A;  2LNT A;  3GL3 A;  4ILF A;  4XRA A;  2NDO A;  1VRS D;  1ERT A;  1PQN A;  3LJR A;  1OKT A;  2LRN A;  3P2A A;  3D4M A;  1U3I A;  3M0F A;  1H75 A;  5AIS A;  3RPP A;  3TGZ A;  1K3O A;  2VL2 C;  3GH9 A;  4ZB6 A;  4NMU A;  5G5E A;  2MBS A;  1EGR A;  4OFN A;  2OBK A;  5ID2 B;  3M8N A;  5D73 A;  1GSU A;  4LL4 B;  5E59 A;  2B5X A;  1CQG A;  2LJK A;  4NHZ A;  4TN8 A;  2L4Q A;  3TCO A;  1SL2 B;  2FY6 A;  4IEL A;  3EYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...