2Z9SA

Crystal structure analysis of rat hbp23/peroxiredoxin i, cys52ser mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
197
structure length
197
Chain Sequence
SGNAKIGHPAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVSPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin-1
publication title Dimer-Oligomer Interconversion of Wild-type and Mutant Rat 2-Cys Peroxiredoxin: DISULFIDE FORMATION AT DIMER-DIMER INTERFACES IS NOT ESSENTIAL FOR DECAMERIZATION
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 58
structure length 197
sequence length 197
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2007-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2z9sA00
2O87A 4I5QA 4ECIA 4K9ZA 1TU7A 1OKDA 3UMAA 2FUG2 4XIHA 3DGQA 1B4PA 4IP1A 4BVYA 4OWYA 2N5FA 2P0GA 1ILOA 3MWHA 1EEJA 5HQPA 5J4UA 3D5JA 1M9AA 4OMVA 3LXZA 3BD2A 5D96A 5DALA 1XW9A 3KTLA 2F8FA 2C0DA 3CRUA 2IPAA 5G31A 2OADA 4Q5FA 1GSQA 3PGTA 4GRFA 4NWYA 3L0HA 2H6YA 5J9BA 4K1FA 6GSUA 2L5OA 3LXTA 1M7TA 3VURA 1HYUA 1K0CA 2HXKA 2RUFA 3TKRA 3DEXA 3RDWA 5AIXA 4L0WA 4ZBBA 1WPIA 5ENUA 3N9JA 4MPFA 2PERA 4GSNA 5LCZA 3MSZA 1DBYA 1J0FA 1V58A 2XPDA 1A24A 3C7MA 1XZOA 3NZNA 3CXGA 1KBNA 2FWFA 2R37A 4AJ8A 2HRNA 4TN8A 5EL8A 2YWMA 1VF4A 3CTGA 2CVDA 2G0FA 2HZEB 2OE0A 5B6NA 1YEPA 2DBCA 2LEGA 2LJAA 3Q18A 2C4JA 1X0RA 16GSA 4ULXA 1HNCA 2VL9A 2HFDA 1XWGA 1K3YA 1SKRB 3C8EA 1B9XC 5AN1A 2C0GA 4JBBA 3IRAA 4KE3A 1FAAA 4DSSA 4X1UA 2GTUA 2GT5A 2Z9SA 1EEMA 1FVJA 1HQOA 2GS3A 5LD0A 2YANA 3FY7A 2A2RA 1JFUA 4OFNA 2XBIA 4WEYA 5DJMA 1OC9A 3A5WA 1XCCA 2V1MA 4EXJA 2ZUPA 4HQZA 3QCPA 3QPMA 5ID2A 3DKSA 1X9WB 2CA8A 3WGEA 1U88A 2FWGA 4G10A 4EDZA 22GSA 1G7OA 3LFLA 2YWNA 5D9VA 1X5EA 2X8CA 3UIWA 1GSDA 3P7XA 2V41A 3ZVJA 5HR3A 3F4TA 5FT3A 2PBJA 4IHUA 1KEBA 1AAZA 2DJKA 2A2SA 3EE2A 1DE2A 3A2VA 1JLWA 1BAYA 5CP1A 4HI7A 2VL2A 4XTSA 3IDVA 1KTEA 5CREA 2VD1A 3GTUB 2F9SA 1USBA 1XW5A 2VCWA 4NHWA 2ON5A 1N8JA 5ECLB 5ECKB 4PXOA 1GWCA 3IR4A 3SBCA 5ID2B 4E8EA 1X5DA 3ZYWA 3DVWA 2KUCA 4PGTA 2KLXA 5KN0A 3HJPA 4K0GA 1B8XA 5B6MA 1YQ1A 1QFNA 1F2EA 1B9YC 1SD8A 4CDOA 5CRHA 3GYKA 1MTCA 4KNDA 3VFIA 5GSSA 2K8SA 5GSTA 1WMJA 3P8WA 1QUWA 2FD3A 1FOVA 1MDIA 2V6KA 4KCAA 2JL4A 3QOUA 18GSA 3HVXA 2H0IA 3DRNA 3VWVA 4ZL8A 4KH7A 2IMDA 1FVKA 2VLTA 5J9CA 4POMA 1EOHA 4GXZA 2M46A 3L9SA 3SWLA 1BX9A 4TXOA 1XWBA 3DWVA 3RPNA 3EMXA 1EGRA 2O85A 2NVLA 3P90A 4IQ1A 2RUEA 3WT1A 3ZIVA 5E4WA 5G30A 3DXBA 4QL7A 4BPYA 5D9TA 4EDYA 3GX8A 2VD0A 4TOPA 5JCUA 3TRQA 2JU5A 2PMTA 1NW2A 1GLQA 2DJ0A 3TJGA 2IMEA 3FR6A 5DAKA 2O7KA 4K2DA 1TW9A 2C3NA 1PX6A 1SU9A 4BL7A 1U6TA 4GSTA 3BOAA 3CRTA 1WE0A 4MJAA 4ISDA 4ML6A 3IAS2 3BCIA 1FB6A 4HS1A 2LQQA 1WRYA 1JZRA 1U87A 3C1RA 2B5EA 5ECNB 3TCOA 1EOGA 5F05A 2IIYA 4YQMA 2NBSA 4I8BA 2GDRA 3TJJA 2C8UA 5IMZA 5F07A 4ZL7A 2RM5A 2HI7A 3DVXA 1NHOA 1GULA 2LKUA 1AQXA 5D8IA 3UJ1A 2YNXA 2AHEA 4I2TA 4MZBA 5IMAA 1XBSA 5G1KA 3ZREA 4F82A 3E0UA 4PQ1A 5J41A 1CQGA 2MYGA 1SK2A 3KH9A 4AGSA 1AW9A 1NHYA 3TKSC 1AXDA 4GQFA 2PWJA 3KZQA 1Y6EA 2P31A 1PKWA 3HVSA 1JZDA 4Q5RA 3GH6A 1O81A 1GH2A 4MJBA 3LQ7A 2H1AA 3F3RA 3ZFBA 3HA9A 2JSZA 3DMLA 4PUFC 5IO2A 4KA0A 1M2BA 1AQVA 4I6XA 3IPZA 3ZMKA 5B7CA 4MH2A 2N5BA 2JZRA 5ECMB 5C04A 2F3MA 5CNWA 5JWQB 2B5XA 1R26A 3C1SA 4E8HA 3CSJA 3FEUA 3F0IA 2YJHA 2VCQA 4HQSA 1PQNA 4MPGA 1XFLA 1R5AA 5KEJA 1T3BA 6GSXA 2PUKC 5CRWA 3KCMA 2C3TA 3GHAA 3GSSA 4N10A 3H8QA 1SL2B 5DQSA 1ZL9A 2HSHA 1F37A 5ECPB 1S3CA 2OE1A 4YH2A 2IL3A 5LNKe 2K9FA 4MK3A 2G2QA 1RQMA 2L59A 4JR4A 3DYRA 2P5RA 1GUKA 3FR9A 2R4VA 5ECIB 2DC5A 3TOUA 5DDLA 4HZ4A 1SL0B 2D2ZA 20GSA 8GSSA 1TTZA 4WR5A 1PL2A 4LLRA 2VCTA 3APQA 4D73B 1TK8B 1PD21 2R5GA 5ECHB 3TKPA 4KSOA 6GSSA 4MA9A 2H8LA 1GUHA 2PN8A 4WBRD 5AGYA 2A4VA 3TB2A 4OO4A 4V2NA 4MZCA 1FB0A 4K7OA 4POKA 5EPFA 4MJCA 2HT9A 1XOBA 2B6MA 1M99A 2E7PA 2CQ9A 3TJFA 4ZB9A 3IE3A 1PA3A 1EP7A 3BBYA 2IFQB 1Q4JA 3ED3A 4RQRA 4GWRA 3RHBA 4JEDA 2HZEA 4ML1A 2RM6A 3HCZA 1YY7A 2B5YA 2OJLA 2H6XA 1Z6MA 5JWOB 2H74A 1NSWA 2K8VA 1O8WA 5HFGA 1OE7A 5A5KA 3M9JA 3F6FA 5GAPD 2RIIA 2DMLA 3P2AA 1K0BA 2CX3A 1VGLA 2LUSA 5HFIA 2GVPA 3LSZA 1MDKA 2GQMA 5G1LA 4IW9A 4MMMA 4OFMA 2FWEA 4WF5A 4IBPA 1ZOFA 4Z7XA 4ACSA 3LEFA 5CO3A 3GKNA 2BMXA 2YCDA 3TDGA 5GAND 3I69A 1GSSA 3GUSA 1GUMA 1SYXA 3FZ5A 1B48A 4PX1A 3UBLA 3H79A 3APOA 4K8MA 2LTKA 1BJXA 1ZMAA 1LU4A 3IA1A 4ZL9A 3ZRDA 5JCGA 1I5GA 3HYPA 1Q98A 3HXSA 4PNFA 3Q74A 1QXHA 2YN1A 3ME7A 3ZZXA 4EE0A 2FLSA 4QL9A 5IOXA 5JCWA 1K0MA 1UC7A 2H19A 2VM2A 4J2FA 2JACA 1X9MB 1TOFA 3ME8A 2WGRA 4AF2A 4F0BA 4TXVA 2N5AA 2MZCA 4GLTA 1HNAA 2WZ9A 1Z5YE 5E59A 3US3A 1UA5A 5FHIA 2LRCA 3GTUA 2DJJA 5DCHA 3UVTA 4LMWA 1A23A 5FWGA 3GH9A 1EGOA 4QQ7A 1ERVA 4KDUA 2YWOA 1TJDA 1R7HA 5IQYA 2HRFA 2DSAA 4GSSA 2YZUA 5CRGA 5H5RA 1BEDA 1AQWA 1U3IA 3UBKA 4YQUA 3EU3A 3EURA 3HJOA 5AISA 1XW6A 3GA4A 2C0FA 4PUAA 2XPEA 1TRWA 2AYTA 2H71A 3ZFLA 3ZL5A 3ISOA 2GSRA 2OBIA 1W89A 3HVVA 2H76A 3LJRA 2LRNA 3GFKA 3GRXA 4IVFA 1T4YA 1VRSD 2C1YA 4EUYA 4NAXA 5ECRB 3F9UA 2I81A 1XXUA 1M9BA 1ERWA 3TUEA 5F06A 3G9BA 4LL1B 5H5SA 3VWUA 3LORA 2VUPA 2H75A 4RQXA 1EWXA 1WJKA 5IMDA 2IMKA 1J08A 2FHEA 5ELAA 3QR6A 2OE3A 4HEA2 1M0UA 4NV5A 1DSBA 3M1GA 4WR4A 3UVHA 4BWQA 1OC3A 2JADA 1K3LA 3LWAA 2K18A 3HY2A 4XS1A 1X5CA 4O32A 4NPBA 1I9DA 2B7KA 2XBQA 4XRDA 2WULA 4MDCA 2TIRA 2VIMA 3HDCA 3KTBA 2YZHA 5DBQA 4OFTA 2CVBA 3D4MA 2YPMA 3IXRA 4V2MA 1XWCA 1QGVA 3NIVA 3K8NA 4WF4A 2WDUA 1H75A 3F3QA 4EO3A 2AAWA 3GL3A 4RI6A 4XS4B 4K0NA 2GZYA 2I3YA 1A2JA 4V2LA 5J5NA 5F0GA 1JLVA 3UOMA 2TRXA 4EL1A 2CAQA 2VCVA 1JHBA 4Q5NA 2L57A 4IS0A 1ZYQB 2L6DA 3TOTA 4MLYA 4JE1A 3E3EA 4V1Ap 3FZ4A 1CQHA 3KXOA 2X8HA 2J23A 1PL1A 1VF3A 1Z6NA 3CTFA 1SL1B 5EVOA 1FO5A 3UARA 4FYBA 2OA7A 1GRXA 4ZXGA 3GURA 1Z7RA 2JZTA 3QAGA 2AUVA 5ABRA 1SYRA 3D22A 1H4OA 1XOAA 2H1DA 5JWRB 5EY6A 4MF6A 1M2DA 2H72A 3UAPA 1THXA 3KMOA 4KDXA 2CX4A 9GSSA 4I2UA 3LGCA 3Q19A 1A0RP 3GL5A 2X8GA 3RAZA 1T8EB 4HOJA 3WGXA 3D0ZA 2PGTA 2GLRA 2VCZA 3L9UA 2PVQA 3NOFA 2QKEA 1GTAA 2VAFA 2VOCA 5COHA 1TK5B 5CAXA 1YDKA 1SENA 2WCIA 4V1Ag 2LNSA 7GSSA 1SK1A 4WBJA 1GSEA 5IMVA 2GSQA 1YF0A 1TKDB 3PR8A 1R5PA 3G7JA 3C73A 4DVCA 3ERFA 4YQVA 4G2EA 2KHPA 1PMTA 2LJKA 4AJ7A 2LNTA 1FW1A 2H30A 3GKKA 4JZQA 4MABA 2GT6A 5CRDA 3TKSA 3L9VA 3I9V2 4KCEA 1THOA 2CZ3A 5GZZB 3ZMLA 3FK8A 3N5OA 1A0FA 1HD2A 3D4TA 1WIKA 4TR1B 3KMNA 2VCXA 2F8AA 4IJIA 3TJBA 4MF7A 1C72A 1MDJA 3W6GA 3IAM2 3O6TA 2PVOC 4FO5A 1U3AA 3ZITA 4D73A 2LQOA 1ABAA 5A4VA 4N0VA 4MZWA 4HJMA 3UEMA 4F03A 4FYCA 2E0QA 4GF0A 4OD7A 2TRCP 5IIZA 2HYXA 2DMMA 4XCSA 1BQ7A 1V9WA 1TXXA 3IOSA 2DIZA 1HNBA 2IMIA 1OE8A 1ST9A 4ZB6A 4ZBDA 1T7PB 4JR6A 1T00A 4XS6A 4YAPA 1ML6A 4HJ2A 1GSYA 3GIXA 2YV7A 1ACVA 3GV1A 3VPTA 3EC3A 2IFQA 2E2MA 3GSTA 2FA4A 3BCKA 6GSVA 1YKCA 3M9KA 1GSFA 2WB9A 2XC2A 5HR0A 3RPPA 2H6ZA 3C71A 3MAKA 4HDEA 1MD3A 4EKZA 4HU9A 2EC4A 1K0NA 2KP1A 2BJXA 5DVBA 5HR2A 4G19A 3J7Yk 4LL4B 3FYGA 3QAVA 1JZWA 2M72A 2EIRA 2AB6A 5A4WA 4ECCA 3U6VA 5ECSA 4FIWA 4NV2A 4H86A 2V2GA 5CYYA 3HZ8A 2XHFA 1PSQA 3U5RE 2PU9C 1TP9A 4L5OA 2YWIA 1RW1A 3KP9A 1AIUA 3ZLPA 3S9FA 1GTUA 1OC8A 3KEBA 2KOKA 2L5LA 1N2AA 3G7YA 4L0UA 3VWXA 2R2JA 3IV4A 4ZBAA 3A3TA 1Z3EA 1XWAA 3A2WA 5G5FA 4NXIA 1V2AA 3F8UA 2HNLA 2VO4A 2DJ1A 3KM6A 2YV9A 4MH3A 4GTUA 2NTOA 5KN3A 1F9MA 3AY8A 5H5QA 3TRXA 1TRSA 2B1LA 2RLIA 2H01A 2QSIA 2V6OA 4O7HA 3UL3A 5ELGA 1XWKA 2L4QA 5AIVA 4J56E 5A4UA 2DIYA 2E2GA 1YKAA 5D73A 3EMPA 3VPQA 3CYNA 4N30A 3IK9A 5L71A 2B7JA 4DSQA 1O7UA 3VK9A 2ON7A 2YP6A 1S3DA 3O3TA 2OBKA 3RBTA 3MDKA 3HD5A 3W8SA 5D9WA 1OAZA 3FZAA 3RHCA 3M8NA 3OR5A 1BYEA 4FH8A 1PRXA 2QGVA 5ECOB 2O89A 2GSSA 1UN2A 5DALB 4GQCA 3HZ4A 3HJMA 1A8YA 1PKZA 5KN1A 3GKXA 12GSA 1E2YA 2WS2A 3PH9A 1S3AA 2YOIA 2FWHA 1K0DA 1VF1A 4PNGA 2FCHA 4PQHA 4N11A 1Z7PA 2BTOT 5DQYA 1MD4A 4IP6A 1T1VA 4POLA 2DJ2A 3IHQA 2V32A 2VLUA 19GSA 1A8LA 5HFKA 4XHMA 3CSIA 4GCIA 4EC0A 4K7NA 1TI3A 2VLVA 2AV4A 2AJQB 3VI5A 2IWTA 3KJYA 4NMUA 2FY6A 1EZKA 2DLXA 2LV3A 1G0TA 2WFCA 1XIYA 5G5EA 2H0GA 4NHZA 5INYA 3KP8A 4F2IA 4AJ6A 3TKSE 1NM3A 2MBSA 4F0CA 1TRVA 1A2LA 3O76A 4IN0A 3I43A 1SJ6A 4PQIA 3Q6OA 2IN3A 1GTBA 4DSSB 3R2QA 4ZB8A 4ECBA 2VL2C 3F6DA 1TDIA 2K6VA 3EVIA 4HU7A 3D6IA 4XS4A 2GQKA 1LBKA 1T4ZA 3EWLA 3H1NA 2J9HA 1F3BA 2FNOA 3WD6A 1OC9B 5IMCA 4X0XA 3TRPA 3ZTLA 5IOWA 3FRCA 2H1BA 1OKTA 2CZ2A 1UVZA 3DIEA 1PN9A 3IBHA 2MMAA 1K0AA 1O73A 4WXTA 3EYTA 1B4QA 2HLSA 2QC7A 4KSMA 1ERUA 4KGIA 2LJRA 4L5LA 3QD9A 2MMZA 5HR1A 3M3MA 1EV4A 3QDNA 4O92A 1URMA 4TR0A 1YEXA 11GSA 2H1GA 2HSYA 1DE1A 2NPBA 2MMNA 2I1UA 2X99A 4N0ZA 1JZOA 2M80A 1XPVA 4G9HA 4HZ2A 4L8EA 1SKSB 2WRTA 5G2ZA 2EIQA 4WETA 4TR3A 4LMVA 1SK0A 4Q5QA 1OVNA 3FW2A 14GSA 1SJZA 3W8JA 1F3AA 3LYKA 3CBUA 4ZILA 3A2XA 4CHSA 2C0EA 2R6KA 4KDYA 2REMA 3G7IA 4TRXA 4POBA 1YF1A 4RUVA 1O6JA 3GNJA 2PPTA 2ES7A 1IYHA 2OKAA 4EF0A 1EP8A 6GSYA 4YAVA 3E9JB 3VLNA 1GL8A 2GZPA 3PINA 1BG5A 3L78A 1GP1A 4IJ3A 4K6XA 2ZNMA 4PURA 2H66A 1F6MC 3I6AA 1SKWB 5IM9A 1FG4A 1ON4A 2H0HA 2EIOA 1O8XA 3M0FA 1DUGA 5DJLA 3V1WA 2H73A 4ID0A 4J57E 4F9ZA 3GX0A 2CVKA 3QAWA 3EINA 4DEJA 1GLPA 2MBTA 4XRAA 4P3YB 2R3XA 3H93A 3KH7A 5B8AA 2P5QA 3ZVJD 1K3OA 1YJ6A 4ILFA 17GSA 4JRRA 4KUNA 3TKQA 3ERWA 5KN2A 1QQ2A 1M2AA 4X43A 1E6BA 1X9SB 1KNGA 5F8BA 3JCML 2HE3A 2CAIA 3IC4A 4K7IA 3TJKA 1W4VA 2I9HA 1QK8A 5IPHA 1V57A 13GSA 1ZCPA 5D93A 4O5RA 3GMFA 3QMXA 4TXOB 4TR1A 1IYIA 3TGZA 2L6CA 2C3QA 10GSA 3GKMA 2CT6A 1FHEA 1QMVA 4TR4A 3VI7A 1V98A 1Y25A 4FYUA 4MJEA 3WGDA 4KAEA 2GQLA 2LS5A 1G6WA 4TKYA 3QFBC 5J3RA 3FR3A 1GTIA 1OYJA 2GZZA 2MMOA 4I97A 2L4CA 1WWJA 2B1KA 2WJUA 2LSTA 5DAKB 4IQAA 1RK4A 3FKFA 1ZYEA 1V40A 4KX4A 3HHVA 3GN3A 3CSHA 5DCGA 4ZIJA 1AUCA 1XVWA 1O85A 1XVQA 2LRTA 2O8VB 4TW5A 4WKWA 2ZCTA 4IELA 3EU4A 4OCEA 3KGKA 1ERTA 1PGTA 4CW9A 2JSYA 4ECJA 5IO0A 3F4SA 3CMIA 3MNGA 1TI1A 1YZXA 1TRUA 2CV4A 2YJ7A 1G7EA 4JU5A 5ECQB 3LG6A 1TK0B 3F63A 6GSWA 3BJ5A 3F4RA 4DSRA 3APSA 2C80A 4BVXA 2NDOA 5IPGA 2OACA 1ZZYA 1PX7A 2I4AA 1GSUA 2DJ3A 4BA7A 4RI7A 2JZSA 3ERGA 1WOUA 1VF2A 4EVMA 2H70A 4HUAA 2VL3A 4KW6A 4BWSA 2X64A 5D9XA 3VWWA 1MEKA 2FGXA 2GSTA 1SJIA 2B3SA 2IMFA 1SD9A 3LYPA 1TU8A 3KD0A 3WT2A 1GNEA 1WP0A 3WYWA 3D21A 3KIJA 2GGTA 3ZIJA 2FA8A 5IMFA 1GNWA 1A2MA 5C00A 3FZ9A 1Z9HA 2HZFA 6GSTA 4MCUA 3QFAC 2VM1A 1G6YA 5B8BA 1J9BA 4MF5A 2KP2A 3FHKA 4KB3A 4TVEA 3IK7A 2IJYA 4OO5A 2F51A 3L4NA 1R4WA 3H4KA 1AC1A 4IGJA 4MP4A 3DD3A 1ZGNA 3HKRA 4LA1A 1K0OA 1LJRA 3J7Yb 4IKHA 2ALBA 4OCFA 1EV9A
chains in the Genus database with same CATH superfamily
2O87A 4I5QA 4ECIA 4K9ZA 1TU7A 1OKDA 3UMAA 2FUG2 4XIHA 3DGQA 1B4PA 4IP1A 4BVYA 4OWYA 2N5FA 2P0GA 1ILOA 3MWHA 1EEJA 5HQPA 5J4UA 3D5JA 1M9AA 4OMVA 3LXZA 3BD2A 5D96A 5DALA 1XW9A 3KTLA 2F8FA 2C0DA 3CRUA 2IPAA 5G31A 2OADA 4Q5FA 1GSQA 3PGTA 4GRFA 4NWYA 3L0HA 2H6YA 5J9BA 4K1FA 6GSUA 2L5OA 3LXTA 1M7TA 3VURA 1HYUA 1K0CA 2HXKA 3MIXA 2RUFA 3TKRA 3DEXA 3RDWA 5AIXA 4L0WA 4ZBBA 1WPIA 5ENUA 3N9JA 4MPFA 4ICYA 2PERA 4GSNA 5LCZA 4KF9A 3MSZA 1DBYA 1J0FA 1V58A 2XPDA 1A24A 3C7MA 1XZOA 3NZNA 3CXGA 1KBNA 2FWFA 2R37A 4AJ8A 2HRNA 4TN8A 5EL8A 2YWMA 1VF4A 3CTGA 2CVDA 2G0FA 2HZEB 2OE0A 5B6NA 1YEPA 2DBCA 2LEGA 2LJAA 3Q18A 2C4JA 1X0RA 1M3JA 16GSA 4ULXA 5KOXA 1HNCA 2VL9A 2HFDA 1XWGA 1K3YA 1SKRB 3C8EA 1B9XC 5AN1A 2C0GA 4JBBA 3IRAA 4KE3A 1FAAA 4DSSA 4X1UA 2GTUA 2GT5A 2Z9SA 1EEMA 1FVJA 1HQOA 2GS3A 5LD0A 2YANA 3FY7A 1PFOA 2A2RA 2X49A 1JFUA 4OFNA 2XBIA 4WEYA 5DJMA 1OC9A 3A5WA 1XCCA 2V1MA 4EXJA 2ZUPA 4HQZA 3QCPA 3QPMA 5ID2A 3DKSA 1X9WB 2CA8A 3WGEA 1U88A 2FWGA 4G10A 4EDZA 22GSA 1G7OA 2HSMA 3LFLA 2YWNA 5D9VA 1X5EA 2X8CA 3UIWA 1GSDA 3P7XA 2V41A 3ZVJA 5HR3A 3F4TA 5FT3A 2PBJA 4IHUA 1KEBA 1AAZA 2DJKA 2A2SA 3EE2A 1DE2A 2R0CA 3A2VA 1JLWA 1BAYA 5CP1A 4HI7A 2VL2A 4XTSA 3IDVA 1KTEA 5CREA 2VD1A 3GTUB 2F9SA 4YKFA 1USBA 1XW5A 2VCWA 4NHWA 2ON5A 1N8JA 5ECLB 5ECKB 4PXOA 1GWCA 2HRKA 3IR4A 3SBCA 5ID2B 4E8EA 1X5DA 3ZYWA 3DVWA 2KUCA 4PGTA 2KLXA 5KN0A 3HJPA 4K0GA 1B8XA 5B6MA 1YQ1A 1QFNA 1F2EA 1B9YC 1SD8A 4CDOA 5CRHA 3GYKA 1MTCA 4KNDA 3VFIA 5GSSA 2K8SA 5GSTA 4CY6A 1WMJA 3P8WA 1QUWA 2FD3A 1FOVA 1MDIA 2V6KA 4KCAA 2JL4A 3QOUA 18GSA 3HVXA 2H0IA 3DRNA 3VWVA 4ZL8A 4KH7A 2IMDA 1FVKA 4EIPA 2VLTA 5J9CA 4POMA 1EOHA 4GXZA 1S3RA 2M46A 3L9SA 3SWLA 1BX9A 4TXOA 1XWBA 3DWVA 3RPNA 3EMXA 1EGRA 2O85A 2NVLA 3P90A 4IQ1A 2RUEA 3WT1A 3ZIVA 5E4WA 5G30A 3DXBA 4QL7A 4BPYA 5D9TA 4EDYA 3GX8A 2VD0A 4TOPA 5JCUA 3TRQA 1ZYNA 2JU5A 4Z2UA 2PMTA 1NW2A 1GLQA 2DJ0A 3TJGA 2IMEA 3FR6A 5DAKA 2O7KA 4K2DA 1TW9A 2C3NA 1PX6A 4K5RA 1SU9A 4BL7A 1U6TA 4GSTA 3BOAA 3CRTA 1WE0A 4MJAA 4ISDA 4ML6A 3IAS2 3BCIA 1FB6A 4HS1A 2LQQA 1WRYA 1JZRA 1U87A 3C1RA 2B5EA 5ECNB 3TCOA 1EOGA 5F05A 2IIYA 4YQMA 2NBSA 4I8BA 2GDRA 3TJJA 2C8UA 5IMZA 5F07A 4ZL7A 2QA1A 2RM5A 2HI7A 3DVXA 1NHOA 1GULA 2LKUA 1AQXA 5D8IA 3UJ1A 2YNXA 2AHEA 4I2TA 4MZBA 5IMAA 1XBSA 5G1KA 3ZREA 4F82A 3E0UA 3IHGA 4PQ1A 5J41A 1CQGA 2MYGA 1SK2A 3KH9A 4AGSA 1AW9A 1NHYA 3A5IA 3TKSC 1AXDA 4GQFA 2PWJA 3KZQA 1Y6EA 2P31A 1PKWA 3HVSA 1JZDA 4Q5RA 3GH6A 1O81A 2X4AA 1GH2A 4MJBA 3LQ7A 2H1AA 3F3RA 3ZFBA 3HA9A 2JSZA 3DMLA 4PUFC 5IO2A 4KA0A 3IC8A 1M2BA 1AQVA 4I6XA 3IPZA 3ZMKA 5B7CA 4MH2A 2N5BA 2JZRA 5ECMB 5C04A 2F3MA 5CNWA 5JWQB 2B5XA 1R26A 3C1SA 4E8HA 3CSJA 3FEUA 3F0IA 2YJHA 2VCQA 4HQSA 1PQNA 4MPGA 1XFLA 1R5AA 5KEJA 1T3BA 6GSXA 2PUKC 5CRWA 3KCMA 2C3TA 3GHAA 3GSSA 4N10A 3H8QA 1SL2B 5DQSA 1ZL9A 2HSHA 1F37A 5ECPB 1S3CA 4YKGA 2OE1A 4YH2A 2IL3A 5KOWA 5LNKe 2K9FA 4MK3A 4MNNA 2G2QA 1RQMA 2L59A 4JR4A 3DYRA 2P5RA 1GUKA 3FR9A 2R4VA 5ECIB 2DC5A 3TOUA 5DDLA 4HZ4A 1SL0B 2D2ZA 20GSA 8GSSA 1TTZA 4HSCX 4WR5A 1PL2A 4LLRA 2VCTA 3APQA 4D73B 4O5QA 1TK8B 1PD21 2R5GA 5ECHB 3TKPA 4KSOA 6GSSA 4MA9A 2H8LA 1GUHA 2PN8A 4WBRD 5AGYA 2A4VA 3TB2A 4OO4A 4V2NA 4MZCA 1FB0A 4K7OA 4POKA 5EPFA 4MJCA 2HT9A 1XOBA 2B6MA 5BRTA 1M99A 2E7PA 2CQ9A 3TJFA 4ZB9A 3IE3A 1PA3A 1EP7A 3BBYA 2IFQB 1Q4JA 3ED3A 4RQRA 4GWRA 3RHBA 3CQFA 4JEDA 2HZEA 4ML1A 2RM6A 3HCZA 1YY7A 2B5YA 2OJLA 2H6XA 1Z6MA 5JWOB 2H74A 1NSWA 2K8VA 1O8WA 5HFGA 1OE7A 5A5KA 3M9JA 3F6FA 5GAPD 2RIIA 2DMLA 3P2AA 1K0BA 2CX3A 1VGLA 2LUSA 5HFIA 2GVPA 3LSZA 1MDKA 2GQMA 5G1LA 4IW9A 4MMMA 4OFMA 2FWEA 4WF5A 4IBPA 1ZOFA 4Z7XA 4ACSA 3LEFA 5CO3A 3GKNA 2BMXA 2YCDA 3TDGA 5GAND 3I69A 1GSSA 3GUSA 1GUMA 1SYXA 3FZ5A 1B48A 4PX1A 3UBLA 3H79A 3APOA 4K8MA 2LTKA 1BJXA 1ZMAA 1LU4A 3IA1A 4ZL9A 2UZ8A 3ZRDA 5JCGA 1I5GA 3HYPA 1Q98A 3HXSA 4PNFA 3Q74A 1QXHA 2YN1A 3ME7A 3ZZXA 4EE0A 2FLSA 4QL9A 5IOXA 5JCWA 1K0MA 1UC7A 2H19A 2VM2A 4J2FA 2JACA 1X9MB 1TOFA 3ME8A 2WGRA 4AF2A 4F0BA 4TXVA 4G0IA 2N5AA 2MZCA 4GLTA 1HNAA 2WZ9A 1Z5YE 5E59A 3US3A 1UA5A 5FHIA 2LRCA 3GTUA 2DJJA 5DCHA 3UVTA 4LMWA 1A23A 5FWGA 3GH9A 1EGOA 4QQ7A 1ERVA 4KDUA 2YWOA 1TJDA 1R7HA 5IQYA 2HRFA 2DSAA 4GSSA 2YZUA 5CRGA 5H5RA 1BEDA 1AQWA 1U3IA 3UBKA 4YQUA 3EU3A 3EURA 3HJOA 5AISA 1XW6A 3GA4A 2C0FA 4PUAA 2XPEA 1ZYPA 1TRWA 2AYTA 2H71A 3ZFLA 3ZL5A 3ISOA 2GSRA 2OBIA 1W89A 3HVVA 2H76A 3LJRA 2LRNA 3GFKA 3GRXA 4IVFA 1T4YA 1VRSD 2C1YA 4EUYA 4NAXA 5ECRB 3F9UA 2I81A 1XXUA 1M9BA 1ERWA 3TUEA 5F06A 3G9BA 4LL1B 5H5SA 3VWUA 3LORA 2VUPA 2H75A 4RQXA 1EWXA 1WJKA 5IMDA 3HVNA 2IMKA 1J08A 2FHEA 5ELAA 3QR6A 2OE3A 4HEA2 1M0UA 4NV5A 1DSBA 3M1GA 4WR4A 3UVHA 4BWQA 1OC3A 2JADA 1K3LA 3LWAA 4BIKA 2K18A 3HY2A 4XS1A 1X5CA 4O32A 4NPBA 1I9DA 2B7KA 2XBQA 4XRDA 3EPTA 2WULA 4MDCA 2TIRA 2VIMA 3HDCA 1PN0A 3KTBA 2YZHA 2R0GA 5DBQA 4OFTA 2CVBA 3D4MA 2YPMA 3IXRA 4V2MA 1XWCA 1QGVA 3NIVA 3K8NA 4WF4A 2WDUA 1H75A 3F3QA 4EO3A 2AAWA 3GL3A 4RI6A 4XS4B 4K0NA 2GZYA 2I3YA 1A2JA 4V2LA 5J5NA 5F0GA 1JLVA 3UOMA 2TRXA 4EL1A 2CAQA 2VCVA 1JHBA 4Q5NA 2L57A 4IS0A 1ZYQB 2L6DA 3TOTA 5BMUA 4MLYA 4JE1A 3E3EA 4V1Ap 3FZ4A 1CQHA 3KXOA 2X8HA 2J23A 1PL1A 1VF3A 1Z6NA 3CTFA 1SL1B 5EVOA 1FO5A 3UARA 4FYBA 2OA7A 1GRXA 4ZXGA 3GURA 1Z7RA 2JZTA 3QAGA 2AUVA 5ABRA 1SYRA 3D22A 1H4OA 1XOAA 2H1DA 5JWRB 5EY6A 4MF6A 1M2DA 2H72A 3UAPA 1THXA 3KMOA 4KDXA 2CX4A 4EIQA 9GSSA 4I2UA 3LGCA 3Q19A 1A0RP 3GL5A 2X8GA 3RAZA 2A4HA 1T8EB 4HOJA 3WGXA 3D0ZA 2PGTA 2GLRA 2VCZA 3L9UA 2PVQA 3NOFA 2QKEA 1GTAA 2VAFA 2VOCA 5COHA 1TK5B 5CAXA 1YDKA 1SENA 2WCIA 4V1Ag 2LNSA 7GSSA 1SK1A 4WBJA 1GSEA 5IMVA 2GSQA 1YF0A 1TKDB 3PR8A 1R5PA 3G7JA 3C73A 4DVCA 3ERFA 4YQVA 4G2EA 2KHPA 1PMTA 2LJKA 4AJ7A 2LNTA 1FW1A 2H30A 3GKKA 2DKHA 4JZQA 4MABA 2GT6A 5CRDA 3TKSA 3L9VA 3I9V2 4KCEA 1THOA 2CZ3A 5GZZB 3ZMLA 3FK8A 3N5OA 1A0FA 1HD2A 3D4TA 1WIKA 4TR1B 3KMNA 2VCXA 2F8AA 4IJIA 3TJBA 4MF7A 1C72A 1MDJA 3W6GA 3IAM2 3O6TA 2PVOC 4FO5A 3LW9A 1U3AA 3ZITA 4D73A 2LQOA 1ABAA 5A4VA 4FQUA 4N0VA 4USSA 4MZWA 4HJMA 3UEMA 4F03A 4FYCA 2E0QA 4GF0A 4OD7A 2TRCP 5IIZA 2HYXA 2DMMA 4XCSA 3MYDA 1BQ7A 1V9WA 1TXXA 3IOSA 2DIZA 1HNBA 2IMIA 1OE8A 1ST9A 4ZB6A 4ZBDA 1T7PB 4JR6A 1T00A 4XS6A 4YAPA 1ML6A 4HJ2A 1GSYA 3GIXA 2YV7A 1ACVA 3GV1A 3VPTA 4O5UA 3EC3A 2IFQA 2E2MA 3GSTA 2FA4A 3BCKA 6GSVA 3PPUA 1YKCA 3M9KA 1GSFA 2WB9A 2XC2A 5HR0A 3RPPA 2H6ZA 3C71A 3MAKA 4HDEA 1MD3A 4EKZA 4HU9A 2EC4A 1K0NA 2KP1A 2BJXA 5DVBA 5HR2A 4G19A 3J7Yk 2R0PA 4LL4B 3FYGA 3QAVA 1JZWA 4BVXB 2M72A 2EIRA 2AB6A 5A4WA 4ECCA 3U6VA 1M3IA 5ECSA 4FIWA 4NV2A 4H86A 2V2GA 5CYYA 3HZ8A 2XHFA 1PSQA 3U5RE 2PU9C 1TP9A 4L5OA 2YWIA 1RW1A 3KP9A 1AIUA 3ZLPA 3S9FA 1GTUA 1OC8A 3KEBA 2KOKA 2L5LA 1N2AA 3G7YA 4L0UA 3VWXA 2R2JA 3IV4A 4ZBAA 3A3TA 1Z3EA 1XWAA 3A2WA 5G5FA 4NXIA 1V2AA 3F8UA 2HNLA 2VO4A 2DJ1A 3KM6A 2YV9A 4MH3A 4GTUA 2NTOA 4K5SA 5KN3A 1F9MA 3AY8A 5H5QA 3TRXA 1TRSA 2B1LA 2RLIA 2H01A 2QSIA 2V6OA 4O7HA 3UL3A 5ELGA 1XWKA 2L4QA 5AIVA 4J56E 5A4UA 2DIYA 2E2GA 1YKAA 5D73A 3EMPA 3VPQA 3CYNA 4N30A 3IK9A 5L71A 2B7JA 4DSQA 1O7UA 4Z2RA 3VK9A 2ON7A 2YP6A 1S3DA 4BVYB 3O3TA 2OBKA 3RBTA 3MDKA 3HD5A 3W8SA 5D9WA 1OAZA 3FZAA 3RHCA 3M8NA 3OR5A 1BYEA 4FH8A 1PRXA 2QGVA 5ECOB 2O89A 2GSSA 1UN2A 5DALB 4GQCA 3HZ4A 4K2XA 3HJMA 1A8YA 1PKZA 5KN1A 3GKXA 12GSA 1E2YA 2WS2A 3PH9A 1S3AA 2YOIA 2FWHA 1K0DA 1VF1A 4PNGA 2FCHA 4PQHA 4N11A 1Z7PA 4G0LA 2BTOT 5DQYA 1MD4A 4IP6A 1T1VA 4POLA 2DJ2A 3IHQA 2V32A 2VLUA 19GSA 1A8LA 5HFKA 4XHMA 3CSIA 4GCIA 4EC0A 4K7NA 1TI3A 2VLVA 2AV4A 2AJQB 3VI5A 2IWTA 3KJYA 4NMUA 2FY6A 1EZKA 2DLXA 2LV3A 1G0TA 2WFCA 1XIYA 5G5EA 2H0GA 4NHZA 1XG8A 5INYA 3KP8A 4F2IA 4AJ6A 3TKSE 1NM3A 2MBSA 4F0CA 1TRVA 1A2LA 3O76A 4IN0A 3I43A 1SJ6A 4PQIA 3Q6OA 2IN3A 1GTBA 4DSSB 3R2QA 4ZB8A 4ECBA 1FOHA 2VL2C 3F6DA 1TDIA 2K6VA 3EVIA 4HU7A 3D6IA 4XS4A 2GQKA 1LBKA 1T4ZA 3EWLA 3H1NA 2J9HA 1F3BA 2FNOA 3WD6A 1OC9B 5IMCA 4X0XA 3TRPA 3ZTLA 5IOWA 3FRCA 2H1BA 1OKTA 2CZ2A 1UVZA 3DIEA 1PN9A 3IBHA 2MMAA 1K0AA 1O73A 4WXTA 3EYTA 1B4QA 2HLSA 2QC7A 4KSMA 3FMWA 1ERUA 4KGIA 2LJRA 4L5LA 3QD9A 2MMZA 5HR1A 3M3MA 1EV4A 3QDNA 4O92A 1URMA 4PTSA 4TR0A 1YEXA 11GSA 2H1GA 2HSYA 1DE1A 2NPBA 2MMNA 2I1UA 2X99A 4N0ZA 1JZOA 2M80A 1XPVA 4G9HA 4HZ2A 4L8EA 1SKSB 2WRTA 5G2ZA 2EIQA 4WETA 4A5PA 4TR3A 4LMVA 1SK0A 4Q5QA 1OVNA 3FW2A 14GSA 1SJZA 3W8JA 1F3AA 3LYKA 3CBUA 4ZILA 3A2XA 4CHSA 2C0EA 2R6KA 4KDYA 2REMA 3G7IA 4TRXA 4POBA 1YF1A 4RUVA 1O6JA 3GNJA 2PPTA 2ES7A 1IYHA 2OKAA 4EF0A 1EP8A 6GSYA 4YAVA 3E9JB 3VLNA 2HRAA 1GL8A 2GZPA 3PINA 1BG5A 3L78A 1GP1A 4IJ3A 4K6XA 2ZNMA 4PURA 2H66A 1F6MC 3I6AA 1SKWB 5IM9A 1FG4A 1ON4A 2H0HA 2EIOA 1O8XA 3M0FA 1DUGA 5DJLA 3V1WA 2H73A 4ID0A 4J57E 4F9ZA 3GX0A 2CVKA 3QAWA 3EINA 4DEJA 1GLPA 2MBTA 4XRAA 3R3EA 4P3YB 2R3XA 3H93A 3KH7A 5B8AA 2P5QA 3ZVJD 1K3OA 1YJ6A 4ILFA 17GSA 4JRRA 4KUNA 3TKQA 3ERWA 5KN2A 1QQ2A 1M2AA 4X43A 1E6BA 1X9SB 1KNGA 5F8BA 3JCML 2HE3A 2CAIA 3IC4A 4K7IA 3TJKA 1W4VA 2I9HA 1QK8A 5IPHA 1V57A 13GSA 1ZCPA 5D93A 4O5RA 3GMFA 3QMXA 4TXOB 4TR1A 1IYIA 3TGZA 2L6CA 2C3QA 10GSA 3GKMA 2CT6A 1FHEA 4CY8A 1QMVA 4TR4A 3VI7A 1V98A 1Y25A 4FYUA 4MJEA 3WGDA 4KAEA 2GQLA 2LS5A 1G6WA 4TKYA 3QFBC 5J3RA 3FR3A 1GTIA 1OYJA 2GZZA 2MMOA 4I97A 2L4CA 1WWJA 2B1KA 2WJUA 2LSTA 5DAKB 4IQAA 1RK4A 3FKFA 1ZYEA 1V40A 4KX4A 3HHVA 3GN3A 3CSHA 5DCGA 4ZIJA 1AUCA 2DKIA 1XVWA 4BL7B 1O85A 1XVQA 2LRTA 2O8VB 4TW5A 4WKWA 2ZCTA 4IELA 3EU4A 4OCEA 3KGKA 1ERTA 1PGTA 4Z2TA 4CW9A 2JSYA 4ECJA 5IO0A 3F4SA 3CMIA 3MNGA 1TI1A 1YZXA 1TRUA 2CV4A 2YJ7A 1G7EA 4JU5A 5ECQB 4G0KA 3LG6A 1TK0B 3F63A 6GSWA 3BJ5A 3F4RA 4DSRA 2QA2A 2C80A 3APSA 4BVXA 2NDOA 5IPGA 2OACA 1ZZYA 1PX7A 2I4AA 1GSUA 2A2PA 2DJ3A 4BA7A 4RI7A 2JZSA 3ERGA 1WOUA 1VF2A 4EVMA 2H70A 4HUAA 2VL3A 4KW6A 4BWSA 2X64A 5D9XA 3VWWA 1MEKA 2FGXA 2GSTA 1SJIA 2B3SA 2IMFA 1SD9A 3LYPA 1TU8A 3KD0A 3WT2A 1GNEA 1WP0A 3WYWA 3D21A 3KIJA 2GGTA 3ZIJA 2FA8A 5IMFA 1GNWA 1A2MA 5C00A 3FZ9A 1Z9HA 2HZFA 4X4JA 6GSTA 4MCUA 3QFAC 2VM1A 1G6YA 5B8BA 1J9BA 4MF5A 2KP2A 3FHKA 4KB3A 4TVEA 3IK7A 2IJYA 4OO5A 2F51A 3L4NA 1R4WA 3H4KA 1AC1A 4IGJA 4MP4A 3DD3A 1ZGNA 3HKRA 4LA1A 1K0OA 1LJRA 3J7Yb 4IKHA 2ALBA 4OCFA 1EV9A
chains in the Genus database with same CATH topology
2O87A 4I5QA 4ECIA 4K9ZA 1TU7A 1OKDA 3UMAA 2FUG2 4XIHA 3DGQA 1B4PA 4IP1A 4BVYA 4OWYA 2N5FA 2P0GA 1ILOA 3MWHA 1EEJA 5HQPA 5J4UA 3D5JA 1M9AA 4OMVA 3LXZA 3BD2A 5D96A 5DALA 1XW9A 3KTLA 2F8FA 2C0DA 3CRUA 2IPAA 5G31A 2OADA 4Q5FA 1GSQA 3PGTA 4GRFA 4NWYA 3L0HA 2H6YA 5J9BA 4K1FA 6GSUA 2L5OA 3LXTA 1M7TA 3VURA 1HYUA 1K0CA 2HXKA 3MIXA 2RUFA 3TKRA 3DEXA 3RDWA 5AIXA 4L0WA 4ZBBA 1WPIA 5ENUA 3N9JA 4MPFA 4ICYA 2PERA 4GSNA 5LCZA 4KF9A 3MSZA 1DBYA 1J0FA 1V58A 2XPDA 1A24A 3C7MA 1XZOA 3NZNA 3CXGA 1KBNA 2FWFA 2R37A 4AJ8A 2HRNA 4TN8A 5EL8A 2YWMA 1VF4A 3CTGA 2CVDA 2G0FA 2HZEB 2OE0A 5B6NA 1YEPA 2DBCA 2LEGA 2LJAA 3Q18A 2C4JA 1X0RA 16GSA 4ULXA 5KOXA 1HNCA 2VL9A 2HFDA 1XWGA 1K3YA 1SKRB 3C8EA 1B9XC 5AN1A 2C0GA 4JBBA 3IRAA 4KE3A 1FAAA 4DSSA 4X1UA 2GTUA 2GT5A 2Z9SA 1EEMA 1FVJA 1HQOA 2GS3A 5LD0A 2YANA 3FY7A 2A2RA 2X49A 1JFUA 4OFNA 2XBIA 4WEYA 5DJMA 1OC9A 3A5WA 1XCCA 2V1MA 4EXJA 2ZUPA 4HQZA 3QCPA 3QPMA 5ID2A 3DKSA 1X9WB 2CA8A 3WGEA 1U88A 2FWGA 4G10A 4EDZA 22GSA 1G7OA 2HSMA 3LFLA 2YWNA 5D9VA 1X5EA 2X8CA 3UIWA 1GSDA 3P7XA 2V41A 3ZVJA 5HR3A 3F4TA 5FT3A 2PBJA 4IHUA 1KEBA 1AAZA 2DJKA 2A2SA 3EE2A 1DE2A 2R0CA 3A2VA 1JLWA 1BAYA 5CP1A 4HI7A 2VL2A 4XTSA 3IDVA 1KTEA 5CREA 2VD1A 3GTUB 2F9SA 4YKFA 1USBA 1XW5A 2VCWA 4NHWA 2ON5A 1N8JA 5ECLB 5ECKB 4PXOA 1GWCA 2HRKA 3IR4A 3SBCA 5ID2B 4E8EA 1X5DA 3ZYWA 3DVWA 2KUCA 4PGTA 2KLXA 5KN0A 3HJPA 4K0GA 1B8XA 5B6MA 1YQ1A 1QFNA 1F2EA 1B9YC 1SD8A 4CDOA 5CRHA 3GYKA 1MTCA 4KNDA 3VFIA 5GSSA 2K8SA 5GSTA 4CY6A 1WMJA 3P8WA 1QUWA 2FD3A 1FOVA 1MDIA 2V6KA 4KCAA 2JL4A 3QOUA 18GSA 3HVXA 2H0IA 3DRNA 3VWVA 4ZL8A 4KH7A 2IMDA 1FVKA 4EIPA 2VLTA 5J9CA 4POMA 1EOHA 4GXZA 2M46A 3L9SA 3SWLA 1BX9A 4TXOA 1XWBA 3DWVA 3RPNA 3EMXA 1EGRA 2O85A 2NVLA 3P90A 4IQ1A 2RUEA 3WT1A 3ZIVA 5E4WA 5G30A 3DXBA 4QL7A 4BPYA 5D9TA 4EDYA 3GX8A 2VD0A 4TOPA 5JCUA 3TRQA 1ZYNA 2JU5A 4Z2UA 2PMTA 1NW2A 1GLQA 2DJ0A 3TJGA 2IMEA 3FR6A 5DAKA 2O7KA 4K2DA 1TW9A 2C3NA 1PX6A 4K5RA 1SU9A 4BL7A 1U6TA 4GSTA 3BOAA 3CRTA 1WE0A 4MJAA 4ISDA 4ML6A 3IAS2 3BCIA 1FB6A 4HS1A 2LQQA 1WRYA 1JZRA 1U87A 3C1RA 2B5EA 5ECNB 3TCOA 1EOGA 5F05A 2IIYA 4YQMA 2NBSA 4I8BA 2GDRA 3TJJA 2C8UA 5IMZA 5F07A 4ZL7A 2QA1A 2RM5A 2HI7A 3DVXA 1NHOA 1GULA 2LKUA 1AQXA 5D8IA 3UJ1A 2YNXA 2AHEA 4I2TA 4MZBA 5IMAA 1XBSA 5G1KA 3ZREA 4F82A 3E0UA 3IHGA 4PQ1A 5J41A 1CQGA 2MYGA 1SK2A 3KH9A 4AGSA 1AW9A 1NHYA 3A5IA 3TKSC 1AXDA 4GQFA 2PWJA 3KZQA 1Y6EA 2P31A 1PKWA 3HVSA 1JZDA 4Q5RA 3GH6A 1O81A 2X4AA 1GH2A 4MJBA 3LQ7A 2H1AA 3F3RA 3ZFBA 3HA9A 2JSZA 3DMLA 4PUFC 5IO2A 4KA0A 3IC8A 1M2BA 1AQVA 4I6XA 3IPZA 3ZMKA 5B7CA 4MH2A 2N5BA 2JZRA 5ECMB 5C04A 2F3MA 5CNWA 5JWQB 2B5XA 1R26A 3C1SA 4E8HA 3CSJA 3FEUA 3F0IA 2YJHA 2VCQA 4HQSA 1PQNA 4MPGA 1XFLA 1R5AA 5KEJA 1T3BA 6GSXA 2PUKC 5CRWA 3KCMA 2C3TA 3GHAA 3GSSA 4N10A 3H8QA 1SL2B 5DQSA 1ZL9A 2HSHA 1F37A 5ECPB 1S3CA 4YKGA 2OE1A 4YH2A 2IL3A 5KOWA 5LNKe 2K9FA 4MK3A 4MNNA 2G2QA 1RQMA 2L59A 4JR4A 3DYRA 2P5RA 1GUKA 3FR9A 2R4VA 5ECIB 2DC5A 3TOUA 5DDLA 4HZ4A 1SL0B 2D2ZA 20GSA 8GSSA 1TTZA 4WR5A 1PL2A 4LLRA 2VCTA 3APQA 4D73B 4O5QA 1TK8B 1PD21 2R5GA 5ECHB 3TKPA 4KSOA 6GSSA 4MA9A 2H8LA 1GUHA 2PN8A 4WBRD 5AGYA 2A4VA 3TB2A 4OO4A 4V2NA 4MZCA 1FB0A 4K7OA 4POKA 5EPFA 4MJCA 2HT9A 1XOBA 2B6MA 5BRTA 1M99A 2E7PA 2CQ9A 3TJFA 4ZB9A 3IE3A 1PA3A 1EP7A 3BBYA 2IFQB 1Q4JA 3ED3A 4RQRA 4GWRA 3RHBA 4JEDA 2HZEA 4ML1A 2RM6A 3HCZA 1YY7A 2B5YA 2OJLA 2H6XA 1Z6MA 5JWOB 2H74A 1NSWA 2K8VA 1O8WA 5HFGA 1OE7A 5A5KA 3M9JA 3F6FA 5GAPD 2RIIA 2DMLA 3P2AA 1K0BA 2CX3A 1VGLA 2LUSA 5HFIA 2GVPA 3LSZA 1MDKA 2GQMA 5G1LA 4IW9A 4MMMA 4OFMA 2FWEA 4WF5A 4IBPA 1ZOFA 4Z7XA 4ACSA 3LEFA 5CO3A 3GKNA 2BMXA 2YCDA 3TDGA 5GAND 3I69A 1GSSA 3GUSA 1GUMA 1SYXA 3FZ5A 1B48A 4PX1A 3UBLA 3H79A 3APOA 4K8MA 2LTKA 1BJXA 1ZMAA 1LU4A 3IA1A 4ZL9A 2UZ8A 3ZRDA 5JCGA 1I5GA 3HYPA 1Q98A 3HXSA 4PNFA 3Q74A 1QXHA 2YN1A 3ME7A 3ZZXA 4EE0A 2FLSA 4QL9A 5IOXA 5JCWA 1K0MA 1UC7A 2H19A 2VM2A 4J2FA 2JACA 1X9MB 1TOFA 3ME8A 2WGRA 4AF2A 4F0BA 4TXVA 4G0IA 2N5AA 2MZCA 4GLTA 1HNAA 2WZ9A 1Z5YE 5E59A 3US3A 1UA5A 5FHIA 2LRCA 3GTUA 2DJJA 5DCHA 3UVTA 4LMWA 1A23A 5FWGA 3GH9A 1EGOA 4QQ7A 1ERVA 4KDUA 2YWOA 1TJDA 1R7HA 5IQYA 2HRFA 2DSAA 4GSSA 2YZUA 5CRGA 5H5RA 1BEDA 1AQWA 1U3IA 3UBKA 4YQUA 3EU3A 3EURA 3HJOA 5AISA 1XW6A 3GA4A 2C0FA 4PUAA 2XPEA 1ZYPA 1TRWA 2AYTA 2H71A 3ZFLA 3ZL5A 3ISOA 2GSRA 2OBIA 1W89A 3HVVA 2H76A 3LJRA 2LRNA 3GFKA 3GRXA 4IVFA 1T4YA 1VRSD 2C1YA 4EUYA 4NAXA 5ECRB 3F9UA 2I81A 1XXUA 1M9BA 1ERWA 3TUEA 5F06A 3G9BA 4LL1B 5H5SA 3VWUA 3LORA 2VUPA 2H75A 4RQXA 1EWXA 1WJKA 5IMDA 2IMKA 1J08A 2FHEA 5ELAA 3QR6A 2OE3A 4HEA2 1M0UA 4NV5A 1DSBA 3M1GA 4WR4A 3UVHA 4BWQA 1OC3A 2JADA 1K3LA 3LWAA 2K18A 3HY2A 4XS1A 1X5CA 4O32A 4NPBA 1I9DA 2B7KA 2XBQA 4XRDA 3EPTA 2WULA 4MDCA 2TIRA 2VIMA 3HDCA 1PN0A 3KTBA 2YZHA 2R0GA 5DBQA 4OFTA 2CVBA 3D4MA 2YPMA 3IXRA 4V2MA 1XWCA 1QGVA 3NIVA 3K8NA 4WF4A 2WDUA 1H75A 3F3QA 4EO3A 2AAWA 3GL3A 4RI6A 4XS4B 4K0NA 2GZYA 2I3YA 1A2JA 4V2LA 5J5NA 5F0GA 1JLVA 3UOMA 2TRXA 4EL1A 2CAQA 2VCVA 1JHBA 4Q5NA 2L57A 4IS0A 1ZYQB 2L6DA 3TOTA 5BMUA 4MLYA 4JE1A 3E3EA 4V1Ap 3FZ4A 1CQHA 3KXOA 2X8HA 2J23A 1PL1A 1VF3A 1Z6NA 3CTFA 1SL1B 5EVOA 1FO5A 3UARA 4FYBA 2OA7A 1GRXA 4ZXGA 3GURA 1Z7RA 2JZTA 3QAGA 2AUVA 5ABRA 1SYRA 3D22A 1H4OA 1XOAA 2H1DA 5JWRB 5EY6A 4MF6A 1M2DA 2H72A 3UAPA 1THXA 3KMOA 4KDXA 2CX4A 4EIQA 9GSSA 4I2UA 3LGCA 3Q19A 1A0RP 3GL5A 2X8GA 3RAZA 2A4HA 1T8EB 4HOJA 3WGXA 3D0ZA 2PGTA 2GLRA 2VCZA 3L9UA 2PVQA 3NOFA 2QKEA 1GTAA 2VAFA 2VOCA 5COHA 1TK5B 5CAXA 1YDKA 1SENA 2WCIA 4V1Ag 2LNSA 7GSSA 1SK1A 4WBJA 1GSEA 5IMVA 2GSQA 1YF0A 1TKDB 3PR8A 1R5PA 3G7JA 3C73A 4DVCA 3ERFA 4YQVA 4G2EA 2KHPA 1PMTA 2LJKA 4AJ7A 2LNTA 1FW1A 2H30A 3GKKA 2DKHA 4JZQA 4MABA 2GT6A 5CRDA 3TKSA 3L9VA 3I9V2 4KCEA 1THOA 2CZ3A 5GZZB 3ZMLA 3FK8A 3N5OA 1A0FA 1HD2A 3D4TA 1WIKA 4TR1B 3KMNA 2VCXA 2F8AA 4IJIA 3TJBA 4MF7A 1C72A 1MDJA 3W6GA 3IAM2 3O6TA 2PVOC 4FO5A 3LW9A 1U3AA 3ZITA 4D73A 2LQOA 1ABAA 5A4VA 4FQUA 4N0VA 4USSA 4MZWA 4HJMA 3UEMA 4F03A 4FYCA 2E0QA 4GF0A 4OD7A 2TRCP 5IIZA 2HYXA 2DMMA 4XCSA 3MYDA 1BQ7A 1V9WA 1TXXA 3IOSA 2DIZA 1HNBA 2IMIA 1OE8A 1ST9A 4ZB6A 4ZBDA 1T7PB 4JR6A 1T00A 4XS6A 4YAPA 1ML6A 4HJ2A 1GSYA 3GIXA 2YV7A 1ACVA 3GV1A 3VPTA 4O5UA 3EC3A 2IFQA 2E2MA 3GSTA 2FA4A 3BCKA 6GSVA 3PPUA 1YKCA 3M9KA 1GSFA 2WB9A 2XC2A 5HR0A 3RPPA 2H6ZA 3C71A 3MAKA 4HDEA 1MD3A 4EKZA 4HU9A 2EC4A 1K0NA 2KP1A 2BJXA 5DVBA 5HR2A 4G19A 3J7Yk 2R0PA 4LL4B 3FYGA 3QAVA 1JZWA 4BVXB 2M72A 2EIRA 2AB6A 5A4WA 4ECCA 3U6VA 5ECSA 4FIWA 4NV2A 4H86A 2V2GA 5CYYA 3HZ8A 2XHFA 1PSQA 3U5RE 2PU9C 1TP9A 4L5OA 2YWIA 1RW1A 3KP9A 1AIUA 3ZLPA 3S9FA 1GTUA 1OC8A 3KEBA 2KOKA 2L5LA 1N2AA 3G7YA 4L0UA 3VWXA 2R2JA 3IV4A 4ZBAA 3A3TA 1Z3EA 1XWAA 3A2WA 5G5FA 4NXIA 1V2AA 3F8UA 2HNLA 2VO4A 2DJ1A 3KM6A 2YV9A 4MH3A 4GTUA 2NTOA 4K5SA 5KN3A 1F9MA 3AY8A 5H5QA 3TRXA 1TRSA 2B1LA 2RLIA 2H01A 2QSIA 2V6OA 4O7HA 3UL3A 5ELGA 1XWKA 2L4QA 5AIVA 4J56E 5A4UA 2DIYA 2E2GA 1YKAA 5D73A 3EMPA 3VPQA 3CYNA 4N30A 3IK9A 5L71A 2B7JA 4DSQA 1O7UA 4Z2RA 3VK9A 2ON7A 2YP6A 1S3DA 4BVYB 3O3TA 2OBKA 3RBTA 3MDKA 3HD5A 3W8SA 5D9WA 1OAZA 3FZAA 3RHCA 3M8NA 3OR5A 1BYEA 4FH8A 1PRXA 2QGVA 5ECOB 2O89A 2GSSA 1UN2A 5DALB 4GQCA 3HZ4A 4K2XA 3HJMA 1A8YA 1PKZA 5KN1A 3GKXA 12GSA 1E2YA 2WS2A 3PH9A 1S3AA 2YOIA 2FWHA 1K0DA 1VF1A 4PNGA 2FCHA 4PQHA 4N11A 1Z7PA 4G0LA 2BTOT 5DQYA 1MD4A 4IP6A 1T1VA 4POLA 2DJ2A 3IHQA 2V32A 2VLUA 19GSA 1A8LA 5HFKA 4XHMA 3CSIA 4GCIA 4EC0A 4K7NA 1TI3A 2VLVA 2AV4A 2AJQB 3VI5A 2IWTA 3KJYA 4NMUA 2FY6A 1EZKA 2DLXA 2LV3A 1G0TA 2WFCA 1XIYA 5G5EA 2H0GA 4NHZA 5INYA 3KP8A 4F2IA 4AJ6A 3TKSE 1NM3A 2MBSA 4F0CA 1TRVA 1A2LA 3O76A 4IN0A 3I43A 1SJ6A 4PQIA 3Q6OA 2IN3A 1GTBA 4DSSB 3R2QA 4ZB8A 4ECBA 1FOHA 2VL2C 3F6DA 1TDIA 2K6VA 3EVIA 4HU7A 3D6IA 4XS4A 2GQKA 1LBKA 1T4ZA 3EWLA 3H1NA 2J9HA 1F3BA 2FNOA 3WD6A 1OC9B 5IMCA 4X0XA 3TRPA 3ZTLA 5IOWA 3FRCA 2H1BA 1OKTA 2CZ2A 1UVZA 3DIEA 1PN9A 3IBHA 2MMAA 1K0AA 1O73A 4WXTA 3EYTA 1B4QA 2HLSA 2QC7A 4KSMA 3FMWA 1ERUA 4KGIA 2LJRA 4L5LA 3QD9A 2MMZA 5HR1A 3M3MA 1EV4A 3QDNA 4O92A 1URMA 4PTSA 4TR0A 1YEXA 11GSA 2H1GA 2HSYA 1DE1A 2NPBA 2MMNA 2I1UA 2X99A 4N0ZA 1JZOA 2M80A 1XPVA 4G9HA 4HZ2A 4L8EA 1SKSB 2WRTA 5G2ZA 2EIQA 4WETA 4A5PA 4TR3A 4LMVA 1SK0A 4Q5QA 1OVNA 3FW2A 14GSA 1SJZA 3W8JA 1F3AA 3LYKA 3CBUA 4ZILA 3A2XA 4CHSA 2C0EA 2R6KA 4KDYA 2REMA 3G7IA 4TRXA 4POBA 1YF1A 4RUVA 1O6JA 3GNJA 2PPTA 2ES7A 1IYHA 2OKAA 4EF0A 1EP8A 6GSYA 4YAVA 3E9JB 3VLNA 2HRAA 1GL8A 2GZPA 3PINA 1BG5A 3L78A 1GP1A 4IJ3A 4K6XA 2ZNMA 4PURA 2H66A 1F6MC 3I6AA 1SKWB 5IM9A 1FG4A 1ON4A 2H0HA 2EIOA 1O8XA 3M0FA 1DUGA 5DJLA 3V1WA 2H73A 4ID0A 4J57E 4F9ZA 3GX0A 2CVKA 3QAWA 3EINA 4DEJA 1GLPA 2MBTA 4XRAA 3R3EA 4P3YB 2R3XA 3H93A 3KH7A 5B8AA 2P5QA 3ZVJD 1K3OA 1YJ6A 4ILFA 17GSA 4JRRA 4KUNA 3TKQA 3ERWA 5KN2A 1QQ2A 1M2AA 4X43A 1E6BA 1X9SB 1KNGA 5F8BA 3JCML 2HE3A 2CAIA 3IC4A 4K7IA 3TJKA 1W4VA 2I9HA 1QK8A 5IPHA 1V57A 13GSA 1ZCPA 5D93A 4O5RA 3GMFA 3QMXA 4TXOB 4TR1A 1IYIA 3TGZA 2L6CA 2C3QA 10GSA 3GKMA 2CT6A 1FHEA 4CY8A 1QMVA 4TR4A 3VI7A 1V98A 1Y25A 4FYUA 4MJEA 3WGDA 4KAEA 2GQLA 2LS5A 1G6WA 4TKYA 3QFBC 5J3RA 3FR3A 1GTIA 1OYJA 2GZZA 2MMOA 4I97A 2L4CA 1WWJA 2B1KA 2WJUA 2LSTA 5DAKB 4IQAA 1RK4A 3FKFA 1ZYEA 1V40A 4KX4A 3HHVA 3GN3A 3CSHA 5DCGA 4ZIJA 1AUCA 2DKIA 1XVWA 4BL7B 1O85A 1XVQA 2LRTA 2O8VB 4TW5A 4WKWA 2ZCTA 4IELA 3EU4A 4OCEA 3KGKA 1ERTA 1PGTA 4Z2TA 4CW9A 2JSYA 4ECJA 5IO0A 3F4SA 3CMIA 3MNGA 1TI1A 1YZXA 1TRUA 2CV4A 2YJ7A 1G7EA 4JU5A 5ECQB 4G0KA 3LG6A 1TK0B 3F63A 6GSWA 3BJ5A 3F4RA 4DSRA 2QA2A 2C80A 3APSA 4BVXA 2NDOA 5IPGA 2OACA 1ZZYA 1PX7A 2I4AA 1GSUA 2A2PA 2DJ3A 4BA7A 4RI7A 2JZSA 3ERGA 1WOUA 1VF2A 4EVMA 2H70A 4HUAA 2VL3A 4KW6A 4BWSA 2X64A 5D9XA 3VWWA 1MEKA 2FGXA 2GSTA 1SJIA 2B3SA 2IMFA 1SD9A 3LYPA 1TU8A 3KD0A 3WT2A 1GNEA 1WP0A 3WYWA 3D21A 3KIJA 2GGTA 3ZIJA 2FA8A 5IMFA 1GNWA 1A2MA 5C00A 3FZ9A 1Z9HA 2HZFA 4X4JA 6GSTA 4MCUA 3QFAC 2VM1A 1G6YA 5B8BA 1J9BA 4MF5A 2KP2A 3FHKA 4KB3A 4TVEA 3IK7A 2IJYA 4OO5A 2F51A 3L4NA 1R4WA 3H4KA 1AC1A 4IGJA 4MP4A 3DD3A 1ZGNA 3HKRA 4LA1A 1K0OA 1LJRA 3J7Yb 4IKHA 2ALBA 4OCFA 1EV9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O87 A;  4I5Q A;  4ECI A;  4K9Z A;  1TU7 A;  1OKD A;  3UMA A;  2FUG 2;  4XIH A;  3DGQ A;  1B4P A;  4IP1 A;  4BVY A;  4OWY A;  2N5F A;  2P0G A;  1ILO A;  3MWH A;  1EEJ A;  5HQP A;  5J4U A;  3D5J A;  1M9A A;  4OMV A;  3LXZ A;  3BD2 A;  5D96 A;  5DAL A;  1XW9 A;  3KTL A;  2F8F A;  2C0D A;  3CRU A;  2IPA A;  5G31 A;  2OAD A;  4Q5F A;  1GSQ A;  3PGT A;  4GRF A;  4NWY A;  3L0H A;  2H6Y A;  5J9B A;  4K1F A;  6GSU A;  2L5O A;  3LXT A;  1M7T A;  3VUR A;  1HYU A;  1K0C A;  2HXK A;  2RUF A;  3TKR A;  3DEX A;  3RDW A;  5AIX A;  4L0W A;  4ZBB A;  1WPI A;  5ENU A;  3N9J A;  4MPF A;  2PER A;  4GSN A;  5LCZ A;  3MSZ A;  1DBY A;  1J0F A;  1V58 A;  2XPD A;  1A24 A;  3C7M A;  1XZO A;  3NZN A;  3CXG A;  1KBN A;  2FWF A;  2R37 A;  4AJ8 A;  2HRN A;  4TN8 A;  5EL8 A;  2YWM A;  1VF4 A;  3CTG A;  2CVD A;  2G0F A;  2HZE B;  2OE0 A;  5B6N A;  1YEP A;  2DBC A;  2LEG A;  2LJA A;  3Q18 A;  2C4J A;  1X0R A;  16GS A;  4ULX A;  1HNC A;  2VL9 A;  2HFD A;  1XWG A;  1K3Y A;  1SKR B;  3C8E A;  1B9X C;  5AN1 A;  2C0G A;  4JBB A;  3IRA A;  4KE3 A;  1FAA A;  4DSS A;  4X1U A;  2GTU A;  2GT5 A;  2Z9S A;  1EEM A;  1FVJ A;  1HQO A;  2GS3 A;  5LD0 A;  2YAN A;  3FY7 A;  2A2R A;  1JFU A;  4OFN A;  2XBI A;  4WEY A;  5DJM A;  1OC9 A;  3A5W A;  1XCC A;  2V1M A;  4EXJ A;  2ZUP A;  4HQZ A;  3QCP A;  3QPM A;  5ID2 A;  3DKS A;  1X9W B;  2CA8 A;  3WGE A;  1U88 A;  2FWG A;  4G10 A;  4EDZ A;  22GS A;  1G7O A;  3LFL A;  2YWN A;  5D9V A;  1X5E A;  2X8C A;  3UIW A;  1GSD A;  3P7X A;  2V41 A;  3ZVJ A;  5HR3 A;  3F4T A;  5FT3 A;  2PBJ A;  4IHU A;  1KEB A;  1AAZ A;  2DJK A;  2A2S A;  3EE2 A;  1DE2 A;  3A2V A;  1JLW A;  1BAY A;  5CP1 A;  4HI7 A;  2VL2 A;  4XTS A;  3IDV A;  1KTE A;  5CRE A;  2VD1 A;  3GTU B;  2F9S A;  1USB A;  1XW5 A;  2VCW A;  4NHW A;  2ON5 A;  1N8J A;  5ECL B;  5ECK B;  4PXO A;  1GWC A;  3IR4 A;  3SBC A;  5ID2 B;  4E8E A;  1X5D A;  3ZYW A;  3DVW A;  2KUC A;  4PGT A;  2KLX A;  5KN0 A;  3HJP A;  4K0G A;  1B8X A;  5B6M A;  1YQ1 A;  1QFN A;  1F2E A;  1B9Y C;  1SD8 A;  4CDO A;  5CRH A;  3GYK A;  1MTC A;  4KND A;  3VFI A;  5GSS A;  2K8S A;  5GST A;  1WMJ A;  3P8W A;  1QUW A;  2FD3 A;  1FOV A;  1MDI A;  2V6K A;  4KCA A;  2JL4 A;  3QOU A;  18GS A;  3HVX A;  2H0I A;  3DRN A;  3VWV A;  4ZL8 A;  4KH7 A;  2IMD A;  1FVK A;  2VLT A;  5J9C A;  4POM A;  1EOH A;  4GXZ A;  2M46 A;  3L9S A;  3SWL A;  1BX9 A;  4TXO A;  1XWB A;  3DWV A;  3RPN A;  3EMX A;  1EGR A;  2O85 A;  2NVL A;  3P90 A;  4IQ1 A;  2RUE A;  3WT1 A;  3ZIV A;  5E4W A;  5G30 A;  3DXB A;  4QL7 A;  4BPY A;  5D9T A;  4EDY A;  3GX8 A;  2VD0 A;  4TOP A;  5JCU A;  3TRQ A;  2JU5 A;  2PMT A;  1NW2 A;  1GLQ A;  2DJ0 A;  3TJG A;  2IME A;  3FR6 A;  5DAK A;  2O7K A;  4K2D A;  1TW9 A;  2C3N A;  1PX6 A;  1SU9 A;  4BL7 A;  1U6T A;  4GST A;  3BOA A;  3CRT A;  1WE0 A;  4MJA A;  4ISD A;  4ML6 A;  3IAS 2;  3BCI A;  1FB6 A;  4HS1 A;  2LQQ A;  1WRY A;  1JZR A;  1U87 A;  3C1R A;  2B5E A;  5ECN B;  3TCO A;  1EOG A;  5F05 A;  2IIY A;  4YQM A;  2NBS A;  4I8B A;  2GDR A;  3TJJ A;  2C8U A;  5IMZ A;  5F07 A;  4ZL7 A;  2RM5 A;  2HI7 A;  3DVX A;  1NHO A;  1GUL A;  2LKU A;  1AQX A;  5D8I A;  3UJ1 A;  2YNX A;  2AHE A;  4I2T A;  4MZB A;  5IMA A;  1XBS A;  5G1K A;  3ZRE A;  4F82 A;  3E0U A;  4PQ1 A;  5J41 A;  1CQG A;  2MYG A;  1SK2 A;  3KH9 A;  4AGS A;  1AW9 A;  1NHY A;  3TKS C;  1AXD A;  4GQF A;  2PWJ A;  3KZQ A;  1Y6E A;  2P31 A;  1PKW A;  3HVS A;  1JZD A;  4Q5R A;  3GH6 A;  1O81 A;  1GH2 A;  4MJB A;  3LQ7 A;  2H1A A;  3F3R A;  3ZFB A;  3HA9 A;  2JSZ A;  3DML A;  4PUF C;  5IO2 A;  4KA0 A;  1M2B A;  1AQV A;  4I6X A;  3IPZ A;  3ZMK A;  5B7C A;  4MH2 A;  2N5B A;  2JZR A;  5ECM B;  5C04 A;  2F3M A;  5CNW A;  5JWQ B;  2B5X A;  1R26 A;  3C1S A;  4E8H A;  3CSJ A;  3FEU A;  3F0I A;  2YJH A;  2VCQ A;  4HQS A;  1PQN A;  4MPG A;  1XFL A;  1R5A A;  5KEJ A;  1T3B A;  6GSX A;  2PUK C;  5CRW A;  3KCM A;  2C3T A;  3GHA A;  3GSS A;  4N10 A;  3H8Q A;  1SL2 B;  5DQS A;  1ZL9 A;  2HSH A;  1F37 A;  5ECP B;  1S3C A;  2OE1 A;  4YH2 A;  2IL3 A;  5LNK e;  2K9F A;  4MK3 A;  2G2Q A;  1RQM A;  2L59 A;  4JR4 A;  3DYR A;  2P5R A;  1GUK A;  3FR9 A;  2R4V A;  5ECI B;  2DC5 A;  3TOU A;  5DDL A;  4HZ4 A;  1SL0 B;  2D2Z A;  20GS A;  8GSS A;  1TTZ A;  4WR5 A;  1PL2 A;  4LLR A;  2VCT A;  3APQ A;  4D73 B;  1TK8 B;  1PD2 1;  2R5G A;  5ECH B;  3TKP A;  4KSO A;  6GSS A;  4MA9 A;  2H8L A;  1GUH A;  2PN8 A;  4WBR D;  5AGY A;  2A4V A;  3TB2 A;  4OO4 A;  4V2N A;  4MZC A;  1FB0 A;  4K7O A;  4POK A;  5EPF A;  4MJC A;  2HT9 A;  1XOB A;  2B6M A;  1M99 A;  2E7P A;  2CQ9 A;  3TJF A;  4ZB9 A;  3IE3 A;  1PA3 A;  1EP7 A;  3BBY A;  2IFQ B;  1Q4J A;  3ED3 A;  4RQR A;  4GWR A;  3RHB A;  4JED A;  2HZE A;  4ML1 A;  2RM6 A;  3HCZ A;  1YY7 A;  2B5Y A;  2OJL A;  2H6X A;  1Z6M A;  5JWO B;  2H74 A;  1NSW A;  2K8V A;  1O8W A;  5HFG A;  1OE7 A;  5A5K A;  3M9J A;  3F6F A;  5GAP D;  2RII A;  2DML A;  3P2A A;  1K0B A;  2CX3 A;  1VGL A;  2LUS A;  5HFI A;  2GVP A;  3LSZ A;  1MDK A;  2GQM A;  5G1L A;  4IW9 A;  4MMM A;  4OFM A;  2FWE A;  4WF5 A;  4IBP A;  1ZOF A;  4Z7X A;  4ACS A;  3LEF A;  5CO3 A;  3GKN A;  2BMX A;  2YCD A;  3TDG A;  5GAN D;  3I69 A;  1GSS A;  3GUS A;  1GUM A;  1SYX A;  3FZ5 A;  1B48 A;  4PX1 A;  3UBL A;  3H79 A;  3APO A;  4K8M A;  2LTK A;  1BJX A;  1ZMA A;  1LU4 A;  3IA1 A;  4ZL9 A;  3ZRD A;  5JCG A;  1I5G A;  3HYP A;  1Q98 A;  3HXS A;  4PNF A;  3Q74 A;  1QXH A;  2YN1 A;  3ME7 A;  3ZZX A;  4EE0 A;  2FLS A;  4QL9 A;  5IOX A;  5JCW A;  1K0M A;  1UC7 A;  2H19 A;  2VM2 A;  4J2F A;  2JAC A;  1X9M B;  1TOF A;  3ME8 A;  2WGR A;  4AF2 A;  4F0B A;  4TXV A;  2N5A A;  2MZC A;  4GLT A;  1HNA A;  2WZ9 A;  1Z5Y E;  5E59 A;  3US3 A;  1UA5 A;  5FHI A;  2LRC A;  3GTU A;  2DJJ A;  5DCH A;  3UVT A;  4LMW A;  1A23 A;  5FWG A;  3GH9 A;  1EGO A;  4QQ7 A;  1ERV A;  4KDU A;  2YWO A;  1TJD A;  1R7H A;  5IQY A;  2HRF A;  2DSA A;  4GSS A;  2YZU A;  5CRG A;  5H5R A;  1BED A;  1AQW A;  1U3I A;  3UBK A;  4YQU A;  3EU3 A;  3EUR A;  3HJO A;  5AIS A;  1XW6 A;  3GA4 A;  2C0F A;  4PUA A;  2XPE A;  1TRW A;  2AYT A;  2H71 A;  3ZFL A;  3ZL5 A;  3ISO A;  2GSR A;  2OBI A;  1W89 A;  3HVV A;  2H76 A;  3LJR A;  2LRN A;  3GFK A;  3GRX A;  4IVF A;  1T4Y A;  1VRS D;  2C1Y A;  4EUY A;  4NAX A;  5ECR B;  3F9U A;  2I81 A;  1XXU A;  1M9B A;  1ERW A;  3TUE A;  5F06 A;  3G9B A;  4LL1 B;  5H5S A;  3VWU A;  3LOR A;  2VUP A;  2H75 A;  4RQX A;  1EWX A;  1WJK A;  5IMD A;  2IMK A;  1J08 A;  2FHE A;  5ELA A;  3QR6 A;  2OE3 A;  4HEA 2;  1M0U A;  4NV5 A;  1DSB A;  3M1G A;  4WR4 A;  3UVH A;  4BWQ A;  1OC3 A;  2JAD A;  1K3L A;  3LWA A;  2K18 A;  3HY2 A;  4XS1 A;  1X5C A;  4O32 A;  4NPB A;  1I9D A;  2B7K A;  2XBQ A;  4XRD A;  2WUL A;  4MDC A;  2TIR A;  2VIM A;  3HDC A;  3KTB A;  2YZH A;  5DBQ A;  4OFT A;  2CVB A;  3D4M A;  2YPM A;  3IXR A;  4V2M A;  1XWC A;  1QGV A;  3NIV A;  3K8N A;  4WF4 A;  2WDU A;  1H75 A;  3F3Q A;  4EO3 A;  2AAW A;  3GL3 A;  4RI6 A;  4XS4 B;  4K0N A;  2GZY A;  2I3Y A;  1A2J A;  4V2L A;  5J5N A;  5F0G A;  1JLV A;  3UOM A;  2TRX A;  4EL1 A;  2CAQ A;  2VCV A;  1JHB A;  4Q5N A;  2L57 A;  4IS0 A;  1ZYQ B;  2L6D A;  3TOT A;  4MLY A;  4JE1 A;  3E3E A;  4V1A p;  3FZ4 A;  1CQH A;  3KXO A;  2X8H A;  2J23 A;  1PL1 A;  1VF3 A;  1Z6N A;  3CTF A;  1SL1 B;  5EVO A;  1FO5 A;  3UAR A;  4FYB A;  2OA7 A;  1GRX A;  4ZXG A;  3GUR A;  1Z7R A;  2JZT A;  3QAG A;  2AUV A;  5ABR A;  1SYR A;  3D22 A;  1H4O A;  1XOA A;  2H1D A;  5JWR B;  5EY6 A;  4MF6 A;  1M2D A;  2H72 A;  3UAP A;  1THX A;  3KMO A;  4KDX A;  2CX4 A;  9GSS A;  4I2U A;  3LGC A;  3Q19 A;  1A0R P;  3GL5 A;  2X8G A;  3RAZ A;  1T8E B;  4HOJ A;  3WGX A;  3D0Z A;  2PGT A;  2GLR A;  2VCZ A;  3L9U A;  2PVQ A;  3NOF A;  2QKE A;  1GTA A;  2VAF A;  2VOC A;  5COH A;  1TK5 B;  5CAX A;  1YDK A;  1SEN A;  2WCI A;  4V1A g;  2LNS A;  7GSS A;  1SK1 A;  4WBJ A;  1GSE A;  5IMV A;  2GSQ A;  1YF0 A;  1TKD B;  3PR8 A;  1R5P A;  3G7J A;  3C73 A;  4DVC A;  3ERF A;  4YQV A;  4G2E A;  2KHP A;  1PMT A;  2LJK A;  4AJ7 A;  2LNT A;  1FW1 A;  2H30 A;  3GKK A;  4JZQ A;  4MAB A;  2GT6 A;  5CRD A;  3TKS A;  3L9V A;  3I9V 2;  4KCE A;  1THO A;  2CZ3 A;  5GZZ B;  3ZML A;  3FK8 A;  3N5O A;  1A0F A;  1HD2 A;  3D4T A;  1WIK A;  4TR1 B;  3KMN A;  2VCX A;  2F8A A;  4IJI A;  3TJB A;  4MF7 A;  1C72 A;  1MDJ A;  3W6G A;  3IAM 2;  3O6T A;  2PVO C;  4FO5 A;  1U3A A;  3ZIT A;  4D73 A;  2LQO A;  1ABA A;  5A4V A;  4N0V A;  4MZW A;  4HJM A;  3UEM A;  4F03 A;  4FYC A;  2E0Q A;  4GF0 A;  4OD7 A;  2TRC P;  5IIZ A;  2HYX A;  2DMM A;  4XCS A;  1BQ7 A;  1V9W A;  1TXX A;  3IOS A;  2DIZ A;  1HNB A;  2IMI A;  1OE8 A;  1ST9 A;  4ZB6 A;  4ZBD A;  1T7P B;  4JR6 A;  1T00 A;  4XS6 A;  4YAP A;  1ML6 A;  4HJ2 A;  1GSY A;  3GIX A;  2YV7 A;  1ACV A;  3GV1 A;  3VPT A;  3EC3 A;  2IFQ A;  2E2M A;  3GST A;  2FA4 A;  3BCK A;  6GSV A;  1YKC A;  3M9K A;  1GSF A;  2WB9 A;  2XC2 A;  5HR0 A;  3RPP A;  2H6Z A;  3C71 A;  3MAK A;  4HDE A;  1MD3 A;  4EKZ A;  4HU9 A;  2EC4 A;  1K0N A;  2KP1 A;  2BJX A;  5DVB A;  5HR2 A;  4G19 A;  3J7Y k;  4LL4 B;  3FYG A;  3QAV A;  1JZW A;  2M72 A;  2EIR A;  2AB6 A;  5A4W A;  4ECC A;  3U6V A;  5ECS A;  4FIW A;  4NV2 A;  4H86 A;  2V2G A;  5CYY A;  3HZ8 A;  2XHF A;  1PSQ A;  3U5R E;  2PU9 C;  1TP9 A;  4L5O A;  2YWI A;  1RW1 A;  3KP9 A;  1AIU A;  3ZLP A;  3S9F A;  1GTU A;  1OC8 A;  3KEB A;  2KOK A;  2L5L A;  1N2A A;  3G7Y A;  4L0U A;  3VWX A;  2R2J A;  3IV4 A;  4ZBA A;  3A3T A;  1Z3E A;  1XWA A;  3A2W A;  5G5F A;  4NXI A;  1V2A A;  3F8U A;  2HNL A;  2VO4 A;  2DJ1 A;  3KM6 A;  2YV9 A;  4MH3 A;  4GTU A;  2NTO A;  5KN3 A;  1F9M A;  3AY8 A;  5H5Q A;  3TRX A;  1TRS A;  2B1L A;  2RLI A;  2H01 A;  2QSI A;  2V6O A;  4O7H A;  3UL3 A;  5ELG A;  1XWK A;  2L4Q A;  5AIV A;  4J56 E;  5A4U A;  2DIY A;  2E2G A;  1YKA A;  5D73 A;  3EMP A;  3VPQ A;  3CYN A;  4N30 A;  3IK9 A;  5L71 A;  2B7J A;  4DSQ A;  1O7U A;  3VK9 A;  2ON7 A;  2YP6 A;  1S3D A;  3O3T A;  2OBK A;  3RBT A;  3MDK A;  3HD5 A;  3W8S A;  5D9W A;  1OAZ A;  3FZA A;  3RHC A;  3M8N A;  3OR5 A;  1BYE A;  4FH8 A;  1PRX A;  2QGV A;  5ECO B;  2O89 A;  2GSS A;  1UN2 A;  5DAL B;  4GQC A;  3HZ4 A;  3HJM A;  1A8Y A;  1PKZ A;  5KN1 A;  3GKX A;  12GS A;  1E2Y A;  2WS2 A;  3PH9 A;  1S3A A;  2YOI A;  2FWH A;  1K0D A;  1VF1 A;  4PNG A;  2FCH A;  4PQH A;  4N11 A;  1Z7P A;  2BTO T;  5DQY A;  1MD4 A;  4IP6 A;  1T1V A;  4POL A;  2DJ2 A;  3IHQ A;  2V32 A;  2VLU A;  19GS A;  1A8L A;  5HFK A;  4XHM A;  3CSI A;  4GCI A;  4EC0 A;  4K7N A;  1TI3 A;  2VLV A;  2AV4 A;  2AJQ B;  3VI5 A;  2IWT A;  3KJY A;  4NMU A;  2FY6 A;  1EZK A;  2DLX A;  2LV3 A;  1G0T A;  2WFC A;  1XIY A;  5G5E A;  2H0G A;  4NHZ A;  5INY A;  3KP8 A;  4F2I A;  4AJ6 A;  3TKS E;  1NM3 A;  2MBS A;  4F0C A;  1TRV A;  1A2L A;  3O76 A;  4IN0 A;  3I43 A;  1SJ6 A;  4PQI A;  3Q6O A;  2IN3 A;  1GTB A;  4DSS B;  3R2Q A;  4ZB8 A;  4ECB A;  2VL2 C;  3F6D A;  1TDI A;  2K6V A;  3EVI A;  4HU7 A;  3D6I A;  4XS4 A;  2GQK A;  1LBK A;  1T4Z A;  3EWL A;  3H1N A;  2J9H A;  1F3B A;  2FNO A;  3WD6 A;  1OC9 B;  5IMC A;  4X0X A;  3TRP A;  3ZTL A;  5IOW A;  3FRC A;  2H1B A;  1OKT A;  2CZ2 A;  1UVZ A;  3DIE A;  1PN9 A;  3IBH A;  2MMA A;  1K0A A;  1O73 A;  4WXT A;  3EYT A;  1B4Q A;  2HLS A;  2QC7 A;  4KSM A;  1ERU A;  4KGI A;  2LJR A;  4L5L A;  3QD9 A;  2MMZ A;  5HR1 A;  3M3M A;  1EV4 A;  3QDN A;  4O92 A;  1URM A;  4TR0 A;  1YEX A;  11GS A;  2H1G A;  2HSY A;  1DE1 A;  2NPB A;  2MMN A;  2I1U A;  2X99 A;  4N0Z A;  1JZO A;  2M80 A;  1XPV A;  4G9H A;  4HZ2 A;  4L8E A;  1SKS B;  2WRT A;  5G2Z A;  2EIQ A;  4WET A;  4TR3 A;  4LMV A;  1SK0 A;  4Q5Q A;  1OVN A;  3FW2 A;  14GS A;  1SJZ A;  3W8J A;  1F3A A;  3LYK A;  3CBU A;  4ZIL A;  3A2X A;  4CHS A;  2C0E A;  2R6K A;  4KDY A;  2REM A;  3G7I A;  4TRX A;  4POB A;  1YF1 A;  4RUV A;  1O6J A;  3GNJ A;  2PPT A;  2ES7 A;  1IYH A;  2OKA A;  4EF0 A;  1EP8 A;  6GSY A;  4YAV A;  3E9J B;  3VLN A;  1GL8 A;  2GZP A;  3PIN A;  1BG5 A;  3L78 A;  1GP1 A;  4IJ3 A;  4K6X A;  2ZNM A;  4PUR A;  2H66 A;  1F6M C;  3I6A A;  1SKW B;  5IM9 A;  1FG4 A;  1ON4 A;  2H0H A;  2EIO A;  1O8X A;  3M0F A;  1DUG A;  5DJL A;  3V1W A;  2H73 A;  4ID0 A;  4J57 E;  4F9Z A;  3GX0 A;  2CVK A;  3QAW A;  3EIN A;  4DEJ A;  1GLP A;  2MBT A;  4XRA A;  4P3Y B;  2R3X A;  3H93 A;  3KH7 A;  5B8A A;  2P5Q A;  3ZVJ D;  1K3O A;  1YJ6 A;  4ILF A;  17GS A;  4JRR A;  4KUN A;  3TKQ A;  3ERW A;  5KN2 A;  1QQ2 A;  1M2A A;  4X43 A;  1E6B A;  1X9S B;  1KNG A;  5F8B A;  3JCM L;  2HE3 A;  2CAI A;  3IC4 A;  4K7I A;  3TJK A;  1W4V A;  2I9H A;  1QK8 A;  5IPH A;  1V57 A;  13GS A;  1ZCP A;  5D93 A;  4O5R A;  3GMF A;  3QMX A;  4TXO B;  4TR1 A;  1IYI A;  3TGZ A;  2L6C A;  2C3Q A;  10GS A;  3GKM A;  2CT6 A;  1FHE A;  1QMV A;  4TR4 A;  3VI7 A;  1V98 A;  1Y25 A;  4FYU A;  4MJE A;  3WGD A;  4KAE A;  2GQL A;  2LS5 A;  1G6W A;  4TKY A;  3QFB C;  5J3R A;  3FR3 A;  1GTI A;  1OYJ A;  2GZZ A;  2MMO A;  4I97 A;  2L4C A;  1WWJ A;  2B1K A;  2WJU A;  2LST A;  5DAK B;  4IQA A;  1RK4 A;  3FKF A;  1ZYE A;  1V40 A;  4KX4 A;  3HHV A;  3GN3 A;  3CSH A;  5DCG A;  4ZIJ A;  1AUC A;  1XVW A;  1O85 A;  1XVQ A;  2LRT A;  2O8V B;  4TW5 A;  4WKW A;  2ZCT A;  4IEL A;  3EU4 A;  4OCE A;  3KGK A;  1ERT A;  1PGT A;  4CW9 A;  2JSY A;  4ECJ A;  5IO0 A;  3F4S A;  3CMI A;  3MNG A;  1TI1 A;  1YZX A;  1TRU A;  2CV4 A;  2YJ7 A;  1G7E A;  4JU5 A;  5ECQ B;  3LG6 A;  1TK0 B;  3F63 A;  6GSW A;  3BJ5 A;  3F4R A;  4DSR A;  3APS A;  2C80 A;  4BVX A;  2NDO A;  5IPG A;  2OAC A;  1ZZY A;  1PX7 A;  2I4A A;  1GSU A;  2DJ3 A;  4BA7 A;  4RI7 A;  2JZS A;  3ERG A;  1WOU A;  1VF2 A;  4EVM A;  2H70 A;  4HUA A;  2VL3 A;  4KW6 A;  4BWS A;  2X64 A;  5D9X A;  3VWW A;  1MEK A;  2FGX A;  2GST A;  1SJI A;  2B3S A;  2IMF A;  1SD9 A;  3LYP A;  1TU8 A;  3KD0 A;  3WT2 A;  1GNE A;  1WP0 A;  3WYW A;  3D21 A;  3KIJ A;  2GGT A;  3ZIJ A;  2FA8 A;  5IMF A;  1GNW A;  1A2M A;  5C00 A;  3FZ9 A;  1Z9H A;  2HZF A;  6GST A;  4MCU A;  3QFA C;  2VM1 A;  1G6Y A;  5B8B A;  1J9B A;  4MF5 A;  2KP2 A;  3FHK A;  4KB3 A;  4TVE A;  3IK7 A;  2IJY A;  4OO5 A;  2F51 A;  3L4N A;  1R4W A;  3H4K A;  1AC1 A;  4IGJ A;  4MP4 A;  3DD3 A;  1ZGN A;  3HKR A;  4LA1 A;  1K0O A;  1LJR A;  3J7Y b;  4IKH A;  2ALB A;  4OCF A;  1EV9 A; 
#chains in the Genus database with same CATH topology
 2O87 A;  4I5Q A;  4ECI A;  4K9Z A;  1TU7 A;  1OKD A;  3UMA A;  2FUG 2;  4XIH A;  3DGQ A;  1B4P A;  4IP1 A;  4BVY A;  4OWY A;  2N5F A;  2P0G A;  1ILO A;  3MWH A;  1EEJ A;  5HQP A;  5J4U A;  3D5J A;  1M9A A;  4OMV A;  3LXZ A;  3BD2 A;  5D96 A;  5DAL A;  1XW9 A;  3KTL A;  2F8F A;  2C0D A;  3CRU A;  2IPA A;  5G31 A;  2OAD A;  4Q5F A;  1GSQ A;  3PGT A;  4GRF A;  4NWY A;  3L0H A;  2H6Y A;  5J9B A;  4K1F A;  6GSU A;  2L5O A;  3LXT A;  1M7T A;  3VUR A;  1HYU A;  1K0C A;  2HXK A;  3MIX A;  2RUF A;  3TKR A;  3DEX A;  3RDW A;  5AIX A;  4L0W A;  4ZBB A;  1WPI A;  5ENU A;  3N9J A;  4MPF A;  4ICY A;  2PER A;  4GSN A;  5LCZ A;  4KF9 A;  3MSZ A;  1DBY A;  1J0F A;  1V58 A;  2XPD A;  1A24 A;  3C7M A;  1XZO A;  3NZN A;  3CXG A;  1KBN A;  2FWF A;  2R37 A;  4AJ8 A;  2HRN A;  4TN8 A;  5EL8 A;  2YWM A;  1VF4 A;  3CTG A;  2CVD A;  2G0F A;  2HZE B;  2OE0 A;  5B6N A;  1YEP A;  2DBC A;  2LEG A;  2LJA A;  3Q18 A;  2C4J A;  1X0R A;  1M3J A;  16GS A;  4ULX A;  5KOX A;  1HNC A;  2VL9 A;  2HFD A;  1XWG A;  1K3Y A;  1SKR B;  3C8E A;  1B9X C;  5AN1 A;  2C0G A;  4JBB A;  3IRA A;  4KE3 A;  1FAA A;  4DSS A;  4X1U A;  2GTU A;  2GT5 A;  2Z9S A;  1EEM A;  1FVJ A;  1HQO A;  2GS3 A;  5LD0 A;  2YAN A;  3FY7 A;  1PFO A;  2A2R A;  2X49 A;  1JFU A;  4OFN A;  2XBI A;  4WEY A;  5DJM A;  1OC9 A;  3A5W A;  1XCC A;  2V1M A;  4EXJ A;  2ZUP A;  4HQZ A;  3QCP A;  3QPM A;  5ID2 A;  3DKS A;  1X9W B;  2CA8 A;  3WGE A;  1U88 A;  2FWG A;  4G10 A;  4EDZ A;  22GS A;  1G7O A;  2HSM A;  3LFL A;  2YWN A;  5D9V A;  1X5E A;  2X8C A;  3UIW A;  1GSD A;  3P7X A;  2V41 A;  3ZVJ A;  5HR3 A;  3F4T A;  5FT3 A;  2PBJ A;  4IHU A;  1KEB A;  1AAZ A;  2DJK A;  2A2S A;  3EE2 A;  1DE2 A;  2R0C A;  3A2V A;  1JLW A;  1BAY A;  5CP1 A;  4HI7 A;  2VL2 A;  4XTS A;  3IDV A;  1KTE A;  5CRE A;  2VD1 A;  3GTU B;  2F9S A;  4YKF A;  1USB A;  1XW5 A;  2VCW A;  4NHW A;  2ON5 A;  1N8J A;  5ECL B;  5ECK B;  4PXO A;  1GWC A;  2HRK A;  3IR4 A;  3SBC A;  5ID2 B;  4E8E A;  1X5D A;  3ZYW A;  3DVW A;  2KUC A;  4PGT A;  2KLX A;  5KN0 A;  3HJP A;  4K0G A;  1B8X A;  5B6M A;  1YQ1 A;  1QFN A;  1F2E A;  1B9Y C;  1SD8 A;  4CDO A;  5CRH A;  3GYK A;  1MTC A;  4KND A;  3VFI A;  5GSS A;  2K8S A;  5GST A;  4CY6 A;  1WMJ A;  3P8W A;  1QUW A;  2FD3 A;  1FOV A;  1MDI A;  2V6K A;  4KCA A;  2JL4 A;  3QOU A;  18GS A;  3HVX A;  2H0I A;  3DRN A;  3VWV A;  4ZL8 A;  4KH7 A;  2IMD A;  1FVK A;  4EIP A;  2VLT A;  5J9C A;  4POM A;  1EOH A;  4GXZ A;  1S3R A;  2M46 A;  3L9S A;  3SWL A;  1BX9 A;  4TXO A;  1XWB A;  3DWV A;  3RPN A;  3EMX A;  1EGR A;  2O85 A;  2NVL A;  3P90 A;  4IQ1 A;  2RUE A;  3WT1 A;  3ZIV A;  5E4W A;  5G30 A;  3DXB A;  4QL7 A;  4BPY A;  5D9T A;  4EDY A;  3GX8 A;  2VD0 A;  4TOP A;  5JCU A;  3TRQ A;  1ZYN A;  2JU5 A;  4Z2U A;  2PMT A;  1NW2 A;  1GLQ A;  2DJ0 A;  3TJG A;  2IME A;  3FR6 A;  5DAK A;  2O7K A;  4K2D A;  1TW9 A;  2C3N A;  1PX6 A;  4K5R A;  1SU9 A;  4BL7 A;  1U6T A;  4GST A;  3BOA A;  3CRT A;  1WE0 A;  4MJA A;  4ISD A;  4ML6 A;  3IAS 2;  3BCI A;  1FB6 A;  4HS1 A;  2LQQ A;  1WRY A;  1JZR A;  1U87 A;  3C1R A;  2B5E A;  5ECN B;  3TCO A;  1EOG A;  5F05 A;  2IIY A;  4YQM A;  2NBS A;  4I8B A;  2GDR A;  3TJJ A;  2C8U A;  5IMZ A;  5F07 A;  4ZL7 A;  2QA1 A;  2RM5 A;  2HI7 A;  3DVX A;  1NHO A;  1GUL A;  2LKU A;  1AQX A;  5D8I A;  3UJ1 A;  2YNX A;  2AHE A;  4I2T A;  4MZB A;  5IMA A;  1XBS A;  5G1K A;  3ZRE A;  4F82 A;  3E0U A;  3IHG A;  4PQ1 A;  5J41 A;  1CQG A;  2MYG A;  1SK2 A;  3KH9 A;  4AGS A;  1AW9 A;  1NHY A;  3A5I A;  3TKS C;  1AXD A;  4GQF A;  2PWJ A;  3KZQ A;  1Y6E A;  2P31 A;  1PKW A;  3HVS A;  1JZD A;  4Q5R A;  3GH6 A;  1O81 A;  2X4A A;  1GH2 A;  4MJB A;  3LQ7 A;  2H1A A;  3F3R A;  3ZFB A;  3HA9 A;  2JSZ A;  3DML A;  4PUF C;  5IO2 A;  4KA0 A;  3IC8 A;  1M2B A;  1AQV A;  4I6X A;  3IPZ A;  3ZMK A;  5B7C A;  4MH2 A;  2N5B A;  2JZR A;  5ECM B;  5C04 A;  2F3M A;  5CNW A;  5JWQ B;  2B5X A;  1R26 A;  3C1S A;  4E8H A;  3CSJ A;  3FEU A;  3F0I A;  2YJH A;  2VCQ A;  4HQS A;  1PQN A;  4MPG A;  1XFL A;  1R5A A;  5KEJ A;  1T3B A;  6GSX A;  2PUK C;  5CRW A;  3KCM A;  2C3T A;  3GHA A;  3GSS A;  4N10 A;  3H8Q A;  1SL2 B;  5DQS A;  1ZL9 A;  2HSH A;  1F37 A;  5ECP B;  1S3C A;  4YKG A;  2OE1 A;  4YH2 A;  2IL3 A;  5KOW A;  5LNK e;  2K9F A;  4MK3 A;  4MNN A;  2G2Q A;  1RQM A;  2L59 A;  4JR4 A;  3DYR A;  2P5R A;  1GUK A;  3FR9 A;  2R4V A;  5ECI B;  2DC5 A;  3TOU A;  5DDL A;  4HZ4 A;  1SL0 B;  2D2Z A;  20GS A;  8GSS A;  1TTZ A;  4HSC X;  4WR5 A;  1PL2 A;  4LLR A;  2VCT A;  3APQ A;  4D73 B;  4O5Q A;  1TK8 B;  1PD2 1;  2R5G A;  5ECH B;  3TKP A;  4KSO A;  6GSS A;  4MA9 A;  2H8L A;  1GUH A;  2PN8 A;  4WBR D;  5AGY A;  2A4V A;  3TB2 A;  4OO4 A;  4V2N A;  4MZC A;  1FB0 A;  4K7O A;  4POK A;  5EPF A;  4MJC A;  2HT9 A;  1XOB A;  2B6M A;  5BRT A;  1M99 A;  2E7P A;  2CQ9 A;  3TJF A;  4ZB9 A;  3IE3 A;  1PA3 A;  1EP7 A;  3BBY A;  2IFQ B;  1Q4J A;  3ED3 A;  4RQR A;  4GWR A;  3RHB A;  3CQF A;  4JED A;  2HZE A;  4ML1 A;  2RM6 A;  3HCZ A;  1YY7 A;  2B5Y A;  2OJL A;  2H6X A;  1Z6M A;  5JWO B;  2H74 A;  1NSW A;  2K8V A;  1O8W A;  5HFG A;  1OE7 A;  5A5K A;  3M9J A;  3F6F A;  5GAP D;  2RII A;  2DML A;  3P2A A;  1K0B A;  2CX3 A;  1VGL A;  2LUS A;  5HFI A;  2GVP A;  3LSZ A;  1MDK A;  2GQM A;  5G1L A;  4IW9 A;  4MMM A;  4OFM A;  2FWE A;  4WF5 A;  4IBP A;  1ZOF A;  4Z7X A;  4ACS A;  3LEF A;  5CO3 A;  3GKN A;  2BMX A;  2YCD A;  3TDG A;  5GAN D;  3I69 A;  1GSS A;  3GUS A;  1GUM A;  1SYX A;  3FZ5 A;  1B48 A;  4PX1 A;  3UBL A;  3H79 A;  3APO A;  4K8M A;  2LTK A;  1BJX A;  1ZMA A;  1LU4 A;  3IA1 A;  4ZL9 A;  2UZ8 A;  3ZRD A;  5JCG A;  1I5G A;  3HYP A;  1Q98 A;  3HXS A;  4PNF A;  3Q74 A;  1QXH A;  2YN1 A;  3ME7 A;  3ZZX A;  4EE0 A;  2FLS A;  4QL9 A;  5IOX A;  5JCW A;  1K0M A;  1UC7 A;  2H19 A;  2VM2 A;  4J2F A;  2JAC A;  1X9M B;  1TOF A;  3ME8 A;  2WGR A;  4AF2 A;  4F0B A;  4TXV A;  4G0I A;  2N5A A;  2MZC A;  4GLT A;  1HNA A;  2WZ9 A;  1Z5Y E;  5E59 A;  3US3 A;  1UA5 A;  5FHI A;  2LRC A;  3GTU A;  2DJJ A;  5DCH A;  3UVT A;  4LMW A;  1A23 A;  5FWG A;  3GH9 A;  1EGO A;  4QQ7 A;  1ERV A;  4KDU A;  2YWO A;  1TJD A;  1R7H A;  5IQY A;  2HRF A;  2DSA A;  4GSS A;  2YZU A;  5CRG A;  5H5R A;  1BED A;  1AQW A;  1U3I A;  3UBK A;  4YQU A;  3EU3 A;  3EUR A;  3HJO A;  5AIS A;  1XW6 A;  3GA4 A;  2C0F A;  4PUA A;  2XPE A;  1ZYP A;  1TRW A;  2AYT A;  2H71 A;  3ZFL A;  3ZL5 A;  3ISO A;  2GSR A;  2OBI A;  1W89 A;  3HVV A;  2H76 A;  3LJR A;  2LRN A;  3GFK A;  3GRX A;  4IVF A;  1T4Y A;  1VRS D;  2C1Y A;  4EUY A;  4NAX A;  5ECR B;  3F9U A;  2I81 A;  1XXU A;  1M9B A;  1ERW A;  3TUE A;  5F06 A;  3G9B A;  4LL1 B;  5H5S A;  3VWU A;  3LOR A;  2VUP A;  2H75 A;  4RQX A;  1EWX A;  1WJK A;  5IMD A;  3HVN A;  2IMK A;  1J08 A;  2FHE A;  5ELA A;  3QR6 A;  2OE3 A;  4HEA 2;  1M0U A;  4NV5 A;  1DSB A;  3M1G A;  4WR4 A;  3UVH A;  4BWQ A;  1OC3 A;  2JAD A;  1K3L A;  3LWA A;  4BIK A;  2K18 A;  3HY2 A;  4XS1 A;  1X5C A;  4O32 A;  4NPB A;  1I9D A;  2B7K A;  2XBQ A;  4XRD A;  3EPT A;  2WUL A;  4MDC A;  2TIR A;  2VIM A;  3HDC A;  1PN0 A;  3KTB A;  2YZH A;  2R0G A;  5DBQ A;  4OFT A;  2CVB A;  3D4M A;  2YPM A;  3IXR A;  4V2M A;  1XWC A;  1QGV A;  3NIV A;  3K8N A;  4WF4 A;  2WDU A;  1H75 A;  3F3Q A;  4EO3 A;  2AAW A;  3GL3 A;  4RI6 A;  4XS4 B;  4K0N A;  2GZY A;  2I3Y A;  1A2J A;  4V2L A;  5J5N A;  5F0G A;  1JLV A;  3UOM A;  2TRX A;  4EL1 A;  2CAQ A;  2VCV A;  1JHB A;  4Q5N A;  2L57 A;  4IS0 A;  1ZYQ B;  2L6D A;  3TOT A;  5BMU A;  4MLY A;  4JE1 A;  3E3E A;  4V1A p;  3FZ4 A;  1CQH A;  3KXO A;  2X8H A;  2J23 A;  1PL1 A;  1VF3 A;  1Z6N A;  3CTF A;  1SL1 B;  5EVO A;  1FO5 A;  3UAR A;  4FYB A;  2OA7 A;  1GRX A;  4ZXG A;  3GUR A;  1Z7R A;  2JZT A;  3QAG A;  2AUV A;  5ABR A;  1SYR A;  3D22 A;  1H4O A;  1XOA A;  2H1D A;  5JWR B;  5EY6 A;  4MF6 A;  1M2D A;  2H72 A;  3UAP A;  1THX A;  3KMO A;  4KDX A;  2CX4 A;  4EIQ A;  9GSS A;  4I2U A;  3LGC A;  3Q19 A;  1A0R P;  3GL5 A;  2X8G A;  3RAZ A;  2A4H A;  1T8E B;  4HOJ A;  3WGX A;  3D0Z A;  2PGT A;  2GLR A;  2VCZ A;  3L9U A;  2PVQ A;  3NOF A;  2QKE A;  1GTA A;  2VAF A;  2VOC A;  5COH A;  1TK5 B;  5CAX A;  1YDK A;  1SEN A;  2WCI A;  4V1A g;  2LNS A;  7GSS A;  1SK1 A;  4WBJ A;  1GSE A;  5IMV A;  2GSQ A;  1YF0 A;  1TKD B;  3PR8 A;  1R5P A;  3G7J A;  3C73 A;  4DVC A;  3ERF A;  4YQV A;  4G2E A;  2KHP A;  1PMT A;  2LJK A;  4AJ7 A;  2LNT A;  1FW1 A;  2H30 A;  3GKK A;  2DKH A;  4JZQ A;  4MAB A;  2GT6 A;  5CRD A;  3TKS A;  3L9V A;  3I9V 2;  4KCE A;  1THO A;  2CZ3 A;  5GZZ B;  3ZML A;  3FK8 A;  3N5O A;  1A0F A;  1HD2 A;  3D4T A;  1WIK A;  4TR1 B;  3KMN A;  2VCX A;  2F8A A;  4IJI A;  3TJB A;  4MF7 A;  1C72 A;  1MDJ A;  3W6G A;  3IAM 2;  3O6T A;  2PVO C;  4FO5 A;  3LW9 A;  1U3A A;  3ZIT A;  4D73 A;  2LQO A;  1ABA A;  5A4V A;  4FQU A;  4N0V A;  4USS A;  4MZW A;  4HJM A;  3UEM A;  4F03 A;  4FYC A;  2E0Q A;  4GF0 A;  4OD7 A;  2TRC P;  5IIZ A;  2HYX A;  2DMM A;  4XCS A;  3MYD A;  1BQ7 A;  1V9W A;  1TXX A;  3IOS A;  2DIZ A;  1HNB A;  2IMI A;  1OE8 A;  1ST9 A;  4ZB6 A;  4ZBD A;  1T7P B;  4JR6 A;  1T00 A;  4XS6 A;  4YAP A;  1ML6 A;  4HJ2 A;  1GSY A;  3GIX A;  2YV7 A;  1ACV A;  3GV1 A;  3VPT A;  4O5U A;  3EC3 A;  2IFQ A;  2E2M A;  3GST A;  2FA4 A;  3BCK A;  6GSV A;  3PPU A;  1YKC A;  3M9K A;  1GSF A;  2WB9 A;  2XC2 A;  5HR0 A;  3RPP A;  2H6Z A;  3C71 A;  3MAK A;  4HDE A;  1MD3 A;  4EKZ A;  4HU9 A;  2EC4 A;  1K0N A;  2KP1 A;  2BJX A;  5DVB A;  5HR2 A;  4G19 A;  3J7Y k;  2R0P A;  4LL4 B;  3FYG A;  3QAV A;  1JZW A;  4BVX B;  2M72 A;  2EIR A;  2AB6 A;  5A4W A;  4ECC A;  3U6V A;  1M3I A;  5ECS A;  4FIW A;  4NV2 A;  4H86 A;  2V2G A;  5CYY A;  3HZ8 A;  2XHF A;  1PSQ A;  3U5R E;  2PU9 C;  1TP9 A;  4L5O A;  2YWI A;  1RW1 A;  3KP9 A;  1AIU A;  3ZLP A;  3S9F A;  1GTU A;  1OC8 A;  3KEB A;  2KOK A;  2L5L A;  1N2A A;  3G7Y A;  4L0U A;  3VWX A;  2R2J A;  3IV4 A;  4ZBA A;  3A3T A;  1Z3E A;  1XWA A;  3A2W A;  5G5F A;  4NXI A;  1V2A A;  3F8U A;  2HNL A;  2VO4 A;  2DJ1 A;  3KM6 A;  2YV9 A;  4MH3 A;  4GTU A;  2NTO A;  4K5S A;  5KN3 A;  1F9M A;  3AY8 A;  5H5Q A;  3TRX A;  1TRS A;  2B1L A;  2RLI A;  2H01 A;  2QSI A;  2V6O A;  4O7H A;  3UL3 A;  5ELG A;  1XWK A;  2L4Q A;  5AIV A;  4J56 E;  5A4U A;  2DIY A;  2E2G A;  1YKA A;  5D73 A;  3EMP A;  3VPQ A;  3CYN A;  4N30 A;  3IK9 A;  5L71 A;  2B7J A;  4DSQ A;  1O7U A;  4Z2R A;  3VK9 A;  2ON7 A;  2YP6 A;  1S3D A;  4BVY B;  3O3T A;  2OBK A;  3RBT A;  3MDK A;  3HD5 A;  3W8S A;  5D9W A;  1OAZ A;  3FZA A;  3RHC A;  3M8N A;  3OR5 A;  1BYE A;  4FH8 A;  1PRX A;  2QGV A;  5ECO B;  2O89 A;  2GSS A;  1UN2 A;  5DAL B;  4GQC A;  3HZ4 A;  4K2X A;  3HJM A;  1A8Y A;  1PKZ A;  5KN1 A;  3GKX A;  12GS A;  1E2Y A;  2WS2 A;  3PH9 A;  1S3A A;  2YOI A;  2FWH A;  1K0D A;  1VF1 A;  4PNG A;  2FCH A;  4PQH A;  4N11 A;  1Z7P A;  4G0L A;  2BTO T;  5DQY A;  1MD4 A;  4IP6 A;  1T1V A;  4POL A;  2DJ2 A;  3IHQ A;  2V32 A;  2VLU A;  19GS A;  1A8L A;  5HFK A;  4XHM A;  3CSI A;  4GCI A;  4EC0 A;  4K7N A;  1TI3 A;  2VLV A;  2AV4 A;  2AJQ B;  3VI5 A;  2IWT A;  3KJY A;  4NMU A;  2FY6 A;  1EZK A;  2DLX A;  2LV3 A;  1G0T A;  2WFC A;  1XIY A;  5G5E A;  2H0G A;  4NHZ A;  1XG8 A;  5INY A;  3KP8 A;  4F2I A;  4AJ6 A;  3TKS E;  1NM3 A;  2MBS A;  4F0C A;  1TRV A;  1A2L A;  3O76 A;  4IN0 A;  3I43 A;  1SJ6 A;  4PQI A;  3Q6O A;  2IN3 A;  1GTB A;  4DSS B;  3R2Q A;  4ZB8 A;  4ECB A;  1FOH A;  2VL2 C;  3F6D A;  1TDI A;  2K6V A;  3EVI A;  4HU7 A;  3D6I A;  4XS4 A;  2GQK A;  1LBK A;  1T4Z A;  3EWL A;  3H1N A;  2J9H A;  1F3B A;  2FNO A;  3WD6 A;  1OC9 B;  5IMC A;  4X0X A;  3TRP A;  3ZTL A;  5IOW A;  3FRC A;  2H1B A;  1OKT A;  2CZ2 A;  1UVZ A;  3DIE A;  1PN9 A;  3IBH A;  2MMA A;  1K0A A;  1O73 A;  4WXT A;  3EYT A;  1B4Q A;  2HLS A;  2QC7 A;  4KSM A;  3FMW A;  1ERU A;  4KGI A;  2LJR A;  4L5L A;  3QD9 A;  2MMZ A;  5HR1 A;  3M3M A;  1EV4 A;  3QDN A;  4O92 A;  1URM A;  4PTS A;  4TR0 A;  1YEX A;  11GS A;  2H1G A;  2HSY A;  1DE1 A;  2NPB A;  2MMN A;  2I1U A;  2X99 A;  4N0Z A;  1JZO A;  2M80 A;  1XPV A;  4G9H A;  4HZ2 A;  4L8E A;  1SKS B;  2WRT A;  5G2Z A;  2EIQ A;  4WET A;  4A5P A;  4TR3 A;  4LMV A;  1SK0 A;  4Q5Q A;  1OVN A;  3FW2 A;  14GS A;  1SJZ A;  3W8J A;  1F3A A;  3LYK A;  3CBU A;  4ZIL A;  3A2X A;  4CHS A;  2C0E A;  2R6K A;  4KDY A;  2REM A;  3G7I A;  4TRX A;  4POB A;  1YF1 A;  4RUV A;  1O6J A;  3GNJ A;  2PPT A;  2ES7 A;  1IYH A;  2OKA A;  4EF0 A;  1EP8 A;  6GSY A;  4YAV A;  3E9J B;  3VLN A;  2HRA A;  1GL8 A;  2GZP A;  3PIN A;  1BG5 A;  3L78 A;  1GP1 A;  4IJ3 A;  4K6X A;  2ZNM A;  4PUR A;  2H66 A;  1F6M C;  3I6A A;  1SKW B;  5IM9 A;  1FG4 A;  1ON4 A;  2H0H A;  2EIO A;  1O8X A;  3M0F A;  1DUG A;  5DJL A;  3V1W A;  2H73 A;  4ID0 A;  4J57 E;  4F9Z A;  3GX0 A;  2CVK A;  3QAW A;  3EIN A;  4DEJ A;  1GLP A;  2MBT A;  4XRA A;  3R3E A;  4P3Y B;  2R3X A;  3H93 A;  3KH7 A;  5B8A A;  2P5Q A;  3ZVJ D;  1K3O A;  1YJ6 A;  4ILF A;  17GS A;  4JRR A;  4KUN A;  3TKQ A;  3ERW A;  5KN2 A;  1QQ2 A;  1M2A A;  4X43 A;  1E6B A;  1X9S B;  1KNG A;  5F8B A;  3JCM L;  2HE3 A;  2CAI A;  3IC4 A;  4K7I A;  3TJK A;  1W4V A;  2I9H A;  1QK8 A;  5IPH A;  1V57 A;  13GS A;  1ZCP A;  5D93 A;  4O5R A;  3GMF A;  3QMX A;  4TXO B;  4TR1 A;  1IYI A;  3TGZ A;  2L6C A;  2C3Q A;  10GS A;  3GKM A;  2CT6 A;  1FHE A;  4CY8 A;  1QMV A;  4TR4 A;  3VI7 A;  1V98 A;  1Y25 A;  4FYU A;  4MJE A;  3WGD A;  4KAE A;  2GQL A;  2LS5 A;  1G6W A;  4TKY A;  3QFB C;  5J3R A;  3FR3 A;  1GTI A;  1OYJ A;  2GZZ A;  2MMO A;  4I97 A;  2L4C A;  1WWJ A;  2B1K A;  2WJU A;  2LST A;  5DAK B;  4IQA A;  1RK4 A;  3FKF A;  1ZYE A;  1V40 A;  4KX4 A;  3HHV A;  3GN3 A;  3CSH A;  5DCG A;  4ZIJ A;  1AUC A;  2DKI A;  1XVW A;  4BL7 B;  1O85 A;  1XVQ A;  2LRT A;  2O8V B;  4TW5 A;  4WKW A;  2ZCT A;  4IEL A;  3EU4 A;  4OCE A;  3KGK A;  1ERT A;  1PGT A;  4Z2T A;  4CW9 A;  2JSY A;  4ECJ A;  5IO0 A;  3F4S A;  3CMI A;  3MNG A;  1TI1 A;  1YZX A;  1TRU A;  2CV4 A;  2YJ7 A;  1G7E A;  4JU5 A;  5ECQ B;  4G0K A;  3LG6 A;  1TK0 B;  3F63 A;  6GSW A;  3BJ5 A;  3F4R A;  4DSR A;  2QA2 A;  2C80 A;  3APS A;  4BVX A;  2NDO A;  5IPG A;  2OAC A;  1ZZY A;  1PX7 A;  2I4A A;  1GSU A;  2A2P A;  2DJ3 A;  4BA7 A;  4RI7 A;  2JZS A;  3ERG A;  1WOU A;  1VF2 A;  4EVM A;  2H70 A;  4HUA A;  2VL3 A;  4KW6 A;  4BWS A;  2X64 A;  5D9X A;  3VWW A;  1MEK A;  2FGX A;  2GST A;  1SJI A;  2B3S A;  2IMF A;  1SD9 A;  3LYP A;  1TU8 A;  3KD0 A;  3WT2 A;  1GNE A;  1WP0 A;  3WYW A;  3D21 A;  3KIJ A;  2GGT A;  3ZIJ A;  2FA8 A;  5IMF A;  1GNW A;  1A2M A;  5C00 A;  3FZ9 A;  1Z9H A;  2HZF A;  4X4J A;  6GST A;  4MCU A;  3QFA C;  2VM1 A;  1G6Y A;  5B8B A;  1J9B A;  4MF5 A;  2KP2 A;  3FHK A;  4KB3 A;  4TVE A;  3IK7 A;  2IJY A;  4OO5 A;  2F51 A;  3L4N A;  1R4W A;  3H4K A;  1AC1 A;  4IGJ A;  4MP4 A;  3DD3 A;  1ZGN A;  3HKR A;  4LA1 A;  1K0O A;  1LJR A;  3J7Y b;  4IKH A;  2ALB A;  4OCF A;  1EV9 A; 
#chains in the Genus database with same CATH homology
 2O87 A;  4I5Q A;  4ECI A;  4K9Z A;  1TU7 A;  1OKD A;  3UMA A;  2FUG 2;  4XIH A;  3DGQ A;  1B4P A;  4IP1 A;  4BVY A;  4OWY A;  2N5F A;  2P0G A;  1ILO A;  3MWH A;  1EEJ A;  5HQP A;  5J4U A;  3D5J A;  1M9A A;  4OMV A;  3LXZ A;  3BD2 A;  5D96 A;  5DAL A;  1XW9 A;  3KTL A;  2F8F A;  2C0D A;  3CRU A;  2IPA A;  5G31 A;  2OAD A;  4Q5F A;  1GSQ A;  3PGT A;  4GRF A;  4NWY A;  3L0H A;  2H6Y A;  5J9B A;  4K1F A;  6GSU A;  2L5O A;  3LXT A;  1M7T A;  3VUR A;  1HYU A;  1K0C A;  2HXK A;  3MIX A;  2RUF A;  3TKR A;  3DEX A;  3RDW A;  5AIX A;  4L0W A;  4ZBB A;  1WPI A;  5ENU A;  3N9J A;  4MPF A;  4ICY A;  2PER A;  4GSN A;  5LCZ A;  4KF9 A;  3MSZ A;  1DBY A;  1J0F A;  1V58 A;  2XPD A;  1A24 A;  3C7M A;  1XZO A;  3NZN A;  3CXG A;  1KBN A;  2FWF A;  2R37 A;  4AJ8 A;  2HRN A;  4TN8 A;  5EL8 A;  2YWM A;  1VF4 A;  3CTG A;  2CVD A;  2G0F A;  2HZE B;  2OE0 A;  5B6N A;  1YEP A;  2DBC A;  2LEG A;  2LJA A;  3Q18 A;  2C4J A;  1X0R A;  16GS A;  4ULX A;  5KOX A;  1HNC A;  2VL9 A;  2HFD A;  1XWG A;  1K3Y A;  1SKR B;  3C8E A;  1B9X C;  5AN1 A;  2C0G A;  4JBB A;  3IRA A;  4KE3 A;  1FAA A;  4DSS A;  4X1U A;  2GTU A;  2GT5 A;  2Z9S A;  1EEM A;  1FVJ A;  1HQO A;  2GS3 A;  5LD0 A;  2YAN A;  3FY7 A;  2A2R A;  2X49 A;  1JFU A;  4OFN A;  2XBI A;  4WEY A;  5DJM A;  1OC9 A;  3A5W A;  1XCC A;  2V1M A;  4EXJ A;  2ZUP A;  4HQZ A;  3QCP A;  3QPM A;  5ID2 A;  3DKS A;  1X9W B;  2CA8 A;  3WGE A;  1U88 A;  2FWG A;  4G10 A;  4EDZ A;  22GS A;  1G7O A;  2HSM A;  3LFL A;  2YWN A;  5D9V A;  1X5E A;  2X8C A;  3UIW A;  1GSD A;  3P7X A;  2V41 A;  3ZVJ A;  5HR3 A;  3F4T A;  5FT3 A;  2PBJ A;  4IHU A;  1KEB A;  1AAZ A;  2DJK A;  2A2S A;  3EE2 A;  1DE2 A;  2R0C A;  3A2V A;  1JLW A;  1BAY A;  5CP1 A;  4HI7 A;  2VL2 A;  4XTS A;  3IDV A;  1KTE A;  5CRE A;  2VD1 A;  3GTU B;  2F9S A;  4YKF A;  1USB A;  1XW5 A;  2VCW A;  4NHW A;  2ON5 A;  1N8J A;  5ECL B;  5ECK B;  4PXO A;  1GWC A;  2HRK A;  3IR4 A;  3SBC A;  5ID2 B;  4E8E A;  1X5D A;  3ZYW A;  3DVW A;  2KUC A;  4PGT A;  2KLX A;  5KN0 A;  3HJP A;  4K0G A;  1B8X A;  5B6M A;  1YQ1 A;  1QFN A;  1F2E A;  1B9Y C;  1SD8 A;  4CDO A;  5CRH A;  3GYK A;  1MTC A;  4KND A;  3VFI A;  5GSS A;  2K8S A;  5GST A;  4CY6 A;  1WMJ A;  3P8W A;  1QUW A;  2FD3 A;  1FOV A;  1MDI A;  2V6K A;  4KCA A;  2JL4 A;  3QOU A;  18GS A;  3HVX A;  2H0I A;  3DRN A;  3VWV A;  4ZL8 A;  4KH7 A;  2IMD A;  1FVK A;  4EIP A;  2VLT A;  5J9C A;  4POM A;  1EOH A;  4GXZ A;  2M46 A;  3L9S A;  3SWL A;  1BX9 A;  4TXO A;  1XWB A;  3DWV A;  3RPN A;  3EMX A;  1EGR A;  2O85 A;  2NVL A;  3P90 A;  4IQ1 A;  2RUE A;  3WT1 A;  3ZIV A;  5E4W A;  5G30 A;  3DXB A;  4QL7 A;  4BPY A;  5D9T A;  4EDY A;  3GX8 A;  2VD0 A;  4TOP A;  5JCU A;  3TRQ A;  1ZYN A;  2JU5 A;  4Z2U A;  2PMT A;  1NW2 A;  1GLQ A;  2DJ0 A;  3TJG A;  2IME A;  3FR6 A;  5DAK A;  2O7K A;  4K2D A;  1TW9 A;  2C3N A;  1PX6 A;  4K5R A;  1SU9 A;  4BL7 A;  1U6T A;  4GST A;  3BOA A;  3CRT A;  1WE0 A;  4MJA A;  4ISD A;  4ML6 A;  3IAS 2;  3BCI A;  1FB6 A;  4HS1 A;  2LQQ A;  1WRY A;  1JZR A;  1U87 A;  3C1R A;  2B5E A;  5ECN B;  3TCO A;  1EOG A;  5F05 A;  2IIY A;  4YQM A;  2NBS A;  4I8B A;  2GDR A;  3TJJ A;  2C8U A;  5IMZ A;  5F07 A;  4ZL7 A;  2QA1 A;  2RM5 A;  2HI7 A;  3DVX A;  1NHO A;  1GUL A;  2LKU A;  1AQX A;  5D8I A;  3UJ1 A;  2YNX A;  2AHE A;  4I2T A;  4MZB A;  5IMA A;  1XBS A;  5G1K A;  3ZRE A;  4F82 A;  3E0U A;  3IHG A;  4PQ1 A;  5J41 A;  1CQG A;  2MYG A;  1SK2 A;  3KH9 A;  4AGS A;  1AW9 A;  1NHY A;  3A5I A;  3TKS C;  1AXD A;  4GQF A;  2PWJ A;  3KZQ A;  1Y6E A;  2P31 A;  1PKW A;  3HVS A;  1JZD A;  4Q5R A;  3GH6 A;  1O81 A;  2X4A A;  1GH2 A;  4MJB A;  3LQ7 A;  2H1A A;  3F3R A;  3ZFB A;  3HA9 A;  2JSZ A;  3DML A;  4PUF C;  5IO2 A;  4KA0 A;  3IC8 A;  1M2B A;  1AQV A;  4I6X A;  3IPZ A;  3ZMK A;  5B7C A;  4MH2 A;  2N5B A;  2JZR A;  5ECM B;  5C04 A;  2F3M A;  5CNW A;  5JWQ B;  2B5X A;  1R26 A;  3C1S A;  4E8H A;  3CSJ A;  3FEU A;  3F0I A;  2YJH A;  2VCQ A;  4HQS A;  1PQN A;  4MPG A;  1XFL A;  1R5A A;  5KEJ A;  1T3B A;  6GSX A;  2PUK C;  5CRW A;  3KCM A;  2C3T A;  3GHA A;  3GSS A;  4N10 A;  3H8Q A;  1SL2 B;  5DQS A;  1ZL9 A;  2HSH A;  1F37 A;  5ECP B;  1S3C A;  4YKG A;  2OE1 A;  4YH2 A;  2IL3 A;  5KOW A;  5LNK e;  2K9F A;  4MK3 A;  4MNN A;  2G2Q A;  1RQM A;  2L59 A;  4JR4 A;  3DYR A;  2P5R A;  1GUK A;  3FR9 A;  2R4V A;  5ECI B;  2DC5 A;  3TOU A;  5DDL A;  4HZ4 A;  1SL0 B;  2D2Z A;  20GS A;  8GSS A;  1TTZ A;  4WR5 A;  1PL2 A;  4LLR A;  2VCT A;  3APQ A;  4D73 B;  4O5Q A;  1TK8 B;  1PD2 1;  2R5G A;  5ECH B;  3TKP A;  4KSO A;  6GSS A;  4MA9 A;  2H8L A;  1GUH A;  2PN8 A;  4WBR D;  5AGY A;  2A4V A;  3TB2 A;  4OO4 A;  4V2N A;  4MZC A;  1FB0 A;  4K7O A;  4POK A;  5EPF A;  4MJC A;  2HT9 A;  1XOB A;  2B6M A;  5BRT A;  1M99 A;  2E7P A;  2CQ9 A;  3TJF A;  4ZB9 A;  3IE3 A;  1PA3 A;  1EP7 A;  3BBY A;  2IFQ B;  1Q4J A;  3ED3 A;  4RQR A;  4GWR A;  3RHB A;  4JED A;  2HZE A;  4ML1 A;  2RM6 A;  3HCZ A;  1YY7 A;  2B5Y A;  2OJL A;  2H6X A;  1Z6M A;  5JWO B;  2H74 A;  1NSW A;  2K8V A;  1O8W A;  5HFG A;  1OE7 A;  5A5K A;  3M9J A;  3F6F A;  5GAP D;  2RII A;  2DML A;  3P2A A;  1K0B A;  2CX3 A;  1VGL A;  2LUS A;  5HFI A;  2GVP A;  3LSZ A;  1MDK A;  2GQM A;  5G1L A;  4IW9 A;  4MMM A;  4OFM A;  2FWE A;  4WF5 A;  4IBP A;  1ZOF A;  4Z7X A;  4ACS A;  3LEF A;  5CO3 A;  3GKN A;  2BMX A;  2YCD A;  3TDG A;  5GAN D;  3I69 A;  1GSS A;  3GUS A;  1GUM A;  1SYX A;  3FZ5 A;  1B48 A;  4PX1 A;  3UBL A;  3H79 A;  3APO A;  4K8M A;  2LTK A;  1BJX A;  1ZMA A;  1LU4 A;  3IA1 A;  4ZL9 A;  2UZ8 A;  3ZRD A;  5JCG A;  1I5G A;  3HYP A;  1Q98 A;  3HXS A;  4PNF A;  3Q74 A;  1QXH A;  2YN1 A;  3ME7 A;  3ZZX A;  4EE0 A;  2FLS A;  4QL9 A;  5IOX A;  5JCW A;  1K0M A;  1UC7 A;  2H19 A;  2VM2 A;  4J2F A;  2JAC A;  1X9M B;  1TOF A;  3ME8 A;  2WGR A;  4AF2 A;  4F0B A;  4TXV A;  4G0I A;  2N5A A;  2MZC A;  4GLT A;  1HNA A;  2WZ9 A;  1Z5Y E;  5E59 A;  3US3 A;  1UA5 A;  5FHI A;  2LRC A;  3GTU A;  2DJJ A;  5DCH A;  3UVT A;  4LMW A;  1A23 A;  5FWG A;  3GH9 A;  1EGO A;  4QQ7 A;  1ERV A;  4KDU A;  2YWO A;  1TJD A;  1R7H A;  5IQY A;  2HRF A;  2DSA A;  4GSS A;  2YZU A;  5CRG A;  5H5R A;  1BED A;  1AQW A;  1U3I A;  3UBK A;  4YQU A;  3EU3 A;  3EUR A;  3HJO A;  5AIS A;  1XW6 A;  3GA4 A;  2C0F A;  4PUA A;  2XPE A;  1ZYP A;  1TRW A;  2AYT A;  2H71 A;  3ZFL A;  3ZL5 A;  3ISO A;  2GSR A;  2OBI A;  1W89 A;  3HVV A;  2H76 A;  3LJR A;  2LRN A;  3GFK A;  3GRX A;  4IVF A;  1T4Y A;  1VRS D;  2C1Y A;  4EUY A;  4NAX A;  5ECR B;  3F9U A;  2I81 A;  1XXU A;  1M9B A;  1ERW A;  3TUE A;  5F06 A;  3G9B A;  4LL1 B;  5H5S A;  3VWU A;  3LOR A;  2VUP A;  2H75 A;  4RQX A;  1EWX A;  1WJK A;  5IMD A;  2IMK A;  1J08 A;  2FHE A;  5ELA A;  3QR6 A;  2OE3 A;  4HEA 2;  1M0U A;  4NV5 A;  1DSB A;  3M1G A;  4WR4 A;  3UVH A;  4BWQ A;  1OC3 A;  2JAD A;  1K3L A;  3LWA A;  2K18 A;  3HY2 A;  4XS1 A;  1X5C A;  4O32 A;  4NPB A;  1I9D A;  2B7K A;  2XBQ A;  4XRD A;  3EPT A;  2WUL A;  4MDC A;  2TIR A;  2VIM A;  3HDC A;  1PN0 A;  3KTB A;  2YZH A;  2R0G A;  5DBQ A;  4OFT A;  2CVB A;  3D4M A;  2YPM A;  3IXR A;  4V2M A;  1XWC A;  1QGV A;  3NIV A;  3K8N A;  4WF4 A;  2WDU A;  1H75 A;  3F3Q A;  4EO3 A;  2AAW A;  3GL3 A;  4RI6 A;  4XS4 B;  4K0N A;  2GZY A;  2I3Y A;  1A2J A;  4V2L A;  5J5N A;  5F0G A;  1JLV A;  3UOM A;  2TRX A;  4EL1 A;  2CAQ A;  2VCV A;  1JHB A;  4Q5N A;  2L57 A;  4IS0 A;  1ZYQ B;  2L6D A;  3TOT A;  5BMU A;  4MLY A;  4JE1 A;  3E3E A;  4V1A p;  3FZ4 A;  1CQH A;  3KXO A;  2X8H A;  2J23 A;  1PL1 A;  1VF3 A;  1Z6N A;  3CTF A;  1SL1 B;  5EVO A;  1FO5 A;  3UAR A;  4FYB A;  2OA7 A;  1GRX A;  4ZXG A;  3GUR A;  1Z7R A;  2JZT A;  3QAG A;  2AUV A;  5ABR A;  1SYR A;  3D22 A;  1H4O A;  1XOA A;  2H1D A;  5JWR B;  5EY6 A;  4MF6 A;  1M2D A;  2H72 A;  3UAP A;  1THX A;  3KMO A;  4KDX A;  2CX4 A;  4EIQ A;  9GSS A;  4I2U A;  3LGC A;  3Q19 A;  1A0R P;  3GL5 A;  2X8G A;  3RAZ A;  2A4H A;  1T8E B;  4HOJ A;  3WGX A;  3D0Z A;  2PGT A;  2GLR A;  2VCZ A;  3L9U A;  2PVQ A;  3NOF A;  2QKE A;  1GTA A;  2VAF A;  2VOC A;  5COH A;  1TK5 B;  5CAX A;  1YDK A;  1SEN A;  2WCI A;  4V1A g;  2LNS A;  7GSS A;  1SK1 A;  4WBJ A;  1GSE A;  5IMV A;  2GSQ A;  1YF0 A;  1TKD B;  3PR8 A;  1R5P A;  3G7J A;  3C73 A;  4DVC A;  3ERF A;  4YQV A;  4G2E A;  2KHP A;  1PMT A;  2LJK A;  4AJ7 A;  2LNT A;  1FW1 A;  2H30 A;  3GKK A;  2DKH A;  4JZQ A;  4MAB A;  2GT6 A;  5CRD A;  3TKS A;  3L9V A;  3I9V 2;  4KCE A;  1THO A;  2CZ3 A;  5GZZ B;  3ZML A;  3FK8 A;  3N5O A;  1A0F A;  1HD2 A;  3D4T A;  1WIK A;  4TR1 B;  3KMN A;  2VCX A;  2F8A A;  4IJI A;  3TJB A;  4MF7 A;  1C72 A;  1MDJ A;  3W6G A;  3IAM 2;  3O6T A;  2PVO C;  4FO5 A;  3LW9 A;  1U3A A;  3ZIT A;  4D73 A;  2LQO A;  1ABA A;  5A4V A;  4FQU A;  4N0V A;  4USS A;  4MZW A;  4HJM A;  3UEM A;  4F03 A;  4FYC A;  2E0Q A;  4GF0 A;  4OD7 A;  2TRC P;  5IIZ A;  2HYX A;  2DMM A;  4XCS A;  3MYD A;  1BQ7 A;  1V9W A;  1TXX A;  3IOS A;  2DIZ A;  1HNB A;  2IMI A;  1OE8 A;  1ST9 A;  4ZB6 A;  4ZBD A;  1T7P B;  4JR6 A;  1T00 A;  4XS6 A;  4YAP A;  1ML6 A;  4HJ2 A;  1GSY A;  3GIX A;  2YV7 A;  1ACV A;  3GV1 A;  3VPT A;  4O5U A;  3EC3 A;  2IFQ A;  2E2M A;  3GST A;  2FA4 A;  3BCK A;  6GSV A;  3PPU A;  1YKC A;  3M9K A;  1GSF A;  2WB9 A;  2XC2 A;  5HR0 A;  3RPP A;  2H6Z A;  3C71 A;  3MAK A;  4HDE A;  1MD3 A;  4EKZ A;  4HU9 A;  2EC4 A;  1K0N A;  2KP1 A;  2BJX A;  5DVB A;  5HR2 A;  4G19 A;  3J7Y k;  2R0P A;  4LL4 B;  3FYG A;  3QAV A;  1JZW A;  4BVX B;  2M72 A;  2EIR A;  2AB6 A;  5A4W A;  4ECC A;  3U6V A;  5ECS A;  4FIW A;  4NV2 A;  4H86 A;  2V2G A;  5CYY A;  3HZ8 A;  2XHF A;  1PSQ A;  3U5R E;  2PU9 C;  1TP9 A;  4L5O A;  2YWI A;  1RW1 A;  3KP9 A;  1AIU A;  3ZLP A;  3S9F A;  1GTU A;  1OC8 A;  3KEB A;  2KOK A;  2L5L A;  1N2A A;  3G7Y A;  4L0U A;  3VWX A;  2R2J A;  3IV4 A;  4ZBA A;  3A3T A;  1Z3E A;  1XWA A;  3A2W A;  5G5F A;  4NXI A;  1V2A A;  3F8U A;  2HNL A;  2VO4 A;  2DJ1 A;  3KM6 A;  2YV9 A;  4MH3 A;  4GTU A;  2NTO A;  4K5S A;  5KN3 A;  1F9M A;  3AY8 A;  5H5Q A;  3TRX A;  1TRS A;  2B1L A;  2RLI A;  2H01 A;  2QSI A;  2V6O A;  4O7H A;  3UL3 A;  5ELG A;  1XWK A;  2L4Q A;  5AIV A;  4J56 E;  5A4U A;  2DIY A;  2E2G A;  1YKA A;  5D73 A;  3EMP A;  3VPQ A;  3CYN A;  4N30 A;  3IK9 A;  5L71 A;  2B7J A;  4DSQ A;  1O7U A;  4Z2R A;  3VK9 A;  2ON7 A;  2YP6 A;  1S3D A;  4BVY B;  3O3T A;  2OBK A;  3RBT A;  3MDK A;  3HD5 A;  3W8S A;  5D9W A;  1OAZ A;  3FZA A;  3RHC A;  3M8N A;  3OR5 A;  1BYE A;  4FH8 A;  1PRX A;  2QGV A;  5ECO B;  2O89 A;  2GSS A;  1UN2 A;  5DAL B;  4GQC A;  3HZ4 A;  4K2X A;  3HJM A;  1A8Y A;  1PKZ A;  5KN1 A;  3GKX A;  12GS A;  1E2Y A;  2WS2 A;  3PH9 A;  1S3A A;  2YOI A;  2FWH A;  1K0D A;  1VF1 A;  4PNG A;  2FCH A;  4PQH A;  4N11 A;  1Z7P A;  4G0L A;  2BTO T;  5DQY A;  1MD4 A;  4IP6 A;  1T1V A;  4POL A;  2DJ2 A;  3IHQ A;  2V32 A;  2VLU A;  19GS A;  1A8L A;  5HFK A;  4XHM A;  3CSI A;  4GCI A;  4EC0 A;  4K7N A;  1TI3 A;  2VLV A;  2AV4 A;  2AJQ B;  3VI5 A;  2IWT A;  3KJY A;  4NMU A;  2FY6 A;  1EZK A;  2DLX A;  2LV3 A;  1G0T A;  2WFC A;  1XIY A;  5G5E A;  2H0G A;  4NHZ A;  5INY A;  3KP8 A;  4F2I A;  4AJ6 A;  3TKS E;  1NM3 A;  2MBS A;  4F0C A;  1TRV A;  1A2L A;  3O76 A;  4IN0 A;  3I43 A;  1SJ6 A;  4PQI A;  3Q6O A;  2IN3 A;  1GTB A;  4DSS B;  3R2Q A;  4ZB8 A;  4ECB A;  1FOH A;  2VL2 C;  3F6D A;  1TDI A;  2K6V A;  3EVI A;  4HU7 A;  3D6I A;  4XS4 A;  2GQK A;  1LBK A;  1T4Z A;  3EWL A;  3H1N A;  2J9H A;  1F3B A;  2FNO A;  3WD6 A;  1OC9 B;  5IMC A;  4X0X A;  3TRP A;  3ZTL A;  5IOW A;  3FRC A;  2H1B A;  1OKT A;  2CZ2 A;  1UVZ A;  3DIE A;  1PN9 A;  3IBH A;  2MMA A;  1K0A A;  1O73 A;  4WXT A;  3EYT A;  1B4Q A;  2HLS A;  2QC7 A;  4KSM A;  3FMW A;  1ERU A;  4KGI A;  2LJR A;  4L5L A;  3QD9 A;  2MMZ A;  5HR1 A;  3M3M A;  1EV4 A;  3QDN A;  4O92 A;  1URM A;  4PTS A;  4TR0 A;  1YEX A;  11GS A;  2H1G A;  2HSY A;  1DE1 A;  2NPB A;  2MMN A;  2I1U A;  2X99 A;  4N0Z A;  1JZO A;  2M80 A;  1XPV A;  4G9H A;  4HZ2 A;  4L8E A;  1SKS B;  2WRT A;  5G2Z A;  2EIQ A;  4WET A;  4A5P A;  4TR3 A;  4LMV A;  1SK0 A;  4Q5Q A;  1OVN A;  3FW2 A;  14GS A;  1SJZ A;  3W8J A;  1F3A A;  3LYK A;  3CBU A;  4ZIL A;  3A2X A;  4CHS A;  2C0E A;  2R6K A;  4KDY A;  2REM A;  3G7I A;  4TRX A;  4POB A;  1YF1 A;  4RUV A;  1O6J A;  3GNJ A;  2PPT A;  2ES7 A;  1IYH A;  2OKA A;  4EF0 A;  1EP8 A;  6GSY A;  4YAV A;  3E9J B;  3VLN A;  2HRA A;  1GL8 A;  2GZP A;  3PIN A;  1BG5 A;  3L78 A;  1GP1 A;  4IJ3 A;  4K6X A;  2ZNM A;  4PUR A;  2H66 A;  1F6M C;  3I6A A;  1SKW B;  5IM9 A;  1FG4 A;  1ON4 A;  2H0H A;  2EIO A;  1O8X A;  3M0F A;  1DUG A;  5DJL A;  3V1W A;  2H73 A;  4ID0 A;  4J57 E;  4F9Z A;  3GX0 A;  2CVK A;  3QAW A;  3EIN A;  4DEJ A;  1GLP A;  2MBT A;  4XRA A;  3R3E A;  4P3Y B;  2R3X A;  3H93 A;  3KH7 A;  5B8A A;  2P5Q A;  3ZVJ D;  1K3O A;  1YJ6 A;  4ILF A;  17GS A;  4JRR A;  4KUN A;  3TKQ A;  3ERW A;  5KN2 A;  1QQ2 A;  1M2A A;  4X43 A;  1E6B A;  1X9S B;  1KNG A;  5F8B A;  3JCM L;  2HE3 A;  2CAI A;  3IC4 A;  4K7I A;  3TJK A;  1W4V A;  2I9H A;  1QK8 A;  5IPH A;  1V57 A;  13GS A;  1ZCP A;  5D93 A;  4O5R A;  3GMF A;  3QMX A;  4TXO B;  4TR1 A;  1IYI A;  3TGZ A;  2L6C A;  2C3Q A;  10GS A;  3GKM A;  2CT6 A;  1FHE A;  4CY8 A;  1QMV A;  4TR4 A;  3VI7 A;  1V98 A;  1Y25 A;  4FYU A;  4MJE A;  3WGD A;  4KAE A;  2GQL A;  2LS5 A;  1G6W A;  4TKY A;  3QFB C;  5J3R A;  3FR3 A;  1GTI A;  1OYJ A;  2GZZ A;  2MMO A;  4I97 A;  2L4C A;  1WWJ A;  2B1K A;  2WJU A;  2LST A;  5DAK B;  4IQA A;  1RK4 A;  3FKF A;  1ZYE A;  1V40 A;  4KX4 A;  3HHV A;  3GN3 A;  3CSH A;  5DCG A;  4ZIJ A;  1AUC A;  2DKI A;  1XVW A;  4BL7 B;  1O85 A;  1XVQ A;  2LRT A;  2O8V B;  4TW5 A;  4WKW A;  2ZCT A;  4IEL A;  3EU4 A;  4OCE A;  3KGK A;  1ERT A;  1PGT A;  4Z2T A;  4CW9 A;  2JSY A;  4ECJ A;  5IO0 A;  3F4S A;  3CMI A;  3MNG A;  1TI1 A;  1YZX A;  1TRU A;  2CV4 A;  2YJ7 A;  1G7E A;  4JU5 A;  5ECQ B;  4G0K A;  3LG6 A;  1TK0 B;  3F63 A;  6GSW A;  3BJ5 A;  3F4R A;  4DSR A;  2QA2 A;  2C80 A;  3APS A;  4BVX A;  2NDO A;  5IPG A;  2OAC A;  1ZZY A;  1PX7 A;  2I4A A;  1GSU A;  2A2P A;  2DJ3 A;  4BA7 A;  4RI7 A;  2JZS A;  3ERG A;  1WOU A;  1VF2 A;  4EVM A;  2H70 A;  4HUA A;  2VL3 A;  4KW6 A;  4BWS A;  2X64 A;  5D9X A;  3VWW A;  1MEK A;  2FGX A;  2GST A;  1SJI A;  2B3S A;  2IMF A;  1SD9 A;  3LYP A;  1TU8 A;  3KD0 A;  3WT2 A;  1GNE A;  1WP0 A;  3WYW A;  3D21 A;  3KIJ A;  2GGT A;  3ZIJ A;  2FA8 A;  5IMF A;  1GNW A;  1A2M A;  5C00 A;  3FZ9 A;  1Z9H A;  2HZF A;  4X4J A;  6GST A;  4MCU A;  3QFA C;  2VM1 A;  1G6Y A;  5B8B A;  1J9B A;  4MF5 A;  2KP2 A;  3FHK A;  4KB3 A;  4TVE A;  3IK7 A;  2IJY A;  4OO5 A;  2F51 A;  3L4N A;  1R4W A;  3H4K A;  1AC1 A;  4IGJ A;  4MP4 A;  3DD3 A;  1ZGN A;  3HKR A;  4LA1 A;  1K0O A;  1LJR A;  3J7Y b;  4IKH A;  2ALB A;  4OCF A;  1EV9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...