2Z9SA

Crystal structure analysis of rat hbp23/peroxiredoxin i, cys52ser mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
197
structure length
197
Chain Sequence
SGNAKIGHPAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVSPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin-1
publication title Dimer-Oligomer Interconversion of Wild-type and Mutant Rat 2-Cys Peroxiredoxin: DISULFIDE FORMATION AT DIMER-DIMER INTERFACES IS NOT ESSENTIAL FOR DECAMERIZATION
pubmed doi rcsb
source organism Rattus norvegicus
total genus 58
structure length 197
sequence length 197
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2007-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2z9sA00
5DQSA 4ZB8A 2C0DA 1SKSB 3UVHA 3TRXA 1C72A 10GSA 4TOPA 4F9ZA 2IL3A 3IAS2 14GSA 2GVPA 2IFQB 1SK0A 1JLVA 1BYEA 2L4QA 2RIIA 2JL4A 4IGJA 2H19A 4ZB9A 2WJUA 2H0HA 3UAPA 2DBCA 3FEUA 3GMFA 5JCGA 1W4VA 1N2AA 1GSUA 1R4WA 2LV3A 2B7KA 2N5AA 5IMCA 3ZMLA 2H73A 4ZILA 3GX8A 2J9HA 3ME7A 4MZWA 5JCUA 1T1VA 2PWJA 4CHSA 2DMMA 3F6DA 1XXUA 4L5LA 1TI1A 5A5KA 4EF0A 2YWMA 3P8WA 2ON7A 5H5QA 4EO3A 3F0IA 1K0DA 2NBSA 2ZCTA 3KJYA 4KB3A 1EZKA 5J5NA 4I2TA 8GSSA 3HD5A 2IJYA 2B5XA 1ZZYA 3ZTLA 1U87A 5G5EA 5AGYA 4E8EA 6GSXA 4HQSA 1SK2A 5ELAA 1TU7A 2NPBA 3DIEA 4PQIA 2YOIA 2VOCA 3C7MA 1UVZA 2IMKA 3IV4A 3KH9A 4HU9A 3TKRA 2ALBA 2H6XA 4TN8A 4E8HA 3EWLA 2VD0A 2PUKC 1OC9A 3VLNA 2ES7A 3FR6A 1EGOA 1NHOA 3FZ5A 4JE1A 4NV2A 3LXTA 1PD21 3I43A 4I2UA 5IO0A 4HDEA 2YWOA 3TKSE 1HD2A 3RPNA 3G7IA 1EV9A 2TIRA 3EE2A 3ZZXA 2H76A 2OJLA 2YV7A 1U3IA 4Q5NA 2GSQA 3KP8A 2YZHA 1PKWA 1PRXA 2G2QA 5DJMA 1GP1A 1O73A 2CX3A 2NDOA 4L5OA 2CAQA 1E2YA 4F0CA 5GSSA 2VL2A 2JZSA 1F3AA 5ECMB 3ZVJA 4MMMA 3HJPA 4TR0A 2KHPA 3WGXA 1HYUA 1M9AA 5F0GA 4Q5FA 2WCIA 2F3MA 1GH2A 4RUVA 2JZRA 2A4VA 1QXHA 4YAVA 1TRSA 2OBKA 2LJAA 6GSYA 2FWFA 1SL2B 1K0CA 1GUMA 3TCOA 2GT5A 2DJ1A 3KTBA 1YEXA 1SD8A 4GQCA 4AF2A 2NVLA 3DMLA 2HFDA 5KN2A 4POKA 1E6BA 3L9SA 3U6VA 3AY8A 4I5QA 3FRCA 3US3A 2R6KA 3M1GA 2O87A 4AJ8A 2VO4A 2D2ZA 4YQMA 2L6DA 1YF0A 3I6AA 1NM3A 4OCEA 4X0XA 4XHMA 5IMFA 1JLWA 1TXXA 4AJ7A 4FYBA 2GZPA 1U6TA 4LL4B 3TKPA 1V2AA 2CVKA 1K3YA 3QOUA 1ZGNA 2FUG2 1BJXA 3VI7A 2LUSA 4DSRA 1R5PA 3IK7A 4N10A 3RBTA 4N0ZA 3ZITA 20GSA 2YV9A 4K9ZA 3VK9A 3TDGA 2VCWA 2O89A 5LD0A 1FAAA 4EDZA 2CZ2A 1ACVA 1ZCPA 2HE3A 1XZOA 2GZYA 3HYPA 4TVEA 3KP9A 3UOMA 1RW1A 1B9XC 2GQMA 2CT6A 3GNJA 2Z9SA 4K2DA 1AIUA 2PVQA 1M7TA 1Y25A 3TJFA 2QGVA 3KIJA 4XS1A 4FH8A 2PVOC 2H8LA 2MMAA 2R4VA 5ECSA 3D0ZA 5ABRA 3HKRA 1TU8A 5HR0A 2B1LA 1WIKA 3IAM2 2QKEA 1SENA 1TK8B 2GDRA 1AW9A 1V40A 1NSWA 3BD2A 1O7UA 1WPIA 2H66A 5J4UA 1GSQA 4JRRA 4PX1A 2E2MA 5HQPA 1Z6MA 5HR3A 1ERWA 1XWKA 1TTZA 3F3RA 4N11A 1CQHA 4EKZA 1EOGA 2H6ZA 5EY6A 3GURA 4DSSB 6GSSA 1WOUA 2LEGA 3W8JA 2GQKA 2GSTA 1EGRA 3H79A 5HFGA 2OACA 1F9MA 1EEJA 4OWYA 4PXOA 5JWOB 5EPFA 4PURA 3CMIA 5G1KA 2FHEA 2C3TA 1IYIA 1AXDA 4GCIA 3LORA 1XCCA 3LWAA 2AHEA 3ZFBA 5DCGA 2IN3A 4XS6A 1URMA 1WP0A 2X99A 5ID2B 3IBHA 2HZEA 4MJCA 1TK0B 3F63A 3EC3A 2GGTA 4KSOA 2CVDA 3GTUA 4J2FA 4GLTA 4DSQA 3Q74A 3GKNA 3EYTA 1G7EA 1EOHA 3EMPA 1VF1A 1GTIA 4K0GA 5D9XA 5ECLB 4Q5QA 4QL7A 5HFIA 4LMVA 2FWGA 2A2RA 3PGTA 5ECRB 3VWUA 5G5FA 2FNOA 2IIYA 2QC7A 3LYPA 3DEXA 1MD3A 2GT6A 4IQ1A 4JR4A 1TRVA 1O81A 1VRSD 3GL5A 3NZNA 5G2ZA 18GSA 4XS4A 5FT3A 1SK1A 2GSSA 4ZBAA 3Q6OA 4JZQA 2M46A 1FW1A 1M99A 2FD3A 4V1Ap 1JZWA 3UBKA 4NAXA 4MF6A 1AQVA 2GLRA 6GSTA 3RAZA 4I97A 4EDYA 4WKWA 4TKYA 4HJ2A 3IXRA 5GSTA 4O32A 2O85A 1B48A 3WYWA 5F05A 3H8QA 2KLXA 2WGRA 2IFQA 4IS0A 3PINA 1FHEA 2YPMA 3GTUB 4OO5A 5B6NA 3WGEA 2EC4A 4LL1B 1YKAA 2FA8A 4IW9A 5J41A 3ZMKA 5ENUA 4EL1A 1AC1A 3TJBA 4NMUA 4HI7A 1GUHA 5DDLA 3TOUA 3U5RE 4G2EA 5E59A 2HRNA 2CX4A 1SYRA 4POMA 3MAKA 1B4QA 2B6MA 3DXBA 4F2IA 3IR4A 4TR1B 1A0RP 3L78A 3PR8A 2I9HA 4XS4B 1S3DA 3D21A 3CSHA 2PN8A 3F4SA 3TKSC 4ECCA 2YN1A 3KXOA 4J56E 4HS1A 2BTOT 1Z9HA 4HOJA 3D6IA 3VFIA 6GSVA 3F6FA 2PPTA 3D4TA 1XOBA 4KH7A 1GWCA 2LQOA 1B9YC 2VLUA 2WS2A 4JEDA 4WR4A 3TGZA 5ECHB 4V2MA 2HXKA 1GSDA 2X8HA 1GSSA 1QMVA 3GHAA 3KZQA 5H5RA 4GSTA 1WMJA 2DSAA 4L0UA 4WBJA 2CQ9A 1G0TA 2L4CA 4K0NA 2J23A 2HT9A 1M2DA 1BX9A 5A4VA 1VF4A 4RQXA 7GSSA 3E0UA 4IJIA 2YNXA 3A2VA 3M0FA 1R26A 3C8EA 4WXTA 2XHFA 4F82A 16GSA 4OMVA 4CDOA 4KCEA 1G6YA 2HSHA 3IA1A 4N30A 1GLQA 4MZBA 1YDKA 3CSIA 3L4NA 1A8LA 1EEMA 2IWTA 1OKTA 1ERUA 3LSZA 5DJLA 2M72A 4KDYA 2HLSA 1XBSA 2IMIA 4MF7A 2VAFA 1BG5A 4GF0A 4PUFC 1M0UA 3E3EA 3MSZA 2YWIA 4BPYA 3BCKA 2E2GA 2CVBA 3QMXA 5CREA 1FOVA 3ERWA 3ZRDA 1A2LA 4F0BA 4IQAA 1S3AA 1BAYA 2CAIA 3KGKA 3A3TA 2XBIA 1X9WB 1K0OA 1HNBA 1TJDA 2L6CA 2AV4A 5AISA 5D73A 3ZLPA 4RI7A 1N8JA 1WE0A 1HQOA 1BQ7A 2XC2A 1O6JA 4IELA 4ZL9A 3QDNA 1FO5A 1XWAA 3UIWA 17GSA 3GKKA 2HNLA 4FO5A 1DUGA 1GSFA 5IOXA 2KOKA 5KEJA 5CP1A 5G30A 4MP4A 2R3XA 2LRTA 3UEMA 1QUWA 2FA4A 2DJJA 5CRHA 2REMA 3C73A 2LTKA 1YZXA 3CTGA 1NW2A 1X9SB 1WJKA 1SD9A 1W89A 4KCAA 4IN0A 4K1FA 6GSUA 3GA4A 3MDKA 1FVJA 4LLRA 4ECJA 3D4MA 3QD9A 4ILFA 2FGXA 2RLIA 1M2AA 2L57A 3A2XA 3C71A 3IC4A 2OA7A 2KUCA 1TW9A 4EXJA 4K7NA 4FYCA 5ECKB 3FHKA 3RPPA 3GSSA 3ZL5A 4PQ1A 1OE7A 2DIZA 1Y6EA 1K0MA 1SJIA 2R37A 1DE1A 2F8FA 4EUYA 2WULA 5DALB 4YQVA 1TOFA 2VL9A 2AAWA 2EIQA 2AYTA 2H1AA 1X0RA 2VCXA 3OR5A 2X8GA 3PH9A 4ACSA 2LS5A 3O76A 1UA5A 5FWGA 3JCML 3UMAA 4ULXA 2YWNA 4L0WA 2DC5A 1JZDA 1WWJA 2AUVA 2K8SA 4KA0A 4DSSA 2JADA 1XWBA 3TB2A 1NHYA 2VUPA 2YANA 4OCFA 5D9TA 4BA7A 5LCZA 1SU9A 1XIYA 4JU5A 2B3SA 4TW5A 1BEDA 4MH3A 5GAND 3UVTA 1GULA 5HFKA 9GSSA 4V2LA 2PGTA 4CW9A 3BCIA 1V58A 1JZRA 3F8UA 2V6KA 2O7KA 1EP8A 4XRAA 3S9FA 4IKHA 5D93A 4MPFA 5CRGA 1GSEA 2FY6A 2VL2C 1PGTA 1FB6A 3DWVA 2MBSA 5C00A 5EL8A 4G9HA 3DRNA 5HR2A 4MA9A 5ID2A 1X5CA 1YQ1A 4IJ3A 4L8EA 5IO2A 1OYJA 4NHZA 3IOSA 1K0BA 1JHBA 5INYA 2RUFA 3GFKA 2FWHA 3M9JA 3TRPA 4KSMA 2H0GA 2TRCP 4D73B 3DKSA 3QAGA 3LFLA 5F8BA 3KD0A 4I6XA 3IPZA 4ECIA 2VCZA 4QL9A 2LNTA 1TK5B 2HZFA 19GSA 2V1MA 1A8YA 3J7Yk 1XFLA 1X5EA 3HVSA 3L9UA 1ILOA 1SL0B 5IPHA 4O5RA 1A2MA 4HQZA 3WGDA 2VLVA 2H0IA 3HY2A 1XW6A 3GKXA 1OKDA 4TXOA 5CNWA 5FHIA 4ZXGA 2JACA 3F4TA 1K0NA 4IP6A 3CXGA 2C80A 1FVKA 2K6VA 2LJKA 1MTCA 2FCHA 2V32A 2ZNMA 3LYKA 4WBRD 4PGTA 5KN3A 1F37A 2MMOA 2B5YA 4O92A 4YAPA 5DAKB 1ML6A 2E0QA 2RM5A 3HJMA 1A0FA 2N5FA 5CAXA 3LGCA 2P31A 4ISDA 1ZMAA 5IIZA 1I5GA 1PN9A 3M3MA 4JBBA 1PX7A 5IMVA 3UARA 3H93A 1DBYA 2GZZA 2LRCA 1MEKA 2C0EA 3VWVA 1SYXA 2PERA 1DE2A 3I9V2 4MJBA 3ZREA 2P0GA 3APSA 4GQFA 2JSYA 1O8WA 2C8UA 1O85A 2KP1A 4TR1A 1ERVA 3LJRA 2CA8A 3QPMA 2C3NA 4NHWA 5ECOB 3WT1A 2QSIA 3IDVA 4J57E 4K7OA 5F06A 1MDIA 3P7XA 4X43A 3D22A 1LJRA 4TR3A 2H70A 3HZ8A 4TR4A 4TXOB 2L59A 1SJ6A 3IRAA 2JSZA 3E9JB 3SWLA 1VF3A 1KTEA 2X8CA 4GRFA 2H71A 2P5QA 2LSTA 4RQRA 2BMXA 5CRWA 2P5RA 4ZL8A 5LNKe 2OE3A 4IHUA 2GSRA 4ECBA 5L71A 1M9BA 2EIRA 5B7CA 5D9VA 3NIVA 3HZ4A 3WD6A 1AAZA 3RDWA 2C4JA 3GX0A 3ZYWA 3IE3A 3ERFA 1GNEA 4MH2A 5IQYA 4BVYA 1LBKA 2B7JA 4KAEA 3FZ9A 3NOFA 4NWYA 1X9MB 1AQXA 1U3AA 4TXVA 3EMXA 1EWXA 1TP9A 5C04A 3UL3A 4GSSA 1PL2A 3ZIVA 2F9SA 5JWRB 3F3QA 2R5GA 2IMFA 1OAZA 3R2QA 2F8AA 1XWGA 4ML1A 3CRTA 3P2AA 2AJQB 2PBJA 3O3TA 2VCTA 4ZBDA 3ZFLA 3FR3A 2C0FA 4MPGA 1A23A 3A2WA 4MDCA 5DCHA 3VI5A 4WF5A 2VIMA 2V2GA 4POLA 2HYXA 1CQGA 2GQLA 5AIXA 3KM6A 3FZ4A 5KN1A 4EC0A 4NPBA 2C1YA 13GSA 3VPQA 4BWSA 4GSNA 2YJ7A 2YJHA 2IPAA 1TKDB 2H75A 2VM1A 4K6XA 3FKFA 3HHVA 3H1NA 4OFTA 4BWQA 5IOWA 1GUKA 3H4KA 3ISOA 1XVQA 3ED3A 1OC3A 2LJRA 1R5AA 1K0AA 3MNGA 3VWXA 2VD1A 1EV4A 1OC8A 3KTLA 1J08A 3ME8A 4XIHA 1GNWA 3CBUA 1ST9A 3BBYA 3N5OA 1HNAA 2IMDA 5COHA 3G7JA 3F9UA 1QFNA 2L5OA 2OE0A 4PUAA 3APQA 4MZCA 3GSTA 1RQMA 4KX4A 4NV5A 3TJKA 3KEBA 2HRFA 2M80A 3W6GA 2H6YA 5CRDA 4NXIA 3DVWA 1OVNA 4KDUA 1PSQA 4PNFA 3UJ1A 4BL7A 2CV4A 5G31A 1XW5A 4LA1A 1SKWB 1HNCA 12GSA 2VLTA 1RK4A 3ERGA 1F3BA 1T4ZA 3TJJA 2WDUA 3RHCA 5DALA 3VURA 1Z5YE 2IMEA 1A2JA 2HSYA 5IMDA 1H75A 5JCWA 2MBTA 4MCUA 4YQUA 1V57A 1MD4A 3G9BA 3MWHA 4TRXA 3APOA 3QAVA 3EVIA 1OE8A 3L0HA 4PQHA 4ID0A 3GH6A 3FR9A 1O8XA 2L5LA 1JFUA 1F2EA 2F51A 3EU4A 6GSWA 3K8NA 1I9DA 4HZ4A 2RM6A 4V1Ag 3LEFA 1VGLA 1S3CA 2I1UA 1ABAA 5DBQA 1B8XA 3GYKA 2JU5A 2MZCA 5A4UA 2JZTA 2VCVA 1ERTA 2VL3A 4G10A 3M8NA 3GV1A 2WFCA 5JWQB 1Z7PA 5B6MA 2NTOA 3LQ7A 4FYUA 4QQ7A 2OADA 3FW2A 1H4OA 3QR6A 3BOAA 1KBNA 1YEPA 2H1GA 3VPTA 1K3OA 3M9KA 3QFAC 4ZIJA 5E4WA 1U88A 4MK3A 2TRXA 3GL3A 4H86A 1GTAA 2VCQA 4OFNA 1X5DA 5J3RA 1GTBA 3I69A 1LU4A 2VM2A 1OC9B 2PMTA 4YH2A 2KP2A 4P3YB 2E7PA 1DSBA 3VWWA 4D73A 1WRYA 2MYGA 2MMZA 1GTUA 1B4PA 1V9WA 2LKUA 1SL1B 3FZAA 4F03A 2ZUPA 2LNSA 3C1SA 3DYRA 2H01A 22GSA 2O8VB 3G7YA 3HJOA 5DQYA 3UBLA 2XBQA 1PL1A 1V98A 2BJXA 4LMWA 2RUEA 4OD7A 4XCSA 2I81A 3KH7A 4MLYA 4N0VA 2B1KA 3HVVA 5ECPB 2R2JA 3F4RA 3FK8A 4WEYA 4K7IA 2K9FA 3LG6A 4HJMA 1GRXA 4GXZA 5B8BA 2DLXA 3TRQA 1SKRB 3DD3A 3LXZA 3HVXA 4V2NA 3A5WA 3QCPA 3TJGA 4BVXA 1YJ6A 5J9CA 5DAKA 2DJ2A 1THXA 1GLPA 1FB0A 1F6MC 3EU3A 1R7HA 3DGQA 4GWRA 5D9WA 1Z7RA 4KGIA 1UN2A 1EP7A 2WZ9A 3QFBC 3CRUA 2EIOA 4G19A 5ECNB 4HZ2A 2K18A 2C3QA 1ZYQB 3WT2A 3RHBA 5IM9A 1T4YA 2V6OA 5D8IA 5IMZA 3O6TA 4PNGA 2DMLA 3C1RA 2LQQA 4RI6A 1Z6NA 4IBPA 5EVOA 4GTUA 4OO4A 1VF2A 1T8EB 1MDKA 3SBCA 2ON5A 5B8AA 2AB6A 3CSJA 3Q19A 4ZL7A 1XOAA 1QGVA 5J9BA 3QAWA 3GH9A 1USBA 1Z3EA 2FLSA 3J7Yb 1ZL9A 2I4AA 3CTFA 3KMNA 4XRDA 1QQ2A 2H1DA 2YP6A 3TKQA 1TRUA 2H30A 1J9BA 1PQNA 2C0GA 3EINA 4MABA 2DJ3A 2GS3A 2I3YA 5KN0A 2H74A 5AN1A 4DEJA 3EURA 1PX6A 4WR5A 4I8BA 5F07A 5ECQB 2YZUA 3GIXA 1T7PB 3HDCA 5IPGA 1G7OA 4X1UA 2XPEA 1K3LA 1M2BA 2B5EA 3TKSA 1GL8A 1PA3A 1PMTA 3GRXA 4ZB6A 1JZOA 3FYGA 2PU9C 3KCMA 1YY7A 2DJKA 4KW6A 4MJAA 5D96A 5GAPD 1YKCA 3GN3A 1T3BA 4FIWA 2OBIA 1SJZA 3CYNA 4EE0A 1KEBA 3P90A 5A4WA 3N9JA 4O7HA 3KMOA 3D5JA 4HU7A 1Q4JA 4DVCA 2DJ0A 4MJEA 4WF4A 3ZVJD 2YCDA 3ZIJA 1PKZA 5G1LA 5GZZB 4OFMA 2CZ3A 3W8SA 4MF5A 2G0FA 2FWEA 4HEA2 3L9VA 1AUCA 4K8MA 3HXSA 2LRNA 5CYYA 2OKAA 2H1BA 4KUNA 4KE3A 1THOA 2GTUA 3HCZA 2HZEB 3FY7A 3TOTA 3HA9A 1Q98A 2X64A 1QK8A 2K8VA 4EVMA 3GKMA 2A2SA 1UC7A 4ML6A 2H72A 3TUEA 1YF1A 1MDJA 4AJ6A 2WRTA 2DIYA 2N5BA 1G6WA 4KNDA 4Q5RA 1FG4A 3DVXA 4WETA 11GSA 4JR6A 1TDIA 2WB9A 1T00A 5CO3A 5ECIB 1AQWA 5H5SA 4ZBBA 4Z7XA 5AIVA 1TI3A 5IMAA 2OE1A 1XVWA 2XPDA 4AGSA 1ZOFA 2HI7A 1XPVA 1XW9A 1ZYEA 4IVFA 1IYHA 4HUAA 3Q18A 1TRWA 5HR1A 2MMNA 5DVBA 4POBA 1ON4A 3GUSA 3IHQA 1A24A 1XWCA 4IP1A 5ELGA 2V41A 3IK9A 4KDXA 1J0FA 1KNGA 3BJ5A 4XTSA 3V1WA 1GSYA
chains in the Genus database with same CATH superfamily
5DQSA 4ZB8A 2C0DA 1SKSB 3UVHA 3TRXA 1C72A 10GSA 4TOPA 4Z2RA 4F9ZA 2IL3A 3FMWA 3IAS2 14GSA 2GVPA 2IFQB 1SK0A 1JLVA 1BYEA 2L4QA 2RIIA 2JL4A 4IGJA 2H19A 4ZB9A 2WJUA 2H0HA 3UAPA 2DBCA 3FEUA 3GMFA 5JCGA 1W4VA 1N2AA 1GSUA 1R4WA 2LV3A 2B7KA 2N5AA 5IMCA 1ZYPA 2H73A 3ZMLA 4ZILA 3GX8A 2J9HA 3ME7A 4MZWA 5JCUA 1T1VA 2PWJA 4CHSA 2DMMA 3F6DA 1XXUA 4L5LA 1TI1A 5A5KA 4EF0A 2YWMA 3P8WA 2ON7A 5H5QA 4EO3A 3MYDA 3F0IA 1K0DA 2NBSA 2ZCTA 3KJYA 4KB3A 1EZKA 5J5NA 4I2TA 8GSSA 3HD5A 2IJYA 4Z2TA 2B5XA 1ZZYA 3ZTLA 1U87A 5G5EA 5AGYA 4E8EA 6GSXA 4HQSA 1SK2A 5ELAA 1TU7A 2NPBA 3DIEA 4PQIA 2YOIA 2VOCA 3C7MA 1UVZA 2IMKA 3IV4A 3KH9A 4HU9A 3TKRA 2ALBA 2H6XA 2R0PA 4TN8A 3EWLA 3MIXA 4E8HA 2VD0A 2PUKC 1OC9A 3VLNA 2ES7A 3FR6A 1EGOA 1NHOA 3FZ5A 4JE1A 4NV2A 3LXTA 1PD21 3I43A 4I2UA 5IO0A 4HDEA 2YWOA 3TKSE 1HD2A 3RPNA 3G7IA 1EV9A 2TIRA 3EE2A 3ZZXA 2H76A 2OJLA 2YV7A 1U3IA 4Q5NA 2GSQA 3KP8A 2YZHA 1PKWA 1PRXA 2G2QA 5DJMA 1GP1A 1O73A 2CX3A 2NDOA 4L5OA 2CAQA 1E2YA 4F0CA 5GSSA 2VL2A 2JZSA 1F3AA 5ECMB 3ZVJA 4MMMA 3HJPA 4TR0A 2KHPA 3WGXA 1HYUA 1M9AA 5F0GA 4Q5FA 2WCIA 2F3MA 1GH2A 4RUVA 2JZRA 2A4VA 4PTSA 1QXHA 4YAVA 1TRSA 2OBKA 2LJAA 6GSYA 2FWFA 1SL2B 1K0CA 1GUMA 3TCOA 2GT5A 2DJ1A 3KTBA 1YEXA 1SD8A 4GQCA 4AF2A 2NVLA 3DMLA 2HFDA 5KN2A 4POKA 5BRTA 1E6BA 3L9SA 3U6VA 3AY8A 4I5QA 3FRCA 3US3A 2R6KA 2QA2A 3M1GA 2O87A 4AJ8A 2VO4A 2D2ZA 4YQMA 2L6DA 1YF0A 3I6AA 1NM3A 4OCEA 4X0XA 4XHMA 5IMFA 1JLWA 1TXXA 4AJ7A 4FYBA 2GZPA 1U6TA 4LL4B 3TKPA 1V2AA 2CVKA 1K3YA 3QOUA 1ZGNA 2FUG2 1BJXA 3VI7A 2LUSA 4DSRA 1R5PA 3IK7A 4N10A 3RBTA 4O5QA 4N0ZA 3ZITA 20GSA 2YV9A 4K9ZA 3VK9A 3TDGA 2VCWA 2O89A 5LD0A 1FAAA 4EDZA 2CZ2A 1ACVA 1ZCPA 2HE3A 1XZOA 2GZYA 3HYPA 4TVEA 3KP9A 4EIPA 3UOMA 1RW1A 1B9XC 2GQMA 2CT6A 3GNJA 2Z9SA 4K2DA 1AIUA 2PVQA 1M7TA 1Y25A 3TJFA 2QGVA 3KIJA 4XS1A 4FH8A 2PVOC 2H8LA 2MMAA 2R4VA 5ECSA 4CY8A 3D0ZA 3CQFA 5ABRA 3HKRA 1TU8A 5HR0A 2B1LA 1WIKA 3IAM2 2QKEA 1SENA 1TK8B 4KF9A 2GDRA 1PFOA 1AW9A 1V40A 1NSWA 3BD2A 1O7UA 1WPIA 4K2XA 2H66A 5J4UA 1GSQA 4JRRA 4PX1A 2E2MA 5HQPA 2HRKA 1Z6MA 5HR3A 1ERWA 1XWKA 1TTZA 3F3RA 4N11A 1CQHA 4EKZA 1EOGA 2H6ZA 5EY6A 3GURA 4DSSB 6GSSA 1WOUA 2LEGA 3W8JA 2GQKA 2GSTA 1EGRA 3H79A 5HFGA 2OACA 1F9MA 1EEJA 4OWYA 4PXOA 5JWOB 5EPFA 4PURA 3CMIA 5G1KA 2FHEA 2C3TA 1IYIA 1XG8A 1AXDA 4GCIA 3LORA 1XCCA 3LWAA 2AHEA 3ZFBA 5DCGA 2IN3A 4XS6A 1URMA 1WP0A 2X99A 5ID2B 3IBHA 2HZEA 4MJCA 1TK0B 3F63A 3EC3A 2GGTA 4KSOA 2CVDA 3GTUA 4J2FA 4GLTA 4DSQA 3Q74A 3GKNA 3EYTA 1G7EA 1EOHA 3EMPA 1VF1A 1GTIA 4K0GA 5D9XA 5ECLB 4Q5QA 4QL7A 5HFIA 4A5PA 4LMVA 2FWGA 2A2RA 3PGTA 5ECRB 3VWUA 5G5FA 2FNOA 2IIYA 2QC7A 3LYPA 3DEXA 1MD3A 2GT6A 4IQ1A 4JR4A 1TRVA 1O81A 1VRSD 3GL5A 3NZNA 5G2ZA 18GSA 4XS4A 5FT3A 1SK1A 2GSSA 4ZBAA 3Q6OA 4JZQA 2M46A 1FW1A 1M99A 2FD3A 4V1Ap 1JZWA 3UBKA 4NAXA 4MF6A 1AQVA 2GLRA 6GSTA 3RAZA 4I97A 4EDYA 4WKWA 4TKYA 4HJ2A 3IXRA 5GSTA 4O32A 2O85A 1B48A 3WYWA 5F05A 3H8QA 2KLXA 2WGRA 2IFQA 4IS0A 3PINA 1FHEA 2YPMA 1PN0A 3GTUB 4OO5A 5B6NA 3WGEA 2EC4A 4LL1B 1YKAA 2FA8A 4IW9A 5J41A 3ZMKA 5ENUA 4EL1A 1AC1A 3TJBA 3LW9A 4NMUA 4HI7A 1GUHA 4HSCX 5DDLA 3TOUA 3U5RE 4G2EA 5E59A 2HRNA 2CX4A 1SYRA 4POMA 2A4HA 3MAKA 1B4QA 2B6MA 3DXBA 4F2IA 3IR4A 4TR1B 1A0RP 3L78A 3PR8A 2I9HA 4XS4B 1S3DA 3D21A 3CSHA 2PN8A 3F4SA 3TKSC 4ECCA 2YN1A 3KXOA 4J56E 4HS1A 2BTOT 1Z9HA 4HOJA 3D6IA 3VFIA 6GSVA 3F6FA 2PPTA 3D4TA 1XOBA 4KH7A 1GWCA 2LQOA 1B9YC 2VLUA 2WS2A 4JEDA 4WR4A 3TGZA 5ECHB 4V2MA 2HXKA 1GSDA 2X8HA 1GSSA 1QMVA 3GHAA 3KZQA 3A5IA 5H5RA 4GSTA 1WMJA 2DSAA 4L0UA 4WBJA 2CQ9A 1G0TA 2L4CA 4K0NA 4BVYB 2J23A 2HT9A 1M2DA 1BX9A 5A4VA 1VF4A 4RQXA 7GSSA 3E0UA 4IJIA 2YNXA 3A2VA 3M0FA 1R26A 3C8EA 2HSMA 4WXTA 2XHFA 4F82A 16GSA 4OMVA 5KOXA 4CDOA 4KCEA 1G6YA 2HSHA 3IA1A 4N30A 1GLQA 4MZBA 1YDKA 3CSIA 3L4NA 1A8LA 1EEMA 2IWTA 1OKTA 1ERUA 3LSZA 5DJLA 2M72A 4KDYA 2HLSA 1XBSA 2IMIA 4MF7A 2VAFA 1BG5A 4GF0A 4PUFC 1M0UA 3E3EA 3MSZA 2YWIA 4BPYA 3BCKA 2E2GA 2CVBA 3QMXA 5CREA 1FOVA 3ERWA 3ZRDA 1A2LA 4F0BA 4IQAA 1S3AA 1BAYA 2CAIA 3KGKA 3A3TA 2XBIA 1X9WB 1K0OA 1HNBA 1TJDA 2L6CA 5BMUA 2AV4A 5AISA 5D73A 3ZLPA 4RI7A 1N8JA 1WE0A 1HQOA 1BQ7A 2XC2A 1O6JA 4IELA 4ZL9A 3QDNA 1FO5A 1XWAA 3UIWA 1S3RA 17GSA 3GKKA 2HNLA 4FO5A 1DUGA 1GSFA 5IOXA 2KOKA 5KEJA 5CP1A 5G30A 4MP4A 2R3XA 2LRTA 3UEMA 1QUWA 2FA4A 2DJJA 5CRHA 2REMA 3C73A 2LTKA 1YZXA 3CTGA 1NW2A 1X9SB 1WJKA 1SD9A 1W89A 4KCAA 4IN0A 4K1FA 6GSUA 3GA4A 3MDKA 1FVJA 4LLRA 4ECJA 3D4MA 3QD9A 4ILFA 2FGXA 2RLIA 1M2AA 2L57A 3A2XA 3C71A 3IC4A 2OA7A 2KUCA 1TW9A 4EXJA 4K7NA 4FYCA 4BL7B 5ECKB 3FHKA 3RPPA 3GSSA 3ZL5A 4PQ1A 1OE7A 2DIZA 1Y6EA 1K0MA 1SJIA 2R37A 1DE1A 4USSA 2F8FA 4EUYA 2WULA 5DALB 4YQVA 1TOFA 4G0IA 2VL9A 2AAWA 2EIQA 2AYTA 2H1AA 1X0RA 2VCXA 3OR5A 2X8GA 3PH9A 4ACSA 2LS5A 3O76A 1UA5A 5FWGA 3JCML 3UMAA 4ULXA 2YWNA 4L0WA 2DC5A 1JZDA 1WWJA 2AUVA 2K8SA 4KA0A 4DSSA 2JADA 1XWBA 3TB2A 1NHYA 2VUPA 2YANA 4OCFA 5D9TA 4BA7A 5LCZA 1SU9A 1XIYA 4JU5A 2B3SA 4TW5A 1BEDA 4MH3A 5GAND 3UVTA 1GULA 5HFKA 9GSSA 4V2LA 4ICYA 2PGTA 4CW9A 4K5SA 3BCIA 1V58A 1JZRA 3F8UA 2V6KA 2O7KA 1EP8A 4XRAA 3S9FA 4IKHA 5D93A 4MPFA 5CRGA 1GSEA 2FY6A 2VL2C 1PGTA 1FB6A 3DWVA 2MBSA 5C00A 5EL8A 4G9HA 3DRNA 5HR2A 4MA9A 5ID2A 1X5CA 1YQ1A 4IJ3A 4L8EA 5IO2A 1OYJA 4NHZA 3IOSA 1K0BA 1JHBA 5INYA 2RUFA 3GFKA 2FWHA 3M9JA 3TRPA 4KSMA 2H0GA 2TRCP 4D73B 3DKSA 3QAGA 3LFLA 2R0GA 5F8BA 3KD0A 4I6XA 3IPZA 4ECIA 2VCZA 4QL9A 2LNTA 1TK5B 2HZFA 19GSA 2V1MA 1A8YA 2X49A 3J7Yk 1XFLA 2DKHA 1X5EA 3HVSA 3L9UA 1ILOA 1SL0B 5IPHA 4O5RA 1A2MA 4HQZA 3WGDA 2VLVA 2H0IA 3HY2A 1XW6A 3GKXA 1OKDA 4TXOA 5CNWA 4MNNA 5FHIA 4ZXGA 2JACA 3F4TA 1K0NA 4IP6A 3CXGA 2C80A 1FVKA 2K6VA 2LJKA 3PPUA 1MTCA 2FCHA 2V32A 2ZNMA 3LYKA 4WBRD 4PGTA 5KN3A 1F37A 4BVXB 2MMOA 2B5YA 4O92A 4YAPA 5DAKB 1ML6A 2E0QA 2RM5A 4Z2UA 3HJMA 1A0FA 2N5FA 5CAXA 3LGCA 2P31A 4ISDA 1ZMAA 5IIZA 1I5GA 1PN9A 3M3MA 4JBBA 1PX7A 5IMVA 3UARA 3H93A 1DBYA 2GZZA 2LRCA 1MEKA 2C0EA 3VWVA 1SYXA 2PERA 1DE2A 3R3EA 3I9V2 4MJBA 3ZREA 2P0GA 3APSA 4GQFA 2JSYA 1O8WA 2C8UA 1O85A 2KP1A 4TR1A 1ERVA 3LJRA 2CA8A 3QPMA 2C3NA 4NHWA 5ECOB 3WT1A 2QSIA 3IDVA 4J57E 4K7OA 5F06A 1MDIA 3P7XA 4X43A 3D22A 1LJRA 4TR3A 2H70A 3HZ8A 4TR4A 4TXOB 2L59A 1SJ6A 3IRAA 2JSZA 3E9JB 3SWLA 1VF3A 1KTEA 2X8CA 4GRFA 2H71A 2P5QA 2LSTA 4RQRA 2BMXA 5CRWA 2P5RA 4ZL8A 5LNKe 2OE3A 3HVNA 4IHUA 2GSRA 4ECBA 5L71A 1M9BA 2EIRA 5B7CA 5D9VA 3NIVA 3HZ4A 3WD6A 1AAZA 3RDWA 2C4JA 3GX0A 2R0CA 3IE3A 3ZYWA 4CY6A 3ERFA 1GNEA 4MH2A 5IQYA 4BVYA 1LBKA 2B7JA 4KAEA 3FZ9A 3NOFA 4NWYA 1X9MB 1AQXA 1U3AA 3EPTA 4TXVA 3EMXA 1EWXA 1TP9A 5C04A 3UL3A 4GSSA 1PL2A 3ZIVA 2F9SA 5JWRB 3F3QA 2R5GA 2IMFA 1OAZA 3R2QA 2F8AA 1XWGA 4ML1A 3CRTA 3P2AA 2AJQB 2PBJA 3O3TA 2VCTA 4ZBDA 3ZFLA 3FR3A 2C0FA 4MPGA 1A23A 3A2WA 4MDCA 5DCHA 3VI5A 4WF5A 4O5UA 2VIMA 2V2GA 4POLA 2HYXA 1CQGA 2GQLA 5AIXA 3KM6A 3FZ4A 5KN1A 4EC0A 4NPBA 2C1YA 13GSA 3VPQA 4BWSA 4GSNA 2YJ7A 4G0KA 2YJHA 2IPAA 1TKDB 2H75A 2VM1A 4K6XA 3FKFA 3HHVA 3H1NA 4OFTA 4BWQA 5IOWA 1GUKA 3H4KA 3ISOA 1XVQA 3ED3A 1OC3A 2LJRA 1R5AA 1K0AA 3MNGA 3VWXA 2VD1A 1EV4A 1OC8A 3KTLA 1J08A 3ME8A 4XIHA 1GNWA 3CBUA 1ST9A 3BBYA 3N5OA 1HNAA 2IMDA 5COHA 3G7JA 3F9UA 1QFNA 2L5OA 2OE0A 4PUAA 3APQA 4MZCA 3GSTA 1RQMA 4KX4A 4NV5A 3TJKA 3KEBA 2HRFA 2M80A 3W6GA 2H6YA 5CRDA 4NXIA 3DVWA 1OVNA 4KDUA 1PSQA 4PNFA 3UJ1A 4BL7A 2CV4A 5G31A 1XW5A 4LA1A 1SKWB 2UZ8A 1HNCA 12GSA 2VLTA 1RK4A 3ERGA 1F3BA 1T4ZA 3TJJA 2WDUA 4X4JA 3RHCA 5DALA 3VURA 1Z5YE 2IMEA 1A2JA 2HSYA 5IMDA 1H75A 5JCWA 2MBTA 4MCUA 4YQUA 1V57A 1MD4A 3G9BA 3MWHA 4TRXA 3APOA 3QAVA 3EVIA 1OE8A 3L0HA 4PQHA 4ID0A 3GH6A 3FR9A 1O8XA 2L5LA 1JFUA 1F2EA 2F51A 3EU4A 4FQUA 6GSWA 3IHGA 3K8NA 1I9DA 4HZ4A 2RM6A 4V1Ag 3LEFA 1VGLA 1S3CA 2I1UA 1ABAA 5DBQA 1B8XA 3GYKA 2JU5A 2MZCA 5A4UA 2JZTA 2VCVA 1ERTA 2VL3A 4G10A 3M8NA 3GV1A 2WFCA 5JWQB 1Z7PA 2X4AA 5B6MA 2NTOA 3LQ7A 4FYUA 4QQ7A 2OADA 3FW2A 1H4OA 3QR6A 3BOAA 1KBNA 1YEPA 2H1GA 3VPTA 1K3OA 2QA1A 3M9KA 3QFAC 4BIKA 4ZIJA 5E4WA 1U88A 4MK3A 2TRXA 3GL3A 4H86A 1GTAA 2VCQA 4OFNA 1X5DA 5J3RA 1GTBA 3I69A 1LU4A 2VM2A 1OC9B 2PMTA 4YH2A 2KP2A 4P3YB 2E7PA 1M3JA 1DSBA 3VWWA 4D73A 1WRYA 2MYGA 2HRAA 2MMZA 1GTUA 1B4PA 1V9WA 2LKUA 1SL1B 3FZAA 4F03A 2ZUPA 2LNSA 3C1SA 3DYRA 2H01A 22GSA 2O8VB 3G7YA 3HJOA 5DQYA 3UBLA 2XBQA 1PL1A 1V98A 2BJXA 4LMWA 2RUEA 4OD7A 4XCSA 2I81A 3KH7A 2A2PA 4MLYA 4N0VA 4EIQA 2B1KA 3HVVA 5ECPB 2R2JA 3F4RA 3FK8A 4WEYA 4K7IA 2K9FA 3LG6A 4HJMA 1GRXA 4GXZA 5B8BA 2DLXA 3TRQA 1SKRB 3DD3A 3LXZA 3HVXA 4V2NA 3A5WA 3QCPA 3TJGA 4BVXA 1YJ6A 5J9CA 5DAKA 2DJ2A 1THXA 1GLPA 1FB0A 1F6MC 3EU3A 1R7HA 3DGQA 4GWRA 5D9WA 1Z7RA 4KGIA 1UN2A 1EP7A 2WZ9A 3QFBC 3CRUA 2EIOA 4G19A 5ECNB 4HZ2A 2K18A 2C3QA 1ZYNA 1ZYQB 3WT2A 3RHBA 2DKIA 1T4YA 2V6OA 5IM9A 5D8IA 5IMZA 3O6TA 4PNGA 2DMLA 3C1RA 2LQQA 4RI6A 1Z6NA 4IBPA 5EVOA 4GTUA 4OO4A 1VF2A 1T8EB 1MDKA 3SBCA 2ON5A 5B8AA 2AB6A 3CSJA 3Q19A 4ZL7A 1XOAA 1QGVA 4YKFA 5J9BA 3QAWA 3GH9A 1USBA 1Z3EA 2FLSA 3J7Yb 1ZL9A 2I4AA 3CTFA 3KMNA 4XRDA 1QQ2A 2H1DA 2YP6A 1FOHA 3TKQA 1TRUA 3IC8A 2H30A 1J9BA 1PQNA 2C0GA 3EINA 4MABA 1M3IA 2DJ3A 2GS3A 2I3YA 5KN0A 2H74A 5AN1A 4DEJA 3EURA 1PX6A 4WR5A 4I8BA 5F07A 5ECQB 2YZUA 3GIXA 1T7PB 3HDCA 5IPGA 1G7OA 4X1UA 2XPEA 1K3LA 1M2BA 2B5EA 3TKSA 1GL8A 1PA3A 1PMTA 3GRXA 4ZB6A 1JZOA 3FYGA 2PU9C 3KCMA 1YY7A 2DJKA 4KW6A 4MJAA 5D96A 5GAPD 1YKCA 3GN3A 1T3BA 4FIWA 2OBIA 1SJZA 3CYNA 4EE0A 1KEBA 3P90A 5A4WA 3N9JA 4O7HA 3KMOA 3D5JA 4HU7A 4YKGA 1Q4JA 4DVCA 2DJ0A 4MJEA 4WF4A 3ZVJD 2YCDA 3ZIJA 1PKZA 5G1LA 5GZZB 4OFMA 2CZ3A 3W8SA 4MF5A 2G0FA 2FWEA 4HEA2 3L9VA 1AUCA 4K8MA 3HXSA 2LRNA 5CYYA 2OKAA 2H1BA 4KUNA 4KE3A 1THOA 2GTUA 3HCZA 2HZEB 3FY7A 4G0LA 3TOTA 3HA9A 1Q98A 2X64A 1QK8A 2K8VA 4EVMA 3GKMA 2A2SA 1UC7A 4ML6A 2H72A 3TUEA 1YF1A 1MDJA 4AJ6A 2WRTA 2DIYA 2N5BA 1G6WA 4KNDA 4Q5RA 1FG4A 3DVXA 4WETA 5KOWA 11GSA 4JR6A 1TDIA 2WB9A 1T00A 5CO3A 5ECIB 1AQWA 5H5SA 4ZBBA 4Z7XA 5AIVA 1TI3A 5IMAA 2OE1A 1XVWA 2XPDA 4AGSA 1ZOFA 2HI7A 1XPVA 1XW9A 1ZYEA 4IVFA 1IYHA 4HUAA 3Q18A 1TRWA 5HR1A 2MMNA 5DVBA 4POBA 1ON4A 3GUSA 3IHQA 1A24A 1XWCA 4IP1A 5ELGA 2V41A 3IK9A 4KDXA 1J0FA 1KNGA 3BJ5A 4XTSA 3V1WA 1GSYA 4K5RA
chains in the Genus database with same CATH topology
5DQSA 4ZB8A 2C0DA 1SKSB 3UVHA 3TRXA 1C72A 10GSA 4TOPA 4Z2RA 4F9ZA 2IL3A 3FMWA 3IAS2 14GSA 2GVPA 2IFQB 1SK0A 1JLVA 1BYEA 2L4QA 2RIIA 2JL4A 4IGJA 2H19A 4ZB9A 2WJUA 2H0HA 3UAPA 2DBCA 3FEUA 3GMFA 5JCGA 1W4VA 1N2AA 1GSUA 1R4WA 2LV3A 2B7KA 2N5AA 5IMCA 1ZYPA 2H73A 3ZMLA 4ZILA 3GX8A 2J9HA 3ME7A 4MZWA 5JCUA 1T1VA 2PWJA 4CHSA 2DMMA 3F6DA 1XXUA 4L5LA 1TI1A 5A5KA 4EF0A 2YWMA 3P8WA 2ON7A 5H5QA 4EO3A 3MYDA 3F0IA 1K0DA 2NBSA 2ZCTA 3KJYA 4KB3A 1EZKA 5J5NA 4I2TA 8GSSA 3HD5A 2IJYA 4Z2TA 2B5XA 1ZZYA 3ZTLA 1U87A 5G5EA 5AGYA 4E8EA 6GSXA 4HQSA 1SK2A 5ELAA 1TU7A 2NPBA 3DIEA 4PQIA 2YOIA 2VOCA 3C7MA 1UVZA 2IMKA 3IV4A 3KH9A 4HU9A 3TKRA 2ALBA 2H6XA 2R0PA 4TN8A 3EWLA 3MIXA 4E8HA 2VD0A 2PUKC 1OC9A 3VLNA 2ES7A 3FR6A 1EGOA 1NHOA 3FZ5A 4JE1A 4NV2A 3LXTA 1PD21 3I43A 4I2UA 5IO0A 4HDEA 2YWOA 3TKSE 1HD2A 3RPNA 3G7IA 1EV9A 2TIRA 3EE2A 3ZZXA 2H76A 2OJLA 2YV7A 1U3IA 4Q5NA 2GSQA 3KP8A 2YZHA 1PKWA 1PRXA 2G2QA 5DJMA 1GP1A 1O73A 2CX3A 2NDOA 4L5OA 2CAQA 1E2YA 4F0CA 5GSSA 2VL2A 2JZSA 1F3AA 5ECMB 3ZVJA 4MMMA 3HJPA 4TR0A 2KHPA 3WGXA 1HYUA 1M9AA 5F0GA 4Q5FA 2WCIA 2F3MA 1GH2A 4RUVA 2JZRA 2A4VA 4PTSA 1QXHA 4YAVA 1TRSA 2OBKA 2LJAA 6GSYA 2FWFA 1SL2B 1K0CA 1GUMA 3TCOA 2GT5A 2DJ1A 3KTBA 1YEXA 1SD8A 4GQCA 4AF2A 2NVLA 3DMLA 2HFDA 5KN2A 4POKA 5BRTA 1E6BA 3L9SA 3U6VA 3AY8A 4I5QA 3FRCA 3US3A 2R6KA 2QA2A 3M1GA 2O87A 4AJ8A 2VO4A 2D2ZA 4YQMA 2L6DA 1YF0A 3I6AA 1NM3A 4OCEA 4X0XA 4XHMA 5IMFA 1JLWA 1TXXA 4AJ7A 4FYBA 2GZPA 1U6TA 4LL4B 3TKPA 1V2AA 2CVKA 1K3YA 3QOUA 1ZGNA 2FUG2 1BJXA 3VI7A 2LUSA 4DSRA 1R5PA 3IK7A 4N10A 3RBTA 4O5QA 4N0ZA 3ZITA 20GSA 2YV9A 4K9ZA 3VK9A 3TDGA 2VCWA 2O89A 5LD0A 1FAAA 4EDZA 2CZ2A 1ACVA 1ZCPA 2HE3A 1XZOA 2GZYA 3HYPA 4TVEA 3KP9A 4EIPA 3UOMA 1RW1A 1B9XC 2GQMA 2CT6A 3GNJA 2Z9SA 4K2DA 1AIUA 2PVQA 1M7TA 1Y25A 3TJFA 2QGVA 3KIJA 4XS1A 4FH8A 2PVOC 2H8LA 2MMAA 2R4VA 5ECSA 4CY8A 3D0ZA 5ABRA 3HKRA 1TU8A 5HR0A 2B1LA 1WIKA 3IAM2 2QKEA 1SENA 1TK8B 4KF9A 2GDRA 1AW9A 1V40A 1NSWA 3BD2A 1O7UA 1WPIA 4K2XA 2H66A 5J4UA 1GSQA 4JRRA 4PX1A 2E2MA 5HQPA 2HRKA 1Z6MA 5HR3A 1ERWA 1XWKA 1TTZA 3F3RA 4N11A 1CQHA 4EKZA 1EOGA 2H6ZA 5EY6A 3GURA 4DSSB 6GSSA 1WOUA 2LEGA 3W8JA 2GQKA 2GSTA 1EGRA 3H79A 5HFGA 2OACA 1F9MA 1EEJA 4OWYA 4PXOA 5JWOB 5EPFA 4PURA 3CMIA 5G1KA 2FHEA 2C3TA 1IYIA 1AXDA 4GCIA 3LORA 1XCCA 3LWAA 2AHEA 3ZFBA 5DCGA 2IN3A 4XS6A 1URMA 1WP0A 2X99A 5ID2B 3IBHA 2HZEA 4MJCA 1TK0B 3F63A 3EC3A 2GGTA 4KSOA 2CVDA 3GTUA 4J2FA 4GLTA 4DSQA 3Q74A 3GKNA 3EYTA 1G7EA 1EOHA 3EMPA 1VF1A 1GTIA 4K0GA 5D9XA 5ECLB 4Q5QA 4QL7A 5HFIA 4A5PA 4LMVA 2FWGA 2A2RA 3PGTA 5ECRB 3VWUA 5G5FA 2FNOA 2IIYA 2QC7A 3LYPA 3DEXA 1MD3A 2GT6A 4IQ1A 4JR4A 1TRVA 1O81A 1VRSD 3GL5A 3NZNA 5G2ZA 18GSA 4XS4A 5FT3A 1SK1A 2GSSA 4ZBAA 3Q6OA 4JZQA 2M46A 1FW1A 1M99A 2FD3A 4V1Ap 1JZWA 3UBKA 4NAXA 4MF6A 1AQVA 2GLRA 6GSTA 3RAZA 4I97A 4EDYA 4WKWA 4TKYA 4HJ2A 3IXRA 5GSTA 4O32A 2O85A 1B48A 3WYWA 5F05A 3H8QA 2KLXA 2WGRA 2IFQA 4IS0A 3PINA 1FHEA 2YPMA 1PN0A 3GTUB 4OO5A 5B6NA 3WGEA 2EC4A 4LL1B 1YKAA 2FA8A 4IW9A 5J41A 3ZMKA 5ENUA 4EL1A 1AC1A 3TJBA 3LW9A 4NMUA 4HI7A 1GUHA 5DDLA 3TOUA 3U5RE 4G2EA 5E59A 2HRNA 2CX4A 1SYRA 4POMA 2A4HA 3MAKA 1B4QA 2B6MA 3DXBA 4F2IA 3IR4A 4TR1B 1A0RP 3L78A 3PR8A 2I9HA 4XS4B 1S3DA 3D21A 3CSHA 2PN8A 3F4SA 3TKSC 4ECCA 2YN1A 3KXOA 4J56E 4HS1A 2BTOT 1Z9HA 4HOJA 3D6IA 3VFIA 6GSVA 3F6FA 2PPTA 3D4TA 1XOBA 4KH7A 1GWCA 2LQOA 1B9YC 2VLUA 2WS2A 4JEDA 4WR4A 3TGZA 5ECHB 4V2MA 2HXKA 1GSDA 2X8HA 1GSSA 1QMVA 3GHAA 3KZQA 3A5IA 5H5RA 4GSTA 1WMJA 2DSAA 4L0UA 4WBJA 2CQ9A 1G0TA 2L4CA 4K0NA 4BVYB 2J23A 2HT9A 1M2DA 1BX9A 5A4VA 1VF4A 4RQXA 7GSSA 3E0UA 4IJIA 2YNXA 3A2VA 3M0FA 1R26A 3C8EA 2HSMA 4WXTA 2XHFA 4F82A 16GSA 4OMVA 5KOXA 4CDOA 4KCEA 1G6YA 2HSHA 3IA1A 4N30A 1GLQA 4MZBA 1YDKA 3CSIA 3L4NA 1A8LA 1EEMA 2IWTA 1OKTA 1ERUA 3LSZA 5DJLA 2M72A 4KDYA 2HLSA 1XBSA 2IMIA 4MF7A 2VAFA 1BG5A 4GF0A 4PUFC 1M0UA 3E3EA 3MSZA 2YWIA 4BPYA 3BCKA 2E2GA 2CVBA 3QMXA 5CREA 1FOVA 3ERWA 3ZRDA 1A2LA 4F0BA 4IQAA 1S3AA 1BAYA 2CAIA 3KGKA 3A3TA 2XBIA 1X9WB 1K0OA 1HNBA 1TJDA 2L6CA 5BMUA 2AV4A 5AISA 5D73A 3ZLPA 4RI7A 1N8JA 1WE0A 1HQOA 1BQ7A 2XC2A 1O6JA 4IELA 4ZL9A 3QDNA 1FO5A 1XWAA 3UIWA 17GSA 3GKKA 2HNLA 4FO5A 1DUGA 1GSFA 5IOXA 2KOKA 5KEJA 5CP1A 5G30A 4MP4A 2R3XA 2LRTA 3UEMA 1QUWA 2FA4A 2DJJA 5CRHA 2REMA 3C73A 2LTKA 1YZXA 3CTGA 1NW2A 1X9SB 1WJKA 1SD9A 1W89A 4KCAA 4IN0A 4K1FA 6GSUA 3GA4A 3MDKA 1FVJA 4LLRA 4ECJA 3D4MA 3QD9A 4ILFA 2FGXA 2RLIA 1M2AA 2L57A 3A2XA 3C71A 3IC4A 2OA7A 2KUCA 1TW9A 4EXJA 4K7NA 4FYCA 4BL7B 5ECKB 3FHKA 3RPPA 3GSSA 3ZL5A 4PQ1A 1OE7A 2DIZA 1Y6EA 1K0MA 1SJIA 2R37A 1DE1A 4USSA 2F8FA 4EUYA 2WULA 5DALB 4YQVA 1TOFA 4G0IA 2VL9A 2AAWA 2EIQA 2AYTA 2H1AA 1X0RA 2VCXA 3OR5A 2X8GA 3PH9A 4ACSA 2LS5A 3O76A 1UA5A 5FWGA 3JCML 3UMAA 4ULXA 2YWNA 4L0WA 2DC5A 1JZDA 1WWJA 2AUVA 2K8SA 4KA0A 4DSSA 2JADA 1XWBA 3TB2A 1NHYA 2VUPA 2YANA 4OCFA 5D9TA 4BA7A 5LCZA 1SU9A 1XIYA 4JU5A 2B3SA 4TW5A 1BEDA 4MH3A 5GAND 3UVTA 1GULA 5HFKA 9GSSA 4V2LA 4ICYA 2PGTA 4CW9A 4K5SA 3BCIA 1V58A 1JZRA 3F8UA 2V6KA 2O7KA 1EP8A 4XRAA 3S9FA 4IKHA 5D93A 4MPFA 5CRGA 1GSEA 2FY6A 2VL2C 1PGTA 1FB6A 3DWVA 2MBSA 5C00A 5EL8A 4G9HA 3DRNA 5HR2A 4MA9A 5ID2A 1X5CA 1YQ1A 4IJ3A 4L8EA 5IO2A 1OYJA 4NHZA 3IOSA 1K0BA 1JHBA 5INYA 2RUFA 3GFKA 2FWHA 3M9JA 3TRPA 4KSMA 2H0GA 2TRCP 4D73B 3DKSA 3QAGA 3LFLA 2R0GA 5F8BA 3KD0A 4I6XA 3IPZA 4ECIA 2VCZA 4QL9A 2LNTA 1TK5B 2HZFA 19GSA 2V1MA 1A8YA 2X49A 3J7Yk 1XFLA 2DKHA 1X5EA 3HVSA 3L9UA 1ILOA 1SL0B 5IPHA 4O5RA 1A2MA 4HQZA 3WGDA 2VLVA 2H0IA 3HY2A 1XW6A 3GKXA 1OKDA 4TXOA 5CNWA 4MNNA 5FHIA 4ZXGA 2JACA 3F4TA 1K0NA 4IP6A 3CXGA 2C80A 1FVKA 2K6VA 2LJKA 3PPUA 1MTCA 2FCHA 2V32A 2ZNMA 3LYKA 4WBRD 4PGTA 5KN3A 1F37A 4BVXB 2MMOA 2B5YA 4O92A 4YAPA 5DAKB 1ML6A 2E0QA 2RM5A 4Z2UA 3HJMA 1A0FA 2N5FA 5CAXA 3LGCA 2P31A 4ISDA 1ZMAA 5IIZA 1I5GA 1PN9A 3M3MA 4JBBA 1PX7A 5IMVA 3UARA 3H93A 1DBYA 2GZZA 2LRCA 1MEKA 2C0EA 3VWVA 1SYXA 2PERA 1DE2A 3R3EA 3I9V2 4MJBA 3ZREA 2P0GA 3APSA 4GQFA 2JSYA 1O8WA 2C8UA 1O85A 2KP1A 4TR1A 1ERVA 3LJRA 2CA8A 3QPMA 2C3NA 4NHWA 5ECOB 3WT1A 2QSIA 3IDVA 4J57E 4K7OA 5F06A 1MDIA 3P7XA 4X43A 3D22A 1LJRA 4TR3A 2H70A 3HZ8A 4TR4A 4TXOB 2L59A 1SJ6A 3IRAA 2JSZA 3E9JB 3SWLA 1VF3A 1KTEA 2X8CA 4GRFA 2H71A 2P5QA 2LSTA 4RQRA 2BMXA 5CRWA 2P5RA 4ZL8A 5LNKe 2OE3A 4IHUA 2GSRA 4ECBA 5L71A 1M9BA 2EIRA 5B7CA 5D9VA 3NIVA 3HZ4A 3WD6A 1AAZA 3RDWA 2C4JA 3GX0A 2R0CA 3IE3A 3ZYWA 4CY6A 3ERFA 1GNEA 4MH2A 5IQYA 4BVYA 1LBKA 2B7JA 4KAEA 3FZ9A 3NOFA 4NWYA 1X9MB 1AQXA 1U3AA 3EPTA 4TXVA 3EMXA 1EWXA 1TP9A 5C04A 3UL3A 4GSSA 1PL2A 3ZIVA 2F9SA 5JWRB 3F3QA 2R5GA 2IMFA 1OAZA 3R2QA 2F8AA 1XWGA 4ML1A 3CRTA 3P2AA 2AJQB 2PBJA 3O3TA 2VCTA 4ZBDA 3ZFLA 3FR3A 2C0FA 4MPGA 1A23A 3A2WA 4MDCA 5DCHA 3VI5A 4WF5A 4O5UA 2VIMA 2V2GA 4POLA 2HYXA 1CQGA 2GQLA 5AIXA 3KM6A 3FZ4A 5KN1A 4EC0A 4NPBA 2C1YA 13GSA 3VPQA 4BWSA 4GSNA 2YJ7A 4G0KA 2YJHA 2IPAA 1TKDB 2H75A 2VM1A 4K6XA 3FKFA 3HHVA 3H1NA 4OFTA 4BWQA 5IOWA 1GUKA 3H4KA 3ISOA 1XVQA 3ED3A 1OC3A 2LJRA 1R5AA 1K0AA 3MNGA 3VWXA 2VD1A 1EV4A 1OC8A 3KTLA 1J08A 3ME8A 4XIHA 1GNWA 3CBUA 1ST9A 3BBYA 3N5OA 1HNAA 2IMDA 5COHA 3G7JA 3F9UA 1QFNA 2L5OA 2OE0A 4PUAA 3APQA 4MZCA 3GSTA 1RQMA 4KX4A 4NV5A 3TJKA 3KEBA 2HRFA 2M80A 3W6GA 2H6YA 5CRDA 4NXIA 3DVWA 1OVNA 4KDUA 1PSQA 4PNFA 3UJ1A 4BL7A 2CV4A 5G31A 1XW5A 4LA1A 1SKWB 2UZ8A 1HNCA 12GSA 2VLTA 1RK4A 3ERGA 1F3BA 1T4ZA 3TJJA 2WDUA 4X4JA 3RHCA 5DALA 3VURA 1Z5YE 2IMEA 1A2JA 2HSYA 5IMDA 1H75A 5JCWA 2MBTA 4MCUA 4YQUA 1V57A 1MD4A 3G9BA 3MWHA 4TRXA 3APOA 3QAVA 3EVIA 1OE8A 3L0HA 4PQHA 4ID0A 3GH6A 3FR9A 1O8XA 2L5LA 1JFUA 1F2EA 2F51A 3EU4A 4FQUA 6GSWA 3IHGA 3K8NA 1I9DA 4HZ4A 2RM6A 4V1Ag 3LEFA 1VGLA 1S3CA 2I1UA 1ABAA 5DBQA 1B8XA 3GYKA 2JU5A 2MZCA 5A4UA 2JZTA 2VCVA 1ERTA 2VL3A 4G10A 3M8NA 3GV1A 2WFCA 5JWQB 1Z7PA 2X4AA 5B6MA 2NTOA 3LQ7A 4FYUA 4QQ7A 2OADA 3FW2A 1H4OA 3QR6A 3BOAA 1KBNA 1YEPA 2H1GA 3VPTA 1K3OA 2QA1A 3M9KA 3QFAC 4ZIJA 5E4WA 1U88A 4MK3A 2TRXA 3GL3A 4H86A 1GTAA 2VCQA 4OFNA 1X5DA 5J3RA 1GTBA 3I69A 1LU4A 2VM2A 1OC9B 2PMTA 4YH2A 2KP2A 4P3YB 2E7PA 1DSBA 3VWWA 4D73A 1WRYA 2MYGA 2HRAA 2MMZA 1GTUA 1B4PA 1V9WA 2LKUA 1SL1B 3FZAA 4F03A 2ZUPA 2LNSA 3C1SA 3DYRA 2H01A 22GSA 2O8VB 3G7YA 3HJOA 5DQYA 3UBLA 2XBQA 1PL1A 1V98A 2BJXA 4LMWA 2RUEA 4OD7A 4XCSA 2I81A 3KH7A 2A2PA 4MLYA 4N0VA 4EIQA 2B1KA 3HVVA 5ECPB 2R2JA 3F4RA 3FK8A 4WEYA 4K7IA 2K9FA 3LG6A 4HJMA 1GRXA 4GXZA 5B8BA 2DLXA 3TRQA 1SKRB 3DD3A 3LXZA 3HVXA 4V2NA 3A5WA 3QCPA 3TJGA 4BVXA 1YJ6A 5J9CA 5DAKA 2DJ2A 1THXA 1GLPA 1FB0A 1F6MC 3EU3A 1R7HA 3DGQA 4GWRA 5D9WA 1Z7RA 4KGIA 1UN2A 1EP7A 2WZ9A 3QFBC 3CRUA 2EIOA 4G19A 5ECNB 4HZ2A 2K18A 2C3QA 1ZYNA 1ZYQB 3WT2A 3RHBA 2DKIA 1T4YA 2V6OA 5IM9A 5D8IA 5IMZA 3O6TA 4PNGA 2DMLA 3C1RA 2LQQA 4RI6A 1Z6NA 4IBPA 5EVOA 4GTUA 4OO4A 1VF2A 1T8EB 1MDKA 3SBCA 2ON5A 5B8AA 2AB6A 3CSJA 3Q19A 4ZL7A 1XOAA 1QGVA 4YKFA 5J9BA 3QAWA 3GH9A 1USBA 1Z3EA 2FLSA 3J7Yb 1ZL9A 2I4AA 3CTFA 3KMNA 4XRDA 1QQ2A 2H1DA 2YP6A 1FOHA 3TKQA 1TRUA 3IC8A 2H30A 1J9BA 1PQNA 2C0GA 3EINA 4MABA 2DJ3A 2GS3A 2I3YA 5KN0A 2H74A 5AN1A 4DEJA 3EURA 1PX6A 4WR5A 4I8BA 5F07A 5ECQB 2YZUA 3GIXA 1T7PB 3HDCA 5IPGA 1G7OA 4X1UA 2XPEA 1K3LA 1M2BA 2B5EA 3TKSA 1GL8A 1PA3A 1PMTA 3GRXA 4ZB6A 1JZOA 3FYGA 2PU9C 3KCMA 1YY7A 2DJKA 4KW6A 4MJAA 5D96A 5GAPD 1YKCA 3GN3A 1T3BA 4FIWA 2OBIA 1SJZA 3CYNA 4EE0A 1KEBA 3P90A 5A4WA 3N9JA 4O7HA 3KMOA 3D5JA 4HU7A 4YKGA 1Q4JA 4DVCA 2DJ0A 4MJEA 4WF4A 3ZVJD 2YCDA 3ZIJA 1PKZA 5G1LA 5GZZB 4OFMA 2CZ3A 3W8SA 4MF5A 2G0FA 2FWEA 4HEA2 3L9VA 1AUCA 4K8MA 3HXSA 2LRNA 5CYYA 2OKAA 2H1BA 4KUNA 4KE3A 1THOA 2GTUA 3HCZA 2HZEB 3FY7A 4G0LA 3TOTA 3HA9A 1Q98A 2X64A 1QK8A 2K8VA 4EVMA 3GKMA 2A2SA 1UC7A 4ML6A 2H72A 3TUEA 1YF1A 1MDJA 4AJ6A 2WRTA 2DIYA 2N5BA 1G6WA 4KNDA 4Q5RA 1FG4A 3DVXA 4WETA 5KOWA 11GSA 4JR6A 1TDIA 2WB9A 1T00A 5CO3A 5ECIB 1AQWA 5H5SA 4ZBBA 4Z7XA 5AIVA 1TI3A 5IMAA 2OE1A 1XVWA 2XPDA 4AGSA 1ZOFA 2HI7A 1XPVA 1XW9A 1ZYEA 4IVFA 1IYHA 4HUAA 3Q18A 1TRWA 5HR1A 2MMNA 5DVBA 4POBA 1ON4A 3GUSA 3IHQA 1A24A 1XWCA 4IP1A 5ELGA 2V41A 3IK9A 4KDXA 1J0FA 1KNGA 3BJ5A 4XTSA 3V1WA 1GSYA 4K5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DQS A;  4ZB8 A;  2C0D A;  1SKS B;  3UVH A;  3TRX A;  1C72 A;  10GS A;  4TOP A;  4F9Z A;  2IL3 A;  3IAS 2;  14GS A;  2GVP A;  2IFQ B;  1SK0 A;  1JLV A;  1BYE A;  2L4Q A;  2RII A;  2JL4 A;  4IGJ A;  2H19 A;  4ZB9 A;  2WJU A;  2H0H A;  3UAP A;  2DBC A;  3FEU A;  3GMF A;  5JCG A;  1W4V A;  1N2A A;  1GSU A;  1R4W A;  2LV3 A;  2B7K A;  2N5A A;  5IMC A;  3ZML A;  2H73 A;  4ZIL A;  3GX8 A;  2J9H A;  3ME7 A;  4MZW A;  5JCU A;  1T1V A;  2PWJ A;  4CHS A;  2DMM A;  3F6D A;  1XXU A;  4L5L A;  1TI1 A;  5A5K A;  4EF0 A;  2YWM A;  3P8W A;  2ON7 A;  5H5Q A;  4EO3 A;  3F0I A;  1K0D A;  2NBS A;  2ZCT A;  3KJY A;  4KB3 A;  1EZK A;  5J5N A;  4I2T A;  8GSS A;  3HD5 A;  2IJY A;  2B5X A;  1ZZY A;  3ZTL A;  1U87 A;  5G5E A;  5AGY A;  4E8E A;  6GSX A;  4HQS A;  1SK2 A;  5ELA A;  1TU7 A;  2NPB A;  3DIE A;  4PQI A;  2YOI A;  2VOC A;  3C7M A;  1UVZ A;  2IMK A;  3IV4 A;  3KH9 A;  4HU9 A;  3TKR A;  2ALB A;  2H6X A;  4TN8 A;  4E8H A;  3EWL A;  2VD0 A;  2PUK C;  1OC9 A;  3VLN A;  2ES7 A;  3FR6 A;  1EGO A;  1NHO A;  3FZ5 A;  4JE1 A;  4NV2 A;  3LXT A;  1PD2 1;  3I43 A;  4I2U A;  5IO0 A;  4HDE A;  2YWO A;  3TKS E;  1HD2 A;  3RPN A;  3G7I A;  1EV9 A;  2TIR A;  3EE2 A;  3ZZX A;  2H76 A;  2OJL A;  2YV7 A;  1U3I A;  4Q5N A;  2GSQ A;  3KP8 A;  2YZH A;  1PKW A;  1PRX A;  2G2Q A;  5DJM A;  1GP1 A;  1O73 A;  2CX3 A;  2NDO A;  4L5O A;  2CAQ A;  1E2Y A;  4F0C A;  5GSS A;  2VL2 A;  2JZS A;  1F3A A;  5ECM B;  3ZVJ A;  4MMM A;  3HJP A;  4TR0 A;  2KHP A;  3WGX A;  1HYU A;  1M9A A;  5F0G A;  4Q5F A;  2WCI A;  2F3M A;  1GH2 A;  4RUV A;  2JZR A;  2A4V A;  1QXH A;  4YAV A;  1TRS A;  2OBK A;  2LJA A;  6GSY A;  2FWF A;  1SL2 B;  1K0C A;  1GUM A;  3TCO A;  2GT5 A;  2DJ1 A;  3KTB A;  1YEX A;  1SD8 A;  4GQC A;  4AF2 A;  2NVL A;  3DML A;  2HFD A;  5KN2 A;  4POK A;  1E6B A;  3L9S A;  3U6V A;  3AY8 A;  4I5Q A;  3FRC A;  3US3 A;  2R6K A;  3M1G A;  2O87 A;  4AJ8 A;  2VO4 A;  2D2Z A;  4YQM A;  2L6D A;  1YF0 A;  3I6A A;  1NM3 A;  4OCE A;  4X0X A;  4XHM A;  5IMF A;  1JLW A;  1TXX A;  4AJ7 A;  4FYB A;  2GZP A;  1U6T A;  4LL4 B;  3TKP A;  1V2A A;  2CVK A;  1K3Y A;  3QOU A;  1ZGN A;  2FUG 2;  1BJX A;  3VI7 A;  2LUS A;  4DSR A;  1R5P A;  3IK7 A;  4N10 A;  3RBT A;  4N0Z A;  3ZIT A;  20GS A;  2YV9 A;  4K9Z A;  3VK9 A;  3TDG A;  2VCW A;  2O89 A;  5LD0 A;  1FAA A;  4EDZ A;  2CZ2 A;  1ACV A;  1ZCP A;  2HE3 A;  1XZO A;  2GZY A;  3HYP A;  4TVE A;  3KP9 A;  3UOM A;  1RW1 A;  1B9X C;  2GQM A;  2CT6 A;  3GNJ A;  2Z9S A;  4K2D A;  1AIU A;  2PVQ A;  1M7T A;  1Y25 A;  3TJF A;  2QGV A;  3KIJ A;  4XS1 A;  4FH8 A;  2PVO C;  2H8L A;  2MMA A;  2R4V A;  5ECS A;  3D0Z A;  5ABR A;  3HKR A;  1TU8 A;  5HR0 A;  2B1L A;  1WIK A;  3IAM 2;  2QKE A;  1SEN A;  1TK8 B;  2GDR A;  1AW9 A;  1V40 A;  1NSW A;  3BD2 A;  1O7U A;  1WPI A;  2H66 A;  5J4U A;  1GSQ A;  4JRR A;  4PX1 A;  2E2M A;  5HQP A;  1Z6M A;  5HR3 A;  1ERW A;  1XWK A;  1TTZ A;  3F3R A;  4N11 A;  1CQH A;  4EKZ A;  1EOG A;  2H6Z A;  5EY6 A;  3GUR A;  4DSS B;  6GSS A;  1WOU A;  2LEG A;  3W8J A;  2GQK A;  2GST A;  1EGR A;  3H79 A;  5HFG A;  2OAC A;  1F9M A;  1EEJ A;  4OWY A;  4PXO A;  5JWO B;  5EPF A;  4PUR A;  3CMI A;  5G1K A;  2FHE A;  2C3T A;  1IYI A;  1AXD A;  4GCI A;  3LOR A;  1XCC A;  3LWA A;  2AHE A;  3ZFB A;  5DCG A;  2IN3 A;  4XS6 A;  1URM A;  1WP0 A;  2X99 A;  5ID2 B;  3IBH A;  2HZE A;  4MJC A;  1TK0 B;  3F63 A;  3EC3 A;  2GGT A;  4KSO A;  2CVD A;  3GTU A;  4J2F A;  4GLT A;  4DSQ A;  3Q74 A;  3GKN A;  3EYT A;  1G7E A;  1EOH A;  3EMP A;  1VF1 A;  1GTI A;  4K0G A;  5D9X A;  5ECL B;  4Q5Q A;  4QL7 A;  5HFI A;  4LMV A;  2FWG A;  2A2R A;  3PGT A;  5ECR B;  3VWU A;  5G5F A;  2FNO A;  2IIY A;  2QC7 A;  3LYP A;  3DEX A;  1MD3 A;  2GT6 A;  4IQ1 A;  4JR4 A;  1TRV A;  1O81 A;  1VRS D;  3GL5 A;  3NZN A;  5G2Z A;  18GS A;  4XS4 A;  5FT3 A;  1SK1 A;  2GSS A;  4ZBA A;  3Q6O A;  4JZQ A;  2M46 A;  1FW1 A;  1M99 A;  2FD3 A;  4V1A p;  1JZW A;  3UBK A;  4NAX A;  4MF6 A;  1AQV A;  2GLR A;  6GST A;  3RAZ A;  4I97 A;  4EDY A;  4WKW A;  4TKY A;  4HJ2 A;  3IXR A;  5GST A;  4O32 A;  2O85 A;  1B48 A;  3WYW A;  5F05 A;  3H8Q A;  2KLX A;  2WGR A;  2IFQ A;  4IS0 A;  3PIN A;  1FHE A;  2YPM A;  3GTU B;  4OO5 A;  5B6N A;  3WGE A;  2EC4 A;  4LL1 B;  1YKA A;  2FA8 A;  4IW9 A;  5J41 A;  3ZMK A;  5ENU A;  4EL1 A;  1AC1 A;  3TJB A;  4NMU A;  4HI7 A;  1GUH A;  5DDL A;  3TOU A;  3U5R E;  4G2E A;  5E59 A;  2HRN A;  2CX4 A;  1SYR A;  4POM A;  3MAK A;  1B4Q A;  2B6M A;  3DXB A;  4F2I A;  3IR4 A;  4TR1 B;  1A0R P;  3L78 A;  3PR8 A;  2I9H A;  4XS4 B;  1S3D A;  3D21 A;  3CSH A;  2PN8 A;  3F4S A;  3TKS C;  4ECC A;  2YN1 A;  3KXO A;  4J56 E;  4HS1 A;  2BTO T;  1Z9H A;  4HOJ A;  3D6I A;  3VFI A;  6GSV A;  3F6F A;  2PPT A;  3D4T A;  1XOB A;  4KH7 A;  1GWC A;  2LQO A;  1B9Y C;  2VLU A;  2WS2 A;  4JED A;  4WR4 A;  3TGZ A;  5ECH B;  4V2M A;  2HXK A;  1GSD A;  2X8H A;  1GSS A;  1QMV A;  3GHA A;  3KZQ A;  5H5R A;  4GST A;  1WMJ A;  2DSA A;  4L0U A;  4WBJ A;  2CQ9 A;  1G0T A;  2L4C A;  4K0N A;  2J23 A;  2HT9 A;  1M2D A;  1BX9 A;  5A4V A;  1VF4 A;  4RQX A;  7GSS A;  3E0U A;  4IJI A;  2YNX A;  3A2V A;  3M0F A;  1R26 A;  3C8E A;  4WXT A;  2XHF A;  4F82 A;  16GS A;  4OMV A;  4CDO A;  4KCE A;  1G6Y A;  2HSH A;  3IA1 A;  4N30 A;  1GLQ A;  4MZB A;  1YDK A;  3CSI A;  3L4N A;  1A8L A;  1EEM A;  2IWT A;  1OKT A;  1ERU A;  3LSZ A;  5DJL A;  2M72 A;  4KDY A;  2HLS A;  1XBS A;  2IMI A;  4MF7 A;  2VAF A;  1BG5 A;  4GF0 A;  4PUF C;  1M0U A;  3E3E A;  3MSZ A;  2YWI A;  4BPY A;  3BCK A;  2E2G A;  2CVB A;  3QMX A;  5CRE A;  1FOV A;  3ERW A;  3ZRD A;  1A2L A;  4F0B A;  4IQA A;  1S3A A;  1BAY A;  2CAI A;  3KGK A;  3A3T A;  2XBI A;  1X9W B;  1K0O A;  1HNB A;  1TJD A;  2L6C A;  2AV4 A;  5AIS A;  5D73 A;  3ZLP A;  4RI7 A;  1N8J A;  1WE0 A;  1HQO A;  1BQ7 A;  2XC2 A;  1O6J A;  4IEL A;  4ZL9 A;  3QDN A;  1FO5 A;  1XWA A;  3UIW A;  17GS A;  3GKK A;  2HNL A;  4FO5 A;  1DUG A;  1GSF A;  5IOX A;  2KOK A;  5KEJ A;  5CP1 A;  5G30 A;  4MP4 A;  2R3X A;  2LRT A;  3UEM A;  1QUW A;  2FA4 A;  2DJJ A;  5CRH A;  2REM A;  3C73 A;  2LTK A;  1YZX A;  3CTG A;  1NW2 A;  1X9S B;  1WJK A;  1SD9 A;  1W89 A;  4KCA A;  4IN0 A;  4K1F A;  6GSU A;  3GA4 A;  3MDK A;  1FVJ A;  4LLR A;  4ECJ A;  3D4M A;  3QD9 A;  4ILF A;  2FGX A;  2RLI A;  1M2A A;  2L57 A;  3A2X A;  3C71 A;  3IC4 A;  2OA7 A;  2KUC A;  1TW9 A;  4EXJ A;  4K7N A;  4FYC A;  5ECK B;  3FHK A;  3RPP A;  3GSS A;  3ZL5 A;  4PQ1 A;  1OE7 A;  2DIZ A;  1Y6E A;  1K0M A;  1SJI A;  2R37 A;  1DE1 A;  2F8F A;  4EUY A;  2WUL A;  5DAL B;  4YQV A;  1TOF A;  2VL9 A;  2AAW A;  2EIQ A;  2AYT A;  2H1A A;  1X0R A;  2VCX A;  3OR5 A;  2X8G A;  3PH9 A;  4ACS A;  2LS5 A;  3O76 A;  1UA5 A;  5FWG A;  3JCM L;  3UMA A;  4ULX A;  2YWN A;  4L0W A;  2DC5 A;  1JZD A;  1WWJ A;  2AUV A;  2K8S A;  4KA0 A;  4DSS A;  2JAD A;  1XWB A;  3TB2 A;  1NHY A;  2VUP A;  2YAN A;  4OCF A;  5D9T A;  4BA7 A;  5LCZ A;  1SU9 A;  1XIY A;  4JU5 A;  2B3S A;  4TW5 A;  1BED A;  4MH3 A;  5GAN D;  3UVT A;  1GUL A;  5HFK A;  9GSS A;  4V2L A;  2PGT A;  4CW9 A;  3BCI A;  1V58 A;  1JZR A;  3F8U A;  2V6K A;  2O7K A;  1EP8 A;  4XRA A;  3S9F A;  4IKH A;  5D93 A;  4MPF A;  5CRG A;  1GSE A;  2FY6 A;  2VL2 C;  1PGT A;  1FB6 A;  3DWV A;  2MBS A;  5C00 A;  5EL8 A;  4G9H A;  3DRN A;  5HR2 A;  4MA9 A;  5ID2 A;  1X5C A;  1YQ1 A;  4IJ3 A;  4L8E A;  5IO2 A;  1OYJ A;  4NHZ A;  3IOS A;  1K0B A;  1JHB A;  5INY A;  2RUF A;  3GFK A;  2FWH A;  3M9J A;  3TRP A;  4KSM A;  2H0G A;  2TRC P;  4D73 B;  3DKS A;  3QAG A;  3LFL A;  5F8B A;  3KD0 A;  4I6X A;  3IPZ A;  4ECI A;  2VCZ A;  4QL9 A;  2LNT A;  1TK5 B;  2HZF A;  19GS A;  2V1M A;  1A8Y A;  3J7Y k;  1XFL A;  1X5E A;  3HVS A;  3L9U A;  1ILO A;  1SL0 B;  5IPH A;  4O5R A;  1A2M A;  4HQZ A;  3WGD A;  2VLV A;  2H0I A;  3HY2 A;  1XW6 A;  3GKX A;  1OKD A;  4TXO A;  5CNW A;  5FHI A;  4ZXG A;  2JAC A;  3F4T A;  1K0N A;  4IP6 A;  3CXG A;  2C80 A;  1FVK A;  2K6V A;  2LJK A;  1MTC A;  2FCH A;  2V32 A;  2ZNM A;  3LYK A;  4WBR D;  4PGT A;  5KN3 A;  1F37 A;  2MMO A;  2B5Y A;  4O92 A;  4YAP A;  5DAK B;  1ML6 A;  2E0Q A;  2RM5 A;  3HJM A;  1A0F A;  2N5F A;  5CAX A;  3LGC A;  2P31 A;  4ISD A;  1ZMA A;  5IIZ A;  1I5G A;  1PN9 A;  3M3M A;  4JBB A;  1PX7 A;  5IMV A;  3UAR A;  3H93 A;  1DBY A;  2GZZ A;  2LRC A;  1MEK A;  2C0E A;  3VWV A;  1SYX A;  2PER A;  1DE2 A;  3I9V 2;  4MJB A;  3ZRE A;  2P0G A;  3APS A;  4GQF A;  2JSY A;  1O8W A;  2C8U A;  1O85 A;  2KP1 A;  4TR1 A;  1ERV A;  3LJR A;  2CA8 A;  3QPM A;  2C3N A;  4NHW A;  5ECO B;  3WT1 A;  2QSI A;  3IDV A;  4J57 E;  4K7O A;  5F06 A;  1MDI A;  3P7X A;  4X43 A;  3D22 A;  1LJR A;  4TR3 A;  2H70 A;  3HZ8 A;  4TR4 A;  4TXO B;  2L59 A;  1SJ6 A;  3IRA A;  2JSZ A;  3E9J B;  3SWL A;  1VF3 A;  1KTE A;  2X8C A;  4GRF A;  2H71 A;  2P5Q A;  2LST A;  4RQR A;  2BMX A;  5CRW A;  2P5R A;  4ZL8 A;  5LNK e;  2OE3 A;  4IHU A;  2GSR A;  4ECB A;  5L71 A;  1M9B A;  2EIR A;  5B7C A;  5D9V A;  3NIV A;  3HZ4 A;  3WD6 A;  1AAZ A;  3RDW A;  2C4J A;  3GX0 A;  3ZYW A;  3IE3 A;  3ERF A;  1GNE A;  4MH2 A;  5IQY A;  4BVY A;  1LBK A;  2B7J A;  4KAE A;  3FZ9 A;  3NOF A;  4NWY A;  1X9M B;  1AQX A;  1U3A A;  4TXV A;  3EMX A;  1EWX A;  1TP9 A;  5C04 A;  3UL3 A;  4GSS A;  1PL2 A;  3ZIV A;  2F9S A;  5JWR B;  3F3Q A;  2R5G A;  2IMF A;  1OAZ A;  3R2Q A;  2F8A A;  1XWG A;  4ML1 A;  3CRT A;  3P2A A;  2AJQ B;  2PBJ A;  3O3T A;  2VCT A;  4ZBD A;  3ZFL A;  3FR3 A;  2C0F A;  4MPG A;  1A23 A;  3A2W A;  4MDC A;  5DCH A;  3VI5 A;  4WF5 A;  2VIM A;  2V2G A;  4POL A;  2HYX A;  1CQG A;  2GQL A;  5AIX A;  3KM6 A;  3FZ4 A;  5KN1 A;  4EC0 A;  4NPB A;  2C1Y A;  13GS A;  3VPQ A;  4BWS A;  4GSN A;  2YJ7 A;  2YJH A;  2IPA A;  1TKD B;  2H75 A;  2VM1 A;  4K6X A;  3FKF A;  3HHV A;  3H1N A;  4OFT A;  4BWQ A;  5IOW A;  1GUK A;  3H4K A;  3ISO A;  1XVQ A;  3ED3 A;  1OC3 A;  2LJR A;  1R5A A;  1K0A A;  3MNG A;  3VWX A;  2VD1 A;  1EV4 A;  1OC8 A;  3KTL A;  1J08 A;  3ME8 A;  4XIH A;  1GNW A;  3CBU A;  1ST9 A;  3BBY A;  3N5O A;  1HNA A;  2IMD A;  5COH A;  3G7J A;  3F9U A;  1QFN A;  2L5O A;  2OE0 A;  4PUA A;  3APQ A;  4MZC A;  3GST A;  1RQM A;  4KX4 A;  4NV5 A;  3TJK A;  3KEB A;  2HRF A;  2M80 A;  3W6G A;  2H6Y A;  5CRD A;  4NXI A;  3DVW A;  1OVN A;  4KDU A;  1PSQ A;  4PNF A;  3UJ1 A;  4BL7 A;  2CV4 A;  5G31 A;  1XW5 A;  4LA1 A;  1SKW B;  1HNC A;  12GS A;  2VLT A;  1RK4 A;  3ERG A;  1F3B A;  1T4Z A;  3TJJ A;  2WDU A;  3RHC A;  5DAL A;  3VUR A;  1Z5Y E;  2IME A;  1A2J A;  2HSY A;  5IMD A;  1H75 A;  5JCW A;  2MBT A;  4MCU A;  4YQU A;  1V57 A;  1MD4 A;  3G9B A;  3MWH A;  4TRX A;  3APO A;  3QAV A;  3EVI A;  1OE8 A;  3L0H A;  4PQH A;  4ID0 A;  3GH6 A;  3FR9 A;  1O8X A;  2L5L A;  1JFU A;  1F2E A;  2F51 A;  3EU4 A;  6GSW A;  3K8N A;  1I9D A;  4HZ4 A;  2RM6 A;  4V1A g;  3LEF A;  1VGL A;  1S3C A;  2I1U A;  1ABA A;  5DBQ A;  1B8X A;  3GYK A;  2JU5 A;  2MZC A;  5A4U A;  2JZT A;  2VCV A;  1ERT A;  2VL3 A;  4G10 A;  3M8N A;  3GV1 A;  2WFC A;  5JWQ B;  1Z7P A;  5B6M A;  2NTO A;  3LQ7 A;  4FYU A;  4QQ7 A;  2OAD A;  3FW2 A;  1H4O A;  3QR6 A;  3BOA A;  1KBN A;  1YEP A;  2H1G A;  3VPT A;  1K3O A;  3M9K A;  3QFA C;  4ZIJ A;  5E4W A;  1U88 A;  4MK3 A;  2TRX A;  3GL3 A;  4H86 A;  1GTA A;  2VCQ A;  4OFN A;  1X5D A;  5J3R A;  1GTB A;  3I69 A;  1LU4 A;  2VM2 A;  1OC9 B;  2PMT A;  4YH2 A;  2KP2 A;  4P3Y B;  2E7P A;  1DSB A;  3VWW A;  4D73 A;  1WRY A;  2MYG A;  2MMZ A;  1GTU A;  1B4P A;  1V9W A;  2LKU A;  1SL1 B;  3FZA A;  4F03 A;  2ZUP A;  2LNS A;  3C1S A;  3DYR A;  2H01 A;  22GS A;  2O8V B;  3G7Y A;  3HJO A;  5DQY A;  3UBL A;  2XBQ A;  1PL1 A;  1V98 A;  2BJX A;  4LMW A;  2RUE A;  4OD7 A;  4XCS A;  2I81 A;  3KH7 A;  4MLY A;  4N0V A;  2B1K A;  3HVV A;  5ECP B;  2R2J A;  3F4R A;  3FK8 A;  4WEY A;  4K7I A;  2K9F A;  3LG6 A;  4HJM A;  1GRX A;  4GXZ A;  5B8B A;  2DLX A;  3TRQ A;  1SKR B;  3DD3 A;  3LXZ A;  3HVX A;  4V2N A;  3A5W A;  3QCP A;  3TJG A;  4BVX A;  1YJ6 A;  5J9C A;  5DAK A;  2DJ2 A;  1THX A;  1GLP A;  1FB0 A;  1F6M C;  3EU3 A;  1R7H A;  3DGQ A;  4GWR A;  5D9W A;  1Z7R A;  4KGI A;  1UN2 A;  1EP7 A;  2WZ9 A;  3QFB C;  3CRU A;  2EIO A;  4G19 A;  5ECN B;  4HZ2 A;  2K18 A;  2C3Q A;  1ZYQ B;  3WT2 A;  3RHB A;  5IM9 A;  1T4Y A;  2V6O A;  5D8I A;  5IMZ A;  3O6T A;  4PNG A;  2DML A;  3C1R A;  2LQQ A;  4RI6 A;  1Z6N A;  4IBP A;  5EVO A;  4GTU A;  4OO4 A;  1VF2 A;  1T8E B;  1MDK A;  3SBC A;  2ON5 A;  5B8A A;  2AB6 A;  3CSJ A;  3Q19 A;  4ZL7 A;  1XOA A;  1QGV A;  5J9B A;  3QAW A;  3GH9 A;  1USB A;  1Z3E A;  2FLS A;  3J7Y b;  1ZL9 A;  2I4A A;  3CTF A;  3KMN A;  4XRD A;  1QQ2 A;  2H1D A;  2YP6 A;  3TKQ A;  1TRU A;  2H30 A;  1J9B A;  1PQN A;  2C0G A;  3EIN A;  4MAB A;  2DJ3 A;  2GS3 A;  2I3Y A;  5KN0 A;  2H74 A;  5AN1 A;  4DEJ A;  3EUR A;  1PX6 A;  4WR5 A;  4I8B A;  5F07 A;  5ECQ B;  2YZU A;  3GIX A;  1T7P B;  3HDC A;  5IPG A;  1G7O A;  4X1U A;  2XPE A;  1K3L A;  1M2B A;  2B5E A;  3TKS A;  1GL8 A;  1PA3 A;  1PMT A;  3GRX A;  4ZB6 A;  1JZO A;  3FYG A;  2PU9 C;  3KCM A;  1YY7 A;  2DJK A;  4KW6 A;  4MJA A;  5D96 A;  5GAP D;  1YKC A;  3GN3 A;  1T3B A;  4FIW A;  2OBI A;  1SJZ A;  3CYN A;  4EE0 A;  1KEB A;  3P90 A;  5A4W A;  3N9J A;  4O7H A;  3KMO A;  3D5J A;  4HU7 A;  1Q4J A;  4DVC A;  2DJ0 A;  4MJE A;  4WF4 A;  3ZVJ D;  2YCD A;  3ZIJ A;  1PKZ A;  5G1L A;  5GZZ B;  4OFM A;  2CZ3 A;  3W8S A;  4MF5 A;  2G0F A;  2FWE A;  4HEA 2;  3L9V A;  1AUC A;  4K8M A;  3HXS A;  2LRN A;  5CYY A;  2OKA A;  2H1B A;  4KUN A;  4KE3 A;  1THO A;  2GTU A;  3HCZ A;  2HZE B;  3FY7 A;  3TOT A;  3HA9 A;  1Q98 A;  2X64 A;  1QK8 A;  2K8V A;  4EVM A;  3GKM A;  2A2S A;  1UC7 A;  4ML6 A;  2H72 A;  3TUE A;  1YF1 A;  1MDJ A;  4AJ6 A;  2WRT A;  2DIY A;  2N5B A;  1G6W A;  4KND A;  4Q5R A;  1FG4 A;  3DVX A;  4WET A;  11GS A;  4JR6 A;  1TDI A;  2WB9 A;  1T00 A;  5CO3 A;  5ECI B;  1AQW A;  5H5S A;  4ZBB A;  4Z7X A;  5AIV A;  1TI3 A;  5IMA A;  2OE1 A;  1XVW A;  2XPD A;  4AGS A;  1ZOF A;  2HI7 A;  1XPV A;  1XW9 A;  1ZYE A;  4IVF A;  1IYH A;  4HUA A;  3Q18 A;  1TRW A;  5HR1 A;  2MMN A;  5DVB A;  4POB A;  1ON4 A;  3GUS A;  3IHQ A;  1A24 A;  1XWC A;  4IP1 A;  5ELG A;  2V41 A;  3IK9 A;  4KDX A;  1J0F A;  1KNG A;  3BJ5 A;  4XTS A;  3V1W A;  1GSY A; 
#chains in the Genus database with same CATH topology
 5DQS A;  4ZB8 A;  2C0D A;  1SKS B;  3UVH A;  3TRX A;  1C72 A;  10GS A;  4TOP A;  4Z2R A;  4F9Z A;  2IL3 A;  3FMW A;  3IAS 2;  14GS A;  2GVP A;  2IFQ B;  1SK0 A;  1JLV A;  1BYE A;  2L4Q A;  2RII A;  2JL4 A;  4IGJ A;  2H19 A;  4ZB9 A;  2WJU A;  2H0H A;  3UAP A;  2DBC A;  3FEU A;  3GMF A;  5JCG A;  1W4V A;  1N2A A;  1GSU A;  1R4W A;  2LV3 A;  2B7K A;  2N5A A;  5IMC A;  1ZYP A;  2H73 A;  3ZML A;  4ZIL A;  3GX8 A;  2J9H A;  3ME7 A;  4MZW A;  5JCU A;  1T1V A;  2PWJ A;  4CHS A;  2DMM A;  3F6D A;  1XXU A;  4L5L A;  1TI1 A;  5A5K A;  4EF0 A;  2YWM A;  3P8W A;  2ON7 A;  5H5Q A;  4EO3 A;  3MYD A;  3F0I A;  1K0D A;  2NBS A;  2ZCT A;  3KJY A;  4KB3 A;  1EZK A;  5J5N A;  4I2T A;  8GSS A;  3HD5 A;  2IJY A;  4Z2T A;  2B5X A;  1ZZY A;  3ZTL A;  1U87 A;  5G5E A;  5AGY A;  4E8E A;  6GSX A;  4HQS A;  1SK2 A;  5ELA A;  1TU7 A;  2NPB A;  3DIE A;  4PQI A;  2YOI A;  2VOC A;  3C7M A;  1UVZ A;  2IMK A;  3IV4 A;  3KH9 A;  4HU9 A;  3TKR A;  2ALB A;  2H6X A;  2R0P A;  4TN8 A;  3EWL A;  3MIX A;  4E8H A;  2VD0 A;  2PUK C;  1OC9 A;  3VLN A;  2ES7 A;  3FR6 A;  1EGO A;  1NHO A;  3FZ5 A;  4JE1 A;  4NV2 A;  3LXT A;  1PD2 1;  3I43 A;  4I2U A;  5IO0 A;  4HDE A;  2YWO A;  3TKS E;  1HD2 A;  3RPN A;  3G7I A;  1EV9 A;  2TIR A;  3EE2 A;  3ZZX A;  2H76 A;  2OJL A;  2YV7 A;  1U3I A;  4Q5N A;  2GSQ A;  3KP8 A;  2YZH A;  1PKW A;  1PRX A;  2G2Q A;  5DJM A;  1GP1 A;  1O73 A;  2CX3 A;  2NDO A;  4L5O A;  2CAQ A;  1E2Y A;  4F0C A;  5GSS A;  2VL2 A;  2JZS A;  1F3A A;  5ECM B;  3ZVJ A;  4MMM A;  3HJP A;  4TR0 A;  2KHP A;  3WGX A;  1HYU A;  1M9A A;  5F0G A;  4Q5F A;  2WCI A;  2F3M A;  1GH2 A;  4RUV A;  2JZR A;  2A4V A;  4PTS A;  1QXH A;  4YAV A;  1TRS A;  2OBK A;  2LJA A;  6GSY A;  2FWF A;  1SL2 B;  1K0C A;  1GUM A;  3TCO A;  2GT5 A;  2DJ1 A;  3KTB A;  1YEX A;  1SD8 A;  4GQC A;  4AF2 A;  2NVL A;  3DML A;  2HFD A;  5KN2 A;  4POK A;  5BRT A;  1E6B A;  3L9S A;  3U6V A;  3AY8 A;  4I5Q A;  3FRC A;  3US3 A;  2R6K A;  2QA2 A;  3M1G A;  2O87 A;  4AJ8 A;  2VO4 A;  2D2Z A;  4YQM A;  2L6D A;  1YF0 A;  3I6A A;  1NM3 A;  4OCE A;  4X0X A;  4XHM A;  5IMF A;  1JLW A;  1TXX A;  4AJ7 A;  4FYB A;  2GZP A;  1U6T A;  4LL4 B;  3TKP A;  1V2A A;  2CVK A;  1K3Y A;  3QOU A;  1ZGN A;  2FUG 2;  1BJX A;  3VI7 A;  2LUS A;  4DSR A;  1R5P A;  3IK7 A;  4N10 A;  3RBT A;  4O5Q A;  4N0Z A;  3ZIT A;  20GS A;  2YV9 A;  4K9Z A;  3VK9 A;  3TDG A;  2VCW A;  2O89 A;  5LD0 A;  1FAA A;  4EDZ A;  2CZ2 A;  1ACV A;  1ZCP A;  2HE3 A;  1XZO A;  2GZY A;  3HYP A;  4TVE A;  3KP9 A;  4EIP A;  3UOM A;  1RW1 A;  1B9X C;  2GQM A;  2CT6 A;  3GNJ A;  2Z9S A;  4K2D A;  1AIU A;  2PVQ A;  1M7T A;  1Y25 A;  3TJF A;  2QGV A;  3KIJ A;  4XS1 A;  4FH8 A;  2PVO C;  2H8L A;  2MMA A;  2R4V A;  5ECS A;  4CY8 A;  3D0Z A;  3CQF A;  5ABR A;  3HKR A;  1TU8 A;  5HR0 A;  2B1L A;  1WIK A;  3IAM 2;  2QKE A;  1SEN A;  1TK8 B;  4KF9 A;  2GDR A;  1PFO A;  1AW9 A;  1V40 A;  1NSW A;  3BD2 A;  1O7U A;  1WPI A;  4K2X A;  2H66 A;  5J4U A;  1GSQ A;  4JRR A;  4PX1 A;  2E2M A;  5HQP A;  2HRK A;  1Z6M A;  5HR3 A;  1ERW A;  1XWK A;  1TTZ A;  3F3R A;  4N11 A;  1CQH A;  4EKZ A;  1EOG A;  2H6Z A;  5EY6 A;  3GUR A;  4DSS B;  6GSS A;  1WOU A;  2LEG A;  3W8J A;  2GQK A;  2GST A;  1EGR A;  3H79 A;  5HFG A;  2OAC A;  1F9M A;  1EEJ A;  4OWY A;  4PXO A;  5JWO B;  5EPF A;  4PUR A;  3CMI A;  5G1K A;  2FHE A;  2C3T A;  1IYI A;  1XG8 A;  1AXD A;  4GCI A;  3LOR A;  1XCC A;  3LWA A;  2AHE A;  3ZFB A;  5DCG A;  2IN3 A;  4XS6 A;  1URM A;  1WP0 A;  2X99 A;  5ID2 B;  3IBH A;  2HZE A;  4MJC A;  1TK0 B;  3F63 A;  3EC3 A;  2GGT A;  4KSO A;  2CVD A;  3GTU A;  4J2F A;  4GLT A;  4DSQ A;  3Q74 A;  3GKN A;  3EYT A;  1G7E A;  1EOH A;  3EMP A;  1VF1 A;  1GTI A;  4K0G A;  5D9X A;  5ECL B;  4Q5Q A;  4QL7 A;  5HFI A;  4A5P A;  4LMV A;  2FWG A;  2A2R A;  3PGT A;  5ECR B;  3VWU A;  5G5F A;  2FNO A;  2IIY A;  2QC7 A;  3LYP A;  3DEX A;  1MD3 A;  2GT6 A;  4IQ1 A;  4JR4 A;  1TRV A;  1O81 A;  1VRS D;  3GL5 A;  3NZN A;  5G2Z A;  18GS A;  4XS4 A;  5FT3 A;  1SK1 A;  2GSS A;  4ZBA A;  3Q6O A;  4JZQ A;  2M46 A;  1FW1 A;  1M99 A;  2FD3 A;  4V1A p;  1JZW A;  3UBK A;  4NAX A;  4MF6 A;  1AQV A;  2GLR A;  6GST A;  3RAZ A;  4I97 A;  4EDY A;  4WKW A;  4TKY A;  4HJ2 A;  3IXR A;  5GST A;  4O32 A;  2O85 A;  1B48 A;  3WYW A;  5F05 A;  3H8Q A;  2KLX A;  2WGR A;  2IFQ A;  4IS0 A;  3PIN A;  1FHE A;  2YPM A;  1PN0 A;  3GTU B;  4OO5 A;  5B6N A;  3WGE A;  2EC4 A;  4LL1 B;  1YKA A;  2FA8 A;  4IW9 A;  5J41 A;  3ZMK A;  5ENU A;  4EL1 A;  1AC1 A;  3TJB A;  3LW9 A;  4NMU A;  4HI7 A;  1GUH A;  4HSC X;  5DDL A;  3TOU A;  3U5R E;  4G2E A;  5E59 A;  2HRN A;  2CX4 A;  1SYR A;  4POM A;  2A4H A;  3MAK A;  1B4Q A;  2B6M A;  3DXB A;  4F2I A;  3IR4 A;  4TR1 B;  1A0R P;  3L78 A;  3PR8 A;  2I9H A;  4XS4 B;  1S3D A;  3D21 A;  3CSH A;  2PN8 A;  3F4S A;  3TKS C;  4ECC A;  2YN1 A;  3KXO A;  4J56 E;  4HS1 A;  2BTO T;  1Z9H A;  4HOJ A;  3D6I A;  3VFI A;  6GSV A;  3F6F A;  2PPT A;  3D4T A;  1XOB A;  4KH7 A;  1GWC A;  2LQO A;  1B9Y C;  2VLU A;  2WS2 A;  4JED A;  4WR4 A;  3TGZ A;  5ECH B;  4V2M A;  2HXK A;  1GSD A;  2X8H A;  1GSS A;  1QMV A;  3GHA A;  3KZQ A;  3A5I A;  5H5R A;  4GST A;  1WMJ A;  2DSA A;  4L0U A;  4WBJ A;  2CQ9 A;  1G0T A;  2L4C A;  4K0N A;  4BVY B;  2J23 A;  2HT9 A;  1M2D A;  1BX9 A;  5A4V A;  1VF4 A;  4RQX A;  7GSS A;  3E0U A;  4IJI A;  2YNX A;  3A2V A;  3M0F A;  1R26 A;  3C8E A;  2HSM A;  4WXT A;  2XHF A;  4F82 A;  16GS A;  4OMV A;  5KOX A;  4CDO A;  4KCE A;  1G6Y A;  2HSH A;  3IA1 A;  4N30 A;  1GLQ A;  4MZB A;  1YDK A;  3CSI A;  3L4N A;  1A8L A;  1EEM A;  2IWT A;  1OKT A;  1ERU A;  3LSZ A;  5DJL A;  2M72 A;  4KDY A;  2HLS A;  1XBS A;  2IMI A;  4MF7 A;  2VAF A;  1BG5 A;  4GF0 A;  4PUF C;  1M0U A;  3E3E A;  3MSZ A;  2YWI A;  4BPY A;  3BCK A;  2E2G A;  2CVB A;  3QMX A;  5CRE A;  1FOV A;  3ERW A;  3ZRD A;  1A2L A;  4F0B A;  4IQA A;  1S3A A;  1BAY A;  2CAI A;  3KGK A;  3A3T A;  2XBI A;  1X9W B;  1K0O A;  1HNB A;  1TJD A;  2L6C A;  5BMU A;  2AV4 A;  5AIS A;  5D73 A;  3ZLP A;  4RI7 A;  1N8J A;  1WE0 A;  1HQO A;  1BQ7 A;  2XC2 A;  1O6J A;  4IEL A;  4ZL9 A;  3QDN A;  1FO5 A;  1XWA A;  3UIW A;  1S3R A;  17GS A;  3GKK A;  2HNL A;  4FO5 A;  1DUG A;  1GSF A;  5IOX A;  2KOK A;  5KEJ A;  5CP1 A;  5G30 A;  4MP4 A;  2R3X A;  2LRT A;  3UEM A;  1QUW A;  2FA4 A;  2DJJ A;  5CRH A;  2REM A;  3C73 A;  2LTK A;  1YZX A;  3CTG A;  1NW2 A;  1X9S B;  1WJK A;  1SD9 A;  1W89 A;  4KCA A;  4IN0 A;  4K1F A;  6GSU A;  3GA4 A;  3MDK A;  1FVJ A;  4LLR A;  4ECJ A;  3D4M A;  3QD9 A;  4ILF A;  2FGX A;  2RLI A;  1M2A A;  2L57 A;  3A2X A;  3C71 A;  3IC4 A;  2OA7 A;  2KUC A;  1TW9 A;  4EXJ A;  4K7N A;  4FYC A;  4BL7 B;  5ECK B;  3FHK A;  3RPP A;  3GSS A;  3ZL5 A;  4PQ1 A;  1OE7 A;  2DIZ A;  1Y6E A;  1K0M A;  1SJI A;  2R37 A;  1DE1 A;  4USS A;  2F8F A;  4EUY A;  2WUL A;  5DAL B;  4YQV A;  1TOF A;  4G0I A;  2VL9 A;  2AAW A;  2EIQ A;  2AYT A;  2H1A A;  1X0R A;  2VCX A;  3OR5 A;  2X8G A;  3PH9 A;  4ACS A;  2LS5 A;  3O76 A;  1UA5 A;  5FWG A;  3JCM L;  3UMA A;  4ULX A;  2YWN A;  4L0W A;  2DC5 A;  1JZD A;  1WWJ A;  2AUV A;  2K8S A;  4KA0 A;  4DSS A;  2JAD A;  1XWB A;  3TB2 A;  1NHY A;  2VUP A;  2YAN A;  4OCF A;  5D9T A;  4BA7 A;  5LCZ A;  1SU9 A;  1XIY A;  4JU5 A;  2B3S A;  4TW5 A;  1BED A;  4MH3 A;  5GAN D;  3UVT A;  1GUL A;  5HFK A;  9GSS A;  4V2L A;  4ICY A;  2PGT A;  4CW9 A;  4K5S A;  3BCI A;  1V58 A;  1JZR A;  3F8U A;  2V6K A;  2O7K A;  1EP8 A;  4XRA A;  3S9F A;  4IKH A;  5D93 A;  4MPF A;  5CRG A;  1GSE A;  2FY6 A;  2VL2 C;  1PGT A;  1FB6 A;  3DWV A;  2MBS A;  5C00 A;  5EL8 A;  4G9H A;  3DRN A;  5HR2 A;  4MA9 A;  5ID2 A;  1X5C A;  1YQ1 A;  4IJ3 A;  4L8E A;  5IO2 A;  1OYJ A;  4NHZ A;  3IOS A;  1K0B A;  1JHB A;  5INY A;  2RUF A;  3GFK A;  2FWH A;  3M9J A;  3TRP A;  4KSM A;  2H0G A;  2TRC P;  4D73 B;  3DKS A;  3QAG A;  3LFL A;  2R0G A;  5F8B A;  3KD0 A;  4I6X A;  3IPZ A;  4ECI A;  2VCZ A;  4QL9 A;  2LNT A;  1TK5 B;  2HZF A;  19GS A;  2V1M A;  1A8Y A;  2X49 A;  3J7Y k;  1XFL A;  2DKH A;  1X5E A;  3HVS A;  3L9U A;  1ILO A;  1SL0 B;  5IPH A;  4O5R A;  1A2M A;  4HQZ A;  3WGD A;  2VLV A;  2H0I A;  3HY2 A;  1XW6 A;  3GKX A;  1OKD A;  4TXO A;  5CNW A;  4MNN A;  5FHI A;  4ZXG A;  2JAC A;  3F4T A;  1K0N A;  4IP6 A;  3CXG A;  2C80 A;  1FVK A;  2K6V A;  2LJK A;  3PPU A;  1MTC A;  2FCH A;  2V32 A;  2ZNM A;  3LYK A;  4WBR D;  4PGT A;  5KN3 A;  1F37 A;  4BVX B;  2MMO A;  2B5Y A;  4O92 A;  4YAP A;  5DAK B;  1ML6 A;  2E0Q A;  2RM5 A;  4Z2U A;  3HJM A;  1A0F A;  2N5F A;  5CAX A;  3LGC A;  2P31 A;  4ISD A;  1ZMA A;  5IIZ A;  1I5G A;  1PN9 A;  3M3M A;  4JBB A;  1PX7 A;  5IMV A;  3UAR A;  3H93 A;  1DBY A;  2GZZ A;  2LRC A;  1MEK A;  2C0E A;  3VWV A;  1SYX A;  2PER A;  1DE2 A;  3R3E A;  3I9V 2;  4MJB A;  3ZRE A;  2P0G A;  3APS A;  4GQF A;  2JSY A;  1O8W A;  2C8U A;  1O85 A;  2KP1 A;  4TR1 A;  1ERV A;  3LJR A;  2CA8 A;  3QPM A;  2C3N A;  4NHW A;  5ECO B;  3WT1 A;  2QSI A;  3IDV A;  4J57 E;  4K7O A;  5F06 A;  1MDI A;  3P7X A;  4X43 A;  3D22 A;  1LJR A;  4TR3 A;  2H70 A;  3HZ8 A;  4TR4 A;  4TXO B;  2L59 A;  1SJ6 A;  3IRA A;  2JSZ A;  3E9J B;  3SWL A;  1VF3 A;  1KTE A;  2X8C A;  4GRF A;  2H71 A;  2P5Q A;  2LST A;  4RQR A;  2BMX A;  5CRW A;  2P5R A;  4ZL8 A;  5LNK e;  2OE3 A;  3HVN A;  4IHU A;  2GSR A;  4ECB A;  5L71 A;  1M9B A;  2EIR A;  5B7C A;  5D9V A;  3NIV A;  3HZ4 A;  3WD6 A;  1AAZ A;  3RDW A;  2C4J A;  3GX0 A;  2R0C A;  3IE3 A;  3ZYW A;  4CY6 A;  3ERF A;  1GNE A;  4MH2 A;  5IQY A;  4BVY A;  1LBK A;  2B7J A;  4KAE A;  3FZ9 A;  3NOF A;  4NWY A;  1X9M B;  1AQX A;  1U3A A;  3EPT A;  4TXV A;  3EMX A;  1EWX A;  1TP9 A;  5C04 A;  3UL3 A;  4GSS A;  1PL2 A;  3ZIV A;  2F9S A;  5JWR B;  3F3Q A;  2R5G A;  2IMF A;  1OAZ A;  3R2Q A;  2F8A A;  1XWG A;  4ML1 A;  3CRT A;  3P2A A;  2AJQ B;  2PBJ A;  3O3T A;  2VCT A;  4ZBD A;  3ZFL A;  3FR3 A;  2C0F A;  4MPG A;  1A23 A;  3A2W A;  4MDC A;  5DCH A;  3VI5 A;  4WF5 A;  4O5U A;  2VIM A;  2V2G A;  4POL A;  2HYX A;  1CQG A;  2GQL A;  5AIX A;  3KM6 A;  3FZ4 A;  5KN1 A;  4EC0 A;  4NPB A;  2C1Y A;  13GS A;  3VPQ A;  4BWS A;  4GSN A;  2YJ7 A;  4G0K A;  2YJH A;  2IPA A;  1TKD B;  2H75 A;  2VM1 A;  4K6X A;  3FKF A;  3HHV A;  3H1N A;  4OFT A;  4BWQ A;  5IOW A;  1GUK A;  3H4K A;  3ISO A;  1XVQ A;  3ED3 A;  1OC3 A;  2LJR A;  1R5A A;  1K0A A;  3MNG A;  3VWX A;  2VD1 A;  1EV4 A;  1OC8 A;  3KTL A;  1J08 A;  3ME8 A;  4XIH A;  1GNW A;  3CBU A;  1ST9 A;  3BBY A;  3N5O A;  1HNA A;  2IMD A;  5COH A;  3G7J A;  3F9U A;  1QFN A;  2L5O A;  2OE0 A;  4PUA A;  3APQ A;  4MZC A;  3GST A;  1RQM A;  4KX4 A;  4NV5 A;  3TJK A;  3KEB A;  2HRF A;  2M80 A;  3W6G A;  2H6Y A;  5CRD A;  4NXI A;  3DVW A;  1OVN A;  4KDU A;  1PSQ A;  4PNF A;  3UJ1 A;  4BL7 A;  2CV4 A;  5G31 A;  1XW5 A;  4LA1 A;  1SKW B;  2UZ8 A;  1HNC A;  12GS A;  2VLT A;  1RK4 A;  3ERG A;  1F3B A;  1T4Z A;  3TJJ A;  2WDU A;  4X4J A;  3RHC A;  5DAL A;  3VUR A;  1Z5Y E;  2IME A;  1A2J A;  2HSY A;  5IMD A;  1H75 A;  5JCW A;  2MBT A;  4MCU A;  4YQU A;  1V57 A;  1MD4 A;  3G9B A;  3MWH A;  4TRX A;  3APO A;  3QAV A;  3EVI A;  1OE8 A;  3L0H A;  4PQH A;  4ID0 A;  3GH6 A;  3FR9 A;  1O8X A;  2L5L A;  1JFU A;  1F2E A;  2F51 A;  3EU4 A;  4FQU A;  6GSW A;  3IHG A;  3K8N A;  1I9D A;  4HZ4 A;  2RM6 A;  4V1A g;  3LEF A;  1VGL A;  1S3C A;  2I1U A;  1ABA A;  5DBQ A;  1B8X A;  3GYK A;  2JU5 A;  2MZC A;  5A4U A;  2JZT A;  2VCV A;  1ERT A;  2VL3 A;  4G10 A;  3M8N A;  3GV1 A;  2WFC A;  5JWQ B;  1Z7P A;  2X4A A;  5B6M A;  2NTO A;  3LQ7 A;  4FYU A;  4QQ7 A;  2OAD A;  3FW2 A;  1H4O A;  3QR6 A;  3BOA A;  1KBN A;  1YEP A;  2H1G A;  3VPT A;  1K3O A;  2QA1 A;  3M9K A;  3QFA C;  4BIK A;  4ZIJ A;  5E4W A;  1U88 A;  4MK3 A;  2TRX A;  3GL3 A;  4H86 A;  1GTA A;  2VCQ A;  4OFN A;  1X5D A;  5J3R A;  1GTB A;  3I69 A;  1LU4 A;  2VM2 A;  1OC9 B;  2PMT A;  4YH2 A;  2KP2 A;  4P3Y B;  2E7P A;  1M3J A;  1DSB A;  3VWW A;  4D73 A;  1WRY A;  2MYG A;  2HRA A;  2MMZ A;  1GTU A;  1B4P A;  1V9W A;  2LKU A;  1SL1 B;  3FZA A;  4F03 A;  2ZUP A;  2LNS A;  3C1S A;  3DYR A;  2H01 A;  22GS A;  2O8V B;  3G7Y A;  3HJO A;  5DQY A;  3UBL A;  2XBQ A;  1PL1 A;  1V98 A;  2BJX A;  4LMW A;  2RUE A;  4OD7 A;  4XCS A;  2I81 A;  3KH7 A;  2A2P A;  4MLY A;  4N0V A;  4EIQ A;  2B1K A;  3HVV A;  5ECP B;  2R2J A;  3F4R A;  3FK8 A;  4WEY A;  4K7I A;  2K9F A;  3LG6 A;  4HJM A;  1GRX A;  4GXZ A;  5B8B A;  2DLX A;  3TRQ A;  1SKR B;  3DD3 A;  3LXZ A;  3HVX A;  4V2N A;  3A5W A;  3QCP A;  3TJG A;  4BVX A;  1YJ6 A;  5J9C A;  5DAK A;  2DJ2 A;  1THX A;  1GLP A;  1FB0 A;  1F6M C;  3EU3 A;  1R7H A;  3DGQ A;  4GWR A;  5D9W A;  1Z7R A;  4KGI A;  1UN2 A;  1EP7 A;  2WZ9 A;  3QFB C;  3CRU A;  2EIO A;  4G19 A;  5ECN B;  4HZ2 A;  2K18 A;  2C3Q A;  1ZYN A;  1ZYQ B;  3WT2 A;  3RHB A;  2DKI A;  1T4Y A;  2V6O A;  5IM9 A;  5D8I A;  5IMZ A;  3O6T A;  4PNG A;  2DML A;  3C1R A;  2LQQ A;  4RI6 A;  1Z6N A;  4IBP A;  5EVO A;  4GTU A;  4OO4 A;  1VF2 A;  1T8E B;  1MDK A;  3SBC A;  2ON5 A;  5B8A A;  2AB6 A;  3CSJ A;  3Q19 A;  4ZL7 A;  1XOA A;  1QGV A;  4YKF A;  5J9B A;  3QAW A;  3GH9 A;  1USB A;  1Z3E A;  2FLS A;  3J7Y b;  1ZL9 A;  2I4A A;  3CTF A;  3KMN A;  4XRD A;  1QQ2 A;  2H1D A;  2YP6 A;  1FOH A;  3TKQ A;  1TRU A;  3IC8 A;  2H30 A;  1J9B A;  1PQN A;  2C0G A;  3EIN A;  4MAB A;  1M3I A;  2DJ3 A;  2GS3 A;  2I3Y A;  5KN0 A;  2H74 A;  5AN1 A;  4DEJ A;  3EUR A;  1PX6 A;  4WR5 A;  4I8B A;  5F07 A;  5ECQ B;  2YZU A;  3GIX A;  1T7P B;  3HDC A;  5IPG A;  1G7O A;  4X1U A;  2XPE A;  1K3L A;  1M2B A;  2B5E A;  3TKS A;  1GL8 A;  1PA3 A;  1PMT A;  3GRX A;  4ZB6 A;  1JZO A;  3FYG A;  2PU9 C;  3KCM A;  1YY7 A;  2DJK A;  4KW6 A;  4MJA A;  5D96 A;  5GAP D;  1YKC A;  3GN3 A;  1T3B A;  4FIW A;  2OBI A;  1SJZ A;  3CYN A;  4EE0 A;  1KEB A;  3P90 A;  5A4W A;  3N9J A;  4O7H A;  3KMO A;  3D5J A;  4HU7 A;  4YKG A;  1Q4J A;  4DVC A;  2DJ0 A;  4MJE A;  4WF4 A;  3ZVJ D;  2YCD A;  3ZIJ A;  1PKZ A;  5G1L A;  5GZZ B;  4OFM A;  2CZ3 A;  3W8S A;  4MF5 A;  2G0F A;  2FWE A;  4HEA 2;  3L9V A;  1AUC A;  4K8M A;  3HXS A;  2LRN A;  5CYY A;  2OKA A;  2H1B A;  4KUN A;  4KE3 A;  1THO A;  2GTU A;  3HCZ A;  2HZE B;  3FY7 A;  4G0L A;  3TOT A;  3HA9 A;  1Q98 A;  2X64 A;  1QK8 A;  2K8V A;  4EVM A;  3GKM A;  2A2S A;  1UC7 A;  4ML6 A;  2H72 A;  3TUE A;  1YF1 A;  1MDJ A;  4AJ6 A;  2WRT A;  2DIY A;  2N5B A;  1G6W A;  4KND A;  4Q5R A;  1FG4 A;  3DVX A;  4WET A;  5KOW A;  11GS A;  4JR6 A;  1TDI A;  2WB9 A;  1T00 A;  5CO3 A;  5ECI B;  1AQW A;  5H5S A;  4ZBB A;  4Z7X A;  5AIV A;  1TI3 A;  5IMA A;  2OE1 A;  1XVW A;  2XPD A;  4AGS A;  1ZOF A;  2HI7 A;  1XPV A;  1XW9 A;  1ZYE A;  4IVF A;  1IYH A;  4HUA A;  3Q18 A;  1TRW A;  5HR1 A;  2MMN A;  5DVB A;  4POB A;  1ON4 A;  3GUS A;  3IHQ A;  1A24 A;  1XWC A;  4IP1 A;  5ELG A;  2V41 A;  3IK9 A;  4KDX A;  1J0F A;  1KNG A;  3BJ5 A;  4XTS A;  3V1W A;  1GSY A;  4K5R A; 
#chains in the Genus database with same CATH homology
 5DQS A;  4ZB8 A;  2C0D A;  1SKS B;  3UVH A;  3TRX A;  1C72 A;  10GS A;  4TOP A;  4Z2R A;  4F9Z A;  2IL3 A;  3FMW A;  3IAS 2;  14GS A;  2GVP A;  2IFQ B;  1SK0 A;  1JLV A;  1BYE A;  2L4Q A;  2RII A;  2JL4 A;  4IGJ A;  2H19 A;  4ZB9 A;  2WJU A;  2H0H A;  3UAP A;  2DBC A;  3FEU A;  3GMF A;  5JCG A;  1W4V A;  1N2A A;  1GSU A;  1R4W A;  2LV3 A;  2B7K A;  2N5A A;  5IMC A;  1ZYP A;  2H73 A;  3ZML A;  4ZIL A;  3GX8 A;  2J9H A;  3ME7 A;  4MZW A;  5JCU A;  1T1V A;  2PWJ A;  4CHS A;  2DMM A;  3F6D A;  1XXU A;  4L5L A;  1TI1 A;  5A5K A;  4EF0 A;  2YWM A;  3P8W A;  2ON7 A;  5H5Q A;  4EO3 A;  3MYD A;  3F0I A;  1K0D A;  2NBS A;  2ZCT A;  3KJY A;  4KB3 A;  1EZK A;  5J5N A;  4I2T A;  8GSS A;  3HD5 A;  2IJY A;  4Z2T A;  2B5X A;  1ZZY A;  3ZTL A;  1U87 A;  5G5E A;  5AGY A;  4E8E A;  6GSX A;  4HQS A;  1SK2 A;  5ELA A;  1TU7 A;  2NPB A;  3DIE A;  4PQI A;  2YOI A;  2VOC A;  3C7M A;  1UVZ A;  2IMK A;  3IV4 A;  3KH9 A;  4HU9 A;  3TKR A;  2ALB A;  2H6X A;  2R0P A;  4TN8 A;  3EWL A;  3MIX A;  4E8H A;  2VD0 A;  2PUK C;  1OC9 A;  3VLN A;  2ES7 A;  3FR6 A;  1EGO A;  1NHO A;  3FZ5 A;  4JE1 A;  4NV2 A;  3LXT A;  1PD2 1;  3I43 A;  4I2U A;  5IO0 A;  4HDE A;  2YWO A;  3TKS E;  1HD2 A;  3RPN A;  3G7I A;  1EV9 A;  2TIR A;  3EE2 A;  3ZZX A;  2H76 A;  2OJL A;  2YV7 A;  1U3I A;  4Q5N A;  2GSQ A;  3KP8 A;  2YZH A;  1PKW A;  1PRX A;  2G2Q A;  5DJM A;  1GP1 A;  1O73 A;  2CX3 A;  2NDO A;  4L5O A;  2CAQ A;  1E2Y A;  4F0C A;  5GSS A;  2VL2 A;  2JZS A;  1F3A A;  5ECM B;  3ZVJ A;  4MMM A;  3HJP A;  4TR0 A;  2KHP A;  3WGX A;  1HYU A;  1M9A A;  5F0G A;  4Q5F A;  2WCI A;  2F3M A;  1GH2 A;  4RUV A;  2JZR A;  2A4V A;  4PTS A;  1QXH A;  4YAV A;  1TRS A;  2OBK A;  2LJA A;  6GSY A;  2FWF A;  1SL2 B;  1K0C A;  1GUM A;  3TCO A;  2GT5 A;  2DJ1 A;  3KTB A;  1YEX A;  1SD8 A;  4GQC A;  4AF2 A;  2NVL A;  3DML A;  2HFD A;  5KN2 A;  4POK A;  5BRT A;  1E6B A;  3L9S A;  3U6V A;  3AY8 A;  4I5Q A;  3FRC A;  3US3 A;  2R6K A;  2QA2 A;  3M1G A;  2O87 A;  4AJ8 A;  2VO4 A;  2D2Z A;  4YQM A;  2L6D A;  1YF0 A;  3I6A A;  1NM3 A;  4OCE A;  4X0X A;  4XHM A;  5IMF A;  1JLW A;  1TXX A;  4AJ7 A;  4FYB A;  2GZP A;  1U6T A;  4LL4 B;  3TKP A;  1V2A A;  2CVK A;  1K3Y A;  3QOU A;  1ZGN A;  2FUG 2;  1BJX A;  3VI7 A;  2LUS A;  4DSR A;  1R5P A;  3IK7 A;  4N10 A;  3RBT A;  4O5Q A;  4N0Z A;  3ZIT A;  20GS A;  2YV9 A;  4K9Z A;  3VK9 A;  3TDG A;  2VCW A;  2O89 A;  5LD0 A;  1FAA A;  4EDZ A;  2CZ2 A;  1ACV A;  1ZCP A;  2HE3 A;  1XZO A;  2GZY A;  3HYP A;  4TVE A;  3KP9 A;  4EIP A;  3UOM A;  1RW1 A;  1B9X C;  2GQM A;  2CT6 A;  3GNJ A;  2Z9S A;  4K2D A;  1AIU A;  2PVQ A;  1M7T A;  1Y25 A;  3TJF A;  2QGV A;  3KIJ A;  4XS1 A;  4FH8 A;  2PVO C;  2H8L A;  2MMA A;  2R4V A;  5ECS A;  4CY8 A;  3D0Z A;  5ABR A;  3HKR A;  1TU8 A;  5HR0 A;  2B1L A;  1WIK A;  3IAM 2;  2QKE A;  1SEN A;  1TK8 B;  4KF9 A;  2GDR A;  1AW9 A;  1V40 A;  1NSW A;  3BD2 A;  1O7U A;  1WPI A;  4K2X A;  2H66 A;  5J4U A;  1GSQ A;  4JRR A;  4PX1 A;  2E2M A;  5HQP A;  2HRK A;  1Z6M A;  5HR3 A;  1ERW A;  1XWK A;  1TTZ A;  3F3R A;  4N11 A;  1CQH A;  4EKZ A;  1EOG A;  2H6Z A;  5EY6 A;  3GUR A;  4DSS B;  6GSS A;  1WOU A;  2LEG A;  3W8J A;  2GQK A;  2GST A;  1EGR A;  3H79 A;  5HFG A;  2OAC A;  1F9M A;  1EEJ A;  4OWY A;  4PXO A;  5JWO B;  5EPF A;  4PUR A;  3CMI A;  5G1K A;  2FHE A;  2C3T A;  1IYI A;  1AXD A;  4GCI A;  3LOR A;  1XCC A;  3LWA A;  2AHE A;  3ZFB A;  5DCG A;  2IN3 A;  4XS6 A;  1URM A;  1WP0 A;  2X99 A;  5ID2 B;  3IBH A;  2HZE A;  4MJC A;  1TK0 B;  3F63 A;  3EC3 A;  2GGT A;  4KSO A;  2CVD A;  3GTU A;  4J2F A;  4GLT A;  4DSQ A;  3Q74 A;  3GKN A;  3EYT A;  1G7E A;  1EOH A;  3EMP A;  1VF1 A;  1GTI A;  4K0G A;  5D9X A;  5ECL B;  4Q5Q A;  4QL7 A;  5HFI A;  4A5P A;  4LMV A;  2FWG A;  2A2R A;  3PGT A;  5ECR B;  3VWU A;  5G5F A;  2FNO A;  2IIY A;  2QC7 A;  3LYP A;  3DEX A;  1MD3 A;  2GT6 A;  4IQ1 A;  4JR4 A;  1TRV A;  1O81 A;  1VRS D;  3GL5 A;  3NZN A;  5G2Z A;  18GS A;  4XS4 A;  5FT3 A;  1SK1 A;  2GSS A;  4ZBA A;  3Q6O A;  4JZQ A;  2M46 A;  1FW1 A;  1M99 A;  2FD3 A;  4V1A p;  1JZW A;  3UBK A;  4NAX A;  4MF6 A;  1AQV A;  2GLR A;  6GST A;  3RAZ A;  4I97 A;  4EDY A;  4WKW A;  4TKY A;  4HJ2 A;  3IXR A;  5GST A;  4O32 A;  2O85 A;  1B48 A;  3WYW A;  5F05 A;  3H8Q A;  2KLX A;  2WGR A;  2IFQ A;  4IS0 A;  3PIN A;  1FHE A;  2YPM A;  1PN0 A;  3GTU B;  4OO5 A;  5B6N A;  3WGE A;  2EC4 A;  4LL1 B;  1YKA A;  2FA8 A;  4IW9 A;  5J41 A;  3ZMK A;  5ENU A;  4EL1 A;  1AC1 A;  3TJB A;  3LW9 A;  4NMU A;  4HI7 A;  1GUH A;  5DDL A;  3TOU A;  3U5R E;  4G2E A;  5E59 A;  2HRN A;  2CX4 A;  1SYR A;  4POM A;  2A4H A;  3MAK A;  1B4Q A;  2B6M A;  3DXB A;  4F2I A;  3IR4 A;  4TR1 B;  1A0R P;  3L78 A;  3PR8 A;  2I9H A;  4XS4 B;  1S3D A;  3D21 A;  3CSH A;  2PN8 A;  3F4S A;  3TKS C;  4ECC A;  2YN1 A;  3KXO A;  4J56 E;  4HS1 A;  2BTO T;  1Z9H A;  4HOJ A;  3D6I A;  3VFI A;  6GSV A;  3F6F A;  2PPT A;  3D4T A;  1XOB A;  4KH7 A;  1GWC A;  2LQO A;  1B9Y C;  2VLU A;  2WS2 A;  4JED A;  4WR4 A;  3TGZ A;  5ECH B;  4V2M A;  2HXK A;  1GSD A;  2X8H A;  1GSS A;  1QMV A;  3GHA A;  3KZQ A;  3A5I A;  5H5R A;  4GST A;  1WMJ A;  2DSA A;  4L0U A;  4WBJ A;  2CQ9 A;  1G0T A;  2L4C A;  4K0N A;  4BVY B;  2J23 A;  2HT9 A;  1M2D A;  1BX9 A;  5A4V A;  1VF4 A;  4RQX A;  7GSS A;  3E0U A;  4IJI A;  2YNX A;  3A2V A;  3M0F A;  1R26 A;  3C8E A;  2HSM A;  4WXT A;  2XHF A;  4F82 A;  16GS A;  4OMV A;  5KOX A;  4CDO A;  4KCE A;  1G6Y A;  2HSH A;  3IA1 A;  4N30 A;  1GLQ A;  4MZB A;  1YDK A;  3CSI A;  3L4N A;  1A8L A;  1EEM A;  2IWT A;  1OKT A;  1ERU A;  3LSZ A;  5DJL A;  2M72 A;  4KDY A;  2HLS A;  1XBS A;  2IMI A;  4MF7 A;  2VAF A;  1BG5 A;  4GF0 A;  4PUF C;  1M0U A;  3E3E A;  3MSZ A;  2YWI A;  4BPY A;  3BCK A;  2E2G A;  2CVB A;  3QMX A;  5CRE A;  1FOV A;  3ERW A;  3ZRD A;  1A2L A;  4F0B A;  4IQA A;  1S3A A;  1BAY A;  2CAI A;  3KGK A;  3A3T A;  2XBI A;  1X9W B;  1K0O A;  1HNB A;  1TJD A;  2L6C A;  5BMU A;  2AV4 A;  5AIS A;  5D73 A;  3ZLP A;  4RI7 A;  1N8J A;  1WE0 A;  1HQO A;  1BQ7 A;  2XC2 A;  1O6J A;  4IEL A;  4ZL9 A;  3QDN A;  1FO5 A;  1XWA A;  3UIW A;  17GS A;  3GKK A;  2HNL A;  4FO5 A;  1DUG A;  1GSF A;  5IOX A;  2KOK A;  5KEJ A;  5CP1 A;  5G30 A;  4MP4 A;  2R3X A;  2LRT A;  3UEM A;  1QUW A;  2FA4 A;  2DJJ A;  5CRH A;  2REM A;  3C73 A;  2LTK A;  1YZX A;  3CTG A;  1NW2 A;  1X9S B;  1WJK A;  1SD9 A;  1W89 A;  4KCA A;  4IN0 A;  4K1F A;  6GSU A;  3GA4 A;  3MDK A;  1FVJ A;  4LLR A;  4ECJ A;  3D4M A;  3QD9 A;  4ILF A;  2FGX A;  2RLI A;  1M2A A;  2L57 A;  3A2X A;  3C71 A;  3IC4 A;  2OA7 A;  2KUC A;  1TW9 A;  4EXJ A;  4K7N A;  4FYC A;  4BL7 B;  5ECK B;  3FHK A;  3RPP A;  3GSS A;  3ZL5 A;  4PQ1 A;  1OE7 A;  2DIZ A;  1Y6E A;  1K0M A;  1SJI A;  2R37 A;  1DE1 A;  4USS A;  2F8F A;  4EUY A;  2WUL A;  5DAL B;  4YQV A;  1TOF A;  4G0I A;  2VL9 A;  2AAW A;  2EIQ A;  2AYT A;  2H1A A;  1X0R A;  2VCX A;  3OR5 A;  2X8G A;  3PH9 A;  4ACS A;  2LS5 A;  3O76 A;  1UA5 A;  5FWG A;  3JCM L;  3UMA A;  4ULX A;  2YWN A;  4L0W A;  2DC5 A;  1JZD A;  1WWJ A;  2AUV A;  2K8S A;  4KA0 A;  4DSS A;  2JAD A;  1XWB A;  3TB2 A;  1NHY A;  2VUP A;  2YAN A;  4OCF A;  5D9T A;  4BA7 A;  5LCZ A;  1SU9 A;  1XIY A;  4JU5 A;  2B3S A;  4TW5 A;  1BED A;  4MH3 A;  5GAN D;  3UVT A;  1GUL A;  5HFK A;  9GSS A;  4V2L A;  4ICY A;  2PGT A;  4CW9 A;  4K5S A;  3BCI A;  1V58 A;  1JZR A;  3F8U A;  2V6K A;  2O7K A;  1EP8 A;  4XRA A;  3S9F A;  4IKH A;  5D93 A;  4MPF A;  5CRG A;  1GSE A;  2FY6 A;  2VL2 C;  1PGT A;  1FB6 A;  3DWV A;  2MBS A;  5C00 A;  5EL8 A;  4G9H A;  3DRN A;  5HR2 A;  4MA9 A;  5ID2 A;  1X5C A;  1YQ1 A;  4IJ3 A;  4L8E A;  5IO2 A;  1OYJ A;  4NHZ A;  3IOS A;  1K0B A;  1JHB A;  5INY A;  2RUF A;  3GFK A;  2FWH A;  3M9J A;  3TRP A;  4KSM A;  2H0G A;  2TRC P;  4D73 B;  3DKS A;  3QAG A;  3LFL A;  2R0G A;  5F8B A;  3KD0 A;  4I6X A;  3IPZ A;  4ECI A;  2VCZ A;  4QL9 A;  2LNT A;  1TK5 B;  2HZF A;  19GS A;  2V1M A;  1A8Y A;  2X49 A;  3J7Y k;  1XFL A;  2DKH A;  1X5E A;  3HVS A;  3L9U A;  1ILO A;  1SL0 B;  5IPH A;  4O5R A;  1A2M A;  4HQZ A;  3WGD A;  2VLV A;  2H0I A;  3HY2 A;  1XW6 A;  3GKX A;  1OKD A;  4TXO A;  5CNW A;  4MNN A;  5FHI A;  4ZXG A;  2JAC A;  3F4T A;  1K0N A;  4IP6 A;  3CXG A;  2C80 A;  1FVK A;  2K6V A;  2LJK A;  3PPU A;  1MTC A;  2FCH A;  2V32 A;  2ZNM A;  3LYK A;  4WBR D;  4PGT A;  5KN3 A;  1F37 A;  4BVX B;  2MMO A;  2B5Y A;  4O92 A;  4YAP A;  5DAK B;  1ML6 A;  2E0Q A;  2RM5 A;  4Z2U A;  3HJM A;  1A0F A;  2N5F A;  5CAX A;  3LGC A;  2P31 A;  4ISD A;  1ZMA A;  5IIZ A;  1I5G A;  1PN9 A;  3M3M A;  4JBB A;  1PX7 A;  5IMV A;  3UAR A;  3H93 A;  1DBY A;  2GZZ A;  2LRC A;  1MEK A;  2C0E A;  3VWV A;  1SYX A;  2PER A;  1DE2 A;  3R3E A;  3I9V 2;  4MJB A;  3ZRE A;  2P0G A;  3APS A;  4GQF A;  2JSY A;  1O8W A;  2C8U A;  1O85 A;  2KP1 A;  4TR1 A;  1ERV A;  3LJR A;  2CA8 A;  3QPM A;  2C3N A;  4NHW A;  5ECO B;  3WT1 A;  2QSI A;  3IDV A;  4J57 E;  4K7O A;  5F06 A;  1MDI A;  3P7X A;  4X43 A;  3D22 A;  1LJR A;  4TR3 A;  2H70 A;  3HZ8 A;  4TR4 A;  4TXO B;  2L59 A;  1SJ6 A;  3IRA A;  2JSZ A;  3E9J B;  3SWL A;  1VF3 A;  1KTE A;  2X8C A;  4GRF A;  2H71 A;  2P5Q A;  2LST A;  4RQR A;  2BMX A;  5CRW A;  2P5R A;  4ZL8 A;  5LNK e;  2OE3 A;  4IHU A;  2GSR A;  4ECB A;  5L71 A;  1M9B A;  2EIR A;  5B7C A;  5D9V A;  3NIV A;  3HZ4 A;  3WD6 A;  1AAZ A;  3RDW A;  2C4J A;  3GX0 A;  2R0C A;  3IE3 A;  3ZYW A;  4CY6 A;  3ERF A;  1GNE A;  4MH2 A;  5IQY A;  4BVY A;  1LBK A;  2B7J A;  4KAE A;  3FZ9 A;  3NOF A;  4NWY A;  1X9M B;  1AQX A;  1U3A A;  3EPT A;  4TXV A;  3EMX A;  1EWX A;  1TP9 A;  5C04 A;  3UL3 A;  4GSS A;  1PL2 A;  3ZIV A;  2F9S A;  5JWR B;  3F3Q A;  2R5G A;  2IMF A;  1OAZ A;  3R2Q A;  2F8A A;  1XWG A;  4ML1 A;  3CRT A;  3P2A A;  2AJQ B;  2PBJ A;  3O3T A;  2VCT A;  4ZBD A;  3ZFL A;  3FR3 A;  2C0F A;  4MPG A;  1A23 A;  3A2W A;  4MDC A;  5DCH A;  3VI5 A;  4WF5 A;  4O5U A;  2VIM A;  2V2G A;  4POL A;  2HYX A;  1CQG A;  2GQL A;  5AIX A;  3KM6 A;  3FZ4 A;  5KN1 A;  4EC0 A;  4NPB A;  2C1Y A;  13GS A;  3VPQ A;  4BWS A;  4GSN A;  2YJ7 A;  4G0K A;  2YJH A;  2IPA A;  1TKD B;  2H75 A;  2VM1 A;  4K6X A;  3FKF A;  3HHV A;  3H1N A;  4OFT A;  4BWQ A;  5IOW A;  1GUK A;  3H4K A;  3ISO A;  1XVQ A;  3ED3 A;  1OC3 A;  2LJR A;  1R5A A;  1K0A A;  3MNG A;  3VWX A;  2VD1 A;  1EV4 A;  1OC8 A;  3KTL A;  1J08 A;  3ME8 A;  4XIH A;  1GNW A;  3CBU A;  1ST9 A;  3BBY A;  3N5O A;  1HNA A;  2IMD A;  5COH A;  3G7J A;  3F9U A;  1QFN A;  2L5O A;  2OE0 A;  4PUA A;  3APQ A;  4MZC A;  3GST A;  1RQM A;  4KX4 A;  4NV5 A;  3TJK A;  3KEB A;  2HRF A;  2M80 A;  3W6G A;  2H6Y A;  5CRD A;  4NXI A;  3DVW A;  1OVN A;  4KDU A;  1PSQ A;  4PNF A;  3UJ1 A;  4BL7 A;  2CV4 A;  5G31 A;  1XW5 A;  4LA1 A;  1SKW B;  2UZ8 A;  1HNC A;  12GS A;  2VLT A;  1RK4 A;  3ERG A;  1F3B A;  1T4Z A;  3TJJ A;  2WDU A;  4X4J A;  3RHC A;  5DAL A;  3VUR A;  1Z5Y E;  2IME A;  1A2J A;  2HSY A;  5IMD A;  1H75 A;  5JCW A;  2MBT A;  4MCU A;  4YQU A;  1V57 A;  1MD4 A;  3G9B A;  3MWH A;  4TRX A;  3APO A;  3QAV A;  3EVI A;  1OE8 A;  3L0H A;  4PQH A;  4ID0 A;  3GH6 A;  3FR9 A;  1O8X A;  2L5L A;  1JFU A;  1F2E A;  2F51 A;  3EU4 A;  4FQU A;  6GSW A;  3IHG A;  3K8N A;  1I9D A;  4HZ4 A;  2RM6 A;  4V1A g;  3LEF A;  1VGL A;  1S3C A;  2I1U A;  1ABA A;  5DBQ A;  1B8X A;  3GYK A;  2JU5 A;  2MZC A;  5A4U A;  2JZT A;  2VCV A;  1ERT A;  2VL3 A;  4G10 A;  3M8N A;  3GV1 A;  2WFC A;  5JWQ B;  1Z7P A;  2X4A A;  5B6M A;  2NTO A;  3LQ7 A;  4FYU A;  4QQ7 A;  2OAD A;  3FW2 A;  1H4O A;  3QR6 A;  3BOA A;  1KBN A;  1YEP A;  2H1G A;  3VPT A;  1K3O A;  2QA1 A;  3M9K A;  3QFA C;  4ZIJ A;  5E4W A;  1U88 A;  4MK3 A;  2TRX A;  3GL3 A;  4H86 A;  1GTA A;  2VCQ A;  4OFN A;  1X5D A;  5J3R A;  1GTB A;  3I69 A;  1LU4 A;  2VM2 A;  1OC9 B;  2PMT A;  4YH2 A;  2KP2 A;  4P3Y B;  2E7P A;  1DSB A;  3VWW A;  4D73 A;  1WRY A;  2MYG A;  2HRA A;  2MMZ A;  1GTU A;  1B4P A;  1V9W A;  2LKU A;  1SL1 B;  3FZA A;  4F03 A;  2ZUP A;  2LNS A;  3C1S A;  3DYR A;  2H01 A;  22GS A;  2O8V B;  3G7Y A;  3HJO A;  5DQY A;  3UBL A;  2XBQ A;  1PL1 A;  1V98 A;  2BJX A;  4LMW A;  2RUE A;  4OD7 A;  4XCS A;  2I81 A;  3KH7 A;  2A2P A;  4MLY A;  4N0V A;  4EIQ A;  2B1K A;  3HVV A;  5ECP B;  2R2J A;  3F4R A;  3FK8 A;  4WEY A;  4K7I A;  2K9F A;  3LG6 A;  4HJM A;  1GRX A;  4GXZ A;  5B8B A;  2DLX A;  3TRQ A;  1SKR B;  3DD3 A;  3LXZ A;  3HVX A;  4V2N A;  3A5W A;  3QCP A;  3TJG A;  4BVX A;  1YJ6 A;  5J9C A;  5DAK A;  2DJ2 A;  1THX A;  1GLP A;  1FB0 A;  1F6M C;  3EU3 A;  1R7H A;  3DGQ A;  4GWR A;  5D9W A;  1Z7R A;  4KGI A;  1UN2 A;  1EP7 A;  2WZ9 A;  3QFB C;  3CRU A;  2EIO A;  4G19 A;  5ECN B;  4HZ2 A;  2K18 A;  2C3Q A;  1ZYN A;  1ZYQ B;  3WT2 A;  3RHB A;  2DKI A;  1T4Y A;  2V6O A;  5IM9 A;  5D8I A;  5IMZ A;  3O6T A;  4PNG A;  2DML A;  3C1R A;  2LQQ A;  4RI6 A;  1Z6N A;  4IBP A;  5EVO A;  4GTU A;  4OO4 A;  1VF2 A;  1T8E B;  1MDK A;  3SBC A;  2ON5 A;  5B8A A;  2AB6 A;  3CSJ A;  3Q19 A;  4ZL7 A;  1XOA A;  1QGV A;  4YKF A;  5J9B A;  3QAW A;  3GH9 A;  1USB A;  1Z3E A;  2FLS A;  3J7Y b;  1ZL9 A;  2I4A A;  3CTF A;  3KMN A;  4XRD A;  1QQ2 A;  2H1D A;  2YP6 A;  1FOH A;  3TKQ A;  1TRU A;  3IC8 A;  2H30 A;  1J9B A;  1PQN A;  2C0G A;  3EIN A;  4MAB A;  2DJ3 A;  2GS3 A;  2I3Y A;  5KN0 A;  2H74 A;  5AN1 A;  4DEJ A;  3EUR A;  1PX6 A;  4WR5 A;  4I8B A;  5F07 A;  5ECQ B;  2YZU A;  3GIX A;  1T7P B;  3HDC A;  5IPG A;  1G7O A;  4X1U A;  2XPE A;  1K3L A;  1M2B A;  2B5E A;  3TKS A;  1GL8 A;  1PA3 A;  1PMT A;  3GRX A;  4ZB6 A;  1JZO A;  3FYG A;  2PU9 C;  3KCM A;  1YY7 A;  2DJK A;  4KW6 A;  4MJA A;  5D96 A;  5GAP D;  1YKC A;  3GN3 A;  1T3B A;  4FIW A;  2OBI A;  1SJZ A;  3CYN A;  4EE0 A;  1KEB A;  3P90 A;  5A4W A;  3N9J A;  4O7H A;  3KMO A;  3D5J A;  4HU7 A;  4YKG A;  1Q4J A;  4DVC A;  2DJ0 A;  4MJE A;  4WF4 A;  3ZVJ D;  2YCD A;  3ZIJ A;  1PKZ A;  5G1L A;  5GZZ B;  4OFM A;  2CZ3 A;  3W8S A;  4MF5 A;  2G0F A;  2FWE A;  4HEA 2;  3L9V A;  1AUC A;  4K8M A;  3HXS A;  2LRN A;  5CYY A;  2OKA A;  2H1B A;  4KUN A;  4KE3 A;  1THO A;  2GTU A;  3HCZ A;  2HZE B;  3FY7 A;  4G0L A;  3TOT A;  3HA9 A;  1Q98 A;  2X64 A;  1QK8 A;  2K8V A;  4EVM A;  3GKM A;  2A2S A;  1UC7 A;  4ML6 A;  2H72 A;  3TUE A;  1YF1 A;  1MDJ A;  4AJ6 A;  2WRT A;  2DIY A;  2N5B A;  1G6W A;  4KND A;  4Q5R A;  1FG4 A;  3DVX A;  4WET A;  5KOW A;  11GS A;  4JR6 A;  1TDI A;  2WB9 A;  1T00 A;  5CO3 A;  5ECI B;  1AQW A;  5H5S A;  4ZBB A;  4Z7X A;  5AIV A;  1TI3 A;  5IMA A;  2OE1 A;  1XVW A;  2XPD A;  4AGS A;  1ZOF A;  2HI7 A;  1XPV A;  1XW9 A;  1ZYE A;  4IVF A;  1IYH A;  4HUA A;  3Q18 A;  1TRW A;  5HR1 A;  2MMN A;  5DVB A;  4POB A;  1ON4 A;  3GUS A;  3IHQ A;  1A24 A;  1XWC A;  4IP1 A;  5ELG A;  2V41 A;  3IK9 A;  4KDX A;  1J0F A;  1KNG A;  3BJ5 A;  4XTS A;  3V1W A;  1GSY A;  4K5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...