2Z9SA

Crystal structure analysis of rat hbp23/peroxiredoxin i, cys52ser mutant
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
197
structure length
197
Chain Sequence
SGNAKIGHPAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVSPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxiredoxin-1
publication title Dimer-Oligomer Interconversion of Wild-type and Mutant Rat 2-Cys Peroxiredoxin: DISULFIDE FORMATION AT DIMER-DIMER INTERFACES IS NOT ESSENTIAL FOR DECAMERIZATION
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 58
structure length 197
sequence length 197
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2007-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2z9sA00
5ID2A 4KA0A 3DMLA 5KEJA 4E8HA 4KSOA 5F0GA 5IMZA 1XW6A 4OFNA 2EIOA 2ES7A 1ZYQB 1IYIA 2K18A 3KCMA 3UIWA 4MPFA 3LXZA 2H6ZA 1OYJA 3HYPA 3WD6A 5H5QA 3FYGA 5DBQA 2O7KA 1YDKA 1TW9A 1TRVA 4IJ3A 3I6AA 4MJAA 3F0IA 4AJ7A 3UBLA 4EVMA 1J0FA 5H5SA 1Z7PA 2NVLA 2DJJA 3D21A 3D4TA 4YAVA 4LMVA 1FB0A 4ZL8A 2O85A 3RHBA 3FR9A 1R7HA 1GSDA 1G6WA 4JU5A 5A4UA 4AF2A 2C1YA 2PMTA 2R4VA 4NHZA 3TKRA 4ECJA 3HZ8A 5DVBA 2GQKA 3QMXA 5B8AA 3I43A 4E8EA 1N2AA 2X8HA 4ZL7A 3R2QA 5B7CA 3VFIA 5IMDA 1A0FA 2YCDA 3GL3A 3BD2A 4QL9A 2HRFA 1B48A 1XXUA 4HDEA 3C7MA 5D93A 5DQSA 6GSUA 2CZ3A 1M7TA 3GIXA 4ACSA 1GRXA 2HXKA 2H0HA 2KOKA 4F82A 2WRTA 3RHCA 1AQWA 4ECBA 3HJOA 5D73A 4ID0A 4N0ZA 5IMCA 2LRCA 3BCIA 3GKKA 2C0FA 13GSA 2LNSA 1A23A 1KEBA 4KNDA 5JWOB 2C0DA 4O5RA 3TRPA 5HR0A 2WCIA 3KEBA 2HI7A 4LA1A 5CP1A 3ZVJA 2VCVA 4RI6A 5IO0A 3KMOA 4KDYA 1Y6EA 2YWOA 2PWJA 2P5RA 2QC7A 4L5OA 1Z9HA 2PVQA 4NXIA 1ZCPA 2DJ2A 2DMLA 2I4AA 1XWGA 1XFLA 1Z6MA 1GUHA 1RK4A 3CTFA 1DUGA 1M2AA 1Z7RA 4TW5A 3DEXA 1BYEA 2E0QA 2PBJA 1TXXA 2IMFA 3GKNA 3IOSA 3TOTA 2VM2A 2OE1A 3LORA 1PSQA 3ZREA 1SJZA 1WJKA 4K7IA 2HNLA 4KUNA 1MEKA 5INYA 3DVXA 4CW9A 4YQVA 1HYUA 3PH9A 3APSA 3HDCA 4NHWA 2XPDA 5J9CA 3G7YA 1YEPA 1F9MA 3KTLA 1XWCA 3DRNA 4N30A 3M8NA 1M2DA 2V32A 1WIKA 2LJRA 4Z7XA 2D2ZA 3GN3A 18GSA 2H72A 3C71A 1QGVA 1XW5A 3DWVA 1SJ6A 3Q19A 4BVYA 1V57A 1GTAA 1OVNA 1DBYA 1YKAA 3MNGA 2TIRA 3LXTA 4V2LA 4WXTA 4IQ1A 2L57A 3KXOA 5J5NA 4ZBAA 4KDUA 5KN1A 2FA8A 2LV3A 4KGIA 4BA7A 1TK8B 1K3LA 1SKSB 2CAIA 3Q18A 2M80A 4F0CA 5G1KA 3KIJA 2VUPA 4FH8A 2PPTA 3KH9A 4WR4A 1VF2A 3F3QA 4YH2A 2FWEA 4IJIA 1HNCA 1YF0A 1JZWA 3H79A 3BBYA 1PKWA 1ZOFA 2V1MA 3DXBA 1JZOA 4F0BA 1GUKA 3C73A 2LS5A 3GX8A 3IE3A 3U5RE 4LL1B 1V40A 4BPYA 2GSTA 5CRDA 6GSVA 5KN2A 3KJYA 2B7KA 5ECRB 4AGSA 2LUSA 4K8MA 3NZNA 3N9JA 1OC9A 2VD1A 2P31A 1TP9A 3KGKA 4IBPA 1FO5A 1V98A 1XPVA 2DJ0A 2HZFA 4GLTA 4IVFA 20GSA 2WJUA 3W8SA 4CDOA 3LEFA 1K0CA 4ZL9A 4K7OA 1UVZA 2A2RA 2VLTA 5D9XA 2R6KA 3CSJA 4O7HA 2VL9A 1AIUA 3GHAA 1ZGNA 2C8UA 1U87A 3FK8A 3IK7A 5D96A 3TJJA 1XOAA 3IC4A 1K0AA 1MTCA 3DKSA 3L78A 4EL1A 4KE3A 3GTUA 4POMA 2MMAA 2L4QA 2R3XA 1AAZA 5ECKB 2RUFA 6GSTA 10GSA 4YQUA 2CX3A 3HJMA 4J2FA 5GSTA 3CBUA 1SKWB 2YPMA 3F4TA 2VCXA 4OCEA 3C1SA 4WR5A 2X8CA 4ILFA 2VOCA 1M99A 3QFAC 5J9BA 4O32A 4XRDA 2V6OA 5J3RA 1W4VA 4OFMA 4TR3A 2IWTA 3MAKA 5CRWA 2JZRA 4L0WA 4G2EA 2LQOA 2R5GA 2WB9A 3KH7A 3GYKA 5L71A 4WBRD 5EY6A 5HR3A 2GSQA 1F6MC 5G30A 3E9JB 1SD8A 3VK9A 4O92A 1GTBA 3QDNA 5DAKA 1U88A 2JSZA 2L5LA 2XBQA 3AY8A 2HYXA 1E2YA 4PUAA 3TJBA 2YWNA 5FT3A 2CVDA 3TCOA 4TXVA 1VF4A 1DE1A 2GQMA 3EVIA 3E3EA 3RBTA 2M72A 2HSYA 3P2AA 2JZTA 5IMAA 3ZZXA 1K0MA 3FKFA 2FLSA 4HEA2 5G5EA 1GSFA 3VWVA 7GSSA 3SBCA 4JBBA 1WPIA 5IM9A 3ZLPA 2H1DA 2B5YA 1R5AA 2GZPA 2N5FA 4K2DA 5JCGA 3UARA 1O81A 3QFBC 2N5AA 2FA4A 4MABA 4FYCA 1LBKA 1VRSD 3ZL5A 1QK8A 1ACVA 5B6MA 1T00A 1TOFA 2WFCA 1MDJA 5CYYA 3H8QA 2WDUA 3FW2A 2HLSA 3WT2A 2CT6A 2FUG2 3EMPA 2I9HA 1QMVA 1SD9A 1GL8A 4MK3A 4QL7A 5ID2B 3EYTA 2C3QA 2G2QA 5A4WA 4FYUA 2NDOA 2GZZA 4L0UA 4KCAA 1OAZA 4K0GA 3FZAA 1PN9A 3TKPA 1V2AA 4EE0A 1EEJA 4XHMA 5IOWA 3ZMKA 3P7XA 1WMJA 4MZCA 2GDRA 2H6YA 3HVVA 3F6FA 3I69A 1THXA 5DALA 1M2BA 3L9VA 1C72A 4DEJA 1AXDA 1R4WA 1B4QA 3F3RA 3O3TA 1LJRA 2GLRA 3UBKA 1TU7A 2MBSA 1X0RA 2OBIA 1RW1A 4HS1A 1KNGA 2OKAA 4KAEA 2DBCA 3VPQA 1OE7A 2LEGA 2IMIA 5ABRA 2FD3A 3D6IA 4TR1A 2CV4A 4EUYA 2TRCP 2GVPA 4X0XA 1F3BA 3J7Yk 2G0FA 2GQLA 3UEMA 1EV4A 1MDIA 4KDXA 5HFIA 3D5JA 1BEDA 1TRSA 3GURA 2LTKA 22GSA 3RPNA 2NBSA 4GRFA 3DIEA 2E7PA 4FO5A 12GSA 3VI7A 4OO5A 5IO2A 1JZRA 4BWSA 1EOGA 2RUEA 4RI7A 1SK1A 3HZ4A 4XRAA 3GNJA 4HOJA 1K3YA 3VWUA 5ELGA 4XS4B 1XWBA 2F8AA 1SK0A 5AIVA 3ZFBA 4KW6A 3H93A 1GP1A 3M9JA 3F4SA 2J23A 1BX9A 2OE3A 3W8JA 1XCCA 3QCPA 1M9BA 5GZZB 5GSSA 1B9XC 1GSYA 2NPBA 2HFDA 2NTOA 5F05A 1ERVA 5F07A 3VPTA 1B8XA 5B8BA 1GTIA 3TKSC 1GWCA 3ZMLA 2WZ9A 3HKRA 2H75A 1AW9A 1J08A 4MZBA 4WF4A 3KP9A 1F37A 4ML6A 2BMXA 2AJQB 17GSA 5AGYA 1RQMA 2DIYA 4DSQA 2YV7A 3KZQA 1T4ZA 1E6BA 2VLUA 2VAFA 3F8UA 2MMNA 1PD21 2H0IA 3A2VA 3HD5A 2EIQA 2C0GA 2C4JA 5KN3A 4TOPA 5COHA 1HQOA 3GKXA 2FWGA 3MWHA 1TTZA 1YJ6A 2B1LA 2HZEB 4Q5RA 4EF0A 2C80A 2O8VB 1EP8A 4N11A 2P5QA 19GSA 2LJKA 3ZYWA 4HQZA 1ST9A 2PGTA 3FRCA 2BJXA 3TGZA 5FHIA 4MF5A 3NOFA 3ZIJA 4OMVA 2F3MA 5CO3A 1CQGA 1U3AA 4D73B 2V41A 2HSHA 4GXZA 3TJKA 1X9MB 2KUCA 1DSBA 3HY2A 4POLA 4GQCA 2YJ7A 1X9WB 4PURA 5CRHA 2VL3A 2IJYA 4HI7A 4MCUA 2K8SA 4F2IA 5IMFA 1TK0B 2OJLA 4L5LA 3FZ4A 4TXOB 1ZZYA 6GSSA 3FHKA 2VCWA 3OR5A 2IMEA 3CTGA 3GFKA 1AC1A 1NSWA 3IAS2 1GH2A 3IV4A 4ZIJA 3KTBA 5H5RA 1FHEA 5ECIB 3UJ1A 5KN0A 2B7JA 3A2XA 3BJ5A 3IAM2 1S3AA 1EEMA 14GSA 3ED3A 4DVCA 1TK5B 3M0FA 4GSNA 1EGRA 1OC9B 3O76A 2AYTA 4HUAA 4MH2A 3G7JA 2YANA 4MZWA 2YP6A 2HRNA 2K9FA 4EO3A 3TRXA 2I3YA 3UVTA 5GAND 4GQFA 3QAVA 1UA5A 1K0DA 3LFLA 1JLVA 5AN1A 2ON7A 2DJ1A 2KP1A 2YZHA 2H70A 3L0HA 2CX4A 5G2ZA 4I5QA 4MMMA 2VCQA 5A5KA 3UMAA 2IIYA 4WKWA 4TR4A 2LJAA 9GSSA 2IPAA 5E4WA 3HVXA 2H01A 5IOXA 2MMOA 1Q4JA 3CRTA 1FB6A 6GSXA 5IMVA 4GCIA 1GNWA 1LU4A 3O6TA 1O7UA 3WYWA 2OE0A 4IP1A 3FZ5A 3DD3A 2F8FA 2KLXA 3JCML 2JACA 2JSYA 2AHEA 2LRNA 1NW2A 2Z9SA 2K8VA 1GLPA 5AIXA 2GT6A 3LWAA 2C0EA 2QGVA 2H76A 3C1RA 3QPMA 1WRYA 2F51A 3IA1A 5LD0A 2E2MA 4MF7A 1YF1A 1VF1A 2V6KA 1WOUA 1YY7A 4Q5QA 5DAKB 1XW9A 1XWAA 4HJ2A 1GSUA 4MDCA 2JZSA 1O8XA 4DSSA 2VLVA 1R5PA 1PX6A 4HZ4A 2QSIA 4KSMA 3G7IA 5ECSA 3ERWA 1EGOA 1M0UA 3ZVJD 3F4RA 1Z3EA 1TI3A 1ZYEA 1YEXA 4J57E 1SU9A 4YAPA 2ZCTA 2TRXA 1A2LA 1FW1A 2MMZA 3F9UA 3IXRA 4XTSA 1KTEA 1T1VA 2GSRA 2WS2A 1BG5A 5G5FA 2CAQA 4JRRA 1K0NA 2KP2A 1SJIA 4QQ7A 5G31A 1TI1A 1YKCA 3ZITA 1V9WA 1O6JA 2H1BA 2N5BA 4IS0A 3WGXA 2FCHA 1QQ2A 2MBTA 3Q6OA 2AAWA 2EIRA 1TDIA 4JZQA 1MDKA 2H71A 5E59A 4ZILA 2XBIA 1J9BA 3H1NA 3E0UA 1UC7A 4EDZA 4ZB6A 3APQA 3ZIVA 4ULXA 1XIYA 1USBA 1Q98A 3TJFA 2BTOT 4MF6A 5ECNB 4X43A 2LNTA 3TKQA 2A2SA 4RQXA 1PMTA 1PL1A 1I9DA 1XZOA 1JHBA 4GWRA 1MD4A 4N10A 5DJLA 1S3CA 5ECHB 4ECIA 1F2EA 1EP7A 3FZ9A 5ECOB 3F6DA 3HXSA 4V1Ag 4ML1A 2ZUPA 4ZB8A 5JWRB 1B4PA 3TB2A 3A5WA 5DALB 2GT5A 1X5EA 5JCUA 4AJ8A 1BJXA 1PRXA 2REMA 3W6GA 4J56E 1SYRA 6GSYA 4IW9A 3L9UA 3TKSA 4X1UA 1ML6A 1A2MA 4GSSA 2PU9C 4OWYA 5J41A 4I2TA 4N0VA 4ZXGA 1KBNA 1Z6NA 4IGJA 3TDGA 4V2NA 4YQMA 2H1AA 3LGCA 1PKZA 2IMDA 5CRGA 1A0RP 4NAXA 1UN2A 2B6MA 3KP8A 3QD9A 3WT1A 4PUFC 4TR1B 3Q74A 2OA7A 4FIWA 5D9VA 4DSRA 1PA3A 1OC8A 3KM6A 4H86A 2PUKC 3FEUA 4IKHA 3A2WA 1QXHA 1W89A 3P90A 4AJ6A 4PX1A 2WULA 2MZCA 3APOA 2O89A 4K7NA 1YZXA 1EWXA 2WGRA 2MYGA 1OKTA 2IMKA 2CQ9A 1FVKA 3GSTA 2AV4A 3RPPA 4RQRA 3PGTA 2VD0A 4MA9A 5B6NA 4KB3A 4JR6A 4MLYA 1OC3A 2IFQA 4CHSA 1ZMAA 4PGTA 2DJ3A 5LNKe 2JL4A 2RLIA 4K0NA 1VF3A 2DMMA 4K6XA 1X9SB 1N8JA 2VL2C 1XVWA 3EMXA 1B9YC 1DE2A 1U6TA 3D0ZA 2YJHA 4BL7A 1ON4A 2L6CA 1A2JA 1SL1B 5ECLB 1O73A 2DSAA 1SL2B 1PL2A 5AISA 3ERFA 3GA4A 3HCZA 2ON5A 1GNEA 1M9AA 2CZ2A 2HE3A 3UL3A 5JWQB 1WWJA 3LSZA 4TKYA 3GV1A 3HVSA 3EC3A 3IDVA 3S9FA 2B5EA 2YN1A 3VWXA 5C00A 1U3IA 3C8EA 4TRXA 3FR6A 1XVQA 3P8WA 4IHUA 4ZBDA 2GSSA 1XBSA 4EKZA 1ILOA 4GTUA 4I2UA 4XS1A 2XHFA 4PNFA 4XS6A 3TKSE 2OACA 4JE1A 1H75A 1G7EA 4IP6A 1EOHA 4L8EA 4EXJA 2P0GA 1R26A 1G7OA 3BOAA 4HU7A 5ELAA 5ENUA 2IN3A 1TRWA 5IQYA 2AUVA 3UVHA 3VWWA 4XS4A 2LSTA 4V1Ap 1PX7A 3L4NA 2H0GA 3QOUA 4TN8A 3ZRDA 3ZTLA 2B1KA 3MSZA 4IQAA 3CXGA 4Q5NA 1EZKA 4RUVA 5LCZA 2R2JA 4HU9A 3CSHA 1AUCA 1HNAA 4ZB9A 2PERA 4Q5FA 3SWLA 1EV9A 3DGQA 1QUWA 3CMIA 1SKRB 2FWHA 1Z5YE 1CQHA 5GAPD 1G0TA 1G6YA 3M3MA 2YOIA 3GX0A 3HA9A 2YWIA 5JCWA 2FNOA 2H73A 3CRUA 1AQXA 1TU8A 4KCEA 3ISOA 5D8IA 3TRQA 3GSSA 3TUEA 2H19A 3DVWA 3PR8A 5C04A 2H1GA 5EL8A 2HZEA 3FR3A 1NHYA 3V1WA 5F06A 5DCGA 3VI5A 4PQ1A 1GUMA 2JADA 2C3NA 5DQYA 5ECQB 2X64A 4GSTA 1VGLA 3WGDA 1ERWA 3D22A 2OBKA 3EWLA 4WBJA 2L5OA 2EC4A 2L59A 2I1UA 2HT9A 2I81A 4MJEA 4EC0A 4MH3A 3IBHA 2GGTA 1ERUA 3CYNA 3WGEA 3GH9A 3IHQA 4D73A 4PQIA 5IPHA 2FY6A 2GS3A 5ECMB 1GULA 2F9SA 4F03A 3A3TA 5HR1A 1K0OA 1K3OA 2YWMA 3RAZA 1V58A 4K9ZA 1PQNA 1AQVA 1BAYA 4NPBA 5EPFA 4TR0A 1F3AA 4JR4A 1HD2A 4HJMA 5IPGA 1O85A 1GTUA 2LRTA 1O8WA 2VO4A 1SL0B 4TXOA 1XWKA 2GZYA 4V2MA 2VCZA 3EURA 3DYRA 2CVKA 2H66A 4F9ZA 1X5CA 3ERGA 4KX4A 4I6XA 3GH6A 4BWQA 3GKMA 4EDYA 1T3BA 4ISDA 3L9SA 3GRXA 2C3TA 4HQSA 3KMNA 2ALBA 5EVOA 3N5OA 3GTUB 1JZDA 4NV2A 4P3YB 1FVJA 1SENA 3QAGA 3FY7A 5DDLA 2M46A 2CVBA 3RDWA 2L6DA 4JEDA 4MP4A 4WEYA 1SK2A 2RM6A 3TOUA 2GTUA 4BVXA 4G19A 1MD3A 3CSIA 5DJMA 4DSSB 1H4OA 4OCFA 1GSQA 2H6XA 4IELA 3IPZA 3IR4A 2O87A 5CREA 4FYBA 5HR2A 1S3DA 2LKUA 3EU3A 2X99A 5A4VA 5F8BA 2PVOC 5G1LA 4I97A 4I8BA 1A8YA 1URMA 1T4YA 2VIMA 2H74A 3LYKA 2B5XA 1QFNA 2H8LA 4OO4A 2YV9A 5HQPA 3VLNA 1PGTA 1WP0A 2H30A 2CA8A 3ME7A 4PNGA 1GLQA 4LLRA 3U6VA 3UOMA 1WE0A 5HFGA 4POKA 3M9KA 4OFTA 4MPGA 1TJDA 2XC2A 3ZFLA 1Y25A 3ME8A 2R37A 3MDKA 4IN0A 1FOVA 1ZL9A 1X5DA 1A24A 3G9BA 3GUSA 1NHOA 4MJBA 2AB6A 4MJCA 2FGXA 1JLWA 1GSEA 4HZ2A 4GF0A 4NWYA 3J7Yb 1BQ7A 5D9TA 3VURA 1HNBA 3QR6A 1OE8A 2DJKA 1OKDA 5DCHA 3BCKA 1SYXA 2LQQA 3LJRA 4KH7A 3LG6A 2YZUA 3M1GA 2VL2A 2L4CA 4XIHA 3H4KA 2KHPA 4G9HA 2XPEA 2OADA 1T8EB 2QKEA 5CAXA 2PN8A 3EU4A 2ZNMA 1IYHA 3HJPA 1XOBA 2IL3A 2VM1A 3IK9A 4XCSA 2K6VA 3HHVA 3QAWA 2RM5A 3EE2A 2FWFA 4WETA 5FWGA 1K0BA 3US3A 5CNWA 2VCTA 1A8LA 3K8NA 3I9V2 4LL4B 8GSSA 2X8GA 2JU5A 4WF5A 5J4UA 4ZBBA 2DLXA 3F63A 2RIIA 4POBA 3LYPA 3GL5A 5HFKA 1ERTA 3KD0A 11GSA 2YNXA 4TVEA 3PINA 1TKDB 2DIZA 4G10A 1FG4A 3TJGA 1YQ1A 3NIVA 3IRAA 1T7PB 5D9WA 4OD7A 1NM3A 1GSSA 3D4MA 2E2GA 3LQ7A 16GSA 2J9HA 4NMUA 1TRUA 4K1FA 1I5GA 4LMWA 2A4VA 2IFQB 4PXOA 1FAAA 2V2GA 5IIZA 4PQHA 2B3SA 3EINA 4ECCA 3GMFA 5ECPB 1THOA 1ABAA 2FHEA 6GSWA 4NV5A 2DC5A 3UAPA 1JFUA
chains in the Genus database with same CATH superfamily
5ID2A 4KA0A 3DMLA 5KEJA 4E8HA 3CQFA 4KSOA 5F0GA 5IMZA 1XW6A 4OFNA 2EIOA 2ES7A 1ZYQB 1IYIA 2K18A 3KCMA 3UIWA 4MPFA 3LXZA 2H6ZA 1OYJA 3HYPA 3WD6A 5H5QA 3FYGA 5DBQA 2O7KA 1YDKA 1TW9A 1TRVA 4IJ3A 3A5IA 3I6AA 4MJAA 3F0IA 4AJ7A 3UBLA 4EVMA 1J0FA 5H5SA 1Z7PA 2NVLA 2DJJA 3D21A 3D4TA 4YAVA 4LMVA 1FB0A 4ZL8A 2O85A 3RHBA 3FR9A 1R7HA 1GSDA 1G6WA 4JU5A 5A4UA 4AF2A 2C1YA 2PMTA 3MIXA 2R4VA 4NHZA 3TKRA 4ECJA 3HZ8A 5DVBA 2GQKA 3QMXA 5B8AA 3I43A 4E8EA 1N2AA 2X8HA 4ZL7A 3R2QA 5B7CA 3VFIA 5IMDA 1A0FA 2YCDA 3GL3A 3BD2A 1ZYPA 4QL9A 2HRFA 1B48A 1XXUA 4HDEA 3C7MA 2HSMA 5D93A 5DQSA 6GSUA 2CZ3A 1M7TA 3GIXA 4ACSA 1GRXA 2HXKA 2H0HA 2KOKA 4F82A 2WRTA 3RHCA 1AQWA 4ECBA 3HJOA 5D73A 4ID0A 4N0ZA 5IMCA 2LRCA 3BCIA 4BIKA 3GKKA 2C0FA 13GSA 2LNSA 1A23A 1KEBA 4KNDA 5JWOB 2C0DA 4O5RA 3TRPA 5HR0A 1M3JA 2WCIA 3KEBA 2HI7A 4LA1A 5CP1A 3ZVJA 2VCVA 4RI6A 5IO0A 3KMOA 4KDYA 1Y6EA 2YWOA 2PWJA 2P5RA 2QC7A 4L5OA 1Z9HA 2PVQA 4NXIA 1ZCPA 2DJ2A 2DMLA 2I4AA 1XWGA 4K5SA 1XFLA 1Z6MA 1GUHA 1RK4A 3CTFA 1DUGA 1M2AA 1Z7RA 4TW5A 3DEXA 1BYEA 2E0QA 2PBJA 1TXXA 2IMFA 3GKNA 3IOSA 3TOTA 2VM2A 2OE1A 3LORA 1PSQA 4O5QA 3ZREA 1SJZA 1WJKA 4K7IA 2HNLA 4KUNA 1MEKA 5INYA 3DVXA 4CW9A 4YQVA 1HYUA 3PH9A 3APSA 2X49A 3HDCA 4NHWA 2XPDA 5J9CA 3G7YA 1YEPA 1F9MA 3KTLA 1XWCA 3DRNA 4N30A 3M8NA 1M2DA 2V32A 1WIKA 2LJRA 4Z7XA 2D2ZA 3GN3A 3PPUA 18GSA 2H72A 3C71A 1QGVA 1XW5A 3DWVA 1SJ6A 3Q19A 4BVYA 1V57A 1GTAA 1OVNA 1DBYA 1YKAA 3MNGA 2TIRA 3LXTA 4V2LA 4WXTA 4IQ1A 2L57A 3KXOA 5J5NA 4ZBAA 4KDUA 5KN1A 2FA8A 2LV3A 4KGIA 4BA7A 1TK8B 1K3LA 1SKSB 2CAIA 3Q18A 2M80A 4F0CA 5G1KA 2R0GA 3KIJA 2VUPA 4FH8A 2PPTA 3KH9A 4WR4A 1VF2A 3F3QA 4YH2A 2FWEA 4IJIA 1HNCA 1YF0A 1JZWA 3H79A 3BBYA 1PKWA 1ZOFA 2V1MA 3DXBA 1JZOA 4BVXB 4F0BA 1GUKA 3C73A 2LS5A 3GX8A 3IE3A 4CY8A 3U5RE 4LL1B 1V40A 4BPYA 2GSTA 2HRAA 5CRDA 6GSVA 5KN2A 3KJYA 2B7KA 5ECRB 4AGSA 2LUSA 4K8MA 3NZNA 3N9JA 1OC9A 2VD1A 1M3IA 2P31A 1TP9A 3KGKA 4IBPA 1ZYNA 1FO5A 1V98A 1XPVA 2DJ0A 2HZFA 4GLTA 4IVFA 20GSA 2WJUA 3W8SA 4CDOA 3LEFA 1K0CA 4ZL9A 4K7OA 1UVZA 2A2RA 2VLTA 5D9XA 2R6KA 3CSJA 4O7HA 2VL9A 1AIUA 3GHAA 1ZGNA 2C8UA 1U87A 3FK8A 3IK7A 5D96A 3TJJA 4G0IA 1XOAA 3IC4A 1K0AA 1MTCA 3DKSA 3L78A 4EL1A 4KE3A 3GTUA 4POMA 2MMAA 2L4QA 2R3XA 1AAZA 5ECKB 2RUFA 6GSTA 10GSA 4YQUA 2CX3A 3HJMA 4J2FA 5GSTA 3CBUA 1SKWB 2YPMA 3F4TA 2VCXA 4OCEA 3C1SA 4WR5A 2X8CA 4ILFA 2VOCA 1M99A 3QFAC 5J9BA 4O32A 4XRDA 2V6OA 5J3RA 1W4VA 4OFMA 4TR3A 2IWTA 3MAKA 5CRWA 2JZRA 4L0WA 4G2EA 2LQOA 2R5GA 2A2PA 1S3RA 2WB9A 3KH7A 3GYKA 5L71A 4WBRD 5EY6A 5HR3A 2GSQA 1F6MC 5G30A 3E9JB 1SD8A 3VK9A 4O92A 1GTBA 3QDNA 5DAKA 1U88A 2JSZA 2L5LA 2XBQA 3AY8A 2HYXA 1E2YA 4PUAA 3TJBA 2YWNA 5FT3A 2CVDA 3TCOA 4TXVA 1VF4A 1DE1A 2GQMA 3EVIA 3E3EA 3RBTA 2M72A 2HSYA 3P2AA 2JZTA 5IMAA 3ZZXA 1K0MA 3FKFA 2FLSA 4HEA2 5G5EA 1GSFA 3VWVA 7GSSA 3SBCA 4USSA 4JBBA 1WPIA 5IM9A 3ZLPA 2H1DA 2B5YA 1R5AA 2GZPA 2N5FA 4K2DA 5JCGA 3UARA 4K5RA 1O81A 3QFBC 2N5AA 2FA4A 4MABA 4FYCA 1LBKA 1VRSD 3ZL5A 1QK8A 1ACVA 5B6MA 1T00A 4G0KA 1TOFA 2WFCA 1MDJA 5CYYA 3H8QA 2WDUA 3FW2A 2HLSA 3WT2A 2CT6A 2FUG2 3EMPA 2I9HA 1QMVA 1SD9A 3LW9A 1GL8A 4MK3A 4QL7A 5ID2B 3EYTA 2C3QA 2G2QA 5A4WA 4FYUA 2NDOA 2GZZA 4L0UA 4KCAA 1OAZA 4Z2TA 4K0GA 3FZAA 1PN9A 3TKPA 1V2AA 4EE0A 1EEJA 4XHMA 5IOWA 3ZMKA 3P7XA 1WMJA 4MZCA 2GDRA 2H6YA 1PFOA 3HVVA 3F6FA 3I69A 1THXA 5DALA 1M2BA 3L9VA 1C72A 4DEJA 1AXDA 1R4WA 1B4QA 1PN0A 3F3RA 3O3TA 1LJRA 2GLRA 3UBKA 4BL7B 1TU7A 2MBSA 1X0RA 2OBIA 1RW1A 4HS1A 1KNGA 2OKAA 4KAEA 2DBCA 3VPQA 1OE7A 2LEGA 2IMIA 5ABRA 2FD3A 3D6IA 4TR1A 2CV4A 4EUYA 2TRCP 4FQUA 2GVPA 4X0XA 1F3BA 3J7Yk 2G0FA 2GQLA 3UEMA 1EV4A 1MDIA 4KDXA 5HFIA 3D5JA 1BEDA 1TRSA 3GURA 2LTKA 22GSA 3RPNA 2NBSA 4GRFA 3DIEA 2E7PA 4FO5A 12GSA 3VI7A 4OO5A 5IO2A 1JZRA 4BWSA 1EOGA 2RUEA 4RI7A 1SK1A 3HZ4A 4XRAA 3GNJA 4HOJA 1K3YA 3VWUA 5ELGA 4XS4B 1XWBA 2F8AA 1SK0A 5AIVA 3ZFBA 4KW6A 3H93A 1GP1A 3M9JA 3F4SA 2J23A 1BX9A 2OE3A 3W8JA 1XCCA 3QCPA 1M9BA 5GZZB 5GSSA 1B9XC 1GSYA 2NPBA 2HFDA 2NTOA 5F05A 1ERVA 5F07A 3VPTA 1B8XA 5B8BA 2R0PA 1GTIA 5BMUA 3TKSC 1GWCA 3ZMLA 2WZ9A 3HKRA 2H75A 1AW9A 1J08A 4MZBA 4WF4A 4Z2UA 3KP9A 1F37A 4ML6A 4Z2RA 4O5UA 2BMXA 2AJQB 17GSA 5AGYA 1RQMA 2DIYA 4DSQA 2YV7A 3KZQA 1T4ZA 1E6BA 4KF9A 2VLUA 2VAFA 3F8UA 2MMNA 1PD21 2H0IA 3A2VA 3HD5A 2EIQA 2C0GA 2C4JA 5KN3A 4TOPA 5COHA 1HQOA 3GKXA 2FWGA 3MWHA 1TTZA 1YJ6A 2B1LA 2HZEB 4Q5RA 4EF0A 2C80A 2O8VB 1EP8A 4N11A 2P5QA 19GSA 4YKFA 2LJKA 3ZYWA 4HQZA 1ST9A 2PGTA 3FRCA 2BJXA 3TGZA 5FHIA 4MF5A 3NOFA 3ZIJA 4OMVA 2F3MA 5CO3A 1CQGA 1U3AA 4D73B 2V41A 2HSHA 4GXZA 3TJKA 1X9MB 2KUCA 1DSBA 3HY2A 4POLA 4GQCA 2YJ7A 1X9WB 4PURA 5CRHA 2VL3A 2IJYA 4HI7A 4MCUA 2DKHA 2K8SA 4F2IA 2X4AA 5IMFA 1TK0B 2OJLA 4L5LA 3FZ4A 4TXOB 1ZZYA 6GSSA 3FHKA 2VCWA 3OR5A 2IMEA 3CTGA 3GFKA 1AC1A 1NSWA 3IAS2 1GH2A 3IV4A 4ZIJA 3KTBA 5H5RA 1FHEA 5ECIB 3UJ1A 5KN0A 2B7JA 3MYDA 3A2XA 3BJ5A 3IAM2 1S3AA 1EEMA 14GSA 3ED3A 4DVCA 1TK5B 3M0FA 4GSNA 1EGRA 1OC9B 3O76A 2AYTA 4HUAA 4A5PA 4MH2A 3G7JA 2YANA 4MZWA 2YP6A 2HRNA 2K9FA 4EO3A 3TRXA 2I3YA 3UVTA 5GAND 4GQFA 3QAVA 1UA5A 1K0DA 3LFLA 1JLVA 5AN1A 2ON7A 2DJ1A 2KP1A 2YZHA 2H70A 2QA2A 3L0HA 2CX4A 5G2ZA 4I5QA 4MMMA 2VCQA 5A5KA 3UMAA 2IIYA 4WKWA 4TR4A 2LJAA 9GSSA 2IPAA 5E4WA 3HVXA 2H01A 5IOXA 2MMOA 1Q4JA 2DKIA 3CRTA 1FB6A 6GSXA 5IMVA 4GCIA 1GNWA 1LU4A 3O6TA 1O7UA 3WYWA 2OE0A 4IP1A 4PTSA 3FZ5A 3DD3A 3HVNA 2F8FA 2KLXA 3JCML 2JACA 2JSYA 2AHEA 4HSCX 2LRNA 1NW2A 2Z9SA 2K8VA 1GLPA 5AIXA 2GT6A 3LWAA 2C0EA 2QGVA 2H76A 3C1RA 3QPMA 1WRYA 2F51A 3IA1A 5LD0A 2E2MA 4MF7A 1YF1A 1VF1A 2V6KA 1WOUA 1YY7A 4Q5QA 5DAKB 1XW9A 1XWAA 4HJ2A 1GSUA 4MDCA 2JZSA 1O8XA 4DSSA 2VLVA 1R5PA 1PX6A 4HZ4A 2QSIA 4KSMA 3G7IA 5ECSA 3ERWA 1EGOA 1M0UA 3ZVJD 3F4RA 1Z3EA 1TI3A 1ZYEA 1YEXA 4J57E 1SU9A 4YAPA 2ZCTA 2TRXA 1A2LA 1FW1A 2MMZA 3F9UA 3IXRA 4XTSA 1KTEA 1T1VA 2GSRA 2WS2A 1BG5A 5G5FA 2CAQA 4JRRA 1K0NA 2KP2A 1SJIA 4QQ7A 5G31A 1TI1A 1YKCA 3ZITA 1V9WA 1O6JA 2H1BA 2N5BA 4IS0A 3WGXA 2FCHA 5BRTA 1QQ2A 2MBTA 3Q6OA 2AAWA 2EIRA 1TDIA 4JZQA 1MDKA 2H71A 5E59A 4ZILA 2XBIA 1J9BA 3H1NA 3E0UA 1UC7A 4EDZA 4ZB6A 3APQA 3ZIVA 4ULXA 1XIYA 1USBA 1Q98A 3TJFA 2BTOT 4MF6A 5ECNB 4X43A 2LNTA 3TKQA 2A2SA 4RQXA 1PMTA 1PL1A 1I9DA 1XZOA 1JHBA 4GWRA 1MD4A 4N10A 5DJLA 1S3CA 5ECHB 4ECIA 1F2EA 3FMWA 1EP7A 3FZ9A 5ECOB 3F6DA 3HXSA 4V1Ag 4ML1A 2ZUPA 4ZB8A 5JWRB 1B4PA 3TB2A 3A5WA 5DALB 2GT5A 1X5EA 5JCUA 4AJ8A 1BJXA 1PRXA 2REMA 3W6GA 4J56E 1SYRA 6GSYA 4IW9A 3L9UA 3TKSA 4X1UA 1ML6A 1A2MA 4GSSA 2PU9C 4OWYA 5J41A 4I2TA 4N0VA 4ZXGA 1KBNA 1Z6NA 4IGJA 3EPTA 3TDGA 4V2NA 4YQMA 2H1AA 3LGCA 1PKZA 2IMDA 4G0LA 5CRGA 1A0RP 4NAXA 1UN2A 2B6MA 3KP8A 3QD9A 3WT1A 4PUFC 4TR1B 3Q74A 2OA7A 4FIWA 5D9VA 4DSRA 1PA3A 1OC8A 3KM6A 4H86A 2PUKC 3FEUA 4IKHA 3A2WA 1QXHA 1W89A 3P90A 4AJ6A 4PX1A 2WULA 2MZCA 3APOA 2O89A 4K7NA 1YZXA 1EWXA 2WGRA 2MYGA 1OKTA 2IMKA 2CQ9A 1FVKA 3GSTA 2AV4A 3RPPA 4RQRA 3PGTA 2VD0A 4MA9A 5B6NA 4KB3A 4JR6A 4MLYA 1OC3A 2IFQA 4CHSA 1ZMAA 4PGTA 4CY6A 2DJ3A 5LNKe 2JL4A 2RLIA 4K0NA 1VF3A 2DMMA 3IC8A 4K6XA 1X9SB 1N8JA 2VL2C 1XVWA 3EMXA 1B9YC 1DE2A 1U6TA 3D0ZA 2YJHA 4BL7A 1ON4A 4EIQA 2L6CA 1A2JA 1SL1B 5ECLB 1O73A 2DSAA 1SL2B 1PL2A 5AISA 3ERFA 3GA4A 3HCZA 2ON5A 1GNEA 1M9AA 2CZ2A 2HE3A 3UL3A 5JWQB 1WWJA 3LSZA 4TKYA 3GV1A 3HVSA 3EC3A 3IDVA 3S9FA 2B5EA 2YN1A 3VWXA 5C00A 1U3IA 3C8EA 4TRXA 3FR6A 1XVQA 3P8WA 4IHUA 4ZBDA 2GSSA 1XBSA 4EKZA 1ILOA 4GTUA 4I2UA 4XS1A 2XHFA 4PNFA 4XS6A 2UZ8A 3TKSE 2OACA 4JE1A 1H75A 1G7EA 4IP6A 1EOHA 4L8EA 4EXJA 2P0GA 1R26A 1G7OA 3BOAA 4HU7A 5ELAA 5ENUA 2IN3A 1TRWA 5IQYA 2AUVA 3UVHA 3VWWA 4XS4A 2LSTA 4V1Ap 1PX7A 3L4NA 2R0CA 2H0GA 3QOUA 4TN8A 3ZRDA 3ZTLA 2B1KA 3MSZA 4IQAA 3CXGA 4Q5NA 1EZKA 4RUVA 5LCZA 2R2JA 4HU9A 3CSHA 1AUCA 1HNAA 4ZB9A 2PERA 4Q5FA 3SWLA 1EV9A 3DGQA 1QUWA 3CMIA 2A4HA 1SKRB 2FWHA 1Z5YE 1CQHA 4MNNA 5GAPD 1G0TA 1G6YA 3M3MA 2YOIA 3GX0A 3HA9A 4BVYB 2YWIA 5JCWA 2FNOA 2H73A 3CRUA 4YKGA 1AQXA 1TU8A 4KCEA 3ISOA 5D8IA 3TRQA 3GSSA 3TUEA 2H19A 3DVWA 3PR8A 5C04A 2H1GA 5EL8A 2HZEA 3FR3A 1NHYA 3V1WA 5F06A 5DCGA 3VI5A 4PQ1A 1GUMA 2JADA 2C3NA 5DQYA 5ECQB 2X64A 4GSTA 1VGLA 3WGDA 1ERWA 3D22A 2OBKA 3EWLA 4WBJA 2L5OA 2EC4A 2L59A 2I1UA 2HT9A 2I81A 4MJEA 4EC0A 4MH3A 3IBHA 2GGTA 1ERUA 3CYNA 3WGEA 3GH9A 3IHQA 4D73A 4PQIA 5IPHA 2FY6A 2GS3A 5ECMB 1GULA 2F9SA 4F03A 3A3TA 5HR1A 1K0OA 1K3OA 2YWMA 3RAZA 1V58A 4K9ZA 1PQNA 1AQVA 1BAYA 4NPBA 5EPFA 4TR0A 1F3AA 4JR4A 1HD2A 4HJMA 5IPGA 1O85A 1GTUA 2LRTA 1O8WA 2VO4A 1SL0B 4TXOA 4X4JA 1XWKA 2GZYA 4V2MA 2VCZA 3EURA 3DYRA 2CVKA 2H66A 4F9ZA 1X5CA 3ERGA 4KX4A 4I6XA 3GH6A 4BWQA 3GKMA 4EDYA 1T3BA 4ISDA 3L9SA 3GRXA 2C3TA 4HQSA 3KMNA 2ALBA 5EVOA 3N5OA 3GTUB 1JZDA 4EIPA 4NV2A 5KOXA 4P3YB 1FVJA 1SENA 3QAGA 3FY7A 5DDLA 2M46A 2CVBA 3RDWA 2L6DA 4JEDA 4MP4A 4WEYA 1SK2A 2RM6A 3TOUA 2GTUA 4BVXA 4G19A 1MD3A 2QA1A 3CSIA 5DJMA 4DSSB 1H4OA 4ICYA 4OCFA 1GSQA 2H6XA 4IELA 3IPZA 3IR4A 2O87A 5CREA 4FYBA 5HR2A 1S3DA 2LKUA 3EU3A 2X99A 5A4VA 5F8BA 2PVOC 5G1LA 4I97A 4I8BA 1A8YA 1URMA 1T4YA 2VIMA 2H74A 3LYKA 2B5XA 1QFNA 2H8LA 4OO4A 2YV9A 5HQPA 3VLNA 5KOWA 1PGTA 1WP0A 2H30A 2CA8A 3ME7A 4PNGA 1GLQA 2HRKA 4LLRA 3U6VA 3UOMA 1WE0A 1XG8A 5HFGA 4POKA 3M9KA 4OFTA 4MPGA 1TJDA 2XC2A 3ZFLA 1Y25A 3ME8A 2R37A 3MDKA 4IN0A 1FOVA 1ZL9A 1X5DA 1A24A 3G9BA 3GUSA 1NHOA 4MJBA 1FOHA 2AB6A 4MJCA 4K2XA 2FGXA 1JLWA 1GSEA 4HZ2A 4GF0A 4NWYA 3J7Yb 1BQ7A 5D9TA 3VURA 1HNBA 3QR6A 1OE8A 2DJKA 1OKDA 5DCHA 3BCKA 1SYXA 2LQQA 3LJRA 4KH7A 3LG6A 2YZUA 3M1GA 2VL2A 3R3EA 2L4CA 4XIHA 3H4KA 2KHPA 4G9HA 2XPEA 2OADA 1T8EB 2QKEA 5CAXA 2PN8A 3EU4A 2ZNMA 3IHGA 1IYHA 3HJPA 1XOBA 2IL3A 2VM1A 3IK9A 4XCSA 2K6VA 3HHVA 3QAWA 2RM5A 3EE2A 2FWFA 4WETA 5FWGA 1K0BA 3US3A 5CNWA 2VCTA 1A8LA 3K8NA 3I9V2 4LL4B 8GSSA 2X8GA 2JU5A 4WF5A 5J4UA 4ZBBA 2DLXA 3F63A 2RIIA 4POBA 3LYPA 3GL5A 5HFKA 1ERTA 3KD0A 11GSA 2YNXA 4TVEA 3PINA 1TKDB 2DIZA 4G10A 1FG4A 3TJGA 1YQ1A 3NIVA 3IRAA 1T7PB 5D9WA 4OD7A 1NM3A 1GSSA 3D4MA 2E2GA 3LQ7A 16GSA 2J9HA 4NMUA 1TRUA 4K1FA 1I5GA 4LMWA 2A4VA 2IFQB 4PXOA 1FAAA 2V2GA 5IIZA 4PQHA 2B3SA 3EINA 4ECCA 3GMFA 5ECPB 1THOA 1ABAA 2FHEA 6GSWA 4NV5A 2DC5A 3UAPA 1JFUA
chains in the Genus database with same CATH topology
5ID2A 4KA0A 3DMLA 5KEJA 4E8HA 4KSOA 5F0GA 5IMZA 1XW6A 4OFNA 2EIOA 2ES7A 1ZYQB 1IYIA 2K18A 3KCMA 3UIWA 4MPFA 3LXZA 2H6ZA 1OYJA 3HYPA 3WD6A 5H5QA 3FYGA 5DBQA 2O7KA 1YDKA 1TW9A 1TRVA 4IJ3A 3A5IA 3I6AA 4MJAA 3F0IA 4AJ7A 3UBLA 4EVMA 1J0FA 5H5SA 1Z7PA 2NVLA 2DJJA 3D21A 3D4TA 4YAVA 4LMVA 1FB0A 4ZL8A 2O85A 3RHBA 3FR9A 1R7HA 1GSDA 1G6WA 4JU5A 5A4UA 4AF2A 2C1YA 2PMTA 3MIXA 2R4VA 4NHZA 3TKRA 4ECJA 3HZ8A 5DVBA 2GQKA 3QMXA 5B8AA 3I43A 4E8EA 1N2AA 2X8HA 4ZL7A 3R2QA 5B7CA 3VFIA 5IMDA 1A0FA 2YCDA 3GL3A 3BD2A 1ZYPA 4QL9A 2HRFA 1B48A 1XXUA 4HDEA 3C7MA 2HSMA 5D93A 5DQSA 6GSUA 2CZ3A 1M7TA 3GIXA 4ACSA 1GRXA 2HXKA 2H0HA 2KOKA 4F82A 2WRTA 3RHCA 1AQWA 4ECBA 3HJOA 5D73A 4ID0A 4N0ZA 5IMCA 2LRCA 3BCIA 3GKKA 2C0FA 13GSA 2LNSA 1A23A 1KEBA 4KNDA 5JWOB 2C0DA 4O5RA 3TRPA 5HR0A 2WCIA 3KEBA 2HI7A 4LA1A 5CP1A 3ZVJA 2VCVA 4RI6A 5IO0A 3KMOA 4KDYA 1Y6EA 2YWOA 2PWJA 2P5RA 2QC7A 4L5OA 1Z9HA 2PVQA 4NXIA 1ZCPA 2DJ2A 2DMLA 2I4AA 1XWGA 4K5SA 1XFLA 1Z6MA 1GUHA 1RK4A 3CTFA 1DUGA 1M2AA 1Z7RA 4TW5A 3DEXA 1BYEA 2E0QA 2PBJA 1TXXA 2IMFA 3GKNA 3IOSA 3TOTA 2VM2A 2OE1A 3LORA 1PSQA 4O5QA 3ZREA 1SJZA 1WJKA 4K7IA 2HNLA 4KUNA 1MEKA 5INYA 3DVXA 4CW9A 4YQVA 1HYUA 3PH9A 3APSA 2X49A 3HDCA 4NHWA 2XPDA 5J9CA 3G7YA 1YEPA 1F9MA 3KTLA 1XWCA 3DRNA 4N30A 3M8NA 1M2DA 2V32A 1WIKA 2LJRA 4Z7XA 2D2ZA 3GN3A 3PPUA 18GSA 2H72A 3C71A 1QGVA 1XW5A 3DWVA 1SJ6A 3Q19A 4BVYA 1V57A 1GTAA 1OVNA 1DBYA 1YKAA 3MNGA 2TIRA 3LXTA 4V2LA 4WXTA 4IQ1A 2L57A 3KXOA 5J5NA 4ZBAA 4KDUA 5KN1A 2FA8A 2LV3A 4KGIA 4BA7A 1TK8B 1K3LA 1SKSB 2CAIA 3Q18A 2M80A 4F0CA 5G1KA 2R0GA 3KIJA 2VUPA 4FH8A 2PPTA 3KH9A 4WR4A 1VF2A 3F3QA 4YH2A 2FWEA 4IJIA 1HNCA 1YF0A 1JZWA 3H79A 3BBYA 1PKWA 1ZOFA 2V1MA 3DXBA 1JZOA 4BVXB 4F0BA 1GUKA 3C73A 2LS5A 3GX8A 3IE3A 4CY8A 3U5RE 4LL1B 1V40A 4BPYA 2GSTA 2HRAA 5CRDA 6GSVA 5KN2A 3KJYA 2B7KA 5ECRB 4AGSA 2LUSA 4K8MA 3NZNA 3N9JA 1OC9A 2VD1A 2P31A 1TP9A 3KGKA 4IBPA 1ZYNA 1FO5A 1V98A 1XPVA 2DJ0A 2HZFA 4GLTA 4IVFA 20GSA 2WJUA 3W8SA 4CDOA 3LEFA 1K0CA 4ZL9A 4K7OA 1UVZA 2A2RA 2VLTA 5D9XA 2R6KA 3CSJA 4O7HA 2VL9A 1AIUA 3GHAA 1ZGNA 2C8UA 1U87A 3FK8A 3IK7A 5D96A 3TJJA 4G0IA 1XOAA 3IC4A 1K0AA 1MTCA 3DKSA 3L78A 4EL1A 4KE3A 3GTUA 4POMA 2MMAA 2L4QA 2R3XA 1AAZA 5ECKB 2RUFA 6GSTA 10GSA 4YQUA 2CX3A 3HJMA 4J2FA 5GSTA 3CBUA 1SKWB 2YPMA 3F4TA 2VCXA 4OCEA 3C1SA 4WR5A 2X8CA 4ILFA 2VOCA 1M99A 3QFAC 5J9BA 4O32A 4XRDA 2V6OA 5J3RA 1W4VA 4OFMA 4TR3A 2IWTA 3MAKA 5CRWA 2JZRA 4L0WA 4G2EA 2LQOA 2R5GA 2A2PA 2WB9A 3KH7A 3GYKA 5L71A 4WBRD 5EY6A 5HR3A 2GSQA 1F6MC 5G30A 3E9JB 1SD8A 3VK9A 4O92A 1GTBA 3QDNA 5DAKA 1U88A 2JSZA 2L5LA 2XBQA 3AY8A 2HYXA 1E2YA 4PUAA 3TJBA 2YWNA 5FT3A 2CVDA 3TCOA 4TXVA 1VF4A 1DE1A 2GQMA 3EVIA 3E3EA 3RBTA 2M72A 2HSYA 3P2AA 2JZTA 5IMAA 3ZZXA 1K0MA 3FKFA 2FLSA 4HEA2 5G5EA 1GSFA 3VWVA 7GSSA 3SBCA 4USSA 4JBBA 1WPIA 5IM9A 3ZLPA 2H1DA 2B5YA 1R5AA 2GZPA 2N5FA 4K2DA 5JCGA 3UARA 4K5RA 1O81A 3QFBC 2N5AA 2FA4A 4MABA 4FYCA 1LBKA 1VRSD 3ZL5A 1QK8A 1ACVA 5B6MA 1T00A 4G0KA 1TOFA 2WFCA 1MDJA 5CYYA 3H8QA 2WDUA 3FW2A 2HLSA 3WT2A 2CT6A 2FUG2 3EMPA 2I9HA 1QMVA 1SD9A 3LW9A 1GL8A 4MK3A 4QL7A 5ID2B 3EYTA 2C3QA 2G2QA 5A4WA 4FYUA 2NDOA 2GZZA 4L0UA 4KCAA 1OAZA 4Z2TA 4K0GA 3FZAA 1PN9A 3TKPA 1V2AA 4EE0A 1EEJA 4XHMA 5IOWA 3ZMKA 3P7XA 1WMJA 4MZCA 2GDRA 2H6YA 3HVVA 3F6FA 3I69A 1THXA 5DALA 1M2BA 3L9VA 1C72A 4DEJA 1AXDA 1R4WA 1B4QA 1PN0A 3F3RA 3O3TA 1LJRA 2GLRA 3UBKA 4BL7B 1TU7A 2MBSA 1X0RA 2OBIA 1RW1A 4HS1A 1KNGA 2OKAA 4KAEA 2DBCA 3VPQA 1OE7A 2LEGA 2IMIA 5ABRA 2FD3A 3D6IA 4TR1A 2CV4A 4EUYA 2TRCP 4FQUA 2GVPA 4X0XA 1F3BA 3J7Yk 2G0FA 2GQLA 3UEMA 1EV4A 1MDIA 4KDXA 5HFIA 3D5JA 1BEDA 1TRSA 3GURA 2LTKA 22GSA 3RPNA 2NBSA 4GRFA 3DIEA 2E7PA 4FO5A 12GSA 3VI7A 4OO5A 5IO2A 1JZRA 4BWSA 1EOGA 2RUEA 4RI7A 1SK1A 3HZ4A 4XRAA 3GNJA 4HOJA 1K3YA 3VWUA 5ELGA 4XS4B 1XWBA 2F8AA 1SK0A 5AIVA 3ZFBA 4KW6A 3H93A 1GP1A 3M9JA 3F4SA 2J23A 1BX9A 2OE3A 3W8JA 1XCCA 3QCPA 1M9BA 5GZZB 5GSSA 1B9XC 1GSYA 2NPBA 2HFDA 2NTOA 5F05A 1ERVA 5F07A 3VPTA 1B8XA 5B8BA 2R0PA 1GTIA 5BMUA 3TKSC 1GWCA 3ZMLA 2WZ9A 3HKRA 2H75A 1AW9A 1J08A 4MZBA 4WF4A 4Z2UA 3KP9A 1F37A 4ML6A 4Z2RA 4O5UA 2BMXA 2AJQB 17GSA 5AGYA 1RQMA 2DIYA 4DSQA 2YV7A 3KZQA 1T4ZA 1E6BA 4KF9A 2VLUA 2VAFA 3F8UA 2MMNA 1PD21 2H0IA 3A2VA 3HD5A 2EIQA 2C0GA 2C4JA 5KN3A 4TOPA 5COHA 1HQOA 3GKXA 2FWGA 3MWHA 1TTZA 1YJ6A 2B1LA 2HZEB 4Q5RA 4EF0A 2C80A 2O8VB 1EP8A 4N11A 2P5QA 19GSA 4YKFA 2LJKA 3ZYWA 4HQZA 1ST9A 2PGTA 3FRCA 2BJXA 3TGZA 5FHIA 4MF5A 3NOFA 3ZIJA 4OMVA 2F3MA 5CO3A 1CQGA 1U3AA 4D73B 2V41A 2HSHA 4GXZA 3TJKA 1X9MB 2KUCA 1DSBA 3HY2A 4POLA 4GQCA 2YJ7A 1X9WB 4PURA 5CRHA 2VL3A 2IJYA 4HI7A 4MCUA 2DKHA 2K8SA 4F2IA 2X4AA 5IMFA 1TK0B 2OJLA 4L5LA 3FZ4A 4TXOB 1ZZYA 6GSSA 3FHKA 2VCWA 3OR5A 2IMEA 3CTGA 3GFKA 1AC1A 1NSWA 3IAS2 1GH2A 3IV4A 4ZIJA 3KTBA 5H5RA 1FHEA 5ECIB 3UJ1A 5KN0A 2B7JA 3MYDA 3A2XA 3BJ5A 3IAM2 1S3AA 1EEMA 14GSA 3ED3A 4DVCA 1TK5B 3M0FA 4GSNA 1EGRA 1OC9B 3O76A 2AYTA 4HUAA 4A5PA 4MH2A 3G7JA 2YANA 4MZWA 2YP6A 2HRNA 2K9FA 4EO3A 3TRXA 2I3YA 3UVTA 5GAND 4GQFA 3QAVA 1UA5A 1K0DA 3LFLA 1JLVA 5AN1A 2ON7A 2DJ1A 2KP1A 2YZHA 2H70A 2QA2A 3L0HA 2CX4A 5G2ZA 4I5QA 4MMMA 2VCQA 5A5KA 3UMAA 2IIYA 4WKWA 4TR4A 2LJAA 9GSSA 2IPAA 5E4WA 3HVXA 2H01A 5IOXA 2MMOA 1Q4JA 2DKIA 3CRTA 1FB6A 6GSXA 5IMVA 4GCIA 1GNWA 1LU4A 3O6TA 1O7UA 3WYWA 2OE0A 4IP1A 4PTSA 3FZ5A 3DD3A 2F8FA 2KLXA 3JCML 2JACA 2JSYA 2AHEA 2LRNA 1NW2A 2Z9SA 2K8VA 1GLPA 5AIXA 2GT6A 3LWAA 2C0EA 2QGVA 2H76A 3C1RA 3QPMA 1WRYA 2F51A 3IA1A 5LD0A 2E2MA 4MF7A 1YF1A 1VF1A 2V6KA 1WOUA 1YY7A 4Q5QA 5DAKB 1XW9A 1XWAA 4HJ2A 1GSUA 4MDCA 2JZSA 1O8XA 4DSSA 2VLVA 1R5PA 1PX6A 4HZ4A 2QSIA 4KSMA 3G7IA 5ECSA 3ERWA 1EGOA 1M0UA 3ZVJD 3F4RA 1Z3EA 1TI3A 1ZYEA 1YEXA 4J57E 1SU9A 4YAPA 2ZCTA 2TRXA 1A2LA 1FW1A 2MMZA 3F9UA 3IXRA 4XTSA 1KTEA 1T1VA 2GSRA 2WS2A 1BG5A 5G5FA 2CAQA 4JRRA 1K0NA 2KP2A 1SJIA 4QQ7A 5G31A 1TI1A 1YKCA 3ZITA 1V9WA 1O6JA 2H1BA 2N5BA 4IS0A 3WGXA 2FCHA 5BRTA 1QQ2A 2MBTA 3Q6OA 2AAWA 2EIRA 1TDIA 4JZQA 1MDKA 2H71A 5E59A 4ZILA 2XBIA 1J9BA 3H1NA 3E0UA 1UC7A 4EDZA 4ZB6A 3APQA 3ZIVA 4ULXA 1XIYA 1USBA 1Q98A 3TJFA 2BTOT 4MF6A 5ECNB 4X43A 2LNTA 3TKQA 2A2SA 4RQXA 1PMTA 1PL1A 1I9DA 1XZOA 1JHBA 4GWRA 1MD4A 4N10A 5DJLA 1S3CA 5ECHB 4ECIA 1F2EA 3FMWA 1EP7A 3FZ9A 5ECOB 3F6DA 3HXSA 4V1Ag 4ML1A 2ZUPA 4ZB8A 5JWRB 1B4PA 3TB2A 3A5WA 5DALB 2GT5A 1X5EA 5JCUA 4AJ8A 1BJXA 1PRXA 2REMA 3W6GA 4J56E 1SYRA 6GSYA 4IW9A 3L9UA 3TKSA 4X1UA 1ML6A 1A2MA 4GSSA 2PU9C 4OWYA 5J41A 4I2TA 4N0VA 4ZXGA 1KBNA 1Z6NA 4IGJA 3EPTA 3TDGA 4V2NA 4YQMA 2H1AA 3LGCA 1PKZA 2IMDA 4G0LA 5CRGA 1A0RP 4NAXA 1UN2A 2B6MA 3KP8A 3QD9A 3WT1A 4PUFC 4TR1B 3Q74A 2OA7A 4FIWA 5D9VA 4DSRA 1PA3A 1OC8A 3KM6A 4H86A 2PUKC 3FEUA 4IKHA 3A2WA 1QXHA 1W89A 3P90A 4AJ6A 4PX1A 2WULA 2MZCA 3APOA 2O89A 4K7NA 1YZXA 1EWXA 2WGRA 2MYGA 1OKTA 2IMKA 2CQ9A 1FVKA 3GSTA 2AV4A 3RPPA 4RQRA 3PGTA 2VD0A 4MA9A 5B6NA 4KB3A 4JR6A 4MLYA 1OC3A 2IFQA 4CHSA 1ZMAA 4PGTA 4CY6A 2DJ3A 5LNKe 2JL4A 2RLIA 4K0NA 1VF3A 2DMMA 3IC8A 4K6XA 1X9SB 1N8JA 2VL2C 1XVWA 3EMXA 1B9YC 1DE2A 1U6TA 3D0ZA 2YJHA 4BL7A 1ON4A 4EIQA 2L6CA 1A2JA 1SL1B 5ECLB 1O73A 2DSAA 1SL2B 1PL2A 5AISA 3ERFA 3GA4A 3HCZA 2ON5A 1GNEA 1M9AA 2CZ2A 2HE3A 3UL3A 5JWQB 1WWJA 3LSZA 4TKYA 3GV1A 3HVSA 3EC3A 3IDVA 3S9FA 2B5EA 2YN1A 3VWXA 5C00A 1U3IA 3C8EA 4TRXA 3FR6A 1XVQA 3P8WA 4IHUA 4ZBDA 2GSSA 1XBSA 4EKZA 1ILOA 4GTUA 4I2UA 4XS1A 2XHFA 4PNFA 4XS6A 2UZ8A 3TKSE 2OACA 4JE1A 1H75A 1G7EA 4IP6A 1EOHA 4L8EA 4EXJA 2P0GA 1R26A 1G7OA 3BOAA 4HU7A 5ELAA 5ENUA 2IN3A 1TRWA 5IQYA 2AUVA 3UVHA 3VWWA 4XS4A 2LSTA 4V1Ap 1PX7A 3L4NA 2R0CA 2H0GA 3QOUA 4TN8A 3ZRDA 3ZTLA 2B1KA 3MSZA 4IQAA 3CXGA 4Q5NA 1EZKA 4RUVA 5LCZA 2R2JA 4HU9A 3CSHA 1AUCA 1HNAA 4ZB9A 2PERA 4Q5FA 3SWLA 1EV9A 3DGQA 1QUWA 3CMIA 2A4HA 1SKRB 2FWHA 1Z5YE 1CQHA 4MNNA 5GAPD 1G0TA 1G6YA 3M3MA 2YOIA 3GX0A 3HA9A 4BVYB 2YWIA 5JCWA 2FNOA 2H73A 3CRUA 4YKGA 1AQXA 1TU8A 4KCEA 3ISOA 5D8IA 3TRQA 3GSSA 3TUEA 2H19A 3DVWA 3PR8A 5C04A 2H1GA 5EL8A 2HZEA 3FR3A 1NHYA 3V1WA 5F06A 5DCGA 3VI5A 4PQ1A 1GUMA 2JADA 2C3NA 5DQYA 5ECQB 2X64A 4GSTA 1VGLA 3WGDA 1ERWA 3D22A 2OBKA 3EWLA 4WBJA 2L5OA 2EC4A 2L59A 2I1UA 2HT9A 2I81A 4MJEA 4EC0A 4MH3A 3IBHA 2GGTA 1ERUA 3CYNA 3WGEA 3GH9A 3IHQA 4D73A 4PQIA 5IPHA 2FY6A 2GS3A 5ECMB 1GULA 2F9SA 4F03A 3A3TA 5HR1A 1K0OA 1K3OA 2YWMA 3RAZA 1V58A 4K9ZA 1PQNA 1AQVA 1BAYA 4NPBA 5EPFA 4TR0A 1F3AA 4JR4A 1HD2A 4HJMA 5IPGA 1O85A 1GTUA 2LRTA 1O8WA 2VO4A 1SL0B 4TXOA 4X4JA 1XWKA 2GZYA 4V2MA 2VCZA 3EURA 3DYRA 2CVKA 2H66A 4F9ZA 1X5CA 3ERGA 4KX4A 4I6XA 3GH6A 4BWQA 3GKMA 4EDYA 1T3BA 4ISDA 3L9SA 3GRXA 2C3TA 4HQSA 3KMNA 2ALBA 5EVOA 3N5OA 3GTUB 1JZDA 4EIPA 4NV2A 5KOXA 4P3YB 1FVJA 1SENA 3QAGA 3FY7A 5DDLA 2M46A 2CVBA 3RDWA 2L6DA 4JEDA 4MP4A 4WEYA 1SK2A 2RM6A 3TOUA 2GTUA 4BVXA 4G19A 1MD3A 2QA1A 3CSIA 5DJMA 4DSSB 1H4OA 4ICYA 4OCFA 1GSQA 2H6XA 4IELA 3IPZA 3IR4A 2O87A 5CREA 4FYBA 5HR2A 1S3DA 2LKUA 3EU3A 2X99A 5A4VA 5F8BA 2PVOC 5G1LA 4I97A 4I8BA 1A8YA 1URMA 1T4YA 2VIMA 2H74A 3LYKA 2B5XA 1QFNA 2H8LA 4OO4A 2YV9A 5HQPA 3VLNA 5KOWA 1PGTA 1WP0A 2H30A 2CA8A 3ME7A 4PNGA 1GLQA 2HRKA 4LLRA 3U6VA 3UOMA 1WE0A 5HFGA 4POKA 3M9KA 4OFTA 4MPGA 1TJDA 2XC2A 3ZFLA 1Y25A 3ME8A 2R37A 3MDKA 4IN0A 1FOVA 1ZL9A 1X5DA 1A24A 3G9BA 3GUSA 1NHOA 4MJBA 1FOHA 2AB6A 4MJCA 4K2XA 2FGXA 1JLWA 1GSEA 4HZ2A 4GF0A 4NWYA 3J7Yb 1BQ7A 5D9TA 3VURA 1HNBA 3QR6A 1OE8A 2DJKA 1OKDA 5DCHA 3BCKA 1SYXA 2LQQA 3LJRA 4KH7A 3LG6A 2YZUA 3M1GA 2VL2A 3R3EA 2L4CA 4XIHA 3H4KA 2KHPA 4G9HA 2XPEA 2OADA 1T8EB 2QKEA 5CAXA 2PN8A 3EU4A 2ZNMA 3IHGA 1IYHA 3HJPA 1XOBA 2IL3A 2VM1A 3IK9A 4XCSA 2K6VA 3HHVA 3QAWA 2RM5A 3EE2A 2FWFA 4WETA 5FWGA 1K0BA 3US3A 5CNWA 2VCTA 1A8LA 3K8NA 3I9V2 4LL4B 8GSSA 2X8GA 2JU5A 4WF5A 5J4UA 4ZBBA 2DLXA 3F63A 2RIIA 4POBA 3LYPA 3GL5A 5HFKA 1ERTA 3KD0A 11GSA 2YNXA 4TVEA 3PINA 1TKDB 2DIZA 4G10A 1FG4A 3TJGA 1YQ1A 3NIVA 3IRAA 1T7PB 5D9WA 4OD7A 1NM3A 1GSSA 3D4MA 2E2GA 3LQ7A 16GSA 2J9HA 4NMUA 1TRUA 4K1FA 1I5GA 4LMWA 2A4VA 2IFQB 4PXOA 1FAAA 2V2GA 5IIZA 4PQHA 2B3SA 3EINA 4ECCA 3GMFA 5ECPB 1THOA 1ABAA 2FHEA 6GSWA 4NV5A 2DC5A 3UAPA 1JFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ID2 A;  4KA0 A;  3DML A;  5KEJ A;  4E8H A;  4KSO A;  5F0G A;  5IMZ A;  1XW6 A;  4OFN A;  2EIO A;  2ES7 A;  1ZYQ B;  1IYI A;  2K18 A;  3KCM A;  3UIW A;  4MPF A;  3LXZ A;  2H6Z A;  1OYJ A;  3HYP A;  3WD6 A;  5H5Q A;  3FYG A;  5DBQ A;  2O7K A;  1YDK A;  1TW9 A;  1TRV A;  4IJ3 A;  3I6A A;  4MJA A;  3F0I A;  4AJ7 A;  3UBL A;  4EVM A;  1J0F A;  5H5S A;  1Z7P A;  2NVL A;  2DJJ A;  3D21 A;  3D4T A;  4YAV A;  4LMV A;  1FB0 A;  4ZL8 A;  2O85 A;  3RHB A;  3FR9 A;  1R7H A;  1GSD A;  1G6W A;  4JU5 A;  5A4U A;  4AF2 A;  2C1Y A;  2PMT A;  2R4V A;  4NHZ A;  3TKR A;  4ECJ A;  3HZ8 A;  5DVB A;  2GQK A;  3QMX A;  5B8A A;  3I43 A;  4E8E A;  1N2A A;  2X8H A;  4ZL7 A;  3R2Q A;  5B7C A;  3VFI A;  5IMD A;  1A0F A;  2YCD A;  3GL3 A;  3BD2 A;  4QL9 A;  2HRF A;  1B48 A;  1XXU A;  4HDE A;  3C7M A;  5D93 A;  5DQS A;  6GSU A;  2CZ3 A;  1M7T A;  3GIX A;  4ACS A;  1GRX A;  2HXK A;  2H0H A;  2KOK A;  4F82 A;  2WRT A;  3RHC A;  1AQW A;  4ECB A;  3HJO A;  5D73 A;  4ID0 A;  4N0Z A;  5IMC A;  2LRC A;  3BCI A;  3GKK A;  2C0F A;  13GS A;  2LNS A;  1A23 A;  1KEB A;  4KND A;  5JWO B;  2C0D A;  4O5R A;  3TRP A;  5HR0 A;  2WCI A;  3KEB A;  2HI7 A;  4LA1 A;  5CP1 A;  3ZVJ A;  2VCV A;  4RI6 A;  5IO0 A;  3KMO A;  4KDY A;  1Y6E A;  2YWO A;  2PWJ A;  2P5R A;  2QC7 A;  4L5O A;  1Z9H A;  2PVQ A;  4NXI A;  1ZCP A;  2DJ2 A;  2DML A;  2I4A A;  1XWG A;  1XFL A;  1Z6M A;  1GUH A;  1RK4 A;  3CTF A;  1DUG A;  1M2A A;  1Z7R A;  4TW5 A;  3DEX A;  1BYE A;  2E0Q A;  2PBJ A;  1TXX A;  2IMF A;  3GKN A;  3IOS A;  3TOT A;  2VM2 A;  2OE1 A;  3LOR A;  1PSQ A;  3ZRE A;  1SJZ A;  1WJK A;  4K7I A;  2HNL A;  4KUN A;  1MEK A;  5INY A;  3DVX A;  4CW9 A;  4YQV A;  1HYU A;  3PH9 A;  3APS A;  3HDC A;  4NHW A;  2XPD A;  5J9C A;  3G7Y A;  1YEP A;  1F9M A;  3KTL A;  1XWC A;  3DRN A;  4N30 A;  3M8N A;  1M2D A;  2V32 A;  1WIK A;  2LJR A;  4Z7X A;  2D2Z A;  3GN3 A;  18GS A;  2H72 A;  3C71 A;  1QGV A;  1XW5 A;  3DWV A;  1SJ6 A;  3Q19 A;  4BVY A;  1V57 A;  1GTA A;  1OVN A;  1DBY A;  1YKA A;  3MNG A;  2TIR A;  3LXT A;  4V2L A;  4WXT A;  4IQ1 A;  2L57 A;  3KXO A;  5J5N A;  4ZBA A;  4KDU A;  5KN1 A;  2FA8 A;  2LV3 A;  4KGI A;  4BA7 A;  1TK8 B;  1K3L A;  1SKS B;  2CAI A;  3Q18 A;  2M80 A;  4F0C A;  5G1K A;  3KIJ A;  2VUP A;  4FH8 A;  2PPT A;  3KH9 A;  4WR4 A;  1VF2 A;  3F3Q A;  4YH2 A;  2FWE A;  4IJI A;  1HNC A;  1YF0 A;  1JZW A;  3H79 A;  3BBY A;  1PKW A;  1ZOF A;  2V1M A;  3DXB A;  1JZO A;  4F0B A;  1GUK A;  3C73 A;  2LS5 A;  3GX8 A;  3IE3 A;  3U5R E;  4LL1 B;  1V40 A;  4BPY A;  2GST A;  5CRD A;  6GSV A;  5KN2 A;  3KJY A;  2B7K A;  5ECR B;  4AGS A;  2LUS A;  4K8M A;  3NZN A;  3N9J A;  1OC9 A;  2VD1 A;  2P31 A;  1TP9 A;  3KGK A;  4IBP A;  1FO5 A;  1V98 A;  1XPV A;  2DJ0 A;  2HZF A;  4GLT A;  4IVF A;  20GS A;  2WJU A;  3W8S A;  4CDO A;  3LEF A;  1K0C A;  4ZL9 A;  4K7O A;  1UVZ A;  2A2R A;  2VLT A;  5D9X A;  2R6K A;  3CSJ A;  4O7H A;  2VL9 A;  1AIU A;  3GHA A;  1ZGN A;  2C8U A;  1U87 A;  3FK8 A;  3IK7 A;  5D96 A;  3TJJ A;  1XOA A;  3IC4 A;  1K0A A;  1MTC A;  3DKS A;  3L78 A;  4EL1 A;  4KE3 A;  3GTU A;  4POM A;  2MMA A;  2L4Q A;  2R3X A;  1AAZ A;  5ECK B;  2RUF A;  6GST A;  10GS A;  4YQU A;  2CX3 A;  3HJM A;  4J2F A;  5GST A;  3CBU A;  1SKW B;  2YPM A;  3F4T A;  2VCX A;  4OCE A;  3C1S A;  4WR5 A;  2X8C A;  4ILF A;  2VOC A;  1M99 A;  3QFA C;  5J9B A;  4O32 A;  4XRD A;  2V6O A;  5J3R A;  1W4V A;  4OFM A;  4TR3 A;  2IWT A;  3MAK A;  5CRW A;  2JZR A;  4L0W A;  4G2E A;  2LQO A;  2R5G A;  2WB9 A;  3KH7 A;  3GYK A;  5L71 A;  4WBR D;  5EY6 A;  5HR3 A;  2GSQ A;  1F6M C;  5G30 A;  3E9J B;  1SD8 A;  3VK9 A;  4O92 A;  1GTB A;  3QDN A;  5DAK A;  1U88 A;  2JSZ A;  2L5L A;  2XBQ A;  3AY8 A;  2HYX A;  1E2Y A;  4PUA A;  3TJB A;  2YWN A;  5FT3 A;  2CVD A;  3TCO A;  4TXV A;  1VF4 A;  1DE1 A;  2GQM A;  3EVI A;  3E3E A;  3RBT A;  2M72 A;  2HSY A;  3P2A A;  2JZT A;  5IMA A;  3ZZX A;  1K0M A;  3FKF A;  2FLS A;  4HEA 2;  5G5E A;  1GSF A;  3VWV A;  7GSS A;  3SBC A;  4JBB A;  1WPI A;  5IM9 A;  3ZLP A;  2H1D A;  2B5Y A;  1R5A A;  2GZP A;  2N5F A;  4K2D A;  5JCG A;  3UAR A;  1O81 A;  3QFB C;  2N5A A;  2FA4 A;  4MAB A;  4FYC A;  1LBK A;  1VRS D;  3ZL5 A;  1QK8 A;  1ACV A;  5B6M A;  1T00 A;  1TOF A;  2WFC A;  1MDJ A;  5CYY A;  3H8Q A;  2WDU A;  3FW2 A;  2HLS A;  3WT2 A;  2CT6 A;  2FUG 2;  3EMP A;  2I9H A;  1QMV A;  1SD9 A;  1GL8 A;  4MK3 A;  4QL7 A;  5ID2 B;  3EYT A;  2C3Q A;  2G2Q A;  5A4W A;  4FYU A;  2NDO A;  2GZZ A;  4L0U A;  4KCA A;  1OAZ A;  4K0G A;  3FZA A;  1PN9 A;  3TKP A;  1V2A A;  4EE0 A;  1EEJ A;  4XHM A;  5IOW A;  3ZMK A;  3P7X A;  1WMJ A;  4MZC A;  2GDR A;  2H6Y A;  3HVV A;  3F6F A;  3I69 A;  1THX A;  5DAL A;  1M2B A;  3L9V A;  1C72 A;  4DEJ A;  1AXD A;  1R4W A;  1B4Q A;  3F3R A;  3O3T A;  1LJR A;  2GLR A;  3UBK A;  1TU7 A;  2MBS A;  1X0R A;  2OBI A;  1RW1 A;  4HS1 A;  1KNG A;  2OKA A;  4KAE A;  2DBC A;  3VPQ A;  1OE7 A;  2LEG A;  2IMI A;  5ABR A;  2FD3 A;  3D6I A;  4TR1 A;  2CV4 A;  4EUY A;  2TRC P;  2GVP A;  4X0X A;  1F3B A;  3J7Y k;  2G0F A;  2GQL A;  3UEM A;  1EV4 A;  1MDI A;  4KDX A;  5HFI A;  3D5J A;  1BED A;  1TRS A;  3GUR A;  2LTK A;  22GS A;  3RPN A;  2NBS A;  4GRF A;  3DIE A;  2E7P A;  4FO5 A;  12GS A;  3VI7 A;  4OO5 A;  5IO2 A;  1JZR A;  4BWS A;  1EOG A;  2RUE A;  4RI7 A;  1SK1 A;  3HZ4 A;  4XRA A;  3GNJ A;  4HOJ A;  1K3Y A;  3VWU A;  5ELG A;  4XS4 B;  1XWB A;  2F8A A;  1SK0 A;  5AIV A;  3ZFB A;  4KW6 A;  3H93 A;  1GP1 A;  3M9J A;  3F4S A;  2J23 A;  1BX9 A;  2OE3 A;  3W8J A;  1XCC A;  3QCP A;  1M9B A;  5GZZ B;  5GSS A;  1B9X C;  1GSY A;  2NPB A;  2HFD A;  2NTO A;  5F05 A;  1ERV A;  5F07 A;  3VPT A;  1B8X A;  5B8B A;  1GTI A;  3TKS C;  1GWC A;  3ZML A;  2WZ9 A;  3HKR A;  2H75 A;  1AW9 A;  1J08 A;  4MZB A;  4WF4 A;  3KP9 A;  1F37 A;  4ML6 A;  2BMX A;  2AJQ B;  17GS A;  5AGY A;  1RQM A;  2DIY A;  4DSQ A;  2YV7 A;  3KZQ A;  1T4Z A;  1E6B A;  2VLU A;  2VAF A;  3F8U A;  2MMN A;  1PD2 1;  2H0I A;  3A2V A;  3HD5 A;  2EIQ A;  2C0G A;  2C4J A;  5KN3 A;  4TOP A;  5COH A;  1HQO A;  3GKX A;  2FWG A;  3MWH A;  1TTZ A;  1YJ6 A;  2B1L A;  2HZE B;  4Q5R A;  4EF0 A;  2C80 A;  2O8V B;  1EP8 A;  4N11 A;  2P5Q A;  19GS A;  2LJK A;  3ZYW A;  4HQZ A;  1ST9 A;  2PGT A;  3FRC A;  2BJX A;  3TGZ A;  5FHI A;  4MF5 A;  3NOF A;  3ZIJ A;  4OMV A;  2F3M A;  5CO3 A;  1CQG A;  1U3A A;  4D73 B;  2V41 A;  2HSH A;  4GXZ A;  3TJK A;  1X9M B;  2KUC A;  1DSB A;  3HY2 A;  4POL A;  4GQC A;  2YJ7 A;  1X9W B;  4PUR A;  5CRH A;  2VL3 A;  2IJY A;  4HI7 A;  4MCU A;  2K8S A;  4F2I A;  5IMF A;  1TK0 B;  2OJL A;  4L5L A;  3FZ4 A;  4TXO B;  1ZZY A;  6GSS A;  3FHK A;  2VCW A;  3OR5 A;  2IME A;  3CTG A;  3GFK A;  1AC1 A;  1NSW A;  3IAS 2;  1GH2 A;  3IV4 A;  4ZIJ A;  3KTB A;  5H5R A;  1FHE A;  5ECI B;  3UJ1 A;  5KN0 A;  2B7J A;  3A2X A;  3BJ5 A;  3IAM 2;  1S3A A;  1EEM A;  14GS A;  3ED3 A;  4DVC A;  1TK5 B;  3M0F A;  4GSN A;  1EGR A;  1OC9 B;  3O76 A;  2AYT A;  4HUA A;  4MH2 A;  3G7J A;  2YAN A;  4MZW A;  2YP6 A;  2HRN A;  2K9F A;  4EO3 A;  3TRX A;  2I3Y A;  3UVT A;  5GAN D;  4GQF A;  3QAV A;  1UA5 A;  1K0D A;  3LFL A;  1JLV A;  5AN1 A;  2ON7 A;  2DJ1 A;  2KP1 A;  2YZH A;  2H70 A;  3L0H A;  2CX4 A;  5G2Z A;  4I5Q A;  4MMM A;  2VCQ A;  5A5K A;  3UMA A;  2IIY A;  4WKW A;  4TR4 A;  2LJA A;  9GSS A;  2IPA A;  5E4W A;  3HVX A;  2H01 A;  5IOX A;  2MMO A;  1Q4J A;  3CRT A;  1FB6 A;  6GSX A;  5IMV A;  4GCI A;  1GNW A;  1LU4 A;  3O6T A;  1O7U A;  3WYW A;  2OE0 A;  4IP1 A;  3FZ5 A;  3DD3 A;  2F8F A;  2KLX A;  3JCM L;  2JAC A;  2JSY A;  2AHE A;  2LRN A;  1NW2 A;  2Z9S A;  2K8V A;  1GLP A;  5AIX A;  2GT6 A;  3LWA A;  2C0E A;  2QGV A;  2H76 A;  3C1R A;  3QPM A;  1WRY A;  2F51 A;  3IA1 A;  5LD0 A;  2E2M A;  4MF7 A;  1YF1 A;  1VF1 A;  2V6K A;  1WOU A;  1YY7 A;  4Q5Q A;  5DAK B;  1XW9 A;  1XWA A;  4HJ2 A;  1GSU A;  4MDC A;  2JZS A;  1O8X A;  4DSS A;  2VLV A;  1R5P A;  1PX6 A;  4HZ4 A;  2QSI A;  4KSM A;  3G7I A;  5ECS A;  3ERW A;  1EGO A;  1M0U A;  3ZVJ D;  3F4R A;  1Z3E A;  1TI3 A;  1ZYE A;  1YEX A;  4J57 E;  1SU9 A;  4YAP A;  2ZCT A;  2TRX A;  1A2L A;  1FW1 A;  2MMZ A;  3F9U A;  3IXR A;  4XTS A;  1KTE A;  1T1V A;  2GSR A;  2WS2 A;  1BG5 A;  5G5F A;  2CAQ A;  4JRR A;  1K0N A;  2KP2 A;  1SJI A;  4QQ7 A;  5G31 A;  1TI1 A;  1YKC A;  3ZIT A;  1V9W A;  1O6J A;  2H1B A;  2N5B A;  4IS0 A;  3WGX A;  2FCH A;  1QQ2 A;  2MBT A;  3Q6O A;  2AAW A;  2EIR A;  1TDI A;  4JZQ A;  1MDK A;  2H71 A;  5E59 A;  4ZIL A;  2XBI A;  1J9B A;  3H1N A;  3E0U A;  1UC7 A;  4EDZ A;  4ZB6 A;  3APQ A;  3ZIV A;  4ULX A;  1XIY A;  1USB A;  1Q98 A;  3TJF A;  2BTO T;  4MF6 A;  5ECN B;  4X43 A;  2LNT A;  3TKQ A;  2A2S A;  4RQX A;  1PMT A;  1PL1 A;  1I9D A;  1XZO A;  1JHB A;  4GWR A;  1MD4 A;  4N10 A;  5DJL A;  1S3C A;  5ECH B;  4ECI A;  1F2E A;  1EP7 A;  3FZ9 A;  5ECO B;  3F6D A;  3HXS A;  4V1A g;  4ML1 A;  2ZUP A;  4ZB8 A;  5JWR B;  1B4P A;  3TB2 A;  3A5W A;  5DAL B;  2GT5 A;  1X5E A;  5JCU A;  4AJ8 A;  1BJX A;  1PRX A;  2REM A;  3W6G A;  4J56 E;  1SYR A;  6GSY A;  4IW9 A;  3L9U A;  3TKS A;  4X1U A;  1ML6 A;  1A2M A;  4GSS A;  2PU9 C;  4OWY A;  5J41 A;  4I2T A;  4N0V A;  4ZXG A;  1KBN A;  1Z6N A;  4IGJ A;  3TDG A;  4V2N A;  4YQM A;  2H1A A;  3LGC A;  1PKZ A;  2IMD A;  5CRG A;  1A0R P;  4NAX A;  1UN2 A;  2B6M A;  3KP8 A;  3QD9 A;  3WT1 A;  4PUF C;  4TR1 B;  3Q74 A;  2OA7 A;  4FIW A;  5D9V A;  4DSR A;  1PA3 A;  1OC8 A;  3KM6 A;  4H86 A;  2PUK C;  3FEU A;  4IKH A;  3A2W A;  1QXH A;  1W89 A;  3P90 A;  4AJ6 A;  4PX1 A;  2WUL A;  2MZC A;  3APO A;  2O89 A;  4K7N A;  1YZX A;  1EWX A;  2WGR A;  2MYG A;  1OKT A;  2IMK A;  2CQ9 A;  1FVK A;  3GST A;  2AV4 A;  3RPP A;  4RQR A;  3PGT A;  2VD0 A;  4MA9 A;  5B6N A;  4KB3 A;  4JR6 A;  4MLY A;  1OC3 A;  2IFQ A;  4CHS A;  1ZMA A;  4PGT A;  2DJ3 A;  5LNK e;  2JL4 A;  2RLI A;  4K0N A;  1VF3 A;  2DMM A;  4K6X A;  1X9S B;  1N8J A;  2VL2 C;  1XVW A;  3EMX A;  1B9Y C;  1DE2 A;  1U6T A;  3D0Z A;  2YJH A;  4BL7 A;  1ON4 A;  2L6C A;  1A2J A;  1SL1 B;  5ECL B;  1O73 A;  2DSA A;  1SL2 B;  1PL2 A;  5AIS A;  3ERF A;  3GA4 A;  3HCZ A;  2ON5 A;  1GNE A;  1M9A A;  2CZ2 A;  2HE3 A;  3UL3 A;  5JWQ B;  1WWJ A;  3LSZ A;  4TKY A;  3GV1 A;  3HVS A;  3EC3 A;  3IDV A;  3S9F A;  2B5E A;  2YN1 A;  3VWX A;  5C00 A;  1U3I A;  3C8E A;  4TRX A;  3FR6 A;  1XVQ A;  3P8W A;  4IHU A;  4ZBD A;  2GSS A;  1XBS A;  4EKZ A;  1ILO A;  4GTU A;  4I2U A;  4XS1 A;  2XHF A;  4PNF A;  4XS6 A;  3TKS E;  2OAC A;  4JE1 A;  1H75 A;  1G7E A;  4IP6 A;  1EOH A;  4L8E A;  4EXJ A;  2P0G A;  1R26 A;  1G7O A;  3BOA A;  4HU7 A;  5ELA A;  5ENU A;  2IN3 A;  1TRW A;  5IQY A;  2AUV A;  3UVH A;  3VWW A;  4XS4 A;  2LST A;  4V1A p;  1PX7 A;  3L4N A;  2H0G A;  3QOU A;  4TN8 A;  3ZRD A;  3ZTL A;  2B1K A;  3MSZ A;  4IQA A;  3CXG A;  4Q5N A;  1EZK A;  4RUV A;  5LCZ A;  2R2J A;  4HU9 A;  3CSH A;  1AUC A;  1HNA A;  4ZB9 A;  2PER A;  4Q5F A;  3SWL A;  1EV9 A;  3DGQ A;  1QUW A;  3CMI A;  1SKR B;  2FWH A;  1Z5Y E;  1CQH A;  5GAP D;  1G0T A;  1G6Y A;  3M3M A;  2YOI A;  3GX0 A;  3HA9 A;  2YWI A;  5JCW A;  2FNO A;  2H73 A;  3CRU A;  1AQX A;  1TU8 A;  4KCE A;  3ISO A;  5D8I A;  3TRQ A;  3GSS A;  3TUE A;  2H19 A;  3DVW A;  3PR8 A;  5C04 A;  2H1G A;  5EL8 A;  2HZE A;  3FR3 A;  1NHY A;  3V1W A;  5F06 A;  5DCG A;  3VI5 A;  4PQ1 A;  1GUM A;  2JAD A;  2C3N A;  5DQY A;  5ECQ B;  2X64 A;  4GST A;  1VGL A;  3WGD A;  1ERW A;  3D22 A;  2OBK A;  3EWL A;  4WBJ A;  2L5O A;  2EC4 A;  2L59 A;  2I1U A;  2HT9 A;  2I81 A;  4MJE A;  4EC0 A;  4MH3 A;  3IBH A;  2GGT A;  1ERU A;  3CYN A;  3WGE A;  3GH9 A;  3IHQ A;  4D73 A;  4PQI A;  5IPH A;  2FY6 A;  2GS3 A;  5ECM B;  1GUL A;  2F9S A;  4F03 A;  3A3T A;  5HR1 A;  1K0O A;  1K3O A;  2YWM A;  3RAZ A;  1V58 A;  4K9Z A;  1PQN A;  1AQV A;  1BAY A;  4NPB A;  5EPF A;  4TR0 A;  1F3A A;  4JR4 A;  1HD2 A;  4HJM A;  5IPG A;  1O85 A;  1GTU A;  2LRT A;  1O8W A;  2VO4 A;  1SL0 B;  4TXO A;  1XWK A;  2GZY A;  4V2M A;  2VCZ A;  3EUR A;  3DYR A;  2CVK A;  2H66 A;  4F9Z A;  1X5C A;  3ERG A;  4KX4 A;  4I6X A;  3GH6 A;  4BWQ A;  3GKM A;  4EDY A;  1T3B A;  4ISD A;  3L9S A;  3GRX A;  2C3T A;  4HQS A;  3KMN A;  2ALB A;  5EVO A;  3N5O A;  3GTU B;  1JZD A;  4NV2 A;  4P3Y B;  1FVJ A;  1SEN A;  3QAG A;  3FY7 A;  5DDL A;  2M46 A;  2CVB A;  3RDW A;  2L6D A;  4JED A;  4MP4 A;  4WEY A;  1SK2 A;  2RM6 A;  3TOU A;  2GTU A;  4BVX A;  4G19 A;  1MD3 A;  3CSI A;  5DJM A;  4DSS B;  1H4O A;  4OCF A;  1GSQ A;  2H6X A;  4IEL A;  3IPZ A;  3IR4 A;  2O87 A;  5CRE A;  4FYB A;  5HR2 A;  1S3D A;  2LKU A;  3EU3 A;  2X99 A;  5A4V A;  5F8B A;  2PVO C;  5G1L A;  4I97 A;  4I8B A;  1A8Y A;  1URM A;  1T4Y A;  2VIM A;  2H74 A;  3LYK A;  2B5X A;  1QFN A;  2H8L A;  4OO4 A;  2YV9 A;  5HQP A;  3VLN A;  1PGT A;  1WP0 A;  2H30 A;  2CA8 A;  3ME7 A;  4PNG A;  1GLQ A;  4LLR A;  3U6V A;  3UOM A;  1WE0 A;  5HFG A;  4POK A;  3M9K A;  4OFT A;  4MPG A;  1TJD A;  2XC2 A;  3ZFL A;  1Y25 A;  3ME8 A;  2R37 A;  3MDK A;  4IN0 A;  1FOV A;  1ZL9 A;  1X5D A;  1A24 A;  3G9B A;  3GUS A;  1NHO A;  4MJB A;  2AB6 A;  4MJC A;  2FGX A;  1JLW A;  1GSE A;  4HZ2 A;  4GF0 A;  4NWY A;  3J7Y b;  1BQ7 A;  5D9T A;  3VUR A;  1HNB A;  3QR6 A;  1OE8 A;  2DJK A;  1OKD A;  5DCH A;  3BCK A;  1SYX A;  2LQQ A;  3LJR A;  4KH7 A;  3LG6 A;  2YZU A;  3M1G A;  2VL2 A;  2L4C A;  4XIH A;  3H4K A;  2KHP A;  4G9H A;  2XPE A;  2OAD A;  1T8E B;  2QKE A;  5CAX A;  2PN8 A;  3EU4 A;  2ZNM A;  1IYH A;  3HJP A;  1XOB A;  2IL3 A;  2VM1 A;  3IK9 A;  4XCS A;  2K6V A;  3HHV A;  3QAW A;  2RM5 A;  3EE2 A;  2FWF A;  4WET A;  5FWG A;  1K0B A;  3US3 A;  5CNW A;  2VCT A;  1A8L A;  3K8N A;  3I9V 2;  4LL4 B;  8GSS A;  2X8G A;  2JU5 A;  4WF5 A;  5J4U A;  4ZBB A;  2DLX A;  3F63 A;  2RII A;  4POB A;  3LYP A;  3GL5 A;  5HFK A;  1ERT A;  3KD0 A;  11GS A;  2YNX A;  4TVE A;  3PIN A;  1TKD B;  2DIZ A;  4G10 A;  1FG4 A;  3TJG A;  1YQ1 A;  3NIV A;  3IRA A;  1T7P B;  5D9W A;  4OD7 A;  1NM3 A;  1GSS A;  3D4M A;  2E2G A;  3LQ7 A;  16GS A;  2J9H A;  4NMU A;  1TRU A;  4K1F A;  1I5G A;  4LMW A;  2A4V A;  2IFQ B;  4PXO A;  1FAA A;  2V2G A;  5IIZ A;  4PQH A;  2B3S A;  3EIN A;  4ECC A;  3GMF A;  5ECP B;  1THO A;  1ABA A;  2FHE A;  6GSW A;  4NV5 A;  2DC5 A;  3UAP A;  1JFU A; 
#chains in the Genus database with same CATH topology
 5ID2 A;  4KA0 A;  3DML A;  5KEJ A;  4E8H A;  3CQF A;  4KSO A;  5F0G A;  5IMZ A;  1XW6 A;  4OFN A;  2EIO A;  2ES7 A;  1ZYQ B;  1IYI A;  2K18 A;  3KCM A;  3UIW A;  4MPF A;  3LXZ A;  2H6Z A;  1OYJ A;  3HYP A;  3WD6 A;  5H5Q A;  3FYG A;  5DBQ A;  2O7K A;  1YDK A;  1TW9 A;  1TRV A;  4IJ3 A;  3A5I A;  3I6A A;  4MJA A;  3F0I A;  4AJ7 A;  3UBL A;  4EVM A;  1J0F A;  5H5S A;  1Z7P A;  2NVL A;  2DJJ A;  3D21 A;  3D4T A;  4YAV A;  4LMV A;  1FB0 A;  4ZL8 A;  2O85 A;  3RHB A;  3FR9 A;  1R7H A;  1GSD A;  1G6W A;  4JU5 A;  5A4U A;  4AF2 A;  2C1Y A;  2PMT A;  3MIX A;  2R4V A;  4NHZ A;  3TKR A;  4ECJ A;  3HZ8 A;  5DVB A;  2GQK A;  3QMX A;  5B8A A;  3I43 A;  4E8E A;  1N2A A;  2X8H A;  4ZL7 A;  3R2Q A;  5B7C A;  3VFI A;  5IMD A;  1A0F A;  2YCD A;  3GL3 A;  3BD2 A;  1ZYP A;  4QL9 A;  2HRF A;  1B48 A;  1XXU A;  4HDE A;  3C7M A;  2HSM A;  5D93 A;  5DQS A;  6GSU A;  2CZ3 A;  1M7T A;  3GIX A;  4ACS A;  1GRX A;  2HXK A;  2H0H A;  2KOK A;  4F82 A;  2WRT A;  3RHC A;  1AQW A;  4ECB A;  3HJO A;  5D73 A;  4ID0 A;  4N0Z A;  5IMC A;  2LRC A;  3BCI A;  4BIK A;  3GKK A;  2C0F A;  13GS A;  2LNS A;  1A23 A;  1KEB A;  4KND A;  5JWO B;  2C0D A;  4O5R A;  3TRP A;  5HR0 A;  1M3J A;  2WCI A;  3KEB A;  2HI7 A;  4LA1 A;  5CP1 A;  3ZVJ A;  2VCV A;  4RI6 A;  5IO0 A;  3KMO A;  4KDY A;  1Y6E A;  2YWO A;  2PWJ A;  2P5R A;  2QC7 A;  4L5O A;  1Z9H A;  2PVQ A;  4NXI A;  1ZCP A;  2DJ2 A;  2DML A;  2I4A A;  1XWG A;  4K5S A;  1XFL A;  1Z6M A;  1GUH A;  1RK4 A;  3CTF A;  1DUG A;  1M2A A;  1Z7R A;  4TW5 A;  3DEX A;  1BYE A;  2E0Q A;  2PBJ A;  1TXX A;  2IMF A;  3GKN A;  3IOS A;  3TOT A;  2VM2 A;  2OE1 A;  3LOR A;  1PSQ A;  4O5Q A;  3ZRE A;  1SJZ A;  1WJK A;  4K7I A;  2HNL A;  4KUN A;  1MEK A;  5INY A;  3DVX A;  4CW9 A;  4YQV A;  1HYU A;  3PH9 A;  3APS A;  2X49 A;  3HDC A;  4NHW A;  2XPD A;  5J9C A;  3G7Y A;  1YEP A;  1F9M A;  3KTL A;  1XWC A;  3DRN A;  4N30 A;  3M8N A;  1M2D A;  2V32 A;  1WIK A;  2LJR A;  4Z7X A;  2D2Z A;  3GN3 A;  3PPU A;  18GS A;  2H72 A;  3C71 A;  1QGV A;  1XW5 A;  3DWV A;  1SJ6 A;  3Q19 A;  4BVY A;  1V57 A;  1GTA A;  1OVN A;  1DBY A;  1YKA A;  3MNG A;  2TIR A;  3LXT A;  4V2L A;  4WXT A;  4IQ1 A;  2L57 A;  3KXO A;  5J5N A;  4ZBA A;  4KDU A;  5KN1 A;  2FA8 A;  2LV3 A;  4KGI A;  4BA7 A;  1TK8 B;  1K3L A;  1SKS B;  2CAI A;  3Q18 A;  2M80 A;  4F0C A;  5G1K A;  2R0G A;  3KIJ A;  2VUP A;  4FH8 A;  2PPT A;  3KH9 A;  4WR4 A;  1VF2 A;  3F3Q A;  4YH2 A;  2FWE A;  4IJI A;  1HNC A;  1YF0 A;  1JZW A;  3H79 A;  3BBY A;  1PKW A;  1ZOF A;  2V1M A;  3DXB A;  1JZO A;  4BVX B;  4F0B A;  1GUK A;  3C73 A;  2LS5 A;  3GX8 A;  3IE3 A;  4CY8 A;  3U5R E;  4LL1 B;  1V40 A;  4BPY A;  2GST A;  2HRA A;  5CRD A;  6GSV A;  5KN2 A;  3KJY A;  2B7K A;  5ECR B;  4AGS A;  2LUS A;  4K8M A;  3NZN A;  3N9J A;  1OC9 A;  2VD1 A;  1M3I A;  2P31 A;  1TP9 A;  3KGK A;  4IBP A;  1ZYN A;  1FO5 A;  1V98 A;  1XPV A;  2DJ0 A;  2HZF A;  4GLT A;  4IVF A;  20GS A;  2WJU A;  3W8S A;  4CDO A;  3LEF A;  1K0C A;  4ZL9 A;  4K7O A;  1UVZ A;  2A2R A;  2VLT A;  5D9X A;  2R6K A;  3CSJ A;  4O7H A;  2VL9 A;  1AIU A;  3GHA A;  1ZGN A;  2C8U A;  1U87 A;  3FK8 A;  3IK7 A;  5D96 A;  3TJJ A;  4G0I A;  1XOA A;  3IC4 A;  1K0A A;  1MTC A;  3DKS A;  3L78 A;  4EL1 A;  4KE3 A;  3GTU A;  4POM A;  2MMA A;  2L4Q A;  2R3X A;  1AAZ A;  5ECK B;  2RUF A;  6GST A;  10GS A;  4YQU A;  2CX3 A;  3HJM A;  4J2F A;  5GST A;  3CBU A;  1SKW B;  2YPM A;  3F4T A;  2VCX A;  4OCE A;  3C1S A;  4WR5 A;  2X8C A;  4ILF A;  2VOC A;  1M99 A;  3QFA C;  5J9B A;  4O32 A;  4XRD A;  2V6O A;  5J3R A;  1W4V A;  4OFM A;  4TR3 A;  2IWT A;  3MAK A;  5CRW A;  2JZR A;  4L0W A;  4G2E A;  2LQO A;  2R5G A;  2A2P A;  1S3R A;  2WB9 A;  3KH7 A;  3GYK A;  5L71 A;  4WBR D;  5EY6 A;  5HR3 A;  2GSQ A;  1F6M C;  5G30 A;  3E9J B;  1SD8 A;  3VK9 A;  4O92 A;  1GTB A;  3QDN A;  5DAK A;  1U88 A;  2JSZ A;  2L5L A;  2XBQ A;  3AY8 A;  2HYX A;  1E2Y A;  4PUA A;  3TJB A;  2YWN A;  5FT3 A;  2CVD A;  3TCO A;  4TXV A;  1VF4 A;  1DE1 A;  2GQM A;  3EVI A;  3E3E A;  3RBT A;  2M72 A;  2HSY A;  3P2A A;  2JZT A;  5IMA A;  3ZZX A;  1K0M A;  3FKF A;  2FLS A;  4HEA 2;  5G5E A;  1GSF A;  3VWV A;  7GSS A;  3SBC A;  4USS A;  4JBB A;  1WPI A;  5IM9 A;  3ZLP A;  2H1D A;  2B5Y A;  1R5A A;  2GZP A;  2N5F A;  4K2D A;  5JCG A;  3UAR A;  4K5R A;  1O81 A;  3QFB C;  2N5A A;  2FA4 A;  4MAB A;  4FYC A;  1LBK A;  1VRS D;  3ZL5 A;  1QK8 A;  1ACV A;  5B6M A;  1T00 A;  4G0K A;  1TOF A;  2WFC A;  1MDJ A;  5CYY A;  3H8Q A;  2WDU A;  3FW2 A;  2HLS A;  3WT2 A;  2CT6 A;  2FUG 2;  3EMP A;  2I9H A;  1QMV A;  1SD9 A;  3LW9 A;  1GL8 A;  4MK3 A;  4QL7 A;  5ID2 B;  3EYT A;  2C3Q A;  2G2Q A;  5A4W A;  4FYU A;  2NDO A;  2GZZ A;  4L0U A;  4KCA A;  1OAZ A;  4Z2T A;  4K0G A;  3FZA A;  1PN9 A;  3TKP A;  1V2A A;  4EE0 A;  1EEJ A;  4XHM A;  5IOW A;  3ZMK A;  3P7X A;  1WMJ A;  4MZC A;  2GDR A;  2H6Y A;  1PFO A;  3HVV A;  3F6F A;  3I69 A;  1THX A;  5DAL A;  1M2B A;  3L9V A;  1C72 A;  4DEJ A;  1AXD A;  1R4W A;  1B4Q A;  1PN0 A;  3F3R A;  3O3T A;  1LJR A;  2GLR A;  3UBK A;  4BL7 B;  1TU7 A;  2MBS A;  1X0R A;  2OBI A;  1RW1 A;  4HS1 A;  1KNG A;  2OKA A;  4KAE A;  2DBC A;  3VPQ A;  1OE7 A;  2LEG A;  2IMI A;  5ABR A;  2FD3 A;  3D6I A;  4TR1 A;  2CV4 A;  4EUY A;  2TRC P;  4FQU A;  2GVP A;  4X0X A;  1F3B A;  3J7Y k;  2G0F A;  2GQL A;  3UEM A;  1EV4 A;  1MDI A;  4KDX A;  5HFI A;  3D5J A;  1BED A;  1TRS A;  3GUR A;  2LTK A;  22GS A;  3RPN A;  2NBS A;  4GRF A;  3DIE A;  2E7P A;  4FO5 A;  12GS A;  3VI7 A;  4OO5 A;  5IO2 A;  1JZR A;  4BWS A;  1EOG A;  2RUE A;  4RI7 A;  1SK1 A;  3HZ4 A;  4XRA A;  3GNJ A;  4HOJ A;  1K3Y A;  3VWU A;  5ELG A;  4XS4 B;  1XWB A;  2F8A A;  1SK0 A;  5AIV A;  3ZFB A;  4KW6 A;  3H93 A;  1GP1 A;  3M9J A;  3F4S A;  2J23 A;  1BX9 A;  2OE3 A;  3W8J A;  1XCC A;  3QCP A;  1M9B A;  5GZZ B;  5GSS A;  1B9X C;  1GSY A;  2NPB A;  2HFD A;  2NTO A;  5F05 A;  1ERV A;  5F07 A;  3VPT A;  1B8X A;  5B8B A;  2R0P A;  1GTI A;  5BMU A;  3TKS C;  1GWC A;  3ZML A;  2WZ9 A;  3HKR A;  2H75 A;  1AW9 A;  1J08 A;  4MZB A;  4WF4 A;  4Z2U A;  3KP9 A;  1F37 A;  4ML6 A;  4Z2R A;  4O5U A;  2BMX A;  2AJQ B;  17GS A;  5AGY A;  1RQM A;  2DIY A;  4DSQ A;  2YV7 A;  3KZQ A;  1T4Z A;  1E6B A;  4KF9 A;  2VLU A;  2VAF A;  3F8U A;  2MMN A;  1PD2 1;  2H0I A;  3A2V A;  3HD5 A;  2EIQ A;  2C0G A;  2C4J A;  5KN3 A;  4TOP A;  5COH A;  1HQO A;  3GKX A;  2FWG A;  3MWH A;  1TTZ A;  1YJ6 A;  2B1L A;  2HZE B;  4Q5R A;  4EF0 A;  2C80 A;  2O8V B;  1EP8 A;  4N11 A;  2P5Q A;  19GS A;  4YKF A;  2LJK A;  3ZYW A;  4HQZ A;  1ST9 A;  2PGT A;  3FRC A;  2BJX A;  3TGZ A;  5FHI A;  4MF5 A;  3NOF A;  3ZIJ A;  4OMV A;  2F3M A;  5CO3 A;  1CQG A;  1U3A A;  4D73 B;  2V41 A;  2HSH A;  4GXZ A;  3TJK A;  1X9M B;  2KUC A;  1DSB A;  3HY2 A;  4POL A;  4GQC A;  2YJ7 A;  1X9W B;  4PUR A;  5CRH A;  2VL3 A;  2IJY A;  4HI7 A;  4MCU A;  2DKH A;  2K8S A;  4F2I A;  2X4A A;  5IMF A;  1TK0 B;  2OJL A;  4L5L A;  3FZ4 A;  4TXO B;  1ZZY A;  6GSS A;  3FHK A;  2VCW A;  3OR5 A;  2IME A;  3CTG A;  3GFK A;  1AC1 A;  1NSW A;  3IAS 2;  1GH2 A;  3IV4 A;  4ZIJ A;  3KTB A;  5H5R A;  1FHE A;  5ECI B;  3UJ1 A;  5KN0 A;  2B7J A;  3MYD A;  3A2X A;  3BJ5 A;  3IAM 2;  1S3A A;  1EEM A;  14GS A;  3ED3 A;  4DVC A;  1TK5 B;  3M0F A;  4GSN A;  1EGR A;  1OC9 B;  3O76 A;  2AYT A;  4HUA A;  4A5P A;  4MH2 A;  3G7J A;  2YAN A;  4MZW A;  2YP6 A;  2HRN A;  2K9F A;  4EO3 A;  3TRX A;  2I3Y A;  3UVT A;  5GAN D;  4GQF A;  3QAV A;  1UA5 A;  1K0D A;  3LFL A;  1JLV A;  5AN1 A;  2ON7 A;  2DJ1 A;  2KP1 A;  2YZH A;  2H70 A;  2QA2 A;  3L0H A;  2CX4 A;  5G2Z A;  4I5Q A;  4MMM A;  2VCQ A;  5A5K A;  3UMA A;  2IIY A;  4WKW A;  4TR4 A;  2LJA A;  9GSS A;  2IPA A;  5E4W A;  3HVX A;  2H01 A;  5IOX A;  2MMO A;  1Q4J A;  2DKI A;  3CRT A;  1FB6 A;  6GSX A;  5IMV A;  4GCI A;  1GNW A;  1LU4 A;  3O6T A;  1O7U A;  3WYW A;  2OE0 A;  4IP1 A;  4PTS A;  3FZ5 A;  3DD3 A;  3HVN A;  2F8F A;  2KLX A;  3JCM L;  2JAC A;  2JSY A;  2AHE A;  4HSC X;  2LRN A;  1NW2 A;  2Z9S A;  2K8V A;  1GLP A;  5AIX A;  2GT6 A;  3LWA A;  2C0E A;  2QGV A;  2H76 A;  3C1R A;  3QPM A;  1WRY A;  2F51 A;  3IA1 A;  5LD0 A;  2E2M A;  4MF7 A;  1YF1 A;  1VF1 A;  2V6K A;  1WOU A;  1YY7 A;  4Q5Q A;  5DAK B;  1XW9 A;  1XWA A;  4HJ2 A;  1GSU A;  4MDC A;  2JZS A;  1O8X A;  4DSS A;  2VLV A;  1R5P A;  1PX6 A;  4HZ4 A;  2QSI A;  4KSM A;  3G7I A;  5ECS A;  3ERW A;  1EGO A;  1M0U A;  3ZVJ D;  3F4R A;  1Z3E A;  1TI3 A;  1ZYE A;  1YEX A;  4J57 E;  1SU9 A;  4YAP A;  2ZCT A;  2TRX A;  1A2L A;  1FW1 A;  2MMZ A;  3F9U A;  3IXR A;  4XTS A;  1KTE A;  1T1V A;  2GSR A;  2WS2 A;  1BG5 A;  5G5F A;  2CAQ A;  4JRR A;  1K0N A;  2KP2 A;  1SJI A;  4QQ7 A;  5G31 A;  1TI1 A;  1YKC A;  3ZIT A;  1V9W A;  1O6J A;  2H1B A;  2N5B A;  4IS0 A;  3WGX A;  2FCH A;  5BRT A;  1QQ2 A;  2MBT A;  3Q6O A;  2AAW A;  2EIR A;  1TDI A;  4JZQ A;  1MDK A;  2H71 A;  5E59 A;  4ZIL A;  2XBI A;  1J9B A;  3H1N A;  3E0U A;  1UC7 A;  4EDZ A;  4ZB6 A;  3APQ A;  3ZIV A;  4ULX A;  1XIY A;  1USB A;  1Q98 A;  3TJF A;  2BTO T;  4MF6 A;  5ECN B;  4X43 A;  2LNT A;  3TKQ A;  2A2S A;  4RQX A;  1PMT A;  1PL1 A;  1I9D A;  1XZO A;  1JHB A;  4GWR A;  1MD4 A;  4N10 A;  5DJL A;  1S3C A;  5ECH B;  4ECI A;  1F2E A;  3FMW A;  1EP7 A;  3FZ9 A;  5ECO B;  3F6D A;  3HXS A;  4V1A g;  4ML1 A;  2ZUP A;  4ZB8 A;  5JWR B;  1B4P A;  3TB2 A;  3A5W A;  5DAL B;  2GT5 A;  1X5E A;  5JCU A;  4AJ8 A;  1BJX A;  1PRX A;  2REM A;  3W6G A;  4J56 E;  1SYR A;  6GSY A;  4IW9 A;  3L9U A;  3TKS A;  4X1U A;  1ML6 A;  1A2M A;  4GSS A;  2PU9 C;  4OWY A;  5J41 A;  4I2T A;  4N0V A;  4ZXG A;  1KBN A;  1Z6N A;  4IGJ A;  3EPT A;  3TDG A;  4V2N A;  4YQM A;  2H1A A;  3LGC A;  1PKZ A;  2IMD A;  4G0L A;  5CRG A;  1A0R P;  4NAX A;  1UN2 A;  2B6M A;  3KP8 A;  3QD9 A;  3WT1 A;  4PUF C;  4TR1 B;  3Q74 A;  2OA7 A;  4FIW A;  5D9V A;  4DSR A;  1PA3 A;  1OC8 A;  3KM6 A;  4H86 A;  2PUK C;  3FEU A;  4IKH A;  3A2W A;  1QXH A;  1W89 A;  3P90 A;  4AJ6 A;  4PX1 A;  2WUL A;  2MZC A;  3APO A;  2O89 A;  4K7N A;  1YZX A;  1EWX A;  2WGR A;  2MYG A;  1OKT A;  2IMK A;  2CQ9 A;  1FVK A;  3GST A;  2AV4 A;  3RPP A;  4RQR A;  3PGT A;  2VD0 A;  4MA9 A;  5B6N A;  4KB3 A;  4JR6 A;  4MLY A;  1OC3 A;  2IFQ A;  4CHS A;  1ZMA A;  4PGT A;  4CY6 A;  2DJ3 A;  5LNK e;  2JL4 A;  2RLI A;  4K0N A;  1VF3 A;  2DMM A;  3IC8 A;  4K6X A;  1X9S B;  1N8J A;  2VL2 C;  1XVW A;  3EMX A;  1B9Y C;  1DE2 A;  1U6T A;  3D0Z A;  2YJH A;  4BL7 A;  1ON4 A;  4EIQ A;  2L6C A;  1A2J A;  1SL1 B;  5ECL B;  1O73 A;  2DSA A;  1SL2 B;  1PL2 A;  5AIS A;  3ERF A;  3GA4 A;  3HCZ A;  2ON5 A;  1GNE A;  1M9A A;  2CZ2 A;  2HE3 A;  3UL3 A;  5JWQ B;  1WWJ A;  3LSZ A;  4TKY A;  3GV1 A;  3HVS A;  3EC3 A;  3IDV A;  3S9F A;  2B5E A;  2YN1 A;  3VWX A;  5C00 A;  1U3I A;  3C8E A;  4TRX A;  3FR6 A;  1XVQ A;  3P8W A;  4IHU A;  4ZBD A;  2GSS A;  1XBS A;  4EKZ A;  1ILO A;  4GTU A;  4I2U A;  4XS1 A;  2XHF A;  4PNF A;  4XS6 A;  2UZ8 A;  3TKS E;  2OAC A;  4JE1 A;  1H75 A;  1G7E A;  4IP6 A;  1EOH A;  4L8E A;  4EXJ A;  2P0G A;  1R26 A;  1G7O A;  3BOA A;  4HU7 A;  5ELA A;  5ENU A;  2IN3 A;  1TRW A;  5IQY A;  2AUV A;  3UVH A;  3VWW A;  4XS4 A;  2LST A;  4V1A p;  1PX7 A;  3L4N A;  2R0C A;  2H0G A;  3QOU A;  4TN8 A;  3ZRD A;  3ZTL A;  2B1K A;  3MSZ A;  4IQA A;  3CXG A;  4Q5N A;  1EZK A;  4RUV A;  5LCZ A;  2R2J A;  4HU9 A;  3CSH A;  1AUC A;  1HNA A;  4ZB9 A;  2PER A;  4Q5F A;  3SWL A;  1EV9 A;  3DGQ A;  1QUW A;  3CMI A;  2A4H A;  1SKR B;  2FWH A;  1Z5Y E;  1CQH A;  4MNN A;  5GAP D;  1G0T A;  1G6Y A;  3M3M A;  2YOI A;  3GX0 A;  3HA9 A;  4BVY B;  2YWI A;  5JCW A;  2FNO A;  2H73 A;  3CRU A;  4YKG A;  1AQX A;  1TU8 A;  4KCE A;  3ISO A;  5D8I A;  3TRQ A;  3GSS A;  3TUE A;  2H19 A;  3DVW A;  3PR8 A;  5C04 A;  2H1G A;  5EL8 A;  2HZE A;  3FR3 A;  1NHY A;  3V1W A;  5F06 A;  5DCG A;  3VI5 A;  4PQ1 A;  1GUM A;  2JAD A;  2C3N A;  5DQY A;  5ECQ B;  2X64 A;  4GST A;  1VGL A;  3WGD A;  1ERW A;  3D22 A;  2OBK A;  3EWL A;  4WBJ A;  2L5O A;  2EC4 A;  2L59 A;  2I1U A;  2HT9 A;  2I81 A;  4MJE A;  4EC0 A;  4MH3 A;  3IBH A;  2GGT A;  1ERU A;  3CYN A;  3WGE A;  3GH9 A;  3IHQ A;  4D73 A;  4PQI A;  5IPH A;  2FY6 A;  2GS3 A;  5ECM B;  1GUL A;  2F9S A;  4F03 A;  3A3T A;  5HR1 A;  1K0O A;  1K3O A;  2YWM A;  3RAZ A;  1V58 A;  4K9Z A;  1PQN A;  1AQV A;  1BAY A;  4NPB A;  5EPF A;  4TR0 A;  1F3A A;  4JR4 A;  1HD2 A;  4HJM A;  5IPG A;  1O85 A;  1GTU A;  2LRT A;  1O8W A;  2VO4 A;  1SL0 B;  4TXO A;  4X4J A;  1XWK A;  2GZY A;  4V2M A;  2VCZ A;  3EUR A;  3DYR A;  2CVK A;  2H66 A;  4F9Z A;  1X5C A;  3ERG A;  4KX4 A;  4I6X A;  3GH6 A;  4BWQ A;  3GKM A;  4EDY A;  1T3B A;  4ISD A;  3L9S A;  3GRX A;  2C3T A;  4HQS A;  3KMN A;  2ALB A;  5EVO A;  3N5O A;  3GTU B;  1JZD A;  4EIP A;  4NV2 A;  5KOX A;  4P3Y B;  1FVJ A;  1SEN A;  3QAG A;  3FY7 A;  5DDL A;  2M46 A;  2CVB A;  3RDW A;  2L6D A;  4JED A;  4MP4 A;  4WEY A;  1SK2 A;  2RM6 A;  3TOU A;  2GTU A;  4BVX A;  4G19 A;  1MD3 A;  2QA1 A;  3CSI A;  5DJM A;  4DSS B;  1H4O A;  4ICY A;  4OCF A;  1GSQ A;  2H6X A;  4IEL A;  3IPZ A;  3IR4 A;  2O87 A;  5CRE A;  4FYB A;  5HR2 A;  1S3D A;  2LKU A;  3EU3 A;  2X99 A;  5A4V A;  5F8B A;  2PVO C;  5G1L A;  4I97 A;  4I8B A;  1A8Y A;  1URM A;  1T4Y A;  2VIM A;  2H74 A;  3LYK A;  2B5X A;  1QFN A;  2H8L A;  4OO4 A;  2YV9 A;  5HQP A;  3VLN A;  5KOW A;  1PGT A;  1WP0 A;  2H30 A;  2CA8 A;  3ME7 A;  4PNG A;  1GLQ A;  2HRK A;  4LLR A;  3U6V A;  3UOM A;  1WE0 A;  1XG8 A;  5HFG A;  4POK A;  3M9K A;  4OFT A;  4MPG A;  1TJD A;  2XC2 A;  3ZFL A;  1Y25 A;  3ME8 A;  2R37 A;  3MDK A;  4IN0 A;  1FOV A;  1ZL9 A;  1X5D A;  1A24 A;  3G9B A;  3GUS A;  1NHO A;  4MJB A;  1FOH A;  2AB6 A;  4MJC A;  4K2X A;  2FGX A;  1JLW A;  1GSE A;  4HZ2 A;  4GF0 A;  4NWY A;  3J7Y b;  1BQ7 A;  5D9T A;  3VUR A;  1HNB A;  3QR6 A;  1OE8 A;  2DJK A;  1OKD A;  5DCH A;  3BCK A;  1SYX A;  2LQQ A;  3LJR A;  4KH7 A;  3LG6 A;  2YZU A;  3M1G A;  2VL2 A;  3R3E A;  2L4C A;  4XIH A;  3H4K A;  2KHP A;  4G9H A;  2XPE A;  2OAD A;  1T8E B;  2QKE A;  5CAX A;  2PN8 A;  3EU4 A;  2ZNM A;  3IHG A;  1IYH A;  3HJP A;  1XOB A;  2IL3 A;  2VM1 A;  3IK9 A;  4XCS A;  2K6V A;  3HHV A;  3QAW A;  2RM5 A;  3EE2 A;  2FWF A;  4WET A;  5FWG A;  1K0B A;  3US3 A;  5CNW A;  2VCT A;  1A8L A;  3K8N A;  3I9V 2;  4LL4 B;  8GSS A;  2X8G A;  2JU5 A;  4WF5 A;  5J4U A;  4ZBB A;  2DLX A;  3F63 A;  2RII A;  4POB A;  3LYP A;  3GL5 A;  5HFK A;  1ERT A;  3KD0 A;  11GS A;  2YNX A;  4TVE A;  3PIN A;  1TKD B;  2DIZ A;  4G10 A;  1FG4 A;  3TJG A;  1YQ1 A;  3NIV A;  3IRA A;  1T7P B;  5D9W A;  4OD7 A;  1NM3 A;  1GSS A;  3D4M A;  2E2G A;  3LQ7 A;  16GS A;  2J9H A;  4NMU A;  1TRU A;  4K1F A;  1I5G A;  4LMW A;  2A4V A;  2IFQ B;  4PXO A;  1FAA A;  2V2G A;  5IIZ A;  4PQH A;  2B3S A;  3EIN A;  4ECC A;  3GMF A;  5ECP B;  1THO A;  1ABA A;  2FHE A;  6GSW A;  4NV5 A;  2DC5 A;  3UAP A;  1JFU A; 
#chains in the Genus database with same CATH homology
 5ID2 A;  4KA0 A;  3DML A;  5KEJ A;  4E8H A;  4KSO A;  5F0G A;  5IMZ A;  1XW6 A;  4OFN A;  2EIO A;  2ES7 A;  1ZYQ B;  1IYI A;  2K18 A;  3KCM A;  3UIW A;  4MPF A;  3LXZ A;  2H6Z A;  1OYJ A;  3HYP A;  3WD6 A;  5H5Q A;  3FYG A;  5DBQ A;  2O7K A;  1YDK A;  1TW9 A;  1TRV A;  4IJ3 A;  3A5I A;  3I6A A;  4MJA A;  3F0I A;  4AJ7 A;  3UBL A;  4EVM A;  1J0F A;  5H5S A;  1Z7P A;  2NVL A;  2DJJ A;  3D21 A;  3D4T A;  4YAV A;  4LMV A;  1FB0 A;  4ZL8 A;  2O85 A;  3RHB A;  3FR9 A;  1R7H A;  1GSD A;  1G6W A;  4JU5 A;  5A4U A;  4AF2 A;  2C1Y A;  2PMT A;  3MIX A;  2R4V A;  4NHZ A;  3TKR A;  4ECJ A;  3HZ8 A;  5DVB A;  2GQK A;  3QMX A;  5B8A A;  3I43 A;  4E8E A;  1N2A A;  2X8H A;  4ZL7 A;  3R2Q A;  5B7C A;  3VFI A;  5IMD A;  1A0F A;  2YCD A;  3GL3 A;  3BD2 A;  1ZYP A;  4QL9 A;  2HRF A;  1B48 A;  1XXU A;  4HDE A;  3C7M A;  2HSM A;  5D93 A;  5DQS A;  6GSU A;  2CZ3 A;  1M7T A;  3GIX A;  4ACS A;  1GRX A;  2HXK A;  2H0H A;  2KOK A;  4F82 A;  2WRT A;  3RHC A;  1AQW A;  4ECB A;  3HJO A;  5D73 A;  4ID0 A;  4N0Z A;  5IMC A;  2LRC A;  3BCI A;  3GKK A;  2C0F A;  13GS A;  2LNS A;  1A23 A;  1KEB A;  4KND A;  5JWO B;  2C0D A;  4O5R A;  3TRP A;  5HR0 A;  2WCI A;  3KEB A;  2HI7 A;  4LA1 A;  5CP1 A;  3ZVJ A;  2VCV A;  4RI6 A;  5IO0 A;  3KMO A;  4KDY A;  1Y6E A;  2YWO A;  2PWJ A;  2P5R A;  2QC7 A;  4L5O A;  1Z9H A;  2PVQ A;  4NXI A;  1ZCP A;  2DJ2 A;  2DML A;  2I4A A;  1XWG A;  4K5S A;  1XFL A;  1Z6M A;  1GUH A;  1RK4 A;  3CTF A;  1DUG A;  1M2A A;  1Z7R A;  4TW5 A;  3DEX A;  1BYE A;  2E0Q A;  2PBJ A;  1TXX A;  2IMF A;  3GKN A;  3IOS A;  3TOT A;  2VM2 A;  2OE1 A;  3LOR A;  1PSQ A;  4O5Q A;  3ZRE A;  1SJZ A;  1WJK A;  4K7I A;  2HNL A;  4KUN A;  1MEK A;  5INY A;  3DVX A;  4CW9 A;  4YQV A;  1HYU A;  3PH9 A;  3APS A;  2X49 A;  3HDC A;  4NHW A;  2XPD A;  5J9C A;  3G7Y A;  1YEP A;  1F9M A;  3KTL A;  1XWC A;  3DRN A;  4N30 A;  3M8N A;  1M2D A;  2V32 A;  1WIK A;  2LJR A;  4Z7X A;  2D2Z A;  3GN3 A;  3PPU A;  18GS A;  2H72 A;  3C71 A;  1QGV A;  1XW5 A;  3DWV A;  1SJ6 A;  3Q19 A;  4BVY A;  1V57 A;  1GTA A;  1OVN A;  1DBY A;  1YKA A;  3MNG A;  2TIR A;  3LXT A;  4V2L A;  4WXT A;  4IQ1 A;  2L57 A;  3KXO A;  5J5N A;  4ZBA A;  4KDU A;  5KN1 A;  2FA8 A;  2LV3 A;  4KGI A;  4BA7 A;  1TK8 B;  1K3L A;  1SKS B;  2CAI A;  3Q18 A;  2M80 A;  4F0C A;  5G1K A;  2R0G A;  3KIJ A;  2VUP A;  4FH8 A;  2PPT A;  3KH9 A;  4WR4 A;  1VF2 A;  3F3Q A;  4YH2 A;  2FWE A;  4IJI A;  1HNC A;  1YF0 A;  1JZW A;  3H79 A;  3BBY A;  1PKW A;  1ZOF A;  2V1M A;  3DXB A;  1JZO A;  4BVX B;  4F0B A;  1GUK A;  3C73 A;  2LS5 A;  3GX8 A;  3IE3 A;  4CY8 A;  3U5R E;  4LL1 B;  1V40 A;  4BPY A;  2GST A;  2HRA A;  5CRD A;  6GSV A;  5KN2 A;  3KJY A;  2B7K A;  5ECR B;  4AGS A;  2LUS A;  4K8M A;  3NZN A;  3N9J A;  1OC9 A;  2VD1 A;  2P31 A;  1TP9 A;  3KGK A;  4IBP A;  1ZYN A;  1FO5 A;  1V98 A;  1XPV A;  2DJ0 A;  2HZF A;  4GLT A;  4IVF A;  20GS A;  2WJU A;  3W8S A;  4CDO A;  3LEF A;  1K0C A;  4ZL9 A;  4K7O A;  1UVZ A;  2A2R A;  2VLT A;  5D9X A;  2R6K A;  3CSJ A;  4O7H A;  2VL9 A;  1AIU A;  3GHA A;  1ZGN A;  2C8U A;  1U87 A;  3FK8 A;  3IK7 A;  5D96 A;  3TJJ A;  4G0I A;  1XOA A;  3IC4 A;  1K0A A;  1MTC A;  3DKS A;  3L78 A;  4EL1 A;  4KE3 A;  3GTU A;  4POM A;  2MMA A;  2L4Q A;  2R3X A;  1AAZ A;  5ECK B;  2RUF A;  6GST A;  10GS A;  4YQU A;  2CX3 A;  3HJM A;  4J2F A;  5GST A;  3CBU A;  1SKW B;  2YPM A;  3F4T A;  2VCX A;  4OCE A;  3C1S A;  4WR5 A;  2X8C A;  4ILF A;  2VOC A;  1M99 A;  3QFA C;  5J9B A;  4O32 A;  4XRD A;  2V6O A;  5J3R A;  1W4V A;  4OFM A;  4TR3 A;  2IWT A;  3MAK A;  5CRW A;  2JZR A;  4L0W A;  4G2E A;  2LQO A;  2R5G A;  2A2P A;  2WB9 A;  3KH7 A;  3GYK A;  5L71 A;  4WBR D;  5EY6 A;  5HR3 A;  2GSQ A;  1F6M C;  5G30 A;  3E9J B;  1SD8 A;  3VK9 A;  4O92 A;  1GTB A;  3QDN A;  5DAK A;  1U88 A;  2JSZ A;  2L5L A;  2XBQ A;  3AY8 A;  2HYX A;  1E2Y A;  4PUA A;  3TJB A;  2YWN A;  5FT3 A;  2CVD A;  3TCO A;  4TXV A;  1VF4 A;  1DE1 A;  2GQM A;  3EVI A;  3E3E A;  3RBT A;  2M72 A;  2HSY A;  3P2A A;  2JZT A;  5IMA A;  3ZZX A;  1K0M A;  3FKF A;  2FLS A;  4HEA 2;  5G5E A;  1GSF A;  3VWV A;  7GSS A;  3SBC A;  4USS A;  4JBB A;  1WPI A;  5IM9 A;  3ZLP A;  2H1D A;  2B5Y A;  1R5A A;  2GZP A;  2N5F A;  4K2D A;  5JCG A;  3UAR A;  4K5R A;  1O81 A;  3QFB C;  2N5A A;  2FA4 A;  4MAB A;  4FYC A;  1LBK A;  1VRS D;  3ZL5 A;  1QK8 A;  1ACV A;  5B6M A;  1T00 A;  4G0K A;  1TOF A;  2WFC A;  1MDJ A;  5CYY A;  3H8Q A;  2WDU A;  3FW2 A;  2HLS A;  3WT2 A;  2CT6 A;  2FUG 2;  3EMP A;  2I9H A;  1QMV A;  1SD9 A;  3LW9 A;  1GL8 A;  4MK3 A;  4QL7 A;  5ID2 B;  3EYT A;  2C3Q A;  2G2Q A;  5A4W A;  4FYU A;  2NDO A;  2GZZ A;  4L0U A;  4KCA A;  1OAZ A;  4Z2T A;  4K0G A;  3FZA A;  1PN9 A;  3TKP A;  1V2A A;  4EE0 A;  1EEJ A;  4XHM A;  5IOW A;  3ZMK A;  3P7X A;  1WMJ A;  4MZC A;  2GDR A;  2H6Y A;  3HVV A;  3F6F A;  3I69 A;  1THX A;  5DAL A;  1M2B A;  3L9V A;  1C72 A;  4DEJ A;  1AXD A;  1R4W A;  1B4Q A;  1PN0 A;  3F3R A;  3O3T A;  1LJR A;  2GLR A;  3UBK A;  4BL7 B;  1TU7 A;  2MBS A;  1X0R A;  2OBI A;  1RW1 A;  4HS1 A;  1KNG A;  2OKA A;  4KAE A;  2DBC A;  3VPQ A;  1OE7 A;  2LEG A;  2IMI A;  5ABR A;  2FD3 A;  3D6I A;  4TR1 A;  2CV4 A;  4EUY A;  2TRC P;  4FQU A;  2GVP A;  4X0X A;  1F3B A;  3J7Y k;  2G0F A;  2GQL A;  3UEM A;  1EV4 A;  1MDI A;  4KDX A;  5HFI A;  3D5J A;  1BED A;  1TRS A;  3GUR A;  2LTK A;  22GS A;  3RPN A;  2NBS A;  4GRF A;  3DIE A;  2E7P A;  4FO5 A;  12GS A;  3VI7 A;  4OO5 A;  5IO2 A;  1JZR A;  4BWS A;  1EOG A;  2RUE A;  4RI7 A;  1SK1 A;  3HZ4 A;  4XRA A;  3GNJ A;  4HOJ A;  1K3Y A;  3VWU A;  5ELG A;  4XS4 B;  1XWB A;  2F8A A;  1SK0 A;  5AIV A;  3ZFB A;  4KW6 A;  3H93 A;  1GP1 A;  3M9J A;  3F4S A;  2J23 A;  1BX9 A;  2OE3 A;  3W8J A;  1XCC A;  3QCP A;  1M9B A;  5GZZ B;  5GSS A;  1B9X C;  1GSY A;  2NPB A;  2HFD A;  2NTO A;  5F05 A;  1ERV A;  5F07 A;  3VPT A;  1B8X A;  5B8B A;  2R0P A;  1GTI A;  5BMU A;  3TKS C;  1GWC A;  3ZML A;  2WZ9 A;  3HKR A;  2H75 A;  1AW9 A;  1J08 A;  4MZB A;  4WF4 A;  4Z2U A;  3KP9 A;  1F37 A;  4ML6 A;  4Z2R A;  4O5U A;  2BMX A;  2AJQ B;  17GS A;  5AGY A;  1RQM A;  2DIY A;  4DSQ A;  2YV7 A;  3KZQ A;  1T4Z A;  1E6B A;  4KF9 A;  2VLU A;  2VAF A;  3F8U A;  2MMN A;  1PD2 1;  2H0I A;  3A2V A;  3HD5 A;  2EIQ A;  2C0G A;  2C4J A;  5KN3 A;  4TOP A;  5COH A;  1HQO A;  3GKX A;  2FWG A;  3MWH A;  1TTZ A;  1YJ6 A;  2B1L A;  2HZE B;  4Q5R A;  4EF0 A;  2C80 A;  2O8V B;  1EP8 A;  4N11 A;  2P5Q A;  19GS A;  4YKF A;  2LJK A;  3ZYW A;  4HQZ A;  1ST9 A;  2PGT A;  3FRC A;  2BJX A;  3TGZ A;  5FHI A;  4MF5 A;  3NOF A;  3ZIJ A;  4OMV A;  2F3M A;  5CO3 A;  1CQG A;  1U3A A;  4D73 B;  2V41 A;  2HSH A;  4GXZ A;  3TJK A;  1X9M B;  2KUC A;  1DSB A;  3HY2 A;  4POL A;  4GQC A;  2YJ7 A;  1X9W B;  4PUR A;  5CRH A;  2VL3 A;  2IJY A;  4HI7 A;  4MCU A;  2DKH A;  2K8S A;  4F2I A;  2X4A A;  5IMF A;  1TK0 B;  2OJL A;  4L5L A;  3FZ4 A;  4TXO B;  1ZZY A;  6GSS A;  3FHK A;  2VCW A;  3OR5 A;  2IME A;  3CTG A;  3GFK A;  1AC1 A;  1NSW A;  3IAS 2;  1GH2 A;  3IV4 A;  4ZIJ A;  3KTB A;  5H5R A;  1FHE A;  5ECI B;  3UJ1 A;  5KN0 A;  2B7J A;  3MYD A;  3A2X A;  3BJ5 A;  3IAM 2;  1S3A A;  1EEM A;  14GS A;  3ED3 A;  4DVC A;  1TK5 B;  3M0F A;  4GSN A;  1EGR A;  1OC9 B;  3O76 A;  2AYT A;  4HUA A;  4A5P A;  4MH2 A;  3G7J A;  2YAN A;  4MZW A;  2YP6 A;  2HRN A;  2K9F A;  4EO3 A;  3TRX A;  2I3Y A;  3UVT A;  5GAN D;  4GQF A;  3QAV A;  1UA5 A;  1K0D A;  3LFL A;  1JLV A;  5AN1 A;  2ON7 A;  2DJ1 A;  2KP1 A;  2YZH A;  2H70 A;  2QA2 A;  3L0H A;  2CX4 A;  5G2Z A;  4I5Q A;  4MMM A;  2VCQ A;  5A5K A;  3UMA A;  2IIY A;  4WKW A;  4TR4 A;  2LJA A;  9GSS A;  2IPA A;  5E4W A;  3HVX A;  2H01 A;  5IOX A;  2MMO A;  1Q4J A;  2DKI A;  3CRT A;  1FB6 A;  6GSX A;  5IMV A;  4GCI A;  1GNW A;  1LU4 A;  3O6T A;  1O7U A;  3WYW A;  2OE0 A;  4IP1 A;  4PTS A;  3FZ5 A;  3DD3 A;  2F8F A;  2KLX A;  3JCM L;  2JAC A;  2JSY A;  2AHE A;  2LRN A;  1NW2 A;  2Z9S A;  2K8V A;  1GLP A;  5AIX A;  2GT6 A;  3LWA A;  2C0E A;  2QGV A;  2H76 A;  3C1R A;  3QPM A;  1WRY A;  2F51 A;  3IA1 A;  5LD0 A;  2E2M A;  4MF7 A;  1YF1 A;  1VF1 A;  2V6K A;  1WOU A;  1YY7 A;  4Q5Q A;  5DAK B;  1XW9 A;  1XWA A;  4HJ2 A;  1GSU A;  4MDC A;  2JZS A;  1O8X A;  4DSS A;  2VLV A;  1R5P A;  1PX6 A;  4HZ4 A;  2QSI A;  4KSM A;  3G7I A;  5ECS A;  3ERW A;  1EGO A;  1M0U A;  3ZVJ D;  3F4R A;  1Z3E A;  1TI3 A;  1ZYE A;  1YEX A;  4J57 E;  1SU9 A;  4YAP A;  2ZCT A;  2TRX A;  1A2L A;  1FW1 A;  2MMZ A;  3F9U A;  3IXR A;  4XTS A;  1KTE A;  1T1V A;  2GSR A;  2WS2 A;  1BG5 A;  5G5F A;  2CAQ A;  4JRR A;  1K0N A;  2KP2 A;  1SJI A;  4QQ7 A;  5G31 A;  1TI1 A;  1YKC A;  3ZIT A;  1V9W A;  1O6J A;  2H1B A;  2N5B A;  4IS0 A;  3WGX A;  2FCH A;  5BRT A;  1QQ2 A;  2MBT A;  3Q6O A;  2AAW A;  2EIR A;  1TDI A;  4JZQ A;  1MDK A;  2H71 A;  5E59 A;  4ZIL A;  2XBI A;  1J9B A;  3H1N A;  3E0U A;  1UC7 A;  4EDZ A;  4ZB6 A;  3APQ A;  3ZIV A;  4ULX A;  1XIY A;  1USB A;  1Q98 A;  3TJF A;  2BTO T;  4MF6 A;  5ECN B;  4X43 A;  2LNT A;  3TKQ A;  2A2S A;  4RQX A;  1PMT A;  1PL1 A;  1I9D A;  1XZO A;  1JHB A;  4GWR A;  1MD4 A;  4N10 A;  5DJL A;  1S3C A;  5ECH B;  4ECI A;  1F2E A;  3FMW A;  1EP7 A;  3FZ9 A;  5ECO B;  3F6D A;  3HXS A;  4V1A g;  4ML1 A;  2ZUP A;  4ZB8 A;  5JWR B;  1B4P A;  3TB2 A;  3A5W A;  5DAL B;  2GT5 A;  1X5E A;  5JCU A;  4AJ8 A;  1BJX A;  1PRX A;  2REM A;  3W6G A;  4J56 E;  1SYR A;  6GSY A;  4IW9 A;  3L9U A;  3TKS A;  4X1U A;  1ML6 A;  1A2M A;  4GSS A;  2PU9 C;  4OWY A;  5J41 A;  4I2T A;  4N0V A;  4ZXG A;  1KBN A;  1Z6N A;  4IGJ A;  3EPT A;  3TDG A;  4V2N A;  4YQM A;  2H1A A;  3LGC A;  1PKZ A;  2IMD A;  4G0L A;  5CRG A;  1A0R P;  4NAX A;  1UN2 A;  2B6M A;  3KP8 A;  3QD9 A;  3WT1 A;  4PUF C;  4TR1 B;  3Q74 A;  2OA7 A;  4FIW A;  5D9V A;  4DSR A;  1PA3 A;  1OC8 A;  3KM6 A;  4H86 A;  2PUK C;  3FEU A;  4IKH A;  3A2W A;  1QXH A;  1W89 A;  3P90 A;  4AJ6 A;  4PX1 A;  2WUL A;  2MZC A;  3APO A;  2O89 A;  4K7N A;  1YZX A;  1EWX A;  2WGR A;  2MYG A;  1OKT A;  2IMK A;  2CQ9 A;  1FVK A;  3GST A;  2AV4 A;  3RPP A;  4RQR A;  3PGT A;  2VD0 A;  4MA9 A;  5B6N A;  4KB3 A;  4JR6 A;  4MLY A;  1OC3 A;  2IFQ A;  4CHS A;  1ZMA A;  4PGT A;  4CY6 A;  2DJ3 A;  5LNK e;  2JL4 A;  2RLI A;  4K0N A;  1VF3 A;  2DMM A;  3IC8 A;  4K6X A;  1X9S B;  1N8J A;  2VL2 C;  1XVW A;  3EMX A;  1B9Y C;  1DE2 A;  1U6T A;  3D0Z A;  2YJH A;  4BL7 A;  1ON4 A;  4EIQ A;  2L6C A;  1A2J A;  1SL1 B;  5ECL B;  1O73 A;  2DSA A;  1SL2 B;  1PL2 A;  5AIS A;  3ERF A;  3GA4 A;  3HCZ A;  2ON5 A;  1GNE A;  1M9A A;  2CZ2 A;  2HE3 A;  3UL3 A;  5JWQ B;  1WWJ A;  3LSZ A;  4TKY A;  3GV1 A;  3HVS A;  3EC3 A;  3IDV A;  3S9F A;  2B5E A;  2YN1 A;  3VWX A;  5C00 A;  1U3I A;  3C8E A;  4TRX A;  3FR6 A;  1XVQ A;  3P8W A;  4IHU A;  4ZBD A;  2GSS A;  1XBS A;  4EKZ A;  1ILO A;  4GTU A;  4I2U A;  4XS1 A;  2XHF A;  4PNF A;  4XS6 A;  2UZ8 A;  3TKS E;  2OAC A;  4JE1 A;  1H75 A;  1G7E A;  4IP6 A;  1EOH A;  4L8E A;  4EXJ A;  2P0G A;  1R26 A;  1G7O A;  3BOA A;  4HU7 A;  5ELA A;  5ENU A;  2IN3 A;  1TRW A;  5IQY A;  2AUV A;  3UVH A;  3VWW A;  4XS4 A;  2LST A;  4V1A p;  1PX7 A;  3L4N A;  2R0C A;  2H0G A;  3QOU A;  4TN8 A;  3ZRD A;  3ZTL A;  2B1K A;  3MSZ A;  4IQA A;  3CXG A;  4Q5N A;  1EZK A;  4RUV A;  5LCZ A;  2R2J A;  4HU9 A;  3CSH A;  1AUC A;  1HNA A;  4ZB9 A;  2PER A;  4Q5F A;  3SWL A;  1EV9 A;  3DGQ A;  1QUW A;  3CMI A;  2A4H A;  1SKR B;  2FWH A;  1Z5Y E;  1CQH A;  4MNN A;  5GAP D;  1G0T A;  1G6Y A;  3M3M A;  2YOI A;  3GX0 A;  3HA9 A;  4BVY B;  2YWI A;  5JCW A;  2FNO A;  2H73 A;  3CRU A;  4YKG A;  1AQX A;  1TU8 A;  4KCE A;  3ISO A;  5D8I A;  3TRQ A;  3GSS A;  3TUE A;  2H19 A;  3DVW A;  3PR8 A;  5C04 A;  2H1G A;  5EL8 A;  2HZE A;  3FR3 A;  1NHY A;  3V1W A;  5F06 A;  5DCG A;  3VI5 A;  4PQ1 A;  1GUM A;  2JAD A;  2C3N A;  5DQY A;  5ECQ B;  2X64 A;  4GST A;  1VGL A;  3WGD A;  1ERW A;  3D22 A;  2OBK A;  3EWL A;  4WBJ A;  2L5O A;  2EC4 A;  2L59 A;  2I1U A;  2HT9 A;  2I81 A;  4MJE A;  4EC0 A;  4MH3 A;  3IBH A;  2GGT A;  1ERU A;  3CYN A;  3WGE A;  3GH9 A;  3IHQ A;  4D73 A;  4PQI A;  5IPH A;  2FY6 A;  2GS3 A;  5ECM B;  1GUL A;  2F9S A;  4F03 A;  3A3T A;  5HR1 A;  1K0O A;  1K3O A;  2YWM A;  3RAZ A;  1V58 A;  4K9Z A;  1PQN A;  1AQV A;  1BAY A;  4NPB A;  5EPF A;  4TR0 A;  1F3A A;  4JR4 A;  1HD2 A;  4HJM A;  5IPG A;  1O85 A;  1GTU A;  2LRT A;  1O8W A;  2VO4 A;  1SL0 B;  4TXO A;  4X4J A;  1XWK A;  2GZY A;  4V2M A;  2VCZ A;  3EUR A;  3DYR A;  2CVK A;  2H66 A;  4F9Z A;  1X5C A;  3ERG A;  4KX4 A;  4I6X A;  3GH6 A;  4BWQ A;  3GKM A;  4EDY A;  1T3B A;  4ISD A;  3L9S A;  3GRX A;  2C3T A;  4HQS A;  3KMN A;  2ALB A;  5EVO A;  3N5O A;  3GTU B;  1JZD A;  4EIP A;  4NV2 A;  5KOX A;  4P3Y B;  1FVJ A;  1SEN A;  3QAG A;  3FY7 A;  5DDL A;  2M46 A;  2CVB A;  3RDW A;  2L6D A;  4JED A;  4MP4 A;  4WEY A;  1SK2 A;  2RM6 A;  3TOU A;  2GTU A;  4BVX A;  4G19 A;  1MD3 A;  2QA1 A;  3CSI A;  5DJM A;  4DSS B;  1H4O A;  4ICY A;  4OCF A;  1GSQ A;  2H6X A;  4IEL A;  3IPZ A;  3IR4 A;  2O87 A;  5CRE A;  4FYB A;  5HR2 A;  1S3D A;  2LKU A;  3EU3 A;  2X99 A;  5A4V A;  5F8B A;  2PVO C;  5G1L A;  4I97 A;  4I8B A;  1A8Y A;  1URM A;  1T4Y A;  2VIM A;  2H74 A;  3LYK A;  2B5X A;  1QFN A;  2H8L A;  4OO4 A;  2YV9 A;  5HQP A;  3VLN A;  5KOW A;  1PGT A;  1WP0 A;  2H30 A;  2CA8 A;  3ME7 A;  4PNG A;  1GLQ A;  2HRK A;  4LLR A;  3U6V A;  3UOM A;  1WE0 A;  5HFG A;  4POK A;  3M9K A;  4OFT A;  4MPG A;  1TJD A;  2XC2 A;  3ZFL A;  1Y25 A;  3ME8 A;  2R37 A;  3MDK A;  4IN0 A;  1FOV A;  1ZL9 A;  1X5D A;  1A24 A;  3G9B A;  3GUS A;  1NHO A;  4MJB A;  1FOH A;  2AB6 A;  4MJC A;  4K2X A;  2FGX A;  1JLW A;  1GSE A;  4HZ2 A;  4GF0 A;  4NWY A;  3J7Y b;  1BQ7 A;  5D9T A;  3VUR A;  1HNB A;  3QR6 A;  1OE8 A;  2DJK A;  1OKD A;  5DCH A;  3BCK A;  1SYX A;  2LQQ A;  3LJR A;  4KH7 A;  3LG6 A;  2YZU A;  3M1G A;  2VL2 A;  3R3E A;  2L4C A;  4XIH A;  3H4K A;  2KHP A;  4G9H A;  2XPE A;  2OAD A;  1T8E B;  2QKE A;  5CAX A;  2PN8 A;  3EU4 A;  2ZNM A;  3IHG A;  1IYH A;  3HJP A;  1XOB A;  2IL3 A;  2VM1 A;  3IK9 A;  4XCS A;  2K6V A;  3HHV A;  3QAW A;  2RM5 A;  3EE2 A;  2FWF A;  4WET A;  5FWG A;  1K0B A;  3US3 A;  5CNW A;  2VCT A;  1A8L A;  3K8N A;  3I9V 2;  4LL4 B;  8GSS A;  2X8G A;  2JU5 A;  4WF5 A;  5J4U A;  4ZBB A;  2DLX A;  3F63 A;  2RII A;  4POB A;  3LYP A;  3GL5 A;  5HFK A;  1ERT A;  3KD0 A;  11GS A;  2YNX A;  4TVE A;  3PIN A;  1TKD B;  2DIZ A;  4G10 A;  1FG4 A;  3TJG A;  1YQ1 A;  3NIV A;  3IRA A;  1T7P B;  5D9W A;  4OD7 A;  1NM3 A;  1GSS A;  3D4M A;  2E2G A;  3LQ7 A;  16GS A;  2J9H A;  4NMU A;  1TRU A;  4K1F A;  1I5G A;  4LMW A;  2A4V A;  2IFQ B;  4PXO A;  1FAA A;  2V2G A;  5IIZ A;  4PQH A;  2B3S A;  3EIN A;  4ECC A;  3GMF A;  5ECP B;  1THO A;  1ABA A;  2FHE A;  6GSW A;  4NV5 A;  2DC5 A;  3UAP A;  1JFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...