2E2MA

Crystal structure of archaeal peroxiredoxin, thioredoxin peroxidase from aeropyrum pernix k1 (sulfinic acid form)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
240
structure length
235
Chain Sequence
SIPLIGERFPEMEVTTDHGVIKLPDHYVSQGKWFVLFSHPADFTPVTTEFVSFARRYEDFQRLGVDLIGLSVDSVFSHIKWKEWIERHIGVRIPFPIIADPQGTVARRLGLLATHTVRGVFIVDARGVIRTMLYYPMELGRLVDEILRIVKALKLGDSLKRAVPADWPNNEIIGEGLIVPPPTTEDQARARMESGQYRSLDWWFCWDTPASRDDVEEARRYLRRAAEKPAKLLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Probable peroxiredoxin
publication title Oxidation of archaeal peroxiredoxin involves a hypervalent sulfur intermediate
pubmed doi rcsb
source organism Aeropyrum pernix
total genus 71
structure length 235
sequence length 240
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1020.20 Alpha Beta 2-Layer Sandwich Antioxidant, Horf6; Chain A, domain 2 Antioxidant, Horf6; Chain A, domain 2 2e2mA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2e2mA01
3FRCA 2KHPA 4BPYA 8GSSA 2H01A 3SBCA 2P31A 4HDEA 3VWXA 3EINA 2O85A 4L8EA 2IFQA 3FZ5A 4O32A 5JWQB 3DMLA 3PINA 5DAKA 3Q19A 4N0ZA 2R3XA 2XBQA 4RI7A 2FCHA 2YWNA 4BVYA 4DSSA 5GSSA 2C8UA 2BJXA 1ZCPA 3Q74A 4DSQA 4IBPA 1OVNA 1TI1A 2B1LA 3V1WA 3DVXA 4F0CA 2B5YA 1K0BA 4IP1A 1B48A 3I43A 2LS5A 4XS4B 3P7XA 4KUNA 3F4RA 1J08A 3HZ8A 5ECKB 2EIRA 4CHSA 4Q5QA 2VAFA 4TR0A 1BG5A 1WRYA 1ABAA 1YF1A 5B7CA 2EIQA 4GXZA 4EVMA 1AXDA 2C4JA 3D6IA 1ERTA 2LUSA 5ECPB 1TRVA 4NHWA 3RBTA 5D8IA 4TN8A 2OBKA 1NW2A 3VFIA 2F51A 1A24A 1SD9A 4IS0A 2F3MA 1B9YC 6GSTA 2OE0A 3IE3A 1JLVA 4GTUA 4ECCA 3EURA 5ID2B 3ZITA 3KM6A 5G5EA 4MLYA 4E8EA 2HSYA 4KDXA 1X5EA 1FW1A 3TGZA 5F0GA 3K8NA 2L5LA 2PGTA 5G1LA 3ZVJD 2H73A 2OACA 4POBA 4RQXA 19GSA 3UOMA 4WF5A 2R5GA 1MDKA 1C72A 5ECSA 1SK2A 1HD2A 4ISDA 1PX6A 1K0MA 5EY6A 2H6XA 2KUCA 4NPBA 2H8LA 3TKSC 13GSA 2FNOA 3P8WA 3QDNA 3F6FA 2DIZA 2RM6A 3C71A 1GH2A 2YOIA 5IMZA 1ON4A 4K8MA 1PA3A 2VCZA 2IMIA 17GSA 1YDKA 3CYNA 5ECHB 5JCWA 2K6VA 1R26A 1FO5A 2JL4A 4MPGA 2R2JA 2A2SA 2GT6A 1ZOFA 2G0FA 4IELA 2KOKA 2IPAA 1K0DA 2RM5A 3HA9A 2L4CA 5D9WA 2CV4A 3EU4A 3TKRA 1GP1A 4OCEA 1SL1B 2OADA 1UVZA 2GLRA 1VF1A 1A0FA 4AJ8A 1B8XA 3D22A 2P5QA 2GVPA 2C0DA 1O8XA 1FVJA 4X43A 1SK0A 4KCAA 4XS4A 4PQ1A 4JRRA 3KIJA 2IL3A 2VOCA 4GCIA 3EWLA 2YP6A 2MBSA 5KN2A 4ACSA 4D73A 1B9XC 3U5RE 2REMA 3QOUA 2AJQB 1PSQA 3P90A 5DJLA 4PQHA 3KTLA 4HEA2 1Z6MA 1G6WA 3QAGA 4K1FA 1QK8A 2VL2A 3UAPA 1B4QA 5DDLA 2GSTA 3H4KA 3ME8A 2HYXA 1MDJA 2I81A 5C04A 3M9JA 4Q5FA 3QPMA 4ECIA 3HVVA 2K8VA 2C0EA 5ECOB 2LRNA 3OR5A 1FOVA 2B3SA 1YZXA 1EOGA 4K7NA 3GN3A 3EU3A 3TJKA 1FG4A 2PWJA 5IIZA 3GKNA 5CREA 1BEDA 5ID2A 1TTZA 4MF7A 2H74A 2B7KA 3CSJA 1AW9A 2HE3A 3VPTA 2LNTA 1PN9A 3HZ4A 2VL3A 9GSSA 4OCFA 3IDVA 1XWCA 1U88A 4ZIJA 2IJYA 5D9VA 4XRAA 1MTCA 2ZUPA 5DCGA 1UN2A 1GUHA 7GSSA 1PGTA 4MK3A 4K6XA 3GSTA 2LJKA 2PN8A 4G2EA 1BJXA 1GTBA 3S9FA 1AC1A 2H6YA 1GUKA 2ZCTA 4MP4A 2FWHA 4NXIA 3FR3A 3FR6A 2PU9C 3F8UA 3F6DA 1TDIA 4WETA 2DIYA 2MMOA 1ERUA 3NZNA 5ECRB 1GSSA 4CW9A 1GNWA 2YPMA 3TB2A 5GSTA 4GLTA 2C3QA 4MH2A 1EEMA 1ZGNA 1XWKA 5HR1A 3UMAA 1ACVA 3H79A 4KW6A 2VIMA 4NWYA 4K0NA 1XBSA 4J2FA 4V2LA 3LJRA 1SYXA 1A23A 1A2LA 3UL3A 2L6DA 2J23A 3ZMKA 1HYUA 1T7PB 1E2YA 4GRFA 3W8JA 3CMIA 4ECJA 1F37A 1GRXA 2YNXA 1SD8A 4OWYA 1GSYA 3L4NA 4ZXGA 1RW1A 3KH9A 5IO0A 4KCEA 3N9JA 3LXTA 1XWBA 3WYWA 1DE1A 5AIXA 4TOPA 3IA1A 2YV9A 2IMDA 2M80A 2MBTA 2GTUA 2WGRA 3ZLPA 22GSA 3A3TA 1YEXA 5E4WA 3TJGA 3BBYA 5IO2A 5HFGA 3IPZA 3TJFA 3LSZA 4DEJA 2MMZA 1PL1A 2LRTA 1GLPA 5IM9A 1VGLA 4L0UA 3DRNA 2KP1A 1OC3A 2HLSA 3ZRDA 2X8HA 2P5RA 3VWUA 2XC2A 4ZB6A 4G10A 4TVEA 2CVKA 1GULA 1GNEA 3EYTA 3TJBA 1GSDA 2GQKA 3DIEA 2YV7A 3CBUA 3TKSA 3ZTLA 5J9BA 4TRXA 4J56E 5G5FA 4FH8A 3DKSA 3MDKA 2WZ9A 3FW2A 4WBRD 3NIVA 3IHQA 6GSYA 1ZYEA 1K3YA 3APQA 3KP9A 3WGDA 4X1UA 1PKWA 2TRXA 1TRSA 2L4QA 2AUVA 3HJOA 2H0IA 4H86A 3ZMLA 1V40A 2HI7A 2VL2C 3TKSE 5CRWA 4NHZA 1XPVA 1WE0A 2E7PA 3FZAA 3O76A 2VLVA 4POLA 3J7Yk 2PVOC 3H8QA 4DVCA 1U6TA 2G2QA 2H1DA 4PURA 3VURA 4KB3A 1SENA 2IWTA 4DSRA 5COHA 1EOHA 3VK9A 4HJ2A 2O87A 5IMCA 4KNDA 2V41A 2Z9SA 1URMA 3BD2A 3KZQA 4HOJA 2H30A 2X64A 5HFKA 1RQMA 3KTBA 3E0UA 3FZ4A 2JACA 3TKQA 1T3BA 2GT5A 2CVDA 3GKMA 1TRUA 4MABA 4RQRA 1LU4A 4JE1A 4JEDA 3DD3A 1HNCA 3NOFA 3KJYA 4JZQA 5B6MA 1BQ7A 4IHUA 2FHEA 1G7OA 4I5QA 2RUFA 3LQ7A 2L59A 2LJRA 5FT3A 1GWCA 1U3AA 3F9UA 2CT6A 1WWJA 1K0OA 3ZREA 1ERVA 1Z6NA 3ZZXA 1SKRB 1SK1A 2GDRA 5ECQB 2CAQA 4MF5A 5JWOB 1WP0A 4LLRA 5B8BA 3GL5A 4KA0A 3HJPA 1OKDA 1X9SB 1U87A 1GTIA 2LV3A 5A5KA 1MD3A 2DMLA 3F3QA 1TU7A 3QFAC 3APOA 4D73B 3QR6A 2N5BA 5LNKe 3L78A 1K3LA 2E0QA 3CSIA 2KP2A 2CZ2A 3C1SA 1M2DA 3WGXA 3TKPA 4N10A 1O7UA 1OKTA 2B1KA 2AYTA 1QMVA 4HQSA 5CYYA 3RAZA 2DJ0A 2OBIA 4IVFA 2M72A 5ELAA 2EC4A 4I8BA 4KH7A 4KE3A 2X99A 4K2DA 3VWWA 5CRHA 1M9BA 2DJJA 5DBQA 3FK8A 4BWSA 6GSUA 3F4SA 3EVIA 4AGSA 2YWOA 4HUAA 3EE2A 3LEFA 4HZ2A 2FA8A 5IMVA 20GSA 4PGTA 4TKYA 4NV5A 3HVXA 3A5WA 2GSQA 2GGTA 4EDZA 4RUVA 4TXOB 1WPIA 2MZCA 3C1RA 1QXHA 3UIWA 3M0FA 1TOFA 2WRTA 3H1NA 3GL3A 2XPEA 3VLNA 1O73A 1J0FA 4WBJA 4L5OA 2B7JA 5JWRB 5ECIB 2VD1A 5IPHA 2NBSA 3I9V2 4EO3A 1E6BA 2C1YA 2FGXA 2DSAA 2ON5A 4PNGA 4Z7XA 3GX0A 2H1BA 3JCML 3LG6A 1M2AA 1QUWA 3IBHA 4KSMA 2YANA 1R5AA 1TU8A 1GSFA 3GA4A 10GSA 1I5GA 1LBKA 4XTSA 2YCDA 2NDOA 2A4VA 2H71A 2O89A 4ILFA 3F4TA 3ERGA 6GSVA 2WCIA 1XOAA 1RK4A 2I4AA 2DLXA 3US3A 4Q5RA 5FWGA 2GQMA 4MJEA 1KBNA 4MZCA 4EC0A 3HD5A 2H76A 1F6MC 5CP1A 3KMOA 3UEMA 2OJLA 2WJUA 3DWVA 4Q5NA 5C00A 3VWVA 1FHEA 5AN1A 12GSA 1EV9A 5H5QA 1XXUA 1V58A 1CQGA 3WD6A 1YJ6A 3GIXA 4QQ7A 1TK5B 1BAYA 4IJIA 4JR4A 1V57A 4WR4A 3GTUA 4FYCA 3M3MA 3BCKA 5IMAA 3TRQA 4F9ZA 3EC3A 5D93A 1LJRA 1G6YA 4ULXA 2H0HA 5GAND 1Z5YE 4F03A 1OE7A 1XWGA 3LORA 1JLWA 4NMUA 2TIRA 5D96A 3Q6OA 5D9XA 4EUYA 2IIYA 4G19A 2V1MA 4N0VA 1ML6A 3A2XA 5J4UA 4TXOA 1KNGA 3F63A 2R6KA 1U3IA 3IK9A 4KGIA 1AAZA 4I2UA 1EP8A 2VCVA 4ZB9A 5CRGA 2RUEA 3FHKA 4TR1B 1X9MB 1F3BA 1PQNA 5AIVA 5FHIA 3D4TA 2VCXA 1XIYA 3IOSA 2KLXA 1Y6EA 4YAVA 1XOBA 4ZILA 2VLTA 3HKRA 3CSHA 4POMA 2QC7A 1G7EA 4WEYA 2CX3A 2H19A 1YY7A 2F8AA 3H93A 3C8EA 1SJ6A 2HFDA 4V2NA 1CQHA 5J5NA 5J9CA 4YQMA 3LYKA 1K0AA 4XHMA 2VCQA 14GSA 2VD0A 3UBLA 1W89A 3MNGA 3RHBA 2FWGA 3PGTA 4FYBA 3KCMA 3FR9A 1K0CA 3HVSA 2WULA 4BVXA 4LL1B 1VF3A 3RHCA 2CX4A 5CAXA 4BWQA 4AJ7A 5ELGA 3GRXA 5KN3A 1SJZA 4G9HA 2R4VA 4ML6A 4WF4A 2X8GA 2FA4A 3BOAA 4MJBA 3HY2A 1A0RP 4IN0A 1Q98A 2JZSA 5HR2A 2ALBA 1SU9A 4I6XA 1NHOA 1J9BA 2DJ3A 4BL7A 1TW9A 2LSTA 4EF0A 1EGRA 5IMFA 2GS3A 1T00A 6GSSA 4XRDA 1TK0B 5H5RA 3ED3A 5A4VA 1W4VA 5IMDA 2OE3A 4WKWA 4AJ6A 1DE2A 3GHAA 1TI3A 1AQVA 2GQLA 3QCPA 2D2ZA 1QFNA 3MSZA 4TR3A 1B4PA 1ZYQB 1O8WA 4I97A 1XW9A 3HXSA 5DALA 3ZIJA 2DMMA 2DJKA 2WDUA 3LYPA 3WT1A 4RI6A 3FYGA 3GSSA 2GZPA 4KDYA 4PUAA 1M9AA 1F2EA 2LNSA 5B8AA 3P2AA 1EV4A 3TJJA 4O92A 2XBIA 2MMAA 2DC5A 2VL9A 4OMVA 3IAS2 2FLSA 2MMNA 2YJHA 3IC4A 2YN1A 2HT9A 4LMVA 4TR1A 3GH9A 3KXOA 2PUKC 3VI5A 5KN0A 3IV4A 16GSA 4MJCA 2HZEB 4X0XA 5A4WA 1WMJA 3RPNA 4HI7A 3IR4A 4IQAA 3ZFBA 1SL2B 1NM3A 3QMXA 1KEBA 1YKCA 2JADA 2JU5A 3UJ1A 2LKUA 1OC8A 4OFTA 1GTAA 2HXKA 4TXVA 3KD0A 1EEJA 3QAVA 2GZZA 2YZUA 2DBCA 4MCUA 4KX4A 2VCWA 1HNAA 1PX7A 3AY8A 3E3EA 3IAM2 3TOUA 2HNLA 1Z7PA 2P0GA 2YZHA 4ZBDA 2NPBA 3DEXA 5ECMB 3GX8A 2YWIA 1DUGA 3TCOA 1TP9A 2H6ZA 1I9DA 4IW9A 3M9KA 1SKWB 1NHYA 4L5LA 1F9MA 1MDIA 3UVHA 1M2BA 2BMXA 2HRFA 4ZB8A 5GAPD 1FB0A 5EVOA 2VO4A 5DQSA 1ST9A 4EDYA 3DYRA 1O81A 2AAWA 4MF6A 3BCIA 4NV2A 2QGVA 2C3NA 3EMPA 5G31A 4PX1A 2VCTA 3I69A 3LFLA 1R5PA 3QD9A 2LQQA 1YEPA 1JFUA 3FEUA 5HFIA 1XWAA 4XS1A 1XCCA 2I3YA 4JR6A 5INYA 4OO4A 3GNJA 1T4YA 2NTOA 3CRUA 4IGJA 4P3YB 5A4UA 2C80A 3UARA 1G0TA 1VF4A 4GSSA 3GYKA 3Q18A 1OE8A 1XW6A 3ISOA 3PH9A 2AV4A 2M46A 2BTOT 2K8SA 5B6NA 4MDCA 1N2AA 1VRSD 1Q4JA 4GF0A 1K3OA 3GV1A 1V9WA 5JCUA 1DSBA 2I9HA 1X5DA 4PUFC 1ERWA 3GKXA 2OE1A 3GTUB 3MAKA 3TUEA 3O6TA 2I1UA 2H1GA 3RPPA 2YJ7A 2PPTA 5CO3A 1IYHA 5EL8A 5G30A 3LXZA 1ILOA 1USBA 2WS2A 4TR4A 3ZL5A 2H66A 4KDUA 3CRTA 1ZZYA 11GSA 1T8EB 2HZEA 2R37A 4MPFA 4N11A 4HZ4A 1JZOA 1JHBA 5IPGA 2JZRA 2O8VB 5G1KA 18GSA 2IMEA 1DBYA 2C3TA 3L9UA 2IMFA 3ZFLA 1ZL9A 5GZZB 1N8JA 1TRWA 4PQIA 3ZYWA 1KTEA 5DCHA 2O7KA 1AQXA 2V2GA 2B5XA 1HQOA 3EMXA 2JSZA 1BX9A 3A2WA 1EP7A 1O6JA 2V6KA 4OD7A 5DJMA 3RDWA 2OKAA 1ZMAA 2CVBA 5ABRA 4HJMA 1PD21 2AHEA 2CA8A 2IMKA 1S3DA 2HRNA 4IJ3A 5IOXA 2L5OA 3L9VA 1JZWA 5D9TA 4AF2A 1GSUA 4MZBA 4GWRA 4MA9A 4FO5A 1Z7RA 2PMTA 2FY6A 4PNFA 5CRDA 2JZTA 1WJKA 4MMMA 1Y25A 3GFKA 4J57E 3D4MA 5HR0A 4V1Ag 1AUCA 1FVKA 4IKHA 2PERA 5AISA 6GSWA 2VM2A 1OAZA 4KAEA 2ZNMA 5H5SA 4KSOA 2RIIA 4OO5A 1MEKA 1A2MA 4WXTA 4YAPA 2NVLA 3F0IA 4OFMA 3D0ZA 1A2JA 1M7TA 4FIWA 1EGOA 1SJIA 2PBJA 1UA5A 1UC7A 2LRCA 1X9WB 3KMNA 4QL9A 3CTFA 3TRXA 3ZIVA 4FYUA 3D5JA 3APSA 3N5OA 3C7MA 3M8NA 1JZDA 3W8SA 3ZVJA 1XVQA 3GMFA 1PKZA 2C0GA 1S3AA 3WGEA 1SKSB 2VLUA 1GUMA 3UBKA 3E9JB 3G9BA 4HU9A 3R2QA 2ON7A 5F8BA 5DALB 5F06A 3HCZA 2YWMA 2IN3A 3ERFA 3U6VA 3DGQA 2E2MA 4XIHA 2LEGA 2LTKA 4XS6A 4YH2A 4ZL7A 4WR5A 1TKDB 1H4OA 2B5EA 5F07A 2VM1A 2VUPA 5LCZA 2FD3A 1AIUA 3O3TA 2CAIA 1JZRA 4JBBA 5E59A 5JCGA 5IOWA 1V98A 4GSTA 3GUSA 1TXXA 2H72A 3L9SA 2LJAA 5CNWA 1A8YA 2CZ3A 4ZL8A 4EXJA 2FWEA 3IRAA 3IK7A 4K0GA 3G7YA 3KGKA 4YQVA 3W6GA 2JSYA 3DVWA 3WT2A 2K18A 4PXOA 4E8HA 2LQOA 4N30A 3D21A 4F0BA 1V2AA 3HHVA 2FWFA 3HJMA 4K7OA 4O5RA 4F2IA 3HYPA 1GL8A 3FY7A 4LL4B 2C0FA 3F3RA 4K9ZA 4HU7A 2H75A 2QKEA 3BJ5A 2PVQA 2N5FA 4GSNA 1PL2A 5ECNB 3FZ9A 1QGVA 2RLIA 1PMTA 4IP6A 5L71A 3VPQA 1OC9B 4ZL9A 3GKKA 4NAXA 4OFNA 5KEJA 2GSRA 1T1VA 3ERWA 2MYGA 1EZKA 3TDGA 2IFQB 3KP8A 4ZBBA 3CXGA 1X5CA 3TRPA 5J41A 3UVTA 2WB9A 4TW5A 4MZWA 5DAKB 5LD0A 2XHFA 1XVWA 1THOA 3LWAA 3M1GA 3QFBC 4DSSB 1QQ2A 2QSIA 4ZBAA 1H75A 1M0UA 3GURA 2L6CA 4XCSA 1OYJA 3G7JA 1NSWA 1VF2A 1A8LA 2F8FA 2HZFA 4K7IA 2WFCA 4QL7A 4HS1A 3LGCA 5HQPA 3J7Yb 1HNBA 5DVBA 2HSHA 1Z3EA 1X0RA 4BA7A 1K0NA 1PRXA 4V1Ap 2CQ9A 2A2RA 1BYEA 4GQCA 3ME7A 5KN1A 1THXA 3DXBA 2ES7A 3FKFA 1MD4A 4ECBA 2FUG2 4MJAA 1AQWA 1YKAA 1XZOA 1TJDA 3KEBA 4JU5A 2OA7A 2B6MA 2J9HA 4I2TA 3GH6A 4HQZA 5G2ZA 1EWXA 5EPFA 1GSEA 2E2GA 4F82A 2L57A 1GTUA 3L0HA 4L0WA 2GSSA 4YQUA 1FB6A 4ID0A 1R7HA 1YQ1A 5F05A 4EKZA 2DJ2A 1Z9HA 1GLQA 1XFLA 1O85A 1SYRA 1TK8B 1WIKA 2H1AA 2XPDA 4CDOA 3C73A 2AB6A 1IYIA 4POKA 2H0GA 3TOTA 1FAAA 5HR3A 4EL1A 1XW5A 4LMWA 2F9SA 3I6AA 5ENUA 5DQYA 3KH7A 1F3AA 3SWLA 3CTGA 4LA1A 4ML1A 2V32A 3IXRA 2H70A 3G7IA 5J3RA 3QAWA 5IQYA 3VI7A 4O7HA 1GSQA 1YF0A 4IQ1A 1M99A 1T4ZA 4GQFA 5ECLB 4EE0A 3PR8A 2K9FA 3MWHA 1S3CA 1R4WA 3A2VA 2N5AA 2X8CA 6GSXA 4V2MA 2GZYA 4MH3A 5AGYA 1WOUA 2TRCP 1SL0B 5D73A 2V6OA 1OC9A 3HDCA 2DJ1A 2EIOA
chains in the Genus database with same CATH superfamily
3FRCA 2KHPA 4BPYA 8GSSA 2H01A 3SBCA 2P31A 4HDEA 3VWXA 3EINA 2O85A 4L8EA 2IFQA 3FZ5A 4O32A 5JWQB 3DMLA 3PINA 5DAKA 3Q19A 4N0ZA 2R3XA 2XBQA 3FMWA 4RI7A 2FCHA 2YWNA 4BVYA 4DSSA 5GSSA 2C8UA 2X49A 2BJXA 1ZCPA 3Q74A 4DSQA 4IBPA 1OVNA 1TI1A 2B1LA 3V1WA 3DVXA 4F0CA 2B5YA 1K0BA 4IP1A 1B48A 3I43A 2LS5A 4XS4B 3P7XA 4KUNA 3F4RA 1J08A 3HZ8A 5ECKB 2EIRA 4CHSA 4Q5QA 2VAFA 4TR0A 1BG5A 2R0PA 1WRYA 1ABAA 3MYDA 1YF1A 5B7CA 2EIQA 4GXZA 4EVMA 1AXDA 2C4JA 3D6IA 1ERTA 2LUSA 5ECPB 1TRVA 4NHWA 3RBTA 5D8IA 4TN8A 2OBKA 1NW2A 1ZYNA 3VFIA 2F51A 1A24A 1SD9A 4IS0A 2F3MA 1B9YC 6GSTA 2OE0A 3IE3A 1JLVA 4GTUA 4ECCA 3EURA 5ID2B 3ZITA 3KM6A 5G5EA 4MLYA 4E8EA 2HSYA 4KDXA 1X5EA 1FW1A 3TGZA 5F0GA 3K8NA 2L5LA 2PGTA 5G1LA 3ZVJD 2H73A 4ICYA 1S3RA 2OACA 4POBA 4RQXA 19GSA 3UOMA 4WF5A 2R5GA 1MDKA 1C72A 5ECSA 1SK2A 1HD2A 4ISDA 1PX6A 1K0MA 5EY6A 2H6XA 2KUCA 4NPBA 2H8LA 3TKSC 13GSA 2FNOA 3P8WA 3QDNA 3F6FA 2DIZA 2RM6A 3C71A 1GH2A 2YOIA 5IMZA 1ON4A 4K8MA 1PA3A 2VCZA 2IMIA 17GSA 1YDKA 3CYNA 5ECHB 5JCWA 2K6VA 1R26A 1FO5A 2JL4A 4MPGA 2R2JA 2A2SA 2GT6A 1ZOFA 2G0FA 4IELA 2KOKA 2IPAA 1K0DA 2RM5A 3HA9A 4A5PA 2L4CA 5D9WA 2CV4A 3EU4A 3TKRA 1GP1A 4OCEA 1SL1B 2OADA 1UVZA 2GLRA 1VF1A 1A0FA 4AJ8A 1B8XA 3D22A 2P5QA 2GVPA 2C0DA 1O8XA 1FVJA 4X43A 1SK0A 4KCAA 4EIQA 4XS4A 4PQ1A 4JRRA 3KIJA 2IL3A 2VOCA 2R0CA 4GCIA 3EWLA 2YP6A 2MBSA 5KN2A 4ACSA 4D73A 1B9XC 3U5RE 2REMA 3QOUA 2AJQB 1PSQA 3P90A 4PQHA 5DJLA 3KTLA 4HEA2 1Z6MA 1G6WA 3QAGA 4K1FA 1QK8A 2VL2A 3UAPA 1B4QA 5DDLA 2GSTA 3H4KA 3ME8A 2HYXA 1MDJA 2I81A 5C04A 3M9JA 4Q5FA 3QPMA 4ECIA 5BMUA 3HVVA 2K8VA 2C0EA 5ECOB 2DKHA 2LRNA 3OR5A 1FOVA 2B3SA 1YZXA 1EOGA 4K7NA 3GN3A 3EU3A 3TJKA 1FG4A 2PWJA 5IIZA 3GKNA 5CREA 1BEDA 5ID2A 1TTZA 4MF7A 2H74A 2B7KA 3CSJA 1AW9A 2HE3A 3VPTA 2LNTA 1PN9A 3HZ4A 2VL3A 9GSSA 4OCFA 3IDVA 1XWCA 1U88A 4X4JA 4ZIJA 2IJYA 5D9VA 4XRAA 1MTCA 2ZUPA 5DCGA 1UN2A 1GUHA 7GSSA 1PGTA 4MK3A 4K6XA 3GSTA 2LJKA 2PN8A 4G2EA 1BJXA 1GTBA 3S9FA 1AC1A 2H6YA 1GUKA 2ZCTA 4MP4A 2FWHA 4NXIA 3FR3A 3FR6A 2PU9C 3F8UA 3F6DA 1TDIA 4WETA 2DIYA 2MMOA 1ERUA 3NZNA 5ECRB 1GSSA 4CW9A 1GNWA 2YPMA 3TB2A 5GSTA 2QA1A 4GLTA 2C3QA 4MH2A 1EEMA 1ZGNA 1XWKA 5HR1A 3UMAA 1ACVA 3H79A 4KW6A 2VIMA 4NWYA 3R3EA 4K0NA 1XBSA 4J2FA 4V2LA 3LJRA 1SYXA 1A23A 1A2LA 3UL3A 2L6DA 2J23A 3ZMKA 1HYUA 1T7PB 1E2YA 4GRFA 3W8JA 3CQFA 3CMIA 4ECJA 1F37A 1GRXA 2YNXA 1SD8A 4OWYA 1GSYA 3L4NA 4ZXGA 1RW1A 4BVYB 3KH9A 5IO0A 4KCEA 1XG8A 3N9JA 3LXTA 1XWBA 3WYWA 1DE1A 5AIXA 4TOPA 3IA1A 2YV9A 2QA2A 2IMDA 2M80A 2MBTA 2GTUA 2WGRA 3ZLPA 22GSA 3A3TA 1YEXA 5E4WA 3TJGA 3BBYA 5IO2A 5HFGA 3IPZA 3TJFA 3LSZA 4DEJA 2MMZA 1PL1A 2LRTA 1GLPA 5IM9A 1VGLA 4L0UA 3DRNA 2KP1A 1OC3A 2HLSA 3ZRDA 2X8HA 2P5RA 3VWUA 2XC2A 4ZB6A 4G10A 4TVEA 2CVKA 1GULA 1GNEA 3EYTA 3TJBA 1GSDA 2GQKA 3DIEA 2YV7A 3CBUA 3TKSA 3ZTLA 5J9BA 3LW9A 4TRXA 4J56E 5G5FA 4FH8A 3DKSA 3MDKA 2WZ9A 3FW2A 4WBRD 3NIVA 3IHQA 6GSYA 1ZYEA 1K3YA 3APQA 3KP9A 3WGDA 4USSA 4X1UA 1PKWA 2TRXA 1TRSA 2L4QA 2AUVA 3HJOA 2H0IA 4H86A 3ZMLA 1V40A 2HI7A 2VL2C 3TKSE 5CRWA 4NHZA 1XPVA 1WE0A 2E7PA 3FZAA 3O76A 2VLVA 4POLA 3J7Yk 2PVOC 3H8QA 4DVCA 1U6TA 2G2QA 2H1DA 4PURA 3VURA 4KB3A 1SENA 2IWTA 4DSRA 5COHA 1EOHA 3VK9A 4HJ2A 2O87A 5IMCA 4KNDA 2V41A 2Z9SA 1URMA 3BD2A 3KZQA 4HOJA 2H30A 2X64A 5HFKA 1RQMA 3KTBA 3E0UA 3FZ4A 1FOHA 2JACA 3TKQA 1T3BA 2GT5A 2CVDA 3GKMA 1TRUA 4MABA 4RQRA 1LU4A 4JE1A 4JEDA 3DD3A 1HNCA 3NOFA 3KJYA 5B6MA 4JZQA 1BQ7A 4IHUA 2FHEA 1G7OA 4I5QA 2RUFA 2A2PA 3LQ7A 2L59A 2LJRA 5FT3A 1GWCA 1U3AA 3F9UA 2CT6A 1WWJA 1K0OA 3ZREA 1ERVA 1Z6NA 3ZZXA 1SKRB 4BIKA 1SK1A 2GDRA 5ECQB 2CAQA 4MF5A 5JWOB 1WP0A 4LLRA 5B8BA 3GL5A 4KA0A 3HJPA 1OKDA 1X9SB 1U87A 1GTIA 2LV3A 5A5KA 1MD3A 2DMLA 3F3QA 1TU7A 3QFAC 3APOA 4D73B 3QR6A 2N5BA 5LNKe 3L78A 1K3LA 2E0QA 3CSIA 2KP2A 2CZ2A 3C1SA 1M2DA 3WGXA 3IHGA 3TKPA 4N10A 1O7UA 1OKTA 2B1KA 2AYTA 1QMVA 2R0GA 4HQSA 5CYYA 3RAZA 2DJ0A 2OBIA 4IVFA 2M72A 5ELAA 2EC4A 4I8BA 4KH7A 4O5QA 4KE3A 2X99A 4K2DA 3VWWA 5CRHA 1M9BA 2DJJA 5DBQA 3FK8A 4BWSA 6GSUA 3F4SA 3EVIA 4AGSA 2YWOA 4HUAA 3EE2A 3LEFA 4HZ2A 2FA8A 5IMVA 20GSA 4PGTA 4TKYA 4NV5A 3HVXA 3A5WA 2GSQA 2GGTA 4EDZA 4RUVA 5KOWA 4TXOB 1WPIA 2MZCA 3C1RA 1QXHA 3UIWA 3M0FA 1TOFA 2WRTA 3H1NA 3GL3A 2XPEA 3VLNA 1O73A 1J0FA 2DKIA 4WBJA 4L5OA 2B7JA 5JWRB 5ECIB 2VD1A 5IPHA 2NBSA 3I9V2 4EO3A 1E6BA 2C1YA 2FGXA 2DSAA 2ON5A 4PNGA 4Z7XA 3GX0A 2H1BA 3JCML 3LG6A 4Z2TA 1M2AA 1QUWA 3IBHA 4KSMA 2YANA 1R5AA 1TU8A 1GSFA 3GA4A 10GSA 1I5GA 1LBKA 4XTSA 2YCDA 2NDOA 2A4VA 2H71A 2O89A 4ILFA 3F4TA 3ERGA 6GSVA 2WCIA 1XOAA 4BVXB 1RK4A 4G0KA 2I4AA 2DLXA 3US3A 4Q5RA 5FWGA 3EPTA 2GQMA 4MJEA 1KBNA 4MZCA 4EC0A 3HD5A 2H76A 1F6MC 5CP1A 3KMOA 3UEMA 2OJLA 2WJUA 3DWVA 4Q5NA 5C00A 3VWVA 4BL7B 1FHEA 5AN1A 12GSA 1EV9A 5H5QA 1XXUA 1V58A 1CQGA 3WD6A 1YJ6A 3GIXA 4K5RA 4QQ7A 4YKFA 1TK5B 1BAYA 4IJIA 4JR4A 1V57A 4WR4A 3GTUA 4FYCA 3M3MA 3BCKA 5IMAA 2X4AA 3TRQA 4F9ZA 3EC3A 5D93A 1LJRA 1G6YA 4ULXA 4HSCX 2H0HA 5GAND 2A4HA 1Z5YE 4F03A 1OE7A 1XWGA 3LORA 1JLWA 4NMUA 2TIRA 5D96A 3Q6OA 5D9XA 4EUYA 2IIYA 4G19A 2V1MA 4N0VA 1ML6A 3A2XA 5J4UA 4TXOA 1KNGA 3F63A 2R6KA 1U3IA 3IK9A 4KGIA 1AAZA 4I2UA 1EP8A 2VCVA 4ZB9A 5CRGA 2RUEA 3FHKA 4TR1B 1X9MB 1F3BA 1PQNA 5AIVA 5FHIA 3D4TA 2VCXA 1XIYA 3IOSA 2KLXA 1Y6EA 4YAVA 1XOBA 4ZILA 2VLTA 3HKRA 3CSHA 4POMA 2QC7A 1G7EA 4WEYA 2CX3A 2H19A 1YY7A 2F8AA 3H93A 3C8EA 1SJ6A 2HFDA 4V2NA 1CQHA 5J5NA 5J9CA 4YQMA 3LYKA 1K0AA 4XHMA 2VCQA 14GSA 2VD0A 3UBLA 5KOXA 1W89A 3MNGA 1PN0A 3RHBA 2FWGA 3PGTA 4FYBA 3KCMA 3FR9A 1K0CA 3HVSA 2WULA 4BVXA 4G0LA 4LL1B 1VF3A 3RHCA 2CX4A 5CAXA 4BWQA 4AJ7A 5ELGA 3GRXA 5KN3A 1SJZA 4G9HA 2R4VA 4ML6A 4WF4A 2X8GA 2FA4A 3BOAA 4MJBA 3HY2A 1A0RP 2UZ8A 4IN0A 1Q98A 2JZSA 5HR2A 2ALBA 1SU9A 4I6XA 1NHOA 1J9BA 2DJ3A 4BL7A 1TW9A 2LSTA 4EF0A 1EGRA 5IMFA 2GS3A 1T00A 6GSSA 4XRDA 1TK0B 5H5RA 3ED3A 5A4VA 1W4VA 5IMDA 2OE3A 4WKWA 5BRTA 4AJ6A 1DE2A 3GHAA 1TI3A 1AQVA 2GQLA 3QCPA 2D2ZA 1QFNA 3MSZA 4TR3A 1B4PA 1ZYQB 1O8WA 4I97A 1XW9A 3HXSA 5DALA 3ZIJA 2DMMA 2DJKA 2WDUA 3LYPA 3WT1A 4RI6A 3FYGA 3GSSA 2GZPA 4KDYA 4PUAA 1M9AA 1F2EA 2LNSA 5B8AA 3P2AA 3PPUA 1EV4A 2HSMA 3TJJA 4O92A 2XBIA 2MMAA 2DC5A 2HRAA 2VL9A 4OMVA 3IAS2 2FLSA 2MMNA 2YJHA 3MIXA 3IC4A 4Z2UA 2YN1A 2HT9A 4LMVA 4TR1A 3GH9A 3KXOA 2PUKC 3VI5A 5KN0A 3IV4A 16GSA 4MJCA 2HZEB 4X0XA 5A4WA 1WMJA 4CY6A 3RPNA 4HI7A 3IR4A 4IQAA 3ZFBA 1M3JA 1SL2B 1NM3A 3QMXA 1KEBA 1YKCA 2JADA 2JU5A 3UJ1A 2LKUA 1OC8A 4OFTA 1GTAA 2HXKA 4TXVA 3KD0A 1EEJA 3QAVA 2GZZA 2YZUA 2DBCA 4MCUA 4KX4A 2VCWA 1HNAA 1PX7A 3AY8A 3E3EA 3IAM2 3TOUA 2HNLA 1Z7PA 2P0GA 2YZHA 4ZBDA 2NPBA 3DEXA 5ECMB 3GX8A 2YWIA 1DUGA 3TCOA 1TP9A 2H6ZA 1I9DA 4IW9A 3M9KA 1SKWB 1NHYA 4L5LA 1F9MA 1MDIA 3UVHA 1M2BA 2BMXA 2HRFA 4ZB8A 5GAPD 1FB0A 5EVOA 2VO4A 5DQSA 1ST9A 4EDYA 3DYRA 1O81A 2AAWA 4MF6A 3BCIA 4NV2A 2QGVA 2C3NA 3EMPA 5G31A 4PX1A 2VCTA 3I69A 3LFLA 1R5PA 3QD9A 2LQQA 1YEPA 1JFUA 3FEUA 5HFIA 1XWAA 4XS1A 1XCCA 2I3YA 4JR6A 5INYA 4OO4A 3GNJA 1T4YA 2NTOA 3CRUA 4IGJA 4KF9A 4P3YB 5A4UA 2C80A 3UARA 1G0TA 1VF4A 4GSSA 3GYKA 3IC8A 3Q18A 1OE8A 1XW6A 3ISOA 3PH9A 2AV4A 2M46A 2BTOT 2K8SA 5B6NA 4MDCA 1N2AA 1VRSD 1Q4JA 4CY8A 4GF0A 1K3OA 3GV1A 1V9WA 5JCUA 1DSBA 2I9HA 1X5DA 4PUFC 1ERWA 3GKXA 2OE1A 3GTUB 3MAKA 3TUEA 3O6TA 2I1UA 2H1GA 3RPPA 2YJ7A 2PPTA 5CO3A 1IYHA 5EL8A 5G30A 3LXZA 1ILOA 1USBA 2WS2A 4TR4A 3ZL5A 2H66A 4KDUA 3CRTA 1ZZYA 11GSA 1T8EB 2HZEA 2R37A 4MPFA 4N11A 4HZ4A 1JZOA 1JHBA 5IPGA 2JZRA 2O8VB 5G1KA 18GSA 2IMEA 1DBYA 2C3TA 3L9UA 2IMFA 3ZFLA 1ZL9A 5GZZB 1N8JA 1TRWA 4PQIA 3ZYWA 1KTEA 5DCHA 2O7KA 1AQXA 2V2GA 2B5XA 1HQOA 3EMXA 2JSZA 1BX9A 3A2WA 1EP7A 1O6JA 2V6KA 4OD7A 5DJMA 3RDWA 2OKAA 1ZMAA 2CVBA 5ABRA 4HJMA 1PD21 2AHEA 2CA8A 2IMKA 1S3DA 2HRNA 4IJ3A 5IOXA 2L5OA 3A5IA 3L9VA 1JZWA 5D9TA 4AF2A 1GSUA 4MZBA 4GWRA 4MA9A 4FO5A 1Z7RA 2PMTA 2FY6A 4PNFA 5CRDA 2JZTA 1WJKA 4MMMA 1Y25A 3GFKA 4J57E 3D4MA 5HR0A 4V1Ag 1AUCA 1FVKA 4K2XA 4IKHA 2PERA 5AISA 6GSWA 2VM2A 1OAZA 4KAEA 2ZNMA 5H5SA 4KSOA 2RIIA 4OO5A 1MEKA 1A2MA 4WXTA 4YAPA 2NVLA 3F0IA 4OFMA 3D0ZA 1A2JA 4Z2RA 1M7TA 4FIWA 1EGOA 1SJIA 2PBJA 1UA5A 1UC7A 2LRCA 1X9WB 3KMNA 4YKGA 4QL9A 3CTFA 3TRXA 3ZIVA 4FYUA 3D5JA 3APSA 3N5OA 3C7MA 3M8NA 2HRKA 1JZDA 3W8SA 3ZVJA 1XVQA 3GMFA 1PKZA 2C0GA 1S3AA 3WGEA 1SKSB 2VLUA 1GUMA 3UBKA 3E9JB 3G9BA 1PFOA 4HU9A 3R2QA 2ON7A 5F8BA 5DALB 5F06A 3HCZA 2YWMA 2IN3A 3ERFA 3U6VA 3DGQA 2E2MA 4XIHA 2LEGA 2LTKA 4XS6A 4YH2A 4ZL7A 4WR5A 1TKDB 1H4OA 2B5EA 5F07A 2VM1A 2VUPA 5LCZA 2FD3A 1AIUA 3O3TA 2CAIA 1JZRA 1M3IA 4JBBA 5E59A 5JCGA 5IOWA 1V98A 4GSTA 3GUSA 4EIPA 1TXXA 2H72A 4MNNA 3L9SA 2LJAA 5CNWA 1A8YA 2CZ3A 4ZL8A 4EXJA 2FWEA 3IRAA 3IK7A 4K0GA 3G7YA 3KGKA 4YQVA 3W6GA 2JSYA 3DVWA 3WT2A 2K18A 4PXOA 4E8HA 2LQOA 4N30A 4K5SA 3D21A 4F0BA 1V2AA 3HHVA 2FWFA 3HJMA 4K7OA 4O5RA 4F2IA 3HYPA 1GL8A 3FY7A 4LL4B 2C0FA 3F3RA 4G0IA 4K9ZA 4HU7A 2H75A 2QKEA 3BJ5A 2PVQA 2N5FA 4GSNA 1PL2A 5ECNB 3FZ9A 1QGVA 2RLIA 1PMTA 4IP6A 5L71A 3VPQA 1OC9B 4ZL9A 3GKKA 4NAXA 4OFNA 5KEJA 2GSRA 1T1VA 3ERWA 2MYGA 1EZKA 3TDGA 2IFQB 3KP8A 4ZBBA 3CXGA 1X5CA 3TRPA 5J41A 3UVTA 2WB9A 4TW5A 4MZWA 5DAKB 5LD0A 2XHFA 1XVWA 1THOA 3LWAA 4O5UA 3M1GA 3QFBC 4DSSB 1QQ2A 2QSIA 4ZBAA 1H75A 1M0UA 3GURA 2L6CA 4XCSA 1OYJA 1ZYPA 3G7JA 1NSWA 1VF2A 1A8LA 2F8FA 2HZFA 4K7IA 2WFCA 4QL7A 4HS1A 3LGCA 5HQPA 3J7Yb 1HNBA 5DVBA 2HSHA 1Z3EA 1X0RA 4BA7A 1K0NA 1PRXA 4V1Ap 2CQ9A 2A2RA 1BYEA 4GQCA 3ME7A 5KN1A 1THXA 3DXBA 2ES7A 3FKFA 1MD4A 4ECBA 2FUG2 4MJAA 1AQWA 1YKAA 1XZOA 1TJDA 3KEBA 4JU5A 2OA7A 2B6MA 2J9HA 4I2TA 3GH6A 4HQZA 5G2ZA 1EWXA 5EPFA 1GSEA 2E2GA 4F82A 2L57A 1GTUA 3L0HA 4L0WA 2GSSA 4YQUA 1FB6A 4ID0A 1R7HA 1YQ1A 5F05A 4EKZA 2DJ2A 1Z9HA 1GLQA 1XFLA 1O85A 1SYRA 1TK8B 1WIKA 2H1AA 2XPDA 4CDOA 3C73A 2AB6A 1IYIA 4POKA 2H0GA 3TOTA 1FAAA 5HR3A 4FQUA 4EL1A 1XW5A 4LMWA 2F9SA 3I6AA 5ENUA 5DQYA 3KH7A 1F3AA 3SWLA 3CTGA 4LA1A 4ML1A 2V32A 3IXRA 2H70A 3G7IA 5J3RA 3QAWA 5IQYA 3VI7A 4O7HA 1GSQA 1YF0A 4IQ1A 1M99A 1T4ZA 3HVNA 4GQFA 5ECLB 4EE0A 3PR8A 2K9FA 3MWHA 1S3CA 1R4WA 3A2VA 2N5AA 2X8CA 6GSXA 4V2MA 2GZYA 4MH3A 5AGYA 1WOUA 2TRCP 1SL0B 5D73A 4PTSA 2V6OA 1OC9A 3HDCA 2DJ1A 2EIOA
chains in the Genus database with same CATH topology
3FRCA 2KHPA 4BPYA 8GSSA 2H01A 3SBCA 2P31A 4HDEA 3VWXA 3EINA 2O85A 4L8EA 2IFQA 3FZ5A 4O32A 5JWQB 3DMLA 3PINA 5DAKA 3Q19A 4N0ZA 2R3XA 2XBQA 3FMWA 4RI7A 2FCHA 2YWNA 4BVYA 4DSSA 5GSSA 2C8UA 2X49A 2BJXA 1ZCPA 3Q74A 4DSQA 4IBPA 1OVNA 1TI1A 2B1LA 3V1WA 3DVXA 4F0CA 2B5YA 1K0BA 4IP1A 1B48A 3I43A 2LS5A 4XS4B 3P7XA 4KUNA 3F4RA 1J08A 3HZ8A 5ECKB 2EIRA 4CHSA 4Q5QA 2VAFA 4TR0A 1BG5A 2R0PA 1WRYA 1ABAA 3MYDA 1YF1A 5B7CA 2EIQA 4GXZA 4EVMA 1AXDA 2C4JA 3D6IA 1ERTA 2LUSA 5ECPB 1TRVA 4NHWA 3RBTA 5D8IA 4TN8A 2OBKA 1NW2A 1ZYNA 3VFIA 2F51A 1A24A 1SD9A 4IS0A 2F3MA 1B9YC 6GSTA 2OE0A 3IE3A 1JLVA 4GTUA 4ECCA 3EURA 5ID2B 3ZITA 3KM6A 5G5EA 4MLYA 4E8EA 2HSYA 4KDXA 1X5EA 1FW1A 3TGZA 5F0GA 3K8NA 2L5LA 2PGTA 5G1LA 3ZVJD 2H73A 4ICYA 2OACA 4POBA 4RQXA 19GSA 3UOMA 4WF5A 2R5GA 1MDKA 1C72A 5ECSA 1SK2A 1HD2A 4ISDA 1PX6A 1K0MA 5EY6A 2H6XA 2KUCA 4NPBA 2H8LA 3TKSC 13GSA 2FNOA 3P8WA 3QDNA 3F6FA 2DIZA 2RM6A 3C71A 1GH2A 2YOIA 5IMZA 1ON4A 4K8MA 1PA3A 2VCZA 2IMIA 17GSA 1YDKA 3CYNA 5ECHB 5JCWA 2K6VA 1R26A 1FO5A 2JL4A 4MPGA 2R2JA 2A2SA 2GT6A 1ZOFA 2G0FA 4IELA 2KOKA 2IPAA 1K0DA 2RM5A 3HA9A 4A5PA 2L4CA 5D9WA 2CV4A 3EU4A 3TKRA 1GP1A 4OCEA 1SL1B 2OADA 1UVZA 2GLRA 1VF1A 1A0FA 4AJ8A 1B8XA 3D22A 2P5QA 2GVPA 2C0DA 1O8XA 1FVJA 4X43A 1SK0A 4KCAA 4EIQA 4XS4A 4PQ1A 4JRRA 3KIJA 2IL3A 2VOCA 2R0CA 4GCIA 3EWLA 2YP6A 2MBSA 5KN2A 4ACSA 4D73A 1B9XC 3U5RE 2REMA 3QOUA 2AJQB 1PSQA 3P90A 4PQHA 5DJLA 3KTLA 4HEA2 1Z6MA 1G6WA 3QAGA 4K1FA 1QK8A 2VL2A 3UAPA 1B4QA 5DDLA 2GSTA 3H4KA 3ME8A 2HYXA 1MDJA 2I81A 5C04A 3M9JA 4Q5FA 3QPMA 4ECIA 5BMUA 3HVVA 2K8VA 2C0EA 5ECOB 2DKHA 2LRNA 3OR5A 1FOVA 2B3SA 1YZXA 1EOGA 4K7NA 3GN3A 3EU3A 3TJKA 1FG4A 2PWJA 5IIZA 3GKNA 5CREA 1BEDA 5ID2A 1TTZA 4MF7A 2H74A 2B7KA 3CSJA 1AW9A 2HE3A 3VPTA 2LNTA 1PN9A 3HZ4A 2VL3A 9GSSA 4OCFA 3IDVA 1XWCA 1U88A 4X4JA 4ZIJA 2IJYA 5D9VA 4XRAA 1MTCA 2ZUPA 5DCGA 1UN2A 1GUHA 7GSSA 1PGTA 4MK3A 4K6XA 3GSTA 2LJKA 2PN8A 4G2EA 1BJXA 1GTBA 3S9FA 1AC1A 2H6YA 1GUKA 2ZCTA 4MP4A 2FWHA 4NXIA 3FR3A 3FR6A 2PU9C 3F8UA 3F6DA 1TDIA 4WETA 2DIYA 2MMOA 1ERUA 3NZNA 5ECRB 1GSSA 4CW9A 1GNWA 2YPMA 3TB2A 5GSTA 2QA1A 4GLTA 2C3QA 4MH2A 1EEMA 1ZGNA 1XWKA 5HR1A 3UMAA 1ACVA 3H79A 4KW6A 2VIMA 4NWYA 3R3EA 4K0NA 1XBSA 4J2FA 4V2LA 3LJRA 1SYXA 1A23A 1A2LA 3UL3A 2L6DA 2J23A 3ZMKA 1HYUA 1T7PB 1E2YA 4GRFA 3W8JA 3CMIA 4ECJA 1F37A 1GRXA 2YNXA 1SD8A 4OWYA 1GSYA 3L4NA 4ZXGA 1RW1A 4BVYB 3KH9A 5IO0A 4KCEA 3N9JA 3LXTA 1XWBA 3WYWA 1DE1A 5AIXA 4TOPA 3IA1A 2YV9A 2QA2A 2IMDA 2M80A 2MBTA 2GTUA 2WGRA 3ZLPA 22GSA 3A3TA 1YEXA 5E4WA 3TJGA 3BBYA 5IO2A 5HFGA 3IPZA 3TJFA 3LSZA 4DEJA 2MMZA 1PL1A 2LRTA 1GLPA 5IM9A 1VGLA 4L0UA 3DRNA 2KP1A 1OC3A 2HLSA 3ZRDA 2X8HA 2P5RA 3VWUA 2XC2A 4ZB6A 4G10A 4TVEA 2CVKA 1GULA 1GNEA 3EYTA 3TJBA 1GSDA 2GQKA 3DIEA 2YV7A 3CBUA 3TKSA 3ZTLA 5J9BA 3LW9A 4TRXA 4J56E 5G5FA 4FH8A 3DKSA 3MDKA 2WZ9A 3FW2A 4WBRD 3NIVA 3IHQA 6GSYA 1ZYEA 1K3YA 3APQA 3KP9A 3WGDA 4USSA 4X1UA 1PKWA 2TRXA 1TRSA 2L4QA 2AUVA 3HJOA 2H0IA 4H86A 3ZMLA 1V40A 2HI7A 2VL2C 3TKSE 5CRWA 4NHZA 1XPVA 1WE0A 2E7PA 3FZAA 3O76A 2VLVA 4POLA 3J7Yk 2PVOC 3H8QA 4DVCA 1U6TA 2G2QA 2H1DA 4PURA 3VURA 4KB3A 1SENA 2IWTA 4DSRA 5COHA 1EOHA 3VK9A 4HJ2A 2O87A 5IMCA 4KNDA 2V41A 2Z9SA 1URMA 3BD2A 3KZQA 4HOJA 2H30A 2X64A 5HFKA 1RQMA 3KTBA 3E0UA 3FZ4A 1FOHA 2JACA 3TKQA 1T3BA 2GT5A 2CVDA 3GKMA 1TRUA 4MABA 4RQRA 1LU4A 4JE1A 4JEDA 3DD3A 1HNCA 3NOFA 3KJYA 4JZQA 5B6MA 1BQ7A 4IHUA 2FHEA 1G7OA 4I5QA 2RUFA 2A2PA 3LQ7A 2L59A 2LJRA 5FT3A 1GWCA 1U3AA 3F9UA 2CT6A 1WWJA 1K0OA 3ZREA 1ERVA 1Z6NA 3ZZXA 1SKRB 1SK1A 2GDRA 5ECQB 2CAQA 4MF5A 5JWOB 1WP0A 4LLRA 5B8BA 3GL5A 4KA0A 3HJPA 1OKDA 1X9SB 1U87A 1GTIA 2LV3A 5A5KA 1MD3A 2DMLA 3F3QA 1TU7A 3QFAC 3APOA 4D73B 3QR6A 2N5BA 5LNKe 3L78A 1K3LA 2E0QA 3CSIA 2KP2A 2CZ2A 3C1SA 1M2DA 3WGXA 3IHGA 3TKPA 4N10A 1O7UA 1OKTA 2B1KA 2AYTA 1QMVA 2R0GA 4HQSA 5CYYA 3RAZA 2DJ0A 2OBIA 4IVFA 2M72A 5ELAA 2EC4A 4I8BA 4KH7A 4O5QA 4KE3A 2X99A 4K2DA 3VWWA 5CRHA 1M9BA 2DJJA 5DBQA 3FK8A 4BWSA 6GSUA 3F4SA 3EVIA 4AGSA 2YWOA 4HUAA 3EE2A 3LEFA 4HZ2A 2FA8A 5IMVA 20GSA 4PGTA 4TKYA 4NV5A 3HVXA 3A5WA 2GSQA 2GGTA 4EDZA 4RUVA 5KOWA 4TXOB 1WPIA 2MZCA 3C1RA 1QXHA 3UIWA 3M0FA 1TOFA 2WRTA 3H1NA 3GL3A 2XPEA 3VLNA 1O73A 1J0FA 2DKIA 4WBJA 4L5OA 2B7JA 5JWRB 5ECIB 2VD1A 5IPHA 2NBSA 3I9V2 4EO3A 1E6BA 2C1YA 2FGXA 2DSAA 2ON5A 4PNGA 4Z7XA 3GX0A 2H1BA 3JCML 3LG6A 4Z2TA 1M2AA 1QUWA 3IBHA 4KSMA 2YANA 1R5AA 1TU8A 1GSFA 3GA4A 10GSA 1I5GA 1LBKA 4XTSA 2YCDA 2NDOA 2A4VA 2H71A 2O89A 4ILFA 3F4TA 3ERGA 6GSVA 2WCIA 1XOAA 4BVXB 1RK4A 4G0KA 2I4AA 2DLXA 3US3A 4Q5RA 5FWGA 3EPTA 2GQMA 4MJEA 1KBNA 4MZCA 4EC0A 3HD5A 2H76A 1F6MC 5CP1A 3KMOA 3UEMA 2OJLA 2WJUA 3DWVA 4Q5NA 5C00A 3VWVA 4BL7B 1FHEA 5AN1A 12GSA 1EV9A 5H5QA 1XXUA 1V58A 1CQGA 3WD6A 1YJ6A 3GIXA 4K5RA 4QQ7A 4YKFA 1TK5B 1BAYA 4IJIA 4JR4A 1V57A 4WR4A 3GTUA 4FYCA 3M3MA 3BCKA 5IMAA 2X4AA 3TRQA 4F9ZA 3EC3A 5D93A 1LJRA 1G6YA 4ULXA 2H0HA 5GAND 2A4HA 1Z5YE 4F03A 1OE7A 1XWGA 3LORA 1JLWA 4NMUA 2TIRA 5D96A 3Q6OA 5D9XA 4EUYA 2IIYA 4G19A 2V1MA 4N0VA 1ML6A 3A2XA 5J4UA 4TXOA 1KNGA 3F63A 2R6KA 1U3IA 3IK9A 4KGIA 1AAZA 4I2UA 1EP8A 2VCVA 4ZB9A 5CRGA 2RUEA 3FHKA 4TR1B 1X9MB 1F3BA 1PQNA 5AIVA 5FHIA 3D4TA 2VCXA 1XIYA 3IOSA 2KLXA 1Y6EA 4YAVA 1XOBA 4ZILA 2VLTA 3HKRA 3CSHA 4POMA 2QC7A 1G7EA 4WEYA 2CX3A 2H19A 1YY7A 2F8AA 3H93A 3C8EA 1SJ6A 2HFDA 4V2NA 1CQHA 5J5NA 5J9CA 4YQMA 3LYKA 1K0AA 4XHMA 2VCQA 14GSA 2VD0A 3UBLA 5KOXA 1W89A 3MNGA 1PN0A 3RHBA 2FWGA 3PGTA 4FYBA 3KCMA 3FR9A 1K0CA 3HVSA 2WULA 4BVXA 4G0LA 4LL1B 1VF3A 3RHCA 2CX4A 5CAXA 4BWQA 4AJ7A 5ELGA 3GRXA 5KN3A 1SJZA 4G9HA 2R4VA 4ML6A 4WF4A 2X8GA 2FA4A 3BOAA 4MJBA 3HY2A 1A0RP 2UZ8A 4IN0A 1Q98A 2JZSA 5HR2A 2ALBA 1SU9A 4I6XA 1NHOA 1J9BA 2DJ3A 4BL7A 1TW9A 2LSTA 4EF0A 1EGRA 5IMFA 2GS3A 1T00A 6GSSA 4XRDA 1TK0B 5H5RA 3ED3A 5A4VA 1W4VA 5IMDA 2OE3A 4WKWA 5BRTA 4AJ6A 1DE2A 3GHAA 1TI3A 1AQVA 2GQLA 3QCPA 2D2ZA 1QFNA 3MSZA 4TR3A 1B4PA 1ZYQB 1O8WA 4I97A 1XW9A 3HXSA 5DALA 3ZIJA 2DMMA 2DJKA 2WDUA 3LYPA 3WT1A 4RI6A 3FYGA 3GSSA 2GZPA 4KDYA 4PUAA 1M9AA 1F2EA 2LNSA 5B8AA 3P2AA 3PPUA 1EV4A 2HSMA 3TJJA 4O92A 2XBIA 2MMAA 2DC5A 2HRAA 2VL9A 4OMVA 3IAS2 2FLSA 2MMNA 2YJHA 3MIXA 3IC4A 4Z2UA 2YN1A 2HT9A 4LMVA 4TR1A 3GH9A 3KXOA 2PUKC 3VI5A 5KN0A 3IV4A 16GSA 4MJCA 2HZEB 4X0XA 5A4WA 1WMJA 4CY6A 3RPNA 4HI7A 3IR4A 4IQAA 3ZFBA 1SL2B 1NM3A 3QMXA 1KEBA 1YKCA 2JADA 2JU5A 3UJ1A 2LKUA 1OC8A 4OFTA 1GTAA 2HXKA 4TXVA 3KD0A 1EEJA 3QAVA 2GZZA 2YZUA 2DBCA 4MCUA 4KX4A 2VCWA 1HNAA 1PX7A 3AY8A 3E3EA 3IAM2 3TOUA 2HNLA 1Z7PA 2P0GA 2YZHA 4ZBDA 2NPBA 3DEXA 5ECMB 3GX8A 2YWIA 1DUGA 3TCOA 1TP9A 2H6ZA 1I9DA 4IW9A 3M9KA 1SKWB 1NHYA 4L5LA 1F9MA 1MDIA 3UVHA 1M2BA 2BMXA 2HRFA 4ZB8A 5GAPD 1FB0A 5EVOA 2VO4A 5DQSA 1ST9A 4EDYA 3DYRA 1O81A 2AAWA 4MF6A 3BCIA 4NV2A 2QGVA 2C3NA 3EMPA 5G31A 4PX1A 2VCTA 3I69A 3LFLA 1R5PA 3QD9A 2LQQA 1YEPA 1JFUA 3FEUA 5HFIA 1XWAA 4XS1A 1XCCA 2I3YA 4JR6A 5INYA 4OO4A 3GNJA 1T4YA 2NTOA 3CRUA 4IGJA 4KF9A 4P3YB 5A4UA 2C80A 3UARA 1G0TA 1VF4A 4GSSA 3GYKA 3IC8A 3Q18A 1OE8A 1XW6A 3ISOA 3PH9A 2AV4A 2M46A 2BTOT 2K8SA 5B6NA 4MDCA 1N2AA 1VRSD 1Q4JA 4CY8A 4GF0A 1K3OA 3GV1A 1V9WA 5JCUA 1DSBA 2I9HA 1X5DA 4PUFC 1ERWA 3GKXA 2OE1A 3GTUB 3MAKA 3TUEA 3O6TA 2I1UA 2H1GA 3RPPA 2YJ7A 2PPTA 5CO3A 1IYHA 5EL8A 5G30A 3LXZA 1ILOA 1USBA 2WS2A 4TR4A 3ZL5A 2H66A 4KDUA 3CRTA 1ZZYA 11GSA 1T8EB 2HZEA 2R37A 4MPFA 4N11A 4HZ4A 1JZOA 1JHBA 5IPGA 2JZRA 2O8VB 5G1KA 18GSA 2IMEA 1DBYA 2C3TA 3L9UA 2IMFA 3ZFLA 1ZL9A 5GZZB 1N8JA 1TRWA 4PQIA 3ZYWA 1KTEA 5DCHA 2O7KA 1AQXA 2V2GA 2B5XA 1HQOA 3EMXA 2JSZA 1BX9A 3A2WA 1EP7A 1O6JA 2V6KA 4OD7A 5DJMA 3RDWA 2OKAA 1ZMAA 2CVBA 5ABRA 4HJMA 1PD21 2AHEA 2CA8A 2IMKA 1S3DA 2HRNA 4IJ3A 5IOXA 2L5OA 3A5IA 3L9VA 1JZWA 5D9TA 4AF2A 1GSUA 4MZBA 4GWRA 4MA9A 4FO5A 1Z7RA 2PMTA 2FY6A 4PNFA 5CRDA 2JZTA 1WJKA 4MMMA 1Y25A 3GFKA 4J57E 3D4MA 5HR0A 4V1Ag 1AUCA 1FVKA 4K2XA 4IKHA 2PERA 5AISA 6GSWA 2VM2A 1OAZA 4KAEA 2ZNMA 5H5SA 4KSOA 2RIIA 4OO5A 1MEKA 1A2MA 4WXTA 4YAPA 2NVLA 3F0IA 4OFMA 3D0ZA 1A2JA 4Z2RA 1M7TA 4FIWA 1EGOA 1SJIA 2PBJA 1UA5A 1UC7A 2LRCA 1X9WB 3KMNA 4YKGA 4QL9A 3CTFA 3TRXA 3ZIVA 4FYUA 3D5JA 3APSA 3N5OA 3C7MA 3M8NA 2HRKA 1JZDA 3W8SA 3ZVJA 1XVQA 3GMFA 1PKZA 2C0GA 1S3AA 3WGEA 1SKSB 2VLUA 1GUMA 3UBKA 3E9JB 3G9BA 4HU9A 3R2QA 2ON7A 5F8BA 5DALB 5F06A 3HCZA 2YWMA 2IN3A 3ERFA 3U6VA 3DGQA 2E2MA 4XIHA 2LEGA 2LTKA 4XS6A 4YH2A 4ZL7A 4WR5A 1TKDB 1H4OA 2B5EA 5F07A 2VM1A 2VUPA 5LCZA 2FD3A 1AIUA 3O3TA 2CAIA 1JZRA 4JBBA 5E59A 5JCGA 5IOWA 1V98A 4GSTA 3GUSA 4EIPA 1TXXA 2H72A 4MNNA 3L9SA 2LJAA 5CNWA 1A8YA 2CZ3A 4ZL8A 4EXJA 2FWEA 3IRAA 3IK7A 4K0GA 3G7YA 3KGKA 4YQVA 3W6GA 2JSYA 3DVWA 3WT2A 2K18A 4PXOA 4E8HA 2LQOA 4N30A 4K5SA 3D21A 4F0BA 1V2AA 3HHVA 2FWFA 3HJMA 4K7OA 4O5RA 4F2IA 3HYPA 1GL8A 3FY7A 4LL4B 2C0FA 3F3RA 4G0IA 4K9ZA 4HU7A 2H75A 2QKEA 3BJ5A 2PVQA 2N5FA 4GSNA 1PL2A 5ECNB 3FZ9A 1QGVA 2RLIA 1PMTA 4IP6A 5L71A 3VPQA 1OC9B 4ZL9A 3GKKA 4NAXA 4OFNA 5KEJA 2GSRA 1T1VA 3ERWA 2MYGA 1EZKA 3TDGA 2IFQB 3KP8A 4ZBBA 3CXGA 1X5CA 3TRPA 5J41A 3UVTA 2WB9A 4TW5A 4MZWA 5DAKB 5LD0A 2XHFA 1XVWA 1THOA 3LWAA 4O5UA 3M1GA 3QFBC 4DSSB 1QQ2A 2QSIA 4ZBAA 1H75A 1M0UA 3GURA 2L6CA 4XCSA 1OYJA 1ZYPA 3G7JA 1NSWA 1VF2A 1A8LA 2F8FA 2HZFA 4K7IA 2WFCA 4QL7A 4HS1A 3LGCA 5HQPA 3J7Yb 1HNBA 5DVBA 2HSHA 1Z3EA 1X0RA 4BA7A 1K0NA 1PRXA 4V1Ap 2CQ9A 2A2RA 1BYEA 4GQCA 3ME7A 5KN1A 1THXA 3DXBA 2ES7A 3FKFA 1MD4A 4ECBA 2FUG2 4MJAA 1AQWA 1YKAA 1XZOA 1TJDA 3KEBA 4JU5A 2OA7A 2B6MA 2J9HA 4I2TA 3GH6A 4HQZA 5G2ZA 1EWXA 5EPFA 1GSEA 2E2GA 4F82A 2L57A 1GTUA 3L0HA 4L0WA 2GSSA 4YQUA 1FB6A 4ID0A 1R7HA 1YQ1A 5F05A 4EKZA 2DJ2A 1Z9HA 1GLQA 1XFLA 1O85A 1SYRA 1TK8B 1WIKA 2H1AA 2XPDA 4CDOA 3C73A 2AB6A 1IYIA 4POKA 2H0GA 3TOTA 1FAAA 5HR3A 4FQUA 4EL1A 1XW5A 4LMWA 2F9SA 3I6AA 5ENUA 5DQYA 3KH7A 1F3AA 3SWLA 3CTGA 4LA1A 4ML1A 2V32A 3IXRA 2H70A 3G7IA 5J3RA 3QAWA 5IQYA 3VI7A 4O7HA 1GSQA 1YF0A 4IQ1A 1M99A 1T4ZA 4GQFA 5ECLB 4EE0A 3PR8A 2K9FA 3MWHA 1S3CA 1R4WA 3A2VA 2N5AA 2X8CA 6GSXA 4V2MA 2GZYA 4MH3A 5AGYA 1WOUA 2TRCP 1SL0B 5D73A 4PTSA 2V6OA 1OC9A 3HDCA 2DJ1A 2EIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FRC A;  2KHP A;  4BPY A;  8GSS A;  2H01 A;  3SBC A;  2P31 A;  4HDE A;  3VWX A;  3EIN A;  2O85 A;  4L8E A;  2IFQ A;  3FZ5 A;  4O32 A;  5JWQ B;  3DML A;  3PIN A;  5DAK A;  3Q19 A;  4N0Z A;  2R3X A;  2XBQ A;  4RI7 A;  2FCH A;  2YWN A;  4BVY A;  4DSS A;  5GSS A;  2C8U A;  2BJX A;  1ZCP A;  3Q74 A;  4DSQ A;  4IBP A;  1OVN A;  1TI1 A;  2B1L A;  3V1W A;  3DVX A;  4F0C A;  2B5Y A;  1K0B A;  4IP1 A;  1B48 A;  3I43 A;  2LS5 A;  4XS4 B;  3P7X A;  4KUN A;  3F4R A;  1J08 A;  3HZ8 A;  5ECK B;  2EIR A;  4CHS A;  4Q5Q A;  2VAF A;  4TR0 A;  1BG5 A;  1WRY A;  1ABA A;  1YF1 A;  5B7C A;  2EIQ A;  4GXZ A;  4EVM A;  1AXD A;  2C4J A;  3D6I A;  1ERT A;  2LUS A;  5ECP B;  1TRV A;  4NHW A;  3RBT A;  5D8I A;  4TN8 A;  2OBK A;  1NW2 A;  3VFI A;  2F51 A;  1A24 A;  1SD9 A;  4IS0 A;  2F3M A;  1B9Y C;  6GST A;  2OE0 A;  3IE3 A;  1JLV A;  4GTU A;  4ECC A;  3EUR A;  5ID2 B;  3ZIT A;  3KM6 A;  5G5E A;  4MLY A;  4E8E A;  2HSY A;  4KDX A;  1X5E A;  1FW1 A;  3TGZ A;  5F0G A;  3K8N A;  2L5L A;  2PGT A;  5G1L A;  3ZVJ D;  2H73 A;  2OAC A;  4POB A;  4RQX A;  19GS A;  3UOM A;  4WF5 A;  2R5G A;  1MDK A;  1C72 A;  5ECS A;  1SK2 A;  1HD2 A;  4ISD A;  1PX6 A;  1K0M A;  5EY6 A;  2H6X A;  2KUC A;  4NPB A;  2H8L A;  3TKS C;  13GS A;  2FNO A;  3P8W A;  3QDN A;  3F6F A;  2DIZ A;  2RM6 A;  3C71 A;  1GH2 A;  2YOI A;  5IMZ A;  1ON4 A;  4K8M A;  1PA3 A;  2VCZ A;  2IMI A;  17GS A;  1YDK A;  3CYN A;  5ECH B;  5JCW A;  2K6V A;  1R26 A;  1FO5 A;  2JL4 A;  4MPG A;  2R2J A;  2A2S A;  2GT6 A;  1ZOF A;  2G0F A;  4IEL A;  2KOK A;  2IPA A;  1K0D A;  2RM5 A;  3HA9 A;  2L4C A;  5D9W A;  2CV4 A;  3EU4 A;  3TKR A;  1GP1 A;  4OCE A;  1SL1 B;  2OAD A;  1UVZ A;  2GLR A;  1VF1 A;  1A0F A;  4AJ8 A;  1B8X A;  3D22 A;  2P5Q A;  2GVP A;  2C0D A;  1O8X A;  1FVJ A;  4X43 A;  1SK0 A;  4KCA A;  4XS4 A;  4PQ1 A;  4JRR A;  3KIJ A;  2IL3 A;  2VOC A;  4GCI A;  3EWL A;  2YP6 A;  2MBS A;  5KN2 A;  4ACS A;  4D73 A;  1B9X C;  3U5R E;  2REM A;  3QOU A;  2AJQ B;  1PSQ A;  3P90 A;  5DJL A;  4PQH A;  3KTL A;  4HEA 2;  1Z6M A;  1G6W A;  3QAG A;  4K1F A;  1QK8 A;  2VL2 A;  3UAP A;  1B4Q A;  5DDL A;  2GST A;  3H4K A;  3ME8 A;  2HYX A;  1MDJ A;  2I81 A;  5C04 A;  3M9J A;  4Q5F A;  3QPM A;  4ECI A;  3HVV A;  2K8V A;  2C0E A;  5ECO B;  2LRN A;  3OR5 A;  1FOV A;  2B3S A;  1YZX A;  1EOG A;  4K7N A;  3GN3 A;  3EU3 A;  3TJK A;  1FG4 A;  2PWJ A;  5IIZ A;  3GKN A;  5CRE A;  1BED A;  5ID2 A;  1TTZ A;  4MF7 A;  2H74 A;  2B7K A;  3CSJ A;  1AW9 A;  2HE3 A;  3VPT A;  2LNT A;  1PN9 A;  3HZ4 A;  2VL3 A;  9GSS A;  4OCF A;  3IDV A;  1XWC A;  1U88 A;  4ZIJ A;  2IJY A;  5D9V A;  4XRA A;  1MTC A;  2ZUP A;  5DCG A;  1UN2 A;  1GUH A;  7GSS A;  1PGT A;  4MK3 A;  4K6X A;  3GST A;  2LJK A;  2PN8 A;  4G2E A;  1BJX A;  1GTB A;  3S9F A;  1AC1 A;  2H6Y A;  1GUK A;  2ZCT A;  4MP4 A;  2FWH A;  4NXI A;  3FR3 A;  3FR6 A;  2PU9 C;  3F8U A;  3F6D A;  1TDI A;  4WET A;  2DIY A;  2MMO A;  1ERU A;  3NZN A;  5ECR B;  1GSS A;  4CW9 A;  1GNW A;  2YPM A;  3TB2 A;  5GST A;  4GLT A;  2C3Q A;  4MH2 A;  1EEM A;  1ZGN A;  1XWK A;  5HR1 A;  3UMA A;  1ACV A;  3H79 A;  4KW6 A;  2VIM A;  4NWY A;  4K0N A;  1XBS A;  4J2F A;  4V2L A;  3LJR A;  1SYX A;  1A23 A;  1A2L A;  3UL3 A;  2L6D A;  2J23 A;  3ZMK A;  1HYU A;  1T7P B;  1E2Y A;  4GRF A;  3W8J A;  3CMI A;  4ECJ A;  1F37 A;  1GRX A;  2YNX A;  1SD8 A;  4OWY A;  1GSY A;  3L4N A;  4ZXG A;  1RW1 A;  3KH9 A;  5IO0 A;  4KCE A;  3N9J A;  3LXT A;  1XWB A;  3WYW A;  1DE1 A;  5AIX A;  4TOP A;  3IA1 A;  2YV9 A;  2IMD A;  2M80 A;  2MBT A;  2GTU A;  2WGR A;  3ZLP A;  22GS A;  3A3T A;  1YEX A;  5E4W A;  3TJG A;  3BBY A;  5IO2 A;  5HFG A;  3IPZ A;  3TJF A;  3LSZ A;  4DEJ A;  2MMZ A;  1PL1 A;  2LRT A;  1GLP A;  5IM9 A;  1VGL A;  4L0U A;  3DRN A;  2KP1 A;  1OC3 A;  2HLS A;  3ZRD A;  2X8H A;  2P5R A;  3VWU A;  2XC2 A;  4ZB6 A;  4G10 A;  4TVE A;  2CVK A;  1GUL A;  1GNE A;  3EYT A;  3TJB A;  1GSD A;  2GQK A;  3DIE A;  2YV7 A;  3CBU A;  3TKS A;  3ZTL A;  5J9B A;  4TRX A;  4J56 E;  5G5F A;  4FH8 A;  3DKS A;  3MDK A;  2WZ9 A;  3FW2 A;  4WBR D;  3NIV A;  3IHQ A;  6GSY A;  1ZYE A;  1K3Y A;  3APQ A;  3KP9 A;  3WGD A;  4X1U A;  1PKW A;  2TRX A;  1TRS A;  2L4Q A;  2AUV A;  3HJO A;  2H0I A;  4H86 A;  3ZML A;  1V40 A;  2HI7 A;  2VL2 C;  3TKS E;  5CRW A;  4NHZ A;  1XPV A;  1WE0 A;  2E7P A;  3FZA A;  3O76 A;  2VLV A;  4POL A;  3J7Y k;  2PVO C;  3H8Q A;  4DVC A;  1U6T A;  2G2Q A;  2H1D A;  4PUR A;  3VUR A;  4KB3 A;  1SEN A;  2IWT A;  4DSR A;  5COH A;  1EOH A;  3VK9 A;  4HJ2 A;  2O87 A;  5IMC A;  4KND A;  2V41 A;  2Z9S A;  1URM A;  3BD2 A;  3KZQ A;  4HOJ A;  2H30 A;  2X64 A;  5HFK A;  1RQM A;  3KTB A;  3E0U A;  3FZ4 A;  2JAC A;  3TKQ A;  1T3B A;  2GT5 A;  2CVD A;  3GKM A;  1TRU A;  4MAB A;  4RQR A;  1LU4 A;  4JE1 A;  4JED A;  3DD3 A;  1HNC A;  3NOF A;  3KJY A;  4JZQ A;  5B6M A;  1BQ7 A;  4IHU A;  2FHE A;  1G7O A;  4I5Q A;  2RUF A;  3LQ7 A;  2L59 A;  2LJR A;  5FT3 A;  1GWC A;  1U3A A;  3F9U A;  2CT6 A;  1WWJ A;  1K0O A;  3ZRE A;  1ERV A;  1Z6N A;  3ZZX A;  1SKR B;  1SK1 A;  2GDR A;  5ECQ B;  2CAQ A;  4MF5 A;  5JWO B;  1WP0 A;  4LLR A;  5B8B A;  3GL5 A;  4KA0 A;  3HJP A;  1OKD A;  1X9S B;  1U87 A;  1GTI A;  2LV3 A;  5A5K A;  1MD3 A;  2DML A;  3F3Q A;  1TU7 A;  3QFA C;  3APO A;  4D73 B;  3QR6 A;  2N5B A;  5LNK e;  3L78 A;  1K3L A;  2E0Q A;  3CSI A;  2KP2 A;  2CZ2 A;  3C1S A;  1M2D A;  3WGX A;  3TKP A;  4N10 A;  1O7U A;  1OKT A;  2B1K A;  2AYT A;  1QMV A;  4HQS A;  5CYY A;  3RAZ A;  2DJ0 A;  2OBI A;  4IVF A;  2M72 A;  5ELA A;  2EC4 A;  4I8B A;  4KH7 A;  4KE3 A;  2X99 A;  4K2D A;  3VWW A;  5CRH A;  1M9B A;  2DJJ A;  5DBQ A;  3FK8 A;  4BWS A;  6GSU A;  3F4S A;  3EVI A;  4AGS A;  2YWO A;  4HUA A;  3EE2 A;  3LEF A;  4HZ2 A;  2FA8 A;  5IMV A;  20GS A;  4PGT A;  4TKY A;  4NV5 A;  3HVX A;  3A5W A;  2GSQ A;  2GGT A;  4EDZ A;  4RUV A;  4TXO B;  1WPI A;  2MZC A;  3C1R A;  1QXH A;  3UIW A;  3M0F A;  1TOF A;  2WRT A;  3H1N A;  3GL3 A;  2XPE A;  3VLN A;  1O73 A;  1J0F A;  4WBJ A;  4L5O A;  2B7J A;  5JWR B;  5ECI B;  2VD1 A;  5IPH A;  2NBS A;  3I9V 2;  4EO3 A;  1E6B A;  2C1Y A;  2FGX A;  2DSA A;  2ON5 A;  4PNG A;  4Z7X A;  3GX0 A;  2H1B A;  3JCM L;  3LG6 A;  1M2A A;  1QUW A;  3IBH A;  4KSM A;  2YAN A;  1R5A A;  1TU8 A;  1GSF A;  3GA4 A;  10GS A;  1I5G A;  1LBK A;  4XTS A;  2YCD A;  2NDO A;  2A4V A;  2H71 A;  2O89 A;  4ILF A;  3F4T A;  3ERG A;  6GSV A;  2WCI A;  1XOA A;  1RK4 A;  2I4A A;  2DLX A;  3US3 A;  4Q5R A;  5FWG A;  2GQM A;  4MJE A;  1KBN A;  4MZC A;  4EC0 A;  3HD5 A;  2H76 A;  1F6M C;  5CP1 A;  3KMO A;  3UEM A;  2OJL A;  2WJU A;  3DWV A;  4Q5N A;  5C00 A;  3VWV A;  1FHE A;  5AN1 A;  12GS A;  1EV9 A;  5H5Q A;  1XXU A;  1V58 A;  1CQG A;  3WD6 A;  1YJ6 A;  3GIX A;  4QQ7 A;  1TK5 B;  1BAY A;  4IJI A;  4JR4 A;  1V57 A;  4WR4 A;  3GTU A;  4FYC A;  3M3M A;  3BCK A;  5IMA A;  3TRQ A;  4F9Z A;  3EC3 A;  5D93 A;  1LJR A;  1G6Y A;  4ULX A;  2H0H A;  5GAN D;  1Z5Y E;  4F03 A;  1OE7 A;  1XWG A;  3LOR A;  1JLW A;  4NMU A;  2TIR A;  5D96 A;  3Q6O A;  5D9X A;  4EUY A;  2IIY A;  4G19 A;  2V1M A;  4N0V A;  1ML6 A;  3A2X A;  5J4U A;  4TXO A;  1KNG A;  3F63 A;  2R6K A;  1U3I A;  3IK9 A;  4KGI A;  1AAZ A;  4I2U A;  1EP8 A;  2VCV A;  4ZB9 A;  5CRG A;  2RUE A;  3FHK A;  4TR1 B;  1X9M B;  1F3B A;  1PQN A;  5AIV A;  5FHI A;  3D4T A;  2VCX A;  1XIY A;  3IOS A;  2KLX A;  1Y6E A;  4YAV A;  1XOB A;  4ZIL A;  2VLT A;  3HKR A;  3CSH A;  4POM A;  2QC7 A;  1G7E A;  4WEY A;  2CX3 A;  2H19 A;  1YY7 A;  2F8A A;  3H93 A;  3C8E A;  1SJ6 A;  2HFD A;  4V2N A;  1CQH A;  5J5N A;  5J9C A;  4YQM A;  3LYK A;  1K0A A;  4XHM A;  2VCQ A;  14GS A;  2VD0 A;  3UBL A;  1W89 A;  3MNG A;  3RHB A;  2FWG A;  3PGT A;  4FYB A;  3KCM A;  3FR9 A;  1K0C A;  3HVS A;  2WUL A;  4BVX A;  4LL1 B;  1VF3 A;  3RHC A;  2CX4 A;  5CAX A;  4BWQ A;  4AJ7 A;  5ELG A;  3GRX A;  5KN3 A;  1SJZ A;  4G9H A;  2R4V A;  4ML6 A;  4WF4 A;  2X8G A;  2FA4 A;  3BOA A;  4MJB A;  3HY2 A;  1A0R P;  4IN0 A;  1Q98 A;  2JZS A;  5HR2 A;  2ALB A;  1SU9 A;  4I6X A;  1NHO A;  1J9B A;  2DJ3 A;  4BL7 A;  1TW9 A;  2LST A;  4EF0 A;  1EGR A;  5IMF A;  2GS3 A;  1T00 A;  6GSS A;  4XRD A;  1TK0 B;  5H5R A;  3ED3 A;  5A4V A;  1W4V A;  5IMD A;  2OE3 A;  4WKW A;  4AJ6 A;  1DE2 A;  3GHA A;  1TI3 A;  1AQV A;  2GQL A;  3QCP A;  2D2Z A;  1QFN A;  3MSZ A;  4TR3 A;  1B4P A;  1ZYQ B;  1O8W A;  4I97 A;  1XW9 A;  3HXS A;  5DAL A;  3ZIJ A;  2DMM A;  2DJK A;  2WDU A;  3LYP A;  3WT1 A;  4RI6 A;  3FYG A;  3GSS A;  2GZP A;  4KDY A;  4PUA A;  1M9A A;  1F2E A;  2LNS A;  5B8A A;  3P2A A;  1EV4 A;  3TJJ A;  4O92 A;  2XBI A;  2MMA A;  2DC5 A;  2VL9 A;  4OMV A;  3IAS 2;  2FLS A;  2MMN A;  2YJH A;  3IC4 A;  2YN1 A;  2HT9 A;  4LMV A;  4TR1 A;  3GH9 A;  3KXO A;  2PUK C;  3VI5 A;  5KN0 A;  3IV4 A;  16GS A;  4MJC A;  2HZE B;  4X0X A;  5A4W A;  1WMJ A;  3RPN A;  4HI7 A;  3IR4 A;  4IQA A;  3ZFB A;  1SL2 B;  1NM3 A;  3QMX A;  1KEB A;  1YKC A;  2JAD A;  2JU5 A;  3UJ1 A;  2LKU A;  1OC8 A;  4OFT A;  1GTA A;  2HXK A;  4TXV A;  3KD0 A;  1EEJ A;  3QAV A;  2GZZ A;  2YZU A;  2DBC A;  4MCU A;  4KX4 A;  2VCW A;  1HNA A;  1PX7 A;  3AY8 A;  3E3E A;  3IAM 2;  3TOU A;  2HNL A;  1Z7P A;  2P0G A;  2YZH A;  4ZBD A;  2NPB A;  3DEX A;  5ECM B;  3GX8 A;  2YWI A;  1DUG A;  3TCO A;  1TP9 A;  2H6Z A;  1I9D A;  4IW9 A;  3M9K A;  1SKW B;  1NHY A;  4L5L A;  1F9M A;  1MDI A;  3UVH A;  1M2B A;  2BMX A;  2HRF A;  4ZB8 A;  5GAP D;  1FB0 A;  5EVO A;  2VO4 A;  5DQS A;  1ST9 A;  4EDY A;  3DYR A;  1O81 A;  2AAW A;  4MF6 A;  3BCI A;  4NV2 A;  2QGV A;  2C3N A;  3EMP A;  5G31 A;  4PX1 A;  2VCT A;  3I69 A;  3LFL A;  1R5P A;  3QD9 A;  2LQQ A;  1YEP A;  1JFU A;  3FEU A;  5HFI A;  1XWA A;  4XS1 A;  1XCC A;  2I3Y A;  4JR6 A;  5INY A;  4OO4 A;  3GNJ A;  1T4Y A;  2NTO A;  3CRU A;  4IGJ A;  4P3Y B;  5A4U A;  2C80 A;  3UAR A;  1G0T A;  1VF4 A;  4GSS A;  3GYK A;  3Q18 A;  1OE8 A;  1XW6 A;  3ISO A;  3PH9 A;  2AV4 A;  2M46 A;  2BTO T;  2K8S A;  5B6N A;  4MDC A;  1N2A A;  1VRS D;  1Q4J A;  4GF0 A;  1K3O A;  3GV1 A;  1V9W A;  5JCU A;  1DSB A;  2I9H A;  1X5D A;  4PUF C;  1ERW A;  3GKX A;  2OE1 A;  3GTU B;  3MAK A;  3TUE A;  3O6T A;  2I1U A;  2H1G A;  3RPP A;  2YJ7 A;  2PPT A;  5CO3 A;  1IYH A;  5EL8 A;  5G30 A;  3LXZ A;  1ILO A;  1USB A;  2WS2 A;  4TR4 A;  3ZL5 A;  2H66 A;  4KDU A;  3CRT A;  1ZZY A;  11GS A;  1T8E B;  2HZE A;  2R37 A;  4MPF A;  4N11 A;  4HZ4 A;  1JZO A;  1JHB A;  5IPG A;  2JZR A;  2O8V B;  5G1K A;  18GS A;  2IME A;  1DBY A;  2C3T A;  3L9U A;  2IMF A;  3ZFL A;  1ZL9 A;  5GZZ B;  1N8J A;  1TRW A;  4PQI A;  3ZYW A;  1KTE A;  5DCH A;  2O7K A;  1AQX A;  2V2G A;  2B5X A;  1HQO A;  3EMX A;  2JSZ A;  1BX9 A;  3A2W A;  1EP7 A;  1O6J A;  2V6K A;  4OD7 A;  5DJM A;  3RDW A;  2OKA A;  1ZMA A;  2CVB A;  5ABR A;  4HJM A;  1PD2 1;  2AHE A;  2CA8 A;  2IMK A;  1S3D A;  2HRN A;  4IJ3 A;  5IOX A;  2L5O A;  3L9V A;  1JZW A;  5D9T A;  4AF2 A;  1GSU A;  4MZB A;  4GWR A;  4MA9 A;  4FO5 A;  1Z7R A;  2PMT A;  2FY6 A;  4PNF A;  5CRD A;  2JZT A;  1WJK A;  4MMM A;  1Y25 A;  3GFK A;  4J57 E;  3D4M A;  5HR0 A;  4V1A g;  1AUC A;  1FVK A;  4IKH A;  2PER A;  5AIS A;  6GSW A;  2VM2 A;  1OAZ A;  4KAE A;  2ZNM A;  5H5S A;  4KSO A;  2RII A;  4OO5 A;  1MEK A;  1A2M A;  4WXT A;  4YAP A;  2NVL A;  3F0I A;  4OFM A;  3D0Z A;  1A2J A;  1M7T A;  4FIW A;  1EGO A;  1SJI A;  2PBJ A;  1UA5 A;  1UC7 A;  2LRC A;  1X9W B;  3KMN A;  4QL9 A;  3CTF A;  3TRX A;  3ZIV A;  4FYU A;  3D5J A;  3APS A;  3N5O A;  3C7M A;  3M8N A;  1JZD A;  3W8S A;  3ZVJ A;  1XVQ A;  3GMF A;  1PKZ A;  2C0G A;  1S3A A;  3WGE A;  1SKS B;  2VLU A;  1GUM A;  3UBK A;  3E9J B;  3G9B A;  4HU9 A;  3R2Q A;  2ON7 A;  5F8B A;  5DAL B;  5F06 A;  3HCZ A;  2YWM A;  2IN3 A;  3ERF A;  3U6V A;  3DGQ A;  2E2M A;  4XIH A;  2LEG A;  2LTK A;  4XS6 A;  4YH2 A;  4ZL7 A;  4WR5 A;  1TKD B;  1H4O A;  2B5E A;  5F07 A;  2VM1 A;  2VUP A;  5LCZ A;  2FD3 A;  1AIU A;  3O3T A;  2CAI A;  1JZR A;  4JBB A;  5E59 A;  5JCG A;  5IOW A;  1V98 A;  4GST A;  3GUS A;  1TXX A;  2H72 A;  3L9S A;  2LJA A;  5CNW A;  1A8Y A;  2CZ3 A;  4ZL8 A;  4EXJ A;  2FWE A;  3IRA A;  3IK7 A;  4K0G A;  3G7Y A;  3KGK A;  4YQV A;  3W6G A;  2JSY A;  3DVW A;  3WT2 A;  2K18 A;  4PXO A;  4E8H A;  2LQO A;  4N30 A;  3D21 A;  4F0B A;  1V2A A;  3HHV A;  2FWF A;  3HJM A;  4K7O A;  4O5R A;  4F2I A;  3HYP A;  1GL8 A;  3FY7 A;  4LL4 B;  2C0F A;  3F3R A;  4K9Z A;  4HU7 A;  2H75 A;  2QKE A;  3BJ5 A;  2PVQ A;  2N5F A;  4GSN A;  1PL2 A;  5ECN B;  3FZ9 A;  1QGV A;  2RLI A;  1PMT A;  4IP6 A;  5L71 A;  3VPQ A;  1OC9 B;  4ZL9 A;  3GKK A;  4NAX A;  4OFN A;  5KEJ A;  2GSR A;  1T1V A;  3ERW A;  2MYG A;  1EZK A;  3TDG A;  2IFQ B;  3KP8 A;  4ZBB A;  3CXG A;  1X5C A;  3TRP A;  5J41 A;  3UVT A;  2WB9 A;  4TW5 A;  4MZW A;  5DAK B;  5LD0 A;  2XHF A;  1XVW A;  1THO A;  3LWA A;  3M1G A;  3QFB C;  4DSS B;  1QQ2 A;  2QSI A;  4ZBA A;  1H75 A;  1M0U A;  3GUR A;  2L6C A;  4XCS A;  1OYJ A;  3G7J A;  1NSW A;  1VF2 A;  1A8L A;  2F8F A;  2HZF A;  4K7I A;  2WFC A;  4QL7 A;  4HS1 A;  3LGC A;  5HQP A;  3J7Y b;  1HNB A;  5DVB A;  2HSH A;  1Z3E A;  1X0R A;  4BA7 A;  1K0N A;  1PRX A;  4V1A p;  2CQ9 A;  2A2R A;  1BYE A;  4GQC A;  3ME7 A;  5KN1 A;  1THX A;  3DXB A;  2ES7 A;  3FKF A;  1MD4 A;  4ECB A;  2FUG 2;  4MJA A;  1AQW A;  1YKA A;  1XZO A;  1TJD A;  3KEB A;  4JU5 A;  2OA7 A;  2B6M A;  2J9H A;  4I2T A;  3GH6 A;  4HQZ A;  5G2Z A;  1EWX A;  5EPF A;  1GSE A;  2E2G A;  4F82 A;  2L57 A;  1GTU A;  3L0H A;  4L0W A;  2GSS A;  4YQU A;  1FB6 A;  4ID0 A;  1R7H A;  1YQ1 A;  5F05 A;  4EKZ A;  2DJ2 A;  1Z9H A;  1GLQ A;  1XFL A;  1O85 A;  1SYR A;  1TK8 B;  1WIK A;  2H1A A;  2XPD A;  4CDO A;  3C73 A;  2AB6 A;  1IYI A;  4POK A;  2H0G A;  3TOT A;  1FAA A;  5HR3 A;  4EL1 A;  1XW5 A;  4LMW A;  2F9S A;  3I6A A;  5ENU A;  5DQY A;  3KH7 A;  1F3A A;  3SWL A;  3CTG A;  4LA1 A;  4ML1 A;  2V32 A;  3IXR A;  2H70 A;  3G7I A;  5J3R A;  3QAW A;  5IQY A;  3VI7 A;  4O7H A;  1GSQ A;  1YF0 A;  4IQ1 A;  1M99 A;  1T4Z A;  4GQF A;  5ECL B;  4EE0 A;  3PR8 A;  2K9F A;  3MWH A;  1S3C A;  1R4W A;  3A2V A;  2N5A A;  2X8C A;  6GSX A;  4V2M A;  2GZY A;  4MH3 A;  5AGY A;  1WOU A;  2TRC P;  1SL0 B;  5D73 A;  2V6O A;  1OC9 A;  3HDC A;  2DJ1 A;  2EIO A; 
#chains in the Genus database with same CATH topology
 3FRC A;  2KHP A;  4BPY A;  8GSS A;  2H01 A;  3SBC A;  2P31 A;  4HDE A;  3VWX A;  3EIN A;  2O85 A;  4L8E A;  2IFQ A;  3FZ5 A;  4O32 A;  5JWQ B;  3DML A;  3PIN A;  5DAK A;  3Q19 A;  4N0Z A;  2R3X A;  2XBQ A;  3FMW A;  4RI7 A;  2FCH A;  2YWN A;  4BVY A;  4DSS A;  5GSS A;  2C8U A;  2X49 A;  2BJX A;  1ZCP A;  3Q74 A;  4DSQ A;  4IBP A;  1OVN A;  1TI1 A;  2B1L A;  3V1W A;  3DVX A;  4F0C A;  2B5Y A;  1K0B A;  4IP1 A;  1B48 A;  3I43 A;  2LS5 A;  4XS4 B;  3P7X A;  4KUN A;  3F4R A;  1J08 A;  3HZ8 A;  5ECK B;  2EIR A;  4CHS A;  4Q5Q A;  2VAF A;  4TR0 A;  1BG5 A;  2R0P A;  1WRY A;  1ABA A;  3MYD A;  1YF1 A;  5B7C A;  2EIQ A;  4GXZ A;  4EVM A;  1AXD A;  2C4J A;  3D6I A;  1ERT A;  2LUS A;  5ECP B;  1TRV A;  4NHW A;  3RBT A;  5D8I A;  4TN8 A;  2OBK A;  1NW2 A;  1ZYN A;  3VFI A;  2F51 A;  1A24 A;  1SD9 A;  4IS0 A;  2F3M A;  1B9Y C;  6GST A;  2OE0 A;  3IE3 A;  1JLV A;  4GTU A;  4ECC A;  3EUR A;  5ID2 B;  3ZIT A;  3KM6 A;  5G5E A;  4MLY A;  4E8E A;  2HSY A;  4KDX A;  1X5E A;  1FW1 A;  3TGZ A;  5F0G A;  3K8N A;  2L5L A;  2PGT A;  5G1L A;  3ZVJ D;  2H73 A;  4ICY A;  1S3R A;  2OAC A;  4POB A;  4RQX A;  19GS A;  3UOM A;  4WF5 A;  2R5G A;  1MDK A;  1C72 A;  5ECS A;  1SK2 A;  1HD2 A;  4ISD A;  1PX6 A;  1K0M A;  5EY6 A;  2H6X A;  2KUC A;  4NPB A;  2H8L A;  3TKS C;  13GS A;  2FNO A;  3P8W A;  3QDN A;  3F6F A;  2DIZ A;  2RM6 A;  3C71 A;  1GH2 A;  2YOI A;  5IMZ A;  1ON4 A;  4K8M A;  1PA3 A;  2VCZ A;  2IMI A;  17GS A;  1YDK A;  3CYN A;  5ECH B;  5JCW A;  2K6V A;  1R26 A;  1FO5 A;  2JL4 A;  4MPG A;  2R2J A;  2A2S A;  2GT6 A;  1ZOF A;  2G0F A;  4IEL A;  2KOK A;  2IPA A;  1K0D A;  2RM5 A;  3HA9 A;  4A5P A;  2L4C A;  5D9W A;  2CV4 A;  3EU4 A;  3TKR A;  1GP1 A;  4OCE A;  1SL1 B;  2OAD A;  1UVZ A;  2GLR A;  1VF1 A;  1A0F A;  4AJ8 A;  1B8X A;  3D22 A;  2P5Q A;  2GVP A;  2C0D A;  1O8X A;  1FVJ A;  4X43 A;  1SK0 A;  4KCA A;  4EIQ A;  4XS4 A;  4PQ1 A;  4JRR A;  3KIJ A;  2IL3 A;  2VOC A;  2R0C A;  4GCI A;  3EWL A;  2YP6 A;  2MBS A;  5KN2 A;  4ACS A;  4D73 A;  1B9X C;  3U5R E;  2REM A;  3QOU A;  2AJQ B;  1PSQ A;  3P90 A;  4PQH A;  5DJL A;  3KTL A;  4HEA 2;  1Z6M A;  1G6W A;  3QAG A;  4K1F A;  1QK8 A;  2VL2 A;  3UAP A;  1B4Q A;  5DDL A;  2GST A;  3H4K A;  3ME8 A;  2HYX A;  1MDJ A;  2I81 A;  5C04 A;  3M9J A;  4Q5F A;  3QPM A;  4ECI A;  5BMU A;  3HVV A;  2K8V A;  2C0E A;  5ECO B;  2DKH A;  2LRN A;  3OR5 A;  1FOV A;  2B3S A;  1YZX A;  1EOG A;  4K7N A;  3GN3 A;  3EU3 A;  3TJK A;  1FG4 A;  2PWJ A;  5IIZ A;  3GKN A;  5CRE A;  1BED A;  5ID2 A;  1TTZ A;  4MF7 A;  2H74 A;  2B7K A;  3CSJ A;  1AW9 A;  2HE3 A;  3VPT A;  2LNT A;  1PN9 A;  3HZ4 A;  2VL3 A;  9GSS A;  4OCF A;  3IDV A;  1XWC A;  1U88 A;  4X4J A;  4ZIJ A;  2IJY A;  5D9V A;  4XRA A;  1MTC A;  2ZUP A;  5DCG A;  1UN2 A;  1GUH A;  7GSS A;  1PGT A;  4MK3 A;  4K6X A;  3GST A;  2LJK A;  2PN8 A;  4G2E A;  1BJX A;  1GTB A;  3S9F A;  1AC1 A;  2H6Y A;  1GUK A;  2ZCT A;  4MP4 A;  2FWH A;  4NXI A;  3FR3 A;  3FR6 A;  2PU9 C;  3F8U A;  3F6D A;  1TDI A;  4WET A;  2DIY A;  2MMO A;  1ERU A;  3NZN A;  5ECR B;  1GSS A;  4CW9 A;  1GNW A;  2YPM A;  3TB2 A;  5GST A;  2QA1 A;  4GLT A;  2C3Q A;  4MH2 A;  1EEM A;  1ZGN A;  1XWK A;  5HR1 A;  3UMA A;  1ACV A;  3H79 A;  4KW6 A;  2VIM A;  4NWY A;  3R3E A;  4K0N A;  1XBS A;  4J2F A;  4V2L A;  3LJR A;  1SYX A;  1A23 A;  1A2L A;  3UL3 A;  2L6D A;  2J23 A;  3ZMK A;  1HYU A;  1T7P B;  1E2Y A;  4GRF A;  3W8J A;  3CQF A;  3CMI A;  4ECJ A;  1F37 A;  1GRX A;  2YNX A;  1SD8 A;  4OWY A;  1GSY A;  3L4N A;  4ZXG A;  1RW1 A;  4BVY B;  3KH9 A;  5IO0 A;  4KCE A;  1XG8 A;  3N9J A;  3LXT A;  1XWB A;  3WYW A;  1DE1 A;  5AIX A;  4TOP A;  3IA1 A;  2YV9 A;  2QA2 A;  2IMD A;  2M80 A;  2MBT A;  2GTU A;  2WGR A;  3ZLP A;  22GS A;  3A3T A;  1YEX A;  5E4W A;  3TJG A;  3BBY A;  5IO2 A;  5HFG A;  3IPZ A;  3TJF A;  3LSZ A;  4DEJ A;  2MMZ A;  1PL1 A;  2LRT A;  1GLP A;  5IM9 A;  1VGL A;  4L0U A;  3DRN A;  2KP1 A;  1OC3 A;  2HLS A;  3ZRD A;  2X8H A;  2P5R A;  3VWU A;  2XC2 A;  4ZB6 A;  4G10 A;  4TVE A;  2CVK A;  1GUL A;  1GNE A;  3EYT A;  3TJB A;  1GSD A;  2GQK A;  3DIE A;  2YV7 A;  3CBU A;  3TKS A;  3ZTL A;  5J9B A;  3LW9 A;  4TRX A;  4J56 E;  5G5F A;  4FH8 A;  3DKS A;  3MDK A;  2WZ9 A;  3FW2 A;  4WBR D;  3NIV A;  3IHQ A;  6GSY A;  1ZYE A;  1K3Y A;  3APQ A;  3KP9 A;  3WGD A;  4USS A;  4X1U A;  1PKW A;  2TRX A;  1TRS A;  2L4Q A;  2AUV A;  3HJO A;  2H0I A;  4H86 A;  3ZML A;  1V40 A;  2HI7 A;  2VL2 C;  3TKS E;  5CRW A;  4NHZ A;  1XPV A;  1WE0 A;  2E7P A;  3FZA A;  3O76 A;  2VLV A;  4POL A;  3J7Y k;  2PVO C;  3H8Q A;  4DVC A;  1U6T A;  2G2Q A;  2H1D A;  4PUR A;  3VUR A;  4KB3 A;  1SEN A;  2IWT A;  4DSR A;  5COH A;  1EOH A;  3VK9 A;  4HJ2 A;  2O87 A;  5IMC A;  4KND A;  2V41 A;  2Z9S A;  1URM A;  3BD2 A;  3KZQ A;  4HOJ A;  2H30 A;  2X64 A;  5HFK A;  1RQM A;  3KTB A;  3E0U A;  3FZ4 A;  1FOH A;  2JAC A;  3TKQ A;  1T3B A;  2GT5 A;  2CVD A;  3GKM A;  1TRU A;  4MAB A;  4RQR A;  1LU4 A;  4JE1 A;  4JED A;  3DD3 A;  1HNC A;  3NOF A;  3KJY A;  5B6M A;  4JZQ A;  1BQ7 A;  4IHU A;  2FHE A;  1G7O A;  4I5Q A;  2RUF A;  2A2P A;  3LQ7 A;  2L59 A;  2LJR A;  5FT3 A;  1GWC A;  1U3A A;  3F9U A;  2CT6 A;  1WWJ A;  1K0O A;  3ZRE A;  1ERV A;  1Z6N A;  3ZZX A;  1SKR B;  4BIK A;  1SK1 A;  2GDR A;  5ECQ B;  2CAQ A;  4MF5 A;  5JWO B;  1WP0 A;  4LLR A;  5B8B A;  3GL5 A;  4KA0 A;  3HJP A;  1OKD A;  1X9S B;  1U87 A;  1GTI A;  2LV3 A;  5A5K A;  1MD3 A;  2DML A;  3F3Q A;  1TU7 A;  3QFA C;  3APO A;  4D73 B;  3QR6 A;  2N5B A;  5LNK e;  3L78 A;  1K3L A;  2E0Q A;  3CSI A;  2KP2 A;  2CZ2 A;  3C1S A;  1M2D A;  3WGX A;  3IHG A;  3TKP A;  4N10 A;  1O7U A;  1OKT A;  2B1K A;  2AYT A;  1QMV A;  2R0G A;  4HQS A;  5CYY A;  3RAZ A;  2DJ0 A;  2OBI A;  4IVF A;  2M72 A;  5ELA A;  2EC4 A;  4I8B A;  4KH7 A;  4O5Q A;  4KE3 A;  2X99 A;  4K2D A;  3VWW A;  5CRH A;  1M9B A;  2DJJ A;  5DBQ A;  3FK8 A;  4BWS A;  6GSU A;  3F4S A;  3EVI A;  4AGS A;  2YWO A;  4HUA A;  3EE2 A;  3LEF A;  4HZ2 A;  2FA8 A;  5IMV A;  20GS A;  4PGT A;  4TKY A;  4NV5 A;  3HVX A;  3A5W A;  2GSQ A;  2GGT A;  4EDZ A;  4RUV A;  5KOW A;  4TXO B;  1WPI A;  2MZC A;  3C1R A;  1QXH A;  3UIW A;  3M0F A;  1TOF A;  2WRT A;  3H1N A;  3GL3 A;  2XPE A;  3VLN A;  1O73 A;  1J0F A;  2DKI A;  4WBJ A;  4L5O A;  2B7J A;  5JWR B;  5ECI B;  2VD1 A;  5IPH A;  2NBS A;  3I9V 2;  4EO3 A;  1E6B A;  2C1Y A;  2FGX A;  2DSA A;  2ON5 A;  4PNG A;  4Z7X A;  3GX0 A;  2H1B A;  3JCM L;  3LG6 A;  4Z2T A;  1M2A A;  1QUW A;  3IBH A;  4KSM A;  2YAN A;  1R5A A;  1TU8 A;  1GSF A;  3GA4 A;  10GS A;  1I5G A;  1LBK A;  4XTS A;  2YCD A;  2NDO A;  2A4V A;  2H71 A;  2O89 A;  4ILF A;  3F4T A;  3ERG A;  6GSV A;  2WCI A;  1XOA A;  4BVX B;  1RK4 A;  4G0K A;  2I4A A;  2DLX A;  3US3 A;  4Q5R A;  5FWG A;  3EPT A;  2GQM A;  4MJE A;  1KBN A;  4MZC A;  4EC0 A;  3HD5 A;  2H76 A;  1F6M C;  5CP1 A;  3KMO A;  3UEM A;  2OJL A;  2WJU A;  3DWV A;  4Q5N A;  5C00 A;  3VWV A;  4BL7 B;  1FHE A;  5AN1 A;  12GS A;  1EV9 A;  5H5Q A;  1XXU A;  1V58 A;  1CQG A;  3WD6 A;  1YJ6 A;  3GIX A;  4K5R A;  4QQ7 A;  4YKF A;  1TK5 B;  1BAY A;  4IJI A;  4JR4 A;  1V57 A;  4WR4 A;  3GTU A;  4FYC A;  3M3M A;  3BCK A;  5IMA A;  2X4A A;  3TRQ A;  4F9Z A;  3EC3 A;  5D93 A;  1LJR A;  1G6Y A;  4ULX A;  4HSC X;  2H0H A;  5GAN D;  2A4H A;  1Z5Y E;  4F03 A;  1OE7 A;  1XWG A;  3LOR A;  1JLW A;  4NMU A;  2TIR A;  5D96 A;  3Q6O A;  5D9X A;  4EUY A;  2IIY A;  4G19 A;  2V1M A;  4N0V A;  1ML6 A;  3A2X A;  5J4U A;  4TXO A;  1KNG A;  3F63 A;  2R6K A;  1U3I A;  3IK9 A;  4KGI A;  1AAZ A;  4I2U A;  1EP8 A;  2VCV A;  4ZB9 A;  5CRG A;  2RUE A;  3FHK A;  4TR1 B;  1X9M B;  1F3B A;  1PQN A;  5AIV A;  5FHI A;  3D4T A;  2VCX A;  1XIY A;  3IOS A;  2KLX A;  1Y6E A;  4YAV A;  1XOB A;  4ZIL A;  2VLT A;  3HKR A;  3CSH A;  4POM A;  2QC7 A;  1G7E A;  4WEY A;  2CX3 A;  2H19 A;  1YY7 A;  2F8A A;  3H93 A;  3C8E A;  1SJ6 A;  2HFD A;  4V2N A;  1CQH A;  5J5N A;  5J9C A;  4YQM A;  3LYK A;  1K0A A;  4XHM A;  2VCQ A;  14GS A;  2VD0 A;  3UBL A;  5KOX A;  1W89 A;  3MNG A;  1PN0 A;  3RHB A;  2FWG A;  3PGT A;  4FYB A;  3KCM A;  3FR9 A;  1K0C A;  3HVS A;  2WUL A;  4BVX A;  4G0L A;  4LL1 B;  1VF3 A;  3RHC A;  2CX4 A;  5CAX A;  4BWQ A;  4AJ7 A;  5ELG A;  3GRX A;  5KN3 A;  1SJZ A;  4G9H A;  2R4V A;  4ML6 A;  4WF4 A;  2X8G A;  2FA4 A;  3BOA A;  4MJB A;  3HY2 A;  1A0R P;  2UZ8 A;  4IN0 A;  1Q98 A;  2JZS A;  5HR2 A;  2ALB A;  1SU9 A;  4I6X A;  1NHO A;  1J9B A;  2DJ3 A;  4BL7 A;  1TW9 A;  2LST A;  4EF0 A;  1EGR A;  5IMF A;  2GS3 A;  1T00 A;  6GSS A;  4XRD A;  1TK0 B;  5H5R A;  3ED3 A;  5A4V A;  1W4V A;  5IMD A;  2OE3 A;  4WKW A;  5BRT A;  4AJ6 A;  1DE2 A;  3GHA A;  1TI3 A;  1AQV A;  2GQL A;  3QCP A;  2D2Z A;  1QFN A;  3MSZ A;  4TR3 A;  1B4P A;  1ZYQ B;  1O8W A;  4I97 A;  1XW9 A;  3HXS A;  5DAL A;  3ZIJ A;  2DMM A;  2DJK A;  2WDU A;  3LYP A;  3WT1 A;  4RI6 A;  3FYG A;  3GSS A;  2GZP A;  4KDY A;  4PUA A;  1M9A A;  1F2E A;  2LNS A;  5B8A A;  3P2A A;  3PPU A;  1EV4 A;  2HSM A;  3TJJ A;  4O92 A;  2XBI A;  2MMA A;  2DC5 A;  2HRA A;  2VL9 A;  4OMV A;  3IAS 2;  2FLS A;  2MMN A;  2YJH A;  3MIX A;  3IC4 A;  4Z2U A;  2YN1 A;  2HT9 A;  4LMV A;  4TR1 A;  3GH9 A;  3KXO A;  2PUK C;  3VI5 A;  5KN0 A;  3IV4 A;  16GS A;  4MJC A;  2HZE B;  4X0X A;  5A4W A;  1WMJ A;  4CY6 A;  3RPN A;  4HI7 A;  3IR4 A;  4IQA A;  3ZFB A;  1M3J A;  1SL2 B;  1NM3 A;  3QMX A;  1KEB A;  1YKC A;  2JAD A;  2JU5 A;  3UJ1 A;  2LKU A;  1OC8 A;  4OFT A;  1GTA A;  2HXK A;  4TXV A;  3KD0 A;  1EEJ A;  3QAV A;  2GZZ A;  2YZU A;  2DBC A;  4MCU A;  4KX4 A;  2VCW A;  1HNA A;  1PX7 A;  3AY8 A;  3E3E A;  3IAM 2;  3TOU A;  2HNL A;  1Z7P A;  2P0G A;  2YZH A;  4ZBD A;  2NPB A;  3DEX A;  5ECM B;  3GX8 A;  2YWI A;  1DUG A;  3TCO A;  1TP9 A;  2H6Z A;  1I9D A;  4IW9 A;  3M9K A;  1SKW B;  1NHY A;  4L5L A;  1F9M A;  1MDI A;  3UVH A;  1M2B A;  2BMX A;  2HRF A;  4ZB8 A;  5GAP D;  1FB0 A;  5EVO A;  2VO4 A;  5DQS A;  1ST9 A;  4EDY A;  3DYR A;  1O81 A;  2AAW A;  4MF6 A;  3BCI A;  4NV2 A;  2QGV A;  2C3N A;  3EMP A;  5G31 A;  4PX1 A;  2VCT A;  3I69 A;  3LFL A;  1R5P A;  3QD9 A;  2LQQ A;  1YEP A;  1JFU A;  3FEU A;  5HFI A;  1XWA A;  4XS1 A;  1XCC A;  2I3Y A;  4JR6 A;  5INY A;  4OO4 A;  3GNJ A;  1T4Y A;  2NTO A;  3CRU A;  4IGJ A;  4KF9 A;  4P3Y B;  5A4U A;  2C80 A;  3UAR A;  1G0T A;  1VF4 A;  4GSS A;  3GYK A;  3IC8 A;  3Q18 A;  1OE8 A;  1XW6 A;  3ISO A;  3PH9 A;  2AV4 A;  2M46 A;  2BTO T;  2K8S A;  5B6N A;  4MDC A;  1N2A A;  1VRS D;  1Q4J A;  4CY8 A;  4GF0 A;  1K3O A;  3GV1 A;  1V9W A;  5JCU A;  1DSB A;  2I9H A;  1X5D A;  4PUF C;  1ERW A;  3GKX A;  2OE1 A;  3GTU B;  3MAK A;  3TUE A;  3O6T A;  2I1U A;  2H1G A;  3RPP A;  2YJ7 A;  2PPT A;  5CO3 A;  1IYH A;  5EL8 A;  5G30 A;  3LXZ A;  1ILO A;  1USB A;  2WS2 A;  4TR4 A;  3ZL5 A;  2H66 A;  4KDU A;  3CRT A;  1ZZY A;  11GS A;  1T8E B;  2HZE A;  2R37 A;  4MPF A;  4N11 A;  4HZ4 A;  1JZO A;  1JHB A;  5IPG A;  2JZR A;  2O8V B;  5G1K A;  18GS A;  2IME A;  1DBY A;  2C3T A;  3L9U A;  2IMF A;  3ZFL A;  1ZL9 A;  5GZZ B;  1N8J A;  1TRW A;  4PQI A;  3ZYW A;  1KTE A;  5DCH A;  2O7K A;  1AQX A;  2V2G A;  2B5X A;  1HQO A;  3EMX A;  2JSZ A;  1BX9 A;  3A2W A;  1EP7 A;  1O6J A;  2V6K A;  4OD7 A;  5DJM A;  3RDW A;  2OKA A;  1ZMA A;  2CVB A;  5ABR A;  4HJM A;  1PD2 1;  2AHE A;  2CA8 A;  2IMK A;  1S3D A;  2HRN A;  4IJ3 A;  5IOX A;  2L5O A;  3A5I A;  3L9V A;  1JZW A;  5D9T A;  4AF2 A;  1GSU A;  4MZB A;  4GWR A;  4MA9 A;  4FO5 A;  1Z7R A;  2PMT A;  2FY6 A;  4PNF A;  5CRD A;  2JZT A;  1WJK A;  4MMM A;  1Y25 A;  3GFK A;  4J57 E;  3D4M A;  5HR0 A;  4V1A g;  1AUC A;  1FVK A;  4K2X A;  4IKH A;  2PER A;  5AIS A;  6GSW A;  2VM2 A;  1OAZ A;  4KAE A;  2ZNM A;  5H5S A;  4KSO A;  2RII A;  4OO5 A;  1MEK A;  1A2M A;  4WXT A;  4YAP A;  2NVL A;  3F0I A;  4OFM A;  3D0Z A;  1A2J A;  4Z2R A;  1M7T A;  4FIW A;  1EGO A;  1SJI A;  2PBJ A;  1UA5 A;  1UC7 A;  2LRC A;  1X9W B;  3KMN A;  4YKG A;  4QL9 A;  3CTF A;  3TRX A;  3ZIV A;  4FYU A;  3D5J A;  3APS A;  3N5O A;  3C7M A;  3M8N A;  2HRK A;  1JZD A;  3W8S A;  3ZVJ A;  1XVQ A;  3GMF A;  1PKZ A;  2C0G A;  1S3A A;  3WGE A;  1SKS B;  2VLU A;  1GUM A;  3UBK A;  3E9J B;  3G9B A;  1PFO A;  4HU9 A;  3R2Q A;  2ON7 A;  5F8B A;  5DAL B;  5F06 A;  3HCZ A;  2YWM A;  2IN3 A;  3ERF A;  3U6V A;  3DGQ A;  2E2M A;  4XIH A;  2LEG A;  2LTK A;  4XS6 A;  4YH2 A;  4ZL7 A;  4WR5 A;  1TKD B;  1H4O A;  2B5E A;  5F07 A;  2VM1 A;  2VUP A;  5LCZ A;  2FD3 A;  1AIU A;  3O3T A;  2CAI A;  1JZR A;  1M3I A;  4JBB A;  5E59 A;  5JCG A;  5IOW A;  1V98 A;  4GST A;  3GUS A;  4EIP A;  1TXX A;  2H72 A;  4MNN A;  3L9S A;  2LJA A;  5CNW A;  1A8Y A;  2CZ3 A;  4ZL8 A;  4EXJ A;  2FWE A;  3IRA A;  3IK7 A;  4K0G A;  3G7Y A;  3KGK A;  4YQV A;  3W6G A;  2JSY A;  3DVW A;  3WT2 A;  2K18 A;  4PXO A;  4E8H A;  2LQO A;  4N30 A;  4K5S A;  3D21 A;  4F0B A;  1V2A A;  3HHV A;  2FWF A;  3HJM A;  4K7O A;  4O5R A;  4F2I A;  3HYP A;  1GL8 A;  3FY7 A;  4LL4 B;  2C0F A;  3F3R A;  4G0I A;  4K9Z A;  4HU7 A;  2H75 A;  2QKE A;  3BJ5 A;  2PVQ A;  2N5F A;  4GSN A;  1PL2 A;  5ECN B;  3FZ9 A;  1QGV A;  2RLI A;  1PMT A;  4IP6 A;  5L71 A;  3VPQ A;  1OC9 B;  4ZL9 A;  3GKK A;  4NAX A;  4OFN A;  5KEJ A;  2GSR A;  1T1V A;  3ERW A;  2MYG A;  1EZK A;  3TDG A;  2IFQ B;  3KP8 A;  4ZBB A;  3CXG A;  1X5C A;  3TRP A;  5J41 A;  3UVT A;  2WB9 A;  4TW5 A;  4MZW A;  5DAK B;  5LD0 A;  2XHF A;  1XVW A;  1THO A;  3LWA A;  4O5U A;  3M1G A;  3QFB C;  4DSS B;  1QQ2 A;  2QSI A;  4ZBA A;  1H75 A;  1M0U A;  3GUR A;  2L6C A;  4XCS A;  1OYJ A;  1ZYP A;  3G7J A;  1NSW A;  1VF2 A;  1A8L A;  2F8F A;  2HZF A;  4K7I A;  2WFC A;  4QL7 A;  4HS1 A;  3LGC A;  5HQP A;  3J7Y b;  1HNB A;  5DVB A;  2HSH A;  1Z3E A;  1X0R A;  4BA7 A;  1K0N A;  1PRX A;  4V1A p;  2CQ9 A;  2A2R A;  1BYE A;  4GQC A;  3ME7 A;  5KN1 A;  1THX A;  3DXB A;  2ES7 A;  3FKF A;  1MD4 A;  4ECB A;  2FUG 2;  4MJA A;  1AQW A;  1YKA A;  1XZO A;  1TJD A;  3KEB A;  4JU5 A;  2OA7 A;  2B6M A;  2J9H A;  4I2T A;  3GH6 A;  4HQZ A;  5G2Z A;  1EWX A;  5EPF A;  1GSE A;  2E2G A;  4F82 A;  2L57 A;  1GTU A;  3L0H A;  4L0W A;  2GSS A;  4YQU A;  1FB6 A;  4ID0 A;  1R7H A;  1YQ1 A;  5F05 A;  4EKZ A;  2DJ2 A;  1Z9H A;  1GLQ A;  1XFL A;  1O85 A;  1SYR A;  1TK8 B;  1WIK A;  2H1A A;  2XPD A;  4CDO A;  3C73 A;  2AB6 A;  1IYI A;  4POK A;  2H0G A;  3TOT A;  1FAA A;  5HR3 A;  4FQU A;  4EL1 A;  1XW5 A;  4LMW A;  2F9S A;  3I6A A;  5ENU A;  5DQY A;  3KH7 A;  1F3A A;  3SWL A;  3CTG A;  4LA1 A;  4ML1 A;  2V32 A;  3IXR A;  2H70 A;  3G7I A;  5J3R A;  3QAW A;  5IQY A;  3VI7 A;  4O7H A;  1GSQ A;  1YF0 A;  4IQ1 A;  1M99 A;  1T4Z A;  3HVN A;  4GQF A;  5ECL B;  4EE0 A;  3PR8 A;  2K9F A;  3MWH A;  1S3C A;  1R4W A;  3A2V A;  2N5A A;  2X8C A;  6GSX A;  4V2M A;  2GZY A;  4MH3 A;  5AGY A;  1WOU A;  2TRC P;  1SL0 B;  5D73 A;  4PTS A;  2V6O A;  1OC9 A;  3HDC A;  2DJ1 A;  2EIO A; 
#chains in the Genus database with same CATH homology
 3FRC A;  2KHP A;  4BPY A;  8GSS A;  2H01 A;  3SBC A;  2P31 A;  4HDE A;  3VWX A;  3EIN A;  2O85 A;  4L8E A;  2IFQ A;  3FZ5 A;  4O32 A;  5JWQ B;  3DML A;  3PIN A;  5DAK A;  3Q19 A;  4N0Z A;  2R3X A;  2XBQ A;  3FMW A;  4RI7 A;  2FCH A;  2YWN A;  4BVY A;  4DSS A;  5GSS A;  2C8U A;  2X49 A;  2BJX A;  1ZCP A;  3Q74 A;  4DSQ A;  4IBP A;  1OVN A;  1TI1 A;  2B1L A;  3V1W A;  3DVX A;  4F0C A;  2B5Y A;  1K0B A;  4IP1 A;  1B48 A;  3I43 A;  2LS5 A;  4XS4 B;  3P7X A;  4KUN A;  3F4R A;  1J08 A;  3HZ8 A;  5ECK B;  2EIR A;  4CHS A;  4Q5Q A;  2VAF A;  4TR0 A;  1BG5 A;  2R0P A;  1WRY A;  1ABA A;  3MYD A;  1YF1 A;  5B7C A;  2EIQ A;  4GXZ A;  4EVM A;  1AXD A;  2C4J A;  3D6I A;  1ERT A;  2LUS A;  5ECP B;  1TRV A;  4NHW A;  3RBT A;  5D8I A;  4TN8 A;  2OBK A;  1NW2 A;  1ZYN A;  3VFI A;  2F51 A;  1A24 A;  1SD9 A;  4IS0 A;  2F3M A;  1B9Y C;  6GST A;  2OE0 A;  3IE3 A;  1JLV A;  4GTU A;  4ECC A;  3EUR A;  5ID2 B;  3ZIT A;  3KM6 A;  5G5E A;  4MLY A;  4E8E A;  2HSY A;  4KDX A;  1X5E A;  1FW1 A;  3TGZ A;  5F0G A;  3K8N A;  2L5L A;  2PGT A;  5G1L A;  3ZVJ D;  2H73 A;  4ICY A;  2OAC A;  4POB A;  4RQX A;  19GS A;  3UOM A;  4WF5 A;  2R5G A;  1MDK A;  1C72 A;  5ECS A;  1SK2 A;  1HD2 A;  4ISD A;  1PX6 A;  1K0M A;  5EY6 A;  2H6X A;  2KUC A;  4NPB A;  2H8L A;  3TKS C;  13GS A;  2FNO A;  3P8W A;  3QDN A;  3F6F A;  2DIZ A;  2RM6 A;  3C71 A;  1GH2 A;  2YOI A;  5IMZ A;  1ON4 A;  4K8M A;  1PA3 A;  2VCZ A;  2IMI A;  17GS A;  1YDK A;  3CYN A;  5ECH B;  5JCW A;  2K6V A;  1R26 A;  1FO5 A;  2JL4 A;  4MPG A;  2R2J A;  2A2S A;  2GT6 A;  1ZOF A;  2G0F A;  4IEL A;  2KOK A;  2IPA A;  1K0D A;  2RM5 A;  3HA9 A;  4A5P A;  2L4C A;  5D9W A;  2CV4 A;  3EU4 A;  3TKR A;  1GP1 A;  4OCE A;  1SL1 B;  2OAD A;  1UVZ A;  2GLR A;  1VF1 A;  1A0F A;  4AJ8 A;  1B8X A;  3D22 A;  2P5Q A;  2GVP A;  2C0D A;  1O8X A;  1FVJ A;  4X43 A;  1SK0 A;  4KCA A;  4EIQ A;  4XS4 A;  4PQ1 A;  4JRR A;  3KIJ A;  2IL3 A;  2VOC A;  2R0C A;  4GCI A;  3EWL A;  2YP6 A;  2MBS A;  5KN2 A;  4ACS A;  4D73 A;  1B9X C;  3U5R E;  2REM A;  3QOU A;  2AJQ B;  1PSQ A;  3P90 A;  4PQH A;  5DJL A;  3KTL A;  4HEA 2;  1Z6M A;  1G6W A;  3QAG A;  4K1F A;  1QK8 A;  2VL2 A;  3UAP A;  1B4Q A;  5DDL A;  2GST A;  3H4K A;  3ME8 A;  2HYX A;  1MDJ A;  2I81 A;  5C04 A;  3M9J A;  4Q5F A;  3QPM A;  4ECI A;  5BMU A;  3HVV A;  2K8V A;  2C0E A;  5ECO B;  2DKH A;  2LRN A;  3OR5 A;  1FOV A;  2B3S A;  1YZX A;  1EOG A;  4K7N A;  3GN3 A;  3EU3 A;  3TJK A;  1FG4 A;  2PWJ A;  5IIZ A;  3GKN A;  5CRE A;  1BED A;  5ID2 A;  1TTZ A;  4MF7 A;  2H74 A;  2B7K A;  3CSJ A;  1AW9 A;  2HE3 A;  3VPT A;  2LNT A;  1PN9 A;  3HZ4 A;  2VL3 A;  9GSS A;  4OCF A;  3IDV A;  1XWC A;  1U88 A;  4X4J A;  4ZIJ A;  2IJY A;  5D9V A;  4XRA A;  1MTC A;  2ZUP A;  5DCG A;  1UN2 A;  1GUH A;  7GSS A;  1PGT A;  4MK3 A;  4K6X A;  3GST A;  2LJK A;  2PN8 A;  4G2E A;  1BJX A;  1GTB A;  3S9F A;  1AC1 A;  2H6Y A;  1GUK A;  2ZCT A;  4MP4 A;  2FWH A;  4NXI A;  3FR3 A;  3FR6 A;  2PU9 C;  3F8U A;  3F6D A;  1TDI A;  4WET A;  2DIY A;  2MMO A;  1ERU A;  3NZN A;  5ECR B;  1GSS A;  4CW9 A;  1GNW A;  2YPM A;  3TB2 A;  5GST A;  2QA1 A;  4GLT A;  2C3Q A;  4MH2 A;  1EEM A;  1ZGN A;  1XWK A;  5HR1 A;  3UMA A;  1ACV A;  3H79 A;  4KW6 A;  2VIM A;  4NWY A;  3R3E A;  4K0N A;  1XBS A;  4J2F A;  4V2L A;  3LJR A;  1SYX A;  1A23 A;  1A2L A;  3UL3 A;  2L6D A;  2J23 A;  3ZMK A;  1HYU A;  1T7P B;  1E2Y A;  4GRF A;  3W8J A;  3CMI A;  4ECJ A;  1F37 A;  1GRX A;  2YNX A;  1SD8 A;  4OWY A;  1GSY A;  3L4N A;  4ZXG A;  1RW1 A;  4BVY B;  3KH9 A;  5IO0 A;  4KCE A;  3N9J A;  3LXT A;  1XWB A;  3WYW A;  1DE1 A;  5AIX A;  4TOP A;  3IA1 A;  2YV9 A;  2QA2 A;  2IMD A;  2M80 A;  2MBT A;  2GTU A;  2WGR A;  3ZLP A;  22GS A;  3A3T A;  1YEX A;  5E4W A;  3TJG A;  3BBY A;  5IO2 A;  5HFG A;  3IPZ A;  3TJF A;  3LSZ A;  4DEJ A;  2MMZ A;  1PL1 A;  2LRT A;  1GLP A;  5IM9 A;  1VGL A;  4L0U A;  3DRN A;  2KP1 A;  1OC3 A;  2HLS A;  3ZRD A;  2X8H A;  2P5R A;  3VWU A;  2XC2 A;  4ZB6 A;  4G10 A;  4TVE A;  2CVK A;  1GUL A;  1GNE A;  3EYT A;  3TJB A;  1GSD A;  2GQK A;  3DIE A;  2YV7 A;  3CBU A;  3TKS A;  3ZTL A;  5J9B A;  3LW9 A;  4TRX A;  4J56 E;  5G5F A;  4FH8 A;  3DKS A;  3MDK A;  2WZ9 A;  3FW2 A;  4WBR D;  3NIV A;  3IHQ A;  6GSY A;  1ZYE A;  1K3Y A;  3APQ A;  3KP9 A;  3WGD A;  4USS A;  4X1U A;  1PKW A;  2TRX A;  1TRS A;  2L4Q A;  2AUV A;  3HJO A;  2H0I A;  4H86 A;  3ZML A;  1V40 A;  2HI7 A;  2VL2 C;  3TKS E;  5CRW A;  4NHZ A;  1XPV A;  1WE0 A;  2E7P A;  3FZA A;  3O76 A;  2VLV A;  4POL A;  3J7Y k;  2PVO C;  3H8Q A;  4DVC A;  1U6T A;  2G2Q A;  2H1D A;  4PUR A;  3VUR A;  4KB3 A;  1SEN A;  2IWT A;  4DSR A;  5COH A;  1EOH A;  3VK9 A;  4HJ2 A;  2O87 A;  5IMC A;  4KND A;  2V41 A;  2Z9S A;  1URM A;  3BD2 A;  3KZQ A;  4HOJ A;  2H30 A;  2X64 A;  5HFK A;  1RQM A;  3KTB A;  3E0U A;  3FZ4 A;  1FOH A;  2JAC A;  3TKQ A;  1T3B A;  2GT5 A;  2CVD A;  3GKM A;  1TRU A;  4MAB A;  4RQR A;  1LU4 A;  4JE1 A;  4JED A;  3DD3 A;  1HNC A;  3NOF A;  3KJY A;  4JZQ A;  5B6M A;  1BQ7 A;  4IHU A;  2FHE A;  1G7O A;  4I5Q A;  2RUF A;  2A2P A;  3LQ7 A;  2L59 A;  2LJR A;  5FT3 A;  1GWC A;  1U3A A;  3F9U A;  2CT6 A;  1WWJ A;  1K0O A;  3ZRE A;  1ERV A;  1Z6N A;  3ZZX A;  1SKR B;  1SK1 A;  2GDR A;  5ECQ B;  2CAQ A;  4MF5 A;  5JWO B;  1WP0 A;  4LLR A;  5B8B A;  3GL5 A;  4KA0 A;  3HJP A;  1OKD A;  1X9S B;  1U87 A;  1GTI A;  2LV3 A;  5A5K A;  1MD3 A;  2DML A;  3F3Q A;  1TU7 A;  3QFA C;  3APO A;  4D73 B;  3QR6 A;  2N5B A;  5LNK e;  3L78 A;  1K3L A;  2E0Q A;  3CSI A;  2KP2 A;  2CZ2 A;  3C1S A;  1M2D A;  3WGX A;  3IHG A;  3TKP A;  4N10 A;  1O7U A;  1OKT A;  2B1K A;  2AYT A;  1QMV A;  2R0G A;  4HQS A;  5CYY A;  3RAZ A;  2DJ0 A;  2OBI A;  4IVF A;  2M72 A;  5ELA A;  2EC4 A;  4I8B A;  4KH7 A;  4O5Q A;  4KE3 A;  2X99 A;  4K2D A;  3VWW A;  5CRH A;  1M9B A;  2DJJ A;  5DBQ A;  3FK8 A;  4BWS A;  6GSU A;  3F4S A;  3EVI A;  4AGS A;  2YWO A;  4HUA A;  3EE2 A;  3LEF A;  4HZ2 A;  2FA8 A;  5IMV A;  20GS A;  4PGT A;  4TKY A;  4NV5 A;  3HVX A;  3A5W A;  2GSQ A;  2GGT A;  4EDZ A;  4RUV A;  5KOW A;  4TXO B;  1WPI A;  2MZC A;  3C1R A;  1QXH A;  3UIW A;  3M0F A;  1TOF A;  2WRT A;  3H1N A;  3GL3 A;  2XPE A;  3VLN A;  1O73 A;  1J0F A;  2DKI A;  4WBJ A;  4L5O A;  2B7J A;  5JWR B;  5ECI B;  2VD1 A;  5IPH A;  2NBS A;  3I9V 2;  4EO3 A;  1E6B A;  2C1Y A;  2FGX A;  2DSA A;  2ON5 A;  4PNG A;  4Z7X A;  3GX0 A;  2H1B A;  3JCM L;  3LG6 A;  4Z2T A;  1M2A A;  1QUW A;  3IBH A;  4KSM A;  2YAN A;  1R5A A;  1TU8 A;  1GSF A;  3GA4 A;  10GS A;  1I5G A;  1LBK A;  4XTS A;  2YCD A;  2NDO A;  2A4V A;  2H71 A;  2O89 A;  4ILF A;  3F4T A;  3ERG A;  6GSV A;  2WCI A;  1XOA A;  4BVX B;  1RK4 A;  4G0K A;  2I4A A;  2DLX A;  3US3 A;  4Q5R A;  5FWG A;  3EPT A;  2GQM A;  4MJE A;  1KBN A;  4MZC A;  4EC0 A;  3HD5 A;  2H76 A;  1F6M C;  5CP1 A;  3KMO A;  3UEM A;  2OJL A;  2WJU A;  3DWV A;  4Q5N A;  5C00 A;  3VWV A;  4BL7 B;  1FHE A;  5AN1 A;  12GS A;  1EV9 A;  5H5Q A;  1XXU A;  1V58 A;  1CQG A;  3WD6 A;  1YJ6 A;  3GIX A;  4K5R A;  4QQ7 A;  4YKF A;  1TK5 B;  1BAY A;  4IJI A;  4JR4 A;  1V57 A;  4WR4 A;  3GTU A;  4FYC A;  3M3M A;  3BCK A;  5IMA A;  2X4A A;  3TRQ A;  4F9Z A;  3EC3 A;  5D93 A;  1LJR A;  1G6Y A;  4ULX A;  2H0H A;  5GAN D;  2A4H A;  1Z5Y E;  4F03 A;  1OE7 A;  1XWG A;  3LOR A;  1JLW A;  4NMU A;  2TIR A;  5D96 A;  3Q6O A;  5D9X A;  4EUY A;  2IIY A;  4G19 A;  2V1M A;  4N0V A;  1ML6 A;  3A2X A;  5J4U A;  4TXO A;  1KNG A;  3F63 A;  2R6K A;  1U3I A;  3IK9 A;  4KGI A;  1AAZ A;  4I2U A;  1EP8 A;  2VCV A;  4ZB9 A;  5CRG A;  2RUE A;  3FHK A;  4TR1 B;  1X9M B;  1F3B A;  1PQN A;  5AIV A;  5FHI A;  3D4T A;  2VCX A;  1XIY A;  3IOS A;  2KLX A;  1Y6E A;  4YAV A;  1XOB A;  4ZIL A;  2VLT A;  3HKR A;  3CSH A;  4POM A;  2QC7 A;  1G7E A;  4WEY A;  2CX3 A;  2H19 A;  1YY7 A;  2F8A A;  3H93 A;  3C8E A;  1SJ6 A;  2HFD A;  4V2N A;  1CQH A;  5J5N A;  5J9C A;  4YQM A;  3LYK A;  1K0A A;  4XHM A;  2VCQ A;  14GS A;  2VD0 A;  3UBL A;  5KOX A;  1W89 A;  3MNG A;  1PN0 A;  3RHB A;  2FWG A;  3PGT A;  4FYB A;  3KCM A;  3FR9 A;  1K0C A;  3HVS A;  2WUL A;  4BVX A;  4G0L A;  4LL1 B;  1VF3 A;  3RHC A;  2CX4 A;  5CAX A;  4BWQ A;  4AJ7 A;  5ELG A;  3GRX A;  5KN3 A;  1SJZ A;  4G9H A;  2R4V A;  4ML6 A;  4WF4 A;  2X8G A;  2FA4 A;  3BOA A;  4MJB A;  3HY2 A;  1A0R P;  2UZ8 A;  4IN0 A;  1Q98 A;  2JZS A;  5HR2 A;  2ALB A;  1SU9 A;  4I6X A;  1NHO A;  1J9B A;  2DJ3 A;  4BL7 A;  1TW9 A;  2LST A;  4EF0 A;  1EGR A;  5IMF A;  2GS3 A;  1T00 A;  6GSS A;  4XRD A;  1TK0 B;  5H5R A;  3ED3 A;  5A4V A;  1W4V A;  5IMD A;  2OE3 A;  4WKW A;  5BRT A;  4AJ6 A;  1DE2 A;  3GHA A;  1TI3 A;  1AQV A;  2GQL A;  3QCP A;  2D2Z A;  1QFN A;  3MSZ A;  4TR3 A;  1B4P A;  1ZYQ B;  1O8W A;  4I97 A;  1XW9 A;  3HXS A;  5DAL A;  3ZIJ A;  2DMM A;  2DJK A;  2WDU A;  3LYP A;  3WT1 A;  4RI6 A;  3FYG A;  3GSS A;  2GZP A;  4KDY A;  4PUA A;  1M9A A;  1F2E A;  2LNS A;  5B8A A;  3P2A A;  3PPU A;  1EV4 A;  2HSM A;  3TJJ A;  4O92 A;  2XBI A;  2MMA A;  2DC5 A;  2HRA A;  2VL9 A;  4OMV A;  3IAS 2;  2FLS A;  2MMN A;  2YJH A;  3MIX A;  3IC4 A;  4Z2U A;  2YN1 A;  2HT9 A;  4LMV A;  4TR1 A;  3GH9 A;  3KXO A;  2PUK C;  3VI5 A;  5KN0 A;  3IV4 A;  16GS A;  4MJC A;  2HZE B;  4X0X A;  5A4W A;  1WMJ A;  4CY6 A;  3RPN A;  4HI7 A;  3IR4 A;  4IQA A;  3ZFB A;  1SL2 B;  1NM3 A;  3QMX A;  1KEB A;  1YKC A;  2JAD A;  2JU5 A;  3UJ1 A;  2LKU A;  1OC8 A;  4OFT A;  1GTA A;  2HXK A;  4TXV A;  3KD0 A;  1EEJ A;  3QAV A;  2GZZ A;  2YZU A;  2DBC A;  4MCU A;  4KX4 A;  2VCW A;  1HNA A;  1PX7 A;  3AY8 A;  3E3E A;  3IAM 2;  3TOU A;  2HNL A;  1Z7P A;  2P0G A;  2YZH A;  4ZBD A;  2NPB A;  3DEX A;  5ECM B;  3GX8 A;  2YWI A;  1DUG A;  3TCO A;  1TP9 A;  2H6Z A;  1I9D A;  4IW9 A;  3M9K A;  1SKW B;  1NHY A;  4L5L A;  1F9M A;  1MDI A;  3UVH A;  1M2B A;  2BMX A;  2HRF A;  4ZB8 A;  5GAP D;  1FB0 A;  5EVO A;  2VO4 A;  5DQS A;  1ST9 A;  4EDY A;  3DYR A;  1O81 A;  2AAW A;  4MF6 A;  3BCI A;  4NV2 A;  2QGV A;  2C3N A;  3EMP A;  5G31 A;  4PX1 A;  2VCT A;  3I69 A;  3LFL A;  1R5P A;  3QD9 A;  2LQQ A;  1YEP A;  1JFU A;  3FEU A;  5HFI A;  1XWA A;  4XS1 A;  1XCC A;  2I3Y A;  4JR6 A;  5INY A;  4OO4 A;  3GNJ A;  1T4Y A;  2NTO A;  3CRU A;  4IGJ A;  4KF9 A;  4P3Y B;  5A4U A;  2C80 A;  3UAR A;  1G0T A;  1VF4 A;  4GSS A;  3GYK A;  3IC8 A;  3Q18 A;  1OE8 A;  1XW6 A;  3ISO A;  3PH9 A;  2AV4 A;  2M46 A;  2BTO T;  2K8S A;  5B6N A;  4MDC A;  1N2A A;  1VRS D;  1Q4J A;  4CY8 A;  4GF0 A;  1K3O A;  3GV1 A;  1V9W A;  5JCU A;  1DSB A;  2I9H A;  1X5D A;  4PUF C;  1ERW A;  3GKX A;  2OE1 A;  3GTU B;  3MAK A;  3TUE A;  3O6T A;  2I1U A;  2H1G A;  3RPP A;  2YJ7 A;  2PPT A;  5CO3 A;  1IYH A;  5EL8 A;  5G30 A;  3LXZ A;  1ILO A;  1USB A;  2WS2 A;  4TR4 A;  3ZL5 A;  2H66 A;  4KDU A;  3CRT A;  1ZZY A;  11GS A;  1T8E B;  2HZE A;  2R37 A;  4MPF A;  4N11 A;  4HZ4 A;  1JZO A;  1JHB A;  5IPG A;  2JZR A;  2O8V B;  5G1K A;  18GS A;  2IME A;  1DBY A;  2C3T A;  3L9U A;  2IMF A;  3ZFL A;  1ZL9 A;  5GZZ B;  1N8J A;  1TRW A;  4PQI A;  3ZYW A;  1KTE A;  5DCH A;  2O7K A;  1AQX A;  2V2G A;  2B5X A;  1HQO A;  3EMX A;  2JSZ A;  1BX9 A;  3A2W A;  1EP7 A;  1O6J A;  2V6K A;  4OD7 A;  5DJM A;  3RDW A;  2OKA A;  1ZMA A;  2CVB A;  5ABR A;  4HJM A;  1PD2 1;  2AHE A;  2CA8 A;  2IMK A;  1S3D A;  2HRN A;  4IJ3 A;  5IOX A;  2L5O A;  3A5I A;  3L9V A;  1JZW A;  5D9T A;  4AF2 A;  1GSU A;  4MZB A;  4GWR A;  4MA9 A;  4FO5 A;  1Z7R A;  2PMT A;  2FY6 A;  4PNF A;  5CRD A;  2JZT A;  1WJK A;  4MMM A;  1Y25 A;  3GFK A;  4J57 E;  3D4M A;  5HR0 A;  4V1A g;  1AUC A;  1FVK A;  4K2X A;  4IKH A;  2PER A;  5AIS A;  6GSW A;  2VM2 A;  1OAZ A;  4KAE A;  2ZNM A;  5H5S A;  4KSO A;  2RII A;  4OO5 A;  1MEK A;  1A2M A;  4WXT A;  4YAP A;  2NVL A;  3F0I A;  4OFM A;  3D0Z A;  1A2J A;  4Z2R A;  1M7T A;  4FIW A;  1EGO A;  1SJI A;  2PBJ A;  1UA5 A;  1UC7 A;  2LRC A;  1X9W B;  3KMN A;  4YKG A;  4QL9 A;  3CTF A;  3TRX A;  3ZIV A;  4FYU A;  3D5J A;  3APS A;  3N5O A;  3C7M A;  3M8N A;  2HRK A;  1JZD A;  3W8S A;  3ZVJ A;  1XVQ A;  3GMF A;  1PKZ A;  2C0G A;  1S3A A;  3WGE A;  1SKS B;  2VLU A;  1GUM A;  3UBK A;  3E9J B;  3G9B A;  4HU9 A;  3R2Q A;  2ON7 A;  5F8B A;  5DAL B;  5F06 A;  3HCZ A;  2YWM A;  2IN3 A;  3ERF A;  3U6V A;  3DGQ A;  2E2M A;  4XIH A;  2LEG A;  2LTK A;  4XS6 A;  4YH2 A;  4ZL7 A;  4WR5 A;  1TKD B;  1H4O A;  2B5E A;  5F07 A;  2VM1 A;  2VUP A;  5LCZ A;  2FD3 A;  1AIU A;  3O3T A;  2CAI A;  1JZR A;  4JBB A;  5E59 A;  5JCG A;  5IOW A;  1V98 A;  4GST A;  3GUS A;  4EIP A;  1TXX A;  2H72 A;  4MNN A;  3L9S A;  2LJA A;  5CNW A;  1A8Y A;  2CZ3 A;  4ZL8 A;  4EXJ A;  2FWE A;  3IRA A;  3IK7 A;  4K0G A;  3G7Y A;  3KGK A;  4YQV A;  3W6G A;  2JSY A;  3DVW A;  3WT2 A;  2K18 A;  4PXO A;  4E8H A;  2LQO A;  4N30 A;  4K5S A;  3D21 A;  4F0B A;  1V2A A;  3HHV A;  2FWF A;  3HJM A;  4K7O A;  4O5R A;  4F2I A;  3HYP A;  1GL8 A;  3FY7 A;  4LL4 B;  2C0F A;  3F3R A;  4G0I A;  4K9Z A;  4HU7 A;  2H75 A;  2QKE A;  3BJ5 A;  2PVQ A;  2N5F A;  4GSN A;  1PL2 A;  5ECN B;  3FZ9 A;  1QGV A;  2RLI A;  1PMT A;  4IP6 A;  5L71 A;  3VPQ A;  1OC9 B;  4ZL9 A;  3GKK A;  4NAX A;  4OFN A;  5KEJ A;  2GSR A;  1T1V A;  3ERW A;  2MYG A;  1EZK A;  3TDG A;  2IFQ B;  3KP8 A;  4ZBB A;  3CXG A;  1X5C A;  3TRP A;  5J41 A;  3UVT A;  2WB9 A;  4TW5 A;  4MZW A;  5DAK B;  5LD0 A;  2XHF A;  1XVW A;  1THO A;  3LWA A;  4O5U A;  3M1G A;  3QFB C;  4DSS B;  1QQ2 A;  2QSI A;  4ZBA A;  1H75 A;  1M0U A;  3GUR A;  2L6C A;  4XCS A;  1OYJ A;  1ZYP A;  3G7J A;  1NSW A;  1VF2 A;  1A8L A;  2F8F A;  2HZF A;  4K7I A;  2WFC A;  4QL7 A;  4HS1 A;  3LGC A;  5HQP A;  3J7Y b;  1HNB A;  5DVB A;  2HSH A;  1Z3E A;  1X0R A;  4BA7 A;  1K0N A;  1PRX A;  4V1A p;  2CQ9 A;  2A2R A;  1BYE A;  4GQC A;  3ME7 A;  5KN1 A;  1THX A;  3DXB A;  2ES7 A;  3FKF A;  1MD4 A;  4ECB A;  2FUG 2;  4MJA A;  1AQW A;  1YKA A;  1XZO A;  1TJD A;  3KEB A;  4JU5 A;  2OA7 A;  2B6M A;  2J9H A;  4I2T A;  3GH6 A;  4HQZ A;  5G2Z A;  1EWX A;  5EPF A;  1GSE A;  2E2G A;  4F82 A;  2L57 A;  1GTU A;  3L0H A;  4L0W A;  2GSS A;  4YQU A;  1FB6 A;  4ID0 A;  1R7H A;  1YQ1 A;  5F05 A;  4EKZ A;  2DJ2 A;  1Z9H A;  1GLQ A;  1XFL A;  1O85 A;  1SYR A;  1TK8 B;  1WIK A;  2H1A A;  2XPD A;  4CDO A;  3C73 A;  2AB6 A;  1IYI A;  4POK A;  2H0G A;  3TOT A;  1FAA A;  5HR3 A;  4FQU A;  4EL1 A;  1XW5 A;  4LMW A;  2F9S A;  3I6A A;  5ENU A;  5DQY A;  3KH7 A;  1F3A A;  3SWL A;  3CTG A;  4LA1 A;  4ML1 A;  2V32 A;  3IXR A;  2H70 A;  3G7I A;  5J3R A;  3QAW A;  5IQY A;  3VI7 A;  4O7H A;  1GSQ A;  1YF0 A;  4IQ1 A;  1M99 A;  1T4Z A;  4GQF A;  5ECL B;  4EE0 A;  3PR8 A;  2K9F A;  3MWH A;  1S3C A;  1R4W A;  3A2V A;  2N5A A;  2X8C A;  6GSX A;  4V2M A;  2GZY A;  4MH3 A;  5AGY A;  1WOU A;  2TRC P;  1SL0 B;  5D73 A;  4PTS A;  2V6O A;  1OC9 A;  3HDC A;  2DJ1 A;  2EIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...