4G2EA

Crystal structure of a dimeric prxq from sulfolobus tokodaii
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
157
structure length
151
Chain Sequence
GHMVEIGELAPDFELPDTELKKVKLSALKGKVVVLAFYPAAFTQVTFRDSMAKFNQVNAVVLGISVDPPFSNKAFKEHNKLNFTILSDYNREVVKKYNVAWEFPALPGYVLAKRAVFVIDKEGKVRYKWVSDDPTKEPPYDEIEKVVKSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Peroxiredoxin
publication title Mapping the Active Site Helix-to-Strand Conversion of CxxxxC Peroxiredoxin Q Enzymes.
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 40
structure length 151
sequence length 157
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2012-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4g2eA00
1Q98A 1YF1A 3PH9A 6GSUA 1X5EA 2ZUPA 2VO4A 2R3XA 1EP7A 1V57A 5KEJA 4HJ2A 3EMXA 2H71A 3HYPA 4HZ2A 5DDLA 1YZXA 3WT2A 1AQXA 1XFLA 4GQCA 1X0RA 4K8MA 5J5NA 1AIUA 2WCIA 4XTSA 3M9JA 2PVQA 2HFDA 2OE0A 1V9WA 2VLVA 1M2BA 1ERWA 5ID2B 3KJYA 3ZFBA 1TJDA 4FYBA 2YWIA 5IPHA 1K0OA 4ILFA 11GSA 10GSA 2I4AA 1U88A 2HZEB 1SJ6A 1FOVA 4ACSA 1AUCA 1O8XA 5HR0A 3SWLA 5ECKB 1BYEA 2RUFA 3FK8A 3GTUA 2WJUA 3GX8A 3W8SA 2X64A 2MBSA 3VWXA 1TTZA 1GSEA 2BTOT 3D4TA 3KD0A 3GFKA 2PPTA 1VGLA 4EC0A 5D9VA 4DSSA 1V40A 2R6KA 4MLYA 3I69A 1X9MB 4MK3A 4OD7A 4MJCA 2H6XA 2OBKA 5IMDA 4KCAA 1GSDA 1WJKA 5IMZA 3DKSA 3CYNA 18GSA 3TJBA 4DSRA 2H01A 1F6MC 5B7CA 5IQYA 1GULA 1PX7A 4LA1A 2L6DA 5JWOB 3IBHA 4ZXGA 2VL2C 1O81A 2AV4A 4ID0A 2H1BA 2H1AA 1FB0A 3C1RA 1UA5A 2OADA 5E59A 4ZL9A 4K0NA 2VLTA 4JZQA 1DSBA 3HHVA 4RI7A 4AJ6A 1V2AA 3GHAA 3FRCA 2NVLA 1BJXA 4WBRD 1O7UA 2VUPA 4I97A 2LRNA 3GN3A 5IIZA 2LS5A 3M8NA 2CQ9A 2GQMA 2ON5A 2HI7A 5HR3A 2ON7A 5AIXA 1QUWA 1TW9A 2E7PA 3DXBA 4CW9A 4I5QA 4JU5A 1M9BA 3UVHA 2H70A 3M0FA 4BPYA 2RUEA 3LQ7A 1EZKA 3TCOA 3FZAA 5ECPB 2H0IA 4K7IA 1NM3A 2LNTA 2P5RA 3EU3A 3D0ZA 3A2VA 2TIRA 4WKWA 1O73A 4HUAA 2GZYA 4NHZA 5HR1A 1TU7A 2NPBA 2B7KA 3G7YA 3HVVA 1OE8A 3IAM2 4DEJA 4HQZA 3R2QA 4TR4A 3GH6A 2O87A 1TRWA 1GSYA 3HZ4A 2E0QA 4MJEA 3TJKA 3CMIA 4X1UA 2V41A 3RDWA 1W4VA 2VCVA 4IP6A 2C4JA 4HEA2 3MWHA 3H1NA 2H30A 1BX9A 3QFBC 2B5YA 3TOTA 1JZOA 4MH3A 4KW6A 2OACA 4ZB6A 4ML1A 4YQVA 5F07A 1AQWA 3O76A 1XW6A 4MJAA 3J7Yb 3L4NA 4IJIA 3DGQA 2JZSA 1ERTA 2JU5A 3IC4A 3TRQA 3H79A 2MMNA 3Q18A 4CDOA 3HD5A 4ZL8A 14GSA 1QGVA 5JWRB 5C00A 3ISOA 2XHFA 2YP6A 2F9SA 3QCPA 4G2EA 3C7MA 2C1YA 1K0MA 2GDRA 1SK0A 1Q4JA 1MTCA 4ZIJA 2VCTA 5D93A 4TOPA 3GL3A 3K8NA 4WF4A 4YAVA 4ECBA 3N9JA 3ZLPA 2H73A 1SKSB 2HZFA 4WXTA 5KN1A 3KGKA 1YF0A 5CREA 4N11A 3TRXA 3PR8A 1B4PA 4K7OA 1B4QA 1ZL9A 4POKA 3KP8A 1VRSD 2LV3A 2ES7A 2JL4A 3LFLA 2LKUA 1WRYA 4GF0A 3F63A 3DYRA 1SJZA 3APQA 1QXHA 2H1DA 1UN2A 2MMZA 3WGDA 2KOKA 2I1UA 3TKSA 3LYPA 3QFAC 3DIEA 4RQXA 2P31A 1TKDB 3G7JA 4F0CA 1AQVA 2RLIA 3GNJA 4MF5A 2F3MA 5GZZB 1O85A 4GLTA 1ZZYA 4F03A 1NHOA 4BVYA 4Z7XA 1OKTA 5ENUA 5EY6A 5ECRB 3ERFA 3M9KA 5IO0A 1NW2A 3IXRA 1WPIA 1PGTA 3KXOA 1ILOA 1VF3A 4EDYA 1QQ2A 2K8SA 5G5EA 4TKYA 3TKSE 2R5GA 3E0UA 4BWQA 5B8BA 3CBUA 4MF6A 3HDCA 2O85A 1ST9A 2AHEA 4RI6A 2LJRA 1SL2B 3GKXA 1J08A 5H5SA 2KP2A 3I43A 4MA9A 1SYRA 2L5OA 2KP1A 1ACVA 1KTEA 1B48A 2E2GA 1ON4A 1HNAA 4HI7A 2IIYA 2WS2A 1I9DA 1YKCA 5DALB 1EV4A 4RQRA 4J2FA 1K0CA 2H19A 4HJMA 3PGTA 1FO5A 4HZ4A 4YH2A 4TR1A 5A4VA 3GSSA 4HOJA 5KN2A 2H76A 3IA1A 4G19A 1O8WA 5J41A 1GTBA 1F3BA 3KCMA 1B8XA 1SJIA 2IMDA 4GTUA 4Q5FA 1Y25A 1I5GA 1MEKA 2FNOA 4PX1A 5COHA 4IQAA 1IYIA 2C80A 4KE3A 4N10A 5EPFA 2K6VA 4OO5A 1WWJA 1DBYA 2PUKC 1THOA 4BA7A 1KEBA 5J9BA 2FWFA 2N5FA 4D73B 4K1FA 5AIVA 1ABAA 3F9UA 2YNXA 3GYKA 2C0DA 4WR5A 4MJBA 3ZVJA 2V32A 2WB9A 2WZ9A 2H0GA 1ZMAA 2CX3A 1MD3A 2YWNA 1XOAA 4I8BA 16GSA 2H0HA 4QL9A 1QMVA 1JLVA 2FD3A 4ZL7A 5G30A 1EGOA 2P5QA 1MD4A 1PKWA 1S3AA 3F0IA 6GSXA 1K3OA 4TVEA 1BEDA 3WT1A 3LXTA 4IKHA 3H8QA 1H75A 3UBKA 3ZFLA 2VL3A 2LRTA 4XIHA 2GZPA 1FHEA 4KCEA 3N5OA 5EVOA 1A24A 1PL1A 2H74A 4NV5A 1F3AA 1TK0B 2C3TA 3ZYWA 2AUVA 1EGRA 2AAWA 1Z5YE 4LL1B 5LD0A 1K0AA 2TRCP 4KDXA 2VCXA 1GNWA 1GSUA 4IJ3A 3J7Yk 5CO3A 5DAKA 1XXUA 5G31A 4PUFC 4KA0A 4CHSA 4POLA 3DEXA 3TKPA 1V58A 4PNFA 3UL3A 1GRXA 1H4OA 4IBPA 3IDVA 4GRFA 1FVKA 4X0XA 3F4TA 3ME7A 5IMAA 3FR3A 1GL8A 5CYYA 3KH7A 4V1Ap 4TXVA 1OC9B 1YY7A 2MYGA 2YN1A 2I81A 4V2LA 3ZRDA 2LUSA 4POMA 1B9XC 4OWYA 4FH8A 4N0ZA 1YJ6A 1FVJA 3QOUA 4NV2A 3G7IA 2XPEA 1GNEA 2VLUA 3P7XA 3ZZXA 3W6GA 1A8YA 4Q5NA 3GURA 1ML6A 5AGYA 5B6MA 3DD3A 5A5KA 4MABA 5L71A 2YWMA 3UMAA 1TP9A 4DVCA 4JR4A 4HS1A 4QL7A 1J9BA 2QC7A 2FWGA 3O6TA 4TXOB 6GSSA 1EP8A 5DJLA 5HQPA 5F8BA 3UAPA 3TRPA 2O89A 4MP4A 2GQLA 4IQ1A 1A0RP 1HD2A 2G2QA 1GLQA 3BOAA 4LL4B 4L8EA 2HXKA 1O6JA 2EC4A 5CRDA 1ZCPA 3NOFA 3F3RA 2JZRA 2YANA 1USBA 3GRXA 2JZTA 3IPZA 4MMMA 2C0FA 5CAXA 2OE3A 5ECNB 4O5RA 2XBIA 3PINA 2LQOA 3F8UA 1X5CA 3WYWA 1E6BA 3FR6A 2DJ0A 1X9WB 5KN3A 2K9FA 2VL9A 3APSA 3FW2A 3F6FA 2J23A 1K3LA 5IMFA 1TU8A 1F2EA 1A8LA 3EURA 2NDOA 3QAVA 1PQNA 5ID2A 2GLRA 2HLSA 4ZILA 2YJ7A 2PBJA 3LXZA 1T00A 2RIIA 1N2AA 2IFQB 1G6YA 2C8UA 2FHEA 5DCHA 2CAIA 4F82A 5D9WA 4XS1A 2MMOA 3EMPA 4OCEA 2HZEA 1Z3EA 5B8AA 1HNCA 3CTGA 1XBSA 2EIOA 5IOWA 3IV4A 3U5RE 2M46A 2BJXA 1AW9A 1XWKA 3L9VA 4I2UA 5JCGA 7GSSA 3S9FA 3D4MA 2H75A 4NWYA 5FHIA 3UARA 1YQ1A 1JFUA 1LBKA 4ULXA 3HCZA 4ZBAA 1SL0B 4IELA 3VLNA 3A3TA 4KDUA 2WDUA 4EL1A 3IRAA 2R37A 2PGTA 3IE3A 2C0GA 1XWCA 2F51A 1GSSA 3C73A 3F4SA 4BVXA 4Q5QA 1T8EB 3P8WA 3IHQA 4OCFA 2VCWA 2TRXA 1T4ZA 3VPQA 4AGSA 2LNSA 3FYGA 1PA3A 3KTLA 4KGIA 3VI5A 1N8JA 1OVNA 3QDNA 2VIMA 1PD21 2LRCA 2VD1A 4L5LA 8GSSA 1JZRA 1AAZA 3LEFA 3H4KA 4F0BA 3AY8A 3RPPA 4AJ8A 2OKAA 3BBYA 1PRXA 12GSA 2YPMA 3LJRA 5GAND 3IR4A 5KN0A 2L57A 4NHWA 1OAZA 4YAPA 4ZBDA 4WETA 5FWGA 2KLXA 2CT6A 4MZWA 2JADA 2FA8A 1UVZA 2KUCA 1GUHA 3GV1A 2IMEA 2VCQA 2NBSA 5CRGA 1LJRA 3KMNA 5HR2A 4MPFA 3GX0A 2R4VA 5E4WA 3VFIA 1OKDA 2C0EA 3VK9A 1M2AA 4WR4A 2K18A 1EEMA 1A0FA 1LU4A 3FZ9A 4F9ZA 3HJMA 2VOCA 4KUNA 4LMVA 5ECHB 4O32A 4GSTA 4WEYA 1TDIA 3KP9A 1F37A 1SYXA 3P90A 4EXJA 3GA4A 1YEXA 3TDGA 3FZ4A 4ZBBA 2MBTA 4PXOA 2B1LA 2B7JA 3LSZA 3Q19A 3APOA 5FT3A 3ERWA 1OYJA 4HQSA 3E9JB 3TJJA 3DVXA 4ECJA 4PQHA 2B3SA 1M2DA 2L6CA 2LQQA 3L9SA 1WOUA 3Q6OA 2PN8A 3D22A 5IPGA 4KX4A 5A4UA 1OE7A 4K9ZA 5ECOB 3IK7A 2JACA 2OE1A 2CZ2A 3HZ8A 2WULA 4H86A 3TGZA 1M9AA 2VM1A 2IN3A 2H6YA 6GSTA 3QMXA 5G1LA 2HRNA 3Q74A 3FR9A 4EUYA 1EWXA 4EDZA 3WGEA 3ZIVA 3M3MA 2M72A 3ZTLA 4XS4B 2V1MA 4HU9A 4XHMA 1PX6A 4G9HA 3FY7A 2GQKA 2YOIA 4ISDA 1G7OA 1MDJA 3HVSA 3TKSC 4GSNA 2XBQA 2QKEA 2H1GA 4X43A 4JRRA 1DUGA 1BAYA 2GSSA 4V1Ag 1VF1A 3TUEA 9GSSA 1TXXA 1TRVA 4IP1A 4I2TA 2FY6A 2EIRA 4POBA 4L5OA 5CNWA 4K2DA 5JCUA 3ZITA 3GTUB 17GSA 3L9UA 3VURA 5GSSA 2X99A 3CTFA 1TOFA 2LTKA 3HVXA 5J3RA 2GSTA 4HU7A 5DCGA 1JHBA 4DSSB 3GMFA 2DBCA 1PMTA 2IMKA 4OMVA 2D2ZA 1G7EA 3EINA 5D8IA 3UEMA 5J4UA 1GTIA 1T3BA 5G2ZA 3EE2A 4GWRA 3GH9A 5ECLB 1Z9HA 2C3QA 2H72A 3WD6A 2B5XA 1XPVA 1VF4A 1G6WA 3ERGA 5DQSA 5ECMB 3VWUA 3A5WA 3QD9A 2I9HA 4TRXA 2YV9A 4HDEA 4XS6A 1ERVA 3MNGA 3VWWA 1SU9A 1BQ7A 4OFTA 3UBLA 1URMA 3A2WA 1XCCA 3TKQA 4F2IA 4KB3A 2DMLA 2RM6A 2DSAA 3CSIA 4E8EA 1KNGA 1S3CA 5DVBA 1TRSA 2V6OA 4MF7A 4K6XA 2GVPA 3P2AA 2FUG2 1K0NA 4G10A 3BCIA 4JR6A 3F4RA 3WGXA 4WF5A 3SBCA 2HYXA 1U3AA 3HY2A 2GZZA 1Z6NA 5ECQB 5H5QA 3VWVA 2PERA 4I6XA 2V6KA 3ZVJD 1ZOFA 3DVWA 4PNGA 1FAAA 2VL2A 2CVDA 2L4QA 2ZNMA 2H8LA 4OFNA 4MH2A 2PMTA 1AXDA 1T4YA 4XS4A 1XVWA 5CRWA 3OR5A 5ELGA 5DALA 3EU4A 1A2LA 1XWGA 4GCIA 1ZYEA 2CX4A 1R5PA 3MAKA 2LEGA 1J0FA 2HE3A 1YKAA 3HKRA 1JZWA 3MSZA 3GUSA 2CAQA 4EE0A 2DJ2A 2IMIA 1MDKA 4QQ7A 4RUVA 4PURA 4PQIA 3BD2A 1GP1A 4NMUA 2X8CA 3GSTA 2FWEA 1GH2A 1ERUA 4NAXA 3KZQA 19GSA 1FB6A 4N30A 3M1GA 1T7PB 3E3EA 3JCML 4J56E 4Q5RA 2J9HA 1RW1A 4IW9A 1KBNA 3C1SA 2ZCTA 3MDKA 1GSQA 4D73A 1JLWA 1SD9A 3BCKA 1XOBA 3LYKA 4LMWA 4BL7A 5IO2A 1F9MA 5IMCA 1QFNA 3ZL5A 1RK4A 3IOSA 3QPMA 2PWJA 1WP0A 2V2GA 3HJOA 6GSYA 3W8JA 4KH7A 2LJKA 2YJHA 1GLPA 1U3IA 1M0UA 4KSMA 3HXSA 2GSRA 3HA9A 4GQFA 3LWAA 1Z6MA 2ALBA 2OBIA 3UJ1A 5B6NA 3CSHA 1RQMA 2GT6A 1TK5B 1XWAA 1PN9A 1GSFA 1M99A 2A2SA 3NZNA 4EO3A 3UVTA 4JBBA 1TI3A 1XIYA 2WRTA 3G9BA 1IYHA 1A2JA 1K3YA 1PL2A 4NXIA 5ECIB 5F0GA 2DMMA 1GTAA 4XCSA 4MPGA 3ME8A 1SL1B 1SK2A 4LLRA 2F8AA 2DIZA 2P0GA 5ECSA 3GIXA 1VF2A 1C72A 2FLSA 2OA7A 1THXA 1HNBA 3GKNA 2H6ZA 2HNLA 1R26A 1T1VA 1HYUA 3KMOA 3IAS2 1WMJA 4GSSA 4V2NA 3U6VA 2O8VB 3FHKA 4KDYA 5HFKA 5INYA 2WFCA 2B5EA 5ELAA 2L59A 1GUMA 3F6DA 1A23A 3ED3A 4TN8A 1Z7RA 3FZ5A 4TR0A 1NSWA 1X5DA 1X9SB 5J9CA 5CP1A 1OC9A 3TOUA 3TB2A 1Z7PA 1EEJA 2GGTA 3D21A 3NIVA 4GXZA 2CV4A 4ZB9A 4L0WA 1K0DA 3O3TA 3LGCA 2XPDA 3US3A 3DMLA 1R5AA 2X8HA 1FW1A 3GKKA 4FO5A 2MMAA 4ZB8A 1U6TA 1G0TA 2FGXA 2WGRA 4YQMA 1FG4A 3C71A 1SK1A 2M80A 2IPAA 3QAGA 3KEBA 2DJKA 4PQ1A 1SENA 1XW9A 2VCZA 4ML6A 1QK8A 2VM2A 4AF2A 13GSA 4MZCA 4TR3A 4J57E 5G1KA 4TXOA 5D9TA 1OC8A 1YEPA 3LORA 4V2MA 4KSOA 2FCHA 5DJMA 4KNDA 4P3YB 1XW5A 4O92A 2MZCA 5HFIA 5D73A 5D9XA 2JSYA 4FYUA 2L4CA 1CQGA 3BJ5A 5H5RA 4TR1B 2GSQA 4DSQA 1PKZA 4KAEA 4MDCA 2YV7A 1GUKA 5D96A 3TKRA 2B1KA 2JSZA 2CZ3A 5GAPD 1K0BA 1EOHA 2EIQA 5GSTA 5LNKe 1HQOA 4AJ7A 3EYTA 2GS3A 4K0GA 2DJJA 2LJAA 3EVIA 2X8GA 5DQYA 4YQUA 1PSQA 1XWBA 1DE2A 2A2RA 2O7KA 2OJLA 4IS0A 2K8VA 3EC3A 2IL3A 3TJGA 5IMVA 3KM6A 3UOMA 5JWQB 2XC2A 2RM5A 4JE1A 5HFGA 1UC7A 1JZDA 2CVBA 2IFQA 5F06A 4NPBA 2C3NA 3FEUA 3H93A 2REMA 3DRNA 3DWVA 3F3QA 4XRDA 3RPNA 22GSA 4JEDA 2H66A 1W89A 2YZUA 2DLXA 2B6MA 3D6IA 4N0VA 2N5BA 2QSIA 1DE1A 2PU9C 1SKWB 4EKZA 6GSVA 4FIWA 5AN1A 1CQHA 4MCUA 3ZMLA 4WBJA 3ZREA 4PGTA 4BWSA 3L0HA 4ECCA 2HT9A 1SD8A 2E2MA 2QGVA 3ZMKA 1XVQA 2DJ1A 3L78A 2FA4A 3RHBA 1TI1A 2FWHA 2KHPA 1U87A 1XZOA 2DIYA 3QAWA 2IJYA 4PUAA 1GWCA 3GKMA 2HRFA 3IK9A 2DJ3A 3CSJA 4K7NA 3KTBA 2I3YA 5CRHA 3CRUA 20GSA 6GSWA 2YZHA 1EV9A 3LG6A 1OC3A 4O7HA 3KH9A 2A4VA 4OO4A 2YWOA 2AB6A 5DAKB 1Y6EA 2HSYA 1GTUA 4EVMA 2GT5A 3ZIJA 1WE0A 3I6AA 5IM9A 5AISA 2Z9SA 2G0FA 1NHYA 3VPTA 1E2YA 2VAFA 5IOXA 4TW5A 3RAZA 2VD0A 1TRUA 5LCZA 3FKFA 2AJQB 2R2JA 1R7HA 2PVOC 1ZGNA 2AYTA 4OFMA 5JCWA 3HJPA 5EL8A 4E8HA 3CRTA 3CXGA 5G5FA 2YCDA 4FYCA 4XRAA 3RHCA 2F8FA 5F05A 4IHUA 1V98A 4MZBA 2N5AA 2IMFA 3VI7A 5A4WA 1R4WA 3EWLA 2LSTA 1BG5A 1EOGA 1YDKA 1ZYQB 3UIWA 5ABRA 2GTUA 3QR6A 4IVFA 2BMXA 2IWTA 2CA8A 1B9YC 2DC5A 4IN0A 4ECIA 1S3DA 5DBQA 1M7TA 1A2MA 2CVKA 3D5JA 2L5LA 1SKRB 3GL5A 3RBTA 3C8EA 4EF0A 1AC1A 5C04A 3TJFA 3I9V2 1WIKA 3KIJA 3A2XA 2HSHA 2NTOA 4L0UA 1TK8B 3V1WA 1MDIA 4IGJA
chains in the Genus database with same CATH superfamily
1Q98A 1YF1A 3PH9A 6GSUA 1X5EA 2QA1A 2ZUPA 2VO4A 2R3XA 1EP7A 1V57A 5KEJA 4HJ2A 3EMXA 2H71A 3HYPA 4HZ2A 5DDLA 1YZXA 3WT2A 1AQXA 1XFLA 4GQCA 1X0RA 4K8MA 4G0IA 1AIUA 2WCIA 4XTSA 5J5NA 3M9JA 2PVQA 2HFDA 2OE0A 1V9WA 2VLVA 1M2BA 1ERWA 5ID2B 3KJYA 3ZFBA 1TJDA 4FYBA 2YWIA 5IPHA 1K0OA 4ILFA 11GSA 10GSA 2I4AA 1U88A 2HZEB 1SJ6A 1FOVA 4ACSA 1AUCA 1O8XA 5HR0A 3SWLA 5ECKB 1BYEA 2RUFA 3FK8A 3GTUA 2WJUA 3GX8A 3W8SA 2X64A 2MBSA 3VWXA 1TTZA 1GSEA 2BTOT 3D4TA 3PPUA 3KD0A 3GFKA 2PPTA 1VGLA 4EC0A 5D9VA 4DSSA 1V40A 2R6KA 4MLYA 3I69A 1X9MB 4MK3A 4OD7A 4MJCA 2H6XA 2OBKA 5IMDA 4KCAA 1GSDA 1WJKA 5IMZA 3DKSA 3CYNA 18GSA 3TJBA 4DSRA 2H01A 1F6MC 5B7CA 5IQYA 1GULA 1PX7A 4LA1A 2L6DA 5JWOB 3IBHA 4BVXB 4ZXGA 2VL2C 1O81A 2AV4A 4ID0A 2H1BA 2H1AA 1FB0A 3C1RA 1UA5A 2OADA 5E59A 4ZL9A 4K0NA 2VLTA 4JZQA 1ZYPA 1DSBA 3HHVA 4RI7A 4AJ6A 1V2AA 3GHAA 3FRCA 2NVLA 1BJXA 4WBRD 1O7UA 2R0GA 2VUPA 4I97A 2LRNA 3GN3A 5IIZA 2LS5A 3M8NA 2CQ9A 2GQMA 4MNNA 2ON5A 2HI7A 5HR3A 2ON7A 5AIXA 1QUWA 1TW9A 2E7PA 3DXBA 4CW9A 4I5QA 4JU5A 1M9BA 3UVHA 2H70A 3M0FA 4BPYA 2RUEA 3LQ7A 1EZKA 3TCOA 3FZAA 5ECPB 2H0IA 4K7IA 1NM3A 2LNTA 2P5RA 3EU3A 3D0ZA 3A2VA 2TIRA 4WKWA 1O73A 4HUAA 2GZYA 4NHZA 5HR1A 1TU7A 2NPBA 2B7KA 3G7YA 3HVVA 1OE8A 3IAM2 4DEJA 4HQZA 2QA2A 3R2QA 4TR4A 3GH6A 2O87A 1TRWA 1GSYA 3HZ4A 2E0QA 4MJEA 3TJKA 3CMIA 1PFOA 4X1UA 2V41A 3RDWA 1W4VA 2VCVA 4IP6A 2C4JA 4HEA2 3MWHA 3H1NA 2H30A 1BX9A 3QFBC 2B5YA 3TOTA 1JZOA 4MH3A 4KW6A 2OACA 4ZB6A 4ML1A 4YQVA 5F07A 1AQWA 3O76A 1XW6A 4MJAA 3J7Yb 3L4NA 4IJIA 3DGQA 2JZSA 1ERTA 4YKGA 2JU5A 3IC4A 3TRQA 3H79A 2MMNA 3Q18A 4CDOA 3HD5A 4ZL8A 14GSA 1QGVA 5JWRB 5C00A 3ISOA 2XHFA 2YP6A 2F9SA 3QCPA 4G2EA 3C7MA 2C1YA 4Z2TA 1K0MA 2GDRA 1SK0A 3EPTA 3MIXA 1Q4JA 1MTCA 4ZIJA 2VCTA 5D93A 4TOPA 3GL3A 3K8NA 4WF4A 4YAVA 4ECBA 3N9JA 3ZLPA 2H73A 1SKSB 2HZFA 4WXTA 5KN1A 3KGKA 1YF0A 5CREA 4N11A 3TRXA 3PR8A 1B4PA 4K7OA 1B4QA 1ZL9A 2R0PA 4POKA 3KP8A 1VRSD 2LV3A 2ES7A 2JL4A 3LFLA 2LKUA 1WRYA 4GF0A 3F63A 3DYRA 1SJZA 3APQA 1QXHA 2H1DA 1UN2A 2MMZA 3WGDA 2KOKA 2I1UA 3TKSA 3LYPA 3QFAC 3DIEA 4RQXA 2P31A 1TKDB 3G7JA 4F0CA 1AQVA 2RLIA 3GNJA 4MF5A 2F3MA 5GZZB 1O85A 4GLTA 1ZZYA 4F03A 1NHOA 4BVYA 4Z7XA 1OKTA 5ENUA 5EY6A 5ECRB 3ERFA 3M9KA 5IO0A 1NW2A 3IXRA 1WPIA 1PGTA 3KXOA 1ILOA 4CY6A 1VF3A 4EDYA 1QQ2A 2K8SA 4USSA 5G5EA 4TKYA 3TKSE 2R5GA 3E0UA 4BWQA 5B8BA 3CBUA 4MF6A 3HDCA 2O85A 1ST9A 2AHEA 4RI6A 2LJRA 1SL2B 3GKXA 1J08A 5H5SA 2KP2A 3I43A 4MA9A 1SYRA 2L5OA 2KP1A 1ACVA 1KTEA 1B48A 2E2GA 1ON4A 1HNAA 4HI7A 2IIYA 2WS2A 1I9DA 1YKCA 5DALB 1EV4A 4RQRA 4J2FA 1K0CA 2H19A 4HJMA 3PGTA 1FO5A 4HZ4A 4YH2A 4TR1A 5A4VA 3GSSA 4HOJA 4KF9A 5KN2A 2H76A 3IA1A 4G19A 1O8WA 5J41A 1GTBA 1F3BA 3KCMA 1B8XA 1SJIA 2IMDA 4GTUA 4Q5FA 1Y25A 1I5GA 1MEKA 2FNOA 4PX1A 5COHA 4IQAA 1IYIA 2C80A 4KE3A 4N10A 5EPFA 2K6VA 4OO5A 1WWJA 4CY8A 1DBYA 2PUKC 1THOA 4BA7A 1KEBA 5J9BA 2FWFA 2N5FA 4D73B 4K1FA 5AIVA 1ABAA 3F9UA 2YNXA 3GYKA 3IC8A 2C0DA 4WR5A 4MJBA 3ZVJA 2V32A 2WB9A 4BL7B 4EIPA 2WZ9A 2H0GA 1ZMAA 2CX3A 1MD3A 2YWNA 1XOAA 4I8BA 16GSA 2H0HA 4QL9A 1QMVA 1JLVA 2FD3A 4ZL7A 5G30A 1EGOA 2P5QA 4G0KA 1MD4A 1PKWA 2DKHA 1S3AA 3F0IA 6GSXA 1K3OA 4TVEA 1BEDA 3WT1A 3LXTA 4IKHA 3H8QA 1H75A 3UBKA 3ZFLA 2VL3A 2LRTA 4XIHA 2GZPA 4YKFA 1FHEA 4KCEA 3N5OA 5EVOA 1A24A 4PTSA 1PL1A 2H74A 4NV5A 1F3AA 1TK0B 2C3TA 3ZYWA 2AUVA 4O5UA 1EGRA 2AAWA 1Z5YE 4LL1B 5LD0A 1K0AA 2TRCP 4KDXA 2VCXA 1GNWA 1GSUA 4IJ3A 3J7Yk 5CO3A 5DAKA 1XXUA 5G31A 4PUFC 4KA0A 4CHSA 4POLA 3DEXA 3TKPA 1V58A 4PNFA 3UL3A 1GRXA 1H4OA 4IBPA 3IDVA 4GRFA 1FVKA 4X0XA 3F4TA 3ME7A 5IMAA 3FR3A 1GL8A 5CYYA 3KH7A 4V1Ap 4TXVA 1OC9B 1YY7A 2MYGA 2YN1A 2I81A 4V2LA 3ZRDA 2LUSA 4POMA 1B9XC 4OWYA 4FH8A 4N0ZA 1YJ6A 1FVJA 3QOUA 4NV2A 3G7IA 2XPEA 1GNEA 2VLUA 3P7XA 3ZZXA 3W6GA 1A8YA 4O5QA 4Q5NA 4X4JA 3GURA 1ML6A 5AGYA 5B6MA 3DD3A 5A5KA 4MABA 5L71A 2YWMA 3UMAA 1TP9A 4DVCA 4JR4A 4HS1A 4QL7A 1J9BA 2QC7A 2FWGA 3O6TA 4TXOB 6GSSA 1EP8A 5DJLA 5HQPA 5F8BA 3UAPA 3TRPA 2O89A 4MP4A 2GQLA 4IQ1A 1A0RP 1HD2A 2G2QA 1GLQA 3BOAA 4LL4B 4L8EA 3R3EA 2HXKA 1O6JA 2EC4A 5CRDA 1M3IA 1ZCPA 3NOFA 3F3RA 2JZRA 2YANA 1USBA 3GRXA 2JZTA 3IPZA 4MMMA 2C0FA 5CAXA 2OE3A 5ECNB 2X4AA 4O5RA 2XBIA 3PINA 2LQOA 3F8UA 1X5CA 3WYWA 1E6BA 3FR6A 2DJ0A 1X9WB 5KN3A 2K9FA 2VL9A 3APSA 3FW2A 3F6FA 2J23A 1K3LA 5IMFA 1TU8A 1F2EA 1A8LA 3EURA 2NDOA 3FMWA 3QAVA 1PQNA 5ID2A 2GLRA 2HLSA 4ZILA 2YJ7A 2PBJA 3LXZA 5KOXA 1T00A 2RIIA 1N2AA 2IFQB 1G6YA 2C8UA 2FHEA 5DCHA 2CAIA 4F82A 5D9WA 4XS1A 2MMOA 3EMPA 4OCEA 2HZEA 1Z3EA 4K2XA 5B8AA 1HNCA 2UZ8A 3CTGA 1XBSA 2EIOA 5IOWA 3IV4A 1XG8A 3U5RE 2M46A 2BJXA 1AW9A 1XWKA 3L9VA 4I2UA 5JCGA 7GSSA 3S9FA 3D4MA 2H75A 4NWYA 5FHIA 3UARA 1YQ1A 1JFUA 1LBKA 4ULXA 3HCZA 4K5SA 4ZBAA 1SL0B 4IELA 3VLNA 3A3TA 4KDUA 2WDUA 4EL1A 3IRAA 2R37A 2PGTA 3IE3A 2C0GA 1XWCA 2F51A 1GSSA 3C73A 3F4SA 4BVXA 4Q5QA 1T8EB 3P8WA 3IHQA 4OCFA 2VCWA 2TRXA 1T4ZA 3VPQA 4AGSA 2LNSA 3FYGA 1PA3A 3KTLA 4KGIA 4Z2RA 3VI5A 1N8JA 1OVNA 3QDNA 2HSMA 2VIMA 1PD21 2LRCA 2VD1A 4L5LA 8GSSA 1JZRA 1AAZA 3LEFA 3H4KA 4F0BA 3AY8A 3RPPA 4AJ8A 2OKAA 3BBYA 1PRXA 12GSA 2YPMA 3LJRA 5GAND 3IR4A 5KN0A 2L57A 4NHWA 1OAZA 4YAPA 4ZBDA 4WETA 5FWGA 2KLXA 2CT6A 4MZWA 2JADA 2FA8A 1UVZA 2KUCA 1GUHA 3GV1A 2IMEA 2VCQA 2NBSA 5CRGA 1LJRA 3KMNA 5HR2A 4MPFA 3GX0A 2R4VA 5E4WA 3VFIA 1OKDA 2C0EA 3VK9A 1M2AA 2A2PA 4WR4A 2K18A 1EEMA 1A0FA 1LU4A 3FZ9A 4F9ZA 3HJMA 2VOCA 4KUNA 4LMVA 5ECHB 4O32A 4GSTA 4WEYA 1TDIA 4HSCX 3KP9A 1F37A 1SYXA 3P90A 4EXJA 3GA4A 1YEXA 3TDGA 3FZ4A 4ZBBA 2MBTA 4PXOA 2B1LA 2B7JA 3LSZA 3Q19A 2R0CA 3APOA 5FT3A 3ERWA 1OYJA 4HQSA 3E9JB 3TJJA 3DVXA 4ECJA 4PQHA 2B3SA 1M2DA 2L6CA 2LQQA 3L9SA 1WOUA 3Q6OA 2PN8A 3D22A 5IPGA 4KX4A 5A4UA 1OE7A 4K9ZA 5ECOB 2DKIA 3IK7A 2JACA 2OE1A 2CZ2A 3HZ8A 2WULA 4H86A 3TGZA 1M9AA 2VM1A 2IN3A 2H6YA 6GSTA 3QMXA 5G1LA 2HRNA 3Q74A 3FR9A 4EUYA 1EWXA 4EDZA 3WGEA 3ZIVA 4Z2UA 3M3MA 2M72A 3ZTLA 4XS4B 2V1MA 4HU9A 4XHMA 1PX6A 4G9HA 3FY7A 2GQKA 2YOIA 4ISDA 1G7OA 1MDJA 3HVSA 3TKSC 4GSNA 2XBQA 2QKEA 2H1GA 4X43A 4JRRA 1DUGA 1BAYA 2GSSA 4V1Ag 1VF1A 3TUEA 9GSSA 1TXXA 1TRVA 4A5PA 2X49A 4IP1A 4FQUA 4I2TA 2FY6A 2EIRA 4POBA 4L5OA 5CNWA 4K2DA 5JCUA 3ZITA 3GTUB 17GSA 3L9UA 3VURA 5GSSA 2X99A 3CTFA 1TOFA 2LTKA 3HVXA 5J3RA 2GSTA 4HU7A 5DCGA 1JHBA 4DSSB 3GMFA 2DBCA 1PMTA 2IMKA 4OMVA 2D2ZA 1G7EA 3EINA 5D8IA 3UEMA 5J4UA 1GTIA 1T3BA 5G2ZA 3EE2A 4GWRA 3GH9A 3HVNA 5ECLB 1Z9HA 2C3QA 2H72A 3WD6A 2B5XA 1XPVA 1VF4A 1G6WA 3ERGA 5DQSA 5ECMB 3VWUA 1ZYNA 3A5WA 3QD9A 4EIQA 2I9HA 4TRXA 2YV9A 4HDEA 4XS6A 1ERVA 3LW9A 3MNGA 3VWWA 1SU9A 1BQ7A 4OFTA 3A5IA 3UBLA 1URMA 3A2WA 1XCCA 3TKQA 4F2IA 4KB3A 2DMLA 2RM6A 2DSAA 3CSIA 4E8EA 1KNGA 1S3CA 5DVBA 1TRSA 2V6OA 4MF7A 4K6XA 2GVPA 3P2AA 2FUG2 1K0NA 4G10A 3BCIA 4JR6A 3F4RA 3WGXA 4WF5A 3SBCA 2HYXA 1U3AA 3HY2A 2GZZA 1Z6NA 5ECQB 5H5QA 3VWVA 2PERA 4I6XA 2V6KA 3ZVJD 1ZOFA 3DVWA 4PNGA 1FAAA 2VL2A 2CVDA 2L4QA 2ZNMA 5BMUA 2H8LA 4OFNA 4MH2A 2PMTA 1AXDA 1T4YA 4XS4A 1XVWA 5CRWA 3OR5A 5ELGA 5DALA 3EU4A 1A2LA 1XWGA 4GCIA 1ZYEA 2CX4A 1R5PA 3MAKA 2LEGA 1J0FA 2HE3A 1YKAA 3HKRA 1JZWA 3MSZA 3GUSA 2CAQA 4EE0A 2DJ2A 2IMIA 1MDKA 4QQ7A 4RUVA 4PURA 4PQIA 3BD2A 1GP1A 4NMUA 2X8CA 3GSTA 2FWEA 1GH2A 1ERUA 4NAXA 3KZQA 19GSA 1FB6A 4N30A 3M1GA 1T7PB 3E3EA 3JCML 4J56E 4Q5RA 2J9HA 1RW1A 4IW9A 1KBNA 3C1SA 2ZCTA 3MDKA 1GSQA 4D73A 1JLWA 1SD9A 3BCKA 1XOBA 3LYKA 2HRKA 4LMWA 4BL7A 5IO2A 1F9MA 5IMCA 1QFNA 3ZL5A 1RK4A 3IOSA 3QPMA 2PWJA 1WP0A 2V2GA 3HJOA 6GSYA 3W8JA 4KH7A 2LJKA 2YJHA 1GLPA 1U3IA 1M0UA 4KSMA 3HXSA 2GSRA 3HA9A 4GQFA 3LWAA 1Z6MA 2ALBA 2OBIA 3UJ1A 5B6NA 3CSHA 1RQMA 2GT6A 1TK5B 1XWAA 1PN9A 1GSFA 1M99A 2A2SA 3NZNA 4EO3A 3UVTA 4JBBA 1TI3A 1XIYA 2WRTA 3G9BA 1IYHA 1A2JA 1K3YA 1PL2A 4NXIA 5ECIB 5F0GA 2DMMA 1GTAA 4XCSA 4MPGA 3ME8A 1SL1B 1SK2A 4LLRA 2F8AA 2DIZA 2P0GA 5ECSA 3GIXA 1VF2A 1C72A 2FLSA 2OA7A 1THXA 1HNBA 3GKNA 2H6ZA 2HNLA 1R26A 1T1VA 1HYUA 3KMOA 1FOHA 1WMJA 3IAS2 4GSSA 4V2NA 3U6VA 2O8VB 3FHKA 4KDYA 5HFKA 5INYA 2WFCA 2B5EA 5ELAA 2L59A 1GUMA 3F6DA 1A23A 3ED3A 4TN8A 1Z7RA 3FZ5A 4TR0A 1NSWA 1X5DA 4BVYB 1X9SB 5J9CA 5CP1A 1OC9A 5KOWA 3TOUA 3TB2A 1Z7PA 1EEJA 2GGTA 3D21A 3NIVA 4GXZA 2CV4A 4ZB9A 4L0WA 1K0DA 3O3TA 3LGCA 2XPDA 3US3A 3DMLA 1R5AA 2X8HA 1FW1A 3GKKA 4FO5A 2MMAA 4ZB8A 1U6TA 1G0TA 2FGXA 2WGRA 4YQMA 1FG4A 3C71A 1SK1A 2M80A 2IPAA 3QAGA 3KEBA 2DJKA 4PQ1A 1SENA 3CQFA 1XW9A 2VCZA 4ML6A 3IHGA 1QK8A 2VM2A 4AF2A 13GSA 4MZCA 4TR3A 4J57E 5G1KA 4TXOA 5D9TA 1OC8A 1YEPA 3LORA 4BIKA 4V2MA 4KSOA 2FCHA 5DJMA 4KNDA 4P3YB 1XW5A 4O92A 2MZCA 5HFIA 5D73A 5D9XA 4ICYA 2JSYA 4FYUA 2L4CA 1CQGA 3BJ5A 5H5RA 4TR1B 2GSQA 4DSQA 1PKZA 1M3JA 4KAEA 4MDCA 2YV7A 1GUKA 5D96A 3TKRA 2B1KA 2JSZA 2CZ3A 5GAPD 1K0BA 1EOHA 2EIQA 5GSTA 5LNKe 5BRTA 1HQOA 4AJ7A 3EYTA 2GS3A 4K0GA 2DJJA 2LJAA 3EVIA 2X8GA 5DQYA 4YQUA 1PSQA 1XWBA 1DE2A 2A2RA 2O7KA 2OJLA 4IS0A 2K8VA 3EC3A 2IL3A 3TJGA 5IMVA 3KM6A 3UOMA 5JWQB 2XC2A 2RM5A 4JE1A 5HFGA 1UC7A 1JZDA 2CVBA 2IFQA 5F06A 4NPBA 2C3NA 3FEUA 3H93A 2REMA 3DRNA 3DWVA 3F3QA 4XRDA 3RPNA 22GSA 4JEDA 2H66A 1W89A 2YZUA 2DLXA 2B6MA 3D6IA 4N0VA 2N5BA 2QSIA 1DE1A 2PU9C 1SKWB 4EKZA 6GSVA 4FIWA 5AN1A 1CQHA 4MCUA 3ZMLA 4WBJA 3ZREA 4PGTA 4BWSA 3L0HA 4ECCA 2HT9A 1SD8A 2E2MA 2QGVA 3ZMKA 1XVQA 2DJ1A 3L78A 2FA4A 3RHBA 1TI1A 2FWHA 2KHPA 1U87A 1XZOA 2DIYA 2A4HA 3QAWA 2IJYA 4PUAA 1GWCA 3GKMA 2HRFA 3IK9A 2DJ3A 3CSJA 4K7NA 3KTBA 2I3YA 5CRHA 3CRUA 20GSA 1PN0A 6GSWA 2YZHA 1EV9A 3LG6A 1OC3A 4O7HA 1S3RA 3KH9A 2A4VA 4OO4A 2YWOA 4G0LA 2AB6A 5DAKB 1Y6EA 2HSYA 1GTUA 4EVMA 2GT5A 3ZIJA 1WE0A 3I6AA 5IM9A 5AISA 2Z9SA 2G0FA 1NHYA 3VPTA 1E2YA 2VAFA 5IOXA 4TW5A 3RAZA 2VD0A 1TRUA 5LCZA 3FKFA 2AJQB 2R2JA 1R7HA 2PVOC 1ZGNA 2AYTA 4OFMA 5JCWA 3HJPA 5EL8A 4E8HA 3CRTA 3CXGA 5G5FA 2YCDA 4FYCA 4XRAA 3RHCA 2F8FA 5F05A 4IHUA 1V98A 4MZBA 2N5AA 2IMFA 3VI7A 5A4WA 1R4WA 3EWLA 2LSTA 1BG5A 1EOGA 1YDKA 1ZYQB 3UIWA 5ABRA 2GTUA 3QR6A 4IVFA 2BMXA 2IWTA 2CA8A 1B9YC 2DC5A 4IN0A 4ECIA 1S3DA 5DBQA 1M7TA 1A2MA 2CVKA 3D5JA 2L5LA 1SKRB 3GL5A 3RBTA 3C8EA 4EF0A 1AC1A 5C04A 3TJFA 3I9V2 3MYDA 1WIKA 2HRAA 3KIJA 4K5RA 3A2XA 2HSHA 2NTOA 4L0UA 1TK8B 3V1WA 1MDIA 4IGJA
chains in the Genus database with same CATH topology
1Q98A 1YF1A 3PH9A 6GSUA 1X5EA 2QA1A 2ZUPA 2VO4A 2R3XA 1EP7A 1V57A 5KEJA 4HJ2A 3EMXA 2H71A 3HYPA 4HZ2A 5DDLA 1YZXA 3WT2A 1AQXA 1XFLA 4GQCA 1X0RA 4K8MA 4G0IA 1AIUA 2WCIA 4XTSA 5J5NA 3M9JA 2PVQA 2HFDA 2OE0A 1V9WA 2VLVA 1M2BA 1ERWA 5ID2B 3KJYA 3ZFBA 1TJDA 4FYBA 2YWIA 5IPHA 1K0OA 4ILFA 11GSA 10GSA 2I4AA 1U88A 2HZEB 1SJ6A 1FOVA 4ACSA 1AUCA 1O8XA 5HR0A 3SWLA 5ECKB 1BYEA 2RUFA 3FK8A 3GTUA 2WJUA 3GX8A 3W8SA 2X64A 2MBSA 3VWXA 1TTZA 1GSEA 2BTOT 3D4TA 3PPUA 3KD0A 3GFKA 2PPTA 1VGLA 4EC0A 5D9VA 4DSSA 1V40A 2R6KA 4MLYA 3I69A 1X9MB 4MK3A 4OD7A 4MJCA 2H6XA 2OBKA 5IMDA 4KCAA 1GSDA 1WJKA 5IMZA 3DKSA 3CYNA 18GSA 3TJBA 4DSRA 2H01A 1F6MC 5B7CA 5IQYA 1GULA 1PX7A 4LA1A 2L6DA 5JWOB 3IBHA 4BVXB 4ZXGA 2VL2C 1O81A 2AV4A 4ID0A 2H1BA 2H1AA 1FB0A 3C1RA 1UA5A 2OADA 5E59A 4ZL9A 4K0NA 2VLTA 4JZQA 1ZYPA 1DSBA 3HHVA 4RI7A 4AJ6A 1V2AA 3GHAA 3FRCA 2NVLA 1BJXA 4WBRD 1O7UA 2R0GA 2VUPA 4I97A 2LRNA 3GN3A 5IIZA 2LS5A 3M8NA 2CQ9A 2GQMA 4MNNA 2ON5A 2HI7A 5HR3A 2ON7A 5AIXA 1QUWA 1TW9A 2E7PA 3DXBA 4CW9A 4I5QA 4JU5A 1M9BA 3UVHA 2H70A 3M0FA 4BPYA 2RUEA 3LQ7A 1EZKA 3TCOA 3FZAA 5ECPB 2H0IA 4K7IA 1NM3A 2LNTA 2P5RA 3EU3A 3D0ZA 3A2VA 2TIRA 4WKWA 1O73A 4HUAA 2GZYA 4NHZA 5HR1A 1TU7A 2NPBA 2B7KA 3G7YA 3HVVA 1OE8A 3IAM2 4DEJA 4HQZA 2QA2A 3R2QA 4TR4A 3GH6A 2O87A 1TRWA 1GSYA 3HZ4A 2E0QA 4MJEA 3TJKA 3CMIA 4X1UA 2V41A 3RDWA 1W4VA 2VCVA 4IP6A 2C4JA 4HEA2 3MWHA 3H1NA 2H30A 1BX9A 3QFBC 2B5YA 3TOTA 1JZOA 4MH3A 4KW6A 2OACA 4ZB6A 4ML1A 4YQVA 5F07A 1AQWA 3O76A 1XW6A 4MJAA 3J7Yb 3L4NA 4IJIA 3DGQA 2JZSA 1ERTA 4YKGA 2JU5A 3IC4A 3TRQA 3H79A 2MMNA 3Q18A 4CDOA 3HD5A 4ZL8A 14GSA 1QGVA 5JWRB 5C00A 3ISOA 2XHFA 2YP6A 2F9SA 3QCPA 4G2EA 3C7MA 2C1YA 4Z2TA 1K0MA 2GDRA 1SK0A 3EPTA 3MIXA 1Q4JA 1MTCA 4ZIJA 2VCTA 5D93A 4TOPA 3GL3A 3K8NA 4WF4A 4YAVA 4ECBA 3N9JA 3ZLPA 2H73A 1SKSB 2HZFA 4WXTA 5KN1A 3KGKA 1YF0A 5CREA 4N11A 3TRXA 3PR8A 1B4PA 4K7OA 1B4QA 1ZL9A 2R0PA 4POKA 3KP8A 1VRSD 2LV3A 2ES7A 2JL4A 3LFLA 2LKUA 1WRYA 4GF0A 3F63A 3DYRA 1SJZA 3APQA 1QXHA 2H1DA 1UN2A 2MMZA 3WGDA 2KOKA 2I1UA 3TKSA 3LYPA 3QFAC 3DIEA 4RQXA 2P31A 1TKDB 3G7JA 4F0CA 1AQVA 2RLIA 3GNJA 4MF5A 2F3MA 5GZZB 1O85A 4GLTA 1ZZYA 4F03A 1NHOA 4BVYA 4Z7XA 1OKTA 5ENUA 5EY6A 5ECRB 3ERFA 3M9KA 5IO0A 1NW2A 3IXRA 1WPIA 1PGTA 3KXOA 1ILOA 4CY6A 1VF3A 4EDYA 1QQ2A 2K8SA 4USSA 5G5EA 4TKYA 3TKSE 2R5GA 3E0UA 4BWQA 5B8BA 3CBUA 4MF6A 3HDCA 2O85A 1ST9A 2AHEA 4RI6A 2LJRA 1SL2B 3GKXA 1J08A 5H5SA 2KP2A 3I43A 4MA9A 1SYRA 2L5OA 2KP1A 1ACVA 1KTEA 1B48A 2E2GA 1ON4A 1HNAA 4HI7A 2IIYA 2WS2A 1I9DA 1YKCA 5DALB 1EV4A 4RQRA 4J2FA 1K0CA 2H19A 4HJMA 3PGTA 1FO5A 4HZ4A 4YH2A 4TR1A 5A4VA 3GSSA 4HOJA 4KF9A 5KN2A 2H76A 3IA1A 4G19A 1O8WA 5J41A 1GTBA 1F3BA 3KCMA 1B8XA 1SJIA 2IMDA 4GTUA 4Q5FA 1Y25A 1I5GA 1MEKA 2FNOA 4PX1A 5COHA 4IQAA 1IYIA 2C80A 4KE3A 4N10A 5EPFA 2K6VA 4OO5A 1WWJA 4CY8A 1DBYA 2PUKC 1THOA 4BA7A 1KEBA 5J9BA 2FWFA 2N5FA 4D73B 4K1FA 5AIVA 1ABAA 3F9UA 2YNXA 3GYKA 3IC8A 2C0DA 4WR5A 4MJBA 3ZVJA 2V32A 2WB9A 4BL7B 4EIPA 2WZ9A 2H0GA 1ZMAA 2CX3A 1MD3A 2YWNA 1XOAA 4I8BA 16GSA 2H0HA 4QL9A 1QMVA 1JLVA 2FD3A 4ZL7A 5G30A 1EGOA 2P5QA 4G0KA 1MD4A 1PKWA 2DKHA 1S3AA 3F0IA 6GSXA 1K3OA 4TVEA 1BEDA 3WT1A 3LXTA 4IKHA 3H8QA 1H75A 3UBKA 3ZFLA 2VL3A 2LRTA 4XIHA 2GZPA 4YKFA 1FHEA 4KCEA 3N5OA 5EVOA 1A24A 4PTSA 1PL1A 2H74A 4NV5A 1F3AA 1TK0B 2C3TA 3ZYWA 2AUVA 4O5UA 1EGRA 2AAWA 1Z5YE 4LL1B 5LD0A 1K0AA 2TRCP 4KDXA 2VCXA 1GNWA 1GSUA 4IJ3A 3J7Yk 5CO3A 5DAKA 1XXUA 5G31A 4PUFC 4KA0A 4CHSA 4POLA 3DEXA 3TKPA 1V58A 4PNFA 3UL3A 1GRXA 1H4OA 4IBPA 3IDVA 4GRFA 1FVKA 4X0XA 3F4TA 3ME7A 5IMAA 3FR3A 1GL8A 5CYYA 3KH7A 4V1Ap 4TXVA 1OC9B 1YY7A 2MYGA 2YN1A 2I81A 4V2LA 3ZRDA 2LUSA 4POMA 1B9XC 4OWYA 4FH8A 4N0ZA 1YJ6A 1FVJA 3QOUA 4NV2A 3G7IA 2XPEA 1GNEA 2VLUA 3P7XA 3ZZXA 3W6GA 1A8YA 4O5QA 4Q5NA 4X4JA 3GURA 1ML6A 5AGYA 5B6MA 3DD3A 5A5KA 4MABA 5L71A 2YWMA 3UMAA 1TP9A 4DVCA 4JR4A 4HS1A 4QL7A 1J9BA 2QC7A 2FWGA 3O6TA 4TXOB 6GSSA 1EP8A 5DJLA 5HQPA 5F8BA 3UAPA 3TRPA 2O89A 4MP4A 2GQLA 4IQ1A 1A0RP 1HD2A 2G2QA 1GLQA 3BOAA 4LL4B 4L8EA 3R3EA 2HXKA 1O6JA 2EC4A 5CRDA 1ZCPA 3NOFA 3F3RA 2JZRA 2YANA 1USBA 3GRXA 2JZTA 3IPZA 4MMMA 2C0FA 5CAXA 2OE3A 5ECNB 2X4AA 4O5RA 2XBIA 3PINA 2LQOA 3F8UA 1X5CA 3WYWA 1E6BA 3FR6A 2DJ0A 1X9WB 5KN3A 2K9FA 2VL9A 3APSA 3FW2A 3F6FA 2J23A 1K3LA 5IMFA 1TU8A 1F2EA 1A8LA 3EURA 2NDOA 3FMWA 3QAVA 1PQNA 5ID2A 2GLRA 2HLSA 4ZILA 2YJ7A 2PBJA 3LXZA 5KOXA 1T00A 2RIIA 1N2AA 2IFQB 1G6YA 2C8UA 2FHEA 5DCHA 2CAIA 4F82A 5D9WA 4XS1A 2MMOA 3EMPA 4OCEA 2HZEA 1Z3EA 4K2XA 5B8AA 1HNCA 2UZ8A 3CTGA 1XBSA 2EIOA 5IOWA 3IV4A 3U5RE 2M46A 2BJXA 1AW9A 1XWKA 3L9VA 4I2UA 5JCGA 7GSSA 3S9FA 3D4MA 2H75A 4NWYA 5FHIA 3UARA 1YQ1A 1JFUA 1LBKA 4ULXA 3HCZA 4K5SA 4ZBAA 1SL0B 4IELA 3VLNA 3A3TA 4KDUA 2WDUA 4EL1A 3IRAA 2R37A 2PGTA 3IE3A 2C0GA 1XWCA 2F51A 1GSSA 3C73A 3F4SA 4BVXA 4Q5QA 1T8EB 3P8WA 3IHQA 4OCFA 2VCWA 2TRXA 1T4ZA 3VPQA 4AGSA 2LNSA 3FYGA 1PA3A 3KTLA 4KGIA 4Z2RA 3VI5A 1N8JA 1OVNA 3QDNA 2HSMA 2VIMA 1PD21 2LRCA 2VD1A 4L5LA 8GSSA 1JZRA 1AAZA 3LEFA 3H4KA 4F0BA 3AY8A 3RPPA 4AJ8A 2OKAA 3BBYA 1PRXA 12GSA 2YPMA 3LJRA 5GAND 3IR4A 5KN0A 2L57A 4NHWA 1OAZA 4YAPA 4ZBDA 4WETA 5FWGA 2KLXA 2CT6A 4MZWA 2JADA 2FA8A 1UVZA 2KUCA 1GUHA 3GV1A 2IMEA 2VCQA 2NBSA 5CRGA 1LJRA 3KMNA 5HR2A 4MPFA 3GX0A 2R4VA 5E4WA 3VFIA 1OKDA 2C0EA 3VK9A 1M2AA 2A2PA 4WR4A 2K18A 1EEMA 1A0FA 1LU4A 3FZ9A 4F9ZA 3HJMA 2VOCA 4KUNA 4LMVA 5ECHB 4O32A 4GSTA 4WEYA 1TDIA 3KP9A 1F37A 1SYXA 3P90A 4EXJA 3GA4A 1YEXA 3TDGA 3FZ4A 4ZBBA 2MBTA 4PXOA 2B1LA 2B7JA 3LSZA 3Q19A 2R0CA 3APOA 5FT3A 3ERWA 1OYJA 4HQSA 3E9JB 3TJJA 3DVXA 4ECJA 4PQHA 2B3SA 1M2DA 2L6CA 2LQQA 3L9SA 1WOUA 3Q6OA 2PN8A 3D22A 5IPGA 4KX4A 5A4UA 1OE7A 4K9ZA 5ECOB 2DKIA 3IK7A 2JACA 2OE1A 2CZ2A 3HZ8A 2WULA 4H86A 3TGZA 1M9AA 2VM1A 2IN3A 2H6YA 6GSTA 3QMXA 5G1LA 2HRNA 3Q74A 3FR9A 4EUYA 1EWXA 4EDZA 3WGEA 3ZIVA 4Z2UA 3M3MA 2M72A 3ZTLA 4XS4B 2V1MA 4HU9A 4XHMA 1PX6A 4G9HA 3FY7A 2GQKA 2YOIA 4ISDA 1G7OA 1MDJA 3HVSA 3TKSC 4GSNA 2XBQA 2QKEA 2H1GA 4X43A 4JRRA 1DUGA 1BAYA 2GSSA 4V1Ag 1VF1A 3TUEA 9GSSA 1TXXA 1TRVA 4A5PA 2X49A 4IP1A 4FQUA 4I2TA 2FY6A 2EIRA 4POBA 4L5OA 5CNWA 4K2DA 5JCUA 3ZITA 3GTUB 17GSA 3L9UA 3VURA 5GSSA 2X99A 3CTFA 1TOFA 2LTKA 3HVXA 5J3RA 2GSTA 4HU7A 5DCGA 1JHBA 4DSSB 3GMFA 2DBCA 1PMTA 2IMKA 4OMVA 2D2ZA 1G7EA 3EINA 5D8IA 3UEMA 5J4UA 1GTIA 1T3BA 5G2ZA 3EE2A 4GWRA 3GH9A 5ECLB 1Z9HA 2C3QA 2H72A 3WD6A 2B5XA 1XPVA 1VF4A 1G6WA 3ERGA 5DQSA 5ECMB 3VWUA 1ZYNA 3A5WA 3QD9A 4EIQA 2I9HA 4TRXA 2YV9A 4HDEA 4XS6A 1ERVA 3LW9A 3MNGA 3VWWA 1SU9A 1BQ7A 4OFTA 3A5IA 3UBLA 1URMA 3A2WA 1XCCA 3TKQA 4F2IA 4KB3A 2DMLA 2RM6A 2DSAA 3CSIA 4E8EA 1KNGA 1S3CA 5DVBA 1TRSA 2V6OA 4MF7A 4K6XA 2GVPA 3P2AA 2FUG2 1K0NA 4G10A 3BCIA 4JR6A 3F4RA 3WGXA 4WF5A 3SBCA 2HYXA 1U3AA 3HY2A 2GZZA 1Z6NA 5ECQB 5H5QA 3VWVA 2PERA 4I6XA 2V6KA 3ZVJD 1ZOFA 3DVWA 4PNGA 1FAAA 2VL2A 2CVDA 2L4QA 2ZNMA 5BMUA 2H8LA 4OFNA 4MH2A 2PMTA 1AXDA 1T4YA 4XS4A 1XVWA 5CRWA 3OR5A 5ELGA 5DALA 3EU4A 1A2LA 1XWGA 4GCIA 1ZYEA 2CX4A 1R5PA 3MAKA 2LEGA 1J0FA 2HE3A 1YKAA 3HKRA 1JZWA 3MSZA 3GUSA 2CAQA 4EE0A 2DJ2A 2IMIA 1MDKA 4QQ7A 4RUVA 4PURA 4PQIA 3BD2A 1GP1A 4NMUA 2X8CA 3GSTA 2FWEA 1GH2A 1ERUA 4NAXA 3KZQA 19GSA 1FB6A 4N30A 3M1GA 1T7PB 3E3EA 3JCML 4J56E 4Q5RA 2J9HA 1RW1A 4IW9A 1KBNA 3C1SA 2ZCTA 3MDKA 1GSQA 4D73A 1JLWA 1SD9A 3BCKA 1XOBA 3LYKA 2HRKA 4LMWA 4BL7A 5IO2A 1F9MA 5IMCA 1QFNA 3ZL5A 1RK4A 3IOSA 3QPMA 2PWJA 1WP0A 2V2GA 3HJOA 6GSYA 3W8JA 4KH7A 2LJKA 2YJHA 1GLPA 1U3IA 1M0UA 4KSMA 3HXSA 2GSRA 3HA9A 4GQFA 3LWAA 1Z6MA 2ALBA 2OBIA 3UJ1A 5B6NA 3CSHA 1RQMA 2GT6A 1TK5B 1XWAA 1PN9A 1GSFA 1M99A 2A2SA 3NZNA 4EO3A 3UVTA 4JBBA 1TI3A 1XIYA 2WRTA 3G9BA 1IYHA 1A2JA 1K3YA 1PL2A 4NXIA 5ECIB 5F0GA 2DMMA 1GTAA 4XCSA 4MPGA 3ME8A 1SL1B 1SK2A 4LLRA 2F8AA 2DIZA 2P0GA 5ECSA 3GIXA 1VF2A 1C72A 2FLSA 2OA7A 1THXA 1HNBA 3GKNA 2H6ZA 2HNLA 1R26A 1T1VA 1HYUA 3KMOA 1FOHA 1WMJA 3IAS2 4GSSA 4V2NA 3U6VA 2O8VB 3FHKA 4KDYA 5HFKA 5INYA 2WFCA 2B5EA 5ELAA 2L59A 1GUMA 3F6DA 1A23A 3ED3A 4TN8A 1Z7RA 3FZ5A 4TR0A 1NSWA 1X5DA 4BVYB 1X9SB 5J9CA 5CP1A 1OC9A 5KOWA 3TOUA 3TB2A 1Z7PA 1EEJA 2GGTA 3D21A 3NIVA 4GXZA 2CV4A 4ZB9A 4L0WA 1K0DA 3O3TA 3LGCA 2XPDA 3US3A 3DMLA 1R5AA 2X8HA 1FW1A 3GKKA 4FO5A 2MMAA 4ZB8A 1U6TA 1G0TA 2FGXA 2WGRA 4YQMA 1FG4A 3C71A 1SK1A 2M80A 2IPAA 3QAGA 3KEBA 2DJKA 4PQ1A 1SENA 1XW9A 2VCZA 4ML6A 3IHGA 1QK8A 2VM2A 4AF2A 13GSA 4MZCA 4TR3A 4J57E 5G1KA 4TXOA 5D9TA 1OC8A 1YEPA 3LORA 4V2MA 4KSOA 2FCHA 5DJMA 4KNDA 4P3YB 1XW5A 4O92A 2MZCA 5HFIA 5D73A 5D9XA 4ICYA 2JSYA 4FYUA 2L4CA 1CQGA 3BJ5A 5H5RA 4TR1B 2GSQA 4DSQA 1PKZA 4KAEA 4MDCA 2YV7A 1GUKA 5D96A 3TKRA 2B1KA 2JSZA 2CZ3A 5GAPD 1K0BA 1EOHA 2EIQA 5GSTA 5LNKe 5BRTA 1HQOA 4AJ7A 3EYTA 2GS3A 4K0GA 2DJJA 2LJAA 3EVIA 2X8GA 5DQYA 4YQUA 1PSQA 1XWBA 1DE2A 2A2RA 2O7KA 2OJLA 4IS0A 2K8VA 3EC3A 2IL3A 3TJGA 5IMVA 3KM6A 3UOMA 5JWQB 2XC2A 2RM5A 4JE1A 5HFGA 1UC7A 1JZDA 2CVBA 2IFQA 5F06A 4NPBA 2C3NA 3FEUA 3H93A 2REMA 3DRNA 3DWVA 3F3QA 4XRDA 3RPNA 22GSA 4JEDA 2H66A 1W89A 2YZUA 2DLXA 2B6MA 3D6IA 4N0VA 2N5BA 2QSIA 1DE1A 2PU9C 1SKWB 4EKZA 6GSVA 4FIWA 5AN1A 1CQHA 4MCUA 3ZMLA 4WBJA 3ZREA 4PGTA 4BWSA 3L0HA 4ECCA 2HT9A 1SD8A 2E2MA 2QGVA 3ZMKA 1XVQA 2DJ1A 3L78A 2FA4A 3RHBA 1TI1A 2FWHA 2KHPA 1U87A 1XZOA 2DIYA 2A4HA 3QAWA 2IJYA 4PUAA 1GWCA 3GKMA 2HRFA 3IK9A 2DJ3A 3CSJA 4K7NA 3KTBA 2I3YA 5CRHA 3CRUA 20GSA 1PN0A 6GSWA 2YZHA 1EV9A 3LG6A 1OC3A 4O7HA 3KH9A 2A4VA 4OO4A 2YWOA 4G0LA 2AB6A 5DAKB 1Y6EA 2HSYA 1GTUA 4EVMA 2GT5A 3ZIJA 1WE0A 3I6AA 5IM9A 5AISA 2Z9SA 2G0FA 1NHYA 3VPTA 1E2YA 2VAFA 5IOXA 4TW5A 3RAZA 2VD0A 1TRUA 5LCZA 3FKFA 2AJQB 2R2JA 1R7HA 2PVOC 1ZGNA 2AYTA 4OFMA 5JCWA 3HJPA 5EL8A 4E8HA 3CRTA 3CXGA 5G5FA 2YCDA 4FYCA 4XRAA 3RHCA 2F8FA 5F05A 4IHUA 1V98A 4MZBA 2N5AA 2IMFA 3VI7A 5A4WA 1R4WA 3EWLA 2LSTA 1BG5A 1EOGA 1YDKA 1ZYQB 3UIWA 5ABRA 2GTUA 3QR6A 4IVFA 2BMXA 2IWTA 2CA8A 1B9YC 2DC5A 4IN0A 4ECIA 1S3DA 5DBQA 1M7TA 1A2MA 2CVKA 3D5JA 2L5LA 1SKRB 3GL5A 3RBTA 3C8EA 4EF0A 1AC1A 5C04A 3TJFA 3I9V2 3MYDA 1WIKA 2HRAA 3KIJA 4K5RA 3A2XA 2HSHA 2NTOA 4L0UA 1TK8B 3V1WA 1MDIA 4IGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q98 A;  1YF1 A;  3PH9 A;  6GSU A;  1X5E A;  2ZUP A;  2VO4 A;  2R3X A;  1EP7 A;  1V57 A;  5KEJ A;  4HJ2 A;  3EMX A;  2H71 A;  3HYP A;  4HZ2 A;  5DDL A;  1YZX A;  3WT2 A;  1AQX A;  1XFL A;  4GQC A;  1X0R A;  4K8M A;  5J5N A;  1AIU A;  2WCI A;  4XTS A;  3M9J A;  2PVQ A;  2HFD A;  2OE0 A;  1V9W A;  2VLV A;  1M2B A;  1ERW A;  5ID2 B;  3KJY A;  3ZFB A;  1TJD A;  4FYB A;  2YWI A;  5IPH A;  1K0O A;  4ILF A;  11GS A;  10GS A;  2I4A A;  1U88 A;  2HZE B;  1SJ6 A;  1FOV A;  4ACS A;  1AUC A;  1O8X A;  5HR0 A;  3SWL A;  5ECK B;  1BYE A;  2RUF A;  3FK8 A;  3GTU A;  2WJU A;  3GX8 A;  3W8S A;  2X64 A;  2MBS A;  3VWX A;  1TTZ A;  1GSE A;  2BTO T;  3D4T A;  3KD0 A;  3GFK A;  2PPT A;  1VGL A;  4EC0 A;  5D9V A;  4DSS A;  1V40 A;  2R6K A;  4MLY A;  3I69 A;  1X9M B;  4MK3 A;  4OD7 A;  4MJC A;  2H6X A;  2OBK A;  5IMD A;  4KCA A;  1GSD A;  1WJK A;  5IMZ A;  3DKS A;  3CYN A;  18GS A;  3TJB A;  4DSR A;  2H01 A;  1F6M C;  5B7C A;  5IQY A;  1GUL A;  1PX7 A;  4LA1 A;  2L6D A;  5JWO B;  3IBH A;  4ZXG A;  2VL2 C;  1O81 A;  2AV4 A;  4ID0 A;  2H1B A;  2H1A A;  1FB0 A;  3C1R A;  1UA5 A;  2OAD A;  5E59 A;  4ZL9 A;  4K0N A;  2VLT A;  4JZQ A;  1DSB A;  3HHV A;  4RI7 A;  4AJ6 A;  1V2A A;  3GHA A;  3FRC A;  2NVL A;  1BJX A;  4WBR D;  1O7U A;  2VUP A;  4I97 A;  2LRN A;  3GN3 A;  5IIZ A;  2LS5 A;  3M8N A;  2CQ9 A;  2GQM A;  2ON5 A;  2HI7 A;  5HR3 A;  2ON7 A;  5AIX A;  1QUW A;  1TW9 A;  2E7P A;  3DXB A;  4CW9 A;  4I5Q A;  4JU5 A;  1M9B A;  3UVH A;  2H70 A;  3M0F A;  4BPY A;  2RUE A;  3LQ7 A;  1EZK A;  3TCO A;  3FZA A;  5ECP B;  2H0I A;  4K7I A;  1NM3 A;  2LNT A;  2P5R A;  3EU3 A;  3D0Z A;  3A2V A;  2TIR A;  4WKW A;  1O73 A;  4HUA A;  2GZY A;  4NHZ A;  5HR1 A;  1TU7 A;  2NPB A;  2B7K A;  3G7Y A;  3HVV A;  1OE8 A;  3IAM 2;  4DEJ A;  4HQZ A;  3R2Q A;  4TR4 A;  3GH6 A;  2O87 A;  1TRW A;  1GSY A;  3HZ4 A;  2E0Q A;  4MJE A;  3TJK A;  3CMI A;  4X1U A;  2V41 A;  3RDW A;  1W4V A;  2VCV A;  4IP6 A;  2C4J A;  4HEA 2;  3MWH A;  3H1N A;  2H30 A;  1BX9 A;  3QFB C;  2B5Y A;  3TOT A;  1JZO A;  4MH3 A;  4KW6 A;  2OAC A;  4ZB6 A;  4ML1 A;  4YQV A;  5F07 A;  1AQW A;  3O76 A;  1XW6 A;  4MJA A;  3J7Y b;  3L4N A;  4IJI A;  3DGQ A;  2JZS A;  1ERT A;  2JU5 A;  3IC4 A;  3TRQ A;  3H79 A;  2MMN A;  3Q18 A;  4CDO A;  3HD5 A;  4ZL8 A;  14GS A;  1QGV A;  5JWR B;  5C00 A;  3ISO A;  2XHF A;  2YP6 A;  2F9S A;  3QCP A;  4G2E A;  3C7M A;  2C1Y A;  1K0M A;  2GDR A;  1SK0 A;  1Q4J A;  1MTC A;  4ZIJ A;  2VCT A;  5D93 A;  4TOP A;  3GL3 A;  3K8N A;  4WF4 A;  4YAV A;  4ECB A;  3N9J A;  3ZLP A;  2H73 A;  1SKS B;  2HZF A;  4WXT A;  5KN1 A;  3KGK A;  1YF0 A;  5CRE A;  4N11 A;  3TRX A;  3PR8 A;  1B4P A;  4K7O A;  1B4Q A;  1ZL9 A;  4POK A;  3KP8 A;  1VRS D;  2LV3 A;  2ES7 A;  2JL4 A;  3LFL A;  2LKU A;  1WRY A;  4GF0 A;  3F63 A;  3DYR A;  1SJZ A;  3APQ A;  1QXH A;  2H1D A;  1UN2 A;  2MMZ A;  3WGD A;  2KOK A;  2I1U A;  3TKS A;  3LYP A;  3QFA C;  3DIE A;  4RQX A;  2P31 A;  1TKD B;  3G7J A;  4F0C A;  1AQV A;  2RLI A;  3GNJ A;  4MF5 A;  2F3M A;  5GZZ B;  1O85 A;  4GLT A;  1ZZY A;  4F03 A;  1NHO A;  4BVY A;  4Z7X A;  1OKT A;  5ENU A;  5EY6 A;  5ECR B;  3ERF A;  3M9K A;  5IO0 A;  1NW2 A;  3IXR A;  1WPI A;  1PGT A;  3KXO A;  1ILO A;  1VF3 A;  4EDY A;  1QQ2 A;  2K8S A;  5G5E A;  4TKY A;  3TKS E;  2R5G A;  3E0U A;  4BWQ A;  5B8B A;  3CBU A;  4MF6 A;  3HDC A;  2O85 A;  1ST9 A;  2AHE A;  4RI6 A;  2LJR A;  1SL2 B;  3GKX A;  1J08 A;  5H5S A;  2KP2 A;  3I43 A;  4MA9 A;  1SYR A;  2L5O A;  2KP1 A;  1ACV A;  1KTE A;  1B48 A;  2E2G A;  1ON4 A;  1HNA A;  4HI7 A;  2IIY A;  2WS2 A;  1I9D A;  1YKC A;  5DAL B;  1EV4 A;  4RQR A;  4J2F A;  1K0C A;  2H19 A;  4HJM A;  3PGT A;  1FO5 A;  4HZ4 A;  4YH2 A;  4TR1 A;  5A4V A;  3GSS A;  4HOJ A;  5KN2 A;  2H76 A;  3IA1 A;  4G19 A;  1O8W A;  5J41 A;  1GTB A;  1F3B A;  3KCM A;  1B8X A;  1SJI A;  2IMD A;  4GTU A;  4Q5F A;  1Y25 A;  1I5G A;  1MEK A;  2FNO A;  4PX1 A;  5COH A;  4IQA A;  1IYI A;  2C80 A;  4KE3 A;  4N10 A;  5EPF A;  2K6V A;  4OO5 A;  1WWJ A;  1DBY A;  2PUK C;  1THO A;  4BA7 A;  1KEB A;  5J9B A;  2FWF A;  2N5F A;  4D73 B;  4K1F A;  5AIV A;  1ABA A;  3F9U A;  2YNX A;  3GYK A;  2C0D A;  4WR5 A;  4MJB A;  3ZVJ A;  2V32 A;  2WB9 A;  2WZ9 A;  2H0G A;  1ZMA A;  2CX3 A;  1MD3 A;  2YWN A;  1XOA A;  4I8B A;  16GS A;  2H0H A;  4QL9 A;  1QMV A;  1JLV A;  2FD3 A;  4ZL7 A;  5G30 A;  1EGO A;  2P5Q A;  1MD4 A;  1PKW A;  1S3A A;  3F0I A;  6GSX A;  1K3O A;  4TVE A;  1BED A;  3WT1 A;  3LXT A;  4IKH A;  3H8Q A;  1H75 A;  3UBK A;  3ZFL A;  2VL3 A;  2LRT A;  4XIH A;  2GZP A;  1FHE A;  4KCE A;  3N5O A;  5EVO A;  1A24 A;  1PL1 A;  2H74 A;  4NV5 A;  1F3A A;  1TK0 B;  2C3T A;  3ZYW A;  2AUV A;  1EGR A;  2AAW A;  1Z5Y E;  4LL1 B;  5LD0 A;  1K0A A;  2TRC P;  4KDX A;  2VCX A;  1GNW A;  1GSU A;  4IJ3 A;  3J7Y k;  5CO3 A;  5DAK A;  1XXU A;  5G31 A;  4PUF C;  4KA0 A;  4CHS A;  4POL A;  3DEX A;  3TKP A;  1V58 A;  4PNF A;  3UL3 A;  1GRX A;  1H4O A;  4IBP A;  3IDV A;  4GRF A;  1FVK A;  4X0X A;  3F4T A;  3ME7 A;  5IMA A;  3FR3 A;  1GL8 A;  5CYY A;  3KH7 A;  4V1A p;  4TXV A;  1OC9 B;  1YY7 A;  2MYG A;  2YN1 A;  2I81 A;  4V2L A;  3ZRD A;  2LUS A;  4POM A;  1B9X C;  4OWY A;  4FH8 A;  4N0Z A;  1YJ6 A;  1FVJ A;  3QOU A;  4NV2 A;  3G7I A;  2XPE A;  1GNE A;  2VLU A;  3P7X A;  3ZZX A;  3W6G A;  1A8Y A;  4Q5N A;  3GUR A;  1ML6 A;  5AGY A;  5B6M A;  3DD3 A;  5A5K A;  4MAB A;  5L71 A;  2YWM A;  3UMA A;  1TP9 A;  4DVC A;  4JR4 A;  4HS1 A;  4QL7 A;  1J9B A;  2QC7 A;  2FWG A;  3O6T A;  4TXO B;  6GSS A;  1EP8 A;  5DJL A;  5HQP A;  5F8B A;  3UAP A;  3TRP A;  2O89 A;  4MP4 A;  2GQL A;  4IQ1 A;  1A0R P;  1HD2 A;  2G2Q A;  1GLQ A;  3BOA A;  4LL4 B;  4L8E A;  2HXK A;  1O6J A;  2EC4 A;  5CRD A;  1ZCP A;  3NOF A;  3F3R A;  2JZR A;  2YAN A;  1USB A;  3GRX A;  2JZT A;  3IPZ A;  4MMM A;  2C0F A;  5CAX A;  2OE3 A;  5ECN B;  4O5R A;  2XBI A;  3PIN A;  2LQO A;  3F8U A;  1X5C A;  3WYW A;  1E6B A;  3FR6 A;  2DJ0 A;  1X9W B;  5KN3 A;  2K9F A;  2VL9 A;  3APS A;  3FW2 A;  3F6F A;  2J23 A;  1K3L A;  5IMF A;  1TU8 A;  1F2E A;  1A8L A;  3EUR A;  2NDO A;  3QAV A;  1PQN A;  5ID2 A;  2GLR A;  2HLS A;  4ZIL A;  2YJ7 A;  2PBJ A;  3LXZ A;  1T00 A;  2RII A;  1N2A A;  2IFQ B;  1G6Y A;  2C8U A;  2FHE A;  5DCH A;  2CAI A;  4F82 A;  5D9W A;  4XS1 A;  2MMO A;  3EMP A;  4OCE A;  2HZE A;  1Z3E A;  5B8A A;  1HNC A;  3CTG A;  1XBS A;  2EIO A;  5IOW A;  3IV4 A;  3U5R E;  2M46 A;  2BJX A;  1AW9 A;  1XWK A;  3L9V A;  4I2U A;  5JCG A;  7GSS A;  3S9F A;  3D4M A;  2H75 A;  4NWY A;  5FHI A;  3UAR A;  1YQ1 A;  1JFU A;  1LBK A;  4ULX A;  3HCZ A;  4ZBA A;  1SL0 B;  4IEL A;  3VLN A;  3A3T A;  4KDU A;  2WDU A;  4EL1 A;  3IRA A;  2R37 A;  2PGT A;  3IE3 A;  2C0G A;  1XWC A;  2F51 A;  1GSS A;  3C73 A;  3F4S A;  4BVX A;  4Q5Q A;  1T8E B;  3P8W A;  3IHQ A;  4OCF A;  2VCW A;  2TRX A;  1T4Z A;  3VPQ A;  4AGS A;  2LNS A;  3FYG A;  1PA3 A;  3KTL A;  4KGI A;  3VI5 A;  1N8J A;  1OVN A;  3QDN A;  2VIM A;  1PD2 1;  2LRC A;  2VD1 A;  4L5L A;  8GSS A;  1JZR A;  1AAZ A;  3LEF A;  3H4K A;  4F0B A;  3AY8 A;  3RPP A;  4AJ8 A;  2OKA A;  3BBY A;  1PRX A;  12GS A;  2YPM A;  3LJR A;  5GAN D;  3IR4 A;  5KN0 A;  2L57 A;  4NHW A;  1OAZ A;  4YAP A;  4ZBD A;  4WET A;  5FWG A;  2KLX A;  2CT6 A;  4MZW A;  2JAD A;  2FA8 A;  1UVZ A;  2KUC A;  1GUH A;  3GV1 A;  2IME A;  2VCQ A;  2NBS A;  5CRG A;  1LJR A;  3KMN A;  5HR2 A;  4MPF A;  3GX0 A;  2R4V A;  5E4W A;  3VFI A;  1OKD A;  2C0E A;  3VK9 A;  1M2A A;  4WR4 A;  2K18 A;  1EEM A;  1A0F A;  1LU4 A;  3FZ9 A;  4F9Z A;  3HJM A;  2VOC A;  4KUN A;  4LMV A;  5ECH B;  4O32 A;  4GST A;  4WEY A;  1TDI A;  3KP9 A;  1F37 A;  1SYX A;  3P90 A;  4EXJ A;  3GA4 A;  1YEX A;  3TDG A;  3FZ4 A;  4ZBB A;  2MBT A;  4PXO A;  2B1L A;  2B7J A;  3LSZ A;  3Q19 A;  3APO A;  5FT3 A;  3ERW A;  1OYJ A;  4HQS A;  3E9J B;  3TJJ A;  3DVX A;  4ECJ A;  4PQH A;  2B3S A;  1M2D A;  2L6C A;  2LQQ A;  3L9S A;  1WOU A;  3Q6O A;  2PN8 A;  3D22 A;  5IPG A;  4KX4 A;  5A4U A;  1OE7 A;  4K9Z A;  5ECO B;  3IK7 A;  2JAC A;  2OE1 A;  2CZ2 A;  3HZ8 A;  2WUL A;  4H86 A;  3TGZ A;  1M9A A;  2VM1 A;  2IN3 A;  2H6Y A;  6GST A;  3QMX A;  5G1L A;  2HRN A;  3Q74 A;  3FR9 A;  4EUY A;  1EWX A;  4EDZ A;  3WGE A;  3ZIV A;  3M3M A;  2M72 A;  3ZTL A;  4XS4 B;  2V1M A;  4HU9 A;  4XHM A;  1PX6 A;  4G9H A;  3FY7 A;  2GQK A;  2YOI A;  4ISD A;  1G7O A;  1MDJ A;  3HVS A;  3TKS C;  4GSN A;  2XBQ A;  2QKE A;  2H1G A;  4X43 A;  4JRR A;  1DUG A;  1BAY A;  2GSS A;  4V1A g;  1VF1 A;  3TUE A;  9GSS A;  1TXX A;  1TRV A;  4IP1 A;  4I2T A;  2FY6 A;  2EIR A;  4POB A;  4L5O A;  5CNW A;  4K2D A;  5JCU A;  3ZIT A;  3GTU B;  17GS A;  3L9U A;  3VUR A;  5GSS A;  2X99 A;  3CTF A;  1TOF A;  2LTK A;  3HVX A;  5J3R A;  2GST A;  4HU7 A;  5DCG A;  1JHB A;  4DSS B;  3GMF A;  2DBC A;  1PMT A;  2IMK A;  4OMV A;  2D2Z A;  1G7E A;  3EIN A;  5D8I A;  3UEM A;  5J4U A;  1GTI A;  1T3B A;  5G2Z A;  3EE2 A;  4GWR A;  3GH9 A;  5ECL B;  1Z9H A;  2C3Q A;  2H72 A;  3WD6 A;  2B5X A;  1XPV A;  1VF4 A;  1G6W A;  3ERG A;  5DQS A;  5ECM B;  3VWU A;  3A5W A;  3QD9 A;  2I9H A;  4TRX A;  2YV9 A;  4HDE A;  4XS6 A;  1ERV A;  3MNG A;  3VWW A;  1SU9 A;  1BQ7 A;  4OFT A;  3UBL A;  1URM A;  3A2W A;  1XCC A;  3TKQ A;  4F2I A;  4KB3 A;  2DML A;  2RM6 A;  2DSA A;  3CSI A;  4E8E A;  1KNG A;  1S3C A;  5DVB A;  1TRS A;  2V6O A;  4MF7 A;  4K6X A;  2GVP A;  3P2A A;  2FUG 2;  1K0N A;  4G10 A;  3BCI A;  4JR6 A;  3F4R A;  3WGX A;  4WF5 A;  3SBC A;  2HYX A;  1U3A A;  3HY2 A;  2GZZ A;  1Z6N A;  5ECQ B;  5H5Q A;  3VWV A;  2PER A;  4I6X A;  2V6K A;  3ZVJ D;  1ZOF A;  3DVW A;  4PNG A;  1FAA A;  2VL2 A;  2CVD A;  2L4Q A;  2ZNM A;  2H8L A;  4OFN A;  4MH2 A;  2PMT A;  1AXD A;  1T4Y A;  4XS4 A;  1XVW A;  5CRW A;  3OR5 A;  5ELG A;  5DAL A;  3EU4 A;  1A2L A;  1XWG A;  4GCI A;  1ZYE A;  2CX4 A;  1R5P A;  3MAK A;  2LEG A;  1J0F A;  2HE3 A;  1YKA A;  3HKR A;  1JZW A;  3MSZ A;  3GUS A;  2CAQ A;  4EE0 A;  2DJ2 A;  2IMI A;  1MDK A;  4QQ7 A;  4RUV A;  4PUR A;  4PQI A;  3BD2 A;  1GP1 A;  4NMU A;  2X8C A;  3GST A;  2FWE A;  1GH2 A;  1ERU A;  4NAX A;  3KZQ A;  19GS A;  1FB6 A;  4N30 A;  3M1G A;  1T7P B;  3E3E A;  3JCM L;  4J56 E;  4Q5R A;  2J9H A;  1RW1 A;  4IW9 A;  1KBN A;  3C1S A;  2ZCT A;  3MDK A;  1GSQ A;  4D73 A;  1JLW A;  1SD9 A;  3BCK A;  1XOB A;  3LYK A;  4LMW A;  4BL7 A;  5IO2 A;  1F9M A;  5IMC A;  1QFN A;  3ZL5 A;  1RK4 A;  3IOS A;  3QPM A;  2PWJ A;  1WP0 A;  2V2G A;  3HJO A;  6GSY A;  3W8J A;  4KH7 A;  2LJK A;  2YJH A;  1GLP A;  1U3I A;  1M0U A;  4KSM A;  3HXS A;  2GSR A;  3HA9 A;  4GQF A;  3LWA A;  1Z6M A;  2ALB A;  2OBI A;  3UJ1 A;  5B6N A;  3CSH A;  1RQM A;  2GT6 A;  1TK5 B;  1XWA A;  1PN9 A;  1GSF A;  1M99 A;  2A2S A;  3NZN A;  4EO3 A;  3UVT A;  4JBB A;  1TI3 A;  1XIY A;  2WRT A;  3G9B A;  1IYH A;  1A2J A;  1K3Y A;  1PL2 A;  4NXI A;  5ECI B;  5F0G A;  2DMM A;  1GTA A;  4XCS A;  4MPG A;  3ME8 A;  1SL1 B;  1SK2 A;  4LLR A;  2F8A A;  2DIZ A;  2P0G A;  5ECS A;  3GIX A;  1VF2 A;  1C72 A;  2FLS A;  2OA7 A;  1THX A;  1HNB A;  3GKN A;  2H6Z A;  2HNL A;  1R26 A;  1T1V A;  1HYU A;  3KMO A;  3IAS 2;  1WMJ A;  4GSS A;  4V2N A;  3U6V A;  2O8V B;  3FHK A;  4KDY A;  5HFK A;  5INY A;  2WFC A;  2B5E A;  5ELA A;  2L59 A;  1GUM A;  3F6D A;  1A23 A;  3ED3 A;  4TN8 A;  1Z7R A;  3FZ5 A;  4TR0 A;  1NSW A;  1X5D A;  1X9S B;  5J9C A;  5CP1 A;  1OC9 A;  3TOU A;  3TB2 A;  1Z7P A;  1EEJ A;  2GGT A;  3D21 A;  3NIV A;  4GXZ A;  2CV4 A;  4ZB9 A;  4L0W A;  1K0D A;  3O3T A;  3LGC A;  2XPD A;  3US3 A;  3DML A;  1R5A A;  2X8H A;  1FW1 A;  3GKK A;  4FO5 A;  2MMA A;  4ZB8 A;  1U6T A;  1G0T A;  2FGX A;  2WGR A;  4YQM A;  1FG4 A;  3C71 A;  1SK1 A;  2M80 A;  2IPA A;  3QAG A;  3KEB A;  2DJK A;  4PQ1 A;  1SEN A;  1XW9 A;  2VCZ A;  4ML6 A;  1QK8 A;  2VM2 A;  4AF2 A;  13GS A;  4MZC A;  4TR3 A;  4J57 E;  5G1K A;  4TXO A;  5D9T A;  1OC8 A;  1YEP A;  3LOR A;  4V2M A;  4KSO A;  2FCH A;  5DJM A;  4KND A;  4P3Y B;  1XW5 A;  4O92 A;  2MZC A;  5HFI A;  5D73 A;  5D9X A;  2JSY A;  4FYU A;  2L4C A;  1CQG A;  3BJ5 A;  5H5R A;  4TR1 B;  2GSQ A;  4DSQ A;  1PKZ A;  4KAE A;  4MDC A;  2YV7 A;  1GUK A;  5D96 A;  3TKR A;  2B1K A;  2JSZ A;  2CZ3 A;  5GAP D;  1K0B A;  1EOH A;  2EIQ A;  5GST A;  5LNK e;  1HQO A;  4AJ7 A;  3EYT A;  2GS3 A;  4K0G A;  2DJJ A;  2LJA A;  3EVI A;  2X8G A;  5DQY A;  4YQU A;  1PSQ A;  1XWB A;  1DE2 A;  2A2R A;  2O7K A;  2OJL A;  4IS0 A;  2K8V A;  3EC3 A;  2IL3 A;  3TJG A;  5IMV A;  3KM6 A;  3UOM A;  5JWQ B;  2XC2 A;  2RM5 A;  4JE1 A;  5HFG A;  1UC7 A;  1JZD A;  2CVB A;  2IFQ A;  5F06 A;  4NPB A;  2C3N A;  3FEU A;  3H93 A;  2REM A;  3DRN A;  3DWV A;  3F3Q A;  4XRD A;  3RPN A;  22GS A;  4JED A;  2H66 A;  1W89 A;  2YZU A;  2DLX A;  2B6M A;  3D6I A;  4N0V A;  2N5B A;  2QSI A;  1DE1 A;  2PU9 C;  1SKW B;  4EKZ A;  6GSV A;  4FIW A;  5AN1 A;  1CQH A;  4MCU A;  3ZML A;  4WBJ A;  3ZRE A;  4PGT A;  4BWS A;  3L0H A;  4ECC A;  2HT9 A;  1SD8 A;  2E2M A;  2QGV A;  3ZMK A;  1XVQ A;  2DJ1 A;  3L78 A;  2FA4 A;  3RHB A;  1TI1 A;  2FWH A;  2KHP A;  1U87 A;  1XZO A;  2DIY A;  3QAW A;  2IJY A;  4PUA A;  1GWC A;  3GKM A;  2HRF A;  3IK9 A;  2DJ3 A;  3CSJ A;  4K7N A;  3KTB A;  2I3Y A;  5CRH A;  3CRU A;  20GS A;  6GSW A;  2YZH A;  1EV9 A;  3LG6 A;  1OC3 A;  4O7H A;  3KH9 A;  2A4V A;  4OO4 A;  2YWO A;  2AB6 A;  5DAK B;  1Y6E A;  2HSY A;  1GTU A;  4EVM A;  2GT5 A;  3ZIJ A;  1WE0 A;  3I6A A;  5IM9 A;  5AIS A;  2Z9S A;  2G0F A;  1NHY A;  3VPT A;  1E2Y A;  2VAF A;  5IOX A;  4TW5 A;  3RAZ A;  2VD0 A;  1TRU A;  5LCZ A;  3FKF A;  2AJQ B;  2R2J A;  1R7H A;  2PVO C;  1ZGN A;  2AYT A;  4OFM A;  5JCW A;  3HJP A;  5EL8 A;  4E8H A;  3CRT A;  3CXG A;  5G5F A;  2YCD A;  4FYC A;  4XRA A;  3RHC A;  2F8F A;  5F05 A;  4IHU A;  1V98 A;  4MZB A;  2N5A A;  2IMF A;  3VI7 A;  5A4W A;  1R4W A;  3EWL A;  2LST A;  1BG5 A;  1EOG A;  1YDK A;  1ZYQ B;  3UIW A;  5ABR A;  2GTU A;  3QR6 A;  4IVF A;  2BMX A;  2IWT A;  2CA8 A;  1B9Y C;  2DC5 A;  4IN0 A;  4ECI A;  1S3D A;  5DBQ A;  1M7T A;  1A2M A;  2CVK A;  3D5J A;  2L5L A;  1SKR B;  3GL5 A;  3RBT A;  3C8E A;  4EF0 A;  1AC1 A;  5C04 A;  3TJF A;  3I9V 2;  1WIK A;  3KIJ A;  3A2X A;  2HSH A;  2NTO A;  4L0U A;  1TK8 B;  3V1W A;  1MDI A;  4IGJ A; 
#chains in the Genus database with same CATH topology
 1Q98 A;  1YF1 A;  3PH9 A;  6GSU A;  1X5E A;  2QA1 A;  2ZUP A;  2VO4 A;  2R3X A;  1EP7 A;  1V57 A;  5KEJ A;  4HJ2 A;  3EMX A;  2H71 A;  3HYP A;  4HZ2 A;  5DDL A;  1YZX A;  3WT2 A;  1AQX A;  1XFL A;  4GQC A;  1X0R A;  4K8M A;  4G0I A;  1AIU A;  2WCI A;  4XTS A;  5J5N A;  3M9J A;  2PVQ A;  2HFD A;  2OE0 A;  1V9W A;  2VLV A;  1M2B A;  1ERW A;  5ID2 B;  3KJY A;  3ZFB A;  1TJD A;  4FYB A;  2YWI A;  5IPH A;  1K0O A;  4ILF A;  11GS A;  10GS A;  2I4A A;  1U88 A;  2HZE B;  1SJ6 A;  1FOV A;  4ACS A;  1AUC A;  1O8X A;  5HR0 A;  3SWL A;  5ECK B;  1BYE A;  2RUF A;  3FK8 A;  3GTU A;  2WJU A;  3GX8 A;  3W8S A;  2X64 A;  2MBS A;  3VWX A;  1TTZ A;  1GSE A;  2BTO T;  3D4T A;  3PPU A;  3KD0 A;  3GFK A;  2PPT A;  1VGL A;  4EC0 A;  5D9V A;  4DSS A;  1V40 A;  2R6K A;  4MLY A;  3I69 A;  1X9M B;  4MK3 A;  4OD7 A;  4MJC A;  2H6X A;  2OBK A;  5IMD A;  4KCA A;  1GSD A;  1WJK A;  5IMZ A;  3DKS A;  3CYN A;  18GS A;  3TJB A;  4DSR A;  2H01 A;  1F6M C;  5B7C A;  5IQY A;  1GUL A;  1PX7 A;  4LA1 A;  2L6D A;  5JWO B;  3IBH A;  4BVX B;  4ZXG A;  2VL2 C;  1O81 A;  2AV4 A;  4ID0 A;  2H1B A;  2H1A A;  1FB0 A;  3C1R A;  1UA5 A;  2OAD A;  5E59 A;  4ZL9 A;  4K0N A;  2VLT A;  4JZQ A;  1ZYP A;  1DSB A;  3HHV A;  4RI7 A;  4AJ6 A;  1V2A A;  3GHA A;  3FRC A;  2NVL A;  1BJX A;  4WBR D;  1O7U A;  2R0G A;  2VUP A;  4I97 A;  2LRN A;  3GN3 A;  5IIZ A;  2LS5 A;  3M8N A;  2CQ9 A;  2GQM A;  4MNN A;  2ON5 A;  2HI7 A;  5HR3 A;  2ON7 A;  5AIX A;  1QUW A;  1TW9 A;  2E7P A;  3DXB A;  4CW9 A;  4I5Q A;  4JU5 A;  1M9B A;  3UVH A;  2H70 A;  3M0F A;  4BPY A;  2RUE A;  3LQ7 A;  1EZK A;  3TCO A;  3FZA A;  5ECP B;  2H0I A;  4K7I A;  1NM3 A;  2LNT A;  2P5R A;  3EU3 A;  3D0Z A;  3A2V A;  2TIR A;  4WKW A;  1O73 A;  4HUA A;  2GZY A;  4NHZ A;  5HR1 A;  1TU7 A;  2NPB A;  2B7K A;  3G7Y A;  3HVV A;  1OE8 A;  3IAM 2;  4DEJ A;  4HQZ A;  2QA2 A;  3R2Q A;  4TR4 A;  3GH6 A;  2O87 A;  1TRW A;  1GSY A;  3HZ4 A;  2E0Q A;  4MJE A;  3TJK A;  3CMI A;  1PFO A;  4X1U A;  2V41 A;  3RDW A;  1W4V A;  2VCV A;  4IP6 A;  2C4J A;  4HEA 2;  3MWH A;  3H1N A;  2H30 A;  1BX9 A;  3QFB C;  2B5Y A;  3TOT A;  1JZO A;  4MH3 A;  4KW6 A;  2OAC A;  4ZB6 A;  4ML1 A;  4YQV A;  5F07 A;  1AQW A;  3O76 A;  1XW6 A;  4MJA A;  3J7Y b;  3L4N A;  4IJI A;  3DGQ A;  2JZS A;  1ERT A;  4YKG A;  2JU5 A;  3IC4 A;  3TRQ A;  3H79 A;  2MMN A;  3Q18 A;  4CDO A;  3HD5 A;  4ZL8 A;  14GS A;  1QGV A;  5JWR B;  5C00 A;  3ISO A;  2XHF A;  2YP6 A;  2F9S A;  3QCP A;  4G2E A;  3C7M A;  2C1Y A;  4Z2T A;  1K0M A;  2GDR A;  1SK0 A;  3EPT A;  3MIX A;  1Q4J A;  1MTC A;  4ZIJ A;  2VCT A;  5D93 A;  4TOP A;  3GL3 A;  3K8N A;  4WF4 A;  4YAV A;  4ECB A;  3N9J A;  3ZLP A;  2H73 A;  1SKS B;  2HZF A;  4WXT A;  5KN1 A;  3KGK A;  1YF0 A;  5CRE A;  4N11 A;  3TRX A;  3PR8 A;  1B4P A;  4K7O A;  1B4Q A;  1ZL9 A;  2R0P A;  4POK A;  3KP8 A;  1VRS D;  2LV3 A;  2ES7 A;  2JL4 A;  3LFL A;  2LKU A;  1WRY A;  4GF0 A;  3F63 A;  3DYR A;  1SJZ A;  3APQ A;  1QXH A;  2H1D A;  1UN2 A;  2MMZ A;  3WGD A;  2KOK A;  2I1U A;  3TKS A;  3LYP A;  3QFA C;  3DIE A;  4RQX A;  2P31 A;  1TKD B;  3G7J A;  4F0C A;  1AQV A;  2RLI A;  3GNJ A;  4MF5 A;  2F3M A;  5GZZ B;  1O85 A;  4GLT A;  1ZZY A;  4F03 A;  1NHO A;  4BVY A;  4Z7X A;  1OKT A;  5ENU A;  5EY6 A;  5ECR B;  3ERF A;  3M9K A;  5IO0 A;  1NW2 A;  3IXR A;  1WPI A;  1PGT A;  3KXO A;  1ILO A;  4CY6 A;  1VF3 A;  4EDY A;  1QQ2 A;  2K8S A;  4USS A;  5G5E A;  4TKY A;  3TKS E;  2R5G A;  3E0U A;  4BWQ A;  5B8B A;  3CBU A;  4MF6 A;  3HDC A;  2O85 A;  1ST9 A;  2AHE A;  4RI6 A;  2LJR A;  1SL2 B;  3GKX A;  1J08 A;  5H5S A;  2KP2 A;  3I43 A;  4MA9 A;  1SYR A;  2L5O A;  2KP1 A;  1ACV A;  1KTE A;  1B48 A;  2E2G A;  1ON4 A;  1HNA A;  4HI7 A;  2IIY A;  2WS2 A;  1I9D A;  1YKC A;  5DAL B;  1EV4 A;  4RQR A;  4J2F A;  1K0C A;  2H19 A;  4HJM A;  3PGT A;  1FO5 A;  4HZ4 A;  4YH2 A;  4TR1 A;  5A4V A;  3GSS A;  4HOJ A;  4KF9 A;  5KN2 A;  2H76 A;  3IA1 A;  4G19 A;  1O8W A;  5J41 A;  1GTB A;  1F3B A;  3KCM A;  1B8X A;  1SJI A;  2IMD A;  4GTU A;  4Q5F A;  1Y25 A;  1I5G A;  1MEK A;  2FNO A;  4PX1 A;  5COH A;  4IQA A;  1IYI A;  2C80 A;  4KE3 A;  4N10 A;  5EPF A;  2K6V A;  4OO5 A;  1WWJ A;  4CY8 A;  1DBY A;  2PUK C;  1THO A;  4BA7 A;  1KEB A;  5J9B A;  2FWF A;  2N5F A;  4D73 B;  4K1F A;  5AIV A;  1ABA A;  3F9U A;  2YNX A;  3GYK A;  3IC8 A;  2C0D A;  4WR5 A;  4MJB A;  3ZVJ A;  2V32 A;  2WB9 A;  4BL7 B;  4EIP A;  2WZ9 A;  2H0G A;  1ZMA A;  2CX3 A;  1MD3 A;  2YWN A;  1XOA A;  4I8B A;  16GS A;  2H0H A;  4QL9 A;  1QMV A;  1JLV A;  2FD3 A;  4ZL7 A;  5G30 A;  1EGO A;  2P5Q A;  4G0K A;  1MD4 A;  1PKW A;  2DKH A;  1S3A A;  3F0I A;  6GSX A;  1K3O A;  4TVE A;  1BED A;  3WT1 A;  3LXT A;  4IKH A;  3H8Q A;  1H75 A;  3UBK A;  3ZFL A;  2VL3 A;  2LRT A;  4XIH A;  2GZP A;  4YKF A;  1FHE A;  4KCE A;  3N5O A;  5EVO A;  1A24 A;  4PTS A;  1PL1 A;  2H74 A;  4NV5 A;  1F3A A;  1TK0 B;  2C3T A;  3ZYW A;  2AUV A;  4O5U A;  1EGR A;  2AAW A;  1Z5Y E;  4LL1 B;  5LD0 A;  1K0A A;  2TRC P;  4KDX A;  2VCX A;  1GNW A;  1GSU A;  4IJ3 A;  3J7Y k;  5CO3 A;  5DAK A;  1XXU A;  5G31 A;  4PUF C;  4KA0 A;  4CHS A;  4POL A;  3DEX A;  3TKP A;  1V58 A;  4PNF A;  3UL3 A;  1GRX A;  1H4O A;  4IBP A;  3IDV A;  4GRF A;  1FVK A;  4X0X A;  3F4T A;  3ME7 A;  5IMA A;  3FR3 A;  1GL8 A;  5CYY A;  3KH7 A;  4V1A p;  4TXV A;  1OC9 B;  1YY7 A;  2MYG A;  2YN1 A;  2I81 A;  4V2L A;  3ZRD A;  2LUS A;  4POM A;  1B9X C;  4OWY A;  4FH8 A;  4N0Z A;  1YJ6 A;  1FVJ A;  3QOU A;  4NV2 A;  3G7I A;  2XPE A;  1GNE A;  2VLU A;  3P7X A;  3ZZX A;  3W6G A;  1A8Y A;  4O5Q A;  4Q5N A;  4X4J A;  3GUR A;  1ML6 A;  5AGY A;  5B6M A;  3DD3 A;  5A5K A;  4MAB A;  5L71 A;  2YWM A;  3UMA A;  1TP9 A;  4DVC A;  4JR4 A;  4HS1 A;  4QL7 A;  1J9B A;  2QC7 A;  2FWG A;  3O6T A;  4TXO B;  6GSS A;  1EP8 A;  5DJL A;  5HQP A;  5F8B A;  3UAP A;  3TRP A;  2O89 A;  4MP4 A;  2GQL A;  4IQ1 A;  1A0R P;  1HD2 A;  2G2Q A;  1GLQ A;  3BOA A;  4LL4 B;  4L8E A;  3R3E A;  2HXK A;  1O6J A;  2EC4 A;  5CRD A;  1M3I A;  1ZCP A;  3NOF A;  3F3R A;  2JZR A;  2YAN A;  1USB A;  3GRX A;  2JZT A;  3IPZ A;  4MMM A;  2C0F A;  5CAX A;  2OE3 A;  5ECN B;  2X4A A;  4O5R A;  2XBI A;  3PIN A;  2LQO A;  3F8U A;  1X5C A;  3WYW A;  1E6B A;  3FR6 A;  2DJ0 A;  1X9W B;  5KN3 A;  2K9F A;  2VL9 A;  3APS A;  3FW2 A;  3F6F A;  2J23 A;  1K3L A;  5IMF A;  1TU8 A;  1F2E A;  1A8L A;  3EUR A;  2NDO A;  3FMW A;  3QAV A;  1PQN A;  5ID2 A;  2GLR A;  2HLS A;  4ZIL A;  2YJ7 A;  2PBJ A;  3LXZ A;  5KOX A;  1T00 A;  2RII A;  1N2A A;  2IFQ B;  1G6Y A;  2C8U A;  2FHE A;  5DCH A;  2CAI A;  4F82 A;  5D9W A;  4XS1 A;  2MMO A;  3EMP A;  4OCE A;  2HZE A;  1Z3E A;  4K2X A;  5B8A A;  1HNC A;  2UZ8 A;  3CTG A;  1XBS A;  2EIO A;  5IOW A;  3IV4 A;  1XG8 A;  3U5R E;  2M46 A;  2BJX A;  1AW9 A;  1XWK A;  3L9V A;  4I2U A;  5JCG A;  7GSS A;  3S9F A;  3D4M A;  2H75 A;  4NWY A;  5FHI A;  3UAR A;  1YQ1 A;  1JFU A;  1LBK A;  4ULX A;  3HCZ A;  4K5S A;  4ZBA A;  1SL0 B;  4IEL A;  3VLN A;  3A3T A;  4KDU A;  2WDU A;  4EL1 A;  3IRA A;  2R37 A;  2PGT A;  3IE3 A;  2C0G A;  1XWC A;  2F51 A;  1GSS A;  3C73 A;  3F4S A;  4BVX A;  4Q5Q A;  1T8E B;  3P8W A;  3IHQ A;  4OCF A;  2VCW A;  2TRX A;  1T4Z A;  3VPQ A;  4AGS A;  2LNS A;  3FYG A;  1PA3 A;  3KTL A;  4KGI A;  4Z2R A;  3VI5 A;  1N8J A;  1OVN A;  3QDN A;  2HSM A;  2VIM A;  1PD2 1;  2LRC A;  2VD1 A;  4L5L A;  8GSS A;  1JZR A;  1AAZ A;  3LEF A;  3H4K A;  4F0B A;  3AY8 A;  3RPP A;  4AJ8 A;  2OKA A;  3BBY A;  1PRX A;  12GS A;  2YPM A;  3LJR A;  5GAN D;  3IR4 A;  5KN0 A;  2L57 A;  4NHW A;  1OAZ A;  4YAP A;  4ZBD A;  4WET A;  5FWG A;  2KLX A;  2CT6 A;  4MZW A;  2JAD A;  2FA8 A;  1UVZ A;  2KUC A;  1GUH A;  3GV1 A;  2IME A;  2VCQ A;  2NBS A;  5CRG A;  1LJR A;  3KMN A;  5HR2 A;  4MPF A;  3GX0 A;  2R4V A;  5E4W A;  3VFI A;  1OKD A;  2C0E A;  3VK9 A;  1M2A A;  2A2P A;  4WR4 A;  2K18 A;  1EEM A;  1A0F A;  1LU4 A;  3FZ9 A;  4F9Z A;  3HJM A;  2VOC A;  4KUN A;  4LMV A;  5ECH B;  4O32 A;  4GST A;  4WEY A;  1TDI A;  4HSC X;  3KP9 A;  1F37 A;  1SYX A;  3P90 A;  4EXJ A;  3GA4 A;  1YEX A;  3TDG A;  3FZ4 A;  4ZBB A;  2MBT A;  4PXO A;  2B1L A;  2B7J A;  3LSZ A;  3Q19 A;  2R0C A;  3APO A;  5FT3 A;  3ERW A;  1OYJ A;  4HQS A;  3E9J B;  3TJJ A;  3DVX A;  4ECJ A;  4PQH A;  2B3S A;  1M2D A;  2L6C A;  2LQQ A;  3L9S A;  1WOU A;  3Q6O A;  2PN8 A;  3D22 A;  5IPG A;  4KX4 A;  5A4U A;  1OE7 A;  4K9Z A;  5ECO B;  2DKI A;  3IK7 A;  2JAC A;  2OE1 A;  2CZ2 A;  3HZ8 A;  2WUL A;  4H86 A;  3TGZ A;  1M9A A;  2VM1 A;  2IN3 A;  2H6Y A;  6GST A;  3QMX A;  5G1L A;  2HRN A;  3Q74 A;  3FR9 A;  4EUY A;  1EWX A;  4EDZ A;  3WGE A;  3ZIV A;  4Z2U A;  3M3M A;  2M72 A;  3ZTL A;  4XS4 B;  2V1M A;  4HU9 A;  4XHM A;  1PX6 A;  4G9H A;  3FY7 A;  2GQK A;  2YOI A;  4ISD A;  1G7O A;  1MDJ A;  3HVS A;  3TKS C;  4GSN A;  2XBQ A;  2QKE A;  2H1G A;  4X43 A;  4JRR A;  1DUG A;  1BAY A;  2GSS A;  4V1A g;  1VF1 A;  3TUE A;  9GSS A;  1TXX A;  1TRV A;  4A5P A;  2X49 A;  4IP1 A;  4FQU A;  4I2T A;  2FY6 A;  2EIR A;  4POB A;  4L5O A;  5CNW A;  4K2D A;  5JCU A;  3ZIT A;  3GTU B;  17GS A;  3L9U A;  3VUR A;  5GSS A;  2X99 A;  3CTF A;  1TOF A;  2LTK A;  3HVX A;  5J3R A;  2GST A;  4HU7 A;  5DCG A;  1JHB A;  4DSS B;  3GMF A;  2DBC A;  1PMT A;  2IMK A;  4OMV A;  2D2Z A;  1G7E A;  3EIN A;  5D8I A;  3UEM A;  5J4U A;  1GTI A;  1T3B A;  5G2Z A;  3EE2 A;  4GWR A;  3GH9 A;  3HVN A;  5ECL B;  1Z9H A;  2C3Q A;  2H72 A;  3WD6 A;  2B5X A;  1XPV A;  1VF4 A;  1G6W A;  3ERG A;  5DQS A;  5ECM B;  3VWU A;  1ZYN A;  3A5W A;  3QD9 A;  4EIQ A;  2I9H A;  4TRX A;  2YV9 A;  4HDE A;  4XS6 A;  1ERV A;  3LW9 A;  3MNG A;  3VWW A;  1SU9 A;  1BQ7 A;  4OFT A;  3A5I A;  3UBL A;  1URM A;  3A2W A;  1XCC A;  3TKQ A;  4F2I A;  4KB3 A;  2DML A;  2RM6 A;  2DSA A;  3CSI A;  4E8E A;  1KNG A;  1S3C A;  5DVB A;  1TRS A;  2V6O A;  4MF7 A;  4K6X A;  2GVP A;  3P2A A;  2FUG 2;  1K0N A;  4G10 A;  3BCI A;  4JR6 A;  3F4R A;  3WGX A;  4WF5 A;  3SBC A;  2HYX A;  1U3A A;  3HY2 A;  2GZZ A;  1Z6N A;  5ECQ B;  5H5Q A;  3VWV A;  2PER A;  4I6X A;  2V6K A;  3ZVJ D;  1ZOF A;  3DVW A;  4PNG A;  1FAA A;  2VL2 A;  2CVD A;  2L4Q A;  2ZNM A;  5BMU A;  2H8L A;  4OFN A;  4MH2 A;  2PMT A;  1AXD A;  1T4Y A;  4XS4 A;  1XVW A;  5CRW A;  3OR5 A;  5ELG A;  5DAL A;  3EU4 A;  1A2L A;  1XWG A;  4GCI A;  1ZYE A;  2CX4 A;  1R5P A;  3MAK A;  2LEG A;  1J0F A;  2HE3 A;  1YKA A;  3HKR A;  1JZW A;  3MSZ A;  3GUS A;  2CAQ A;  4EE0 A;  2DJ2 A;  2IMI A;  1MDK A;  4QQ7 A;  4RUV A;  4PUR A;  4PQI A;  3BD2 A;  1GP1 A;  4NMU A;  2X8C A;  3GST A;  2FWE A;  1GH2 A;  1ERU A;  4NAX A;  3KZQ A;  19GS A;  1FB6 A;  4N30 A;  3M1G A;  1T7P B;  3E3E A;  3JCM L;  4J56 E;  4Q5R A;  2J9H A;  1RW1 A;  4IW9 A;  1KBN A;  3C1S A;  2ZCT A;  3MDK A;  1GSQ A;  4D73 A;  1JLW A;  1SD9 A;  3BCK A;  1XOB A;  3LYK A;  2HRK A;  4LMW A;  4BL7 A;  5IO2 A;  1F9M A;  5IMC A;  1QFN A;  3ZL5 A;  1RK4 A;  3IOS A;  3QPM A;  2PWJ A;  1WP0 A;  2V2G A;  3HJO A;  6GSY A;  3W8J A;  4KH7 A;  2LJK A;  2YJH A;  1GLP A;  1U3I A;  1M0U A;  4KSM A;  3HXS A;  2GSR A;  3HA9 A;  4GQF A;  3LWA A;  1Z6M A;  2ALB A;  2OBI A;  3UJ1 A;  5B6N A;  3CSH A;  1RQM A;  2GT6 A;  1TK5 B;  1XWA A;  1PN9 A;  1GSF A;  1M99 A;  2A2S A;  3NZN A;  4EO3 A;  3UVT A;  4JBB A;  1TI3 A;  1XIY A;  2WRT A;  3G9B A;  1IYH A;  1A2J A;  1K3Y A;  1PL2 A;  4NXI A;  5ECI B;  5F0G A;  2DMM A;  1GTA A;  4XCS A;  4MPG A;  3ME8 A;  1SL1 B;  1SK2 A;  4LLR A;  2F8A A;  2DIZ A;  2P0G A;  5ECS A;  3GIX A;  1VF2 A;  1C72 A;  2FLS A;  2OA7 A;  1THX A;  1HNB A;  3GKN A;  2H6Z A;  2HNL A;  1R26 A;  1T1V A;  1HYU A;  3KMO A;  1FOH A;  1WMJ A;  3IAS 2;  4GSS A;  4V2N A;  3U6V A;  2O8V B;  3FHK A;  4KDY A;  5HFK A;  5INY A;  2WFC A;  2B5E A;  5ELA A;  2L59 A;  1GUM A;  3F6D A;  1A23 A;  3ED3 A;  4TN8 A;  1Z7R A;  3FZ5 A;  4TR0 A;  1NSW A;  1X5D A;  4BVY B;  1X9S B;  5J9C A;  5CP1 A;  1OC9 A;  5KOW A;  3TOU A;  3TB2 A;  1Z7P A;  1EEJ A;  2GGT A;  3D21 A;  3NIV A;  4GXZ A;  2CV4 A;  4ZB9 A;  4L0W A;  1K0D A;  3O3T A;  3LGC A;  2XPD A;  3US3 A;  3DML A;  1R5A A;  2X8H A;  1FW1 A;  3GKK A;  4FO5 A;  2MMA A;  4ZB8 A;  1U6T A;  1G0T A;  2FGX A;  2WGR A;  4YQM A;  1FG4 A;  3C71 A;  1SK1 A;  2M80 A;  2IPA A;  3QAG A;  3KEB A;  2DJK A;  4PQ1 A;  1SEN A;  3CQF A;  1XW9 A;  2VCZ A;  4ML6 A;  3IHG A;  1QK8 A;  2VM2 A;  4AF2 A;  13GS A;  4MZC A;  4TR3 A;  4J57 E;  5G1K A;  4TXO A;  5D9T A;  1OC8 A;  1YEP A;  3LOR A;  4BIK A;  4V2M A;  4KSO A;  2FCH A;  5DJM A;  4KND A;  4P3Y B;  1XW5 A;  4O92 A;  2MZC A;  5HFI A;  5D73 A;  5D9X A;  4ICY A;  2JSY A;  4FYU A;  2L4C A;  1CQG A;  3BJ5 A;  5H5R A;  4TR1 B;  2GSQ A;  4DSQ A;  1PKZ A;  1M3J A;  4KAE A;  4MDC A;  2YV7 A;  1GUK A;  5D96 A;  3TKR A;  2B1K A;  2JSZ A;  2CZ3 A;  5GAP D;  1K0B A;  1EOH A;  2EIQ A;  5GST A;  5LNK e;  5BRT A;  1HQO A;  4AJ7 A;  3EYT A;  2GS3 A;  4K0G A;  2DJJ A;  2LJA A;  3EVI A;  2X8G A;  5DQY A;  4YQU A;  1PSQ A;  1XWB A;  1DE2 A;  2A2R A;  2O7K A;  2OJL A;  4IS0 A;  2K8V A;  3EC3 A;  2IL3 A;  3TJG A;  5IMV A;  3KM6 A;  3UOM A;  5JWQ B;  2XC2 A;  2RM5 A;  4JE1 A;  5HFG A;  1UC7 A;  1JZD A;  2CVB A;  2IFQ A;  5F06 A;  4NPB A;  2C3N A;  3FEU A;  3H93 A;  2REM A;  3DRN A;  3DWV A;  3F3Q A;  4XRD A;  3RPN A;  22GS A;  4JED A;  2H66 A;  1W89 A;  2YZU A;  2DLX A;  2B6M A;  3D6I A;  4N0V A;  2N5B A;  2QSI A;  1DE1 A;  2PU9 C;  1SKW B;  4EKZ A;  6GSV A;  4FIW A;  5AN1 A;  1CQH A;  4MCU A;  3ZML A;  4WBJ A;  3ZRE A;  4PGT A;  4BWS A;  3L0H A;  4ECC A;  2HT9 A;  1SD8 A;  2E2M A;  2QGV A;  3ZMK A;  1XVQ A;  2DJ1 A;  3L78 A;  2FA4 A;  3RHB A;  1TI1 A;  2FWH A;  2KHP A;  1U87 A;  1XZO A;  2DIY A;  2A4H A;  3QAW A;  2IJY A;  4PUA A;  1GWC A;  3GKM A;  2HRF A;  3IK9 A;  2DJ3 A;  3CSJ A;  4K7N A;  3KTB A;  2I3Y A;  5CRH A;  3CRU A;  20GS A;  1PN0 A;  6GSW A;  2YZH A;  1EV9 A;  3LG6 A;  1OC3 A;  4O7H A;  1S3R A;  3KH9 A;  2A4V A;  4OO4 A;  2YWO A;  4G0L A;  2AB6 A;  5DAK B;  1Y6E A;  2HSY A;  1GTU A;  4EVM A;  2GT5 A;  3ZIJ A;  1WE0 A;  3I6A A;  5IM9 A;  5AIS A;  2Z9S A;  2G0F A;  1NHY A;  3VPT A;  1E2Y A;  2VAF A;  5IOX A;  4TW5 A;  3RAZ A;  2VD0 A;  1TRU A;  5LCZ A;  3FKF A;  2AJQ B;  2R2J A;  1R7H A;  2PVO C;  1ZGN A;  2AYT A;  4OFM A;  5JCW A;  3HJP A;  5EL8 A;  4E8H A;  3CRT A;  3CXG A;  5G5F A;  2YCD A;  4FYC A;  4XRA A;  3RHC A;  2F8F A;  5F05 A;  4IHU A;  1V98 A;  4MZB A;  2N5A A;  2IMF A;  3VI7 A;  5A4W A;  1R4W A;  3EWL A;  2LST A;  1BG5 A;  1EOG A;  1YDK A;  1ZYQ B;  3UIW A;  5ABR A;  2GTU A;  3QR6 A;  4IVF A;  2BMX A;  2IWT A;  2CA8 A;  1B9Y C;  2DC5 A;  4IN0 A;  4ECI A;  1S3D A;  5DBQ A;  1M7T A;  1A2M A;  2CVK A;  3D5J A;  2L5L A;  1SKR B;  3GL5 A;  3RBT A;  3C8E A;  4EF0 A;  1AC1 A;  5C04 A;  3TJF A;  3I9V 2;  3MYD A;  1WIK A;  2HRA A;  3KIJ A;  4K5R A;  3A2X A;  2HSH A;  2NTO A;  4L0U A;  1TK8 B;  3V1W A;  1MDI A;  4IGJ A; 
#chains in the Genus database with same CATH homology
 1Q98 A;  1YF1 A;  3PH9 A;  6GSU A;  1X5E A;  2QA1 A;  2ZUP A;  2VO4 A;  2R3X A;  1EP7 A;  1V57 A;  5KEJ A;  4HJ2 A;  3EMX A;  2H71 A;  3HYP A;  4HZ2 A;  5DDL A;  1YZX A;  3WT2 A;  1AQX A;  1XFL A;  4GQC A;  1X0R A;  4K8M A;  4G0I A;  1AIU A;  2WCI A;  4XTS A;  5J5N A;  3M9J A;  2PVQ A;  2HFD A;  2OE0 A;  1V9W A;  2VLV A;  1M2B A;  1ERW A;  5ID2 B;  3KJY A;  3ZFB A;  1TJD A;  4FYB A;  2YWI A;  5IPH A;  1K0O A;  4ILF A;  11GS A;  10GS A;  2I4A A;  1U88 A;  2HZE B;  1SJ6 A;  1FOV A;  4ACS A;  1AUC A;  1O8X A;  5HR0 A;  3SWL A;  5ECK B;  1BYE A;  2RUF A;  3FK8 A;  3GTU A;  2WJU A;  3GX8 A;  3W8S A;  2X64 A;  2MBS A;  3VWX A;  1TTZ A;  1GSE A;  2BTO T;  3D4T A;  3PPU A;  3KD0 A;  3GFK A;  2PPT A;  1VGL A;  4EC0 A;  5D9V A;  4DSS A;  1V40 A;  2R6K A;  4MLY A;  3I69 A;  1X9M B;  4MK3 A;  4OD7 A;  4MJC A;  2H6X A;  2OBK A;  5IMD A;  4KCA A;  1GSD A;  1WJK A;  5IMZ A;  3DKS A;  3CYN A;  18GS A;  3TJB A;  4DSR A;  2H01 A;  1F6M C;  5B7C A;  5IQY A;  1GUL A;  1PX7 A;  4LA1 A;  2L6D A;  5JWO B;  3IBH A;  4BVX B;  4ZXG A;  2VL2 C;  1O81 A;  2AV4 A;  4ID0 A;  2H1B A;  2H1A A;  1FB0 A;  3C1R A;  1UA5 A;  2OAD A;  5E59 A;  4ZL9 A;  4K0N A;  2VLT A;  4JZQ A;  1ZYP A;  1DSB A;  3HHV A;  4RI7 A;  4AJ6 A;  1V2A A;  3GHA A;  3FRC A;  2NVL A;  1BJX A;  4WBR D;  1O7U A;  2R0G A;  2VUP A;  4I97 A;  2LRN A;  3GN3 A;  5IIZ A;  2LS5 A;  3M8N A;  2CQ9 A;  2GQM A;  4MNN A;  2ON5 A;  2HI7 A;  5HR3 A;  2ON7 A;  5AIX A;  1QUW A;  1TW9 A;  2E7P A;  3DXB A;  4CW9 A;  4I5Q A;  4JU5 A;  1M9B A;  3UVH A;  2H70 A;  3M0F A;  4BPY A;  2RUE A;  3LQ7 A;  1EZK A;  3TCO A;  3FZA A;  5ECP B;  2H0I A;  4K7I A;  1NM3 A;  2LNT A;  2P5R A;  3EU3 A;  3D0Z A;  3A2V A;  2TIR A;  4WKW A;  1O73 A;  4HUA A;  2GZY A;  4NHZ A;  5HR1 A;  1TU7 A;  2NPB A;  2B7K A;  3G7Y A;  3HVV A;  1OE8 A;  3IAM 2;  4DEJ A;  4HQZ A;  2QA2 A;  3R2Q A;  4TR4 A;  3GH6 A;  2O87 A;  1TRW A;  1GSY A;  3HZ4 A;  2E0Q A;  4MJE A;  3TJK A;  3CMI A;  4X1U A;  2V41 A;  3RDW A;  1W4V A;  2VCV A;  4IP6 A;  2C4J A;  4HEA 2;  3MWH A;  3H1N A;  2H30 A;  1BX9 A;  3QFB C;  2B5Y A;  3TOT A;  1JZO A;  4MH3 A;  4KW6 A;  2OAC A;  4ZB6 A;  4ML1 A;  4YQV A;  5F07 A;  1AQW A;  3O76 A;  1XW6 A;  4MJA A;  3J7Y b;  3L4N A;  4IJI A;  3DGQ A;  2JZS A;  1ERT A;  4YKG A;  2JU5 A;  3IC4 A;  3TRQ A;  3H79 A;  2MMN A;  3Q18 A;  4CDO A;  3HD5 A;  4ZL8 A;  14GS A;  1QGV A;  5JWR B;  5C00 A;  3ISO A;  2XHF A;  2YP6 A;  2F9S A;  3QCP A;  4G2E A;  3C7M A;  2C1Y A;  4Z2T A;  1K0M A;  2GDR A;  1SK0 A;  3EPT A;  3MIX A;  1Q4J A;  1MTC A;  4ZIJ A;  2VCT A;  5D93 A;  4TOP A;  3GL3 A;  3K8N A;  4WF4 A;  4YAV A;  4ECB A;  3N9J A;  3ZLP A;  2H73 A;  1SKS B;  2HZF A;  4WXT A;  5KN1 A;  3KGK A;  1YF0 A;  5CRE A;  4N11 A;  3TRX A;  3PR8 A;  1B4P A;  4K7O A;  1B4Q A;  1ZL9 A;  2R0P A;  4POK A;  3KP8 A;  1VRS D;  2LV3 A;  2ES7 A;  2JL4 A;  3LFL A;  2LKU A;  1WRY A;  4GF0 A;  3F63 A;  3DYR A;  1SJZ A;  3APQ A;  1QXH A;  2H1D A;  1UN2 A;  2MMZ A;  3WGD A;  2KOK A;  2I1U A;  3TKS A;  3LYP A;  3QFA C;  3DIE A;  4RQX A;  2P31 A;  1TKD B;  3G7J A;  4F0C A;  1AQV A;  2RLI A;  3GNJ A;  4MF5 A;  2F3M A;  5GZZ B;  1O85 A;  4GLT A;  1ZZY A;  4F03 A;  1NHO A;  4BVY A;  4Z7X A;  1OKT A;  5ENU A;  5EY6 A;  5ECR B;  3ERF A;  3M9K A;  5IO0 A;  1NW2 A;  3IXR A;  1WPI A;  1PGT A;  3KXO A;  1ILO A;  4CY6 A;  1VF3 A;  4EDY A;  1QQ2 A;  2K8S A;  4USS A;  5G5E A;  4TKY A;  3TKS E;  2R5G A;  3E0U A;  4BWQ A;  5B8B A;  3CBU A;  4MF6 A;  3HDC A;  2O85 A;  1ST9 A;  2AHE A;  4RI6 A;  2LJR A;  1SL2 B;  3GKX A;  1J08 A;  5H5S A;  2KP2 A;  3I43 A;  4MA9 A;  1SYR A;  2L5O A;  2KP1 A;  1ACV A;  1KTE A;  1B48 A;  2E2G A;  1ON4 A;  1HNA A;  4HI7 A;  2IIY A;  2WS2 A;  1I9D A;  1YKC A;  5DAL B;  1EV4 A;  4RQR A;  4J2F A;  1K0C A;  2H19 A;  4HJM A;  3PGT A;  1FO5 A;  4HZ4 A;  4YH2 A;  4TR1 A;  5A4V A;  3GSS A;  4HOJ A;  4KF9 A;  5KN2 A;  2H76 A;  3IA1 A;  4G19 A;  1O8W A;  5J41 A;  1GTB A;  1F3B A;  3KCM A;  1B8X A;  1SJI A;  2IMD A;  4GTU A;  4Q5F A;  1Y25 A;  1I5G A;  1MEK A;  2FNO A;  4PX1 A;  5COH A;  4IQA A;  1IYI A;  2C80 A;  4KE3 A;  4N10 A;  5EPF A;  2K6V A;  4OO5 A;  1WWJ A;  4CY8 A;  1DBY A;  2PUK C;  1THO A;  4BA7 A;  1KEB A;  5J9B A;  2FWF A;  2N5F A;  4D73 B;  4K1F A;  5AIV A;  1ABA A;  3F9U A;  2YNX A;  3GYK A;  3IC8 A;  2C0D A;  4WR5 A;  4MJB A;  3ZVJ A;  2V32 A;  2WB9 A;  4BL7 B;  4EIP A;  2WZ9 A;  2H0G A;  1ZMA A;  2CX3 A;  1MD3 A;  2YWN A;  1XOA A;  4I8B A;  16GS A;  2H0H A;  4QL9 A;  1QMV A;  1JLV A;  2FD3 A;  4ZL7 A;  5G30 A;  1EGO A;  2P5Q A;  4G0K A;  1MD4 A;  1PKW A;  2DKH A;  1S3A A;  3F0I A;  6GSX A;  1K3O A;  4TVE A;  1BED A;  3WT1 A;  3LXT A;  4IKH A;  3H8Q A;  1H75 A;  3UBK A;  3ZFL A;  2VL3 A;  2LRT A;  4XIH A;  2GZP A;  4YKF A;  1FHE A;  4KCE A;  3N5O A;  5EVO A;  1A24 A;  4PTS A;  1PL1 A;  2H74 A;  4NV5 A;  1F3A A;  1TK0 B;  2C3T A;  3ZYW A;  2AUV A;  4O5U A;  1EGR A;  2AAW A;  1Z5Y E;  4LL1 B;  5LD0 A;  1K0A A;  2TRC P;  4KDX A;  2VCX A;  1GNW A;  1GSU A;  4IJ3 A;  3J7Y k;  5CO3 A;  5DAK A;  1XXU A;  5G31 A;  4PUF C;  4KA0 A;  4CHS A;  4POL A;  3DEX A;  3TKP A;  1V58 A;  4PNF A;  3UL3 A;  1GRX A;  1H4O A;  4IBP A;  3IDV A;  4GRF A;  1FVK A;  4X0X A;  3F4T A;  3ME7 A;  5IMA A;  3FR3 A;  1GL8 A;  5CYY A;  3KH7 A;  4V1A p;  4TXV A;  1OC9 B;  1YY7 A;  2MYG A;  2YN1 A;  2I81 A;  4V2L A;  3ZRD A;  2LUS A;  4POM A;  1B9X C;  4OWY A;  4FH8 A;  4N0Z A;  1YJ6 A;  1FVJ A;  3QOU A;  4NV2 A;  3G7I A;  2XPE A;  1GNE A;  2VLU A;  3P7X A;  3ZZX A;  3W6G A;  1A8Y A;  4O5Q A;  4Q5N A;  4X4J A;  3GUR A;  1ML6 A;  5AGY A;  5B6M A;  3DD3 A;  5A5K A;  4MAB A;  5L71 A;  2YWM A;  3UMA A;  1TP9 A;  4DVC A;  4JR4 A;  4HS1 A;  4QL7 A;  1J9B A;  2QC7 A;  2FWG A;  3O6T A;  4TXO B;  6GSS A;  1EP8 A;  5DJL A;  5HQP A;  5F8B A;  3UAP A;  3TRP A;  2O89 A;  4MP4 A;  2GQL A;  4IQ1 A;  1A0R P;  1HD2 A;  2G2Q A;  1GLQ A;  3BOA A;  4LL4 B;  4L8E A;  3R3E A;  2HXK A;  1O6J A;  2EC4 A;  5CRD A;  1ZCP A;  3NOF A;  3F3R A;  2JZR A;  2YAN A;  1USB A;  3GRX A;  2JZT A;  3IPZ A;  4MMM A;  2C0F A;  5CAX A;  2OE3 A;  5ECN B;  2X4A A;  4O5R A;  2XBI A;  3PIN A;  2LQO A;  3F8U A;  1X5C A;  3WYW A;  1E6B A;  3FR6 A;  2DJ0 A;  1X9W B;  5KN3 A;  2K9F A;  2VL9 A;  3APS A;  3FW2 A;  3F6F A;  2J23 A;  1K3L A;  5IMF A;  1TU8 A;  1F2E A;  1A8L A;  3EUR A;  2NDO A;  3FMW A;  3QAV A;  1PQN A;  5ID2 A;  2GLR A;  2HLS A;  4ZIL A;  2YJ7 A;  2PBJ A;  3LXZ A;  5KOX A;  1T00 A;  2RII A;  1N2A A;  2IFQ B;  1G6Y A;  2C8U A;  2FHE A;  5DCH A;  2CAI A;  4F82 A;  5D9W A;  4XS1 A;  2MMO A;  3EMP A;  4OCE A;  2HZE A;  1Z3E A;  4K2X A;  5B8A A;  1HNC A;  2UZ8 A;  3CTG A;  1XBS A;  2EIO A;  5IOW A;  3IV4 A;  3U5R E;  2M46 A;  2BJX A;  1AW9 A;  1XWK A;  3L9V A;  4I2U A;  5JCG A;  7GSS A;  3S9F A;  3D4M A;  2H75 A;  4NWY A;  5FHI A;  3UAR A;  1YQ1 A;  1JFU A;  1LBK A;  4ULX A;  3HCZ A;  4K5S A;  4ZBA A;  1SL0 B;  4IEL A;  3VLN A;  3A3T A;  4KDU A;  2WDU A;  4EL1 A;  3IRA A;  2R37 A;  2PGT A;  3IE3 A;  2C0G A;  1XWC A;  2F51 A;  1GSS A;  3C73 A;  3F4S A;  4BVX A;  4Q5Q A;  1T8E B;  3P8W A;  3IHQ A;  4OCF A;  2VCW A;  2TRX A;  1T4Z A;  3VPQ A;  4AGS A;  2LNS A;  3FYG A;  1PA3 A;  3KTL A;  4KGI A;  4Z2R A;  3VI5 A;  1N8J A;  1OVN A;  3QDN A;  2HSM A;  2VIM A;  1PD2 1;  2LRC A;  2VD1 A;  4L5L A;  8GSS A;  1JZR A;  1AAZ A;  3LEF A;  3H4K A;  4F0B A;  3AY8 A;  3RPP A;  4AJ8 A;  2OKA A;  3BBY A;  1PRX A;  12GS A;  2YPM A;  3LJR A;  5GAN D;  3IR4 A;  5KN0 A;  2L57 A;  4NHW A;  1OAZ A;  4YAP A;  4ZBD A;  4WET A;  5FWG A;  2KLX A;  2CT6 A;  4MZW A;  2JAD A;  2FA8 A;  1UVZ A;  2KUC A;  1GUH A;  3GV1 A;  2IME A;  2VCQ A;  2NBS A;  5CRG A;  1LJR A;  3KMN A;  5HR2 A;  4MPF A;  3GX0 A;  2R4V A;  5E4W A;  3VFI A;  1OKD A;  2C0E A;  3VK9 A;  1M2A A;  2A2P A;  4WR4 A;  2K18 A;  1EEM A;  1A0F A;  1LU4 A;  3FZ9 A;  4F9Z A;  3HJM A;  2VOC A;  4KUN A;  4LMV A;  5ECH B;  4O32 A;  4GST A;  4WEY A;  1TDI A;  3KP9 A;  1F37 A;  1SYX A;  3P90 A;  4EXJ A;  3GA4 A;  1YEX A;  3TDG A;  3FZ4 A;  4ZBB A;  2MBT A;  4PXO A;  2B1L A;  2B7J A;  3LSZ A;  3Q19 A;  2R0C A;  3APO A;  5FT3 A;  3ERW A;  1OYJ A;  4HQS A;  3E9J B;  3TJJ A;  3DVX A;  4ECJ A;  4PQH A;  2B3S A;  1M2D A;  2L6C A;  2LQQ A;  3L9S A;  1WOU A;  3Q6O A;  2PN8 A;  3D22 A;  5IPG A;  4KX4 A;  5A4U A;  1OE7 A;  4K9Z A;  5ECO B;  2DKI A;  3IK7 A;  2JAC A;  2OE1 A;  2CZ2 A;  3HZ8 A;  2WUL A;  4H86 A;  3TGZ A;  1M9A A;  2VM1 A;  2IN3 A;  2H6Y A;  6GST A;  3QMX A;  5G1L A;  2HRN A;  3Q74 A;  3FR9 A;  4EUY A;  1EWX A;  4EDZ A;  3WGE A;  3ZIV A;  4Z2U A;  3M3M A;  2M72 A;  3ZTL A;  4XS4 B;  2V1M A;  4HU9 A;  4XHM A;  1PX6 A;  4G9H A;  3FY7 A;  2GQK A;  2YOI A;  4ISD A;  1G7O A;  1MDJ A;  3HVS A;  3TKS C;  4GSN A;  2XBQ A;  2QKE A;  2H1G A;  4X43 A;  4JRR A;  1DUG A;  1BAY A;  2GSS A;  4V1A g;  1VF1 A;  3TUE A;  9GSS A;  1TXX A;  1TRV A;  4A5P A;  2X49 A;  4IP1 A;  4FQU A;  4I2T A;  2FY6 A;  2EIR A;  4POB A;  4L5O A;  5CNW A;  4K2D A;  5JCU A;  3ZIT A;  3GTU B;  17GS A;  3L9U A;  3VUR A;  5GSS A;  2X99 A;  3CTF A;  1TOF A;  2LTK A;  3HVX A;  5J3R A;  2GST A;  4HU7 A;  5DCG A;  1JHB A;  4DSS B;  3GMF A;  2DBC A;  1PMT A;  2IMK A;  4OMV A;  2D2Z A;  1G7E A;  3EIN A;  5D8I A;  3UEM A;  5J4U A;  1GTI A;  1T3B A;  5G2Z A;  3EE2 A;  4GWR A;  3GH9 A;  5ECL B;  1Z9H A;  2C3Q A;  2H72 A;  3WD6 A;  2B5X A;  1XPV A;  1VF4 A;  1G6W A;  3ERG A;  5DQS A;  5ECM B;  3VWU A;  1ZYN A;  3A5W A;  3QD9 A;  4EIQ A;  2I9H A;  4TRX A;  2YV9 A;  4HDE A;  4XS6 A;  1ERV A;  3LW9 A;  3MNG A;  3VWW A;  1SU9 A;  1BQ7 A;  4OFT A;  3A5I A;  3UBL A;  1URM A;  3A2W A;  1XCC A;  3TKQ A;  4F2I A;  4KB3 A;  2DML A;  2RM6 A;  2DSA A;  3CSI A;  4E8E A;  1KNG A;  1S3C A;  5DVB A;  1TRS A;  2V6O A;  4MF7 A;  4K6X A;  2GVP A;  3P2A A;  2FUG 2;  1K0N A;  4G10 A;  3BCI A;  4JR6 A;  3F4R A;  3WGX A;  4WF5 A;  3SBC A;  2HYX A;  1U3A A;  3HY2 A;  2GZZ A;  1Z6N A;  5ECQ B;  5H5Q A;  3VWV A;  2PER A;  4I6X A;  2V6K A;  3ZVJ D;  1ZOF A;  3DVW A;  4PNG A;  1FAA A;  2VL2 A;  2CVD A;  2L4Q A;  2ZNM A;  5BMU A;  2H8L A;  4OFN A;  4MH2 A;  2PMT A;  1AXD A;  1T4Y A;  4XS4 A;  1XVW A;  5CRW A;  3OR5 A;  5ELG A;  5DAL A;  3EU4 A;  1A2L A;  1XWG A;  4GCI A;  1ZYE A;  2CX4 A;  1R5P A;  3MAK A;  2LEG A;  1J0F A;  2HE3 A;  1YKA A;  3HKR A;  1JZW A;  3MSZ A;  3GUS A;  2CAQ A;  4EE0 A;  2DJ2 A;  2IMI A;  1MDK A;  4QQ7 A;  4RUV A;  4PUR A;  4PQI A;  3BD2 A;  1GP1 A;  4NMU A;  2X8C A;  3GST A;  2FWE A;  1GH2 A;  1ERU A;  4NAX A;  3KZQ A;  19GS A;  1FB6 A;  4N30 A;  3M1G A;  1T7P B;  3E3E A;  3JCM L;  4J56 E;  4Q5R A;  2J9H A;  1RW1 A;  4IW9 A;  1KBN A;  3C1S A;  2ZCT A;  3MDK A;  1GSQ A;  4D73 A;  1JLW A;  1SD9 A;  3BCK A;  1XOB A;  3LYK A;  2HRK A;  4LMW A;  4BL7 A;  5IO2 A;  1F9M A;  5IMC A;  1QFN A;  3ZL5 A;  1RK4 A;  3IOS A;  3QPM A;  2PWJ A;  1WP0 A;  2V2G A;  3HJO A;  6GSY A;  3W8J A;  4KH7 A;  2LJK A;  2YJH A;  1GLP A;  1U3I A;  1M0U A;  4KSM A;  3HXS A;  2GSR A;  3HA9 A;  4GQF A;  3LWA A;  1Z6M A;  2ALB A;  2OBI A;  3UJ1 A;  5B6N A;  3CSH A;  1RQM A;  2GT6 A;  1TK5 B;  1XWA A;  1PN9 A;  1GSF A;  1M99 A;  2A2S A;  3NZN A;  4EO3 A;  3UVT A;  4JBB A;  1TI3 A;  1XIY A;  2WRT A;  3G9B A;  1IYH A;  1A2J A;  1K3Y A;  1PL2 A;  4NXI A;  5ECI B;  5F0G A;  2DMM A;  1GTA A;  4XCS A;  4MPG A;  3ME8 A;  1SL1 B;  1SK2 A;  4LLR A;  2F8A A;  2DIZ A;  2P0G A;  5ECS A;  3GIX A;  1VF2 A;  1C72 A;  2FLS A;  2OA7 A;  1THX A;  1HNB A;  3GKN A;  2H6Z A;  2HNL A;  1R26 A;  1T1V A;  1HYU A;  3KMO A;  1FOH A;  1WMJ A;  3IAS 2;  4GSS A;  4V2N A;  3U6V A;  2O8V B;  3FHK A;  4KDY A;  5HFK A;  5INY A;  2WFC A;  2B5E A;  5ELA A;  2L59 A;  1GUM A;  3F6D A;  1A23 A;  3ED3 A;  4TN8 A;  1Z7R A;  3FZ5 A;  4TR0 A;  1NSW A;  1X5D A;  4BVY B;  1X9S B;  5J9C A;  5CP1 A;  1OC9 A;  5KOW A;  3TOU A;  3TB2 A;  1Z7P A;  1EEJ A;  2GGT A;  3D21 A;  3NIV A;  4GXZ A;  2CV4 A;  4ZB9 A;  4L0W A;  1K0D A;  3O3T A;  3LGC A;  2XPD A;  3US3 A;  3DML A;  1R5A A;  2X8H A;  1FW1 A;  3GKK A;  4FO5 A;  2MMA A;  4ZB8 A;  1U6T A;  1G0T A;  2FGX A;  2WGR A;  4YQM A;  1FG4 A;  3C71 A;  1SK1 A;  2M80 A;  2IPA A;  3QAG A;  3KEB A;  2DJK A;  4PQ1 A;  1SEN A;  1XW9 A;  2VCZ A;  4ML6 A;  3IHG A;  1QK8 A;  2VM2 A;  4AF2 A;  13GS A;  4MZC A;  4TR3 A;  4J57 E;  5G1K A;  4TXO A;  5D9T A;  1OC8 A;  1YEP A;  3LOR A;  4V2M A;  4KSO A;  2FCH A;  5DJM A;  4KND A;  4P3Y B;  1XW5 A;  4O92 A;  2MZC A;  5HFI A;  5D73 A;  5D9X A;  4ICY A;  2JSY A;  4FYU A;  2L4C A;  1CQG A;  3BJ5 A;  5H5R A;  4TR1 B;  2GSQ A;  4DSQ A;  1PKZ A;  4KAE A;  4MDC A;  2YV7 A;  1GUK A;  5D96 A;  3TKR A;  2B1K A;  2JSZ A;  2CZ3 A;  5GAP D;  1K0B A;  1EOH A;  2EIQ A;  5GST A;  5LNK e;  5BRT A;  1HQO A;  4AJ7 A;  3EYT A;  2GS3 A;  4K0G A;  2DJJ A;  2LJA A;  3EVI A;  2X8G A;  5DQY A;  4YQU A;  1PSQ A;  1XWB A;  1DE2 A;  2A2R A;  2O7K A;  2OJL A;  4IS0 A;  2K8V A;  3EC3 A;  2IL3 A;  3TJG A;  5IMV A;  3KM6 A;  3UOM A;  5JWQ B;  2XC2 A;  2RM5 A;  4JE1 A;  5HFG A;  1UC7 A;  1JZD A;  2CVB A;  2IFQ A;  5F06 A;  4NPB A;  2C3N A;  3FEU A;  3H93 A;  2REM A;  3DRN A;  3DWV A;  3F3Q A;  4XRD A;  3RPN A;  22GS A;  4JED A;  2H66 A;  1W89 A;  2YZU A;  2DLX A;  2B6M A;  3D6I A;  4N0V A;  2N5B A;  2QSI A;  1DE1 A;  2PU9 C;  1SKW B;  4EKZ A;  6GSV A;  4FIW A;  5AN1 A;  1CQH A;  4MCU A;  3ZML A;  4WBJ A;  3ZRE A;  4PGT A;  4BWS A;  3L0H A;  4ECC A;  2HT9 A;  1SD8 A;  2E2M A;  2QGV A;  3ZMK A;  1XVQ A;  2DJ1 A;  3L78 A;  2FA4 A;  3RHB A;  1TI1 A;  2FWH A;  2KHP A;  1U87 A;  1XZO A;  2DIY A;  2A4H A;  3QAW A;  2IJY A;  4PUA A;  1GWC A;  3GKM A;  2HRF A;  3IK9 A;  2DJ3 A;  3CSJ A;  4K7N A;  3KTB A;  2I3Y A;  5CRH A;  3CRU A;  20GS A;  1PN0 A;  6GSW A;  2YZH A;  1EV9 A;  3LG6 A;  1OC3 A;  4O7H A;  3KH9 A;  2A4V A;  4OO4 A;  2YWO A;  4G0L A;  2AB6 A;  5DAK B;  1Y6E A;  2HSY A;  1GTU A;  4EVM A;  2GT5 A;  3ZIJ A;  1WE0 A;  3I6A A;  5IM9 A;  5AIS A;  2Z9S A;  2G0F A;  1NHY A;  3VPT A;  1E2Y A;  2VAF A;  5IOX A;  4TW5 A;  3RAZ A;  2VD0 A;  1TRU A;  5LCZ A;  3FKF A;  2AJQ B;  2R2J A;  1R7H A;  2PVO C;  1ZGN A;  2AYT A;  4OFM A;  5JCW A;  3HJP A;  5EL8 A;  4E8H A;  3CRT A;  3CXG A;  5G5F A;  2YCD A;  4FYC A;  4XRA A;  3RHC A;  2F8F A;  5F05 A;  4IHU A;  1V98 A;  4MZB A;  2N5A A;  2IMF A;  3VI7 A;  5A4W A;  1R4W A;  3EWL A;  2LST A;  1BG5 A;  1EOG A;  1YDK A;  1ZYQ B;  3UIW A;  5ABR A;  2GTU A;  3QR6 A;  4IVF A;  2BMX A;  2IWT A;  2CA8 A;  1B9Y C;  2DC5 A;  4IN0 A;  4ECI A;  1S3D A;  5DBQ A;  1M7T A;  1A2M A;  2CVK A;  3D5J A;  2L5L A;  1SKR B;  3GL5 A;  3RBT A;  3C8E A;  4EF0 A;  1AC1 A;  5C04 A;  3TJF A;  3I9V 2;  3MYD A;  1WIK A;  2HRA A;  3KIJ A;  4K5R A;  3A2X A;  2HSH A;  2NTO A;  4L0U A;  1TK8 B;  3V1W A;  1MDI A;  4IGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...