3M9KA

Crystal structure of human thioredoxin c69/73s double-mutant, oxidized form
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASESEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title Crystal structure of human thioredoxin revealing an unraveled helix and exposed S-nitrosation site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 37
structure length 105
sequence length 105
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3m9kA00
4KB3A 1AQWA 1S3DA 3PH9A 1VF3A 3WT1A 1YY7A 19GSA 1V9WA 3KH9A 3I69A 3L0HA 3O6TA 2YV7A 5CRWA 4HU9A 5HR0A 4K6XA 1XCCA 14GSA 3CSJA 2XC2A 4BWQA 1IYHA 3HDCA 3LQ7A 3IBHA 4XS4B 2K6VA 1S3CA 1THXA 3IR4A 4L5LA 3FR9A 2HZFA 4E8HA 4EKZA 2F51A 2IJYA 4XRDA 2YWNA 5DCGA 2ALBA 1PKZA 3Q18A 1UA5A 4NAXA 4XRAA 2F8FA 3TJGA 2YPMA 3IK9A 4L8EA 2AAWA 1U88A 2A2RA 1DE2A 4TXOA 3KEBA 3M1GA 3I9V2 3A2WA 1OE7A 1C72A 5D73A 4E8EA 4IP6A 1TXXA 1TRUA 3ZZXA 2CZ3A 5JCWA 3VLNA 1XW9A 4X1UA 5ABRA 2VLTA 2HFDA 1NM3A 1ERWA 4MMMA 4XTSA 3BD2A 4IVFA 1XWGA 2WS2A 2YOIA 2H71A 3CBUA 3UBKA 4EUYA 2LRCA 4TR0A 20GSA 3UVHA 3SWLA 2VL2C 2HXKA 4F2IA 4NMUA 4PURA 3DVWA 2H19A 4TRXA 1K0DA 4Q5NA 2VAFA 1B8XA 1KNGA 3F9UA 3MWHA 2V2GA 2YJHA 3FK8A 5ECKB 2OKAA 3F3RA 4ZILA 3IE3A 4TOPA 3I43A 4KDUA 1YKAA 2X8HA 4I6XA 3UIWA 2H0HA 1Z9HA 4ECIA 3HZ8A 1XXUA 1B4PA 2DJJA 4QL7A 2MZCA 4MH3A 4Z7XA 3KIJA 3EMXA 1W89A 5B8BA 2P0GA 2IPAA 1CQGA 1TK5B 1EGRA 4ILFA 3LWAA 2HLSA 2VL3A 2K8VA 4GQCA 3D21A 4DEJA 2JSYA 3C1SA 3D22A 4XS6A 1XWBA 2C1YA 1XWCA 1T00A 1MDKA 1PL1A 1CQHA 4DSSB 1WIKA 1SK1A 2DMLA 2HYXA 2F3MA 3A2XA 4O92A 2C3TA 2DJKA 3R2QA 3ZMLA 3J7Yb 5COHA 1V58A 4TR3A 4F0CA 3D4MA 5A4WA 2H0IA 2H74A 3FZ4A 3EMPA 2GSRA 4HQSA 4KSMA 1EGOA 1Z6NA 3GURA 1A2MA 2PERA 2O89A 2O85A 5CNWA 2O8VB 1G6YA 4PUAA 1V2AA 3E3EA 3UAPA 4N30A 5IIZA 4POBA 5DJMA 3MAKA 1A8LA 1ERTA 4LL1B 4ML6A 2HSHA 1ZOFA 2OBIA 3GL5A 4K0GA 4AJ8A 1SENA 2B7JA 4IQAA 2H75A 4I5QA 2VL9A 5DDLA 2OACA 4LLRA 3F6FA 3ZIJA 2YWIA 2DJ3A 1J0FA 4IP1A 1J08A 1Z7RA 3Q6OA 1ERVA 3ZREA 4I8BA 2JADA 4KGIA 4MJBA 2OBKA 1KEBA 5CO3A 1IYIA 2GZZA 4TR1B 2LRNA 2MMOA 6GSSA 2RM5A 2HI7A 2WB9A 2B5EA 1ZMAA 2YWOA 3EU4A 1ZGNA 1XZOA 4LA1A 1HYUA 1ACVA 2JL4A 5EPFA 4CHSA 3C71A 1EEJA 3DWVA 1TRWA 2HE3A 5HR2A 1LU4A 4BVXA 1TU8A 2HZEA 3ZIVA 3M9KA 1G7EA 3CXGA 4ZB6A 2C0DA 3KGKA 5GAND 5J41A 4ZL8A 2LV3A 1GWCA 1AQVA 1U3IA 1OC9B 3WGEA 1X5CA 4OO4A 1Q98A 2VIMA 2XHFA 4WKWA 2LTKA 4PXOA 2PMTA 1K0OA 3TKSA 2VL2A 1U3AA 1VF2A 2PGTA 2PPTA 3QAVA 2M80A 2VLUA 2FWGA 4MDCA 2JZTA 1EV4A 2L5OA 5E59A 1FB0A 5D9WA 1EOHA 1HNCA 3M9JA 2WRTA 5A5KA 4L0WA 1OAZA 2E2GA 2RUFA 3CYNA 5ELGA 4FYCA 4N0ZA 4L0UA 4GWRA 1VRSD 2FCHA 1TRVA 3IC4A 2R4VA 3F3QA 4NV2A 2XPEA 3HYPA 4IQ1A 2WZ9A 2XPDA 2IFQA 3H93A 5ECOB 1GLPA 3W6GA 3U5RE 2B5YA 1MDIA 1OKDA 1FO5A 2GQKA 1GSUA 2VCXA 3DMLA 4KCAA 5CAXA 3ZYWA 4IJIA 4KH7A 3QDNA 5B6NA 1T3BA 2VM1A 4MPGA 5G2ZA 5H5SA 1Z6MA 1G7OA 2C0FA 1SU9A 6GSYA 3VWWA 1RW1A 2BMXA 4OFNA 2LQOA 4PUFC 4ECCA 2FY6A 1GSFA 2EIRA 1ZYQB 2NVLA 1PRXA 2V6OA 2X64A 1TK8B 2FA8A 1A24A 5DCHA 4EXJA 3ME8A 1HD2A 4KNDA 1TJDA 3FKFA 5GZZB 4BPYA 3TOTA 3DIEA 2GSQA 4MZWA 3VI5A 2Z9SA 2DIYA 4MP4A 1GUMA 5KEJA 1ABAA 4K7OA 4G9HA 3APSA 2B3SA 5ECIB 2LQQA 3ISOA 1FVKA 4NPBA 4K0NA 1WRYA 5ID2A 2LJAA 5LD0A 1T8EB 3HJMA 1XVQA 2C8UA 4PNGA 4KDYA 2JZSA 4G2EA 4HUAA 2CZ2A 3Q19A 3TCOA 4OFMA 4MABA 1PMTA 2LKUA 2A4VA 3H4KA 1SJZA 2LSTA 1XVWA 1AQXA 1AUCA 3QD9A 3F4TA 2EIQA 1NW2A 2IMFA 1TKDB 1SL1B 4TR4A 4V1Ap 18GSA 2VCQA 3ZFLA 2NPBA 5HQPA 2GT5A 3GSSA 3HXSA 5ELAA 3UOMA 2C0EA 5FWGA 1OVNA 2AB6A 3DEXA 1EOGA 2D2ZA 2E7PA 5AIXA 4OO5A 1GULA 5DAKB 3KMNA 4IN0A 2CV4A 2L6DA 4JZQA 1O6JA 3IHQA 5HR3A 2MBSA 5CRDA 5C04A 3FEUA 5B6MA 1O73A 3FZAA 5CRGA 1M0UA 3ZFBA 5G31A 4HDEA 3GKXA 2RM6A 3O3TA 5IMZA 3TJJA 2PBJA 1GSDA 2GQMA 3EINA 3QPMA 3LJRA 1FW1A 2DJ0A 3D4TA 5DQYA 3TKRA 2AUVA 1O8XA 3DKSA 1YF0A 4OMVA 3VPTA 4RI7A 4O32A 2H30A 3EYTA 3MSZA 3HVSA 4HJMA 3DRNA 4QQ7A 1GSEA 3LYKA 1BQ7A 4YQMA 4POMA 6GSTA 1WJKA 3KP9A 3GHAA 2LUSA 3L4NA 1M9AA 4ZB9A 3TJFA 4G19A 1PN9A 1SD9A 3EE2A 2B1KA 1X5DA 22GSA 3FYGA 2XBIA 2H6ZA 2V1MA 2WFCA 5ECNB 4P3YB 2YV9A 1XFLA 4JEDA 2REMA 3C7MA 3TKSC 1ST9A 3O76A 1TI3A 2QSIA 2IMKA 4JR6A 2DSAA 5A4UA 1F3BA 2DC5A 4BL7A 2TRCP 4OFTA 3GH9A 2YANA 4PX1A 5H5RA 5IOWA 1YDKA 3CTFA 3KXOA 4J57E 1Z3EA 3QFBC 5IMFA 5CREA 2KP1A 3P7XA 4RQRA 5AN1A 3A3TA 1RQMA 4L5OA 4JE1A 5FHIA 3H1NA 2IMIA 3QAWA 4FYUA 2KHPA 5ECPB 5L71A 3V1WA 2R5GA 5IMAA 3RPPA 4MLYA 3ERFA 2G0FA 4WEYA 4DSRA 4OCEA 2E0QA 3G7JA 5D8IA 1TOFA 2AYTA 2B7KA 4EO3A 4F0BA 3TKQA 1MDJA 5AIVA 3LYPA 2KP2A 2I9HA 2JU5A 3VK9A 2H6YA 3VPQA 1GNWA 2IL3A 4DSSA 1WPIA 3QCPA 2H0GA 5ECLB 1VF4A 4GTUA 1OE8A 1OKTA 3EVIA 3ZVJD 1GSSA 2H76A 1R5PA 5KN2A 1M7TA 2FA4A 5ECQB 1MTCA 2FHEA 1N8JA 3H79A 3WGXA 1O7UA 2H8LA 3ZTLA 2CAIA 1TP9A 4F9ZA 3GH6A 4BVYA 3GUSA 2FWEA 3M3MA 2FNOA 4JBBA 2GVPA 4KA0A 4ECJA 2P31A 5J9BA 3L9VA 2OE1A 1DBYA 2VCZA 4MH2A 2EC4A 4ML1A 1SJ6A 4GF0A 2H66A 1GRXA 4ZXGA 3Q74A 1SKRB 1GUHA 1E6BA 3TB2A 4Q5FA 1YEXA 4EE0A 3GIXA 2F8AA 1PKWA 2LEGA 1GL8A 5GSTA 1K0MA 1XOAA 1A23A 2VLVA 2YCDA 4BA7A 2I81A 3CRTA 4TR1A 1YJ6A 3QFAC 3HHVA 1A8YA 1MEKA 5G30A 2RIIA 1UN2A 2PU9C 3DYRA 2BTOT 1E2YA 4MK3A 2YJ7A 1B9XC 3TRQA 4YAPA 2FUG2 2DJ2A 1AW9A 5HFGA 3RAZA 3J7Yk 3KMOA 1HQOA 3TRXA 4K7IA 4HEA2 5ENUA 5ECRB 2R2JA 2PVQA 1SL2B 3IAM2 3TGZA 2FWHA 5CRHA 2DMMA 2MMZA 3FHKA 5INYA 2CAQA 4MZCA 3GL3A 2C3NA 5F07A 2HZEB 1XW6A 3ZVJA 1G6WA 4KDXA 3TJKA 5KN3A 1X9MB 1XWKA 1WOUA 3I6AA 4X0XA 4MPFA 3BBYA 3ZLPA 1NHOA 3C8EA 3H8QA 4V2NA 1HNAA 1F37A 3GTUA 1PA3A 3DGQA 4POKA 4O7HA 2PWJA 3ED3A 3HY2A 1RK4A 4RUVA 5JCGA 4HOJA 1EEMA 2GSTA 1H75A 1K3LA 5FT3A 5D96A 1F2EA 2X8CA 3M8NA 2O87A 2LJRA 1GTIA 2A2SA 2RUEA 2YN1A 3F6DA 1Y6EA 3WYWA 4YQUA 3NZNA 5DALB 4WETA 2G2QA 1GUKA 3A5WA 4POLA 4IELA 4GRFA 1MD3A 3KTBA 2HSYA 2CVKA 2M46A 4WXTA 3JCML 5IO2A 3BOAA 4MJAA 4I2TA 2GZYA 2IN3A 1R4WA 2C80A 4X43A 2KOKA 2LNTA 1XWAA 1FHEA 1PQNA 2K9FA 4NHWA 6GSXA 3IPZA 3APOA 5B7CA 3LXZA 2I1UA 4YH2A 3A2VA 3BCIA 3D0ZA 1M2DA 3PINA 2HNLA 1PGTA 2CQ9A 1VGLA 2QKEA 3FY7A 4ZBDA 4AGSA 1GTUA 3HJPA 1K0CA 3G9BA 1TK0B 4LMWA 1FVJA 2E2MA 3IXRA 2IFQB 3UL3A 2YNXA 1GSYA 5IQYA 1GLQA 3OR5A 1VF1A 3RPNA 2MMAA 3MDKA 9GSSA 3APQA 4ZBBA 2V41A 3VURA 4TW5A 2L57A 5A4VA 17GSA 4D73A 3F4SA 1SK0A 1XIYA 3KZQA 4WBRD 4HZ2A 2GLRA 2CA8A 2IMDA 2L59A 3QMXA 1THOA 4TXVA 6GSWA 5JWQB 1UC7A 1K3OA 2M72A 2PVOC 2KLXA 1WE0A 4FO5A 4K7NA 5JCUA 6GSUA 1T1VA 4WF4A 4XIHA 2DLXA 2CVDA 5IMDA 2H1DA 3CRUA 4GXZA 3U6VA 4EVMA 2GS3A 5IMVA 5DVBA 7GSSA 2H1BA 2VCVA 3GRXA 4NWYA 3TJBA 3TUEA 1F3AA 2MBTA 1M9BA 1FG4A 1UVZA 5ID2B 4ZB8A 3QR6A 1YQ1A 11GSA 4EC0A 3G7YA 1XBSA 4WBJA 5GAPD 2V6KA 1ML6A 3WD6A 4K1FA 1BX9A 2C4JA 2K18A 1QQ2A 3N5OA 2KUCA 3HVXA 4DSQA 4KAEA 1GP1A 3QOUA 4WF5A 2GQLA 3ZMKA 3KD0A 3EC3A 1SKWB 2QC7A 4HI7A 2N5FA 1OC8A 2WCIA 3LORA 1T4YA 2ZCTA 5D93A 2J23A 5KN1A 2X99A 4TKYA 1M99A 1N2AA 1QUWA 5J9CA 2GGTA 1LJRA 4ACSA 4EF0A 1LBKA 4FH8A 2WDUA 1KTEA 3LGCA 1WWJA 1JZDA 2LRTA 2P5RA 4G10A 3KM6A 4XS4A 4DVCA 3KP8A 1BYEA 1TDIA 2ZNMA 3F63A 1MD4A 1PD21 5DJLA 1EP8A 3FR3A 1SL0B 3ZL5A 4HJ2A 1Q4JA 1GTBA 3P90A 2AV4A 4XHMA 3HVVA 5JWRB 4AJ7A 4RQXA 2GSSA 3HD5A 1XPVA 4KUNA 4TN8A 3IV4A 2GT6A 4TVEA 3FRCA 4CW9A 5AISA 4XCSA 5F05A 3CSHA 1JLWA 4TXOB 2MYGA 3IAS2 3UARA 4HQZA 2C3QA 4WR4A 1Y25A 5ECMB 1ZCPA 1M2AA 4IW9A 3RDWA 2XBQA 4ZL7A 3HJOA 1GTAA 3IOSA 3UJ1A 3LSZA 3DXBA 2JZRA 4N11A 5G1LA 4K9ZA 4EDZA 3RHBA 1ZYEA 2WULA 4K8MA 5G5FA 1F6MC 3CMIA 3L9UA 5CP1A 3D6IA 3HCZA 4IKHA 5F0GA 3MNGA 4AJ6A 1TW9A 4N10A 3FZ5A 1ERUA 4GSTA 2R6KA 2H1GA 4IS0A 3L78A 3KH7A 2DBCA 4KCEA 4FIWA 5D9VA 2RLIA 5IMCA 4V1Ag 4O5RA 1R5AA 3NOFA 2B5XA 1AAZA 1EV9A 1BJXA 3GX8A 1TU7A 1TI1A 1FOVA 1ON4A 1WMJA 1F9MA 3F8UA 4GLTA 2VD1A 4H86A 3VI7A 5CYYA 3ME7A 2F9SA 4V2LA 4IJ3A 4PQ1A 2CT6A 3IA1A 2FLSA 2WJUA 3GYKA 13GSA 1G0TA 4RI6A 3W8SA 4OWYA 1QK8A 1X0RA 4NXIA 1A2LA 2FD3A 3LEFA 4YAVA 1T4ZA 4MCUA 1DSBA 3GKNA 4JR4A 4HS1A 4ZBAA 1I5GA 5HR1A 2H1AA 1PX6A 2OE3A 3DD3A 1WP0A 3FW2A 2H01A 1M2BA 1R7HA 2HT9A 3GFKA 4MJCA 5LCZA 1X9SB 1JZOA 2H72A 3N9JA 1GH2A 3TKPA 3WGDA 1AXDA 4GQFA 4NV5A 4MF6A 3KJYA 4Q5QA 2YZUA 1U87A 3GMFA 3PR8A 4IBPA 2H73A 1SYRA 4NHZA 4LMVA 1AC1A 4V2MA 1BG5A 4XS1A 5C00A 3VWVA 2CX4A 2N5AA 4HZ4A 3S9FA 1EZKA 3BJ5A 3GSTA 3LG6A 1SD8A 3GX0A 1JFUA 5F06A 4ZL9A 3IK7A 3C73A 3GNJA 5G1KA 1H4OA 2GTUA 2FGXA 2EIOA 1V40A 3ZITA 3AY8A 1XOBA 5D9XA 4QL9A 1JHBA 4OD7A 5IPHA 2LJKA 1QXHA 4ULXA 3TKSE 1YEPA 1A0RP 1J9BA 4K2DA 4KE3A 3HA9A 4WR5A 12GSA 4BWSA 3M0FA 3F0IA 3KCMA 5IOXA 1JZRA 3BCKA 1QGVA 5LNKe 1B48A 5E4WA 2DJ1A 2H70A 2JSZA 3ZRDA 4OCFA 2IMEA 1KBNA 1B9YC 2ON7A 4GCIA 2NBSA 3FR6A 5IM9A 3L9SA 1DUGA 3VFIA 1XW5A 2DIZA 3VWUA 1OC9A 4F82A 1X5EA 1YF1A 2LS5A 5EVOA 2HRFA 4MJEA 5ECHB 10GSA 2J9HA 1USBA 3UVTA 2TIRA 3EU3A 2ZUPA 1EWXA 5IO0A 4AF2A 3WT2A 2FWFA 4YQVA 2BJXA 3D5JA 2H6XA 1SJIA 1YKCA 4MF5A 1OYJA 3NIVA 1GSQA 2B1LA 1X9WB 3TOUA 1QFNA 5DBQA 3TDGA 1I9DA 3HKRA 2OADA 3UEMA 3P8WA 2HRNA 2VM2A 3KTLA 3GTUB 2JACA 2PUKC 3QAGA 3ERGA 5DALA 3IRAA 2OE0A 1YZXA 2ON5A 1NHYA 2NTOA 3EWLA 3LXTA 3GKKA 3UMAA 4EL1A 1Z7PA 3G7IA 2IIYA 2VO4A 1PSQA 5EY6A 1B4QA 2K8SA 1ZL9A 4J56E 4MZBA 4JRRA 8GSSA 5B8AA 2N5BA 2AJQB 3RHCA 2VUPA 4I2UA 3EURA 2PN8A 4IGJA 2B6MA 3GA4A 2GZPA 4KW6A 3C1RA 5J3RA 2VCWA 1SK2A 2C0GA 2CVBA 1W4VA 4CDOA 3RBTA 5ECSA 1HNBA 4KSOA 5KN0A 2L4CA 5HFKA 1SKSB 1R26A 1PX7A 4PNFA 3HZ4A 4FYBA 3GN3A 2OJLA 2R3XA 1SYXA 3W8JA 1K0AA 1ZZYA 1TRSA 2LNSA 4PQHA 5D9TA 1AIUA 2OA7A 3US3A 2L6CA 3FZ9A 1NSWA 1A2JA 2R37A 4ZIJA 4ID0A 2NDOA 2YP6A 1FAAA 1TTZA 2L4QA 1O81A 4D73B 5J5NA 2V32A 5G5EA 1T7PB 2MMNA 1OC3A 3UBLA 1K3YA 5AGYA 2GDRA 4MF7A 3IDVA 1A0FA 1V57A 5EL8A 4I97A 1Z5YE 16GSA 1O8WA 3SBCA 1V98A 1O85A 2AHEA 3DVXA 2I4AA 4Q5RA 4MA9A 3E9JB 3GKMA 4HU7A 3K8NA 1FB6A 4JU5A 6GSVA 2WGRA 3CSIA 4IHUA 1DE1A 1QMVA 5F8BA 2YZHA 5HFIA 4F03A 1GNEA 1K0NA 4PQIA 1K0BA 2VD0A 1EP7A 4ISDA 2YWMA 3GV1A 2TRXA 5GSSA 5H5QA 4LL4B 1PL2A 3PGTA 5J4UA 2X8GA 1BAYA 4N0VA 2IWTA 2P5QA 4J2FA 2O7KA 1JZWA 1URMA 2ES7A 1ILOA 2L5LA 1BEDA 3P2AA 3LFLA 3VWXA 4GSNA 1JLVA 4KX4A 5DQSA 4GSSA 2VCTA 3E0UA 5JWOB 4PGTA 3CTGA 2I3YA 5DAKA 4EDYA 4ECBA 2QGVA 1S3AA 5IPGA 3ERWA 1U6TA 3F4RA 3TRPA 2VOCA 2CX3A
chains in the Genus database with same CATH superfamily
4KB3A 1AQWA 1S3DA 3PH9A 1VF3A 3WT1A 1YY7A 19GSA 1V9WA 3KH9A 3I69A 3R3EA 3L0HA 3O6TA 2YV7A 5CRWA 4HU9A 5HR0A 4K6XA 1XCCA 14GSA 3CSJA 2XC2A 4BWQA 1IYHA 3HDCA 3LQ7A 3IBHA 4XS4B 2K6VA 1S3CA 1THXA 3IR4A 4L5LA 3FR9A 2HZFA 4E8HA 4EKZA 2F51A 2IJYA 4XRDA 2YWNA 5DCGA 2ALBA 1PKZA 3Q18A 1UA5A 4O5QA 4NAXA 1PN0A 4XRAA 2F8FA 3TJGA 2YPMA 2A2PA 3IK9A 4L8EA 2AAWA 1U88A 2A2RA 1DE2A 4TXOA 3KEBA 3M1GA 3I9V2 3A2WA 1OE7A 1C72A 5D73A 4E8EA 4IP6A 1TXXA 1TRUA 3ZZXA 2CZ3A 5JCWA 3VLNA 1M3JA 1XW9A 4X1UA 5ABRA 2VLTA 2HFDA 1NM3A 1ERWA 4MMMA 4XTSA 3BD2A 4IVFA 1XWGA 2WS2A 2YOIA 2H71A 3CBUA 3UBKA 4EUYA 2LRCA 4TR0A 20GSA 3UVHA 3SWLA 2VL2C 2HXKA 2X4AA 4F2IA 4NMUA 4PURA 3DVWA 2H19A 4TRXA 1K0DA 4Q5NA 2VAFA 3MIXA 1B8XA 1KNGA 3F9UA 3MWHA 2V2GA 2YJHA 3FK8A 5ECKB 2OKAA 3F3RA 4ZILA 3IE3A 4TOPA 3I43A 4KDUA 1YKAA 2X8HA 4I6XA 3UIWA 2H0HA 1Z9HA 4ECIA 3HZ8A 1XXUA 1B4PA 2DJJA 4QL7A 2MZCA 4MH3A 4Z7XA 4A5PA 3KIJA 3EMXA 1W89A 5B8BA 2P0GA 2IPAA 1CQGA 1TK5B 1EGRA 4ILFA 3LWAA 2HLSA 2VL3A 2K8VA 4GQCA 3D21A 4DEJA 2JSYA 3C1SA 3D22A 4XS6A 1XWBA 2C1YA 1XWCA 1T00A 1MDKA 1PL1A 1CQHA 4DSSB 1WIKA 1SK1A 2DMLA 2HYXA 2F3MA 3A2XA 4O92A 2C3TA 2DJKA 3R2QA 3ZMLA 3J7Yb 5COHA 1V58A 4TR3A 4F0CA 3D4MA 5A4WA 2H0IA 2H74A 3FZ4A 3EMPA 2GSRA 4HQSA 4KSMA 1EGOA 1Z6NA 3GURA 1A2MA 2PERA 2O89A 2O85A 5CNWA 2O8VB 1G6YA 4PUAA 1V2AA 4Z2TA 3E3EA 3UAPA 4N30A 5IIZA 4POBA 2QA1A 5DJMA 3MAKA 1A8LA 1ERTA 5KOWA 4LL1B 4ML6A 2HSHA 1ZOFA 2OBIA 3GL5A 4K0GA 4AJ8A 1SENA 2B7JA 4IQAA 2H75A 4I5QA 2VL9A 5DDLA 2OACA 4LLRA 3F6FA 3ZIJA 2YWIA 2DJ3A 1J0FA 4IP1A 1J08A 1Z7RA 3Q6OA 1ERVA 3ZREA 4I8BA 2JADA 4KGIA 4MJBA 2OBKA 1KEBA 5CO3A 1IYIA 2GZZA 4TR1B 2LRNA 2MMOA 6GSSA 2RM5A 2HI7A 2WB9A 2B5EA 1ZMAA 2YWOA 3EU4A 1ZGNA 1XZOA 4K5SA 1HYUA 4LA1A 1ACVA 2JL4A 5EPFA 4CHSA 3C71A 1EEJA 3DWVA 1TRWA 2HE3A 5HR2A 1LU4A 4BVXA 1TU8A 2HZEA 3ZIVA 3M9KA 1G7EA 3CXGA 4ZB6A 2C0DA 3KGKA 5GAND 5J41A 4ZL8A 2LV3A 1GWCA 1AQVA 1U3IA 1OC9B 3WGEA 1X5CA 4OO4A 1Q98A 2VIMA 2XHFA 4WKWA 2LTKA 4PXOA 2PMTA 1K0OA 3TKSA 2VL2A 1U3AA 1VF2A 2PGTA 2PPTA 3QAVA 2M80A 2VLUA 2FWGA 4MDCA 2JZTA 1EV4A 2L5OA 5E59A 1FB0A 5D9WA 1EOHA 4ICYA 4YKGA 1HNCA 3M9JA 2WRTA 5A5KA 4L0WA 1OAZA 2E2GA 2RUFA 3CYNA 5ELGA 4FYCA 4N0ZA 4L0UA 4GWRA 1VRSD 2FCHA 4X4JA 1TRVA 3IC4A 2R4VA 3F3QA 4NV2A 2XPEA 3HYPA 4IQ1A 2WZ9A 2XPDA 2IFQA 3H93A 5ECOB 1GLPA 3W6GA 3U5RE 2B5YA 1MDIA 1OKDA 4PTSA 4USSA 1FO5A 2GQKA 1GSUA 2VCXA 3DMLA 4KCAA 5CAXA 3ZYWA 4IJIA 4KH7A 3QDNA 5B6NA 1T3BA 2VM1A 4MPGA 5G2ZA 5H5SA 1Z6MA 1G7OA 2C0FA 1SU9A 6GSYA 3VWWA 1RW1A 2BMXA 4OFNA 2LQOA 4PUFC 4ECCA 2FY6A 1GSFA 2EIRA 1ZYQB 2NVLA 1PRXA 2V6OA 2X64A 1TK8B 2FA8A 1A24A 5DCHA 4EXJA 3ME8A 1HD2A 4KNDA 1TJDA 3FKFA 5GZZB 4BPYA 3TOTA 3DIEA 2GSQA 4MZWA 3VI5A 2Z9SA 2DIYA 4MP4A 1GUMA 5KEJA 1ABAA 4K7OA 4G9HA 3APSA 2B3SA 5ECIB 2LQQA 3ISOA 1FVKA 4NPBA 4K0NA 1WRYA 5ID2A 2LJAA 5LD0A 1T8EB 3HJMA 1XVQA 2C8UA 4PNGA 4KDYA 1S3RA 2JZSA 4G2EA 4HUAA 2CZ2A 3Q19A 3TCOA 4OFMA 4MABA 1PMTA 2LKUA 2A4VA 3H4KA 1SJZA 2LSTA 1XVWA 1AQXA 1AUCA 3QD9A 3F4TA 2UZ8A 2EIQA 1NW2A 2IMFA 1TKDB 1SL1B 4TR4A 4V1Ap 18GSA 2VCQA 3ZFLA 2NPBA 4CY6A 5HQPA 2GT5A 3GSSA 3HXSA 5ELAA 3UOMA 3IHGA 2C0EA 5FWGA 1OVNA 1ZYPA 2AB6A 3DEXA 1EOGA 2D2ZA 2E7PA 5AIXA 4OO5A 3MYDA 1GULA 5DAKB 3KMNA 4IN0A 2CV4A 2L6DA 4JZQA 1O6JA 3IHQA 5HR3A 2MBSA 5CRDA 5C04A 3FEUA 5B6MA 1O73A 3FZAA 5CRGA 1M0UA 3ZFBA 5G31A 4HDEA 3GKXA 4YKFA 2RM6A 3O3TA 5IMZA 3TJJA 2PBJA 1GSDA 2GQMA 3EINA 3QPMA 3LJRA 1FW1A 2DJ0A 3D4TA 5DQYA 3TKRA 2AUVA 1O8XA 3DKSA 1YF0A 4OMVA 3VPTA 4RI7A 4O32A 2H30A 3EYTA 3MSZA 3HVSA 4HJMA 3DRNA 4QQ7A 1GSEA 2R0GA 1BQ7A 3LYKA 4YQMA 4POMA 6GSTA 1WJKA 3KP9A 3GHAA 2LUSA 3L4NA 1M9AA 4ZB9A 3TJFA 4G19A 1PN9A 1SD9A 3EE2A 2B1KA 1X5DA 22GSA 3FYGA 2XBIA 2H6ZA 2V1MA 2WFCA 5ECNB 4P3YB 2YV9A 1XFLA 4JEDA 2REMA 3C7MA 3TKSC 1ST9A 3O76A 1TI3A 2QSIA 2IMKA 4JR6A 2DSAA 5A4UA 1F3BA 2DC5A 4BL7A 2TRCP 4OFTA 3GH9A 2YANA 4PX1A 3EPTA 5H5RA 5IOWA 1YDKA 3CTFA 3KXOA 4J57E 3CQFA 1Z3EA 3QFBC 5IMFA 5CREA 2KP1A 3P7XA 4RQRA 5AN1A 3A3TA 1RQMA 4MNNA 4L5OA 4JE1A 5FHIA 3H1NA 2IMIA 3QAWA 4FYUA 2KHPA 5ECPB 5L71A 3V1WA 2R5GA 5IMAA 3RPPA 4MLYA 3ERFA 2G0FA 4WEYA 4DSRA 4OCEA 2E0QA 3G7JA 5D8IA 1TOFA 2AYTA 2B7KA 4EO3A 3LW9A 4F0BA 3TKQA 1MDJA 5AIVA 3LYPA 2KP2A 2I9HA 2JU5A 3VK9A 2H6YA 3VPQA 1GNWA 2QA2A 2IL3A 4DSSA 1WPIA 3QCPA 2H0GA 5ECLB 1VF4A 4GTUA 1OE8A 1OKTA 3EVIA 3ZVJD 1GSSA 2H76A 1R5PA 5KN2A 1M7TA 2FA4A 5ECQB 1MTCA 2FHEA 1N8JA 3H79A 3WGXA 1O7UA 2H8LA 3ZTLA 2CAIA 1TP9A 4F9ZA 3GH6A 4BVYA 3GUSA 2FWEA 3M3MA 2FNOA 4JBBA 2GVPA 4EIPA 4KA0A 4ECJA 2P31A 5J9BA 3L9VA 2OE1A 1DBYA 2VCZA 4MH2A 2EC4A 4ML1A 1SJ6A 4GF0A 2H66A 1PFOA 1GRXA 4ZXGA 3Q74A 1SKRB 1GUHA 1E6BA 3TB2A 4Q5FA 2HSMA 1YEXA 4EE0A 3GIXA 2F8AA 1PKWA 2LEGA 1GL8A 5GSTA 1K0MA 1XOAA 1A23A 2VLVA 2YCDA 4BA7A 4Z2RA 2I81A 3CRTA 2A4HA 4TR1A 1YJ6A 3QFAC 3HHVA 1A8YA 1MEKA 5G30A 2RIIA 1UN2A 2PU9C 3DYRA 2BTOT 1E2YA 4MK3A 2YJ7A 1B9XC 3TRQA 4YAPA 2FUG2 2DJ2A 1AW9A 5HFGA 3RAZA 3J7Yk 3KMOA 1HQOA 3TRXA 4K7IA 1XG8A 4HEA2 5ENUA 5ECRB 2R2JA 2PVQA 1SL2B 3IAM2 3TGZA 2FWHA 5CRHA 2DMMA 2MMZA 3FHKA 5INYA 2CAQA 4BVXB 4MZCA 3GL3A 2C3NA 5F07A 2HZEB 1XW6A 3ZVJA 1G6WA 4KDXA 3TJKA 5KN3A 1X9MB 1XWKA 1WOUA 3I6AA 4X0XA 4MPFA 3BBYA 3ZLPA 1NHOA 3C8EA 3H8QA 4V2NA 1HNAA 1F37A 3GTUA 1PA3A 3DGQA 4POKA 4O7HA 2PWJA 3ED3A 3HY2A 1RK4A 4RUVA 5JCGA 4HOJA 1EEMA 2GSTA 1H75A 1K3LA 5FT3A 5D96A 1F2EA 2X8CA 3M8NA 2O87A 2LJRA 1GTIA 2A2SA 5BMUA 2RUEA 2YN1A 3F6DA 1Y6EA 3WYWA 5KOXA 4YQUA 3NZNA 5DALB 4WETA 2G2QA 1GUKA 3A5WA 4POLA 4IELA 4GRFA 1MD3A 3KTBA 2HSYA 2CVKA 2M46A 4WXTA 3JCML 5IO2A 3BOAA 4MJAA 4I2TA 2GZYA 2IN3A 1R4WA 2C80A 4X43A 2KOKA 2LNTA 1XWAA 1FHEA 4EIQA 1PQNA 2K9FA 4NHWA 6GSXA 3IPZA 3APOA 5B7CA 3LXZA 2I1UA 4YH2A 3A2VA 3BCIA 3D0ZA 4CY8A 3IC8A 4K5RA 1M2DA 3PINA 2HNLA 1PGTA 2CQ9A 1VGLA 2QKEA 3FY7A 4ZBDA 4AGSA 1GTUA 3HJPA 1K0CA 3G9BA 1TK0B 4LMWA 1FVJA 2E2MA 3IXRA 2IFQB 3UL3A 2YNXA 1GSYA 5IQYA 1GLQA 3OR5A 1VF1A 3RPNA 2MMAA 3MDKA 9GSSA 3APQA 4ZBBA 2V41A 3VURA 4TW5A 2L57A 5A4VA 17GSA 4D73A 3F4SA 1SK0A 1XIYA 3KZQA 4WBRD 4HZ2A 2GLRA 2CA8A 2IMDA 2L59A 3QMXA 1THOA 4TXVA 6GSWA 5JWQB 1UC7A 2HRAA 1K3OA 2M72A 2PVOC 2KLXA 1WE0A 4FO5A 4G0IA 1M3IA 4K7NA 5JCUA 6GSUA 1T1VA 4WF4A 4XIHA 2DLXA 2CVDA 5IMDA 2H1DA 3CRUA 4GXZA 3U6VA 4EVMA 2GS3A 5IMVA 5DVBA 7GSSA 2H1BA 2VCVA 3GRXA 4NWYA 3TJBA 3TUEA 1F3AA 2MBTA 1M9BA 1FG4A 1UVZA 5ID2B 4ZB8A 3QR6A 1YQ1A 11GSA 4EC0A 3G7YA 1XBSA 4WBJA 5GAPD 2V6KA 1ML6A 3WD6A 4K1FA 1BX9A 2C4JA 2K18A 1QQ2A 3N5OA 2KUCA 3HVXA 4DSQA 4KAEA 1GP1A 3QOUA 4WF5A 3FMWA 2GQLA 3ZMKA 3KD0A 3EC3A 1SKWB 2QC7A 4HI7A 2N5FA 4G0LA 1OC8A 2WCIA 3LORA 1T4YA 2ZCTA 5D93A 2J23A 5KN1A 2X99A 4TKYA 1M99A 1N2AA 1QUWA 5J9CA 2GGTA 1LJRA 4ACSA 4EF0A 1LBKA 4FH8A 2WDUA 1KTEA 3LGCA 1WWJA 1JZDA 2LRTA 2P5RA 4G10A 3KM6A 4XS4A 4DVCA 3KP8A 1BYEA 1TDIA 2ZNMA 3F63A 1MD4A 1PD21 5DJLA 1EP8A 3FR3A 4Z2UA 1SL0B 3ZL5A 4HJ2A 1FOHA 1Q4JA 1GTBA 3P90A 2HRKA 2AV4A 4XHMA 3HVVA 5JWRB 4AJ7A 4RQXA 2GSSA 3HD5A 1XPVA 4KUNA 4TN8A 3IV4A 2GT6A 4TVEA 3FRCA 4CW9A 5AISA 4XCSA 5F05A 3CSHA 1JLWA 4TXOB 2MYGA 3IAS2 3UARA 4HQZA 2C3QA 4WR4A 1Y25A 5ECMB 1ZCPA 1M2AA 4IW9A 3RDWA 2XBQA 4ZL7A 3HJOA 1GTAA 3IOSA 3UJ1A 3LSZA 3DXBA 2JZRA 4N11A 5G1LA 4K9ZA 4EDZA 3RHBA 1ZYEA 2WULA 4K8MA 5G5FA 1F6MC 3CMIA 3L9UA 5CP1A 3D6IA 3HCZA 2DKIA 4IKHA 5F0GA 3MNGA 4AJ6A 4BL7B 1TW9A 4N10A 1ZYNA 3FZ5A 1ERUA 4GSTA 2R6KA 2H1GA 4IS0A 3L78A 3KH7A 2DBCA 4KCEA 4FQUA 4O5UA 4FIWA 5D9VA 2RLIA 5IMCA 4V1Ag 4O5RA 1R5AA 3NOFA 2B5XA 1AAZA 1EV9A 1BJXA 3GX8A 1TU7A 1TI1A 1FOVA 1ON4A 1WMJA 1F9MA 3F8UA 4GLTA 2VD1A 4H86A 3VI7A 5CYYA 3ME7A 2F9SA 4V2LA 4IJ3A 4PQ1A 2CT6A 3IA1A 2FLSA 2WJUA 3GYKA 13GSA 1G0TA 4RI6A 3W8SA 4OWYA 3HVNA 1QK8A 1X0RA 4NXIA 1A2LA 2FD3A 3LEFA 4YAVA 1T4ZA 4MCUA 1DSBA 3GKNA 4JR4A 4HS1A 4ZBAA 1I5GA 5HR1A 2H1AA 1PX6A 2OE3A 3DD3A 1WP0A 3FW2A 2H01A 1M2BA 1R7HA 2HT9A 3GFKA 4MJCA 5LCZA 1X9SB 1JZOA 2H72A 3N9JA 1GH2A 3TKPA 3WGDA 1AXDA 4GQFA 4NV5A 4MF6A 3KJYA 4Q5QA 2YZUA 1U87A 3GMFA 3PR8A 4IBPA 2H73A 1SYRA 4NHZA 4LMVA 1AC1A 4V2MA 1BG5A 4XS1A 5C00A 3VWVA 2CX4A 2N5AA 4HZ4A 4BVYB 3S9FA 1EZKA 3BJ5A 3GSTA 3LG6A 1SD8A 3GX0A 1JFUA 5F06A 4ZL9A 3IK7A 3C73A 3GNJA 5G1KA 1H4OA 2GTUA 2FGXA 2EIOA 1V40A 3ZITA 3AY8A 1XOBA 5D9XA 4QL9A 1JHBA 4OD7A 5IPHA 2LJKA 1QXHA 4ULXA 3TKSE 1YEPA 1A0RP 1J9BA 4K2DA 4KE3A 3HA9A 4WR5A 12GSA 4BWSA 3M0FA 3F0IA 3KCMA 5IOXA 1JZRA 3BCKA 1QGVA 5LNKe 1B48A 5E4WA 2DJ1A 2H70A 2JSZA 3ZRDA 4OCFA 2IMEA 1KBNA 1B9YC 2ON7A 4GCIA 2NBSA 3FR6A 5IM9A 3L9SA 1DUGA 3VFIA 2R0CA 1XW5A 2DIZA 3VWUA 1OC9A 4F82A 1X5EA 1YF1A 2LS5A 5EVOA 2HRFA 4MJEA 5ECHB 10GSA 2J9HA 1USBA 3UVTA 2TIRA 3EU3A 2ZUPA 1EWXA 5IO0A 4AF2A 3WT2A 2FWFA 4YQVA 2BJXA 3D5JA 2H6XA 1SJIA 1YKCA 4MF5A 1OYJA 3NIVA 1GSQA 2B1LA 1X9WB 3TOUA 1QFNA 5DBQA 3TDGA 1I9DA 4K2XA 3HKRA 2OADA 3UEMA 3P8WA 2HRNA 2VM2A 3KTLA 3GTUB 2JACA 2PUKC 3QAGA 3ERGA 5DALA 3IRAA 2OE0A 1YZXA 2ON5A 1NHYA 2NTOA 3EWLA 3LXTA 3GKKA 3UMAA 4EL1A 1Z7PA 3G7IA 2IIYA 2VO4A 1PSQA 5EY6A 1B4QA 2K8SA 1ZL9A 4J56E 4MZBA 4JRRA 8GSSA 5B8AA 2N5BA 2AJQB 3RHCA 2VUPA 4I2UA 3EURA 2PN8A 4IGJA 2B6MA 3GA4A 2GZPA 4KW6A 3C1RA 5J3RA 2VCWA 1SK2A 2C0GA 2CVBA 3A5IA 1W4VA 4CDOA 3RBTA 5ECSA 1HNBA 4KSOA 5KN0A 2L4CA 5HFKA 1SKSB 1R26A 1PX7A 4PNFA 3HZ4A 4FYBA 3GN3A 5BRTA 2R0PA 2OJLA 2R3XA 1SYXA 3W8JA 1K0AA 1ZZYA 1TRSA 2LNSA 4PQHA 5D9TA 1AIUA 2OA7A 3US3A 2L6CA 3FZ9A 1NSWA 1A2JA 2R37A 4ZIJA 4ID0A 2NDOA 2YP6A 1FAAA 1TTZA 3PPUA 2L4QA 1O81A 4D73B 5J5NA 2V32A 5G5EA 1T7PB 2MMNA 1OC3A 3UBLA 1K3YA 5AGYA 2GDRA 2DKHA 4MF7A 2X49A 3IDVA 4BIKA 1A0FA 1V57A 4KF9A 5EL8A 4I97A 1Z5YE 16GSA 1O8WA 3SBCA 1V98A 1O85A 2AHEA 3DVXA 2I4AA 4Q5RA 4MA9A 3E9JB 4HSCX 3GKMA 4HU7A 3K8NA 1FB6A 4JU5A 6GSVA 2WGRA 3CSIA 4IHUA 1DE1A 1QMVA 5F8BA 2YZHA 5HFIA 4F03A 1GNEA 1K0NA 4PQIA 1K0BA 2VD0A 1EP7A 4G0KA 4ISDA 2YWMA 3GV1A 2TRXA 5GSSA 5H5QA 4LL4B 1PL2A 3PGTA 5J4UA 2X8GA 1BAYA 4N0VA 2IWTA 2P5QA 4J2FA 2O7KA 1JZWA 1URMA 2ES7A 1ILOA 2L5LA 1BEDA 3P2AA 3LFLA 3VWXA 4GSNA 1JLVA 4KX4A 5DQSA 4GSSA 2VCTA 3E0UA 5JWOB 4PGTA 3CTGA 2I3YA 5DAKA 4EDYA 4ECBA 2QGVA 1S3AA 5IPGA 3ERWA 1U6TA 3F4RA 3TRPA 2VOCA 2CX3A
chains in the Genus database with same CATH topology
4KB3A 1AQWA 1S3DA 3PH9A 1VF3A 3WT1A 1YY7A 19GSA 1V9WA 3KH9A 3I69A 3R3EA 3L0HA 3O6TA 2YV7A 5CRWA 4HU9A 5HR0A 4K6XA 1XCCA 14GSA 3CSJA 2XC2A 4BWQA 1IYHA 3HDCA 3LQ7A 3IBHA 4XS4B 2K6VA 1S3CA 1THXA 3IR4A 4L5LA 3FR9A 2HZFA 4E8HA 4EKZA 2F51A 2IJYA 4XRDA 2YWNA 5DCGA 2ALBA 1PKZA 3Q18A 1UA5A 4O5QA 4NAXA 1PN0A 4XRAA 2F8FA 3TJGA 2YPMA 2A2PA 3IK9A 4L8EA 2AAWA 1U88A 2A2RA 1DE2A 4TXOA 3KEBA 3M1GA 3I9V2 3A2WA 1OE7A 1C72A 5D73A 4E8EA 4IP6A 1TXXA 1TRUA 3ZZXA 2CZ3A 5JCWA 3VLNA 1XW9A 4X1UA 5ABRA 2VLTA 2HFDA 1NM3A 1ERWA 4MMMA 4XTSA 3BD2A 4IVFA 1XWGA 2WS2A 2YOIA 2H71A 3CBUA 3UBKA 4EUYA 2LRCA 4TR0A 20GSA 3UVHA 3SWLA 2VL2C 2HXKA 2X4AA 4F2IA 4NMUA 4PURA 3DVWA 2H19A 4TRXA 1K0DA 4Q5NA 2VAFA 3MIXA 1B8XA 1KNGA 3F9UA 3MWHA 2V2GA 2YJHA 3FK8A 5ECKB 2OKAA 3F3RA 4ZILA 3IE3A 4TOPA 3I43A 4KDUA 1YKAA 2X8HA 4I6XA 3UIWA 2H0HA 1Z9HA 4ECIA 3HZ8A 1XXUA 1B4PA 2DJJA 4QL7A 2MZCA 4MH3A 4Z7XA 4A5PA 3KIJA 3EMXA 1W89A 5B8BA 2P0GA 2IPAA 1CQGA 1TK5B 1EGRA 4ILFA 3LWAA 2HLSA 2VL3A 2K8VA 4GQCA 3D21A 4DEJA 2JSYA 3C1SA 3D22A 4XS6A 1XWBA 2C1YA 1XWCA 1T00A 1MDKA 1PL1A 1CQHA 4DSSB 1WIKA 1SK1A 2DMLA 2HYXA 2F3MA 3A2XA 4O92A 2C3TA 2DJKA 3R2QA 3ZMLA 3J7Yb 5COHA 1V58A 4TR3A 4F0CA 3D4MA 5A4WA 2H0IA 2H74A 3FZ4A 3EMPA 2GSRA 4HQSA 4KSMA 1EGOA 1Z6NA 3GURA 1A2MA 2PERA 2O89A 2O85A 5CNWA 2O8VB 1G6YA 4PUAA 1V2AA 4Z2TA 3E3EA 3UAPA 4N30A 5IIZA 4POBA 2QA1A 5DJMA 3MAKA 1A8LA 1ERTA 5KOWA 4LL1B 4ML6A 2HSHA 1ZOFA 2OBIA 3GL5A 4K0GA 4AJ8A 1SENA 2B7JA 4IQAA 2H75A 4I5QA 2VL9A 5DDLA 2OACA 4LLRA 3F6FA 3ZIJA 2YWIA 2DJ3A 1J0FA 4IP1A 1J08A 1Z7RA 3Q6OA 1ERVA 3ZREA 4I8BA 2JADA 4KGIA 4MJBA 2OBKA 1KEBA 5CO3A 1IYIA 2GZZA 4TR1B 2LRNA 2MMOA 6GSSA 2RM5A 2HI7A 2WB9A 2B5EA 1ZMAA 2YWOA 3EU4A 1ZGNA 1XZOA 4K5SA 1HYUA 4LA1A 1ACVA 2JL4A 5EPFA 4CHSA 3C71A 1EEJA 3DWVA 1TRWA 2HE3A 5HR2A 1LU4A 4BVXA 1TU8A 2HZEA 3ZIVA 3M9KA 1G7EA 3CXGA 4ZB6A 2C0DA 3KGKA 5GAND 5J41A 4ZL8A 2LV3A 1GWCA 1AQVA 1U3IA 1OC9B 3WGEA 1X5CA 4OO4A 1Q98A 2VIMA 2XHFA 4WKWA 2LTKA 4PXOA 2PMTA 1K0OA 3TKSA 2VL2A 1U3AA 1VF2A 2PGTA 2PPTA 3QAVA 2M80A 2VLUA 2FWGA 4MDCA 2JZTA 1EV4A 2L5OA 5E59A 1FB0A 5D9WA 1EOHA 4ICYA 4YKGA 1HNCA 3M9JA 2WRTA 5A5KA 4L0WA 1OAZA 2E2GA 2RUFA 3CYNA 5ELGA 4FYCA 4N0ZA 4L0UA 4GWRA 1VRSD 2FCHA 4X4JA 1TRVA 3IC4A 2R4VA 3F3QA 4NV2A 2XPEA 3HYPA 4IQ1A 2WZ9A 2XPDA 2IFQA 3H93A 5ECOB 1GLPA 3W6GA 3U5RE 2B5YA 1MDIA 1OKDA 4PTSA 4USSA 1FO5A 2GQKA 1GSUA 2VCXA 3DMLA 4KCAA 5CAXA 3ZYWA 4IJIA 4KH7A 3QDNA 5B6NA 1T3BA 2VM1A 4MPGA 5G2ZA 5H5SA 1Z6MA 1G7OA 2C0FA 1SU9A 6GSYA 3VWWA 1RW1A 2BMXA 4OFNA 2LQOA 4PUFC 4ECCA 2FY6A 1GSFA 2EIRA 1ZYQB 2NVLA 1PRXA 2V6OA 2X64A 1TK8B 2FA8A 1A24A 5DCHA 4EXJA 3ME8A 1HD2A 4KNDA 1TJDA 3FKFA 5GZZB 4BPYA 3TOTA 3DIEA 2GSQA 4MZWA 3VI5A 2Z9SA 2DIYA 4MP4A 1GUMA 5KEJA 1ABAA 4K7OA 4G9HA 3APSA 2B3SA 5ECIB 2LQQA 3ISOA 1FVKA 4NPBA 4K0NA 1WRYA 5ID2A 2LJAA 5LD0A 1T8EB 3HJMA 1XVQA 2C8UA 4PNGA 4KDYA 2JZSA 4G2EA 4HUAA 2CZ2A 3Q19A 3TCOA 4OFMA 4MABA 1PMTA 2LKUA 2A4VA 3H4KA 1SJZA 2LSTA 1XVWA 1AQXA 1AUCA 3QD9A 3F4TA 2UZ8A 2EIQA 1NW2A 2IMFA 1TKDB 1SL1B 4TR4A 4V1Ap 18GSA 2VCQA 3ZFLA 2NPBA 4CY6A 5HQPA 2GT5A 3GSSA 3HXSA 5ELAA 3UOMA 3IHGA 2C0EA 5FWGA 1OVNA 1ZYPA 2AB6A 3DEXA 1EOGA 2D2ZA 2E7PA 5AIXA 4OO5A 3MYDA 1GULA 5DAKB 3KMNA 4IN0A 2CV4A 2L6DA 4JZQA 1O6JA 3IHQA 5HR3A 2MBSA 5CRDA 5C04A 3FEUA 5B6MA 1O73A 3FZAA 5CRGA 1M0UA 3ZFBA 5G31A 4HDEA 3GKXA 4YKFA 2RM6A 3O3TA 5IMZA 3TJJA 2PBJA 1GSDA 2GQMA 3EINA 3QPMA 3LJRA 1FW1A 2DJ0A 3D4TA 5DQYA 3TKRA 2AUVA 1O8XA 3DKSA 1YF0A 4OMVA 3VPTA 4RI7A 4O32A 2H30A 3EYTA 3MSZA 3HVSA 4HJMA 3DRNA 4QQ7A 1GSEA 2R0GA 1BQ7A 3LYKA 4YQMA 4POMA 6GSTA 1WJKA 3KP9A 3GHAA 2LUSA 3L4NA 1M9AA 4ZB9A 3TJFA 4G19A 1PN9A 1SD9A 3EE2A 2B1KA 1X5DA 22GSA 3FYGA 2XBIA 2H6ZA 2V1MA 2WFCA 5ECNB 4P3YB 2YV9A 1XFLA 4JEDA 2REMA 3C7MA 3TKSC 1ST9A 3O76A 1TI3A 2QSIA 2IMKA 4JR6A 2DSAA 5A4UA 1F3BA 2DC5A 4BL7A 2TRCP 4OFTA 3GH9A 2YANA 4PX1A 3EPTA 5H5RA 5IOWA 1YDKA 3CTFA 3KXOA 4J57E 1Z3EA 3QFBC 5IMFA 5CREA 2KP1A 3P7XA 4RQRA 5AN1A 3A3TA 1RQMA 4MNNA 4L5OA 4JE1A 5FHIA 3H1NA 2IMIA 3QAWA 4FYUA 2KHPA 5ECPB 5L71A 3V1WA 2R5GA 5IMAA 3RPPA 4MLYA 3ERFA 2G0FA 4WEYA 4DSRA 4OCEA 2E0QA 3G7JA 5D8IA 1TOFA 2AYTA 2B7KA 4EO3A 3LW9A 4F0BA 3TKQA 1MDJA 5AIVA 3LYPA 2KP2A 2I9HA 2JU5A 3VK9A 2H6YA 3VPQA 1GNWA 2QA2A 2IL3A 4DSSA 1WPIA 3QCPA 2H0GA 5ECLB 1VF4A 4GTUA 1OE8A 1OKTA 3EVIA 3ZVJD 1GSSA 2H76A 1R5PA 5KN2A 1M7TA 2FA4A 5ECQB 1MTCA 2FHEA 1N8JA 3H79A 3WGXA 1O7UA 2H8LA 3ZTLA 2CAIA 1TP9A 4F9ZA 3GH6A 4BVYA 3GUSA 2FWEA 3M3MA 2FNOA 4JBBA 2GVPA 4EIPA 4KA0A 4ECJA 2P31A 5J9BA 3L9VA 2OE1A 1DBYA 2VCZA 4MH2A 2EC4A 4ML1A 1SJ6A 4GF0A 2H66A 1GRXA 4ZXGA 3Q74A 1SKRB 1GUHA 1E6BA 3TB2A 4Q5FA 2HSMA 1YEXA 4EE0A 3GIXA 2F8AA 1PKWA 2LEGA 1GL8A 5GSTA 1K0MA 1XOAA 1A23A 2VLVA 2YCDA 4BA7A 4Z2RA 2I81A 3CRTA 2A4HA 4TR1A 1YJ6A 3QFAC 3HHVA 1A8YA 1MEKA 5G30A 2RIIA 1UN2A 2PU9C 3DYRA 2BTOT 1E2YA 4MK3A 2YJ7A 1B9XC 3TRQA 4YAPA 2FUG2 2DJ2A 1AW9A 5HFGA 3RAZA 3J7Yk 3KMOA 1HQOA 3TRXA 4K7IA 4HEA2 5ENUA 5ECRB 2R2JA 2PVQA 1SL2B 3IAM2 3TGZA 2FWHA 5CRHA 2DMMA 2MMZA 3FHKA 5INYA 2CAQA 4BVXB 4MZCA 3GL3A 2C3NA 5F07A 2HZEB 1XW6A 3ZVJA 1G6WA 4KDXA 3TJKA 5KN3A 1X9MB 1XWKA 1WOUA 3I6AA 4X0XA 4MPFA 3BBYA 3ZLPA 1NHOA 3C8EA 3H8QA 4V2NA 1HNAA 1F37A 3GTUA 1PA3A 3DGQA 4POKA 4O7HA 2PWJA 3ED3A 3HY2A 1RK4A 4RUVA 5JCGA 4HOJA 1EEMA 2GSTA 1H75A 1K3LA 5FT3A 5D96A 1F2EA 2X8CA 3M8NA 2O87A 2LJRA 1GTIA 2A2SA 5BMUA 2RUEA 2YN1A 3F6DA 1Y6EA 3WYWA 5KOXA 4YQUA 3NZNA 5DALB 4WETA 2G2QA 1GUKA 3A5WA 4POLA 4IELA 4GRFA 1MD3A 3KTBA 2HSYA 2CVKA 2M46A 4WXTA 3JCML 5IO2A 3BOAA 4MJAA 4I2TA 2GZYA 2IN3A 1R4WA 2C80A 4X43A 2KOKA 2LNTA 1XWAA 1FHEA 4EIQA 1PQNA 2K9FA 4NHWA 6GSXA 3IPZA 3APOA 5B7CA 3LXZA 2I1UA 4YH2A 3A2VA 3BCIA 3D0ZA 4CY8A 3IC8A 4K5RA 1M2DA 3PINA 2HNLA 1PGTA 2CQ9A 1VGLA 2QKEA 3FY7A 4ZBDA 4AGSA 1GTUA 3HJPA 1K0CA 3G9BA 1TK0B 4LMWA 1FVJA 2E2MA 3IXRA 2IFQB 3UL3A 2YNXA 1GSYA 5IQYA 1GLQA 3OR5A 1VF1A 3RPNA 2MMAA 3MDKA 9GSSA 3APQA 4ZBBA 2V41A 3VURA 4TW5A 2L57A 5A4VA 17GSA 4D73A 3F4SA 1SK0A 1XIYA 3KZQA 4WBRD 4HZ2A 2GLRA 2CA8A 2IMDA 2L59A 3QMXA 1THOA 4TXVA 6GSWA 5JWQB 1UC7A 2HRAA 1K3OA 2M72A 2PVOC 2KLXA 1WE0A 4FO5A 4G0IA 4K7NA 5JCUA 6GSUA 1T1VA 4WF4A 4XIHA 2DLXA 2CVDA 5IMDA 2H1DA 3CRUA 4GXZA 3U6VA 4EVMA 2GS3A 5IMVA 5DVBA 7GSSA 2H1BA 2VCVA 3GRXA 4NWYA 3TJBA 3TUEA 1F3AA 2MBTA 1M9BA 1FG4A 1UVZA 5ID2B 4ZB8A 3QR6A 1YQ1A 11GSA 4EC0A 3G7YA 1XBSA 4WBJA 5GAPD 2V6KA 1ML6A 3WD6A 4K1FA 1BX9A 2C4JA 2K18A 1QQ2A 3N5OA 2KUCA 3HVXA 4DSQA 4KAEA 1GP1A 3QOUA 4WF5A 3FMWA 2GQLA 3ZMKA 3KD0A 3EC3A 1SKWB 2QC7A 4HI7A 2N5FA 4G0LA 1OC8A 2WCIA 3LORA 1T4YA 2ZCTA 5D93A 2J23A 5KN1A 2X99A 4TKYA 1M99A 1N2AA 1QUWA 5J9CA 2GGTA 1LJRA 4ACSA 4EF0A 1LBKA 4FH8A 2WDUA 1KTEA 3LGCA 1WWJA 1JZDA 2LRTA 2P5RA 4G10A 3KM6A 4XS4A 4DVCA 3KP8A 1BYEA 1TDIA 2ZNMA 3F63A 1MD4A 1PD21 5DJLA 1EP8A 3FR3A 4Z2UA 1SL0B 3ZL5A 4HJ2A 1FOHA 1Q4JA 1GTBA 3P90A 2HRKA 2AV4A 4XHMA 3HVVA 5JWRB 4AJ7A 4RQXA 2GSSA 3HD5A 1XPVA 4KUNA 4TN8A 3IV4A 2GT6A 4TVEA 3FRCA 4CW9A 5AISA 4XCSA 5F05A 3CSHA 1JLWA 4TXOB 2MYGA 3IAS2 3UARA 4HQZA 2C3QA 4WR4A 1Y25A 5ECMB 1ZCPA 1M2AA 4IW9A 3RDWA 2XBQA 4ZL7A 3HJOA 1GTAA 3IOSA 3UJ1A 3LSZA 3DXBA 2JZRA 4N11A 5G1LA 4K9ZA 4EDZA 3RHBA 1ZYEA 2WULA 4K8MA 5G5FA 1F6MC 3CMIA 3L9UA 5CP1A 3D6IA 3HCZA 2DKIA 4IKHA 5F0GA 3MNGA 4AJ6A 4BL7B 1TW9A 4N10A 1ZYNA 3FZ5A 1ERUA 4GSTA 2R6KA 2H1GA 4IS0A 3L78A 3KH7A 2DBCA 4KCEA 4FQUA 4O5UA 4FIWA 5D9VA 2RLIA 5IMCA 4V1Ag 4O5RA 1R5AA 3NOFA 2B5XA 1AAZA 1EV9A 1BJXA 3GX8A 1TU7A 1TI1A 1FOVA 1ON4A 1WMJA 1F9MA 3F8UA 4GLTA 2VD1A 4H86A 3VI7A 5CYYA 3ME7A 2F9SA 4V2LA 4IJ3A 4PQ1A 2CT6A 3IA1A 2FLSA 2WJUA 3GYKA 13GSA 1G0TA 4RI6A 3W8SA 4OWYA 1QK8A 1X0RA 4NXIA 1A2LA 2FD3A 3LEFA 4YAVA 1T4ZA 4MCUA 1DSBA 3GKNA 4JR4A 4HS1A 4ZBAA 1I5GA 5HR1A 2H1AA 1PX6A 2OE3A 3DD3A 1WP0A 3FW2A 2H01A 1M2BA 1R7HA 2HT9A 3GFKA 4MJCA 5LCZA 1X9SB 1JZOA 2H72A 3N9JA 1GH2A 3TKPA 3WGDA 1AXDA 4GQFA 4NV5A 4MF6A 3KJYA 4Q5QA 2YZUA 1U87A 3GMFA 3PR8A 4IBPA 2H73A 1SYRA 4NHZA 4LMVA 1AC1A 4V2MA 1BG5A 4XS1A 5C00A 3VWVA 2CX4A 2N5AA 4HZ4A 4BVYB 3S9FA 1EZKA 3BJ5A 3GSTA 3LG6A 1SD8A 3GX0A 1JFUA 5F06A 4ZL9A 3IK7A 3C73A 3GNJA 5G1KA 1H4OA 2GTUA 2FGXA 2EIOA 1V40A 3ZITA 3AY8A 1XOBA 5D9XA 4QL9A 1JHBA 4OD7A 5IPHA 2LJKA 1QXHA 4ULXA 3TKSE 1YEPA 1A0RP 1J9BA 4K2DA 4KE3A 3HA9A 4WR5A 12GSA 4BWSA 3M0FA 3F0IA 3KCMA 5IOXA 1JZRA 3BCKA 1QGVA 5LNKe 1B48A 5E4WA 2DJ1A 2H70A 2JSZA 3ZRDA 4OCFA 2IMEA 1KBNA 1B9YC 2ON7A 4GCIA 2NBSA 3FR6A 5IM9A 3L9SA 1DUGA 3VFIA 2R0CA 1XW5A 2DIZA 3VWUA 1OC9A 4F82A 1X5EA 1YF1A 2LS5A 5EVOA 2HRFA 4MJEA 5ECHB 10GSA 2J9HA 1USBA 3UVTA 2TIRA 3EU3A 2ZUPA 1EWXA 5IO0A 4AF2A 3WT2A 2FWFA 4YQVA 2BJXA 3D5JA 2H6XA 1SJIA 1YKCA 4MF5A 1OYJA 3NIVA 1GSQA 2B1LA 1X9WB 3TOUA 1QFNA 5DBQA 3TDGA 1I9DA 4K2XA 3HKRA 2OADA 3UEMA 3P8WA 2HRNA 2VM2A 3KTLA 3GTUB 2JACA 2PUKC 3QAGA 3ERGA 5DALA 3IRAA 2OE0A 1YZXA 2ON5A 1NHYA 2NTOA 3EWLA 3LXTA 3GKKA 3UMAA 4EL1A 1Z7PA 3G7IA 2IIYA 2VO4A 1PSQA 5EY6A 1B4QA 2K8SA 1ZL9A 4J56E 4MZBA 4JRRA 8GSSA 5B8AA 2N5BA 2AJQB 3RHCA 2VUPA 4I2UA 3EURA 2PN8A 4IGJA 2B6MA 3GA4A 2GZPA 4KW6A 3C1RA 5J3RA 2VCWA 1SK2A 2C0GA 2CVBA 3A5IA 1W4VA 4CDOA 3RBTA 5ECSA 1HNBA 4KSOA 5KN0A 2L4CA 5HFKA 1SKSB 1R26A 1PX7A 4PNFA 3HZ4A 4FYBA 3GN3A 5BRTA 2R0PA 2OJLA 2R3XA 1SYXA 3W8JA 1K0AA 1ZZYA 1TRSA 2LNSA 4PQHA 5D9TA 1AIUA 2OA7A 3US3A 2L6CA 3FZ9A 1NSWA 1A2JA 2R37A 4ZIJA 4ID0A 2NDOA 2YP6A 1FAAA 1TTZA 3PPUA 2L4QA 1O81A 4D73B 5J5NA 2V32A 5G5EA 1T7PB 2MMNA 1OC3A 3UBLA 1K3YA 5AGYA 2GDRA 2DKHA 4MF7A 2X49A 3IDVA 1A0FA 1V57A 4KF9A 5EL8A 4I97A 1Z5YE 16GSA 1O8WA 3SBCA 1V98A 1O85A 2AHEA 3DVXA 2I4AA 4Q5RA 4MA9A 3E9JB 3GKMA 4HU7A 3K8NA 1FB6A 4JU5A 6GSVA 2WGRA 3CSIA 4IHUA 1DE1A 1QMVA 5F8BA 2YZHA 5HFIA 4F03A 1GNEA 1K0NA 4PQIA 1K0BA 2VD0A 1EP7A 4G0KA 4ISDA 2YWMA 3GV1A 2TRXA 5GSSA 5H5QA 4LL4B 1PL2A 3PGTA 5J4UA 2X8GA 1BAYA 4N0VA 2IWTA 2P5QA 4J2FA 2O7KA 1JZWA 1URMA 2ES7A 1ILOA 2L5LA 1BEDA 3P2AA 3LFLA 3VWXA 4GSNA 1JLVA 4KX4A 5DQSA 4GSSA 2VCTA 3E0UA 5JWOB 4PGTA 3CTGA 2I3YA 5DAKA 4EDYA 4ECBA 2QGVA 1S3AA 5IPGA 3ERWA 1U6TA 3F4RA 3TRPA 2VOCA 2CX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KB3 A;  1AQW A;  1S3D A;  3PH9 A;  1VF3 A;  3WT1 A;  1YY7 A;  19GS A;  1V9W A;  3KH9 A;  3I69 A;  3L0H A;  3O6T A;  2YV7 A;  5CRW A;  4HU9 A;  5HR0 A;  4K6X A;  1XCC A;  14GS A;  3CSJ A;  2XC2 A;  4BWQ A;  1IYH A;  3HDC A;  3LQ7 A;  3IBH A;  4XS4 B;  2K6V A;  1S3C A;  1THX A;  3IR4 A;  4L5L A;  3FR9 A;  2HZF A;  4E8H A;  4EKZ A;  2F51 A;  2IJY A;  4XRD A;  2YWN A;  5DCG A;  2ALB A;  1PKZ A;  3Q18 A;  1UA5 A;  4NAX A;  4XRA A;  2F8F A;  3TJG A;  2YPM A;  3IK9 A;  4L8E A;  2AAW A;  1U88 A;  2A2R A;  1DE2 A;  4TXO A;  3KEB A;  3M1G A;  3I9V 2;  3A2W A;  1OE7 A;  1C72 A;  5D73 A;  4E8E A;  4IP6 A;  1TXX A;  1TRU A;  3ZZX A;  2CZ3 A;  5JCW A;  3VLN A;  1XW9 A;  4X1U A;  5ABR A;  2VLT A;  2HFD A;  1NM3 A;  1ERW A;  4MMM A;  4XTS A;  3BD2 A;  4IVF A;  1XWG A;  2WS2 A;  2YOI A;  2H71 A;  3CBU A;  3UBK A;  4EUY A;  2LRC A;  4TR0 A;  20GS A;  3UVH A;  3SWL A;  2VL2 C;  2HXK A;  4F2I A;  4NMU A;  4PUR A;  3DVW A;  2H19 A;  4TRX A;  1K0D A;  4Q5N A;  2VAF A;  1B8X A;  1KNG A;  3F9U A;  3MWH A;  2V2G A;  2YJH A;  3FK8 A;  5ECK B;  2OKA A;  3F3R A;  4ZIL A;  3IE3 A;  4TOP A;  3I43 A;  4KDU A;  1YKA A;  2X8H A;  4I6X A;  3UIW A;  2H0H A;  1Z9H A;  4ECI A;  3HZ8 A;  1XXU A;  1B4P A;  2DJJ A;  4QL7 A;  2MZC A;  4MH3 A;  4Z7X A;  3KIJ A;  3EMX A;  1W89 A;  5B8B A;  2P0G A;  2IPA A;  1CQG A;  1TK5 B;  1EGR A;  4ILF A;  3LWA A;  2HLS A;  2VL3 A;  2K8V A;  4GQC A;  3D21 A;  4DEJ A;  2JSY A;  3C1S A;  3D22 A;  4XS6 A;  1XWB A;  2C1Y A;  1XWC A;  1T00 A;  1MDK A;  1PL1 A;  1CQH A;  4DSS B;  1WIK A;  1SK1 A;  2DML A;  2HYX A;  2F3M A;  3A2X A;  4O92 A;  2C3T A;  2DJK A;  3R2Q A;  3ZML A;  3J7Y b;  5COH A;  1V58 A;  4TR3 A;  4F0C A;  3D4M A;  5A4W A;  2H0I A;  2H74 A;  3FZ4 A;  3EMP A;  2GSR A;  4HQS A;  4KSM A;  1EGO A;  1Z6N A;  3GUR A;  1A2M A;  2PER A;  2O89 A;  2O85 A;  5CNW A;  2O8V B;  1G6Y A;  4PUA A;  1V2A A;  3E3E A;  3UAP A;  4N30 A;  5IIZ A;  4POB A;  5DJM A;  3MAK A;  1A8L A;  1ERT A;  4LL1 B;  4ML6 A;  2HSH A;  1ZOF A;  2OBI A;  3GL5 A;  4K0G A;  4AJ8 A;  1SEN A;  2B7J A;  4IQA A;  2H75 A;  4I5Q A;  2VL9 A;  5DDL A;  2OAC A;  4LLR A;  3F6F A;  3ZIJ A;  2YWI A;  2DJ3 A;  1J0F A;  4IP1 A;  1J08 A;  1Z7R A;  3Q6O A;  1ERV A;  3ZRE A;  4I8B A;  2JAD A;  4KGI A;  4MJB A;  2OBK A;  1KEB A;  5CO3 A;  1IYI A;  2GZZ A;  4TR1 B;  2LRN A;  2MMO A;  6GSS A;  2RM5 A;  2HI7 A;  2WB9 A;  2B5E A;  1ZMA A;  2YWO A;  3EU4 A;  1ZGN A;  1XZO A;  4LA1 A;  1HYU A;  1ACV A;  2JL4 A;  5EPF A;  4CHS A;  3C71 A;  1EEJ A;  3DWV A;  1TRW A;  2HE3 A;  5HR2 A;  1LU4 A;  4BVX A;  1TU8 A;  2HZE A;  3ZIV A;  3M9K A;  1G7E A;  3CXG A;  4ZB6 A;  2C0D A;  3KGK A;  5GAN D;  5J41 A;  4ZL8 A;  2LV3 A;  1GWC A;  1AQV A;  1U3I A;  1OC9 B;  3WGE A;  1X5C A;  4OO4 A;  1Q98 A;  2VIM A;  2XHF A;  4WKW A;  2LTK A;  4PXO A;  2PMT A;  1K0O A;  3TKS A;  2VL2 A;  1U3A A;  1VF2 A;  2PGT A;  2PPT A;  3QAV A;  2M80 A;  2VLU A;  2FWG A;  4MDC A;  2JZT A;  1EV4 A;  2L5O A;  5E59 A;  1FB0 A;  5D9W A;  1EOH A;  1HNC A;  3M9J A;  2WRT A;  5A5K A;  4L0W A;  1OAZ A;  2E2G A;  2RUF A;  3CYN A;  5ELG A;  4FYC A;  4N0Z A;  4L0U A;  4GWR A;  1VRS D;  2FCH A;  1TRV A;  3IC4 A;  2R4V A;  3F3Q A;  4NV2 A;  2XPE A;  3HYP A;  4IQ1 A;  2WZ9 A;  2XPD A;  2IFQ A;  3H93 A;  5ECO B;  1GLP A;  3W6G A;  3U5R E;  2B5Y A;  1MDI A;  1OKD A;  1FO5 A;  2GQK A;  1GSU A;  2VCX A;  3DML A;  4KCA A;  5CAX A;  3ZYW A;  4IJI A;  4KH7 A;  3QDN A;  5B6N A;  1T3B A;  2VM1 A;  4MPG A;  5G2Z A;  5H5S A;  1Z6M A;  1G7O A;  2C0F A;  1SU9 A;  6GSY A;  3VWW A;  1RW1 A;  2BMX A;  4OFN A;  2LQO A;  4PUF C;  4ECC A;  2FY6 A;  1GSF A;  2EIR A;  1ZYQ B;  2NVL A;  1PRX A;  2V6O A;  2X64 A;  1TK8 B;  2FA8 A;  1A24 A;  5DCH A;  4EXJ A;  3ME8 A;  1HD2 A;  4KND A;  1TJD A;  3FKF A;  5GZZ B;  4BPY A;  3TOT A;  3DIE A;  2GSQ A;  4MZW A;  3VI5 A;  2Z9S A;  2DIY A;  4MP4 A;  1GUM A;  5KEJ A;  1ABA A;  4K7O A;  4G9H A;  3APS A;  2B3S A;  5ECI B;  2LQQ A;  3ISO A;  1FVK A;  4NPB A;  4K0N A;  1WRY A;  5ID2 A;  2LJA A;  5LD0 A;  1T8E B;  3HJM A;  1XVQ A;  2C8U A;  4PNG A;  4KDY A;  2JZS A;  4G2E A;  4HUA A;  2CZ2 A;  3Q19 A;  3TCO A;  4OFM A;  4MAB A;  1PMT A;  2LKU A;  2A4V A;  3H4K A;  1SJZ A;  2LST A;  1XVW A;  1AQX A;  1AUC A;  3QD9 A;  3F4T A;  2EIQ A;  1NW2 A;  2IMF A;  1TKD B;  1SL1 B;  4TR4 A;  4V1A p;  18GS A;  2VCQ A;  3ZFL A;  2NPB A;  5HQP A;  2GT5 A;  3GSS A;  3HXS A;  5ELA A;  3UOM A;  2C0E A;  5FWG A;  1OVN A;  2AB6 A;  3DEX A;  1EOG A;  2D2Z A;  2E7P A;  5AIX A;  4OO5 A;  1GUL A;  5DAK B;  3KMN A;  4IN0 A;  2CV4 A;  2L6D A;  4JZQ A;  1O6J A;  3IHQ A;  5HR3 A;  2MBS A;  5CRD A;  5C04 A;  3FEU A;  5B6M A;  1O73 A;  3FZA A;  5CRG A;  1M0U A;  3ZFB A;  5G31 A;  4HDE A;  3GKX A;  2RM6 A;  3O3T A;  5IMZ A;  3TJJ A;  2PBJ A;  1GSD A;  2GQM A;  3EIN A;  3QPM A;  3LJR A;  1FW1 A;  2DJ0 A;  3D4T A;  5DQY A;  3TKR A;  2AUV A;  1O8X A;  3DKS A;  1YF0 A;  4OMV A;  3VPT A;  4RI7 A;  4O32 A;  2H30 A;  3EYT A;  3MSZ A;  3HVS A;  4HJM A;  3DRN A;  4QQ7 A;  1GSE A;  3LYK A;  1BQ7 A;  4YQM A;  4POM A;  6GST A;  1WJK A;  3KP9 A;  3GHA A;  2LUS A;  3L4N A;  1M9A A;  4ZB9 A;  3TJF A;  4G19 A;  1PN9 A;  1SD9 A;  3EE2 A;  2B1K A;  1X5D A;  22GS A;  3FYG A;  2XBI A;  2H6Z A;  2V1M A;  2WFC A;  5ECN B;  4P3Y B;  2YV9 A;  1XFL A;  4JED A;  2REM A;  3C7M A;  3TKS C;  1ST9 A;  3O76 A;  1TI3 A;  2QSI A;  2IMK A;  4JR6 A;  2DSA A;  5A4U A;  1F3B A;  2DC5 A;  4BL7 A;  2TRC P;  4OFT A;  3GH9 A;  2YAN A;  4PX1 A;  5H5R A;  5IOW A;  1YDK A;  3CTF A;  3KXO A;  4J57 E;  1Z3E A;  3QFB C;  5IMF A;  5CRE A;  2KP1 A;  3P7X A;  4RQR A;  5AN1 A;  3A3T A;  1RQM A;  4L5O A;  4JE1 A;  5FHI A;  3H1N A;  2IMI A;  3QAW A;  4FYU A;  2KHP A;  5ECP B;  5L71 A;  3V1W A;  2R5G A;  5IMA A;  3RPP A;  4MLY A;  3ERF A;  2G0F A;  4WEY A;  4DSR A;  4OCE A;  2E0Q A;  3G7J A;  5D8I A;  1TOF A;  2AYT A;  2B7K A;  4EO3 A;  4F0B A;  3TKQ A;  1MDJ A;  5AIV A;  3LYP A;  2KP2 A;  2I9H A;  2JU5 A;  3VK9 A;  2H6Y A;  3VPQ A;  1GNW A;  2IL3 A;  4DSS A;  1WPI A;  3QCP A;  2H0G A;  5ECL B;  1VF4 A;  4GTU A;  1OE8 A;  1OKT A;  3EVI A;  3ZVJ D;  1GSS A;  2H76 A;  1R5P A;  5KN2 A;  1M7T A;  2FA4 A;  5ECQ B;  1MTC A;  2FHE A;  1N8J A;  3H79 A;  3WGX A;  1O7U A;  2H8L A;  3ZTL A;  2CAI A;  1TP9 A;  4F9Z A;  3GH6 A;  4BVY A;  3GUS A;  2FWE A;  3M3M A;  2FNO A;  4JBB A;  2GVP A;  4KA0 A;  4ECJ A;  2P31 A;  5J9B A;  3L9V A;  2OE1 A;  1DBY A;  2VCZ A;  4MH2 A;  2EC4 A;  4ML1 A;  1SJ6 A;  4GF0 A;  2H66 A;  1GRX A;  4ZXG A;  3Q74 A;  1SKR B;  1GUH A;  1E6B A;  3TB2 A;  4Q5F A;  1YEX A;  4EE0 A;  3GIX A;  2F8A A;  1PKW A;  2LEG A;  1GL8 A;  5GST A;  1K0M A;  1XOA A;  1A23 A;  2VLV A;  2YCD A;  4BA7 A;  2I81 A;  3CRT A;  4TR1 A;  1YJ6 A;  3QFA C;  3HHV A;  1A8Y A;  1MEK A;  5G30 A;  2RII A;  1UN2 A;  2PU9 C;  3DYR A;  2BTO T;  1E2Y A;  4MK3 A;  2YJ7 A;  1B9X C;  3TRQ A;  4YAP A;  2FUG 2;  2DJ2 A;  1AW9 A;  5HFG A;  3RAZ A;  3J7Y k;  3KMO A;  1HQO A;  3TRX A;  4K7I A;  4HEA 2;  5ENU A;  5ECR B;  2R2J A;  2PVQ A;  1SL2 B;  3IAM 2;  3TGZ A;  2FWH A;  5CRH A;  2DMM A;  2MMZ A;  3FHK A;  5INY A;  2CAQ A;  4MZC A;  3GL3 A;  2C3N A;  5F07 A;  2HZE B;  1XW6 A;  3ZVJ A;  1G6W A;  4KDX A;  3TJK A;  5KN3 A;  1X9M B;  1XWK A;  1WOU A;  3I6A A;  4X0X A;  4MPF A;  3BBY A;  3ZLP A;  1NHO A;  3C8E A;  3H8Q A;  4V2N A;  1HNA A;  1F37 A;  3GTU A;  1PA3 A;  3DGQ A;  4POK A;  4O7H A;  2PWJ A;  3ED3 A;  3HY2 A;  1RK4 A;  4RUV A;  5JCG A;  4HOJ A;  1EEM A;  2GST A;  1H75 A;  1K3L A;  5FT3 A;  5D96 A;  1F2E A;  2X8C A;  3M8N A;  2O87 A;  2LJR A;  1GTI A;  2A2S A;  2RUE A;  2YN1 A;  3F6D A;  1Y6E A;  3WYW A;  4YQU A;  3NZN A;  5DAL B;  4WET A;  2G2Q A;  1GUK A;  3A5W A;  4POL A;  4IEL A;  4GRF A;  1MD3 A;  3KTB A;  2HSY A;  2CVK A;  2M46 A;  4WXT A;  3JCM L;  5IO2 A;  3BOA A;  4MJA A;  4I2T A;  2GZY A;  2IN3 A;  1R4W A;  2C80 A;  4X43 A;  2KOK A;  2LNT A;  1XWA A;  1FHE A;  1PQN A;  2K9F A;  4NHW A;  6GSX A;  3IPZ A;  3APO A;  5B7C A;  3LXZ A;  2I1U A;  4YH2 A;  3A2V A;  3BCI A;  3D0Z A;  1M2D A;  3PIN A;  2HNL A;  1PGT A;  2CQ9 A;  1VGL A;  2QKE A;  3FY7 A;  4ZBD A;  4AGS A;  1GTU A;  3HJP A;  1K0C A;  3G9B A;  1TK0 B;  4LMW A;  1FVJ A;  2E2M A;  3IXR A;  2IFQ B;  3UL3 A;  2YNX A;  1GSY A;  5IQY A;  1GLQ A;  3OR5 A;  1VF1 A;  3RPN A;  2MMA A;  3MDK A;  9GSS A;  3APQ A;  4ZBB A;  2V41 A;  3VUR A;  4TW5 A;  2L57 A;  5A4V A;  17GS A;  4D73 A;  3F4S A;  1SK0 A;  1XIY A;  3KZQ A;  4WBR D;  4HZ2 A;  2GLR A;  2CA8 A;  2IMD A;  2L59 A;  3QMX A;  1THO A;  4TXV A;  6GSW A;  5JWQ B;  1UC7 A;  1K3O A;  2M72 A;  2PVO C;  2KLX A;  1WE0 A;  4FO5 A;  4K7N A;  5JCU A;  6GSU A;  1T1V A;  4WF4 A;  4XIH A;  2DLX A;  2CVD A;  5IMD A;  2H1D A;  3CRU A;  4GXZ A;  3U6V A;  4EVM A;  2GS3 A;  5IMV A;  5DVB A;  7GSS A;  2H1B A;  2VCV A;  3GRX A;  4NWY A;  3TJB A;  3TUE A;  1F3A A;  2MBT A;  1M9B A;  1FG4 A;  1UVZ A;  5ID2 B;  4ZB8 A;  3QR6 A;  1YQ1 A;  11GS A;  4EC0 A;  3G7Y A;  1XBS A;  4WBJ A;  5GAP D;  2V6K A;  1ML6 A;  3WD6 A;  4K1F A;  1BX9 A;  2C4J A;  2K18 A;  1QQ2 A;  3N5O A;  2KUC A;  3HVX A;  4DSQ A;  4KAE A;  1GP1 A;  3QOU A;  4WF5 A;  2GQL A;  3ZMK A;  3KD0 A;  3EC3 A;  1SKW B;  2QC7 A;  4HI7 A;  2N5F A;  1OC8 A;  2WCI A;  3LOR A;  1T4Y A;  2ZCT A;  5D93 A;  2J23 A;  5KN1 A;  2X99 A;  4TKY A;  1M99 A;  1N2A A;  1QUW A;  5J9C A;  2GGT A;  1LJR A;  4ACS A;  4EF0 A;  1LBK A;  4FH8 A;  2WDU A;  1KTE A;  3LGC A;  1WWJ A;  1JZD A;  2LRT A;  2P5R A;  4G10 A;  3KM6 A;  4XS4 A;  4DVC A;  3KP8 A;  1BYE A;  1TDI A;  2ZNM A;  3F63 A;  1MD4 A;  1PD2 1;  5DJL A;  1EP8 A;  3FR3 A;  1SL0 B;  3ZL5 A;  4HJ2 A;  1Q4J A;  1GTB A;  3P90 A;  2AV4 A;  4XHM A;  3HVV A;  5JWR B;  4AJ7 A;  4RQX A;  2GSS A;  3HD5 A;  1XPV A;  4KUN A;  4TN8 A;  3IV4 A;  2GT6 A;  4TVE A;  3FRC A;  4CW9 A;  5AIS A;  4XCS A;  5F05 A;  3CSH A;  1JLW A;  4TXO B;  2MYG A;  3IAS 2;  3UAR A;  4HQZ A;  2C3Q A;  4WR4 A;  1Y25 A;  5ECM B;  1ZCP A;  1M2A A;  4IW9 A;  3RDW A;  2XBQ A;  4ZL7 A;  3HJO A;  1GTA A;  3IOS A;  3UJ1 A;  3LSZ A;  3DXB A;  2JZR A;  4N11 A;  5G1L A;  4K9Z A;  4EDZ A;  3RHB A;  1ZYE A;  2WUL A;  4K8M A;  5G5F A;  1F6M C;  3CMI A;  3L9U A;  5CP1 A;  3D6I A;  3HCZ A;  4IKH A;  5F0G A;  3MNG A;  4AJ6 A;  1TW9 A;  4N10 A;  3FZ5 A;  1ERU A;  4GST A;  2R6K A;  2H1G A;  4IS0 A;  3L78 A;  3KH7 A;  2DBC A;  4KCE A;  4FIW A;  5D9V A;  2RLI A;  5IMC A;  4V1A g;  4O5R A;  1R5A A;  3NOF A;  2B5X A;  1AAZ A;  1EV9 A;  1BJX A;  3GX8 A;  1TU7 A;  1TI1 A;  1FOV A;  1ON4 A;  1WMJ A;  1F9M A;  3F8U A;  4GLT A;  2VD1 A;  4H86 A;  3VI7 A;  5CYY A;  3ME7 A;  2F9S A;  4V2L A;  4IJ3 A;  4PQ1 A;  2CT6 A;  3IA1 A;  2FLS A;  2WJU A;  3GYK A;  13GS A;  1G0T A;  4RI6 A;  3W8S A;  4OWY A;  1QK8 A;  1X0R A;  4NXI A;  1A2L A;  2FD3 A;  3LEF A;  4YAV A;  1T4Z A;  4MCU A;  1DSB A;  3GKN A;  4JR4 A;  4HS1 A;  4ZBA A;  1I5G A;  5HR1 A;  2H1A A;  1PX6 A;  2OE3 A;  3DD3 A;  1WP0 A;  3FW2 A;  2H01 A;  1M2B A;  1R7H A;  2HT9 A;  3GFK A;  4MJC A;  5LCZ A;  1X9S B;  1JZO A;  2H72 A;  3N9J A;  1GH2 A;  3TKP A;  3WGD A;  1AXD A;  4GQF A;  4NV5 A;  4MF6 A;  3KJY A;  4Q5Q A;  2YZU A;  1U87 A;  3GMF A;  3PR8 A;  4IBP A;  2H73 A;  1SYR A;  4NHZ A;  4LMV A;  1AC1 A;  4V2M A;  1BG5 A;  4XS1 A;  5C00 A;  3VWV A;  2CX4 A;  2N5A A;  4HZ4 A;  3S9F A;  1EZK A;  3BJ5 A;  3GST A;  3LG6 A;  1SD8 A;  3GX0 A;  1JFU A;  5F06 A;  4ZL9 A;  3IK7 A;  3C73 A;  3GNJ A;  5G1K A;  1H4O A;  2GTU A;  2FGX A;  2EIO A;  1V40 A;  3ZIT A;  3AY8 A;  1XOB A;  5D9X A;  4QL9 A;  1JHB A;  4OD7 A;  5IPH A;  2LJK A;  1QXH A;  4ULX A;  3TKS E;  1YEP A;  1A0R P;  1J9B A;  4K2D A;  4KE3 A;  3HA9 A;  4WR5 A;  12GS A;  4BWS A;  3M0F A;  3F0I A;  3KCM A;  5IOX A;  1JZR A;  3BCK A;  1QGV A;  5LNK e;  1B48 A;  5E4W A;  2DJ1 A;  2H70 A;  2JSZ A;  3ZRD A;  4OCF A;  2IME A;  1KBN A;  1B9Y C;  2ON7 A;  4GCI A;  2NBS A;  3FR6 A;  5IM9 A;  3L9S A;  1DUG A;  3VFI A;  1XW5 A;  2DIZ A;  3VWU A;  1OC9 A;  4F82 A;  1X5E A;  1YF1 A;  2LS5 A;  5EVO A;  2HRF A;  4MJE A;  5ECH B;  10GS A;  2J9H A;  1USB A;  3UVT A;  2TIR A;  3EU3 A;  2ZUP A;  1EWX A;  5IO0 A;  4AF2 A;  3WT2 A;  2FWF A;  4YQV A;  2BJX A;  3D5J A;  2H6X A;  1SJI A;  1YKC A;  4MF5 A;  1OYJ A;  3NIV A;  1GSQ A;  2B1L A;  1X9W B;  3TOU A;  1QFN A;  5DBQ A;  3TDG A;  1I9D A;  3HKR A;  2OAD A;  3UEM A;  3P8W A;  2HRN A;  2VM2 A;  3KTL A;  3GTU B;  2JAC A;  2PUK C;  3QAG A;  3ERG A;  5DAL A;  3IRA A;  2OE0 A;  1YZX A;  2ON5 A;  1NHY A;  2NTO A;  3EWL A;  3LXT A;  3GKK A;  3UMA A;  4EL1 A;  1Z7P A;  3G7I A;  2IIY A;  2VO4 A;  1PSQ A;  5EY6 A;  1B4Q A;  2K8S A;  1ZL9 A;  4J56 E;  4MZB A;  4JRR A;  8GSS A;  5B8A A;  2N5B A;  2AJQ B;  3RHC A;  2VUP A;  4I2U A;  3EUR A;  2PN8 A;  4IGJ A;  2B6M A;  3GA4 A;  2GZP A;  4KW6 A;  3C1R A;  5J3R A;  2VCW A;  1SK2 A;  2C0G A;  2CVB A;  1W4V A;  4CDO A;  3RBT A;  5ECS A;  1HNB A;  4KSO A;  5KN0 A;  2L4C A;  5HFK A;  1SKS B;  1R26 A;  1PX7 A;  4PNF A;  3HZ4 A;  4FYB A;  3GN3 A;  2OJL A;  2R3X A;  1SYX A;  3W8J A;  1K0A A;  1ZZY A;  1TRS A;  2LNS A;  4PQH A;  5D9T A;  1AIU A;  2OA7 A;  3US3 A;  2L6C A;  3FZ9 A;  1NSW A;  1A2J A;  2R37 A;  4ZIJ A;  4ID0 A;  2NDO A;  2YP6 A;  1FAA A;  1TTZ A;  2L4Q A;  1O81 A;  4D73 B;  5J5N A;  2V32 A;  5G5E A;  1T7P B;  2MMN A;  1OC3 A;  3UBL A;  1K3Y A;  5AGY A;  2GDR A;  4MF7 A;  3IDV A;  1A0F A;  1V57 A;  5EL8 A;  4I97 A;  1Z5Y E;  16GS A;  1O8W A;  3SBC A;  1V98 A;  1O85 A;  2AHE A;  3DVX A;  2I4A A;  4Q5R A;  4MA9 A;  3E9J B;  3GKM A;  4HU7 A;  3K8N A;  1FB6 A;  4JU5 A;  6GSV A;  2WGR A;  3CSI A;  4IHU A;  1DE1 A;  1QMV A;  5F8B A;  2YZH A;  5HFI A;  4F03 A;  1GNE A;  1K0N A;  4PQI A;  1K0B A;  2VD0 A;  1EP7 A;  4ISD A;  2YWM A;  3GV1 A;  2TRX A;  5GSS A;  5H5Q A;  4LL4 B;  1PL2 A;  3PGT A;  5J4U A;  2X8G A;  1BAY A;  4N0V A;  2IWT A;  2P5Q A;  4J2F A;  2O7K A;  1JZW A;  1URM A;  2ES7 A;  1ILO A;  2L5L A;  1BED A;  3P2A A;  3LFL A;  3VWX A;  4GSN A;  1JLV A;  4KX4 A;  5DQS A;  4GSS A;  2VCT A;  3E0U A;  5JWO B;  4PGT A;  3CTG A;  2I3Y A;  5DAK A;  4EDY A;  4ECB A;  2QGV A;  1S3A A;  5IPG A;  3ERW A;  1U6T A;  3F4R A;  3TRP A;  2VOC A;  2CX3 A; 
#chains in the Genus database with same CATH topology
 4KB3 A;  1AQW A;  1S3D A;  3PH9 A;  1VF3 A;  3WT1 A;  1YY7 A;  19GS A;  1V9W A;  3KH9 A;  3I69 A;  3R3E A;  3L0H A;  3O6T A;  2YV7 A;  5CRW A;  4HU9 A;  5HR0 A;  4K6X A;  1XCC A;  14GS A;  3CSJ A;  2XC2 A;  4BWQ A;  1IYH A;  3HDC A;  3LQ7 A;  3IBH A;  4XS4 B;  2K6V A;  1S3C A;  1THX A;  3IR4 A;  4L5L A;  3FR9 A;  2HZF A;  4E8H A;  4EKZ A;  2F51 A;  2IJY A;  4XRD A;  2YWN A;  5DCG A;  2ALB A;  1PKZ A;  3Q18 A;  1UA5 A;  4O5Q A;  4NAX A;  1PN0 A;  4XRA A;  2F8F A;  3TJG A;  2YPM A;  2A2P A;  3IK9 A;  4L8E A;  2AAW A;  1U88 A;  2A2R A;  1DE2 A;  4TXO A;  3KEB A;  3M1G A;  3I9V 2;  3A2W A;  1OE7 A;  1C72 A;  5D73 A;  4E8E A;  4IP6 A;  1TXX A;  1TRU A;  3ZZX A;  2CZ3 A;  5JCW A;  3VLN A;  1M3J A;  1XW9 A;  4X1U A;  5ABR A;  2VLT A;  2HFD A;  1NM3 A;  1ERW A;  4MMM A;  4XTS A;  3BD2 A;  4IVF A;  1XWG A;  2WS2 A;  2YOI A;  2H71 A;  3CBU A;  3UBK A;  4EUY A;  2LRC A;  4TR0 A;  20GS A;  3UVH A;  3SWL A;  2VL2 C;  2HXK A;  2X4A A;  4F2I A;  4NMU A;  4PUR A;  3DVW A;  2H19 A;  4TRX A;  1K0D A;  4Q5N A;  2VAF A;  3MIX A;  1B8X A;  1KNG A;  3F9U A;  3MWH A;  2V2G A;  2YJH A;  3FK8 A;  5ECK B;  2OKA A;  3F3R A;  4ZIL A;  3IE3 A;  4TOP A;  3I43 A;  4KDU A;  1YKA A;  2X8H A;  4I6X A;  3UIW A;  2H0H A;  1Z9H A;  4ECI A;  3HZ8 A;  1XXU A;  1B4P A;  2DJJ A;  4QL7 A;  2MZC A;  4MH3 A;  4Z7X A;  4A5P A;  3KIJ A;  3EMX A;  1W89 A;  5B8B A;  2P0G A;  2IPA A;  1CQG A;  1TK5 B;  1EGR A;  4ILF A;  3LWA A;  2HLS A;  2VL3 A;  2K8V A;  4GQC A;  3D21 A;  4DEJ A;  2JSY A;  3C1S A;  3D22 A;  4XS6 A;  1XWB A;  2C1Y A;  1XWC A;  1T00 A;  1MDK A;  1PL1 A;  1CQH A;  4DSS B;  1WIK A;  1SK1 A;  2DML A;  2HYX A;  2F3M A;  3A2X A;  4O92 A;  2C3T A;  2DJK A;  3R2Q A;  3ZML A;  3J7Y b;  5COH A;  1V58 A;  4TR3 A;  4F0C A;  3D4M A;  5A4W A;  2H0I A;  2H74 A;  3FZ4 A;  3EMP A;  2GSR A;  4HQS A;  4KSM A;  1EGO A;  1Z6N A;  3GUR A;  1A2M A;  2PER A;  2O89 A;  2O85 A;  5CNW A;  2O8V B;  1G6Y A;  4PUA A;  1V2A A;  4Z2T A;  3E3E A;  3UAP A;  4N30 A;  5IIZ A;  4POB A;  2QA1 A;  5DJM A;  3MAK A;  1A8L A;  1ERT A;  5KOW A;  4LL1 B;  4ML6 A;  2HSH A;  1ZOF A;  2OBI A;  3GL5 A;  4K0G A;  4AJ8 A;  1SEN A;  2B7J A;  4IQA A;  2H75 A;  4I5Q A;  2VL9 A;  5DDL A;  2OAC A;  4LLR A;  3F6F A;  3ZIJ A;  2YWI A;  2DJ3 A;  1J0F A;  4IP1 A;  1J08 A;  1Z7R A;  3Q6O A;  1ERV A;  3ZRE A;  4I8B A;  2JAD A;  4KGI A;  4MJB A;  2OBK A;  1KEB A;  5CO3 A;  1IYI A;  2GZZ A;  4TR1 B;  2LRN A;  2MMO A;  6GSS A;  2RM5 A;  2HI7 A;  2WB9 A;  2B5E A;  1ZMA A;  2YWO A;  3EU4 A;  1ZGN A;  1XZO A;  4K5S A;  1HYU A;  4LA1 A;  1ACV A;  2JL4 A;  5EPF A;  4CHS A;  3C71 A;  1EEJ A;  3DWV A;  1TRW A;  2HE3 A;  5HR2 A;  1LU4 A;  4BVX A;  1TU8 A;  2HZE A;  3ZIV A;  3M9K A;  1G7E A;  3CXG A;  4ZB6 A;  2C0D A;  3KGK A;  5GAN D;  5J41 A;  4ZL8 A;  2LV3 A;  1GWC A;  1AQV A;  1U3I A;  1OC9 B;  3WGE A;  1X5C A;  4OO4 A;  1Q98 A;  2VIM A;  2XHF A;  4WKW A;  2LTK A;  4PXO A;  2PMT A;  1K0O A;  3TKS A;  2VL2 A;  1U3A A;  1VF2 A;  2PGT A;  2PPT A;  3QAV A;  2M80 A;  2VLU A;  2FWG A;  4MDC A;  2JZT A;  1EV4 A;  2L5O A;  5E59 A;  1FB0 A;  5D9W A;  1EOH A;  4ICY A;  4YKG A;  1HNC A;  3M9J A;  2WRT A;  5A5K A;  4L0W A;  1OAZ A;  2E2G A;  2RUF A;  3CYN A;  5ELG A;  4FYC A;  4N0Z A;  4L0U A;  4GWR A;  1VRS D;  2FCH A;  4X4J A;  1TRV A;  3IC4 A;  2R4V A;  3F3Q A;  4NV2 A;  2XPE A;  3HYP A;  4IQ1 A;  2WZ9 A;  2XPD A;  2IFQ A;  3H93 A;  5ECO B;  1GLP A;  3W6G A;  3U5R E;  2B5Y A;  1MDI A;  1OKD A;  4PTS A;  4USS A;  1FO5 A;  2GQK A;  1GSU A;  2VCX A;  3DML A;  4KCA A;  5CAX A;  3ZYW A;  4IJI A;  4KH7 A;  3QDN A;  5B6N A;  1T3B A;  2VM1 A;  4MPG A;  5G2Z A;  5H5S A;  1Z6M A;  1G7O A;  2C0F A;  1SU9 A;  6GSY A;  3VWW A;  1RW1 A;  2BMX A;  4OFN A;  2LQO A;  4PUF C;  4ECC A;  2FY6 A;  1GSF A;  2EIR A;  1ZYQ B;  2NVL A;  1PRX A;  2V6O A;  2X64 A;  1TK8 B;  2FA8 A;  1A24 A;  5DCH A;  4EXJ A;  3ME8 A;  1HD2 A;  4KND A;  1TJD A;  3FKF A;  5GZZ B;  4BPY A;  3TOT A;  3DIE A;  2GSQ A;  4MZW A;  3VI5 A;  2Z9S A;  2DIY A;  4MP4 A;  1GUM A;  5KEJ A;  1ABA A;  4K7O A;  4G9H A;  3APS A;  2B3S A;  5ECI B;  2LQQ A;  3ISO A;  1FVK A;  4NPB A;  4K0N A;  1WRY A;  5ID2 A;  2LJA A;  5LD0 A;  1T8E B;  3HJM A;  1XVQ A;  2C8U A;  4PNG A;  4KDY A;  1S3R A;  2JZS A;  4G2E A;  4HUA A;  2CZ2 A;  3Q19 A;  3TCO A;  4OFM A;  4MAB A;  1PMT A;  2LKU A;  2A4V A;  3H4K A;  1SJZ A;  2LST A;  1XVW A;  1AQX A;  1AUC A;  3QD9 A;  3F4T A;  2UZ8 A;  2EIQ A;  1NW2 A;  2IMF A;  1TKD B;  1SL1 B;  4TR4 A;  4V1A p;  18GS A;  2VCQ A;  3ZFL A;  2NPB A;  4CY6 A;  5HQP A;  2GT5 A;  3GSS A;  3HXS A;  5ELA A;  3UOM A;  3IHG A;  2C0E A;  5FWG A;  1OVN A;  1ZYP A;  2AB6 A;  3DEX A;  1EOG A;  2D2Z A;  2E7P A;  5AIX A;  4OO5 A;  3MYD A;  1GUL A;  5DAK B;  3KMN A;  4IN0 A;  2CV4 A;  2L6D A;  4JZQ A;  1O6J A;  3IHQ A;  5HR3 A;  2MBS A;  5CRD A;  5C04 A;  3FEU A;  5B6M A;  1O73 A;  3FZA A;  5CRG A;  1M0U A;  3ZFB A;  5G31 A;  4HDE A;  3GKX A;  4YKF A;  2RM6 A;  3O3T A;  5IMZ A;  3TJJ A;  2PBJ A;  1GSD A;  2GQM A;  3EIN A;  3QPM A;  3LJR A;  1FW1 A;  2DJ0 A;  3D4T A;  5DQY A;  3TKR A;  2AUV A;  1O8X A;  3DKS A;  1YF0 A;  4OMV A;  3VPT A;  4RI7 A;  4O32 A;  2H30 A;  3EYT A;  3MSZ A;  3HVS A;  4HJM A;  3DRN A;  4QQ7 A;  1GSE A;  2R0G A;  1BQ7 A;  3LYK A;  4YQM A;  4POM A;  6GST A;  1WJK A;  3KP9 A;  3GHA A;  2LUS A;  3L4N A;  1M9A A;  4ZB9 A;  3TJF A;  4G19 A;  1PN9 A;  1SD9 A;  3EE2 A;  2B1K A;  1X5D A;  22GS A;  3FYG A;  2XBI A;  2H6Z A;  2V1M A;  2WFC A;  5ECN B;  4P3Y B;  2YV9 A;  1XFL A;  4JED A;  2REM A;  3C7M A;  3TKS C;  1ST9 A;  3O76 A;  1TI3 A;  2QSI A;  2IMK A;  4JR6 A;  2DSA A;  5A4U A;  1F3B A;  2DC5 A;  4BL7 A;  2TRC P;  4OFT A;  3GH9 A;  2YAN A;  4PX1 A;  3EPT A;  5H5R A;  5IOW A;  1YDK A;  3CTF A;  3KXO A;  4J57 E;  3CQF A;  1Z3E A;  3QFB C;  5IMF A;  5CRE A;  2KP1 A;  3P7X A;  4RQR A;  5AN1 A;  3A3T A;  1RQM A;  4MNN A;  4L5O A;  4JE1 A;  5FHI A;  3H1N A;  2IMI A;  3QAW A;  4FYU A;  2KHP A;  5ECP B;  5L71 A;  3V1W A;  2R5G A;  5IMA A;  3RPP A;  4MLY A;  3ERF A;  2G0F A;  4WEY A;  4DSR A;  4OCE A;  2E0Q A;  3G7J A;  5D8I A;  1TOF A;  2AYT A;  2B7K A;  4EO3 A;  3LW9 A;  4F0B A;  3TKQ A;  1MDJ A;  5AIV A;  3LYP A;  2KP2 A;  2I9H A;  2JU5 A;  3VK9 A;  2H6Y A;  3VPQ A;  1GNW A;  2QA2 A;  2IL3 A;  4DSS A;  1WPI A;  3QCP A;  2H0G A;  5ECL B;  1VF4 A;  4GTU A;  1OE8 A;  1OKT A;  3EVI A;  3ZVJ D;  1GSS A;  2H76 A;  1R5P A;  5KN2 A;  1M7T A;  2FA4 A;  5ECQ B;  1MTC A;  2FHE A;  1N8J A;  3H79 A;  3WGX A;  1O7U A;  2H8L A;  3ZTL A;  2CAI A;  1TP9 A;  4F9Z A;  3GH6 A;  4BVY A;  3GUS A;  2FWE A;  3M3M A;  2FNO A;  4JBB A;  2GVP A;  4EIP A;  4KA0 A;  4ECJ A;  2P31 A;  5J9B A;  3L9V A;  2OE1 A;  1DBY A;  2VCZ A;  4MH2 A;  2EC4 A;  4ML1 A;  1SJ6 A;  4GF0 A;  2H66 A;  1PFO A;  1GRX A;  4ZXG A;  3Q74 A;  1SKR B;  1GUH A;  1E6B A;  3TB2 A;  4Q5F A;  2HSM A;  1YEX A;  4EE0 A;  3GIX A;  2F8A A;  1PKW A;  2LEG A;  1GL8 A;  5GST A;  1K0M A;  1XOA A;  1A23 A;  2VLV A;  2YCD A;  4BA7 A;  4Z2R A;  2I81 A;  3CRT A;  2A4H A;  4TR1 A;  1YJ6 A;  3QFA C;  3HHV A;  1A8Y A;  1MEK A;  5G30 A;  2RII A;  1UN2 A;  2PU9 C;  3DYR A;  2BTO T;  1E2Y A;  4MK3 A;  2YJ7 A;  1B9X C;  3TRQ A;  4YAP A;  2FUG 2;  2DJ2 A;  1AW9 A;  5HFG A;  3RAZ A;  3J7Y k;  3KMO A;  1HQO A;  3TRX A;  4K7I A;  1XG8 A;  4HEA 2;  5ENU A;  5ECR B;  2R2J A;  2PVQ A;  1SL2 B;  3IAM 2;  3TGZ A;  2FWH A;  5CRH A;  2DMM A;  2MMZ A;  3FHK A;  5INY A;  2CAQ A;  4BVX B;  4MZC A;  3GL3 A;  2C3N A;  5F07 A;  2HZE B;  1XW6 A;  3ZVJ A;  1G6W A;  4KDX A;  3TJK A;  5KN3 A;  1X9M B;  1XWK A;  1WOU A;  3I6A A;  4X0X A;  4MPF A;  3BBY A;  3ZLP A;  1NHO A;  3C8E A;  3H8Q A;  4V2N A;  1HNA A;  1F37 A;  3GTU A;  1PA3 A;  3DGQ A;  4POK A;  4O7H A;  2PWJ A;  3ED3 A;  3HY2 A;  1RK4 A;  4RUV A;  5JCG A;  4HOJ A;  1EEM A;  2GST A;  1H75 A;  1K3L A;  5FT3 A;  5D96 A;  1F2E A;  2X8C A;  3M8N A;  2O87 A;  2LJR A;  1GTI A;  2A2S A;  5BMU A;  2RUE A;  2YN1 A;  3F6D A;  1Y6E A;  3WYW A;  5KOX A;  4YQU A;  3NZN A;  5DAL B;  4WET A;  2G2Q A;  1GUK A;  3A5W A;  4POL A;  4IEL A;  4GRF A;  1MD3 A;  3KTB A;  2HSY A;  2CVK A;  2M46 A;  4WXT A;  3JCM L;  5IO2 A;  3BOA A;  4MJA A;  4I2T A;  2GZY A;  2IN3 A;  1R4W A;  2C80 A;  4X43 A;  2KOK A;  2LNT A;  1XWA A;  1FHE A;  4EIQ A;  1PQN A;  2K9F A;  4NHW A;  6GSX A;  3IPZ A;  3APO A;  5B7C A;  3LXZ A;  2I1U A;  4YH2 A;  3A2V A;  3BCI A;  3D0Z A;  4CY8 A;  3IC8 A;  4K5R A;  1M2D A;  3PIN A;  2HNL A;  1PGT A;  2CQ9 A;  1VGL A;  2QKE A;  3FY7 A;  4ZBD A;  4AGS A;  1GTU A;  3HJP A;  1K0C A;  3G9B A;  1TK0 B;  4LMW A;  1FVJ A;  2E2M A;  3IXR A;  2IFQ B;  3UL3 A;  2YNX A;  1GSY A;  5IQY A;  1GLQ A;  3OR5 A;  1VF1 A;  3RPN A;  2MMA A;  3MDK A;  9GSS A;  3APQ A;  4ZBB A;  2V41 A;  3VUR A;  4TW5 A;  2L57 A;  5A4V A;  17GS A;  4D73 A;  3F4S A;  1SK0 A;  1XIY A;  3KZQ A;  4WBR D;  4HZ2 A;  2GLR A;  2CA8 A;  2IMD A;  2L59 A;  3QMX A;  1THO A;  4TXV A;  6GSW A;  5JWQ B;  1UC7 A;  2HRA A;  1K3O A;  2M72 A;  2PVO C;  2KLX A;  1WE0 A;  4FO5 A;  4G0I A;  1M3I A;  4K7N A;  5JCU A;  6GSU A;  1T1V A;  4WF4 A;  4XIH A;  2DLX A;  2CVD A;  5IMD A;  2H1D A;  3CRU A;  4GXZ A;  3U6V A;  4EVM A;  2GS3 A;  5IMV A;  5DVB A;  7GSS A;  2H1B A;  2VCV A;  3GRX A;  4NWY A;  3TJB A;  3TUE A;  1F3A A;  2MBT A;  1M9B A;  1FG4 A;  1UVZ A;  5ID2 B;  4ZB8 A;  3QR6 A;  1YQ1 A;  11GS A;  4EC0 A;  3G7Y A;  1XBS A;  4WBJ A;  5GAP D;  2V6K A;  1ML6 A;  3WD6 A;  4K1F A;  1BX9 A;  2C4J A;  2K18 A;  1QQ2 A;  3N5O A;  2KUC A;  3HVX A;  4DSQ A;  4KAE A;  1GP1 A;  3QOU A;  4WF5 A;  3FMW A;  2GQL A;  3ZMK A;  3KD0 A;  3EC3 A;  1SKW B;  2QC7 A;  4HI7 A;  2N5F A;  4G0L A;  1OC8 A;  2WCI A;  3LOR A;  1T4Y A;  2ZCT A;  5D93 A;  2J23 A;  5KN1 A;  2X99 A;  4TKY A;  1M99 A;  1N2A A;  1QUW A;  5J9C A;  2GGT A;  1LJR A;  4ACS A;  4EF0 A;  1LBK A;  4FH8 A;  2WDU A;  1KTE A;  3LGC A;  1WWJ A;  1JZD A;  2LRT A;  2P5R A;  4G10 A;  3KM6 A;  4XS4 A;  4DVC A;  3KP8 A;  1BYE A;  1TDI A;  2ZNM A;  3F63 A;  1MD4 A;  1PD2 1;  5DJL A;  1EP8 A;  3FR3 A;  4Z2U A;  1SL0 B;  3ZL5 A;  4HJ2 A;  1FOH A;  1Q4J A;  1GTB A;  3P90 A;  2HRK A;  2AV4 A;  4XHM A;  3HVV A;  5JWR B;  4AJ7 A;  4RQX A;  2GSS A;  3HD5 A;  1XPV A;  4KUN A;  4TN8 A;  3IV4 A;  2GT6 A;  4TVE A;  3FRC A;  4CW9 A;  5AIS A;  4XCS A;  5F05 A;  3CSH A;  1JLW A;  4TXO B;  2MYG A;  3IAS 2;  3UAR A;  4HQZ A;  2C3Q A;  4WR4 A;  1Y25 A;  5ECM B;  1ZCP A;  1M2A A;  4IW9 A;  3RDW A;  2XBQ A;  4ZL7 A;  3HJO A;  1GTA A;  3IOS A;  3UJ1 A;  3LSZ A;  3DXB A;  2JZR A;  4N11 A;  5G1L A;  4K9Z A;  4EDZ A;  3RHB A;  1ZYE A;  2WUL A;  4K8M A;  5G5F A;  1F6M C;  3CMI A;  3L9U A;  5CP1 A;  3D6I A;  3HCZ A;  2DKI A;  4IKH A;  5F0G A;  3MNG A;  4AJ6 A;  4BL7 B;  1TW9 A;  4N10 A;  1ZYN A;  3FZ5 A;  1ERU A;  4GST A;  2R6K A;  2H1G A;  4IS0 A;  3L78 A;  3KH7 A;  2DBC A;  4KCE A;  4FQU A;  4O5U A;  4FIW A;  5D9V A;  2RLI A;  5IMC A;  4V1A g;  4O5R A;  1R5A A;  3NOF A;  2B5X A;  1AAZ A;  1EV9 A;  1BJX A;  3GX8 A;  1TU7 A;  1TI1 A;  1FOV A;  1ON4 A;  1WMJ A;  1F9M A;  3F8U A;  4GLT A;  2VD1 A;  4H86 A;  3VI7 A;  5CYY A;  3ME7 A;  2F9S A;  4V2L A;  4IJ3 A;  4PQ1 A;  2CT6 A;  3IA1 A;  2FLS A;  2WJU A;  3GYK A;  13GS A;  1G0T A;  4RI6 A;  3W8S A;  4OWY A;  3HVN A;  1QK8 A;  1X0R A;  4NXI A;  1A2L A;  2FD3 A;  3LEF A;  4YAV A;  1T4Z A;  4MCU A;  1DSB A;  3GKN A;  4JR4 A;  4HS1 A;  4ZBA A;  1I5G A;  5HR1 A;  2H1A A;  1PX6 A;  2OE3 A;  3DD3 A;  1WP0 A;  3FW2 A;  2H01 A;  1M2B A;  1R7H A;  2HT9 A;  3GFK A;  4MJC A;  5LCZ A;  1X9S B;  1JZO A;  2H72 A;  3N9J A;  1GH2 A;  3TKP A;  3WGD A;  1AXD A;  4GQF A;  4NV5 A;  4MF6 A;  3KJY A;  4Q5Q A;  2YZU A;  1U87 A;  3GMF A;  3PR8 A;  4IBP A;  2H73 A;  1SYR A;  4NHZ A;  4LMV A;  1AC1 A;  4V2M A;  1BG5 A;  4XS1 A;  5C00 A;  3VWV A;  2CX4 A;  2N5A A;  4HZ4 A;  4BVY B;  3S9F A;  1EZK A;  3BJ5 A;  3GST A;  3LG6 A;  1SD8 A;  3GX0 A;  1JFU A;  5F06 A;  4ZL9 A;  3IK7 A;  3C73 A;  3GNJ A;  5G1K A;  1H4O A;  2GTU A;  2FGX A;  2EIO A;  1V40 A;  3ZIT A;  3AY8 A;  1XOB A;  5D9X A;  4QL9 A;  1JHB A;  4OD7 A;  5IPH A;  2LJK A;  1QXH A;  4ULX A;  3TKS E;  1YEP A;  1A0R P;  1J9B A;  4K2D A;  4KE3 A;  3HA9 A;  4WR5 A;  12GS A;  4BWS A;  3M0F A;  3F0I A;  3KCM A;  5IOX A;  1JZR A;  3BCK A;  1QGV A;  5LNK e;  1B48 A;  5E4W A;  2DJ1 A;  2H70 A;  2JSZ A;  3ZRD A;  4OCF A;  2IME A;  1KBN A;  1B9Y C;  2ON7 A;  4GCI A;  2NBS A;  3FR6 A;  5IM9 A;  3L9S A;  1DUG A;  3VFI A;  2R0C A;  1XW5 A;  2DIZ A;  3VWU A;  1OC9 A;  4F82 A;  1X5E A;  1YF1 A;  2LS5 A;  5EVO A;  2HRF A;  4MJE A;  5ECH B;  10GS A;  2J9H A;  1USB A;  3UVT A;  2TIR A;  3EU3 A;  2ZUP A;  1EWX A;  5IO0 A;  4AF2 A;  3WT2 A;  2FWF A;  4YQV A;  2BJX A;  3D5J A;  2H6X A;  1SJI A;  1YKC A;  4MF5 A;  1OYJ A;  3NIV A;  1GSQ A;  2B1L A;  1X9W B;  3TOU A;  1QFN A;  5DBQ A;  3TDG A;  1I9D A;  4K2X A;  3HKR A;  2OAD A;  3UEM A;  3P8W A;  2HRN A;  2VM2 A;  3KTL A;  3GTU B;  2JAC A;  2PUK C;  3QAG A;  3ERG A;  5DAL A;  3IRA A;  2OE0 A;  1YZX A;  2ON5 A;  1NHY A;  2NTO A;  3EWL A;  3LXT A;  3GKK A;  3UMA A;  4EL1 A;  1Z7P A;  3G7I A;  2IIY A;  2VO4 A;  1PSQ A;  5EY6 A;  1B4Q A;  2K8S A;  1ZL9 A;  4J56 E;  4MZB A;  4JRR A;  8GSS A;  5B8A A;  2N5B A;  2AJQ B;  3RHC A;  2VUP A;  4I2U A;  3EUR A;  2PN8 A;  4IGJ A;  2B6M A;  3GA4 A;  2GZP A;  4KW6 A;  3C1R A;  5J3R A;  2VCW A;  1SK2 A;  2C0G A;  2CVB A;  3A5I A;  1W4V A;  4CDO A;  3RBT A;  5ECS A;  1HNB A;  4KSO A;  5KN0 A;  2L4C A;  5HFK A;  1SKS B;  1R26 A;  1PX7 A;  4PNF A;  3HZ4 A;  4FYB A;  3GN3 A;  5BRT A;  2R0P A;  2OJL A;  2R3X A;  1SYX A;  3W8J A;  1K0A A;  1ZZY A;  1TRS A;  2LNS A;  4PQH A;  5D9T A;  1AIU A;  2OA7 A;  3US3 A;  2L6C A;  3FZ9 A;  1NSW A;  1A2J A;  2R37 A;  4ZIJ A;  4ID0 A;  2NDO A;  2YP6 A;  1FAA A;  1TTZ A;  3PPU A;  2L4Q A;  1O81 A;  4D73 B;  5J5N A;  2V32 A;  5G5E A;  1T7P B;  2MMN A;  1OC3 A;  3UBL A;  1K3Y A;  5AGY A;  2GDR A;  2DKH A;  4MF7 A;  2X49 A;  3IDV A;  4BIK A;  1A0F A;  1V57 A;  4KF9 A;  5EL8 A;  4I97 A;  1Z5Y E;  16GS A;  1O8W A;  3SBC A;  1V98 A;  1O85 A;  2AHE A;  3DVX A;  2I4A A;  4Q5R A;  4MA9 A;  3E9J B;  4HSC X;  3GKM A;  4HU7 A;  3K8N A;  1FB6 A;  4JU5 A;  6GSV A;  2WGR A;  3CSI A;  4IHU A;  1DE1 A;  1QMV A;  5F8B A;  2YZH A;  5HFI A;  4F03 A;  1GNE A;  1K0N A;  4PQI A;  1K0B A;  2VD0 A;  1EP7 A;  4G0K A;  4ISD A;  2YWM A;  3GV1 A;  2TRX A;  5GSS A;  5H5Q A;  4LL4 B;  1PL2 A;  3PGT A;  5J4U A;  2X8G A;  1BAY A;  4N0V A;  2IWT A;  2P5Q A;  4J2F A;  2O7K A;  1JZW A;  1URM A;  2ES7 A;  1ILO A;  2L5L A;  1BED A;  3P2A A;  3LFL A;  3VWX A;  4GSN A;  1JLV A;  4KX4 A;  5DQS A;  4GSS A;  2VCT A;  3E0U A;  5JWO B;  4PGT A;  3CTG A;  2I3Y A;  5DAK A;  4EDY A;  4ECB A;  2QGV A;  1S3A A;  5IPG A;  3ERW A;  1U6T A;  3F4R A;  3TRP A;  2VOC A;  2CX3 A; 
#chains in the Genus database with same CATH homology
 4KB3 A;  1AQW A;  1S3D A;  3PH9 A;  1VF3 A;  3WT1 A;  1YY7 A;  19GS A;  1V9W A;  3KH9 A;  3I69 A;  3R3E A;  3L0H A;  3O6T A;  2YV7 A;  5CRW A;  4HU9 A;  5HR0 A;  4K6X A;  1XCC A;  14GS A;  3CSJ A;  2XC2 A;  4BWQ A;  1IYH A;  3HDC A;  3LQ7 A;  3IBH A;  4XS4 B;  2K6V A;  1S3C A;  1THX A;  3IR4 A;  4L5L A;  3FR9 A;  2HZF A;  4E8H A;  4EKZ A;  2F51 A;  2IJY A;  4XRD A;  2YWN A;  5DCG A;  2ALB A;  1PKZ A;  3Q18 A;  1UA5 A;  4O5Q A;  4NAX A;  1PN0 A;  4XRA A;  2F8F A;  3TJG A;  2YPM A;  2A2P A;  3IK9 A;  4L8E A;  2AAW A;  1U88 A;  2A2R A;  1DE2 A;  4TXO A;  3KEB A;  3M1G A;  3I9V 2;  3A2W A;  1OE7 A;  1C72 A;  5D73 A;  4E8E A;  4IP6 A;  1TXX A;  1TRU A;  3ZZX A;  2CZ3 A;  5JCW A;  3VLN A;  1XW9 A;  4X1U A;  5ABR A;  2VLT A;  2HFD A;  1NM3 A;  1ERW A;  4MMM A;  4XTS A;  3BD2 A;  4IVF A;  1XWG A;  2WS2 A;  2YOI A;  2H71 A;  3CBU A;  3UBK A;  4EUY A;  2LRC A;  4TR0 A;  20GS A;  3UVH A;  3SWL A;  2VL2 C;  2HXK A;  2X4A A;  4F2I A;  4NMU A;  4PUR A;  3DVW A;  2H19 A;  4TRX A;  1K0D A;  4Q5N A;  2VAF A;  3MIX A;  1B8X A;  1KNG A;  3F9U A;  3MWH A;  2V2G A;  2YJH A;  3FK8 A;  5ECK B;  2OKA A;  3F3R A;  4ZIL A;  3IE3 A;  4TOP A;  3I43 A;  4KDU A;  1YKA A;  2X8H A;  4I6X A;  3UIW A;  2H0H A;  1Z9H A;  4ECI A;  3HZ8 A;  1XXU A;  1B4P A;  2DJJ A;  4QL7 A;  2MZC A;  4MH3 A;  4Z7X A;  4A5P A;  3KIJ A;  3EMX A;  1W89 A;  5B8B A;  2P0G A;  2IPA A;  1CQG A;  1TK5 B;  1EGR A;  4ILF A;  3LWA A;  2HLS A;  2VL3 A;  2K8V A;  4GQC A;  3D21 A;  4DEJ A;  2JSY A;  3C1S A;  3D22 A;  4XS6 A;  1XWB A;  2C1Y A;  1XWC A;  1T00 A;  1MDK A;  1PL1 A;  1CQH A;  4DSS B;  1WIK A;  1SK1 A;  2DML A;  2HYX A;  2F3M A;  3A2X A;  4O92 A;  2C3T A;  2DJK A;  3R2Q A;  3ZML A;  3J7Y b;  5COH A;  1V58 A;  4TR3 A;  4F0C A;  3D4M A;  5A4W A;  2H0I A;  2H74 A;  3FZ4 A;  3EMP A;  2GSR A;  4HQS A;  4KSM A;  1EGO A;  1Z6N A;  3GUR A;  1A2M A;  2PER A;  2O89 A;  2O85 A;  5CNW A;  2O8V B;  1G6Y A;  4PUA A;  1V2A A;  4Z2T A;  3E3E A;  3UAP A;  4N30 A;  5IIZ A;  4POB A;  2QA1 A;  5DJM A;  3MAK A;  1A8L A;  1ERT A;  5KOW A;  4LL1 B;  4ML6 A;  2HSH A;  1ZOF A;  2OBI A;  3GL5 A;  4K0G A;  4AJ8 A;  1SEN A;  2B7J A;  4IQA A;  2H75 A;  4I5Q A;  2VL9 A;  5DDL A;  2OAC A;  4LLR A;  3F6F A;  3ZIJ A;  2YWI A;  2DJ3 A;  1J0F A;  4IP1 A;  1J08 A;  1Z7R A;  3Q6O A;  1ERV A;  3ZRE A;  4I8B A;  2JAD A;  4KGI A;  4MJB A;  2OBK A;  1KEB A;  5CO3 A;  1IYI A;  2GZZ A;  4TR1 B;  2LRN A;  2MMO A;  6GSS A;  2RM5 A;  2HI7 A;  2WB9 A;  2B5E A;  1ZMA A;  2YWO A;  3EU4 A;  1ZGN A;  1XZO A;  4K5S A;  1HYU A;  4LA1 A;  1ACV A;  2JL4 A;  5EPF A;  4CHS A;  3C71 A;  1EEJ A;  3DWV A;  1TRW A;  2HE3 A;  5HR2 A;  1LU4 A;  4BVX A;  1TU8 A;  2HZE A;  3ZIV A;  3M9K A;  1G7E A;  3CXG A;  4ZB6 A;  2C0D A;  3KGK A;  5GAN D;  5J41 A;  4ZL8 A;  2LV3 A;  1GWC A;  1AQV A;  1U3I A;  1OC9 B;  3WGE A;  1X5C A;  4OO4 A;  1Q98 A;  2VIM A;  2XHF A;  4WKW A;  2LTK A;  4PXO A;  2PMT A;  1K0O A;  3TKS A;  2VL2 A;  1U3A A;  1VF2 A;  2PGT A;  2PPT A;  3QAV A;  2M80 A;  2VLU A;  2FWG A;  4MDC A;  2JZT A;  1EV4 A;  2L5O A;  5E59 A;  1FB0 A;  5D9W A;  1EOH A;  4ICY A;  4YKG A;  1HNC A;  3M9J A;  2WRT A;  5A5K A;  4L0W A;  1OAZ A;  2E2G A;  2RUF A;  3CYN A;  5ELG A;  4FYC A;  4N0Z A;  4L0U A;  4GWR A;  1VRS D;  2FCH A;  4X4J A;  1TRV A;  3IC4 A;  2R4V A;  3F3Q A;  4NV2 A;  2XPE A;  3HYP A;  4IQ1 A;  2WZ9 A;  2XPD A;  2IFQ A;  3H93 A;  5ECO B;  1GLP A;  3W6G A;  3U5R E;  2B5Y A;  1MDI A;  1OKD A;  4PTS A;  4USS A;  1FO5 A;  2GQK A;  1GSU A;  2VCX A;  3DML A;  4KCA A;  5CAX A;  3ZYW A;  4IJI A;  4KH7 A;  3QDN A;  5B6N A;  1T3B A;  2VM1 A;  4MPG A;  5G2Z A;  5H5S A;  1Z6M A;  1G7O A;  2C0F A;  1SU9 A;  6GSY A;  3VWW A;  1RW1 A;  2BMX A;  4OFN A;  2LQO A;  4PUF C;  4ECC A;  2FY6 A;  1GSF A;  2EIR A;  1ZYQ B;  2NVL A;  1PRX A;  2V6O A;  2X64 A;  1TK8 B;  2FA8 A;  1A24 A;  5DCH A;  4EXJ A;  3ME8 A;  1HD2 A;  4KND A;  1TJD A;  3FKF A;  5GZZ B;  4BPY A;  3TOT A;  3DIE A;  2GSQ A;  4MZW A;  3VI5 A;  2Z9S A;  2DIY A;  4MP4 A;  1GUM A;  5KEJ A;  1ABA A;  4K7O A;  4G9H A;  3APS A;  2B3S A;  5ECI B;  2LQQ A;  3ISO A;  1FVK A;  4NPB A;  4K0N A;  1WRY A;  5ID2 A;  2LJA A;  5LD0 A;  1T8E B;  3HJM A;  1XVQ A;  2C8U A;  4PNG A;  4KDY A;  2JZS A;  4G2E A;  4HUA A;  2CZ2 A;  3Q19 A;  3TCO A;  4OFM A;  4MAB A;  1PMT A;  2LKU A;  2A4V A;  3H4K A;  1SJZ A;  2LST A;  1XVW A;  1AQX A;  1AUC A;  3QD9 A;  3F4T A;  2UZ8 A;  2EIQ A;  1NW2 A;  2IMF A;  1TKD B;  1SL1 B;  4TR4 A;  4V1A p;  18GS A;  2VCQ A;  3ZFL A;  2NPB A;  4CY6 A;  5HQP A;  2GT5 A;  3GSS A;  3HXS A;  5ELA A;  3UOM A;  3IHG A;  2C0E A;  5FWG A;  1OVN A;  1ZYP A;  2AB6 A;  3DEX A;  1EOG A;  2D2Z A;  2E7P A;  5AIX A;  4OO5 A;  3MYD A;  1GUL A;  5DAK B;  3KMN A;  4IN0 A;  2CV4 A;  2L6D A;  4JZQ A;  1O6J A;  3IHQ A;  5HR3 A;  2MBS A;  5CRD A;  5C04 A;  3FEU A;  5B6M A;  1O73 A;  3FZA A;  5CRG A;  1M0U A;  3ZFB A;  5G31 A;  4HDE A;  3GKX A;  4YKF A;  2RM6 A;  3O3T A;  5IMZ A;  3TJJ A;  2PBJ A;  1GSD A;  2GQM A;  3EIN A;  3QPM A;  3LJR A;  1FW1 A;  2DJ0 A;  3D4T A;  5DQY A;  3TKR A;  2AUV A;  1O8X A;  3DKS A;  1YF0 A;  4OMV A;  3VPT A;  4RI7 A;  4O32 A;  2H30 A;  3EYT A;  3MSZ A;  3HVS A;  4HJM A;  3DRN A;  4QQ7 A;  1GSE A;  2R0G A;  1BQ7 A;  3LYK A;  4YQM A;  4POM A;  6GST A;  1WJK A;  3KP9 A;  3GHA A;  2LUS A;  3L4N A;  1M9A A;  4ZB9 A;  3TJF A;  4G19 A;  1PN9 A;  1SD9 A;  3EE2 A;  2B1K A;  1X5D A;  22GS A;  3FYG A;  2XBI A;  2H6Z A;  2V1M A;  2WFC A;  5ECN B;  4P3Y B;  2YV9 A;  1XFL A;  4JED A;  2REM A;  3C7M A;  3TKS C;  1ST9 A;  3O76 A;  1TI3 A;  2QSI A;  2IMK A;  4JR6 A;  2DSA A;  5A4U A;  1F3B A;  2DC5 A;  4BL7 A;  2TRC P;  4OFT A;  3GH9 A;  2YAN A;  4PX1 A;  3EPT A;  5H5R A;  5IOW A;  1YDK A;  3CTF A;  3KXO A;  4J57 E;  1Z3E A;  3QFB C;  5IMF A;  5CRE A;  2KP1 A;  3P7X A;  4RQR A;  5AN1 A;  3A3T A;  1RQM A;  4MNN A;  4L5O A;  4JE1 A;  5FHI A;  3H1N A;  2IMI A;  3QAW A;  4FYU A;  2KHP A;  5ECP B;  5L71 A;  3V1W A;  2R5G A;  5IMA A;  3RPP A;  4MLY A;  3ERF A;  2G0F A;  4WEY A;  4DSR A;  4OCE A;  2E0Q A;  3G7J A;  5D8I A;  1TOF A;  2AYT A;  2B7K A;  4EO3 A;  3LW9 A;  4F0B A;  3TKQ A;  1MDJ A;  5AIV A;  3LYP A;  2KP2 A;  2I9H A;  2JU5 A;  3VK9 A;  2H6Y A;  3VPQ A;  1GNW A;  2QA2 A;  2IL3 A;  4DSS A;  1WPI A;  3QCP A;  2H0G A;  5ECL B;  1VF4 A;  4GTU A;  1OE8 A;  1OKT A;  3EVI A;  3ZVJ D;  1GSS A;  2H76 A;  1R5P A;  5KN2 A;  1M7T A;  2FA4 A;  5ECQ B;  1MTC A;  2FHE A;  1N8J A;  3H79 A;  3WGX A;  1O7U A;  2H8L A;  3ZTL A;  2CAI A;  1TP9 A;  4F9Z A;  3GH6 A;  4BVY A;  3GUS A;  2FWE A;  3M3M A;  2FNO A;  4JBB A;  2GVP A;  4EIP A;  4KA0 A;  4ECJ A;  2P31 A;  5J9B A;  3L9V A;  2OE1 A;  1DBY A;  2VCZ A;  4MH2 A;  2EC4 A;  4ML1 A;  1SJ6 A;  4GF0 A;  2H66 A;  1GRX A;  4ZXG A;  3Q74 A;  1SKR B;  1GUH A;  1E6B A;  3TB2 A;  4Q5F A;  2HSM A;  1YEX A;  4EE0 A;  3GIX A;  2F8A A;  1PKW A;  2LEG A;  1GL8 A;  5GST A;  1K0M A;  1XOA A;  1A23 A;  2VLV A;  2YCD A;  4BA7 A;  4Z2R A;  2I81 A;  3CRT A;  2A4H A;  4TR1 A;  1YJ6 A;  3QFA C;  3HHV A;  1A8Y A;  1MEK A;  5G30 A;  2RII A;  1UN2 A;  2PU9 C;  3DYR A;  2BTO T;  1E2Y A;  4MK3 A;  2YJ7 A;  1B9X C;  3TRQ A;  4YAP A;  2FUG 2;  2DJ2 A;  1AW9 A;  5HFG A;  3RAZ A;  3J7Y k;  3KMO A;  1HQO A;  3TRX A;  4K7I A;  4HEA 2;  5ENU A;  5ECR B;  2R2J A;  2PVQ A;  1SL2 B;  3IAM 2;  3TGZ A;  2FWH A;  5CRH A;  2DMM A;  2MMZ A;  3FHK A;  5INY A;  2CAQ A;  4BVX B;  4MZC A;  3GL3 A;  2C3N A;  5F07 A;  2HZE B;  1XW6 A;  3ZVJ A;  1G6W A;  4KDX A;  3TJK A;  5KN3 A;  1X9M B;  1XWK A;  1WOU A;  3I6A A;  4X0X A;  4MPF A;  3BBY A;  3ZLP A;  1NHO A;  3C8E A;  3H8Q A;  4V2N A;  1HNA A;  1F37 A;  3GTU A;  1PA3 A;  3DGQ A;  4POK A;  4O7H A;  2PWJ A;  3ED3 A;  3HY2 A;  1RK4 A;  4RUV A;  5JCG A;  4HOJ A;  1EEM A;  2GST A;  1H75 A;  1K3L A;  5FT3 A;  5D96 A;  1F2E A;  2X8C A;  3M8N A;  2O87 A;  2LJR A;  1GTI A;  2A2S A;  5BMU A;  2RUE A;  2YN1 A;  3F6D A;  1Y6E A;  3WYW A;  5KOX A;  4YQU A;  3NZN A;  5DAL B;  4WET A;  2G2Q A;  1GUK A;  3A5W A;  4POL A;  4IEL A;  4GRF A;  1MD3 A;  3KTB A;  2HSY A;  2CVK A;  2M46 A;  4WXT A;  3JCM L;  5IO2 A;  3BOA A;  4MJA A;  4I2T A;  2GZY A;  2IN3 A;  1R4W A;  2C80 A;  4X43 A;  2KOK A;  2LNT A;  1XWA A;  1FHE A;  4EIQ A;  1PQN A;  2K9F A;  4NHW A;  6GSX A;  3IPZ A;  3APO A;  5B7C A;  3LXZ A;  2I1U A;  4YH2 A;  3A2V A;  3BCI A;  3D0Z A;  4CY8 A;  3IC8 A;  4K5R A;  1M2D A;  3PIN A;  2HNL A;  1PGT A;  2CQ9 A;  1VGL A;  2QKE A;  3FY7 A;  4ZBD A;  4AGS A;  1GTU A;  3HJP A;  1K0C A;  3G9B A;  1TK0 B;  4LMW A;  1FVJ A;  2E2M A;  3IXR A;  2IFQ B;  3UL3 A;  2YNX A;  1GSY A;  5IQY A;  1GLQ A;  3OR5 A;  1VF1 A;  3RPN A;  2MMA A;  3MDK A;  9GSS A;  3APQ A;  4ZBB A;  2V41 A;  3VUR A;  4TW5 A;  2L57 A;  5A4V A;  17GS A;  4D73 A;  3F4S A;  1SK0 A;  1XIY A;  3KZQ A;  4WBR D;  4HZ2 A;  2GLR A;  2CA8 A;  2IMD A;  2L59 A;  3QMX A;  1THO A;  4TXV A;  6GSW A;  5JWQ B;  1UC7 A;  2HRA A;  1K3O A;  2M72 A;  2PVO C;  2KLX A;  1WE0 A;  4FO5 A;  4G0I A;  4K7N A;  5JCU A;  6GSU A;  1T1V A;  4WF4 A;  4XIH A;  2DLX A;  2CVD A;  5IMD A;  2H1D A;  3CRU A;  4GXZ A;  3U6V A;  4EVM A;  2GS3 A;  5IMV A;  5DVB A;  7GSS A;  2H1B A;  2VCV A;  3GRX A;  4NWY A;  3TJB A;  3TUE A;  1F3A A;  2MBT A;  1M9B A;  1FG4 A;  1UVZ A;  5ID2 B;  4ZB8 A;  3QR6 A;  1YQ1 A;  11GS A;  4EC0 A;  3G7Y A;  1XBS A;  4WBJ A;  5GAP D;  2V6K A;  1ML6 A;  3WD6 A;  4K1F A;  1BX9 A;  2C4J A;  2K18 A;  1QQ2 A;  3N5O A;  2KUC A;  3HVX A;  4DSQ A;  4KAE A;  1GP1 A;  3QOU A;  4WF5 A;  3FMW A;  2GQL A;  3ZMK A;  3KD0 A;  3EC3 A;  1SKW B;  2QC7 A;  4HI7 A;  2N5F A;  4G0L A;  1OC8 A;  2WCI A;  3LOR A;  1T4Y A;  2ZCT A;  5D93 A;  2J23 A;  5KN1 A;  2X99 A;  4TKY A;  1M99 A;  1N2A A;  1QUW A;  5J9C A;  2GGT A;  1LJR A;  4ACS A;  4EF0 A;  1LBK A;  4FH8 A;  2WDU A;  1KTE A;  3LGC A;  1WWJ A;  1JZD A;  2LRT A;  2P5R A;  4G10 A;  3KM6 A;  4XS4 A;  4DVC A;  3KP8 A;  1BYE A;  1TDI A;  2ZNM A;  3F63 A;  1MD4 A;  1PD2 1;  5DJL A;  1EP8 A;  3FR3 A;  4Z2U A;  1SL0 B;  3ZL5 A;  4HJ2 A;  1FOH A;  1Q4J A;  1GTB A;  3P90 A;  2HRK A;  2AV4 A;  4XHM A;  3HVV A;  5JWR B;  4AJ7 A;  4RQX A;  2GSS A;  3HD5 A;  1XPV A;  4KUN A;  4TN8 A;  3IV4 A;  2GT6 A;  4TVE A;  3FRC A;  4CW9 A;  5AIS A;  4XCS A;  5F05 A;  3CSH A;  1JLW A;  4TXO B;  2MYG A;  3IAS 2;  3UAR A;  4HQZ A;  2C3Q A;  4WR4 A;  1Y25 A;  5ECM B;  1ZCP A;  1M2A A;  4IW9 A;  3RDW A;  2XBQ A;  4ZL7 A;  3HJO A;  1GTA A;  3IOS A;  3UJ1 A;  3LSZ A;  3DXB A;  2JZR A;  4N11 A;  5G1L A;  4K9Z A;  4EDZ A;  3RHB A;  1ZYE A;  2WUL A;  4K8M A;  5G5F A;  1F6M C;  3CMI A;  3L9U A;  5CP1 A;  3D6I A;  3HCZ A;  2DKI A;  4IKH A;  5F0G A;  3MNG A;  4AJ6 A;  4BL7 B;  1TW9 A;  4N10 A;  1ZYN A;  3FZ5 A;  1ERU A;  4GST A;  2R6K A;  2H1G A;  4IS0 A;  3L78 A;  3KH7 A;  2DBC A;  4KCE A;  4FQU A;  4O5U A;  4FIW A;  5D9V A;  2RLI A;  5IMC A;  4V1A g;  4O5R A;  1R5A A;  3NOF A;  2B5X A;  1AAZ A;  1EV9 A;  1BJX A;  3GX8 A;  1TU7 A;  1TI1 A;  1FOV A;  1ON4 A;  1WMJ A;  1F9M A;  3F8U A;  4GLT A;  2VD1 A;  4H86 A;  3VI7 A;  5CYY A;  3ME7 A;  2F9S A;  4V2L A;  4IJ3 A;  4PQ1 A;  2CT6 A;  3IA1 A;  2FLS A;  2WJU A;  3GYK A;  13GS A;  1G0T A;  4RI6 A;  3W8S A;  4OWY A;  1QK8 A;  1X0R A;  4NXI A;  1A2L A;  2FD3 A;  3LEF A;  4YAV A;  1T4Z A;  4MCU A;  1DSB A;  3GKN A;  4JR4 A;  4HS1 A;  4ZBA A;  1I5G A;  5HR1 A;  2H1A A;  1PX6 A;  2OE3 A;  3DD3 A;  1WP0 A;  3FW2 A;  2H01 A;  1M2B A;  1R7H A;  2HT9 A;  3GFK A;  4MJC A;  5LCZ A;  1X9S B;  1JZO A;  2H72 A;  3N9J A;  1GH2 A;  3TKP A;  3WGD A;  1AXD A;  4GQF A;  4NV5 A;  4MF6 A;  3KJY A;  4Q5Q A;  2YZU A;  1U87 A;  3GMF A;  3PR8 A;  4IBP A;  2H73 A;  1SYR A;  4NHZ A;  4LMV A;  1AC1 A;  4V2M A;  1BG5 A;  4XS1 A;  5C00 A;  3VWV A;  2CX4 A;  2N5A A;  4HZ4 A;  4BVY B;  3S9F A;  1EZK A;  3BJ5 A;  3GST A;  3LG6 A;  1SD8 A;  3GX0 A;  1JFU A;  5F06 A;  4ZL9 A;  3IK7 A;  3C73 A;  3GNJ A;  5G1K A;  1H4O A;  2GTU A;  2FGX A;  2EIO A;  1V40 A;  3ZIT A;  3AY8 A;  1XOB A;  5D9X A;  4QL9 A;  1JHB A;  4OD7 A;  5IPH A;  2LJK A;  1QXH A;  4ULX A;  3TKS E;  1YEP A;  1A0R P;  1J9B A;  4K2D A;  4KE3 A;  3HA9 A;  4WR5 A;  12GS A;  4BWS A;  3M0F A;  3F0I A;  3KCM A;  5IOX A;  1JZR A;  3BCK A;  1QGV A;  5LNK e;  1B48 A;  5E4W A;  2DJ1 A;  2H70 A;  2JSZ A;  3ZRD A;  4OCF A;  2IME A;  1KBN A;  1B9Y C;  2ON7 A;  4GCI A;  2NBS A;  3FR6 A;  5IM9 A;  3L9S A;  1DUG A;  3VFI A;  2R0C A;  1XW5 A;  2DIZ A;  3VWU A;  1OC9 A;  4F82 A;  1X5E A;  1YF1 A;  2LS5 A;  5EVO A;  2HRF A;  4MJE A;  5ECH B;  10GS A;  2J9H A;  1USB A;  3UVT A;  2TIR A;  3EU3 A;  2ZUP A;  1EWX A;  5IO0 A;  4AF2 A;  3WT2 A;  2FWF A;  4YQV A;  2BJX A;  3D5J A;  2H6X A;  1SJI A;  1YKC A;  4MF5 A;  1OYJ A;  3NIV A;  1GSQ A;  2B1L A;  1X9W B;  3TOU A;  1QFN A;  5DBQ A;  3TDG A;  1I9D A;  4K2X A;  3HKR A;  2OAD A;  3UEM A;  3P8W A;  2HRN A;  2VM2 A;  3KTL A;  3GTU B;  2JAC A;  2PUK C;  3QAG A;  3ERG A;  5DAL A;  3IRA A;  2OE0 A;  1YZX A;  2ON5 A;  1NHY A;  2NTO A;  3EWL A;  3LXT A;  3GKK A;  3UMA A;  4EL1 A;  1Z7P A;  3G7I A;  2IIY A;  2VO4 A;  1PSQ A;  5EY6 A;  1B4Q A;  2K8S A;  1ZL9 A;  4J56 E;  4MZB A;  4JRR A;  8GSS A;  5B8A A;  2N5B A;  2AJQ B;  3RHC A;  2VUP A;  4I2U A;  3EUR A;  2PN8 A;  4IGJ A;  2B6M A;  3GA4 A;  2GZP A;  4KW6 A;  3C1R A;  5J3R A;  2VCW A;  1SK2 A;  2C0G A;  2CVB A;  3A5I A;  1W4V A;  4CDO A;  3RBT A;  5ECS A;  1HNB A;  4KSO A;  5KN0 A;  2L4C A;  5HFK A;  1SKS B;  1R26 A;  1PX7 A;  4PNF A;  3HZ4 A;  4FYB A;  3GN3 A;  5BRT A;  2R0P A;  2OJL A;  2R3X A;  1SYX A;  3W8J A;  1K0A A;  1ZZY A;  1TRS A;  2LNS A;  4PQH A;  5D9T A;  1AIU A;  2OA7 A;  3US3 A;  2L6C A;  3FZ9 A;  1NSW A;  1A2J A;  2R37 A;  4ZIJ A;  4ID0 A;  2NDO A;  2YP6 A;  1FAA A;  1TTZ A;  3PPU A;  2L4Q A;  1O81 A;  4D73 B;  5J5N A;  2V32 A;  5G5E A;  1T7P B;  2MMN A;  1OC3 A;  3UBL A;  1K3Y A;  5AGY A;  2GDR A;  2DKH A;  4MF7 A;  2X49 A;  3IDV A;  1A0F A;  1V57 A;  4KF9 A;  5EL8 A;  4I97 A;  1Z5Y E;  16GS A;  1O8W A;  3SBC A;  1V98 A;  1O85 A;  2AHE A;  3DVX A;  2I4A A;  4Q5R A;  4MA9 A;  3E9J B;  3GKM A;  4HU7 A;  3K8N A;  1FB6 A;  4JU5 A;  6GSV A;  2WGR A;  3CSI A;  4IHU A;  1DE1 A;  1QMV A;  5F8B A;  2YZH A;  5HFI A;  4F03 A;  1GNE A;  1K0N A;  4PQI A;  1K0B A;  2VD0 A;  1EP7 A;  4G0K A;  4ISD A;  2YWM A;  3GV1 A;  2TRX A;  5GSS A;  5H5Q A;  4LL4 B;  1PL2 A;  3PGT A;  5J4U A;  2X8G A;  1BAY A;  4N0V A;  2IWT A;  2P5Q A;  4J2F A;  2O7K A;  1JZW A;  1URM A;  2ES7 A;  1ILO A;  2L5L A;  1BED A;  3P2A A;  3LFL A;  3VWX A;  4GSN A;  1JLV A;  4KX4 A;  5DQS A;  4GSS A;  2VCT A;  3E0U A;  5JWO B;  4PGT A;  3CTG A;  2I3Y A;  5DAK A;  4EDY A;  4ECB A;  2QGV A;  1S3A A;  5IPG A;  3ERW A;  1U6T A;  3F4R A;  3TRP A;  2VOC A;  2CX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...