4NXIA

Rv2466c mediates the activation of tp053 to kill replicating and non-replicating mycobacterium tuberculosis
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
200
structure length
193
Chain Sequence
QKSVADFWFDPLCPWCWITSRWILEVAKVRDIEVNFHVMSLAILNENRREGMARAWGPVRVAIAAEQAHGAKVLDPLYTAMGNRIHNQGNHELDEVITQSLADAGLPAELAKAATSDAYDNALRKSHHAGMDAVGEDVGTPTIHVNGVAFFGPVLSKIPRGEEAGKLWDASVTFASYPHFFELKRTRTEPPQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Uncharacterized protein
publication title Rv2466c mediates the activation of TP053 to kill replicating and non-replicating Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 62
structure length 193
sequence length 200
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4nxiA00
4JEDA 4NV5A 1UA5A 5JWRB 4MH3A 3IC4A 1SKSB 1R7HA 2VCWA 4O32A 3N5OA 2JADA 1HNBA 5B6MA 1O6JA 3D21A 5B8BA 4TR0A 3TRPA 2IIYA 3LXTA 4YQVA 4LL4B 3IBHA 1GL8A 1WWJA 5G30A 1KBNA 3VFIA 1X5EA 4ML1A 1FVJA 2KUCA 3UBLA 2NBSA 1BQ7A 5AISA 4MF5A 3L9UA 1OC9A 5CNWA 3BD2A 5IPGA 2VAFA 1ERVA 2LRCA 3LWAA 2MMAA 3FHKA 3TOUA 2PVQA 1C72A 1OC3A 2C0FA 2TRXA 2AHEA 2N5AA 2F3MA 1S3AA 1YF1A 1F3BA 1MDIA 5CP1A 2V2GA 2ON5A 1HQOA 4POBA 4JR4A 3VI5A 5D9VA 2OKAA 1TK0B 1GSYA 4ZBBA 2YWIA 1GP1A 18GSA 3UVHA 2VL3A 4KW6A 5IOWA 1TDIA 2CZ2A 1SL0B 1O8XA 4D73B 1K0NA 4EC0A 2RM6A 5IPHA 2B5YA 1A0RP 2DJ3A 3I6AA 2E2MA 3O3TA 4FO5A 4V1Ap 3IOSA 4L5OA 2CVKA 2LSTA 1O7UA 3FKFA 3ISOA 1PL1A 5A4WA 3TJJA 2E2GA 1DBYA 3Q6OA 4KE3A 2V41A 4ECBA 3KTLA 4X0XA 1NSWA 3EWLA 1WP0A 5DVBA 2QC7A 2C4JA 3C71A 2B6MA 1UVZA 4HZ2A 2PWJA 3GV1A 4ZXGA 2LQOA 4TXVA 1O73A 2JL4A 1J9BA 2AYTA 2H6XA 3H93A 1H4OA 1GTBA 4DSSB 3ZMKA 5F07A 1TRVA 2YN1A 2GDRA 3E3EA 4XHMA 5HFIA 4XS4B 1R5PA 3SWLA 1JHBA 2GZPA 3DEXA 3F8UA 3IDVA 3O6TA 3TKSA 3CRUA 3TDGA 2HZFA 3H79A 1XWKA 3N9JA 3KXOA 2WFCA 1JZRA 3IXRA 1A0FA 1TI1A 3IAS2 3QMXA 12GSA 5DAKB 4PURA 4YQMA 4MDCA 5F0GA 3A2XA 3HYPA 4NMUA 1BAYA 4PGTA 1VF1A 1ACVA 1B8XA 3FR3A 4OMVA 5D8IA 2LKUA 2CX3A 3GRXA 1SJIA 1GSSA 2C1YA 3C8EA 3M9JA 1TTZA 5G1LA 3UEMA 5HQPA 1FAAA 3L78A 2R2JA 2YP6A 1ML6A 4EE0A 4TW5A 3QOUA 4F82A 1AIUA 3HJMA 2NTOA 2Z9SA 5IMVA 1TJDA 4IW9A 9GSSA 2LJKA 3PGTA 4PX1A 3TRXA 4EDZA 1JFUA 3HJOA 1FOVA 1PD21 1R26A 3FW2A 1IYHA 3LFLA 4YH2A 2QSIA 4JE1A 2O85A 4NAXA 2GSRA 1S3CA 3HJPA 2YJHA 4OFMA 4BVXA 2DBCA 3QPMA 3KEBA 4KGIA 3A2VA 4PNGA 1OAZA 3GUSA 1GNWA 3CSHA 2VD0A 1F9MA 2YANA 2GVPA 1O8WA 4HJ2A 5JWQB 3FZAA 3APOA 5KN3A 1M2DA 1YDKA 3LXZA 2H1GA 1AQVA 3TKRA 5A5KA 3IR4A 2QKEA 1AAZA 2IFQA 3IPZA 3ZZXA 1Q98A 2B1LA 2GGTA 4Q5RA 2H0GA 2JU5A 1T00A 5B7CA 3GKNA 5CRGA 4TOPA 4NXIA 3EINA 3AY8A 2H76A 3UL3A 1X9WB 2MMNA 1OE7A 4F0CA 14GSA 2LV3A 1WPIA 5ELGA 3HZ4A 17GSA 1K0OA 1A8YA 4QL9A 4MLYA 2LJRA 1E6BA 5ECOB 4QQ7A 4IP6A 4GQFA 2GQKA 4AGSA 1EOGA 4PQ1A 2GTUA 1XW6A 3CYNA 2DIZA 2H6YA 4I5QA 1FB0A 2YJ7A 4KA0A 5ECLB 2FWHA 3UMAA 2HSHA 1SYXA 1XCCA 1X0RA 1M9AA 4POMA 5ECIB 3TJFA 2V6KA 4MJBA 1Z6MA 2L5LA 3FZ9A 2H72A 1GTAA 3O76A 1ERWA 3LORA 1Q4JA 3KJYA 3QDNA 4GSNA 4TRXA 4BWQA 2ZNMA 2HFDA 2YWNA 3D5JA 5LD0A 5HFKA 2DJJA 4JR6A 3KM6A 1THOA 4MCUA 1EV4A 3GYKA 2VCTA 5KN2A 2HYXA 2MZCA 6GSVA 2AAWA 3IK7A 4TR4A 1BJXA 2LEGA 4HUAA 1VGLA 2XHFA 2I3YA 1XXUA 22GSA 3CTFA 3HDCA 4WF4A 1TOFA 3KH9A 1ZOFA 4MF6A 4WETA 3RDWA 2R5GA 1THXA 1A23A 2I81A 5FT3A 4IP1A 4NV2A 2LNTA 1DSBA 2I1UA 3IAM2 1B4QA 5AGYA 3HVXA 1OC9B 4O92A 2H30A 4ZBAA 4PXOA 2FWEA 3KMOA 4WXTA 3HCZA 5J41A 2WRTA 2LRTA 2LQQA 3F3QA 1MD4A 3MNGA 1XWCA 3HVVA 1GRXA 3WT2A 4X43A 1XWBA 2CV4A 2K18A 2N5BA 3D0ZA 2WZ9A 1TXXA 3UJ1A 3F6DA 3IV4A 1YEPA 1WJKA 3FZ4A 3PINA 3Q74A 2OE3A 1G7OA 1B9YC 2ZUPA 1A24A 4LLRA 4PQHA 2H0HA 2FA4A 2VLUA 1K3OA 4IN0A 1OKTA 2ALBA 3BCKA 3JCML 2V32A 2H74A 3DXBA 1K3YA 2IMEA 5ECSA 1JLVA 3J7Yk 3KIJA 2P0GA 5H5RA 3LYKA 1DE2A 2P5QA 4KDYA 3KTBA 5EY6A 1EP7A 3GSSA 1K3LA 2H19A 5ID2A 2G2QA 4XRDA 1T4YA 1GSQA 2PU9C 2F9SA 2AJQB 4IKHA 5DALA 1QXHA 4ILFA 2YWMA 4DSRA 1PQNA 4JRRA 2YV7A 2HE3A 5DCGA 2C80A 6GSSA 3TJKA 5HR2A 2VUPA 4DVCA 1WE0A 1FO5A 4G2EA 4PQIA 3W8JA 5ECMB 2MMOA 5HR3A 3CMIA 4KCAA 2HT9A 8GSSA 1T4ZA 4KUNA 3F63A 4Q5FA 5G5FA 1M0UA 2FWFA 2L4CA 4NPBA 5EPFA 1AW9A 1LJRA 16GSA 4WF5A 1DE1A 1NW2A 1TRWA 1X5CA 4V2NA 3GH6A 4ID0A 3PH9A 2IWTA 4F03A 3EMPA 1TI3A 4G19A 6GSXA 2VL9A 1B4PA 3M1GA 1VF4A 3RBTA 3UAPA 4EUYA 4BVYA 4TR1A 4ZB8A 3RHCA 1SD9A 1YY7A 4L8EA 3I69A 4G10A 5F05A 4BA7A 1YQ1A 4CW9A 4EVMA 2FCHA 3DGQA 3WYWA 4V1Ag 2F51A 4K7IA 2CAQA 5IMCA 1GUHA 3H8QA 4JBBA 1KEBA 4IVFA 1WIKA 1M2AA 3CSIA 2TRCP 3KZQA 3KH7A 2PERA 4I2TA 1Z7PA 2V6OA 4ZB9A 1ERTA 2RIIA 2OJLA 4WR4A 2CX4A 2X8GA 3ZIJA 2PGTA 2YZUA 2HZEA 5FHIA 3EE2A 2M80A 3WT1A 2HXKA 4N0ZA 1G7EA 4BPYA 3GX0A 3ZVJD 1SJZA 2E7PA 4HU7A 5CYYA 4NHWA 2YWOA 4ISDA 5DDLA 4NWYA 3KP8A 5IMAA 3DMLA 1YF0A 3UIWA 5G5EA 3L0HA 3GKXA 3VWVA 2IFQB 2VO4A 1MDJA 3KMNA 1GTIA 5HR1A 4EXJA 2VLTA 1USBA 2OA7A 3CTGA 3LQ7A 2EIOA 2YZHA 3EU3A 5F8BA 4OCEA 1BYEA 2H71A 2REMA 3FR6A 3F3RA 1SD8A 2WULA 2VL2C 5J9BA 1PKZA 4BL7A 4XS1A 2CAIA 3TJGA 4HS1A 2ES7A 2FHEA 3CXGA 1SJ6A 4WBRD 3ZITA 2B3SA 4V2LA 1XZOA 4HI7A 3D6IA 5IO0A 4RUVA 4ULXA 3VK9A 4POKA 4WR5A 3RHBA 1OC8A 1K0BA 1AUCA 2LJAA 4AJ6A 2F8AA 4FYCA 1F6MC 3IHQA 2DJ0A 1GUMA 3G7JA 3VPTA 1QQ2A 1MDKA 3KP9A 4MK3A 4KX4A 4GQCA 1N2AA 2OADA 4IQAA 3M3MA 1RW1A 1Y25A 3ZFBA 4K7OA 2OACA 1OVNA 4G9HA 4IGJA 3APSA 4RQXA 5A4UA 3S9FA 1HNAA 4HOJA 2VM1A 1OYJA 1IYIA 2L4QA 5ENUA 6GSYA 4IBPA 2HI7A 2CT6A 5CREA 1TK8B 3GX8A 3P7XA 5G2ZA 1ZYEA 1V40A 1NHOA 4I8BA 4AJ8A 4N0VA 5B6NA 4TVEA 2A2RA 3WGEA 3QAGA 3QD9A 3DKSA 1SKWB 2GZZA 2DJKA 2R6KA 1PX7A 3DWVA 3M8NA 3U6VA 2L5OA 5JCGA 4ZIJA 1FG4A 1K0CA 3TOTA 2L6CA 2KOKA 1PL2A 4MA9A 2L6DA 3L9SA 1AXDA 1EOHA 2MMZA 13GSA 3VWXA 1B48A 3ZIVA 4K2DA 2FLSA 5ELAA 4LMWA 1H75A 3ZL5A 1OKDA 1QFNA 4IS0A 2KP1A 2XPEA 3HD5A 2PMTA 3J7Yb 2YPMA 5GZZB 3NZNA 3US3A 1A2LA 3A3TA 3W6GA 1DUGA 1SL2B 1ZCPA 4ACSA 2CVDA 1GH2A 3R2QA 1X9SB 1Z6NA 1PA3A 4WKWA 3ED3A 3LYPA 4MJAA 1GTUA 4ZL9A 3TUEA 4OFNA 5ECNB 3W8SA 2C0DA 1BEDA 4JZQA 2OBKA 3HA9A 4PUFC 4L0UA 2M46A 3A5WA 3HVSA 2VCVA 2FGXA 1GNEA 2C3TA 4ZILA 3DRNA 3I43A 5DCHA 1UC7A 2KLXA 7GSSA 1XOBA 4K0GA 1GSDA 4X1UA 4MZCA 3DIEA 3HXSA 1LU4A 1SK0A 3GKKA 4ECJA 3TKQA 2NDOA 1A2MA 2P5RA 1LBKA 2ON7A 4TXOA 4AJ7A 3VURA 2H6ZA 3BJ5A 2HSYA 4TN8A 5ID2B 1XWGA 2GSSA 3MWHA 2I4AA 4N30A 5DJMA 2IPAA 2NPBA 5J5NA 2YOIA 2CQ9A 1WRYA 3DYRA 4GSTA 3MAKA 4MABA 3IK9A 1FHEA 5DALB 2IN3A 3LGCA 4P3YB 3G9BA 4ML6A 1ABAA 1J0FA 2EC4A 3G7YA 2M72A 3P90A 5HR0A 4PUAA 1NHYA 5ABRA 2JACA 2H01A 2CA8A 3KGKA 2H66A 2VIMA 1M9BA 1HNCA 2FUG2 4GF0A 3HZ8A 3UVTA 3E9JB 3D4TA 2H75A 3ZFLA 4YAVA 2BTOT 2MBTA 5C04A 3KD0A 1T8EB 4H86A 1XIYA 4XTSA 5CRDA 1XPVA 3GKMA 5EVOA 3UARA 2PBJA 4MZWA 3VI7A 5J4UA 3ME8A 3P2AA 2GQLA 1AC1A 1GWCA 3ZMLA 1GUKA 4J56E 1K0MA 5D73A 3NIVA 1XW5A 4MZBA 4FYUA 5L71A 4OCFA 5INYA 3EURA 4TR1B 4K0NA 1MEKA 1XOAA 1U3IA 3ERWA 4J57E 1V2AA 4K7NA 2DMLA 5DQSA 1N8JA 4CHSA 2C0EA 2FNOA 3MSZA 3L4NA 5C00A 5IQYA 1X5DA 1XBSA 1Z5YE 2J9HA 1W4VA 5E4WA 1U87A 3GHAA 6GSTA 2IJYA 1HD2A 3FR9A 4RI7A 4V2MA 1W89A 1JZWA 2H1BA 1URMA 2XBQA 1MTCA 1PN9A 2WJUA 4O5RA 3LG6A 2RUEA 1F2EA 2RM5A 3C73A 1EGOA 1BX9A 4KH7A 4GRFA 2HZEB 4EDYA 5B8AA 2E0QA 4GTUA 3GNJA 3GH9A 1FW1A 1U3AA 2GT5A 1G6WA 3WD6A 1G0TA 2AB6A 2WS2A 1ZGNA 3NOFA 1T3BA 4IHUA 3FRCA 1ILOA 1HYUA 2HRNA 3M0FA 3CSJA 2O87A 3CBUA 1Z7RA 4MF7A 2L59A 1VF2A 4GXZA 4PNFA 2LS5A 2IMFA 1O81A 3GTUA 5D93A 1A8LA 4HJMA 5ECPB 1PMTA 3G7IA 2MBSA 3LJRA 2FA8A 5CAXA 2K8VA 3F6FA 3DD3A 5ECRB 4K9ZA 2XBIA 3C1SA 3F4SA 2B1KA 1A2JA 1RK4A 3PR8A 4KDUA 1J08A 5JCWA 3QFAC 1PGTA 3HY2A 1Z9HA 4ECCA 3EVIA 1Z3EA 3GN3A 2V1MA 3IE3A 2A2SA 5AIXA 1CQHA 2GSQA 2CZ3A 5LCZA 1AQWA 3FYGA 2B7JA 3D22A 5AIVA 5J9CA 2VLVA 2YV9A 3Q18A 4LL1B 2IL3A 4KB3A 1M2BA 2H1AA 2PVOC 1TKDB 1M99A 2H1DA 3GURA 3U5RE 4N10A 4J2FA 5IMFA 1SENA 3EU4A 4F2IA 1XFLA 1YKCA 4MH2A 5GAND 1TU7A 2GS3A 3F4RA 2C8UA 2B5XA 2FY6A 1K0DA 5IOXA 2RUFA 2CVBA 2KHPA 4GCIA 3FK8A 5ECQB 1GULA 2F8FA 4F0BA 1TRUA 6GSUA 5A4VA 4RI6A 2TIRA 4NHZA 4OO5A 1YJ6A 2O8VB 2H0IA 11GSA 3GL5A 2VD1A 4IJ3A 3DVWA 1G6YA 5IMDA 4L5LA 3BOAA 3F4TA 4EF0A 1WOUA 4OWYA 5IIZA 1V58A 1XW9A 1F3AA 3HHVA 4JU5A 1OE8A 2WDUA 3TKPA 2GSTA 4AF2A 1R4WA 6GSWA 4N11A 2HRFA 1V57A 2VL2A 2LUSA 2O7KA 2OE1A 1MD3A 5AN1A 3VLNA 10GSA 3QAWA 1S3DA 2JSZA 2WGRA 4HQSA 2KP2A 4TKYA 4LMVA 3H4KA 5D9XA 2PPTA 3IA1A 2OBIA 2I9HA 3FEUA 4HU9A 5FWGA 5DBQA 2K9FA 1SKRB 1SYRA 4DSQA 4F9ZA 2XC2A 4I2UA 4E8EA 3ZLPA 3OR5A 5H5SA 4MJCA 1TP9A 3F0IA 3ZRDA 3TKSC 4KSMA 1EZKA 2C3NA 3GMFA 1T1VA 2R3XA 1SL1B 3GIXA 4D73A 4QL7A 2RLIA 1EEJA 4FH8A 2WB9A 1JLWA 2JZTA 5G1KA 1YZXA 2VCXA 5GAPD 1GSUA 3ZVJA 3VWWA 3I9V2 4E8HA 2R37A 3UOMA 4EL1A 1TU8A 2O89A 3WGDA 4RQRA 3TGZA 4HZ4A 1Y6EA 4MPFA 1ON4A 3ZREA 2QGVA 1VF3A 4K1FA 5HFGA 4FIWA 4KDXA 3TRQA 2GQMA 5JWOB 2C3QA 4YAPA 4IJIA 4EO3A 3TCOA 1YKAA 3E0UA 2OE0A 2LTKA 5DQYA 5GSSA 1EV9A 1BG5A 1ZYQB 4DSSA 1K0AA 4HQZA 2FWGA 2AUVA 1V98A 4TXOB 1V9WA 1F37A 4IQ1A 3QFBC 3EYTA 4XS4A 3Q19A 2GLRA 3SBCA 20GSA 1O85A 1JZOA 1PRXA 2X99A 1GLPA 1U88A 3QR6A 2G0FA 5D9WA 4Q5NA 2J23A 1AQXA 4EKZA 3C1RA 1EWXA 1GLQA 5DAKA 4LA1A 3VWUA 2IMKA 1GSEA 3GSTA 2AV4A 3F9UA 4Z7XA 5D9TA 2HLSA 5JCUA 5DJLA 1ZL9A 3GL3A 1QGVA 2JZRA 3MDKA 3RPNA 4WEYA 3ME7A 4XRAA 5GSTA 2VM2A 2X8CA 2VCQA 3RPPA 1QK8A 2N5FA 3BCIA 4YQUA 2XPDA 1ZZYA 4HEA2 4Q5QA 1FVKA 2X8HA 4ZL8A 3M9KA 5G31A 2HNLA 2DIYA 3QAVA 1I9DA 2YCDA 4MJEA 1ZMAA 1RQMA 3IRAA 5IO2A 2LNSA 1QUWA 4GSSA 4ZL7A 1M7TA 2DC5A 3GFKA 3QCPA 5IM9A 4OFTA 3TKSE 1X9MB 2JZSA 2X64A 1JZDA 3A2WA 5CRHA 1PKWA 5ECKB 2L57A 4L0WA 3UBKA 2K6VA 4KSOA 3K8NA 4GLTA 4K8MA 4O7HA 2IMIA 2B7KA 2DJ2A 5E59A 3DVXA 3V1WA 1GSFA 1WMJA 5KN0A 2EIRA 3GA4A 5D96A 4ZB6A 2DLXA 5EL8A 1R5AA 3HKRA 2P31A 4MPGA 4ECIA 1CQGA 3BBYA 2WCIA 4K6XA 2K8SA 2PUKC 1SK1A 4KAEA 2LRNA 4BWSA 2H73A 3VPQA 4WBJA 3RAZA 2H70A 1U6TA 3TJBA 3D4MA 1PX6A 1XWAA 2EIQA 5COHA 1VRSD 5KN1A 2MYGA 3LEFA 3ZYWA 1TK5B 1PSQA 3L9VA 2B5EA 4HDEA 5F06A 3ZTLA 3P8WA 4CDOA 2GZYA 1EGRA 4IELA 2FD3A 2BMXA 2YNXA 3KCMA 4I6XA 3WGXA 5H5QA 3GTUB 4GWRA 5IMZA 1YEXA 5CRWA 1XVQA 2BJXA 4OO4A 4DEJA 1ERUA 1TW9A 4XCSA 1EEMA 5LNKe 4XIHA 3EMXA 1SK2A 4XS6A 3EC3A 2C0GA 2VOCA 1I5GA 1TRSA 5ECHB 2IMDA 2VCZA 3C7MA 4ZBDA 1EP8A 5CO3A 3TB2A 1FB6A 3ERFA 2ZCTA 4POLA 5J3RA 3ERGA 4MP4A 1XVWA 3FY7A 3APQA 1NM3A 2PN8A 3FZ5A 4MMMA 2R4VA 2H8LA 4I97A 1B9XC 1E2YA 2A4VA 3LSZA 4TR3A 4KNDA 4OD7A 2DJ1A 1KTEA 2DSAA 1KNGA 1QMVA 2JSYA 5KEJA 2GT6A 1T7PB 19GSA 1ST9A 1SU9A 3CRTA 3H1NA 2NVLA 1UN2A 2D2ZA 4FYBA 2DMMA 4KCEA
chains in the Genus database with same CATH superfamily
4JEDA 4NV5A 1UA5A 5JWRB 4MH3A 3IC4A 1SKSB 1R7HA 2VCWA 4O32A 3N5OA 2JADA 1HNBA 5B6MA 1O6JA 3D21A 5B8BA 4TR0A 3TRPA 2IIYA 3LXTA 4YQVA 4LL4B 3EPTA 3IBHA 1GL8A 1WWJA 5G30A 1KBNA 3VFIA 1X5EA 4ML1A 1FVJA 2KUCA 3UBLA 2NBSA 1BQ7A 5AISA 4MF5A 3L9UA 1OC9A 5CNWA 1FOHA 3BD2A 5IPGA 2VAFA 1ERVA 2LRCA 3LWAA 2MMAA 3FHKA 3TOUA 2PVQA 1C72A 1OC3A 2C0FA 2TRXA 2AHEA 2N5AA 2F3MA 1S3AA 1YF1A 1F3BA 1MDIA 5CP1A 2V2GA 2ON5A 1HQOA 3MYDA 4POBA 4JR4A 3VI5A 5D9VA 2OKAA 1TK0B 1GSYA 4ZBBA 2YWIA 1GP1A 18GSA 3UVHA 2VL3A 4KW6A 5IOWA 1TDIA 2CZ2A 1SL0B 1O8XA 4D73B 1K0NA 2HRKA 4EC0A 2RM6A 5IPHA 2B5YA 1A0RP 2DJ3A 1ZYPA 3I6AA 2E2MA 3O3TA 4FO5A 4V1Ap 3IOSA 4L5OA 2CVKA 2LSTA 1O7UA 3FKFA 3ISOA 1PL1A 5A4WA 3TJJA 2E2GA 1DBYA 3Q6OA 4KE3A 2V41A 4ECBA 3KTLA 4X0XA 1NSWA 3EWLA 1WP0A 5DVBA 2QC7A 2C4JA 3C71A 2B6MA 1UVZA 4HZ2A 2PWJA 3GV1A 4ZXGA 2LQOA 4TXVA 1O73A 3LW9A 2JL4A 4CY8A 1J9BA 2AYTA 2H6XA 3H93A 1H4OA 1GTBA 4DSSB 3ZMKA 5F07A 1TRVA 2YN1A 2GDRA 3E3EA 4XHMA 5HFIA 4XS4B 1R5PA 3SWLA 3HVNA 1JHBA 2GZPA 3DEXA 3F8UA 3IDVA 3O6TA 3TKSA 3CRUA 3TDGA 2HZFA 3H79A 1XWKA 3N9JA 3KXOA 2WFCA 1JZRA 3IXRA 1A0FA 1TI1A 3IAS2 3QMXA 12GSA 5DAKB 4PURA 4YQMA 4MDCA 5F0GA 3A2XA 3HYPA 4NMUA 1BAYA 4PGTA 1VF1A 1ACVA 1B8XA 3FR3A 4OMVA 5D8IA 2LKUA 2CX3A 3GRXA 1SJIA 1GSSA 2C1YA 3C8EA 3M9JA 1TTZA 5G1LA 3UEMA 5HQPA 1FAAA 3L78A 2R2JA 2YP6A 1ML6A 4EE0A 4TW5A 3QOUA 4F82A 1AIUA 3HJMA 2NTOA 2Z9SA 5IMVA 1TJDA 4IW9A 9GSSA 2LJKA 3PGTA 4PX1A 2A2PA 3TRXA 4EDZA 1JFUA 3HJOA 1FOVA 1PD21 1R26A 2QA2A 3FW2A 1IYHA 3LFLA 4YH2A 2QSIA 4JE1A 2O85A 4NAXA 2GSRA 1S3CA 3HJPA 2YJHA 4OFMA 4BVXA 2DBCA 3QPMA 3KEBA 4KGIA 3A2VA 4PNGA 1OAZA 3GUSA 1GNWA 3CSHA 2VD0A 1F9MA 2YANA 2GVPA 1O8WA 4HJ2A 5JWQB 3FZAA 3APOA 5KN3A 1M2DA 1YDKA 3LXZA 2H1GA 1AQVA 3TKRA 5A5KA 3IR4A 2QKEA 1AAZA 2IFQA 3IPZA 3ZZXA 3CQFA 1Q98A 2B1LA 2GGTA 4K2XA 4Q5RA 2H0GA 2A4HA 2JU5A 1T00A 5B7CA 3GKNA 5CRGA 4TOPA 4KF9A 4NXIA 3EINA 3AY8A 2H76A 3UL3A 1X9WB 2MMNA 1OE7A 4F0CA 14GSA 2LV3A 1WPIA 5ELGA 3HZ4A 17GSA 1K0OA 1A8YA 4QL9A 4MLYA 2LJRA 1E6BA 5ECOB 4QQ7A 4IP6A 4USSA 4GQFA 2GQKA 4AGSA 1EOGA 4PQ1A 2GTUA 1XW6A 3CYNA 2DIZA 2H6YA 4I5QA 1FB0A 2YJ7A 4KA0A 5ECLB 2FWHA 3UMAA 2HSHA 1SYXA 1XCCA 1X0RA 1M9AA 4POMA 5ECIB 3TJFA 2V6KA 4MJBA 1Z6MA 2L5LA 3FZ9A 2H72A 1GTAA 3O76A 1ERWA 3LORA 1Q4JA 3KJYA 4O5UA 3QDNA 4GSNA 4TRXA 4BWQA 2ZNMA 2HFDA 4MNNA 2YWNA 3D5JA 5LD0A 5HFKA 2DJJA 4JR6A 3KM6A 1THOA 4MCUA 2HRAA 1EV4A 3GYKA 2VCTA 5KN2A 2HYXA 2MZCA 6GSVA 2AAWA 3IK7A 4TR4A 1BJXA 2LEGA 4HUAA 1VGLA 2XHFA 4PTSA 2I3YA 1XXUA 22GSA 3CTFA 3HDCA 4WF4A 1TOFA 3KH9A 1ZOFA 4MF6A 4WETA 3RDWA 2R5GA 1THXA 1A23A 2I81A 5FT3A 4IP1A 4NV2A 2LNTA 1DSBA 2I1UA 3IAM2 1B4QA 5AGYA 3HVXA 1OC9B 4O92A 2H30A 4ZBAA 4Z2TA 4PXOA 2FWEA 3KMOA 4YKFA 4WXTA 4A5PA 3HCZA 5J41A 2WRTA 2LRTA 2LQQA 3F3QA 1MD4A 3MNGA 1XWCA 3HVVA 1GRXA 3WT2A 4X43A 1XWBA 2CV4A 2K18A 2N5BA 3D0ZA 2WZ9A 1TXXA 3UJ1A 3F6DA 3IV4A 1YEPA 3A5IA 1WJKA 3FZ4A 3PINA 3Q74A 2OE3A 1G7OA 1B9YC 2ZUPA 1A24A 4LLRA 4PQHA 2H0HA 2FA4A 2VLUA 1K3OA 4IN0A 1OKTA 2ALBA 3BCKA 3JCML 2V32A 2H74A 3DXBA 1K3YA 2IMEA 5ECSA 1JLVA 3J7Yk 3KIJA 2P0GA 5H5RA 3LYKA 1DE2A 2P5QA 4KDYA 3KTBA 5EY6A 1EP7A 3GSSA 1K3LA 2H19A 5ID2A 2G2QA 4XRDA 1T4YA 1GSQA 2PU9C 2F9SA 2X49A 2AJQB 4IKHA 5DALA 3R3EA 1QXHA 4ILFA 2YWMA 4DSRA 1PQNA 4JRRA 2YV7A 2HE3A 5DCGA 2C80A 6GSSA 3TJKA 5HR2A 2VUPA 4DVCA 1WE0A 1FO5A 4G2EA 4PQIA 3W8JA 5ECMB 2MMOA 5HR3A 3CMIA 4KCAA 2HT9A 8GSSA 1T4ZA 4KUNA 3F63A 4Q5FA 5G5FA 1M0UA 2FWFA 2L4CA 4NPBA 5EPFA 1AW9A 1LJRA 16GSA 4WF5A 1DE1A 1NW2A 1TRWA 1X5CA 4V2NA 3GH6A 4ID0A 3PH9A 2IWTA 4F03A 3EMPA 1TI3A 4G19A 6GSXA 2VL9A 1B4PA 3M1GA 1VF4A 3RBTA 3UAPA 4EUYA 4BVYA 4TR1A 4ZB8A 3RHCA 1SD9A 1YY7A 4L8EA 3I69A 4G10A 5F05A 4BA7A 1YQ1A 4CW9A 4EVMA 2FCHA 4FQUA 3DGQA 3WYWA 4V1Ag 2F51A 4K7IA 4Z2UA 2CAQA 5IMCA 1GUHA 3H8QA 4JBBA 1KEBA 4IVFA 1WIKA 1M2AA 3CSIA 2TRCP 3KZQA 3KH7A 2PERA 4I2TA 1Z7PA 2V6OA 4ZB9A 1ERTA 2R0PA 2RIIA 2OJLA 4WR4A 2CX4A 2X8GA 3ZIJA 2PGTA 2YZUA 2HZEA 5FHIA 3EE2A 2M80A 4BVXB 3IC8A 2HXKA 3WT1A 4N0ZA 1G7EA 4BPYA 3GX0A 3ZVJD 1SJZA 2E7PA 4HU7A 5CYYA 4NHWA 2YWOA 5BMUA 4ISDA 5DDLA 4NWYA 3KP8A 5IMAA 3DMLA 1YF0A 3UIWA 5G5EA 3L0HA 3GKXA 3VWVA 2IFQB 2VO4A 1MDJA 3KMNA 1GTIA 5HR1A 4EXJA 2VLTA 1USBA 2OA7A 3CTGA 3LQ7A 2EIOA 2HSMA 2YZHA 3EU3A 5F8BA 4OCEA 1BYEA 2H71A 2REMA 3FR6A 3F3RA 1SD8A 2WULA 2VL2C 5J9BA 1PKZA 4BL7A 2DKHA 4XS1A 2CAIA 3TJGA 4HS1A 2ES7A 2FHEA 3CXGA 1SJ6A 4WBRD 3ZITA 2B3SA 4V2LA 1XZOA 4HI7A 4K5RA 3D6IA 5IO0A 4RUVA 4ULXA 3VK9A 4POKA 5KOXA 2R0GA 4WR5A 3RHBA 1OC8A 1K0BA 1AUCA 2LJAA 4AJ6A 2F8AA 4FYCA 1F6MC 3IHQA 2DJ0A 1GUMA 3G7JA 3VPTA 1QQ2A 1MDKA 3KP9A 4MK3A 4KX4A 4GQCA 1N2AA 2OADA 4IQAA 3M3MA 1RW1A 1Y25A 3ZFBA 4K7OA 2OACA 1OVNA 4G9HA 4IGJA 3APSA 4RQXA 5A4UA 3S9FA 1HNAA 4HOJA 2VM1A 1OYJA 1IYIA 2L4QA 5ENUA 6GSYA 4IBPA 2HI7A 2CT6A 5CREA 1TK8B 3GX8A 3P7XA 5G2ZA 1ZYEA 1V40A 1NHOA 4CY6A 4I8BA 4AJ8A 4N0VA 5B6NA 4TVEA 2A2RA 3WGEA 3QAGA 3QD9A 3DKSA 1SKWB 2GZZA 2DJKA 2R6KA 1PX7A 3DWVA 3M8NA 3U6VA 2L5OA 1M3JA 5JCGA 4ZIJA 1FG4A 1K0CA 3TOTA 2L6CA 2KOKA 1PL2A 4MA9A 2L6DA 3L9SA 1AXDA 1EOHA 2MMZA 13GSA 3VWXA 1B48A 3ZIVA 4K2DA 2FLSA 5ELAA 4LMWA 1H75A 3ZL5A 1OKDA 1QFNA 4IS0A 2KP1A 2XPEA 3HD5A 2PMTA 3J7Yb 2YPMA 5GZZB 3NZNA 3US3A 1A2LA 3A3TA 3W6GA 1DUGA 1SL2B 1ZCPA 4ACSA 2CVDA 1GH2A 3R2QA 1X9SB 1Z6NA 1PA3A 4WKWA 3ED3A 3LYPA 4MJAA 1GTUA 4ZL9A 3TUEA 4OFNA 5ECNB 3W8SA 2C0DA 1BEDA 2UZ8A 4JZQA 2OBKA 3HA9A 4PUFC 4L0UA 2M46A 3A5WA 3HVSA 2VCVA 2FGXA 1GNEA 2C3TA 4ZILA 3DRNA 3FMWA 3I43A 5DCHA 1UC7A 2KLXA 7GSSA 1XOBA 4K0GA 1GSDA 4X1UA 4MZCA 3DIEA 3HXSA 1LU4A 1SK0A 3GKKA 4ECJA 3TKQA 2NDOA 1A2MA 2P5RA 1LBKA 2ON7A 4TXOA 4AJ7A 3VURA 2H6ZA 3BJ5A 2HSYA 4TN8A 5ID2B 1XWGA 2GSSA 3MWHA 2I4AA 4N30A 5DJMA 2IPAA 2NPBA 5J5NA 2YOIA 2CQ9A 1WRYA 3DYRA 4GSTA 3MAKA 4MABA 3IK9A 1FHEA 5DALB 2IN3A 3LGCA 4P3YB 3G9BA 4ML6A 1ABAA 1J0FA 2EC4A 3G7YA 2M72A 3P90A 5HR0A 4PUAA 1NHYA 5ABRA 2JACA 2H01A 2CA8A 3KGKA 2H66A 2VIMA 1M9BA 1HNCA 2FUG2 4GF0A 3HZ8A 3UVTA 3E9JB 3D4TA 2H75A 3ZFLA 4YAVA 2BTOT 2MBTA 5C04A 3KD0A 1T8EB 4H86A 1XIYA 4XTSA 5CRDA 1XPVA 3GKMA 5EVOA 3UARA 2PBJA 4MZWA 3VI7A 5J4UA 3ME8A 3P2AA 2GQLA 1AC1A 1GWCA 3ZMLA 1GUKA 4J56E 1K0MA 5D73A 3NIVA 1XW5A 4MZBA 4FYUA 5L71A 4OCFA 5INYA 3EURA 3MIXA 4BVYB 2DKIA 4TR1B 4K0NA 1MEKA 1XOAA 1U3IA 3ERWA 4J57E 1V2AA 4K7NA 2DMLA 5DQSA 1N8JA 4HSCX 4CHSA 2C0EA 2FNOA 3MSZA 3L4NA 5C00A 5IQYA 1X5DA 1XBSA 1Z5YE 2J9HA 1W4VA 5E4WA 1U87A 3GHAA 6GSTA 2IJYA 1HD2A 4V2MA 3FR9A 4RI7A 3IHGA 1W89A 1JZWA 2H1BA 2X4AA 1URMA 2XBQA 1MTCA 1PN9A 2WJUA 4O5RA 3LG6A 2RUEA 4BIKA 1F2EA 2RM5A 3C73A 1EGOA 1BX9A 4KH7A 1XG8A 4GRFA 2HZEB 4EDYA 5B8AA 2E0QA 4GTUA 3GNJA 3GH9A 1FW1A 1U3AA 2GT5A 1G6WA 3WD6A 1G0TA 2AB6A 4K5SA 2WS2A 1ZGNA 3NOFA 1T3BA 4IHUA 3FRCA 1ILOA 1HYUA 2HRNA 3M0FA 3CSJA 2O87A 3CBUA 1Z7RA 4MF7A 2L59A 1VF2A 4GXZA 4PNFA 2LS5A 2IMFA 1O81A 3GTUA 5D93A 1A8LA 4HJMA 5ECPB 1PMTA 3G7IA 2MBSA 3LJRA 2FA8A 5CAXA 2K8VA 3F6FA 3DD3A 5ECRB 4K9ZA 2XBIA 3C1SA 3F4SA 2B1KA 1A2JA 1RK4A 3PR8A 4KDUA 1J08A 5JCWA 3QFAC 1PGTA 3HY2A 4BL7B 1Z9HA 4ECCA 3EVIA 1Z3EA 3GN3A 2V1MA 3IE3A 2A2SA 5AIXA 1CQHA 4EIQA 2GSQA 2CZ3A 5LCZA 1AQWA 3FYGA 2B7JA 3D22A 5AIVA 5J9CA 2VLVA 2YV9A 3Q18A 4LL1B 2IL3A 4KB3A 1M2BA 2H1AA 2PVOC 1TKDB 1M99A 2H1DA 3GURA 3U5RE 4N10A 4J2FA 5IMFA 1SENA 3EU4A 4F2IA 1XFLA 1YKCA 4MH2A 5GAND 1TU7A 2GS3A 3F4RA 2C8UA 2B5XA 2FY6A 1K0DA 5IOXA 2RUFA 2CVBA 2KHPA 4GCIA 3FK8A 5ECQB 1GULA 2F8FA 4F0BA 1TRUA 6GSUA 5A4VA 4RI6A 2TIRA 4NHZA 4OO5A 1YJ6A 2O8VB 2H0IA 11GSA 3GL5A 2VD1A 4IJ3A 3DVWA 1G6YA 5IMDA 4L5LA 3BOAA 3F4TA 4EF0A 1WOUA 4OWYA 5IIZA 1V58A 1XW9A 1F3AA 3HHVA 4JU5A 1OE8A 2WDUA 3TKPA 2GSTA 4AF2A 1R4WA 6GSWA 4N11A 2HRFA 1V57A 2VL2A 2LUSA 2O7KA 2OE1A 1MD3A 5AN1A 3VLNA 10GSA 3QAWA 4G0IA 3PPUA 1S3DA 2JSZA 2WGRA 4HQSA 2KP2A 4TKYA 4LMVA 3H4KA 5D9XA 2PPTA 3IA1A 2OBIA 2I9HA 3FEUA 4HU9A 5FWGA 5DBQA 4G0KA 2K9FA 1SKRB 1SYRA 4DSQA 4F9ZA 2XC2A 4I2UA 4E8EA 3ZLPA 3OR5A 5H5SA 4MJCA 1TP9A 3F0IA 3ZRDA 3TKSC 4KSMA 1EZKA 2C3NA 3GMFA 1T1VA 2R3XA 1SL1B 3GIXA 4D73A 4QL7A 2RLIA 1EEJA 4FH8A 2WB9A 1JLWA 2JZTA 5G1KA 1YZXA 2VCXA 5GAPD 1GSUA 3ZVJA 3VWWA 3I9V2 4E8HA 2R37A 3UOMA 4EL1A 1TU8A 2O89A 3WGDA 4RQRA 4EIPA 3TGZA 4HZ4A 1Y6EA 4MPFA 1ON4A 3ZREA 2QGVA 1VF3A 4K1FA 5HFGA 4FIWA 4KDXA 3TRQA 2GQMA 5JWOB 2C3QA 4YAPA 4IJIA 4EO3A 3TCOA 1YKAA 3E0UA 2OE0A 2LTKA 5DQYA 2R0CA 5GSSA 1EV9A 1BG5A 1ZYQB 4DSSA 1K0AA 4HQZA 2FWGA 2AUVA 1V98A 4TXOB 1V9WA 1F37A 4IQ1A 3QFBC 3EYTA 4XS4A 3Q19A 2GLRA 3SBCA 20GSA 1O85A 1JZOA 1PRXA 2X99A 1GLPA 1U88A 3QR6A 2G0FA 4ICYA 5D9WA 4Q5NA 2J23A 1AQXA 4EKZA 3C1RA 1EWXA 1GLQA 5DAKA 4LA1A 3VWUA 2IMKA 1GSEA 3GSTA 2AV4A 3F9UA 4Z7XA 5D9TA 2HLSA 5JCUA 5DJLA 1ZL9A 3GL3A 1QGVA 2JZRA 3MDKA 3RPNA 4WEYA 3ME7A 4XRAA 5GSTA 2VM2A 2X8CA 2VCQA 3RPPA 1QK8A 2N5FA 3BCIA 4YQUA 2XPDA 1ZZYA 4HEA2 4Q5QA 1FVKA 2X8HA 4ZL8A 3M9KA 5G31A 2HNLA 2DIYA 3QAVA 1I9DA 2YCDA 4MJEA 1ZMAA 1RQMA 2QA1A 3IRAA 1S3RA 5IO2A 2LNSA 1QUWA 4GSSA 4ZL7A 1M7TA 2DC5A 3GFKA 3QCPA 5IM9A 4OFTA 3TKSE 1X9MB 2JZSA 2X64A 1JZDA 3A2WA 5CRHA 1PKWA 2L57A 5ECKB 4L0WA 3UBKA 2K6VA 4KSOA 3K8NA 4GLTA 4K8MA 4O7HA 2IMIA 2B7KA 2DJ2A 3DVXA 5E59A 3V1WA 1GSFA 1WMJA 5KN0A 2EIRA 3GA4A 5D96A 4ZB6A 2DLXA 4X4JA 5EL8A 1R5AA 3HKRA 2P31A 4MPGA 4ECIA 1CQGA 3BBYA 2WCIA 4K6XA 2K8SA 5KOWA 2PUKC 1SK1A 4KAEA 2LRNA 4BWSA 2H73A 3VPQA 1ZYNA 4WBJA 3RAZA 4Z2RA 2H70A 1U6TA 3TJBA 3D4MA 1PX6A 1XWAA 2EIQA 5COHA 1VRSD 5KN1A 2MYGA 4O5QA 3LEFA 3ZYWA 1TK5B 1PSQA 3L9VA 2B5EA 4HDEA 5F06A 3ZTLA 3P8WA 4CDOA 2GZYA 1EGRA 4IELA 2FD3A 2BMXA 2YNXA 1PN0A 3KCMA 4I6XA 3WGXA 5H5QA 5BRTA 3GTUB 4GWRA 5IMZA 1YEXA 1M3IA 5CRWA 1XVQA 1PFOA 2BJXA 4OO4A 4DEJA 1ERUA 1TW9A 4XCSA 1EEMA 5LNKe 4XIHA 3EMXA 1SK2A 4XS6A 3EC3A 4YKGA 2C0GA 2VOCA 1I5GA 1TRSA 5ECHB 2IMDA 2VCZA 3C7MA 4ZBDA 1EP8A 5CO3A 3TB2A 1FB6A 3ERFA 4G0LA 2ZCTA 4POLA 5J3RA 3ERGA 4MP4A 1XVWA 3FY7A 3APQA 1NM3A 2PN8A 3FZ5A 4MMMA 2R4VA 2H8LA 4I97A 1B9XC 1E2YA 2A4VA 3LSZA 4TR3A 4KNDA 4OD7A 2DJ1A 1KTEA 2DSAA 1KNGA 1QMVA 2JSYA 5KEJA 2GT6A 1T7PB 19GSA 1ST9A 1SU9A 3CRTA 3H1NA 2NVLA 1UN2A 2D2ZA 4FYBA 2DMMA 4KCEA
chains in the Genus database with same CATH topology
4JEDA 4NV5A 1UA5A 5JWRB 4MH3A 3IC4A 1SKSB 1R7HA 2VCWA 4O32A 3N5OA 2JADA 1HNBA 5B6MA 1O6JA 3D21A 5B8BA 4TR0A 3TRPA 2IIYA 3LXTA 4YQVA 4LL4B 3EPTA 3IBHA 1GL8A 1WWJA 5G30A 1KBNA 3VFIA 1X5EA 4ML1A 1FVJA 2KUCA 3UBLA 2NBSA 1BQ7A 5AISA 4MF5A 3L9UA 1OC9A 5CNWA 1FOHA 3BD2A 5IPGA 2VAFA 1ERVA 2LRCA 3LWAA 2MMAA 3FHKA 3TOUA 2PVQA 1C72A 1OC3A 2C0FA 2TRXA 2AHEA 2N5AA 2F3MA 1S3AA 1YF1A 1F3BA 1MDIA 5CP1A 2V2GA 2ON5A 1HQOA 3MYDA 4POBA 4JR4A 3VI5A 5D9VA 2OKAA 1TK0B 1GSYA 4ZBBA 2YWIA 1GP1A 18GSA 3UVHA 2VL3A 4KW6A 5IOWA 1TDIA 2CZ2A 1SL0B 1O8XA 4D73B 1K0NA 2HRKA 4EC0A 2RM6A 5IPHA 2B5YA 1A0RP 2DJ3A 1ZYPA 3I6AA 2E2MA 3O3TA 4FO5A 4V1Ap 3IOSA 4L5OA 2CVKA 2LSTA 1O7UA 3FKFA 3ISOA 1PL1A 5A4WA 3TJJA 2E2GA 1DBYA 3Q6OA 4KE3A 2V41A 4ECBA 3KTLA 4X0XA 1NSWA 3EWLA 1WP0A 5DVBA 2QC7A 2C4JA 3C71A 2B6MA 1UVZA 4HZ2A 2PWJA 3GV1A 4ZXGA 2LQOA 4TXVA 1O73A 3LW9A 2JL4A 4CY8A 1J9BA 2AYTA 2H6XA 3H93A 1H4OA 1GTBA 4DSSB 3ZMKA 5F07A 1TRVA 2YN1A 2GDRA 3E3EA 4XHMA 5HFIA 4XS4B 1R5PA 3SWLA 1JHBA 2GZPA 3DEXA 3F8UA 3IDVA 3O6TA 3TKSA 3CRUA 3TDGA 2HZFA 3H79A 1XWKA 3N9JA 3KXOA 2WFCA 1JZRA 3IXRA 1A0FA 1TI1A 3IAS2 3QMXA 12GSA 5DAKB 4PURA 4YQMA 4MDCA 5F0GA 3A2XA 3HYPA 4NMUA 1BAYA 4PGTA 1VF1A 1ACVA 1B8XA 3FR3A 4OMVA 5D8IA 2LKUA 2CX3A 3GRXA 1SJIA 1GSSA 2C1YA 3C8EA 3M9JA 1TTZA 5G1LA 3UEMA 5HQPA 1FAAA 3L78A 2R2JA 2YP6A 1ML6A 4EE0A 4TW5A 3QOUA 4F82A 1AIUA 3HJMA 2NTOA 2Z9SA 5IMVA 1TJDA 4IW9A 9GSSA 2LJKA 3PGTA 4PX1A 2A2PA 3TRXA 4EDZA 1JFUA 3HJOA 1FOVA 1PD21 1R26A 2QA2A 3FW2A 1IYHA 3LFLA 4YH2A 2QSIA 4JE1A 2O85A 4NAXA 2GSRA 1S3CA 3HJPA 2YJHA 4OFMA 4BVXA 2DBCA 3QPMA 3KEBA 4KGIA 3A2VA 4PNGA 1OAZA 3GUSA 1GNWA 3CSHA 2VD0A 1F9MA 2YANA 2GVPA 1O8WA 4HJ2A 5JWQB 3FZAA 3APOA 5KN3A 1M2DA 1YDKA 3LXZA 2H1GA 1AQVA 3TKRA 5A5KA 3IR4A 2QKEA 1AAZA 2IFQA 3IPZA 3ZZXA 1Q98A 2B1LA 2GGTA 4K2XA 4Q5RA 2H0GA 2A4HA 2JU5A 1T00A 5B7CA 3GKNA 5CRGA 4TOPA 4KF9A 4NXIA 3EINA 3AY8A 2H76A 3UL3A 1X9WB 2MMNA 1OE7A 4F0CA 14GSA 2LV3A 1WPIA 5ELGA 3HZ4A 17GSA 1K0OA 1A8YA 4QL9A 4MLYA 2LJRA 1E6BA 5ECOB 4QQ7A 4IP6A 4USSA 4GQFA 2GQKA 4AGSA 1EOGA 4PQ1A 2GTUA 1XW6A 3CYNA 2DIZA 2H6YA 4I5QA 1FB0A 2YJ7A 4KA0A 5ECLB 2FWHA 3UMAA 2HSHA 1SYXA 1XCCA 1X0RA 1M9AA 4POMA 5ECIB 3TJFA 2V6KA 4MJBA 1Z6MA 2L5LA 3FZ9A 2H72A 1GTAA 3O76A 1ERWA 3LORA 1Q4JA 3KJYA 4O5UA 3QDNA 4GSNA 4TRXA 4BWQA 2ZNMA 2HFDA 4MNNA 2YWNA 3D5JA 5LD0A 5HFKA 2DJJA 4JR6A 3KM6A 1THOA 4MCUA 2HRAA 1EV4A 3GYKA 2VCTA 5KN2A 2HYXA 2MZCA 6GSVA 2AAWA 3IK7A 4TR4A 1BJXA 2LEGA 4HUAA 1VGLA 2XHFA 4PTSA 2I3YA 1XXUA 22GSA 3CTFA 3HDCA 4WF4A 1TOFA 3KH9A 1ZOFA 4MF6A 4WETA 3RDWA 2R5GA 1THXA 1A23A 2I81A 5FT3A 4IP1A 4NV2A 2LNTA 1DSBA 2I1UA 3IAM2 1B4QA 5AGYA 3HVXA 1OC9B 4O92A 2H30A 4ZBAA 4Z2TA 4PXOA 2FWEA 3KMOA 4YKFA 4WXTA 4A5PA 3HCZA 5J41A 2WRTA 2LRTA 2LQQA 3F3QA 1MD4A 3MNGA 1XWCA 3HVVA 1GRXA 3WT2A 4X43A 1XWBA 2CV4A 2K18A 2N5BA 3D0ZA 2WZ9A 1TXXA 3UJ1A 3F6DA 3IV4A 1YEPA 3A5IA 1WJKA 3FZ4A 3PINA 3Q74A 2OE3A 1G7OA 1B9YC 2ZUPA 1A24A 4LLRA 4PQHA 2H0HA 2FA4A 2VLUA 1K3OA 4IN0A 1OKTA 2ALBA 3BCKA 3JCML 2V32A 2H74A 3DXBA 1K3YA 2IMEA 5ECSA 1JLVA 3J7Yk 3KIJA 2P0GA 5H5RA 3LYKA 1DE2A 2P5QA 4KDYA 3KTBA 5EY6A 1EP7A 3GSSA 1K3LA 2H19A 5ID2A 2G2QA 4XRDA 1T4YA 1GSQA 2PU9C 2F9SA 2X49A 2AJQB 4IKHA 5DALA 3R3EA 1QXHA 4ILFA 2YWMA 4DSRA 1PQNA 4JRRA 2YV7A 2HE3A 5DCGA 2C80A 6GSSA 3TJKA 5HR2A 2VUPA 4DVCA 1WE0A 1FO5A 4G2EA 4PQIA 3W8JA 5ECMB 2MMOA 5HR3A 3CMIA 4KCAA 2HT9A 8GSSA 1T4ZA 4KUNA 3F63A 4Q5FA 5G5FA 1M0UA 2FWFA 2L4CA 4NPBA 5EPFA 1AW9A 1LJRA 16GSA 4WF5A 1DE1A 1NW2A 1TRWA 1X5CA 4V2NA 3GH6A 4ID0A 3PH9A 2IWTA 4F03A 3EMPA 1TI3A 4G19A 6GSXA 2VL9A 1B4PA 3M1GA 1VF4A 3RBTA 3UAPA 4EUYA 4BVYA 4TR1A 4ZB8A 3RHCA 1SD9A 1YY7A 4L8EA 3I69A 4G10A 5F05A 4BA7A 1YQ1A 4CW9A 4EVMA 2FCHA 4FQUA 3DGQA 3WYWA 4V1Ag 2F51A 4K7IA 4Z2UA 2CAQA 5IMCA 1GUHA 3H8QA 4JBBA 1KEBA 4IVFA 1WIKA 1M2AA 3CSIA 2TRCP 3KZQA 3KH7A 2PERA 4I2TA 1Z7PA 2V6OA 4ZB9A 1ERTA 2R0PA 2RIIA 2OJLA 4WR4A 2CX4A 2X8GA 3ZIJA 2PGTA 2YZUA 2HZEA 5FHIA 3EE2A 2M80A 4BVXB 3IC8A 2HXKA 3WT1A 4N0ZA 1G7EA 4BPYA 3GX0A 3ZVJD 1SJZA 2E7PA 4HU7A 5CYYA 4NHWA 2YWOA 5BMUA 4ISDA 5DDLA 4NWYA 3KP8A 5IMAA 3DMLA 1YF0A 3UIWA 5G5EA 3L0HA 3GKXA 3VWVA 2IFQB 2VO4A 1MDJA 3KMNA 1GTIA 5HR1A 4EXJA 2VLTA 1USBA 2OA7A 3CTGA 3LQ7A 2EIOA 2HSMA 2YZHA 3EU3A 5F8BA 4OCEA 1BYEA 2H71A 2REMA 3FR6A 3F3RA 1SD8A 2WULA 2VL2C 5J9BA 1PKZA 4BL7A 2DKHA 4XS1A 2CAIA 3TJGA 4HS1A 2ES7A 2FHEA 3CXGA 1SJ6A 4WBRD 3ZITA 2B3SA 4V2LA 1XZOA 4HI7A 4K5RA 3D6IA 5IO0A 4RUVA 4ULXA 3VK9A 4POKA 5KOXA 2R0GA 4WR5A 3RHBA 1OC8A 1K0BA 1AUCA 2LJAA 4AJ6A 2F8AA 4FYCA 1F6MC 3IHQA 2DJ0A 1GUMA 3G7JA 3VPTA 1QQ2A 1MDKA 3KP9A 4MK3A 4KX4A 4GQCA 1N2AA 2OADA 4IQAA 3M3MA 1RW1A 1Y25A 3ZFBA 4K7OA 2OACA 1OVNA 4G9HA 4IGJA 3APSA 4RQXA 5A4UA 3S9FA 1HNAA 4HOJA 2VM1A 1OYJA 1IYIA 2L4QA 5ENUA 6GSYA 4IBPA 2HI7A 2CT6A 5CREA 1TK8B 3GX8A 3P7XA 5G2ZA 1ZYEA 1V40A 1NHOA 4CY6A 4I8BA 4AJ8A 4N0VA 5B6NA 4TVEA 2A2RA 3WGEA 3QAGA 3QD9A 3DKSA 1SKWB 2GZZA 2DJKA 2R6KA 1PX7A 3DWVA 3M8NA 3U6VA 2L5OA 5JCGA 4ZIJA 1FG4A 1K0CA 3TOTA 2L6CA 2KOKA 1PL2A 4MA9A 2L6DA 3L9SA 1AXDA 1EOHA 2MMZA 13GSA 3VWXA 1B48A 3ZIVA 4K2DA 2FLSA 5ELAA 4LMWA 1H75A 3ZL5A 1OKDA 1QFNA 4IS0A 2KP1A 2XPEA 3HD5A 2PMTA 3J7Yb 2YPMA 5GZZB 3NZNA 3US3A 1A2LA 3A3TA 3W6GA 1DUGA 1SL2B 1ZCPA 4ACSA 2CVDA 1GH2A 3R2QA 1X9SB 1Z6NA 1PA3A 4WKWA 3ED3A 3LYPA 4MJAA 1GTUA 4ZL9A 3TUEA 4OFNA 5ECNB 3W8SA 2C0DA 1BEDA 2UZ8A 4JZQA 2OBKA 3HA9A 4PUFC 4L0UA 2M46A 3A5WA 3HVSA 2VCVA 2FGXA 1GNEA 2C3TA 4ZILA 3DRNA 3FMWA 3I43A 5DCHA 1UC7A 2KLXA 7GSSA 1XOBA 4K0GA 1GSDA 4X1UA 4MZCA 3DIEA 3HXSA 1LU4A 1SK0A 3GKKA 4ECJA 3TKQA 2NDOA 1A2MA 2P5RA 1LBKA 2ON7A 4TXOA 4AJ7A 3VURA 2H6ZA 3BJ5A 2HSYA 4TN8A 5ID2B 1XWGA 2GSSA 3MWHA 2I4AA 4N30A 5DJMA 2IPAA 2NPBA 5J5NA 2YOIA 2CQ9A 1WRYA 3DYRA 4GSTA 3MAKA 4MABA 3IK9A 1FHEA 5DALB 2IN3A 3LGCA 4P3YB 3G9BA 4ML6A 1ABAA 1J0FA 2EC4A 3G7YA 2M72A 3P90A 5HR0A 4PUAA 1NHYA 5ABRA 2JACA 2H01A 2CA8A 3KGKA 2H66A 2VIMA 1M9BA 1HNCA 2FUG2 4GF0A 3HZ8A 3UVTA 3E9JB 3D4TA 2H75A 3ZFLA 4YAVA 2BTOT 2MBTA 5C04A 3KD0A 1T8EB 4H86A 1XIYA 4XTSA 5CRDA 1XPVA 3GKMA 5EVOA 3UARA 2PBJA 4MZWA 3VI7A 5J4UA 3ME8A 3P2AA 2GQLA 1AC1A 1GWCA 3ZMLA 1GUKA 4J56E 1K0MA 5D73A 3NIVA 1XW5A 4MZBA 4FYUA 5L71A 4OCFA 5INYA 3EURA 3MIXA 4BVYB 2DKIA 4TR1B 4K0NA 1MEKA 1XOAA 1U3IA 3ERWA 4J57E 1V2AA 4K7NA 2DMLA 5DQSA 1N8JA 4CHSA 2C0EA 2FNOA 3MSZA 3L4NA 5C00A 5IQYA 1X5DA 1XBSA 1Z5YE 2J9HA 1W4VA 5E4WA 1U87A 3GHAA 6GSTA 2IJYA 1HD2A 4V2MA 3FR9A 4RI7A 3IHGA 1W89A 1JZWA 2H1BA 2X4AA 1URMA 2XBQA 1MTCA 1PN9A 2WJUA 4O5RA 3LG6A 2RUEA 1F2EA 2RM5A 3C73A 1EGOA 1BX9A 4KH7A 4GRFA 2HZEB 4EDYA 5B8AA 2E0QA 4GTUA 3GNJA 3GH9A 1FW1A 1U3AA 2GT5A 1G6WA 3WD6A 1G0TA 2AB6A 4K5SA 2WS2A 1ZGNA 3NOFA 1T3BA 4IHUA 3FRCA 1ILOA 1HYUA 2HRNA 3M0FA 3CSJA 2O87A 3CBUA 1Z7RA 4MF7A 2L59A 1VF2A 4GXZA 4PNFA 2LS5A 2IMFA 1O81A 3GTUA 5D93A 1A8LA 4HJMA 5ECPB 1PMTA 3G7IA 2MBSA 3LJRA 2FA8A 5CAXA 2K8VA 3F6FA 3DD3A 5ECRB 4K9ZA 2XBIA 3C1SA 3F4SA 2B1KA 1A2JA 1RK4A 3PR8A 4KDUA 1J08A 5JCWA 3QFAC 1PGTA 3HY2A 4BL7B 1Z9HA 4ECCA 3EVIA 1Z3EA 3GN3A 2V1MA 3IE3A 2A2SA 5AIXA 1CQHA 4EIQA 2GSQA 2CZ3A 5LCZA 1AQWA 3FYGA 2B7JA 3D22A 5AIVA 5J9CA 2VLVA 2YV9A 3Q18A 4LL1B 2IL3A 4KB3A 1M2BA 2H1AA 2PVOC 1TKDB 1M99A 2H1DA 3GURA 3U5RE 4N10A 4J2FA 5IMFA 1SENA 3EU4A 4F2IA 1XFLA 1YKCA 4MH2A 5GAND 1TU7A 2GS3A 3F4RA 2C8UA 2B5XA 2FY6A 1K0DA 5IOXA 2RUFA 2CVBA 2KHPA 4GCIA 3FK8A 5ECQB 1GULA 2F8FA 4F0BA 1TRUA 6GSUA 5A4VA 4RI6A 2TIRA 4NHZA 4OO5A 1YJ6A 2O8VB 2H0IA 11GSA 3GL5A 2VD1A 4IJ3A 3DVWA 1G6YA 5IMDA 4L5LA 3BOAA 3F4TA 4EF0A 1WOUA 4OWYA 5IIZA 1V58A 1XW9A 1F3AA 3HHVA 4JU5A 1OE8A 2WDUA 3TKPA 2GSTA 4AF2A 1R4WA 6GSWA 4N11A 2HRFA 1V57A 2VL2A 2LUSA 2O7KA 2OE1A 1MD3A 5AN1A 3VLNA 10GSA 3QAWA 4G0IA 3PPUA 1S3DA 2JSZA 2WGRA 4HQSA 2KP2A 4TKYA 4LMVA 3H4KA 5D9XA 2PPTA 3IA1A 2OBIA 2I9HA 3FEUA 4HU9A 5FWGA 5DBQA 4G0KA 2K9FA 1SKRB 1SYRA 4DSQA 4F9ZA 2XC2A 4I2UA 4E8EA 3ZLPA 3OR5A 5H5SA 4MJCA 1TP9A 3F0IA 3ZRDA 3TKSC 4KSMA 1EZKA 2C3NA 3GMFA 1T1VA 2R3XA 1SL1B 3GIXA 4D73A 4QL7A 2RLIA 1EEJA 4FH8A 2WB9A 1JLWA 2JZTA 5G1KA 1YZXA 2VCXA 5GAPD 1GSUA 3ZVJA 3VWWA 3I9V2 4E8HA 2R37A 3UOMA 4EL1A 1TU8A 2O89A 3WGDA 4RQRA 4EIPA 3TGZA 4HZ4A 1Y6EA 4MPFA 1ON4A 3ZREA 2QGVA 1VF3A 4K1FA 5HFGA 4FIWA 4KDXA 3TRQA 2GQMA 5JWOB 2C3QA 4YAPA 4IJIA 4EO3A 3TCOA 1YKAA 3E0UA 2OE0A 2LTKA 5DQYA 2R0CA 5GSSA 1EV9A 1BG5A 1ZYQB 4DSSA 1K0AA 4HQZA 2FWGA 2AUVA 1V98A 4TXOB 1V9WA 1F37A 4IQ1A 3QFBC 3EYTA 4XS4A 3Q19A 2GLRA 3SBCA 20GSA 1O85A 1JZOA 1PRXA 2X99A 1GLPA 1U88A 3QR6A 2G0FA 4ICYA 5D9WA 4Q5NA 2J23A 1AQXA 4EKZA 3C1RA 1EWXA 1GLQA 5DAKA 4LA1A 3VWUA 2IMKA 1GSEA 3GSTA 2AV4A 3F9UA 4Z7XA 5D9TA 2HLSA 5JCUA 5DJLA 1ZL9A 3GL3A 1QGVA 2JZRA 3MDKA 3RPNA 4WEYA 3ME7A 4XRAA 5GSTA 2VM2A 2X8CA 2VCQA 3RPPA 1QK8A 2N5FA 3BCIA 4YQUA 2XPDA 1ZZYA 4HEA2 4Q5QA 1FVKA 2X8HA 4ZL8A 3M9KA 5G31A 2HNLA 2DIYA 3QAVA 1I9DA 2YCDA 4MJEA 1ZMAA 1RQMA 2QA1A 3IRAA 5IO2A 2LNSA 1QUWA 4GSSA 4ZL7A 1M7TA 2DC5A 3GFKA 3QCPA 5IM9A 4OFTA 3TKSE 1X9MB 2JZSA 2X64A 1JZDA 3A2WA 5CRHA 1PKWA 2L57A 5ECKB 4L0WA 3UBKA 2K6VA 4KSOA 3K8NA 4GLTA 4K8MA 4O7HA 2IMIA 2B7KA 2DJ2A 3DVXA 5E59A 3V1WA 1GSFA 1WMJA 5KN0A 2EIRA 3GA4A 5D96A 4ZB6A 2DLXA 4X4JA 5EL8A 1R5AA 3HKRA 2P31A 4MPGA 4ECIA 1CQGA 3BBYA 2WCIA 4K6XA 2K8SA 5KOWA 2PUKC 1SK1A 4KAEA 2LRNA 4BWSA 2H73A 3VPQA 1ZYNA 4WBJA 3RAZA 4Z2RA 2H70A 1U6TA 3TJBA 3D4MA 1PX6A 1XWAA 2EIQA 5COHA 1VRSD 5KN1A 2MYGA 4O5QA 3LEFA 3ZYWA 1TK5B 1PSQA 3L9VA 2B5EA 4HDEA 5F06A 3ZTLA 3P8WA 4CDOA 2GZYA 1EGRA 4IELA 2FD3A 2BMXA 2YNXA 1PN0A 3KCMA 4I6XA 3WGXA 5H5QA 5BRTA 3GTUB 4GWRA 5IMZA 1YEXA 5CRWA 1XVQA 2BJXA 4OO4A 4DEJA 1ERUA 1TW9A 4XCSA 1EEMA 5LNKe 4XIHA 3EMXA 1SK2A 4XS6A 3EC3A 4YKGA 2C0GA 2VOCA 1I5GA 1TRSA 5ECHB 2IMDA 2VCZA 3C7MA 4ZBDA 1EP8A 5CO3A 3TB2A 1FB6A 3ERFA 4G0LA 2ZCTA 4POLA 5J3RA 3ERGA 4MP4A 1XVWA 3FY7A 3APQA 1NM3A 2PN8A 3FZ5A 4MMMA 2R4VA 2H8LA 4I97A 1B9XC 1E2YA 2A4VA 3LSZA 4TR3A 4KNDA 4OD7A 2DJ1A 1KTEA 2DSAA 1KNGA 1QMVA 2JSYA 5KEJA 2GT6A 1T7PB 19GSA 1ST9A 1SU9A 3CRTA 3H1NA 2NVLA 1UN2A 2D2ZA 4FYBA 2DMMA 4KCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JED A;  4NV5 A;  1UA5 A;  5JWR B;  4MH3 A;  3IC4 A;  1SKS B;  1R7H A;  2VCW A;  4O32 A;  3N5O A;  2JAD A;  1HNB A;  5B6M A;  1O6J A;  3D21 A;  5B8B A;  4TR0 A;  3TRP A;  2IIY A;  3LXT A;  4YQV A;  4LL4 B;  3IBH A;  1GL8 A;  1WWJ A;  5G30 A;  1KBN A;  3VFI A;  1X5E A;  4ML1 A;  1FVJ A;  2KUC A;  3UBL A;  2NBS A;  1BQ7 A;  5AIS A;  4MF5 A;  3L9U A;  1OC9 A;  5CNW A;  3BD2 A;  5IPG A;  2VAF A;  1ERV A;  2LRC A;  3LWA A;  2MMA A;  3FHK A;  3TOU A;  2PVQ A;  1C72 A;  1OC3 A;  2C0F A;  2TRX A;  2AHE A;  2N5A A;  2F3M A;  1S3A A;  1YF1 A;  1F3B A;  1MDI A;  5CP1 A;  2V2G A;  2ON5 A;  1HQO A;  4POB A;  4JR4 A;  3VI5 A;  5D9V A;  2OKA A;  1TK0 B;  1GSY A;  4ZBB A;  2YWI A;  1GP1 A;  18GS A;  3UVH A;  2VL3 A;  4KW6 A;  5IOW A;  1TDI A;  2CZ2 A;  1SL0 B;  1O8X A;  4D73 B;  1K0N A;  4EC0 A;  2RM6 A;  5IPH A;  2B5Y A;  1A0R P;  2DJ3 A;  3I6A A;  2E2M A;  3O3T A;  4FO5 A;  4V1A p;  3IOS A;  4L5O A;  2CVK A;  2LST A;  1O7U A;  3FKF A;  3ISO A;  1PL1 A;  5A4W A;  3TJJ A;  2E2G A;  1DBY A;  3Q6O A;  4KE3 A;  2V41 A;  4ECB A;  3KTL A;  4X0X A;  1NSW A;  3EWL A;  1WP0 A;  5DVB A;  2QC7 A;  2C4J A;  3C71 A;  2B6M A;  1UVZ A;  4HZ2 A;  2PWJ A;  3GV1 A;  4ZXG A;  2LQO A;  4TXV A;  1O73 A;  2JL4 A;  1J9B A;  2AYT A;  2H6X A;  3H93 A;  1H4O A;  1GTB A;  4DSS B;  3ZMK A;  5F07 A;  1TRV A;  2YN1 A;  2GDR A;  3E3E A;  4XHM A;  5HFI A;  4XS4 B;  1R5P A;  3SWL A;  1JHB A;  2GZP A;  3DEX A;  3F8U A;  3IDV A;  3O6T A;  3TKS A;  3CRU A;  3TDG A;  2HZF A;  3H79 A;  1XWK A;  3N9J A;  3KXO A;  2WFC A;  1JZR A;  3IXR A;  1A0F A;  1TI1 A;  3IAS 2;  3QMX A;  12GS A;  5DAK B;  4PUR A;  4YQM A;  4MDC A;  5F0G A;  3A2X A;  3HYP A;  4NMU A;  1BAY A;  4PGT A;  1VF1 A;  1ACV A;  1B8X A;  3FR3 A;  4OMV A;  5D8I A;  2LKU A;  2CX3 A;  3GRX A;  1SJI A;  1GSS A;  2C1Y A;  3C8E A;  3M9J A;  1TTZ A;  5G1L A;  3UEM A;  5HQP A;  1FAA A;  3L78 A;  2R2J A;  2YP6 A;  1ML6 A;  4EE0 A;  4TW5 A;  3QOU A;  4F82 A;  1AIU A;  3HJM A;  2NTO A;  2Z9S A;  5IMV A;  1TJD A;  4IW9 A;  9GSS A;  2LJK A;  3PGT A;  4PX1 A;  3TRX A;  4EDZ A;  1JFU A;  3HJO A;  1FOV A;  1PD2 1;  1R26 A;  3FW2 A;  1IYH A;  3LFL A;  4YH2 A;  2QSI A;  4JE1 A;  2O85 A;  4NAX A;  2GSR A;  1S3C A;  3HJP A;  2YJH A;  4OFM A;  4BVX A;  2DBC A;  3QPM A;  3KEB A;  4KGI A;  3A2V A;  4PNG A;  1OAZ A;  3GUS A;  1GNW A;  3CSH A;  2VD0 A;  1F9M A;  2YAN A;  2GVP A;  1O8W A;  4HJ2 A;  5JWQ B;  3FZA A;  3APO A;  5KN3 A;  1M2D A;  1YDK A;  3LXZ A;  2H1G A;  1AQV A;  3TKR A;  5A5K A;  3IR4 A;  2QKE A;  1AAZ A;  2IFQ A;  3IPZ A;  3ZZX A;  1Q98 A;  2B1L A;  2GGT A;  4Q5R A;  2H0G A;  2JU5 A;  1T00 A;  5B7C A;  3GKN A;  5CRG A;  4TOP A;  4NXI A;  3EIN A;  3AY8 A;  2H76 A;  3UL3 A;  1X9W B;  2MMN A;  1OE7 A;  4F0C A;  14GS A;  2LV3 A;  1WPI A;  5ELG A;  3HZ4 A;  17GS A;  1K0O A;  1A8Y A;  4QL9 A;  4MLY A;  2LJR A;  1E6B A;  5ECO B;  4QQ7 A;  4IP6 A;  4GQF A;  2GQK A;  4AGS A;  1EOG A;  4PQ1 A;  2GTU A;  1XW6 A;  3CYN A;  2DIZ A;  2H6Y A;  4I5Q A;  1FB0 A;  2YJ7 A;  4KA0 A;  5ECL B;  2FWH A;  3UMA A;  2HSH A;  1SYX A;  1XCC A;  1X0R A;  1M9A A;  4POM A;  5ECI B;  3TJF A;  2V6K A;  4MJB A;  1Z6M A;  2L5L A;  3FZ9 A;  2H72 A;  1GTA A;  3O76 A;  1ERW A;  3LOR A;  1Q4J A;  3KJY A;  3QDN A;  4GSN A;  4TRX A;  4BWQ A;  2ZNM A;  2HFD A;  2YWN A;  3D5J A;  5LD0 A;  5HFK A;  2DJJ A;  4JR6 A;  3KM6 A;  1THO A;  4MCU A;  1EV4 A;  3GYK A;  2VCT A;  5KN2 A;  2HYX A;  2MZC A;  6GSV A;  2AAW A;  3IK7 A;  4TR4 A;  1BJX A;  2LEG A;  4HUA A;  1VGL A;  2XHF A;  2I3Y A;  1XXU A;  22GS A;  3CTF A;  3HDC A;  4WF4 A;  1TOF A;  3KH9 A;  1ZOF A;  4MF6 A;  4WET A;  3RDW A;  2R5G A;  1THX A;  1A23 A;  2I81 A;  5FT3 A;  4IP1 A;  4NV2 A;  2LNT A;  1DSB A;  2I1U A;  3IAM 2;  1B4Q A;  5AGY A;  3HVX A;  1OC9 B;  4O92 A;  2H30 A;  4ZBA A;  4PXO A;  2FWE A;  3KMO A;  4WXT A;  3HCZ A;  5J41 A;  2WRT A;  2LRT A;  2LQQ A;  3F3Q A;  1MD4 A;  3MNG A;  1XWC A;  3HVV A;  1GRX A;  3WT2 A;  4X43 A;  1XWB A;  2CV4 A;  2K18 A;  2N5B A;  3D0Z A;  2WZ9 A;  1TXX A;  3UJ1 A;  3F6D A;  3IV4 A;  1YEP A;  1WJK A;  3FZ4 A;  3PIN A;  3Q74 A;  2OE3 A;  1G7O A;  1B9Y C;  2ZUP A;  1A24 A;  4LLR A;  4PQH A;  2H0H A;  2FA4 A;  2VLU A;  1K3O A;  4IN0 A;  1OKT A;  2ALB A;  3BCK A;  3JCM L;  2V32 A;  2H74 A;  3DXB A;  1K3Y A;  2IME A;  5ECS A;  1JLV A;  3J7Y k;  3KIJ A;  2P0G A;  5H5R A;  3LYK A;  1DE2 A;  2P5Q A;  4KDY A;  3KTB A;  5EY6 A;  1EP7 A;  3GSS A;  1K3L A;  2H19 A;  5ID2 A;  2G2Q A;  4XRD A;  1T4Y A;  1GSQ A;  2PU9 C;  2F9S A;  2AJQ B;  4IKH A;  5DAL A;  1QXH A;  4ILF A;  2YWM A;  4DSR A;  1PQN A;  4JRR A;  2YV7 A;  2HE3 A;  5DCG A;  2C80 A;  6GSS A;  3TJK A;  5HR2 A;  2VUP A;  4DVC A;  1WE0 A;  1FO5 A;  4G2E A;  4PQI A;  3W8J A;  5ECM B;  2MMO A;  5HR3 A;  3CMI A;  4KCA A;  2HT9 A;  8GSS A;  1T4Z A;  4KUN A;  3F63 A;  4Q5F A;  5G5F A;  1M0U A;  2FWF A;  2L4C A;  4NPB A;  5EPF A;  1AW9 A;  1LJR A;  16GS A;  4WF5 A;  1DE1 A;  1NW2 A;  1TRW A;  1X5C A;  4V2N A;  3GH6 A;  4ID0 A;  3PH9 A;  2IWT A;  4F03 A;  3EMP A;  1TI3 A;  4G19 A;  6GSX A;  2VL9 A;  1B4P A;  3M1G A;  1VF4 A;  3RBT A;  3UAP A;  4EUY A;  4BVY A;  4TR1 A;  4ZB8 A;  3RHC A;  1SD9 A;  1YY7 A;  4L8E A;  3I69 A;  4G10 A;  5F05 A;  4BA7 A;  1YQ1 A;  4CW9 A;  4EVM A;  2FCH A;  3DGQ A;  3WYW A;  4V1A g;  2F51 A;  4K7I A;  2CAQ A;  5IMC A;  1GUH A;  3H8Q A;  4JBB A;  1KEB A;  4IVF A;  1WIK A;  1M2A A;  3CSI A;  2TRC P;  3KZQ A;  3KH7 A;  2PER A;  4I2T A;  1Z7P A;  2V6O A;  4ZB9 A;  1ERT A;  2RII A;  2OJL A;  4WR4 A;  2CX4 A;  2X8G A;  3ZIJ A;  2PGT A;  2YZU A;  2HZE A;  5FHI A;  3EE2 A;  2M80 A;  3WT1 A;  2HXK A;  4N0Z A;  1G7E A;  4BPY A;  3GX0 A;  3ZVJ D;  1SJZ A;  2E7P A;  4HU7 A;  5CYY A;  4NHW A;  2YWO A;  4ISD A;  5DDL A;  4NWY A;  3KP8 A;  5IMA A;  3DML A;  1YF0 A;  3UIW A;  5G5E A;  3L0H A;  3GKX A;  3VWV A;  2IFQ B;  2VO4 A;  1MDJ A;  3KMN A;  1GTI A;  5HR1 A;  4EXJ A;  2VLT A;  1USB A;  2OA7 A;  3CTG A;  3LQ7 A;  2EIO A;  2YZH A;  3EU3 A;  5F8B A;  4OCE A;  1BYE A;  2H71 A;  2REM A;  3FR6 A;  3F3R A;  1SD8 A;  2WUL A;  2VL2 C;  5J9B A;  1PKZ A;  4BL7 A;  4XS1 A;  2CAI A;  3TJG A;  4HS1 A;  2ES7 A;  2FHE A;  3CXG A;  1SJ6 A;  4WBR D;  3ZIT A;  2B3S A;  4V2L A;  1XZO A;  4HI7 A;  3D6I A;  5IO0 A;  4RUV A;  4ULX A;  3VK9 A;  4POK A;  4WR5 A;  3RHB A;  1OC8 A;  1K0B A;  1AUC A;  2LJA A;  4AJ6 A;  2F8A A;  4FYC A;  1F6M C;  3IHQ A;  2DJ0 A;  1GUM A;  3G7J A;  3VPT A;  1QQ2 A;  1MDK A;  3KP9 A;  4MK3 A;  4KX4 A;  4GQC A;  1N2A A;  2OAD A;  4IQA A;  3M3M A;  1RW1 A;  1Y25 A;  3ZFB A;  4K7O A;  2OAC A;  1OVN A;  4G9H A;  4IGJ A;  3APS A;  4RQX A;  5A4U A;  3S9F A;  1HNA A;  4HOJ A;  2VM1 A;  1OYJ A;  1IYI A;  2L4Q A;  5ENU A;  6GSY A;  4IBP A;  2HI7 A;  2CT6 A;  5CRE A;  1TK8 B;  3GX8 A;  3P7X A;  5G2Z A;  1ZYE A;  1V40 A;  1NHO A;  4I8B A;  4AJ8 A;  4N0V A;  5B6N A;  4TVE A;  2A2R A;  3WGE A;  3QAG A;  3QD9 A;  3DKS A;  1SKW B;  2GZZ A;  2DJK A;  2R6K A;  1PX7 A;  3DWV A;  3M8N A;  3U6V A;  2L5O A;  5JCG A;  4ZIJ A;  1FG4 A;  1K0C A;  3TOT A;  2L6C A;  2KOK A;  1PL2 A;  4MA9 A;  2L6D A;  3L9S A;  1AXD A;  1EOH A;  2MMZ A;  13GS A;  3VWX A;  1B48 A;  3ZIV A;  4K2D A;  2FLS A;  5ELA A;  4LMW A;  1H75 A;  3ZL5 A;  1OKD A;  1QFN A;  4IS0 A;  2KP1 A;  2XPE A;  3HD5 A;  2PMT A;  3J7Y b;  2YPM A;  5GZZ B;  3NZN A;  3US3 A;  1A2L A;  3A3T A;  3W6G A;  1DUG A;  1SL2 B;  1ZCP A;  4ACS A;  2CVD A;  1GH2 A;  3R2Q A;  1X9S B;  1Z6N A;  1PA3 A;  4WKW A;  3ED3 A;  3LYP A;  4MJA A;  1GTU A;  4ZL9 A;  3TUE A;  4OFN A;  5ECN B;  3W8S A;  2C0D A;  1BED A;  4JZQ A;  2OBK A;  3HA9 A;  4PUF C;  4L0U A;  2M46 A;  3A5W A;  3HVS A;  2VCV A;  2FGX A;  1GNE A;  2C3T A;  4ZIL A;  3DRN A;  3I43 A;  5DCH A;  1UC7 A;  2KLX A;  7GSS A;  1XOB A;  4K0G A;  1GSD A;  4X1U A;  4MZC A;  3DIE A;  3HXS A;  1LU4 A;  1SK0 A;  3GKK A;  4ECJ A;  3TKQ A;  2NDO A;  1A2M A;  2P5R A;  1LBK A;  2ON7 A;  4TXO A;  4AJ7 A;  3VUR A;  2H6Z A;  3BJ5 A;  2HSY A;  4TN8 A;  5ID2 B;  1XWG A;  2GSS A;  3MWH A;  2I4A A;  4N30 A;  5DJM A;  2IPA A;  2NPB A;  5J5N A;  2YOI A;  2CQ9 A;  1WRY A;  3DYR A;  4GST A;  3MAK A;  4MAB A;  3IK9 A;  1FHE A;  5DAL B;  2IN3 A;  3LGC A;  4P3Y B;  3G9B A;  4ML6 A;  1ABA A;  1J0F A;  2EC4 A;  3G7Y A;  2M72 A;  3P90 A;  5HR0 A;  4PUA A;  1NHY A;  5ABR A;  2JAC A;  2H01 A;  2CA8 A;  3KGK A;  2H66 A;  2VIM A;  1M9B A;  1HNC A;  2FUG 2;  4GF0 A;  3HZ8 A;  3UVT A;  3E9J B;  3D4T A;  2H75 A;  3ZFL A;  4YAV A;  2BTO T;  2MBT A;  5C04 A;  3KD0 A;  1T8E B;  4H86 A;  1XIY A;  4XTS A;  5CRD A;  1XPV A;  3GKM A;  5EVO A;  3UAR A;  2PBJ A;  4MZW A;  3VI7 A;  5J4U A;  3ME8 A;  3P2A A;  2GQL A;  1AC1 A;  1GWC A;  3ZML A;  1GUK A;  4J56 E;  1K0M A;  5D73 A;  3NIV A;  1XW5 A;  4MZB A;  4FYU A;  5L71 A;  4OCF A;  5INY A;  3EUR A;  4TR1 B;  4K0N A;  1MEK A;  1XOA A;  1U3I A;  3ERW A;  4J57 E;  1V2A A;  4K7N A;  2DML A;  5DQS A;  1N8J A;  4CHS A;  2C0E A;  2FNO A;  3MSZ A;  3L4N A;  5C00 A;  5IQY A;  1X5D A;  1XBS A;  1Z5Y E;  2J9H A;  1W4V A;  5E4W A;  1U87 A;  3GHA A;  6GST A;  2IJY A;  1HD2 A;  3FR9 A;  4RI7 A;  4V2M A;  1W89 A;  1JZW A;  2H1B A;  1URM A;  2XBQ A;  1MTC A;  1PN9 A;  2WJU A;  4O5R A;  3LG6 A;  2RUE A;  1F2E A;  2RM5 A;  3C73 A;  1EGO A;  1BX9 A;  4KH7 A;  4GRF A;  2HZE B;  4EDY A;  5B8A A;  2E0Q A;  4GTU A;  3GNJ A;  3GH9 A;  1FW1 A;  1U3A A;  2GT5 A;  1G6W A;  3WD6 A;  1G0T A;  2AB6 A;  2WS2 A;  1ZGN A;  3NOF A;  1T3B A;  4IHU A;  3FRC A;  1ILO A;  1HYU A;  2HRN A;  3M0F A;  3CSJ A;  2O87 A;  3CBU A;  1Z7R A;  4MF7 A;  2L59 A;  1VF2 A;  4GXZ A;  4PNF A;  2LS5 A;  2IMF A;  1O81 A;  3GTU A;  5D93 A;  1A8L A;  4HJM A;  5ECP B;  1PMT A;  3G7I A;  2MBS A;  3LJR A;  2FA8 A;  5CAX A;  2K8V A;  3F6F A;  3DD3 A;  5ECR B;  4K9Z A;  2XBI A;  3C1S A;  3F4S A;  2B1K A;  1A2J A;  1RK4 A;  3PR8 A;  4KDU A;  1J08 A;  5JCW A;  3QFA C;  1PGT A;  3HY2 A;  1Z9H A;  4ECC A;  3EVI A;  1Z3E A;  3GN3 A;  2V1M A;  3IE3 A;  2A2S A;  5AIX A;  1CQH A;  2GSQ A;  2CZ3 A;  5LCZ A;  1AQW A;  3FYG A;  2B7J A;  3D22 A;  5AIV A;  5J9C A;  2VLV A;  2YV9 A;  3Q18 A;  4LL1 B;  2IL3 A;  4KB3 A;  1M2B A;  2H1A A;  2PVO C;  1TKD B;  1M99 A;  2H1D A;  3GUR A;  3U5R E;  4N10 A;  4J2F A;  5IMF A;  1SEN A;  3EU4 A;  4F2I A;  1XFL A;  1YKC A;  4MH2 A;  5GAN D;  1TU7 A;  2GS3 A;  3F4R A;  2C8U A;  2B5X A;  2FY6 A;  1K0D A;  5IOX A;  2RUF A;  2CVB A;  2KHP A;  4GCI A;  3FK8 A;  5ECQ B;  1GUL A;  2F8F A;  4F0B A;  1TRU A;  6GSU A;  5A4V A;  4RI6 A;  2TIR A;  4NHZ A;  4OO5 A;  1YJ6 A;  2O8V B;  2H0I A;  11GS A;  3GL5 A;  2VD1 A;  4IJ3 A;  3DVW A;  1G6Y A;  5IMD A;  4L5L A;  3BOA A;  3F4T A;  4EF0 A;  1WOU A;  4OWY A;  5IIZ A;  1V58 A;  1XW9 A;  1F3A A;  3HHV A;  4JU5 A;  1OE8 A;  2WDU A;  3TKP A;  2GST A;  4AF2 A;  1R4W A;  6GSW A;  4N11 A;  2HRF A;  1V57 A;  2VL2 A;  2LUS A;  2O7K A;  2OE1 A;  1MD3 A;  5AN1 A;  3VLN A;  10GS A;  3QAW A;  1S3D A;  2JSZ A;  2WGR A;  4HQS A;  2KP2 A;  4TKY A;  4LMV A;  3H4K A;  5D9X A;  2PPT A;  3IA1 A;  2OBI A;  2I9H A;  3FEU A;  4HU9 A;  5FWG A;  5DBQ A;  2K9F A;  1SKR B;  1SYR A;  4DSQ A;  4F9Z A;  2XC2 A;  4I2U A;  4E8E A;  3ZLP A;  3OR5 A;  5H5S A;  4MJC A;  1TP9 A;  3F0I A;  3ZRD A;  3TKS C;  4KSM A;  1EZK A;  2C3N A;  3GMF A;  1T1V A;  2R3X A;  1SL1 B;  3GIX A;  4D73 A;  4QL7 A;  2RLI A;  1EEJ A;  4FH8 A;  2WB9 A;  1JLW A;  2JZT A;  5G1K A;  1YZX A;  2VCX A;  5GAP D;  1GSU A;  3ZVJ A;  3VWW A;  3I9V 2;  4E8H A;  2R37 A;  3UOM A;  4EL1 A;  1TU8 A;  2O89 A;  3WGD A;  4RQR A;  3TGZ A;  4HZ4 A;  1Y6E A;  4MPF A;  1ON4 A;  3ZRE A;  2QGV A;  1VF3 A;  4K1F A;  5HFG A;  4FIW A;  4KDX A;  3TRQ A;  2GQM A;  5JWO B;  2C3Q A;  4YAP A;  4IJI A;  4EO3 A;  3TCO A;  1YKA A;  3E0U A;  2OE0 A;  2LTK A;  5DQY A;  5GSS A;  1EV9 A;  1BG5 A;  1ZYQ B;  4DSS A;  1K0A A;  4HQZ A;  2FWG A;  2AUV A;  1V98 A;  4TXO B;  1V9W A;  1F37 A;  4IQ1 A;  3QFB C;  3EYT A;  4XS4 A;  3Q19 A;  2GLR A;  3SBC A;  20GS A;  1O85 A;  1JZO A;  1PRX A;  2X99 A;  1GLP A;  1U88 A;  3QR6 A;  2G0F A;  5D9W A;  4Q5N A;  2J23 A;  1AQX A;  4EKZ A;  3C1R A;  1EWX A;  1GLQ A;  5DAK A;  4LA1 A;  3VWU A;  2IMK A;  1GSE A;  3GST A;  2AV4 A;  3F9U A;  4Z7X A;  5D9T A;  2HLS A;  5JCU A;  5DJL A;  1ZL9 A;  3GL3 A;  1QGV A;  2JZR A;  3MDK A;  3RPN A;  4WEY A;  3ME7 A;  4XRA A;  5GST A;  2VM2 A;  2X8C A;  2VCQ A;  3RPP A;  1QK8 A;  2N5F A;  3BCI A;  4YQU A;  2XPD A;  1ZZY A;  4HEA 2;  4Q5Q A;  1FVK A;  2X8H A;  4ZL8 A;  3M9K A;  5G31 A;  2HNL A;  2DIY A;  3QAV A;  1I9D A;  2YCD A;  4MJE A;  1ZMA A;  1RQM A;  3IRA A;  5IO2 A;  2LNS A;  1QUW A;  4GSS A;  4ZL7 A;  1M7T A;  2DC5 A;  3GFK A;  3QCP A;  5IM9 A;  4OFT A;  3TKS E;  1X9M B;  2JZS A;  2X64 A;  1JZD A;  3A2W A;  5CRH A;  1PKW A;  5ECK B;  2L57 A;  4L0W A;  3UBK A;  2K6V A;  4KSO A;  3K8N A;  4GLT A;  4K8M A;  4O7H A;  2IMI A;  2B7K A;  2DJ2 A;  5E59 A;  3DVX A;  3V1W A;  1GSF A;  1WMJ A;  5KN0 A;  2EIR A;  3GA4 A;  5D96 A;  4ZB6 A;  2DLX A;  5EL8 A;  1R5A A;  3HKR A;  2P31 A;  4MPG A;  4ECI A;  1CQG A;  3BBY A;  2WCI A;  4K6X A;  2K8S A;  2PUK C;  1SK1 A;  4KAE A;  2LRN A;  4BWS A;  2H73 A;  3VPQ A;  4WBJ A;  3RAZ A;  2H70 A;  1U6T A;  3TJB A;  3D4M A;  1PX6 A;  1XWA A;  2EIQ A;  5COH A;  1VRS D;  5KN1 A;  2MYG A;  3LEF A;  3ZYW A;  1TK5 B;  1PSQ A;  3L9V A;  2B5E A;  4HDE A;  5F06 A;  3ZTL A;  3P8W A;  4CDO A;  2GZY A;  1EGR A;  4IEL A;  2FD3 A;  2BMX A;  2YNX A;  3KCM A;  4I6X A;  3WGX A;  5H5Q A;  3GTU B;  4GWR A;  5IMZ A;  1YEX A;  5CRW A;  1XVQ A;  2BJX A;  4OO4 A;  4DEJ A;  1ERU A;  1TW9 A;  4XCS A;  1EEM A;  5LNK e;  4XIH A;  3EMX A;  1SK2 A;  4XS6 A;  3EC3 A;  2C0G A;  2VOC A;  1I5G A;  1TRS A;  5ECH B;  2IMD A;  2VCZ A;  3C7M A;  4ZBD A;  1EP8 A;  5CO3 A;  3TB2 A;  1FB6 A;  3ERF A;  2ZCT A;  4POL A;  5J3R A;  3ERG A;  4MP4 A;  1XVW A;  3FY7 A;  3APQ A;  1NM3 A;  2PN8 A;  3FZ5 A;  4MMM A;  2R4V A;  2H8L A;  4I97 A;  1B9X C;  1E2Y A;  2A4V A;  3LSZ A;  4TR3 A;  4KND A;  4OD7 A;  2DJ1 A;  1KTE A;  2DSA A;  1KNG A;  1QMV A;  2JSY A;  5KEJ A;  2GT6 A;  1T7P B;  19GS A;  1ST9 A;  1SU9 A;  3CRT A;  3H1N A;  2NVL A;  1UN2 A;  2D2Z A;  4FYB A;  2DMM A;  4KCE A; 
#chains in the Genus database with same CATH topology
 4JED A;  4NV5 A;  1UA5 A;  5JWR B;  4MH3 A;  3IC4 A;  1SKS B;  1R7H A;  2VCW A;  4O32 A;  3N5O A;  2JAD A;  1HNB A;  5B6M A;  1O6J A;  3D21 A;  5B8B A;  4TR0 A;  3TRP A;  2IIY A;  3LXT A;  4YQV A;  4LL4 B;  3EPT A;  3IBH A;  1GL8 A;  1WWJ A;  5G30 A;  1KBN A;  3VFI A;  1X5E A;  4ML1 A;  1FVJ A;  2KUC A;  3UBL A;  2NBS A;  1BQ7 A;  5AIS A;  4MF5 A;  3L9U A;  1OC9 A;  5CNW A;  1FOH A;  3BD2 A;  5IPG A;  2VAF A;  1ERV A;  2LRC A;  3LWA A;  2MMA A;  3FHK A;  3TOU A;  2PVQ A;  1C72 A;  1OC3 A;  2C0F A;  2TRX A;  2AHE A;  2N5A A;  2F3M A;  1S3A A;  1YF1 A;  1F3B A;  1MDI A;  5CP1 A;  2V2G A;  2ON5 A;  1HQO A;  3MYD A;  4POB A;  4JR4 A;  3VI5 A;  5D9V A;  2OKA A;  1TK0 B;  1GSY A;  4ZBB A;  2YWI A;  1GP1 A;  18GS A;  3UVH A;  2VL3 A;  4KW6 A;  5IOW A;  1TDI A;  2CZ2 A;  1SL0 B;  1O8X A;  4D73 B;  1K0N A;  2HRK A;  4EC0 A;  2RM6 A;  5IPH A;  2B5Y A;  1A0R P;  2DJ3 A;  1ZYP A;  3I6A A;  2E2M A;  3O3T A;  4FO5 A;  4V1A p;  3IOS A;  4L5O A;  2CVK A;  2LST A;  1O7U A;  3FKF A;  3ISO A;  1PL1 A;  5A4W A;  3TJJ A;  2E2G A;  1DBY A;  3Q6O A;  4KE3 A;  2V41 A;  4ECB A;  3KTL A;  4X0X A;  1NSW A;  3EWL A;  1WP0 A;  5DVB A;  2QC7 A;  2C4J A;  3C71 A;  2B6M A;  1UVZ A;  4HZ2 A;  2PWJ A;  3GV1 A;  4ZXG A;  2LQO A;  4TXV A;  1O73 A;  3LW9 A;  2JL4 A;  4CY8 A;  1J9B A;  2AYT A;  2H6X A;  3H93 A;  1H4O A;  1GTB A;  4DSS B;  3ZMK A;  5F07 A;  1TRV A;  2YN1 A;  2GDR A;  3E3E A;  4XHM A;  5HFI A;  4XS4 B;  1R5P A;  3SWL A;  3HVN A;  1JHB A;  2GZP A;  3DEX A;  3F8U A;  3IDV A;  3O6T A;  3TKS A;  3CRU A;  3TDG A;  2HZF A;  3H79 A;  1XWK A;  3N9J A;  3KXO A;  2WFC A;  1JZR A;  3IXR A;  1A0F A;  1TI1 A;  3IAS 2;  3QMX A;  12GS A;  5DAK B;  4PUR A;  4YQM A;  4MDC A;  5F0G A;  3A2X A;  3HYP A;  4NMU A;  1BAY A;  4PGT A;  1VF1 A;  1ACV A;  1B8X A;  3FR3 A;  4OMV A;  5D8I A;  2LKU A;  2CX3 A;  3GRX A;  1SJI A;  1GSS A;  2C1Y A;  3C8E A;  3M9J A;  1TTZ A;  5G1L A;  3UEM A;  5HQP A;  1FAA A;  3L78 A;  2R2J A;  2YP6 A;  1ML6 A;  4EE0 A;  4TW5 A;  3QOU A;  4F82 A;  1AIU A;  3HJM A;  2NTO A;  2Z9S A;  5IMV A;  1TJD A;  4IW9 A;  9GSS A;  2LJK A;  3PGT A;  4PX1 A;  2A2P A;  3TRX A;  4EDZ A;  1JFU A;  3HJO A;  1FOV A;  1PD2 1;  1R26 A;  2QA2 A;  3FW2 A;  1IYH A;  3LFL A;  4YH2 A;  2QSI A;  4JE1 A;  2O85 A;  4NAX A;  2GSR A;  1S3C A;  3HJP A;  2YJH A;  4OFM A;  4BVX A;  2DBC A;  3QPM A;  3KEB A;  4KGI A;  3A2V A;  4PNG A;  1OAZ A;  3GUS A;  1GNW A;  3CSH A;  2VD0 A;  1F9M A;  2YAN A;  2GVP A;  1O8W A;  4HJ2 A;  5JWQ B;  3FZA A;  3APO A;  5KN3 A;  1M2D A;  1YDK A;  3LXZ A;  2H1G A;  1AQV A;  3TKR A;  5A5K A;  3IR4 A;  2QKE A;  1AAZ A;  2IFQ A;  3IPZ A;  3ZZX A;  3CQF A;  1Q98 A;  2B1L A;  2GGT A;  4K2X A;  4Q5R A;  2H0G A;  2A4H A;  2JU5 A;  1T00 A;  5B7C A;  3GKN A;  5CRG A;  4TOP A;  4KF9 A;  4NXI A;  3EIN A;  3AY8 A;  2H76 A;  3UL3 A;  1X9W B;  2MMN A;  1OE7 A;  4F0C A;  14GS A;  2LV3 A;  1WPI A;  5ELG A;  3HZ4 A;  17GS A;  1K0O A;  1A8Y A;  4QL9 A;  4MLY A;  2LJR A;  1E6B A;  5ECO B;  4QQ7 A;  4IP6 A;  4USS A;  4GQF A;  2GQK A;  4AGS A;  1EOG A;  4PQ1 A;  2GTU A;  1XW6 A;  3CYN A;  2DIZ A;  2H6Y A;  4I5Q A;  1FB0 A;  2YJ7 A;  4KA0 A;  5ECL B;  2FWH A;  3UMA A;  2HSH A;  1SYX A;  1XCC A;  1X0R A;  1M9A A;  4POM A;  5ECI B;  3TJF A;  2V6K A;  4MJB A;  1Z6M A;  2L5L A;  3FZ9 A;  2H72 A;  1GTA A;  3O76 A;  1ERW A;  3LOR A;  1Q4J A;  3KJY A;  4O5U A;  3QDN A;  4GSN A;  4TRX A;  4BWQ A;  2ZNM A;  2HFD A;  4MNN A;  2YWN A;  3D5J A;  5LD0 A;  5HFK A;  2DJJ A;  4JR6 A;  3KM6 A;  1THO A;  4MCU A;  2HRA A;  1EV4 A;  3GYK A;  2VCT A;  5KN2 A;  2HYX A;  2MZC A;  6GSV A;  2AAW A;  3IK7 A;  4TR4 A;  1BJX A;  2LEG A;  4HUA A;  1VGL A;  2XHF A;  4PTS A;  2I3Y A;  1XXU A;  22GS A;  3CTF A;  3HDC A;  4WF4 A;  1TOF A;  3KH9 A;  1ZOF A;  4MF6 A;  4WET A;  3RDW A;  2R5G A;  1THX A;  1A23 A;  2I81 A;  5FT3 A;  4IP1 A;  4NV2 A;  2LNT A;  1DSB A;  2I1U A;  3IAM 2;  1B4Q A;  5AGY A;  3HVX A;  1OC9 B;  4O92 A;  2H30 A;  4ZBA A;  4Z2T A;  4PXO A;  2FWE A;  3KMO A;  4YKF A;  4WXT A;  4A5P A;  3HCZ A;  5J41 A;  2WRT A;  2LRT A;  2LQQ A;  3F3Q A;  1MD4 A;  3MNG A;  1XWC A;  3HVV A;  1GRX A;  3WT2 A;  4X43 A;  1XWB A;  2CV4 A;  2K18 A;  2N5B A;  3D0Z A;  2WZ9 A;  1TXX A;  3UJ1 A;  3F6D A;  3IV4 A;  1YEP A;  3A5I A;  1WJK A;  3FZ4 A;  3PIN A;  3Q74 A;  2OE3 A;  1G7O A;  1B9Y C;  2ZUP A;  1A24 A;  4LLR A;  4PQH A;  2H0H A;  2FA4 A;  2VLU A;  1K3O A;  4IN0 A;  1OKT A;  2ALB A;  3BCK A;  3JCM L;  2V32 A;  2H74 A;  3DXB A;  1K3Y A;  2IME A;  5ECS A;  1JLV A;  3J7Y k;  3KIJ A;  2P0G A;  5H5R A;  3LYK A;  1DE2 A;  2P5Q A;  4KDY A;  3KTB A;  5EY6 A;  1EP7 A;  3GSS A;  1K3L A;  2H19 A;  5ID2 A;  2G2Q A;  4XRD A;  1T4Y A;  1GSQ A;  2PU9 C;  2F9S A;  2X49 A;  2AJQ B;  4IKH A;  5DAL A;  3R3E A;  1QXH A;  4ILF A;  2YWM A;  4DSR A;  1PQN A;  4JRR A;  2YV7 A;  2HE3 A;  5DCG A;  2C80 A;  6GSS A;  3TJK A;  5HR2 A;  2VUP A;  4DVC A;  1WE0 A;  1FO5 A;  4G2E A;  4PQI A;  3W8J A;  5ECM B;  2MMO A;  5HR3 A;  3CMI A;  4KCA A;  2HT9 A;  8GSS A;  1T4Z A;  4KUN A;  3F63 A;  4Q5F A;  5G5F A;  1M0U A;  2FWF A;  2L4C A;  4NPB A;  5EPF A;  1AW9 A;  1LJR A;  16GS A;  4WF5 A;  1DE1 A;  1NW2 A;  1TRW A;  1X5C A;  4V2N A;  3GH6 A;  4ID0 A;  3PH9 A;  2IWT A;  4F03 A;  3EMP A;  1TI3 A;  4G19 A;  6GSX A;  2VL9 A;  1B4P A;  3M1G A;  1VF4 A;  3RBT A;  3UAP A;  4EUY A;  4BVY A;  4TR1 A;  4ZB8 A;  3RHC A;  1SD9 A;  1YY7 A;  4L8E A;  3I69 A;  4G10 A;  5F05 A;  4BA7 A;  1YQ1 A;  4CW9 A;  4EVM A;  2FCH A;  4FQU A;  3DGQ A;  3WYW A;  4V1A g;  2F51 A;  4K7I A;  4Z2U A;  2CAQ A;  5IMC A;  1GUH A;  3H8Q A;  4JBB A;  1KEB A;  4IVF A;  1WIK A;  1M2A A;  3CSI A;  2TRC P;  3KZQ A;  3KH7 A;  2PER A;  4I2T A;  1Z7P A;  2V6O A;  4ZB9 A;  1ERT A;  2R0P A;  2RII A;  2OJL A;  4WR4 A;  2CX4 A;  2X8G A;  3ZIJ A;  2PGT A;  2YZU A;  2HZE A;  5FHI A;  3EE2 A;  2M80 A;  4BVX B;  3IC8 A;  2HXK A;  3WT1 A;  4N0Z A;  1G7E A;  4BPY A;  3GX0 A;  3ZVJ D;  1SJZ A;  2E7P A;  4HU7 A;  5CYY A;  4NHW A;  2YWO A;  5BMU A;  4ISD A;  5DDL A;  4NWY A;  3KP8 A;  5IMA A;  3DML A;  1YF0 A;  3UIW A;  5G5E A;  3L0H A;  3GKX A;  3VWV A;  2IFQ B;  2VO4 A;  1MDJ A;  3KMN A;  1GTI A;  5HR1 A;  4EXJ A;  2VLT A;  1USB A;  2OA7 A;  3CTG A;  3LQ7 A;  2EIO A;  2HSM A;  2YZH A;  3EU3 A;  5F8B A;  4OCE A;  1BYE A;  2H71 A;  2REM A;  3FR6 A;  3F3R A;  1SD8 A;  2WUL A;  2VL2 C;  5J9B A;  1PKZ A;  4BL7 A;  2DKH A;  4XS1 A;  2CAI A;  3TJG A;  4HS1 A;  2ES7 A;  2FHE A;  3CXG A;  1SJ6 A;  4WBR D;  3ZIT A;  2B3S A;  4V2L A;  1XZO A;  4HI7 A;  4K5R A;  3D6I A;  5IO0 A;  4RUV A;  4ULX A;  3VK9 A;  4POK A;  5KOX A;  2R0G A;  4WR5 A;  3RHB A;  1OC8 A;  1K0B A;  1AUC A;  2LJA A;  4AJ6 A;  2F8A A;  4FYC A;  1F6M C;  3IHQ A;  2DJ0 A;  1GUM A;  3G7J A;  3VPT A;  1QQ2 A;  1MDK A;  3KP9 A;  4MK3 A;  4KX4 A;  4GQC A;  1N2A A;  2OAD A;  4IQA A;  3M3M A;  1RW1 A;  1Y25 A;  3ZFB A;  4K7O A;  2OAC A;  1OVN A;  4G9H A;  4IGJ A;  3APS A;  4RQX A;  5A4U A;  3S9F A;  1HNA A;  4HOJ A;  2VM1 A;  1OYJ A;  1IYI A;  2L4Q A;  5ENU A;  6GSY A;  4IBP A;  2HI7 A;  2CT6 A;  5CRE A;  1TK8 B;  3GX8 A;  3P7X A;  5G2Z A;  1ZYE A;  1V40 A;  1NHO A;  4CY6 A;  4I8B A;  4AJ8 A;  4N0V A;  5B6N A;  4TVE A;  2A2R A;  3WGE A;  3QAG A;  3QD9 A;  3DKS A;  1SKW B;  2GZZ A;  2DJK A;  2R6K A;  1PX7 A;  3DWV A;  3M8N A;  3U6V A;  2L5O A;  1M3J A;  5JCG A;  4ZIJ A;  1FG4 A;  1K0C A;  3TOT A;  2L6C A;  2KOK A;  1PL2 A;  4MA9 A;  2L6D A;  3L9S A;  1AXD A;  1EOH A;  2MMZ A;  13GS A;  3VWX A;  1B48 A;  3ZIV A;  4K2D A;  2FLS A;  5ELA A;  4LMW A;  1H75 A;  3ZL5 A;  1OKD A;  1QFN A;  4IS0 A;  2KP1 A;  2XPE A;  3HD5 A;  2PMT A;  3J7Y b;  2YPM A;  5GZZ B;  3NZN A;  3US3 A;  1A2L A;  3A3T A;  3W6G A;  1DUG A;  1SL2 B;  1ZCP A;  4ACS A;  2CVD A;  1GH2 A;  3R2Q A;  1X9S B;  1Z6N A;  1PA3 A;  4WKW A;  3ED3 A;  3LYP A;  4MJA A;  1GTU A;  4ZL9 A;  3TUE A;  4OFN A;  5ECN B;  3W8S A;  2C0D A;  1BED A;  2UZ8 A;  4JZQ A;  2OBK A;  3HA9 A;  4PUF C;  4L0U A;  2M46 A;  3A5W A;  3HVS A;  2VCV A;  2FGX A;  1GNE A;  2C3T A;  4ZIL A;  3DRN A;  3FMW A;  3I43 A;  5DCH A;  1UC7 A;  2KLX A;  7GSS A;  1XOB A;  4K0G A;  1GSD A;  4X1U A;  4MZC A;  3DIE A;  3HXS A;  1LU4 A;  1SK0 A;  3GKK A;  4ECJ A;  3TKQ A;  2NDO A;  1A2M A;  2P5R A;  1LBK A;  2ON7 A;  4TXO A;  4AJ7 A;  3VUR A;  2H6Z A;  3BJ5 A;  2HSY A;  4TN8 A;  5ID2 B;  1XWG A;  2GSS A;  3MWH A;  2I4A A;  4N30 A;  5DJM A;  2IPA A;  2NPB A;  5J5N A;  2YOI A;  2CQ9 A;  1WRY A;  3DYR A;  4GST A;  3MAK A;  4MAB A;  3IK9 A;  1FHE A;  5DAL B;  2IN3 A;  3LGC A;  4P3Y B;  3G9B A;  4ML6 A;  1ABA A;  1J0F A;  2EC4 A;  3G7Y A;  2M72 A;  3P90 A;  5HR0 A;  4PUA A;  1NHY A;  5ABR A;  2JAC A;  2H01 A;  2CA8 A;  3KGK A;  2H66 A;  2VIM A;  1M9B A;  1HNC A;  2FUG 2;  4GF0 A;  3HZ8 A;  3UVT A;  3E9J B;  3D4T A;  2H75 A;  3ZFL A;  4YAV A;  2BTO T;  2MBT A;  5C04 A;  3KD0 A;  1T8E B;  4H86 A;  1XIY A;  4XTS A;  5CRD A;  1XPV A;  3GKM A;  5EVO A;  3UAR A;  2PBJ A;  4MZW A;  3VI7 A;  5J4U A;  3ME8 A;  3P2A A;  2GQL A;  1AC1 A;  1GWC A;  3ZML A;  1GUK A;  4J56 E;  1K0M A;  5D73 A;  3NIV A;  1XW5 A;  4MZB A;  4FYU A;  5L71 A;  4OCF A;  5INY A;  3EUR A;  3MIX A;  4BVY B;  2DKI A;  4TR1 B;  4K0N A;  1MEK A;  1XOA A;  1U3I A;  3ERW A;  4J57 E;  1V2A A;  4K7N A;  2DML A;  5DQS A;  1N8J A;  4HSC X;  4CHS A;  2C0E A;  2FNO A;  3MSZ A;  3L4N A;  5C00 A;  5IQY A;  1X5D A;  1XBS A;  1Z5Y E;  2J9H A;  1W4V A;  5E4W A;  1U87 A;  3GHA A;  6GST A;  2IJY A;  1HD2 A;  4V2M A;  3FR9 A;  4RI7 A;  3IHG A;  1W89 A;  1JZW A;  2H1B A;  2X4A A;  1URM A;  2XBQ A;  1MTC A;  1PN9 A;  2WJU A;  4O5R A;  3LG6 A;  2RUE A;  4BIK A;  1F2E A;  2RM5 A;  3C73 A;  1EGO A;  1BX9 A;  4KH7 A;  1XG8 A;  4GRF A;  2HZE B;  4EDY A;  5B8A A;  2E0Q A;  4GTU A;  3GNJ A;  3GH9 A;  1FW1 A;  1U3A A;  2GT5 A;  1G6W A;  3WD6 A;  1G0T A;  2AB6 A;  4K5S A;  2WS2 A;  1ZGN A;  3NOF A;  1T3B A;  4IHU A;  3FRC A;  1ILO A;  1HYU A;  2HRN A;  3M0F A;  3CSJ A;  2O87 A;  3CBU A;  1Z7R A;  4MF7 A;  2L59 A;  1VF2 A;  4GXZ A;  4PNF A;  2LS5 A;  2IMF A;  1O81 A;  3GTU A;  5D93 A;  1A8L A;  4HJM A;  5ECP B;  1PMT A;  3G7I A;  2MBS A;  3LJR A;  2FA8 A;  5CAX A;  2K8V A;  3F6F A;  3DD3 A;  5ECR B;  4K9Z A;  2XBI A;  3C1S A;  3F4S A;  2B1K A;  1A2J A;  1RK4 A;  3PR8 A;  4KDU A;  1J08 A;  5JCW A;  3QFA C;  1PGT A;  3HY2 A;  4BL7 B;  1Z9H A;  4ECC A;  3EVI A;  1Z3E A;  3GN3 A;  2V1M A;  3IE3 A;  2A2S A;  5AIX A;  1CQH A;  4EIQ A;  2GSQ A;  2CZ3 A;  5LCZ A;  1AQW A;  3FYG A;  2B7J A;  3D22 A;  5AIV A;  5J9C A;  2VLV A;  2YV9 A;  3Q18 A;  4LL1 B;  2IL3 A;  4KB3 A;  1M2B A;  2H1A A;  2PVO C;  1TKD B;  1M99 A;  2H1D A;  3GUR A;  3U5R E;  4N10 A;  4J2F A;  5IMF A;  1SEN A;  3EU4 A;  4F2I A;  1XFL A;  1YKC A;  4MH2 A;  5GAN D;  1TU7 A;  2GS3 A;  3F4R A;  2C8U A;  2B5X A;  2FY6 A;  1K0D A;  5IOX A;  2RUF A;  2CVB A;  2KHP A;  4GCI A;  3FK8 A;  5ECQ B;  1GUL A;  2F8F A;  4F0B A;  1TRU A;  6GSU A;  5A4V A;  4RI6 A;  2TIR A;  4NHZ A;  4OO5 A;  1YJ6 A;  2O8V B;  2H0I A;  11GS A;  3GL5 A;  2VD1 A;  4IJ3 A;  3DVW A;  1G6Y A;  5IMD A;  4L5L A;  3BOA A;  3F4T A;  4EF0 A;  1WOU A;  4OWY A;  5IIZ A;  1V58 A;  1XW9 A;  1F3A A;  3HHV A;  4JU5 A;  1OE8 A;  2WDU A;  3TKP A;  2GST A;  4AF2 A;  1R4W A;  6GSW A;  4N11 A;  2HRF A;  1V57 A;  2VL2 A;  2LUS A;  2O7K A;  2OE1 A;  1MD3 A;  5AN1 A;  3VLN A;  10GS A;  3QAW A;  4G0I A;  3PPU A;  1S3D A;  2JSZ A;  2WGR A;  4HQS A;  2KP2 A;  4TKY A;  4LMV A;  3H4K A;  5D9X A;  2PPT A;  3IA1 A;  2OBI A;  2I9H A;  3FEU A;  4HU9 A;  5FWG A;  5DBQ A;  4G0K A;  2K9F A;  1SKR B;  1SYR A;  4DSQ A;  4F9Z A;  2XC2 A;  4I2U A;  4E8E A;  3ZLP A;  3OR5 A;  5H5S A;  4MJC A;  1TP9 A;  3F0I A;  3ZRD A;  3TKS C;  4KSM A;  1EZK A;  2C3N A;  3GMF A;  1T1V A;  2R3X A;  1SL1 B;  3GIX A;  4D73 A;  4QL7 A;  2RLI A;  1EEJ A;  4FH8 A;  2WB9 A;  1JLW A;  2JZT A;  5G1K A;  1YZX A;  2VCX A;  5GAP D;  1GSU A;  3ZVJ A;  3VWW A;  3I9V 2;  4E8H A;  2R37 A;  3UOM A;  4EL1 A;  1TU8 A;  2O89 A;  3WGD A;  4RQR A;  4EIP A;  3TGZ A;  4HZ4 A;  1Y6E A;  4MPF A;  1ON4 A;  3ZRE A;  2QGV A;  1VF3 A;  4K1F A;  5HFG A;  4FIW A;  4KDX A;  3TRQ A;  2GQM A;  5JWO B;  2C3Q A;  4YAP A;  4IJI A;  4EO3 A;  3TCO A;  1YKA A;  3E0U A;  2OE0 A;  2LTK A;  5DQY A;  2R0C A;  5GSS A;  1EV9 A;  1BG5 A;  1ZYQ B;  4DSS A;  1K0A A;  4HQZ A;  2FWG A;  2AUV A;  1V98 A;  4TXO B;  1V9W A;  1F37 A;  4IQ1 A;  3QFB C;  3EYT A;  4XS4 A;  3Q19 A;  2GLR A;  3SBC A;  20GS A;  1O85 A;  1JZO A;  1PRX A;  2X99 A;  1GLP A;  1U88 A;  3QR6 A;  2G0F A;  4ICY A;  5D9W A;  4Q5N A;  2J23 A;  1AQX A;  4EKZ A;  3C1R A;  1EWX A;  1GLQ A;  5DAK A;  4LA1 A;  3VWU A;  2IMK A;  1GSE A;  3GST A;  2AV4 A;  3F9U A;  4Z7X A;  5D9T A;  2HLS A;  5JCU A;  5DJL A;  1ZL9 A;  3GL3 A;  1QGV A;  2JZR A;  3MDK A;  3RPN A;  4WEY A;  3ME7 A;  4XRA A;  5GST A;  2VM2 A;  2X8C A;  2VCQ A;  3RPP A;  1QK8 A;  2N5F A;  3BCI A;  4YQU A;  2XPD A;  1ZZY A;  4HEA 2;  4Q5Q A;  1FVK A;  2X8H A;  4ZL8 A;  3M9K A;  5G31 A;  2HNL A;  2DIY A;  3QAV A;  1I9D A;  2YCD A;  4MJE A;  1ZMA A;  1RQM A;  2QA1 A;  3IRA A;  1S3R A;  5IO2 A;  2LNS A;  1QUW A;  4GSS A;  4ZL7 A;  1M7T A;  2DC5 A;  3GFK A;  3QCP A;  5IM9 A;  4OFT A;  3TKS E;  1X9M B;  2JZS A;  2X64 A;  1JZD A;  3A2W A;  5CRH A;  1PKW A;  2L57 A;  5ECK B;  4L0W A;  3UBK A;  2K6V A;  4KSO A;  3K8N A;  4GLT A;  4K8M A;  4O7H A;  2IMI A;  2B7K A;  2DJ2 A;  3DVX A;  5E59 A;  3V1W A;  1GSF A;  1WMJ A;  5KN0 A;  2EIR A;  3GA4 A;  5D96 A;  4ZB6 A;  2DLX A;  4X4J A;  5EL8 A;  1R5A A;  3HKR A;  2P31 A;  4MPG A;  4ECI A;  1CQG A;  3BBY A;  2WCI A;  4K6X A;  2K8S A;  5KOW A;  2PUK C;  1SK1 A;  4KAE A;  2LRN A;  4BWS A;  2H73 A;  3VPQ A;  1ZYN A;  4WBJ A;  3RAZ A;  4Z2R A;  2H70 A;  1U6T A;  3TJB A;  3D4M A;  1PX6 A;  1XWA A;  2EIQ A;  5COH A;  1VRS D;  5KN1 A;  2MYG A;  4O5Q A;  3LEF A;  3ZYW A;  1TK5 B;  1PSQ A;  3L9V A;  2B5E A;  4HDE A;  5F06 A;  3ZTL A;  3P8W A;  4CDO A;  2GZY A;  1EGR A;  4IEL A;  2FD3 A;  2BMX A;  2YNX A;  1PN0 A;  3KCM A;  4I6X A;  3WGX A;  5H5Q A;  5BRT A;  3GTU B;  4GWR A;  5IMZ A;  1YEX A;  1M3I A;  5CRW A;  1XVQ A;  1PFO A;  2BJX A;  4OO4 A;  4DEJ A;  1ERU A;  1TW9 A;  4XCS A;  1EEM A;  5LNK e;  4XIH A;  3EMX A;  1SK2 A;  4XS6 A;  3EC3 A;  4YKG A;  2C0G A;  2VOC A;  1I5G A;  1TRS A;  5ECH B;  2IMD A;  2VCZ A;  3C7M A;  4ZBD A;  1EP8 A;  5CO3 A;  3TB2 A;  1FB6 A;  3ERF A;  4G0L A;  2ZCT A;  4POL A;  5J3R A;  3ERG A;  4MP4 A;  1XVW A;  3FY7 A;  3APQ A;  1NM3 A;  2PN8 A;  3FZ5 A;  4MMM A;  2R4V A;  2H8L A;  4I97 A;  1B9X C;  1E2Y A;  2A4V A;  3LSZ A;  4TR3 A;  4KND A;  4OD7 A;  2DJ1 A;  1KTE A;  2DSA A;  1KNG A;  1QMV A;  2JSY A;  5KEJ A;  2GT6 A;  1T7P B;  19GS A;  1ST9 A;  1SU9 A;  3CRT A;  3H1N A;  2NVL A;  1UN2 A;  2D2Z A;  4FYB A;  2DMM A;  4KCE A; 
#chains in the Genus database with same CATH homology
 4JED A;  4NV5 A;  1UA5 A;  5JWR B;  4MH3 A;  3IC4 A;  1SKS B;  1R7H A;  2VCW A;  4O32 A;  3N5O A;  2JAD A;  1HNB A;  5B6M A;  1O6J A;  3D21 A;  5B8B A;  4TR0 A;  3TRP A;  2IIY A;  3LXT A;  4YQV A;  4LL4 B;  3EPT A;  3IBH A;  1GL8 A;  1WWJ A;  5G30 A;  1KBN A;  3VFI A;  1X5E A;  4ML1 A;  1FVJ A;  2KUC A;  3UBL A;  2NBS A;  1BQ7 A;  5AIS A;  4MF5 A;  3L9U A;  1OC9 A;  5CNW A;  1FOH A;  3BD2 A;  5IPG A;  2VAF A;  1ERV A;  2LRC A;  3LWA A;  2MMA A;  3FHK A;  3TOU A;  2PVQ A;  1C72 A;  1OC3 A;  2C0F A;  2TRX A;  2AHE A;  2N5A A;  2F3M A;  1S3A A;  1YF1 A;  1F3B A;  1MDI A;  5CP1 A;  2V2G A;  2ON5 A;  1HQO A;  3MYD A;  4POB A;  4JR4 A;  3VI5 A;  5D9V A;  2OKA A;  1TK0 B;  1GSY A;  4ZBB A;  2YWI A;  1GP1 A;  18GS A;  3UVH A;  2VL3 A;  4KW6 A;  5IOW A;  1TDI A;  2CZ2 A;  1SL0 B;  1O8X A;  4D73 B;  1K0N A;  2HRK A;  4EC0 A;  2RM6 A;  5IPH A;  2B5Y A;  1A0R P;  2DJ3 A;  1ZYP A;  3I6A A;  2E2M A;  3O3T A;  4FO5 A;  4V1A p;  3IOS A;  4L5O A;  2CVK A;  2LST A;  1O7U A;  3FKF A;  3ISO A;  1PL1 A;  5A4W A;  3TJJ A;  2E2G A;  1DBY A;  3Q6O A;  4KE3 A;  2V41 A;  4ECB A;  3KTL A;  4X0X A;  1NSW A;  3EWL A;  1WP0 A;  5DVB A;  2QC7 A;  2C4J A;  3C71 A;  2B6M A;  1UVZ A;  4HZ2 A;  2PWJ A;  3GV1 A;  4ZXG A;  2LQO A;  4TXV A;  1O73 A;  3LW9 A;  2JL4 A;  4CY8 A;  1J9B A;  2AYT A;  2H6X A;  3H93 A;  1H4O A;  1GTB A;  4DSS B;  3ZMK A;  5F07 A;  1TRV A;  2YN1 A;  2GDR A;  3E3E A;  4XHM A;  5HFI A;  4XS4 B;  1R5P A;  3SWL A;  1JHB A;  2GZP A;  3DEX A;  3F8U A;  3IDV A;  3O6T A;  3TKS A;  3CRU A;  3TDG A;  2HZF A;  3H79 A;  1XWK A;  3N9J A;  3KXO A;  2WFC A;  1JZR A;  3IXR A;  1A0F A;  1TI1 A;  3IAS 2;  3QMX A;  12GS A;  5DAK B;  4PUR A;  4YQM A;  4MDC A;  5F0G A;  3A2X A;  3HYP A;  4NMU A;  1BAY A;  4PGT A;  1VF1 A;  1ACV A;  1B8X A;  3FR3 A;  4OMV A;  5D8I A;  2LKU A;  2CX3 A;  3GRX A;  1SJI A;  1GSS A;  2C1Y A;  3C8E A;  3M9J A;  1TTZ A;  5G1L A;  3UEM A;  5HQP A;  1FAA A;  3L78 A;  2R2J A;  2YP6 A;  1ML6 A;  4EE0 A;  4TW5 A;  3QOU A;  4F82 A;  1AIU A;  3HJM A;  2NTO A;  2Z9S A;  5IMV A;  1TJD A;  4IW9 A;  9GSS A;  2LJK A;  3PGT A;  4PX1 A;  2A2P A;  3TRX A;  4EDZ A;  1JFU A;  3HJO A;  1FOV A;  1PD2 1;  1R26 A;  2QA2 A;  3FW2 A;  1IYH A;  3LFL A;  4YH2 A;  2QSI A;  4JE1 A;  2O85 A;  4NAX A;  2GSR A;  1S3C A;  3HJP A;  2YJH A;  4OFM A;  4BVX A;  2DBC A;  3QPM A;  3KEB A;  4KGI A;  3A2V A;  4PNG A;  1OAZ A;  3GUS A;  1GNW A;  3CSH A;  2VD0 A;  1F9M A;  2YAN A;  2GVP A;  1O8W A;  4HJ2 A;  5JWQ B;  3FZA A;  3APO A;  5KN3 A;  1M2D A;  1YDK A;  3LXZ A;  2H1G A;  1AQV A;  3TKR A;  5A5K A;  3IR4 A;  2QKE A;  1AAZ A;  2IFQ A;  3IPZ A;  3ZZX A;  1Q98 A;  2B1L A;  2GGT A;  4K2X A;  4Q5R A;  2H0G A;  2A4H A;  2JU5 A;  1T00 A;  5B7C A;  3GKN A;  5CRG A;  4TOP A;  4KF9 A;  4NXI A;  3EIN A;  3AY8 A;  2H76 A;  3UL3 A;  1X9W B;  2MMN A;  1OE7 A;  4F0C A;  14GS A;  2LV3 A;  1WPI A;  5ELG A;  3HZ4 A;  17GS A;  1K0O A;  1A8Y A;  4QL9 A;  4MLY A;  2LJR A;  1E6B A;  5ECO B;  4QQ7 A;  4IP6 A;  4USS A;  4GQF A;  2GQK A;  4AGS A;  1EOG A;  4PQ1 A;  2GTU A;  1XW6 A;  3CYN A;  2DIZ A;  2H6Y A;  4I5Q A;  1FB0 A;  2YJ7 A;  4KA0 A;  5ECL B;  2FWH A;  3UMA A;  2HSH A;  1SYX A;  1XCC A;  1X0R A;  1M9A A;  4POM A;  5ECI B;  3TJF A;  2V6K A;  4MJB A;  1Z6M A;  2L5L A;  3FZ9 A;  2H72 A;  1GTA A;  3O76 A;  1ERW A;  3LOR A;  1Q4J A;  3KJY A;  4O5U A;  3QDN A;  4GSN A;  4TRX A;  4BWQ A;  2ZNM A;  2HFD A;  4MNN A;  2YWN A;  3D5J A;  5LD0 A;  5HFK A;  2DJJ A;  4JR6 A;  3KM6 A;  1THO A;  4MCU A;  2HRA A;  1EV4 A;  3GYK A;  2VCT A;  5KN2 A;  2HYX A;  2MZC A;  6GSV A;  2AAW A;  3IK7 A;  4TR4 A;  1BJX A;  2LEG A;  4HUA A;  1VGL A;  2XHF A;  4PTS A;  2I3Y A;  1XXU A;  22GS A;  3CTF A;  3HDC A;  4WF4 A;  1TOF A;  3KH9 A;  1ZOF A;  4MF6 A;  4WET A;  3RDW A;  2R5G A;  1THX A;  1A23 A;  2I81 A;  5FT3 A;  4IP1 A;  4NV2 A;  2LNT A;  1DSB A;  2I1U A;  3IAM 2;  1B4Q A;  5AGY A;  3HVX A;  1OC9 B;  4O92 A;  2H30 A;  4ZBA A;  4Z2T A;  4PXO A;  2FWE A;  3KMO A;  4YKF A;  4WXT A;  4A5P A;  3HCZ A;  5J41 A;  2WRT A;  2LRT A;  2LQQ A;  3F3Q A;  1MD4 A;  3MNG A;  1XWC A;  3HVV A;  1GRX A;  3WT2 A;  4X43 A;  1XWB A;  2CV4 A;  2K18 A;  2N5B A;  3D0Z A;  2WZ9 A;  1TXX A;  3UJ1 A;  3F6D A;  3IV4 A;  1YEP A;  3A5I A;  1WJK A;  3FZ4 A;  3PIN A;  3Q74 A;  2OE3 A;  1G7O A;  1B9Y C;  2ZUP A;  1A24 A;  4LLR A;  4PQH A;  2H0H A;  2FA4 A;  2VLU A;  1K3O A;  4IN0 A;  1OKT A;  2ALB A;  3BCK A;  3JCM L;  2V32 A;  2H74 A;  3DXB A;  1K3Y A;  2IME A;  5ECS A;  1JLV A;  3J7Y k;  3KIJ A;  2P0G A;  5H5R A;  3LYK A;  1DE2 A;  2P5Q A;  4KDY A;  3KTB A;  5EY6 A;  1EP7 A;  3GSS A;  1K3L A;  2H19 A;  5ID2 A;  2G2Q A;  4XRD A;  1T4Y A;  1GSQ A;  2PU9 C;  2F9S A;  2X49 A;  2AJQ B;  4IKH A;  5DAL A;  3R3E A;  1QXH A;  4ILF A;  2YWM A;  4DSR A;  1PQN A;  4JRR A;  2YV7 A;  2HE3 A;  5DCG A;  2C80 A;  6GSS A;  3TJK A;  5HR2 A;  2VUP A;  4DVC A;  1WE0 A;  1FO5 A;  4G2E A;  4PQI A;  3W8J A;  5ECM B;  2MMO A;  5HR3 A;  3CMI A;  4KCA A;  2HT9 A;  8GSS A;  1T4Z A;  4KUN A;  3F63 A;  4Q5F A;  5G5F A;  1M0U A;  2FWF A;  2L4C A;  4NPB A;  5EPF A;  1AW9 A;  1LJR A;  16GS A;  4WF5 A;  1DE1 A;  1NW2 A;  1TRW A;  1X5C A;  4V2N A;  3GH6 A;  4ID0 A;  3PH9 A;  2IWT A;  4F03 A;  3EMP A;  1TI3 A;  4G19 A;  6GSX A;  2VL9 A;  1B4P A;  3M1G A;  1VF4 A;  3RBT A;  3UAP A;  4EUY A;  4BVY A;  4TR1 A;  4ZB8 A;  3RHC A;  1SD9 A;  1YY7 A;  4L8E A;  3I69 A;  4G10 A;  5F05 A;  4BA7 A;  1YQ1 A;  4CW9 A;  4EVM A;  2FCH A;  4FQU A;  3DGQ A;  3WYW A;  4V1A g;  2F51 A;  4K7I A;  4Z2U A;  2CAQ A;  5IMC A;  1GUH A;  3H8Q A;  4JBB A;  1KEB A;  4IVF A;  1WIK A;  1M2A A;  3CSI A;  2TRC P;  3KZQ A;  3KH7 A;  2PER A;  4I2T A;  1Z7P A;  2V6O A;  4ZB9 A;  1ERT A;  2R0P A;  2RII A;  2OJL A;  4WR4 A;  2CX4 A;  2X8G A;  3ZIJ A;  2PGT A;  2YZU A;  2HZE A;  5FHI A;  3EE2 A;  2M80 A;  4BVX B;  3IC8 A;  2HXK A;  3WT1 A;  4N0Z A;  1G7E A;  4BPY A;  3GX0 A;  3ZVJ D;  1SJZ A;  2E7P A;  4HU7 A;  5CYY A;  4NHW A;  2YWO A;  5BMU A;  4ISD A;  5DDL A;  4NWY A;  3KP8 A;  5IMA A;  3DML A;  1YF0 A;  3UIW A;  5G5E A;  3L0H A;  3GKX A;  3VWV A;  2IFQ B;  2VO4 A;  1MDJ A;  3KMN A;  1GTI A;  5HR1 A;  4EXJ A;  2VLT A;  1USB A;  2OA7 A;  3CTG A;  3LQ7 A;  2EIO A;  2HSM A;  2YZH A;  3EU3 A;  5F8B A;  4OCE A;  1BYE A;  2H71 A;  2REM A;  3FR6 A;  3F3R A;  1SD8 A;  2WUL A;  2VL2 C;  5J9B A;  1PKZ A;  4BL7 A;  2DKH A;  4XS1 A;  2CAI A;  3TJG A;  4HS1 A;  2ES7 A;  2FHE A;  3CXG A;  1SJ6 A;  4WBR D;  3ZIT A;  2B3S A;  4V2L A;  1XZO A;  4HI7 A;  4K5R A;  3D6I A;  5IO0 A;  4RUV A;  4ULX A;  3VK9 A;  4POK A;  5KOX A;  2R0G A;  4WR5 A;  3RHB A;  1OC8 A;  1K0B A;  1AUC A;  2LJA A;  4AJ6 A;  2F8A A;  4FYC A;  1F6M C;  3IHQ A;  2DJ0 A;  1GUM A;  3G7J A;  3VPT A;  1QQ2 A;  1MDK A;  3KP9 A;  4MK3 A;  4KX4 A;  4GQC A;  1N2A A;  2OAD A;  4IQA A;  3M3M A;  1RW1 A;  1Y25 A;  3ZFB A;  4K7O A;  2OAC A;  1OVN A;  4G9H A;  4IGJ A;  3APS A;  4RQX A;  5A4U A;  3S9F A;  1HNA A;  4HOJ A;  2VM1 A;  1OYJ A;  1IYI A;  2L4Q A;  5ENU A;  6GSY A;  4IBP A;  2HI7 A;  2CT6 A;  5CRE A;  1TK8 B;  3GX8 A;  3P7X A;  5G2Z A;  1ZYE A;  1V40 A;  1NHO A;  4CY6 A;  4I8B A;  4AJ8 A;  4N0V A;  5B6N A;  4TVE A;  2A2R A;  3WGE A;  3QAG A;  3QD9 A;  3DKS A;  1SKW B;  2GZZ A;  2DJK A;  2R6K A;  1PX7 A;  3DWV A;  3M8N A;  3U6V A;  2L5O A;  5JCG A;  4ZIJ A;  1FG4 A;  1K0C A;  3TOT A;  2L6C A;  2KOK A;  1PL2 A;  4MA9 A;  2L6D A;  3L9S A;  1AXD A;  1EOH A;  2MMZ A;  13GS A;  3VWX A;  1B48 A;  3ZIV A;  4K2D A;  2FLS A;  5ELA A;  4LMW A;  1H75 A;  3ZL5 A;  1OKD A;  1QFN A;  4IS0 A;  2KP1 A;  2XPE A;  3HD5 A;  2PMT A;  3J7Y b;  2YPM A;  5GZZ B;  3NZN A;  3US3 A;  1A2L A;  3A3T A;  3W6G A;  1DUG A;  1SL2 B;  1ZCP A;  4ACS A;  2CVD A;  1GH2 A;  3R2Q A;  1X9S B;  1Z6N A;  1PA3 A;  4WKW A;  3ED3 A;  3LYP A;  4MJA A;  1GTU A;  4ZL9 A;  3TUE A;  4OFN A;  5ECN B;  3W8S A;  2C0D A;  1BED A;  2UZ8 A;  4JZQ A;  2OBK A;  3HA9 A;  4PUF C;  4L0U A;  2M46 A;  3A5W A;  3HVS A;  2VCV A;  2FGX A;  1GNE A;  2C3T A;  4ZIL A;  3DRN A;  3FMW A;  3I43 A;  5DCH A;  1UC7 A;  2KLX A;  7GSS A;  1XOB A;  4K0G A;  1GSD A;  4X1U A;  4MZC A;  3DIE A;  3HXS A;  1LU4 A;  1SK0 A;  3GKK A;  4ECJ A;  3TKQ A;  2NDO A;  1A2M A;  2P5R A;  1LBK A;  2ON7 A;  4TXO A;  4AJ7 A;  3VUR A;  2H6Z A;  3BJ5 A;  2HSY A;  4TN8 A;  5ID2 B;  1XWG A;  2GSS A;  3MWH A;  2I4A A;  4N30 A;  5DJM A;  2IPA A;  2NPB A;  5J5N A;  2YOI A;  2CQ9 A;  1WRY A;  3DYR A;  4GST A;  3MAK A;  4MAB A;  3IK9 A;  1FHE A;  5DAL B;  2IN3 A;  3LGC A;  4P3Y B;  3G9B A;  4ML6 A;  1ABA A;  1J0F A;  2EC4 A;  3G7Y A;  2M72 A;  3P90 A;  5HR0 A;  4PUA A;  1NHY A;  5ABR A;  2JAC A;  2H01 A;  2CA8 A;  3KGK A;  2H66 A;  2VIM A;  1M9B A;  1HNC A;  2FUG 2;  4GF0 A;  3HZ8 A;  3UVT A;  3E9J B;  3D4T A;  2H75 A;  3ZFL A;  4YAV A;  2BTO T;  2MBT A;  5C04 A;  3KD0 A;  1T8E B;  4H86 A;  1XIY A;  4XTS A;  5CRD A;  1XPV A;  3GKM A;  5EVO A;  3UAR A;  2PBJ A;  4MZW A;  3VI7 A;  5J4U A;  3ME8 A;  3P2A A;  2GQL A;  1AC1 A;  1GWC A;  3ZML A;  1GUK A;  4J56 E;  1K0M A;  5D73 A;  3NIV A;  1XW5 A;  4MZB A;  4FYU A;  5L71 A;  4OCF A;  5INY A;  3EUR A;  3MIX A;  4BVY B;  2DKI A;  4TR1 B;  4K0N A;  1MEK A;  1XOA A;  1U3I A;  3ERW A;  4J57 E;  1V2A A;  4K7N A;  2DML A;  5DQS A;  1N8J A;  4CHS A;  2C0E A;  2FNO A;  3MSZ A;  3L4N A;  5C00 A;  5IQY A;  1X5D A;  1XBS A;  1Z5Y E;  2J9H A;  1W4V A;  5E4W A;  1U87 A;  3GHA A;  6GST A;  2IJY A;  1HD2 A;  4V2M A;  3FR9 A;  4RI7 A;  3IHG A;  1W89 A;  1JZW A;  2H1B A;  2X4A A;  1URM A;  2XBQ A;  1MTC A;  1PN9 A;  2WJU A;  4O5R A;  3LG6 A;  2RUE A;  1F2E A;  2RM5 A;  3C73 A;  1EGO A;  1BX9 A;  4KH7 A;  4GRF A;  2HZE B;  4EDY A;  5B8A A;  2E0Q A;  4GTU A;  3GNJ A;  3GH9 A;  1FW1 A;  1U3A A;  2GT5 A;  1G6W A;  3WD6 A;  1G0T A;  2AB6 A;  4K5S A;  2WS2 A;  1ZGN A;  3NOF A;  1T3B A;  4IHU A;  3FRC A;  1ILO A;  1HYU A;  2HRN A;  3M0F A;  3CSJ A;  2O87 A;  3CBU A;  1Z7R A;  4MF7 A;  2L59 A;  1VF2 A;  4GXZ A;  4PNF A;  2LS5 A;  2IMF A;  1O81 A;  3GTU A;  5D93 A;  1A8L A;  4HJM A;  5ECP B;  1PMT A;  3G7I A;  2MBS A;  3LJR A;  2FA8 A;  5CAX A;  2K8V A;  3F6F A;  3DD3 A;  5ECR B;  4K9Z A;  2XBI A;  3C1S A;  3F4S A;  2B1K A;  1A2J A;  1RK4 A;  3PR8 A;  4KDU A;  1J08 A;  5JCW A;  3QFA C;  1PGT A;  3HY2 A;  4BL7 B;  1Z9H A;  4ECC A;  3EVI A;  1Z3E A;  3GN3 A;  2V1M A;  3IE3 A;  2A2S A;  5AIX A;  1CQH A;  4EIQ A;  2GSQ A;  2CZ3 A;  5LCZ A;  1AQW A;  3FYG A;  2B7J A;  3D22 A;  5AIV A;  5J9C A;  2VLV A;  2YV9 A;  3Q18 A;  4LL1 B;  2IL3 A;  4KB3 A;  1M2B A;  2H1A A;  2PVO C;  1TKD B;  1M99 A;  2H1D A;  3GUR A;  3U5R E;  4N10 A;  4J2F A;  5IMF A;  1SEN A;  3EU4 A;  4F2I A;  1XFL A;  1YKC A;  4MH2 A;  5GAN D;  1TU7 A;  2GS3 A;  3F4R A;  2C8U A;  2B5X A;  2FY6 A;  1K0D A;  5IOX A;  2RUF A;  2CVB A;  2KHP A;  4GCI A;  3FK8 A;  5ECQ B;  1GUL A;  2F8F A;  4F0B A;  1TRU A;  6GSU A;  5A4V A;  4RI6 A;  2TIR A;  4NHZ A;  4OO5 A;  1YJ6 A;  2O8V B;  2H0I A;  11GS A;  3GL5 A;  2VD1 A;  4IJ3 A;  3DVW A;  1G6Y A;  5IMD A;  4L5L A;  3BOA A;  3F4T A;  4EF0 A;  1WOU A;  4OWY A;  5IIZ A;  1V58 A;  1XW9 A;  1F3A A;  3HHV A;  4JU5 A;  1OE8 A;  2WDU A;  3TKP A;  2GST A;  4AF2 A;  1R4W A;  6GSW A;  4N11 A;  2HRF A;  1V57 A;  2VL2 A;  2LUS A;  2O7K A;  2OE1 A;  1MD3 A;  5AN1 A;  3VLN A;  10GS A;  3QAW A;  4G0I A;  3PPU A;  1S3D A;  2JSZ A;  2WGR A;  4HQS A;  2KP2 A;  4TKY A;  4LMV A;  3H4K A;  5D9X A;  2PPT A;  3IA1 A;  2OBI A;  2I9H A;  3FEU A;  4HU9 A;  5FWG A;  5DBQ A;  4G0K A;  2K9F A;  1SKR B;  1SYR A;  4DSQ A;  4F9Z A;  2XC2 A;  4I2U A;  4E8E A;  3ZLP A;  3OR5 A;  5H5S A;  4MJC A;  1TP9 A;  3F0I A;  3ZRD A;  3TKS C;  4KSM A;  1EZK A;  2C3N A;  3GMF A;  1T1V A;  2R3X A;  1SL1 B;  3GIX A;  4D73 A;  4QL7 A;  2RLI A;  1EEJ A;  4FH8 A;  2WB9 A;  1JLW A;  2JZT A;  5G1K A;  1YZX A;  2VCX A;  5GAP D;  1GSU A;  3ZVJ A;  3VWW A;  3I9V 2;  4E8H A;  2R37 A;  3UOM A;  4EL1 A;  1TU8 A;  2O89 A;  3WGD A;  4RQR A;  4EIP A;  3TGZ A;  4HZ4 A;  1Y6E A;  4MPF A;  1ON4 A;  3ZRE A;  2QGV A;  1VF3 A;  4K1F A;  5HFG A;  4FIW A;  4KDX A;  3TRQ A;  2GQM A;  5JWO B;  2C3Q A;  4YAP A;  4IJI A;  4EO3 A;  3TCO A;  1YKA A;  3E0U A;  2OE0 A;  2LTK A;  5DQY A;  2R0C A;  5GSS A;  1EV9 A;  1BG5 A;  1ZYQ B;  4DSS A;  1K0A A;  4HQZ A;  2FWG A;  2AUV A;  1V98 A;  4TXO B;  1V9W A;  1F37 A;  4IQ1 A;  3QFB C;  3EYT A;  4XS4 A;  3Q19 A;  2GLR A;  3SBC A;  20GS A;  1O85 A;  1JZO A;  1PRX A;  2X99 A;  1GLP A;  1U88 A;  3QR6 A;  2G0F A;  4ICY A;  5D9W A;  4Q5N A;  2J23 A;  1AQX A;  4EKZ A;  3C1R A;  1EWX A;  1GLQ A;  5DAK A;  4LA1 A;  3VWU A;  2IMK A;  1GSE A;  3GST A;  2AV4 A;  3F9U A;  4Z7X A;  5D9T A;  2HLS A;  5JCU A;  5DJL A;  1ZL9 A;  3GL3 A;  1QGV A;  2JZR A;  3MDK A;  3RPN A;  4WEY A;  3ME7 A;  4XRA A;  5GST A;  2VM2 A;  2X8C A;  2VCQ A;  3RPP A;  1QK8 A;  2N5F A;  3BCI A;  4YQU A;  2XPD A;  1ZZY A;  4HEA 2;  4Q5Q A;  1FVK A;  2X8H A;  4ZL8 A;  3M9K A;  5G31 A;  2HNL A;  2DIY A;  3QAV A;  1I9D A;  2YCD A;  4MJE A;  1ZMA A;  1RQM A;  2QA1 A;  3IRA A;  5IO2 A;  2LNS A;  1QUW A;  4GSS A;  4ZL7 A;  1M7T A;  2DC5 A;  3GFK A;  3QCP A;  5IM9 A;  4OFT A;  3TKS E;  1X9M B;  2JZS A;  2X64 A;  1JZD A;  3A2W A;  5CRH A;  1PKW A;  2L57 A;  5ECK B;  4L0W A;  3UBK A;  2K6V A;  4KSO A;  3K8N A;  4GLT A;  4K8M A;  4O7H A;  2IMI A;  2B7K A;  2DJ2 A;  3DVX A;  5E59 A;  3V1W A;  1GSF A;  1WMJ A;  5KN0 A;  2EIR A;  3GA4 A;  5D96 A;  4ZB6 A;  2DLX A;  4X4J A;  5EL8 A;  1R5A A;  3HKR A;  2P31 A;  4MPG A;  4ECI A;  1CQG A;  3BBY A;  2WCI A;  4K6X A;  2K8S A;  5KOW A;  2PUK C;  1SK1 A;  4KAE A;  2LRN A;  4BWS A;  2H73 A;  3VPQ A;  1ZYN A;  4WBJ A;  3RAZ A;  4Z2R A;  2H70 A;  1U6T A;  3TJB A;  3D4M A;  1PX6 A;  1XWA A;  2EIQ A;  5COH A;  1VRS D;  5KN1 A;  2MYG A;  4O5Q A;  3LEF A;  3ZYW A;  1TK5 B;  1PSQ A;  3L9V A;  2B5E A;  4HDE A;  5F06 A;  3ZTL A;  3P8W A;  4CDO A;  2GZY A;  1EGR A;  4IEL A;  2FD3 A;  2BMX A;  2YNX A;  1PN0 A;  3KCM A;  4I6X A;  3WGX A;  5H5Q A;  5BRT A;  3GTU B;  4GWR A;  5IMZ A;  1YEX A;  5CRW A;  1XVQ A;  2BJX A;  4OO4 A;  4DEJ A;  1ERU A;  1TW9 A;  4XCS A;  1EEM A;  5LNK e;  4XIH A;  3EMX A;  1SK2 A;  4XS6 A;  3EC3 A;  4YKG A;  2C0G A;  2VOC A;  1I5G A;  1TRS A;  5ECH B;  2IMD A;  2VCZ A;  3C7M A;  4ZBD A;  1EP8 A;  5CO3 A;  3TB2 A;  1FB6 A;  3ERF A;  4G0L A;  2ZCT A;  4POL A;  5J3R A;  3ERG A;  4MP4 A;  1XVW A;  3FY7 A;  3APQ A;  1NM3 A;  2PN8 A;  3FZ5 A;  4MMM A;  2R4V A;  2H8L A;  4I97 A;  1B9X C;  1E2Y A;  2A4V A;  3LSZ A;  4TR3 A;  4KND A;  4OD7 A;  2DJ1 A;  1KTE A;  2DSA A;  1KNG A;  1QMV A;  2JSY A;  5KEJ A;  2GT6 A;  1T7P B;  19GS A;  1ST9 A;  1SU9 A;  3CRT A;  3H1N A;  2NVL A;  1UN2 A;  2D2Z A;  4FYB A;  2DMM A;  4KCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...