1XWCA

Drosophila thioredoxin, reduced, p6522
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thioredoxin
publication title Comparative structural analysis of oxidized and reduced thioredoxin from Drosophila melanogaster
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Electron transport
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xwcA00
1H4OA 4HI7A 3ZREA 2X64A 3IOSA 5GAPD 2CX4A 2FGXA 2CZ3A 2H70A 4MP4A 1FHEA 2LRCA 4TR1A 2E2MA 3DEXA 4OFMA 4IW9A 2MMNA 4IELA 2IIYA 4EKZA 4OFNA 1TDIA 2R6KA 2F3MA 5DAKA 1XWKA 1DUGA 1CQHA 3KCMA 4RQXA 4XS6A 3UMAA 2LV3A 1F6MC 1TU8A 4CW9A 4QL9A 2R37A 2QKEA 1ZZYA 2DMMA 2AHEA 4XS4A 2EIOA 3F3RA 3KTBA 3ZFBA 1YF1A 1M9AA 2E7PA 3IV4A 1ZMAA 2GZZA 1ERVA 5G30A 3ZZXA 1WE0A 1BX9A 3ZTLA 5B7CA 4IJ3A 4MK3A 4O92A 5ECNB 4RI7A 2L4QA 2DBCA 5HFIA 4GWRA 1Z7RA 1O7UA 5DDLA 5CREA 1O8XA 5JWOB 2N5FA 1MD4A 2AYTA 2YWOA 3TDGA 1WRYA 2RUEA 1YF0A 3UVTA 4ECIA 1GULA 1PSQA 1ABAA 1ZL9A 4J57E 3DWVA 3EU4A 1T4ZA 4I8BA 2WGRA 2C1YA 1RK4A 1SJ6A 3DIEA 4J2FA 5JWRB 5ECOB 1IYHA 2FA8A 3WYWA 1MD3A 1TOFA 6GSYA 3UEMA 3RHCA 1T4YA 3RPNA 3M8NA 1ZCPA 2A4VA 2K9FA 1ZOFA 4PNGA 1GSDA 1HNAA 4E8EA 4KDUA 1FB0A 4POKA 2IMKA 3VK9A 1K0CA 3BJ5A 5E59A 3HA9A 5ECIB 3L9UA 3IAM2 1VGLA 1WIKA 3ERWA 4EUYA 3FRCA 4TR0A 3D0ZA 4NAXA 4IBPA 3CSHA 1M9BA 2E0QA 3TRPA 4NHZA 3GRXA 1B9XC 2YJ7A 1U87A 1PA3A 4JRRA 1ON4A 4FYUA 5EY6A 3I43A 2V6KA 2VCQA 1V58A 1PGTA 1SK0A 2GQLA 4MPGA 4MZCA 4Q5RA 4NWYA 4KNDA 1PKZA 2JZRA 1WPIA 2DIZA 1EV9A 2YWMA 3ISOA 1TRVA 1WWJA 1R26A 4N11A 1KBNA 2CZ2A 2HLSA 1OKDA 2P0GA 3ZL5A 3D6IA 2CAIA 1NHOA 3L78A 2ON7A 2JZTA 4YAPA 3GX8A 4V2LA 1EP8A 5B6MA 4LLRA 2R5GA 4EXJA 4MMMA 4F0CA 2VL2C 2H74A 3EWLA 4GF0A 3G7YA 1WOUA 4DSSB 3FZ5A 4WF5A 1Z9HA 4J56E 1U3IA 5AN1A 5IOXA 3KMNA 1YY7A 1W4VA 2ON5A 3TOTA 2AJQB 1XVWA 1TP9A 2ZNMA 2VCWA 4FYCA 2B5EA 2FY6A 4PUFC 3G9BA 1GL8A 3IRAA 3VFIA 5E4WA 4O7HA 3V1WA 1URMA 2QC7A 4IHUA 2PPTA 4I2UA 1MDIA 5CNWA 5J9CA 2P5RA 2VO4A 3ZFLA 2GGTA 5CRDA 14GSA 2C0EA 5H5SA 1SKSB 1TKDB 1VRSD 1QK8A 2VOCA 4JR4A 3HZ8A 3RPPA 1EGRA 3UIWA 2KUCA 4HQSA 4ZBAA 2OKAA 3ZIVA 5ABRA 4K9ZA 2M46A 5DVBA 2R4VA 3CSJA 4JR6A 1Q98A 2FCHA 1V40A 2XC2A 2CVBA 2VCVA 4ILFA 3DXBA 2X8GA 1LU4A 1K0MA 1RW1A 3ZVJD 4G2EA 2WZ9A 4MLYA 16GSA 1PRXA 3HCZA 1UVZA 4K8MA 4QQ7A 1X9SB 5D8IA 5G1LA 4D73A 2FWEA 4HU7A 2IJYA 1DSBA 13GSA 1HYUA 3F63A 3CYNA 1R5AA 5LD0A 1G0TA 4YQMA 2QSIA 4LMVA 3LXTA 1FAAA 5ECLB 2X8CA 4HJMA 5LNKe 3BCKA 2DJJA 5J9BA 2O8VB 3DKSA 1DBYA 2GS3A 2VD1A 1AAZA 3VI5A 3OR5A 2VCZA 9GSSA 3WT1A 3C8EA 4DEJA 4H86A 4F03A 2XPDA 2K6VA 5B8BA 1K3LA 2H1BA 1NM3A 1WP0A 3ZVJA 5AISA 3TB2A 3C71A 1K3YA 1TI1A 4ZB6A 3CTGA 5G2ZA 3GHAA 4I2TA 2IMDA 2NVLA 2J23A 4MF6A 1SJZA 3D4TA 3GH6A 4XS4B 1M2AA 1SL1B 1ACVA 4ZXGA 3HHVA 5IMDA 2VL2A 4ID0A 1A2JA 1FOVA 1ZYEA 2GSQA 1A2LA 1OE8A 3ME7A 3IDVA 2BMXA 1UN2A 3EINA 4EDZA 4KDXA 1Y6EA 4WF4A 1PN9A 4WBJA 2I3YA 3IHQA 2V1MA 3G7JA 3VWWA 3LORA 3RAZA 1FW1A 3IAS2 1JFUA 1GTIA 1XPVA 3N9JA 4RI6A 4OWYA 4DSSA 5G31A 3EYTA 3ZITA 5ECSA 4OO4A 2JACA 1FB6A 2XHFA 1PKWA 1O73A 3Q19A 1TTZA 3TRQA 1XW9A 2K8VA 5CRGA 5HR0A 4TOPA 1KNGA 2CAQA 4Q5NA 4IGJA 3FZAA 5B6NA 2FUG2 4OCEA 4XHMA 3FHKA 5A4VA 22GSA 3KIJA 2L59A 1THXA 2TIRA 3NOFA 3VPQA 2O89A 2GSTA 4K7IA 3E0UA 3D21A 3TGZA 3FK8A 4EE0A 4WR5A 2GQKA 3I69A 3WGXA 1G7OA 5AIXA 3EVIA 3HXSA 6GSTA 2L6CA 3VPTA 1JZOA 3KXOA 4MH3A 2OACA 4K0NA 2MMAA 2VD0A 2WJUA 3A2VA 2B5YA 2PMTA 3HY2A 18GSA 3O6TA 2L5LA 2GZYA 3A3TA 2LTKA 3QAWA 4X43A 1NW2A 3D22A 5LCZA 2IMIA 2P5QA 2VIMA 4ZBDA 3ZLPA 4DVCA 1CQGA 3J7Yk 3C1RA 3TKSC 3KM6A 3KH9A 2H1GA 3AY8A 2LQQA 2CVKA 4HOJA 3FZ4A 5HR3A 3GYKA 1GSFA 2PWJA 4IS0A 2LJKA 4PURA 1V98A 2C3QA 1A8LA 2H6ZA 1GTAA 1GRXA 1SU9A 4LL1B 1TRSA 3A5WA 5IMVA 2PGTA 3KP9A 1AC1A 3MNGA 5JWQB 4BPYA 1XWBA 2H73A 2V41A 5CAXA 2NDOA 4ZILA 1B8XA 5G5FA 1SKRB 2IPAA 2H0IA 2C8UA 4MH2A 2FA4A 2NPBA 3IC4A 4KDYA 1X5EA 1Z6MA 1YQ1A 1K0NA 4OMVA 1B48A 3CBUA 3H79A 1Z3EA 3VWVA 4AJ7A 5J41A 2PVQA 2DJ1A 2WFCA 4PGTA 5DJLA 1GUKA 1M0UA 1WJKA 4LL4B 2CVDA 5CRWA 2RM5A 2VAFA 1XCCA 3C1SA 4GRFA 1LJRA 2LKUA 3P90A 2B3SA 1TXXA 2F8FA 5H5QA 3ZMLA 3L9VA 2C80A 4PUAA 3ZYWA 5IMAA 4K2DA 3DD3A 5FHIA 4KUNA 3HZ4A 2H6YA 3K8NA 2HSHA 3ERGA 4IJIA 2KP1A 1AQVA 2GT6A 3DVWA 4TW5A 1OC9A 1AXDA 1A8YA 4P3YB 1ZGNA 3F4RA 5D9VA 3FKFA 3LXZA 3KZQA 4HUAA 1GSYA 3LWAA 4GXZA 1V9WA 3GL5A 3HJOA 2FWFA 3GIXA 1QFNA 4WR4A 1XVQA 1EP7A 2F8AA 4O32A 2H30A 3C7MA 2H8LA 2C3TA 2K8SA 4D73B 2DSAA 4O5RA 3DYRA 4X1UA 3A2WA 2A2SA 1VF4A 2DJ2A 4F82A 4I6XA 4FH8A 3Q6OA 2H0GA 2IFQA 3TKSA 1SL2B 4NPBA 4K7OA 3TOUA 3F9UA 3D5JA 1GP1A 4L0WA 4TKYA 3TRXA 4ML6A 5ECRB 1XW5A 4OFTA 1ML6A 4TXVA 3HDCA 2WCIA 2GT5A 4N30A 4BVYA 3G7IA 4ECCA 2LSTA 4RUVA 1SJIA 3EE2A 3CRUA 2H76A 2HNLA 2G0FA 2YN1A 2AAWA 5KN1A 4AGSA 3VLNA 1PD21 4TXOB 3M3MA 3IXRA 5A4UA 5EL8A 1DE2A 4HEA2 5CYYA 6GSUA 3HKRA 3FYGA 3SBCA 3W8JA 2IMEA 2C3NA 1C72A 1DE1A 1O6JA 4G9HA 4NMUA 1M2BA 2WULA 2OBKA 1J9BA 2H01A 1VF2A 2RUFA 1QGVA 5F05A 5A5KA 2YP6A 2DMLA 4PNFA 4GTUA 4K6XA 1R7HA 1QQ2A 3TKSE 5KN3A 5INYA 2VLTA 1K0DA 1EGOA 1SENA 2JSYA 2XPEA 1A24A 4EDYA 1F9MA 2VL9A 1FO5A 4EC0A 4BL7A 1ZYQB 5GAND 2TRCP 2EC4A 2G2QA 4ECBA 3FZ9A 3APQA 2WB9A 1PL2A 4FO5A 2YWIA 4AJ8A 5KN0A 2RIIA 4ECJA 1KEBA 4Z7XA 2H71A 3J7Yb 1BG5A 1GH2A 4IVFA 4CDOA 3MSZA 4K0GA 1GNEA 2VLVA 3ZRDA 3EU3A 4L8EA 5F0GA 2K18A 3IA1A 3H93A 4L5OA 4HQZA 1B9YC 4IKHA 3APOA 5ECHB 4GCIA 6GSXA 3U6VA 3CXGA 5GZZB 2B1LA 2Z9SA 4GQCA 3QMXA 3GSTA 3ZMKA 1OC3A 1FVJA 5DCHA 4GSTA 3FR9A 4PQHA 5IQYA 3W6GA 2IN3A 4OO5A 1IYIA 4PXOA 1GUMA 2PERA 2FD3A 1XOBA 4KSMA 1OE7A 1JLVA 2KHPA 3QAGA 3PGTA 4HJ2A 3GFKA 4DSRA 2XBQA 2REMA 4WEYA 3DGQA 4MCUA 3BCIA 4FIWA 1K0AA 3MDKA 1HQOA 1N2AA 2I81A 4KW6A 2YJHA 3KGKA 4I5QA 1GUHA 1TK5B 2ZUPA 2R3XA 4OCFA 2GTUA 1RQMA 2AB6A 3GUSA 4BA7A 1YKAA 1EEJA 3HD5A 1M99A 2YV9A 4NXIA 4HZ4A 2DC5A 4BWQA 2JZSA 4MZBA 4X0XA 2VM1A 4TXOA 1VF3A 1GSUA 1OVNA 1J08A 3FW2A 2VCXA 3APSA 2BJXA 1XOAA 5FT3A 2I4AA 2F9SA 4XCSA 3EC3A 3IR4A 4NHWA 20GSA 2MZCA 1JHBA 2LJRA 3LGCA 2OBIA 2B1KA 4I97A 2H0HA 4MJBA 2YV7A 2V6OA 3LEFA 1PMTA 1AUCA 3F0IA 2EIQA 4ZL9A 1OC9B 2FHEA 8GSSA 1XXUA 2JU5A 3PR8A 1V2AA 5D73A 3US3A 2C0DA 4WETA 5GSSA 4JBBA 4HZ2A 1Q4JA 3GSSA 1GSQA 3LQ7A 2HI7A 4IP1A 1EZKA 3R2QA 1ERTA 2ES7A 5DALA 1F2EA 3C73A 5IMZA 3ZIJA 3ERFA 2XBIA 5IO2A 3GKMA 4XTSA 2MBSA 1EWXA 1NHYA 4KB3A 1J0FA 5DQYA 2GLRA 3UJ1A 3KD0A 1G7EA 1U6TA 1GLPA 3NZNA 2BTOT 4PQ1A 4YH2A 4POLA 3MWHA 1AQWA 1M7TA 2GSRA 1A0FA 2OE0A 5L71A 5ECMB 2IFQB 4AJ6A 4EO3A 4F9ZA 3UVHA 5ECKB 5DBQA 2PBJA 2MMZA 4F2IA 3CMIA 2B7JA 2RM6A 4NV2A 2KP2A 4FYBA 2PN8A 1OAZA 1TJDA 1GWCA 3N5OA 1SYRA 1YJ6A 2VL3A 3RBTA 2GQMA 5JCUA 4ML1A 1ST9A 4KX4A 3CRTA 4POMA 3WGEA 3NIVA 1NSWA 1E2YA 2FWHA 1USBA 2F51A 2MYGA 4WBRD 1XWCA 4GLTA 2FLSA 1X9WB 2HRFA 1GSSA 3E9JB 3PINA 5EVOA 2YWNA 2H19A 1EOGA 1I9DA 5ECQB 3HJPA 1R4WA 3S9FA 4ULXA 3UL3A 1HD2A 2LEGA 1PX7A 3PH9A 1GNWA 4E8HA 6GSVA 4JEDA 2P31A 2IMFA 2HZEB 1TI3A 5KEJA 4MF5A 2VLUA 4EL1A 3TJBA 4KE3A 1XWAA 1UA5A 2V2GA 3FEUA 2IWTA 2J9HA 3QFAC 2PU9C 3CTFA 5ELGA 5F8BA 3VI7A 1TU7A 5ID2B 4N0VA 3SWLA 3KTLA 1XIYA 2AUVA 4KH7A 3TJJA 4TVEA 1SD9A 3GKXA 3O76A 1TW9A 4DSQA 2YNXA 1O8WA 1Z7PA 2TRXA 1TK0B 2CT6A 2HT9A 4NV5A 4IP6A 1AIUA 3KMOA 2YPMA 4N10A 1SKWB 1S3CA 2B5XA 3GL3A 3KEBA 4TN8A 2D2ZA 2JSZA 1SD8A 4ZBBA 3GV1A 5F06A 2N5BA 3WT2A 2YZUA 5KN2A 2DJKA 3ED3A 1TK8B 3I9V2 3IPZA 1TRWA 2GSSA 5ECPB 3DMLA 4BVXA 3VURA 3QFBC 2ZCTA 3TCOA 2LS5A 4F0BA 1Z6NA 3M9JA 3M1GA 3F4TA 4EVMA 5HR1A 1QMVA 3L9SA 3TKRA 4YQVA 3HYPA 2L5OA 3GTUB 4V2MA 2VM2A 4ZIJA 2IL3A 2CV4A 4IQ1A 1QXHA 3IK9A 1MDJA 2YZHA 3LYKA 4XIHA 1PQNA 5AGYA 1T3BA 1A23A 4PQIA 1BYEA 1YZXA 3GX0A 3LYPA 3L4NA 2C4JA 2CQ9A 4XRDA 2I1UA 5G5EA 3L0HA 2VUPA 1OYJA 3TJKA 1W89A 1BEDA 2JL4A 1R5PA 2LUSA 4MZWA 3BBYA 3IE3A 2DLXA 4MJEA 1S3AA 4MJAA 12GSA 2H1AA 3TJFA 4BWSA 4KCAA 3UARA 4IN0A 1PX6A 1GTBA 2E2GA 4ZB8A 4LA1A 5ENUA 5AIVA 2OE1A 1MTCA 1K0BA 3A2XA 3DVXA 3UAPA 5IPHA 4JU5A 1O81A 4QL7A 3CSIA 2LQOA 4V2NA 1FG4A 3KH7A 4WXTA 1G6YA 3H8QA 2GDRA 2N5AA 4WKWA 2OE3A 1THOA 3GN3A 3EURA 4KCEA 5D96A 4G19A 3F8UA 3Q18A 3QD9A 3QDNA 2AV4A 5FWGA 3ME8A 1BAYA 5J5NA 2HZEA 3KP8A 4GSSA 1K0OA 19GSA 2OJLA 1OC8A 3EMXA 2V32A 2O7KA 5DCGA 4YQUA 1FVKA 5ID2A 7GSSA 4PX1A 4V1Ag 1GLQA 1F3AA 1YEXA 3HVXA 1AQXA 1PL1A 1T8EB 5IO0A 3IK7A 5DALB 5D93A 3LJRA 4Q5QA 2OADA 2M72A 2R2JA 1B4QA 3TKQA 5A4WA 1BQ7A 1HNCA 1T00A 1KTEA 5H5RA 3GMFA 1ERUA 3GA4A 4KAEA 3QAVA 1I5GA 3BD2A 1B4PA 4MPFA 3QR6A 2HFDA 5ELAA 1M2DA 3RHBA 2LJAA 3E3EA 5IMCA 3VWUA 3QPMA 3MAKA 4KA0A 5C00A 4RQRA 2H66A 1Y25A 4GQFA 5IOWA 2H1DA 3VWXA 3P8WA 5DJMA 4JZQA 5CP1A 3UBKA 4XS1A 2L4CA 3P2AA 4HDEA 1A0RP 3TJGA 2VCTA 3GTUA 1U3AA 1TRUA 2HE3A 3P7XA 4ZL7A 1HNBA 2C0GA 5D9TA 1H75A 1X5DA 5C04A 3WD6A 2CX3A 5J4UA 1EEMA 1T1VA 5G1KA 5IIZA 1X0RA 3I6AA 1E6BA 1A2MA 2EIRA 5CO3A 1LBKA 1N8JA 1SYXA 4HS1A 4YAVA 2HXKA 2A2RA 4L5LA 2MMOA 1XW6A 1JZDA 2I9HA 2WS2A 2GZPA 5IPGA 3HVVA 17GSA 1YDKA 1XWGA 5IM9A 1VF1A 1ILOA 1F37A 1SL0B 4ISDA 5COHA 3DRNA 3LSZA 2FNOA 4ZB9A 2NTOA 4TR1B 3UOMA 1UC7A 1JZRA 1X9MB 2KOKA 2HZFA 2L57A 3F6DA 3Q74A 4OD7A 5D9XA 2DJ3A 3BOAA 2CA8A 3LFLA 3FR6A 4AF2A 4L0UA 2DJ0A 1GTUA 1YKCA 4TR3A 2H6XA 5DAKB 4JE1A 2JADA 10GSA 3HJMA 2NBSA 2LNSA 1OKTA 4GSNA 3WGDA 1XFLA 4V1Ap 1YEPA 3UBLA 5HFGA 5J3RA 4MDCA 1EV4A 1JLWA 1QUWA 3JCML 1U88A 3HVSA 1F3BA 4ZL8A 3TKPA 1G6WA 2HRNA 4Q5FA 4XRAA 2DIYA 1EOHA 3GKKA 4MA9A 3FR3A 5DQSA 3GNJA 3O3TA 5F07A 4KSOA 2KLXA 3D4MA 5EPFA 1V57A 3M9KA 2LNTA 3GURA 4MJCA 2PVOC 1T7PB 4CHSA 4MABA 1AW9A 1ERWA 1X5CA 3GH9A 3U5RE 3KJYA 3GKNA 2O85A 2RLIA 2C0FA 1K3OA 2OA7A 5HR2A 2B7KA 5HQPA 3LG6A 1BJXA 3F6FA 6GSWA 1SK1A 5CRHA 1XZOA 4MF7A 2X99A 2YANA 2WDUA 3W8SA 2PUKC 2HSYA 2L6DA 4G10A 5D9WA 2ALBA 3RDWA 5B8AA 4N0ZA 3F3QA 1MEKA 4POBA 4ACSA 2MBTA 2H72A 1XBSA 3QCPA 2WRTA 3TUEA 4IQAA 2FWGA 3H4KA 4TR4A 5JCGA 1O85A 2LRNA 2GVPA 3FY7A 4KGIA 4K1FA 1JZWA 1GSEA 1SK2A 2LRTA 1MDKA 2B6MA 5HFKA 2H75A 5GSTA 5JCWA 4EF0A 1S3DA 1WMJA 4HU9A 4LMWA 3H1NA 1Z5YE 6GSSA 3M0FA 3EMPA 11GSA 2X8HA 2YCDA 5IMFA 2YOIA 4TRXA 2HYXA 3IBHA 3QOUA 4K7NA 2M80A 3F4SA 2O87A 2QGVA
chains in the Genus database with same CATH superfamily
1H4OA 4HI7A 3ZREA 2X64A 3IOSA 5GAPD 2CX4A 2FGXA 2CZ3A 2H70A 4MP4A 1FHEA 2LRCA 4TR1A 2E2MA 3DEXA 4OFMA 4IW9A 2MMNA 4IELA 2IIYA 4EKZA 4OFNA 1TDIA 2R6KA 2F3MA 5DAKA 1XWKA 1DUGA 1CQHA 3KCMA 4RQXA 4XS6A 3UMAA 2LV3A 1F6MC 1TU8A 4CW9A 4QL9A 2R37A 2QKEA 1ZZYA 2DMMA 2AHEA 4XS4A 2EIOA 3F3RA 3KTBA 3ZFBA 1YF1A 1M9AA 2E7PA 3IV4A 1ZMAA 2GZZA 1ERVA 5G30A 3ZZXA 1WE0A 1BX9A 3ZTLA 5B7CA 4IJ3A 4MK3A 4O92A 5ECNB 4RI7A 2L4QA 2DBCA 5HFIA 4GWRA 4EIQA 1Z7RA 1O7UA 5DDLA 5CREA 1O8XA 5JWOB 2N5FA 1MD4A 2AYTA 2YWOA 3TDGA 1WRYA 2RUEA 1YF0A 3UVTA 4ECIA 1GULA 1PSQA 1ABAA 1ZL9A 4J57E 3DWVA 3EU4A 1T4ZA 4I8BA 2WGRA 2C1YA 1RK4A 1SJ6A 3DIEA 4J2FA 5JWRB 5ECOB 1IYHA 2FA8A 3WYWA 4G0IA 1MD3A 1TOFA 6GSYA 3UEMA 3RHCA 1T4YA 3RPNA 3M8NA 1ZCPA 2A4VA 2K9FA 1ZOFA 4Z2UA 4PNGA 1GSDA 1HNAA 4E8EA 4KDUA 1FB0A 4POKA 2IMKA 3VK9A 1K0CA 3BJ5A 5E59A 3HA9A 5ECIB 3L9UA 3IAM2 1VGLA 1WIKA 3ERWA 4EUYA 3FRCA 4TR0A 3D0ZA 4NAXA 2DKIA 4IBPA 3LW9A 3CSHA 1M9BA 2E0QA 3TRPA 4NHZA 3GRXA 1B9XC 2YJ7A 1U87A 1PA3A 4JRRA 1ON4A 4FYUA 5EY6A 3I43A 2V6KA 2VCQA 1V58A 2R0CA 1PGTA 1SK0A 2GQLA 4MPGA 4MZCA 4Q5RA 4NWYA 4KNDA 1PKZA 2JZRA 1WPIA 2DIZA 1EV9A 2YWMA 3ISOA 1TRVA 1WWJA 1R26A 4N11A 1KBNA 2CZ2A 2HLSA 1OKDA 2P0GA 3ZL5A 3D6IA 2CAIA 1NHOA 3L78A 2ON7A 2JZTA 4YAPA 3GX8A 4V2LA 1EP8A 5B6MA 4LLRA 2R5GA 4EXJA 4MMMA 4F0CA 2VL2C 2H74A 3EWLA 4GF0A 3G7YA 1WOUA 4DSSB 3FZ5A 4WF5A 1Z9HA 4J56E 1U3IA 5AN1A 5IOXA 3KMNA 1YY7A 1W4VA 2ON5A 3TOTA 2AJQB 1XVWA 1TP9A 2ZNMA 2VCWA 3HVNA 4FYCA 2B5EA 2FY6A 4PUFC 3G9BA 1GL8A 3IRAA 3VFIA 5E4WA 4O7HA 3V1WA 1URMA 2QC7A 4IHUA 2PPTA 4I2UA 1MDIA 5CNWA 5J9CA 2P5RA 2VO4A 3ZFLA 2GGTA 5CRDA 14GSA 2C0EA 5H5SA 1SKSB 1TKDB 1VRSD 1QK8A 2VOCA 4JR4A 3HZ8A 3RPPA 1EGRA 3UIWA 2KUCA 4HQSA 4ZBAA 2OKAA 3ZIVA 5ABRA 4K9ZA 2M46A 5DVBA 2R4VA 3CSJA 4JR6A 1Q98A 2FCHA 1V40A 2XC2A 2CVBA 2VCVA 4ILFA 3DXBA 4EIPA 2X8GA 1LU4A 1K0MA 1RW1A 3ZVJD 4A5PA 4G2EA 2WZ9A 4MLYA 16GSA 1PRXA 3HCZA 1UVZA 4K8MA 4QQ7A 1X9SB 5D8IA 5G1LA 4D73A 2FWEA 4HU7A 2IJYA 1DSBA 13GSA 1HYUA 3F63A 3CYNA 1R5AA 5LD0A 1G0TA 4YQMA 2QSIA 4LMVA 3LXTA 1FAAA 5ECLB 2X8CA 4HJMA 5LNKe 3BCKA 2DJJA 5J9BA 2O8VB 3DKSA 1DBYA 2GS3A 2VD1A 1AAZA 3VI5A 4FQUA 3OR5A 2VCZA 9GSSA 3WT1A 3C8EA 4DEJA 4H86A 4F03A 2XPDA 2K6VA 5B8BA 1K3LA 2H1BA 1NM3A 1WP0A 3ZVJA 5AISA 3TB2A 3C71A 1K3YA 1TI1A 4ZB6A 3CTGA 5G2ZA 3GHAA 4I2TA 2IMDA 2NVLA 2J23A 4MF6A 1SJZA 3D4TA 3GH6A 4XS4B 1M2AA 1SL1B 1ACVA 4ZXGA 3HHVA 5IMDA 2VL2A 4ID0A 1A2JA 1FOVA 1ZYEA 2GSQA 1A2LA 1OE8A 3ME7A 3IDVA 2BMXA 1UN2A 3EINA 4EDZA 4KDXA 1Y6EA 4WF4A 1PN9A 4WBJA 2I3YA 3FMWA 3IHQA 2V1MA 3G7JA 3VWWA 3LORA 3RAZA 1FW1A 3IAS2 1JFUA 1GTIA 1XPVA 3N9JA 4RI6A 1S3RA 4OWYA 4DSSA 5G31A 3EYTA 3ZITA 4HSCX 5ECSA 3MIXA 4OO4A 2JACA 1FB6A 2XHFA 1PKWA 1O73A 3Q19A 1TTZA 3TRQA 1XW9A 2K8VA 5CRGA 5HR0A 4TOPA 1KNGA 2CAQA 4Q5NA 4IGJA 3FZAA 5B6NA 2FUG2 4OCEA 4XHMA 3FHKA 5A4VA 22GSA 3KIJA 2L59A 1THXA 2TIRA 2QA1A 3NOFA 3VPQA 2O89A 4YKFA 2GSTA 4K7IA 3E0UA 3D21A 3TGZA 3FK8A 4EE0A 4WR5A 2GQKA 3I69A 3WGXA 1G7OA 5AIXA 3EVIA 3HXSA 6GSTA 2L6CA 3VPTA 1JZOA 3KXOA 4MH3A 2OACA 4K0NA 2MMAA 2VD0A 2WJUA 3A2VA 2B5YA 2PMTA 3HY2A 18GSA 3O6TA 2L5LA 2GZYA 3A3TA 2LTKA 3QAWA 4X43A 1NW2A 3D22A 4BVYB 5LCZA 2IMIA 2A4HA 2P5QA 2VIMA 4ZBDA 3ZLPA 4DVCA 1CQGA 3J7Yk 3C1RA 3TKSC 3KM6A 3KH9A 2H1GA 3AY8A 2LQQA 2CVKA 4HOJA 3FZ4A 5HR3A 3GYKA 4O5UA 1GSFA 2PWJA 4IS0A 2LJKA 4PURA 1V98A 2C3QA 1A8LA 2H6ZA 1GTAA 1GRXA 1SU9A 4LL1B 1TRSA 3A5WA 5IMVA 2PGTA 3KP9A 1AC1A 4K5RA 3MNGA 5JWQB 4BPYA 1XWBA 2H73A 2V41A 5CAXA 2NDOA 5KOWA 4ZILA 1B8XA 5G5FA 1SKRB 2IPAA 2H0IA 2C8UA 4MH2A 2FA4A 2NPBA 3IC4A 4KDYA 1X5EA 1Z6MA 1YQ1A 2X49A 1K0NA 4OMVA 1B48A 3CBUA 3H79A 1Z3EA 3VWVA 4AJ7A 5J41A 5BMUA 2PVQA 2DJ1A 2WFCA 4PGTA 5DJLA 1GUKA 1M0UA 1WJKA 4LL4B 2CVDA 5CRWA 2RM5A 2VAFA 1XCCA 3C1SA 4BL7B 2UZ8A 4GRFA 1LJRA 2LKUA 3P90A 2B3SA 1TXXA 2F8FA 5H5QA 3ZMLA 3L9VA 2C80A 4PUAA 3ZYWA 5IMAA 4K2DA 3DD3A 5FHIA 4KUNA 3HZ4A 2H6YA 3K8NA 2HSHA 3ERGA 4IJIA 2KP1A 1AQVA 2GT6A 3DVWA 4TW5A 1OC9A 1AXDA 1A8YA 4P3YB 1PN0A 1ZGNA 3F4RA 5D9VA 3FKFA 3LXZA 3KZQA 4HUAA 1GSYA 3LWAA 4GXZA 1V9WA 3GL5A 3HJOA 2FWFA 3GIXA 1QFNA 4WR4A 1XVQA 1EP7A 2F8AA 4O32A 2H30A 3C7MA 2H8LA 2C3TA 2K8SA 4D73B 2DSAA 4O5RA 3DYRA 4X1UA 3A2WA 2A2SA 1VF4A 2DJ2A 4F82A 4I6XA 4FH8A 3Q6OA 2H0GA 2IFQA 3TKSA 1SL2B 1M3IA 4NPBA 1FOHA 4K7OA 5KOXA 3TOUA 3F9UA 3D5JA 1GP1A 4L0WA 4TKYA 3R3EA 3TRXA 4ML6A 5ECRB 1XW5A 4OFTA 1ML6A 4TXVA 1ZYPA 3HDCA 2WCIA 2GT5A 4N30A 4BVYA 3G7IA 4ECCA 2LSTA 4RUVA 1SJIA 2R0GA 4BIKA 3EE2A 3CRUA 2H76A 2HNLA 2G0FA 2YN1A 2AAWA 5KN1A 4AGSA 3VLNA 1PD21 4TXOB 3M3MA 3IXRA 5A4UA 5EL8A 1DE2A 3PPUA 4HEA2 5CYYA 6GSUA 3HKRA 3FYGA 3SBCA 3W8JA 2IMEA 2C3NA 1C72A 1DE1A 1PFOA 1O6JA 4G9HA 4NMUA 1M2BA 2WULA 4ICYA 2OBKA 1J9BA 2H01A 1VF2A 2RUFA 1QGVA 5F05A 5A5KA 2YP6A 2DMLA 4PNFA 4GTUA 4K6XA 1R7HA 1QQ2A 2HSMA 3TKSE 5KN3A 5INYA 2VLTA 1K0DA 1EGOA 1SENA 2JSYA 2XPEA 1A24A 4EDYA 1F9MA 2VL9A 1FO5A 4EC0A 4BL7A 1ZYQB 5GAND 2TRCP 2EC4A 2G2QA 4ECBA 3FZ9A 3APQA 2WB9A 1PL2A 4FO5A 4K2XA 2YWIA 4AJ8A 5KN0A 2RIIA 4ECJA 1KEBA 4Z7XA 2H71A 3J7Yb 1BG5A 1GH2A 2X4AA 4IVFA 4CDOA 3MSZA 1XG8A 4K0GA 1GNEA 2VLVA 3ZRDA 3EU3A 4L8EA 5F0GA 2K18A 3IA1A 3H93A 4L5OA 4HQZA 1B9YC 4IKHA 3APOA 5ECHB 4GCIA 6GSXA 3U6VA 3CXGA 5GZZB 3IHGA 2B1LA 2Z9SA 4GQCA 3QMXA 3GSTA 3ZMKA 1OC3A 1FVJA 5DCHA 4GSTA 3FR9A 4PQHA 5IQYA 3W6GA 2IN3A 4OO5A 1IYIA 4PXOA 1GUMA 2PERA 2FD3A 1XOBA 4KSMA 1OE7A 1JLVA 4USSA 2KHPA 3QAGA 3PGTA 4HJ2A 3GFKA 4DSRA 2XBQA 2REMA 4WEYA 3DGQA 4MCUA 3BCIA 4FIWA 4CY8A 1K0AA 3MDKA 1HQOA 1N2AA 2I81A 4KW6A 2YJHA 3KGKA 4I5QA 1GUHA 1TK5B 2ZUPA 2R3XA 4OCFA 2GTUA 1RQMA 2AB6A 3GUSA 4BA7A 1YKAA 1EEJA 3HD5A 2HRKA 1M99A 2YV9A 4Z2RA 4NXIA 4HZ4A 4KF9A 2DC5A 4BWQA 2JZSA 4MZBA 4X0XA 2VM1A 4TXOA 1VF3A 1GSUA 1OVNA 1J08A 3FW2A 2VCXA 3APSA 2BJXA 1XOAA 5FT3A 4G0LA 2I4AA 2F9SA 4XCSA 3EC3A 3IR4A 4NHWA 20GSA 2MZCA 1M3JA 1JHBA 2LJRA 3LGCA 2OBIA 2B1KA 4G0KA 4I97A 2H0HA 2HRAA 4MJBA 2QA2A 2YV7A 2V6OA 3LEFA 1PMTA 1AUCA 3F0IA 2EIQA 4ZL9A 1OC9B 2FHEA 8GSSA 1XXUA 2JU5A 3PR8A 1V2AA 5D73A 3US3A 2C0DA 4WETA 5GSSA 4JBBA 4HZ2A 1Q4JA 3GSSA 1GSQA 3LQ7A 2HI7A 4IP1A 1EZKA 3R2QA 1ERTA 2ES7A 5DALA 1F2EA 3IC8A 4PTSA 3C73A 5IMZA 3ZIJA 3ERFA 2DKHA 2XBIA 5IO2A 3GKMA 4XTSA 2MBSA 1EWXA 1NHYA 4KB3A 1J0FA 5DQYA 2GLRA 3UJ1A 3KD0A 1G7EA 1U6TA 1GLPA 3NZNA 2BTOT 4PQ1A 4YH2A 4POLA 3MWHA 1AQWA 1M7TA 2GSRA 1A0FA 2OE0A 5L71A 5ECMB 2IFQB 4AJ6A 4EO3A 4F9ZA 3UVHA 5ECKB 5DBQA 2PBJA 4YKGA 2MMZA 4F2IA 5BRTA 3CMIA 2B7JA 2RM6A 4NV2A 2KP2A 4FYBA 2PN8A 1OAZA 1TJDA 1GWCA 3N5OA 1SYRA 1YJ6A 2VL3A 3RBTA 2GQMA 5JCUA 4ML1A 1ST9A 4KX4A 3CRTA 4POMA 3WGEA 3NIVA 1NSWA 1E2YA 2FWHA 1USBA 2F51A 2MYGA 4WBRD 1XWCA 4GLTA 2FLSA 1X9WB 2HRFA 1GSSA 3E9JB 3PINA 5EVOA 2YWNA 2H19A 1EOGA 1I9DA 5ECQB 3HJPA 1R4WA 3S9FA 4ULXA 3UL3A 1HD2A 2LEGA 1PX7A 3PH9A 1GNWA 4E8HA 6GSVA 4JEDA 2P31A 2IMFA 2HZEB 1TI3A 5KEJA 4MF5A 2VLUA 4EL1A 3TJBA 4KE3A 1XWAA 1UA5A 2V2GA 3FEUA 2IWTA 2J9HA 3QFAC 2PU9C 3CTFA 5ELGA 5F8BA 3VI7A 1TU7A 5ID2B 4O5QA 4N0VA 3SWLA 3KTLA 1XIYA 2AUVA 4KH7A 3TJJA 4TVEA 1SD9A 3GKXA 3O76A 1TW9A 4DSQA 2YNXA 1O8WA 1Z7PA 2TRXA 1TK0B 2CT6A 2HT9A 4NV5A 4IP6A 1AIUA 3KMOA 2YPMA 4N10A 1SKWB 1S3CA 2B5XA 3GL3A 3KEBA 4TN8A 2D2ZA 2JSZA 1SD8A 4ZBBA 3GV1A 5F06A 2N5BA 3WT2A 3A5IA 2YZUA 5KN2A 2DJKA 3ED3A 1TK8B 3I9V2 3IPZA 1TRWA 2GSSA 5ECPB 3DMLA 4BVXA 3VURA 3QFBC 2ZCTA 3TCOA 2LS5A 4F0BA 1Z6NA 3M9JA 3M1GA 3F4TA 4EVMA 5HR1A 1QMVA 3L9SA 3TKRA 4YQVA 3HYPA 2L5OA 3EPTA 3GTUB 4V2MA 2VM2A 4ZIJA 2IL3A 2R0PA 2CV4A 4IQ1A 1QXHA 3IK9A 1MDJA 2YZHA 3LYKA 4XIHA 1PQNA 5AGYA 1T3BA 1A23A 4PQIA 1BYEA 1YZXA 3GX0A 3LYPA 3L4NA 2C4JA 2CQ9A 4XRDA 2I1UA 5G5EA 3L0HA 2VUPA 1OYJA 4Z2TA 3TJKA 1W89A 1BEDA 2JL4A 1R5PA 2LUSA 4MZWA 3BBYA 3IE3A 2DLXA 4MJEA 1S3AA 4MJAA 12GSA 2H1AA 3TJFA 4BWSA 4KCAA 3UARA 4IN0A 1PX6A 1GTBA 2E2GA 4ZB8A 4LA1A 5ENUA 5AIVA 2OE1A 1MTCA 1K0BA 3A2XA 3DVXA 3UAPA 5IPHA 4JU5A 1O81A 4QL7A 3CSIA 2LQOA 4V2NA 2A2PA 1FG4A 3KH7A 4WXTA 1G6YA 3H8QA 2GDRA 2N5AA 4WKWA 2OE3A 1THOA 3GN3A 3EURA 4KCEA 5D96A 4G19A 3F8UA 3Q18A 3QD9A 3QDNA 2AV4A 5FWGA 3ME8A 1BAYA 5J5NA 2HZEA 3KP8A 4GSSA 1K0OA 19GSA 2OJLA 1OC8A 3EMXA 2V32A 2O7KA 5DCGA 4YQUA 1FVKA 5ID2A 7GSSA 4PX1A 4V1Ag 1GLQA 1F3AA 1YEXA 3HVXA 1AQXA 1PL1A 1T8EB 5IO0A 3IK7A 5DALB 5D93A 3LJRA 4Q5QA 2OADA 2M72A 2R2JA 1B4QA 3TKQA 5A4WA 1BQ7A 1HNCA 1T00A 1KTEA 5H5RA 3GMFA 1ERUA 3GA4A 4KAEA 3QAVA 1I5GA 3BD2A 1B4PA 4MPFA 3QR6A 2HFDA 5ELAA 1M2DA 3RHBA 2LJAA 3E3EA 5IMCA 3VWUA 3QPMA 3MAKA 4KA0A 5C00A 4RQRA 2H66A 1Y25A 4GQFA 5IOWA 2H1DA 3VWXA 3P8WA 5DJMA 4JZQA 5CP1A 3UBKA 4XS1A 2L4CA 3P2AA 4HDEA 1A0RP 3TJGA 2VCTA 3GTUA 1U3AA 1TRUA 2HE3A 3P7XA 4ZL7A 1HNBA 2C0GA 5D9TA 1H75A 1X5DA 5C04A 3WD6A 2CX3A 5J4UA 1EEMA 1T1VA 5G1KA 5IIZA 1X0RA 3I6AA 1E6BA 1A2MA 4X4JA 2EIRA 5CO3A 1LBKA 1N8JA 1SYXA 4HS1A 4YAVA 2HXKA 2A2RA 4L5LA 2MMOA 1XW6A 1JZDA 2I9HA 2WS2A 2GZPA 5IPGA 3HVVA 17GSA 1YDKA 1XWGA 5IM9A 1VF1A 1ILOA 1F37A 1SL0B 4MNNA 4ISDA 5COHA 3DRNA 3LSZA 2FNOA 4ZB9A 2NTOA 4TR1B 3UOMA 1UC7A 1JZRA 1X9MB 2KOKA 4K5SA 2HZFA 2L57A 3F6DA 3Q74A 4OD7A 5D9XA 2DJ3A 3BOAA 2CA8A 3LFLA 3FR6A 4AF2A 4L0UA 2DJ0A 1GTUA 1YKCA 4TR3A 2H6XA 5DAKB 4JE1A 2JADA 10GSA 3HJMA 2NBSA 2LNSA 1OKTA 4GSNA 3WGDA 1XFLA 4V1Ap 1YEPA 3UBLA 5HFGA 5J3RA 4MDCA 1EV4A 1JLWA 1QUWA 3JCML 1U88A 3HVSA 1F3BA 4ZL8A 3TKPA 1ZYNA 1G6WA 2HRNA 4Q5FA 4XRAA 2DIYA 1EOHA 3GKKA 4MA9A 3FR3A 4BVXB 5DQSA 3GNJA 3O3TA 5F07A 4KSOA 2KLXA 3D4MA 5EPFA 1V57A 3M9KA 2LNTA 3GURA 4MJCA 2PVOC 1T7PB 4CHSA 4MABA 1AW9A 1ERWA 1X5CA 3GH9A 3U5RE 3KJYA 3GKNA 2O85A 2RLIA 2C0FA 1K3OA 2OA7A 5HR2A 2B7KA 5HQPA 3LG6A 1BJXA 3F6FA 6GSWA 1SK1A 5CRHA 1XZOA 4MF7A 2X99A 2YANA 2WDUA 3W8SA 2PUKC 2HSYA 2L6DA 4G10A 3MYDA 5D9WA 2ALBA 3RDWA 5B8AA 4N0ZA 3F3QA 1MEKA 4POBA 4ACSA 2MBTA 2H72A 1XBSA 3QCPA 2WRTA 3TUEA 4IQAA 2FWGA 3H4KA 4TR4A 5JCGA 1O85A 2LRNA 2GVPA 3FY7A 4KGIA 4K1FA 1JZWA 1GSEA 1SK2A 2LRTA 1MDKA 2B6MA 5HFKA 2H75A 5GSTA 5JCWA 4EF0A 1S3DA 1WMJA 4HU9A 4LMWA 4CY6A 3H1NA 1Z5YE 3CQFA 6GSSA 3M0FA 3EMPA 11GSA 2X8HA 2YCDA 5IMFA 2YOIA 4TRXA 2HYXA 3IBHA 3QOUA 4K7NA 2M80A 3F4SA 2O87A 2QGVA
chains in the Genus database with same CATH topology
1H4OA 4HI7A 3ZREA 2X64A 3IOSA 5GAPD 2CX4A 2FGXA 2CZ3A 2H70A 4MP4A 1FHEA 2LRCA 4TR1A 2E2MA 3DEXA 4OFMA 4IW9A 2MMNA 4IELA 2IIYA 4EKZA 4OFNA 1TDIA 2R6KA 2F3MA 5DAKA 1XWKA 1DUGA 1CQHA 3KCMA 4RQXA 4XS6A 3UMAA 2LV3A 1F6MC 1TU8A 4CW9A 4QL9A 2R37A 2QKEA 1ZZYA 2DMMA 2AHEA 4XS4A 2EIOA 3F3RA 3KTBA 3ZFBA 1YF1A 1M9AA 2E7PA 3IV4A 1ZMAA 2GZZA 1ERVA 5G30A 3ZZXA 1WE0A 1BX9A 3ZTLA 5B7CA 4IJ3A 4MK3A 4O92A 5ECNB 4RI7A 2L4QA 2DBCA 5HFIA 4GWRA 4EIQA 1Z7RA 1O7UA 5DDLA 5CREA 1O8XA 5JWOB 2N5FA 1MD4A 2AYTA 2YWOA 3TDGA 1WRYA 2RUEA 1YF0A 3UVTA 4ECIA 1GULA 1PSQA 1ABAA 1ZL9A 4J57E 3DWVA 3EU4A 1T4ZA 4I8BA 2WGRA 2C1YA 1RK4A 1SJ6A 3DIEA 4J2FA 5JWRB 5ECOB 1IYHA 2FA8A 3WYWA 4G0IA 1MD3A 1TOFA 6GSYA 3UEMA 3RHCA 1T4YA 3RPNA 3M8NA 1ZCPA 2A4VA 2K9FA 1ZOFA 4Z2UA 4PNGA 1GSDA 1HNAA 4E8EA 4KDUA 1FB0A 4POKA 2IMKA 3VK9A 1K0CA 3BJ5A 5E59A 3HA9A 5ECIB 3L9UA 3IAM2 1VGLA 1WIKA 3ERWA 4EUYA 3FRCA 4TR0A 3D0ZA 4NAXA 2DKIA 4IBPA 3LW9A 3CSHA 1M9BA 2E0QA 3TRPA 4NHZA 3GRXA 1B9XC 2YJ7A 1U87A 1PA3A 4JRRA 1ON4A 4FYUA 5EY6A 3I43A 2V6KA 2VCQA 1V58A 2R0CA 1PGTA 1SK0A 2GQLA 4MPGA 4MZCA 4Q5RA 4NWYA 4KNDA 1PKZA 2JZRA 1WPIA 2DIZA 1EV9A 2YWMA 3ISOA 1TRVA 1WWJA 1R26A 4N11A 1KBNA 2CZ2A 2HLSA 1OKDA 2P0GA 3ZL5A 3D6IA 2CAIA 1NHOA 3L78A 2ON7A 2JZTA 4YAPA 3GX8A 4V2LA 1EP8A 5B6MA 4LLRA 2R5GA 4EXJA 4MMMA 4F0CA 2VL2C 2H74A 3EWLA 4GF0A 3G7YA 1WOUA 4DSSB 3FZ5A 4WF5A 1Z9HA 4J56E 1U3IA 5AN1A 5IOXA 3KMNA 1YY7A 1W4VA 2ON5A 3TOTA 2AJQB 1XVWA 1TP9A 2ZNMA 2VCWA 4FYCA 2B5EA 2FY6A 4PUFC 3G9BA 1GL8A 3IRAA 3VFIA 5E4WA 4O7HA 3V1WA 1URMA 2QC7A 4IHUA 2PPTA 4I2UA 1MDIA 5CNWA 5J9CA 2P5RA 2VO4A 3ZFLA 2GGTA 5CRDA 14GSA 2C0EA 5H5SA 1SKSB 1TKDB 1VRSD 1QK8A 2VOCA 4JR4A 3HZ8A 3RPPA 1EGRA 3UIWA 2KUCA 4HQSA 4ZBAA 2OKAA 3ZIVA 5ABRA 4K9ZA 2M46A 5DVBA 2R4VA 3CSJA 4JR6A 1Q98A 2FCHA 1V40A 2XC2A 2CVBA 2VCVA 4ILFA 3DXBA 4EIPA 2X8GA 1LU4A 1K0MA 1RW1A 3ZVJD 4A5PA 4G2EA 2WZ9A 4MLYA 16GSA 1PRXA 3HCZA 1UVZA 4K8MA 4QQ7A 1X9SB 5D8IA 5G1LA 4D73A 2FWEA 4HU7A 2IJYA 1DSBA 13GSA 1HYUA 3F63A 3CYNA 1R5AA 5LD0A 1G0TA 4YQMA 2QSIA 4LMVA 3LXTA 1FAAA 5ECLB 2X8CA 4HJMA 5LNKe 3BCKA 2DJJA 5J9BA 2O8VB 3DKSA 1DBYA 2GS3A 2VD1A 1AAZA 3VI5A 4FQUA 3OR5A 2VCZA 9GSSA 3WT1A 3C8EA 4DEJA 4H86A 4F03A 2XPDA 2K6VA 5B8BA 1K3LA 2H1BA 1NM3A 1WP0A 3ZVJA 5AISA 3TB2A 3C71A 1K3YA 1TI1A 4ZB6A 3CTGA 5G2ZA 3GHAA 4I2TA 2IMDA 2NVLA 2J23A 4MF6A 1SJZA 3D4TA 3GH6A 4XS4B 1M2AA 1SL1B 1ACVA 4ZXGA 3HHVA 5IMDA 2VL2A 4ID0A 1A2JA 1FOVA 1ZYEA 2GSQA 1A2LA 1OE8A 3ME7A 3IDVA 2BMXA 1UN2A 3EINA 4EDZA 4KDXA 1Y6EA 4WF4A 1PN9A 4WBJA 2I3YA 3FMWA 3IHQA 2V1MA 3G7JA 3VWWA 3LORA 3RAZA 1FW1A 3IAS2 1JFUA 1GTIA 1XPVA 3N9JA 4RI6A 4OWYA 4DSSA 5G31A 3EYTA 3ZITA 5ECSA 3MIXA 4OO4A 2JACA 1FB6A 2XHFA 1PKWA 1O73A 3Q19A 1TTZA 3TRQA 1XW9A 2K8VA 5CRGA 5HR0A 4TOPA 1KNGA 2CAQA 4Q5NA 4IGJA 3FZAA 5B6NA 2FUG2 4OCEA 4XHMA 3FHKA 5A4VA 22GSA 3KIJA 2L59A 1THXA 2TIRA 2QA1A 3NOFA 3VPQA 2O89A 4YKFA 2GSTA 4K7IA 3E0UA 3D21A 3TGZA 3FK8A 4EE0A 4WR5A 2GQKA 3I69A 3WGXA 1G7OA 5AIXA 3EVIA 3HXSA 6GSTA 2L6CA 3VPTA 1JZOA 3KXOA 4MH3A 2OACA 4K0NA 2MMAA 2VD0A 2WJUA 3A2VA 2B5YA 2PMTA 3HY2A 18GSA 3O6TA 2L5LA 2GZYA 3A3TA 2LTKA 3QAWA 4X43A 1NW2A 3D22A 4BVYB 5LCZA 2IMIA 2A4HA 2P5QA 2VIMA 4ZBDA 3ZLPA 4DVCA 1CQGA 3J7Yk 3C1RA 3TKSC 3KM6A 3KH9A 2H1GA 3AY8A 2LQQA 2CVKA 4HOJA 3FZ4A 5HR3A 3GYKA 4O5UA 1GSFA 2PWJA 4IS0A 2LJKA 4PURA 1V98A 2C3QA 1A8LA 2H6ZA 1GTAA 1GRXA 1SU9A 4LL1B 1TRSA 3A5WA 5IMVA 2PGTA 3KP9A 1AC1A 4K5RA 3MNGA 5JWQB 4BPYA 1XWBA 2H73A 2V41A 5CAXA 2NDOA 5KOWA 4ZILA 1B8XA 5G5FA 1SKRB 2IPAA 2H0IA 2C8UA 4MH2A 2FA4A 2NPBA 3IC4A 4KDYA 1X5EA 1Z6MA 1YQ1A 2X49A 1K0NA 4OMVA 1B48A 3CBUA 3H79A 1Z3EA 3VWVA 4AJ7A 5J41A 5BMUA 2PVQA 2DJ1A 2WFCA 4PGTA 5DJLA 1GUKA 1M0UA 1WJKA 4LL4B 2CVDA 5CRWA 2RM5A 2VAFA 1XCCA 3C1SA 4BL7B 2UZ8A 4GRFA 1LJRA 2LKUA 3P90A 2B3SA 1TXXA 2F8FA 5H5QA 3ZMLA 3L9VA 2C80A 4PUAA 3ZYWA 5IMAA 4K2DA 3DD3A 5FHIA 4KUNA 3HZ4A 2H6YA 3K8NA 2HSHA 3ERGA 4IJIA 2KP1A 1AQVA 2GT6A 3DVWA 4TW5A 1OC9A 1AXDA 1A8YA 4P3YB 1PN0A 1ZGNA 3F4RA 5D9VA 3FKFA 3LXZA 3KZQA 4HUAA 1GSYA 3LWAA 4GXZA 1V9WA 3GL5A 3HJOA 2FWFA 3GIXA 1QFNA 4WR4A 1XVQA 1EP7A 2F8AA 4O32A 2H30A 3C7MA 2H8LA 2C3TA 2K8SA 4D73B 2DSAA 4O5RA 3DYRA 4X1UA 3A2WA 2A2SA 1VF4A 2DJ2A 4F82A 4I6XA 4FH8A 3Q6OA 2H0GA 2IFQA 3TKSA 1SL2B 4NPBA 1FOHA 4K7OA 5KOXA 3TOUA 3F9UA 3D5JA 1GP1A 4L0WA 4TKYA 3R3EA 3TRXA 4ML6A 5ECRB 1XW5A 4OFTA 1ML6A 4TXVA 1ZYPA 3HDCA 2WCIA 2GT5A 4N30A 4BVYA 3G7IA 4ECCA 2LSTA 4RUVA 1SJIA 2R0GA 3EE2A 3CRUA 2H76A 2HNLA 2G0FA 2YN1A 2AAWA 5KN1A 4AGSA 3VLNA 1PD21 4TXOB 3M3MA 3IXRA 5A4UA 5EL8A 1DE2A 3PPUA 4HEA2 5CYYA 6GSUA 3HKRA 3FYGA 3SBCA 3W8JA 2IMEA 2C3NA 1C72A 1DE1A 1O6JA 4G9HA 4NMUA 1M2BA 2WULA 4ICYA 2OBKA 1J9BA 2H01A 1VF2A 2RUFA 1QGVA 5F05A 5A5KA 2YP6A 2DMLA 4PNFA 4GTUA 4K6XA 1R7HA 1QQ2A 2HSMA 3TKSE 5KN3A 5INYA 2VLTA 1K0DA 1EGOA 1SENA 2JSYA 2XPEA 1A24A 4EDYA 1F9MA 2VL9A 1FO5A 4EC0A 4BL7A 1ZYQB 5GAND 2TRCP 2EC4A 2G2QA 4ECBA 3FZ9A 3APQA 2WB9A 1PL2A 4FO5A 4K2XA 2YWIA 4AJ8A 5KN0A 2RIIA 4ECJA 1KEBA 4Z7XA 2H71A 3J7Yb 1BG5A 1GH2A 2X4AA 4IVFA 4CDOA 3MSZA 4K0GA 1GNEA 2VLVA 3ZRDA 3EU3A 4L8EA 5F0GA 2K18A 3IA1A 3H93A 4L5OA 4HQZA 1B9YC 4IKHA 3APOA 5ECHB 4GCIA 6GSXA 3U6VA 3CXGA 5GZZB 3IHGA 2B1LA 2Z9SA 4GQCA 3QMXA 3GSTA 3ZMKA 1OC3A 1FVJA 5DCHA 4GSTA 3FR9A 4PQHA 5IQYA 3W6GA 2IN3A 4OO5A 1IYIA 4PXOA 1GUMA 2PERA 2FD3A 1XOBA 4KSMA 1OE7A 1JLVA 4USSA 2KHPA 3QAGA 3PGTA 4HJ2A 3GFKA 4DSRA 2XBQA 2REMA 4WEYA 3DGQA 4MCUA 3BCIA 4FIWA 4CY8A 1K0AA 3MDKA 1HQOA 1N2AA 2I81A 4KW6A 2YJHA 3KGKA 4I5QA 1GUHA 1TK5B 2ZUPA 2R3XA 4OCFA 2GTUA 1RQMA 2AB6A 3GUSA 4BA7A 1YKAA 1EEJA 3HD5A 2HRKA 1M99A 2YV9A 4Z2RA 4NXIA 4HZ4A 4KF9A 2DC5A 4BWQA 2JZSA 4MZBA 4X0XA 2VM1A 4TXOA 1VF3A 1GSUA 1OVNA 1J08A 3FW2A 2VCXA 3APSA 2BJXA 1XOAA 5FT3A 4G0LA 2I4AA 2F9SA 4XCSA 3EC3A 3IR4A 4NHWA 20GSA 2MZCA 1JHBA 2LJRA 3LGCA 2OBIA 2B1KA 4G0KA 4I97A 2H0HA 2HRAA 4MJBA 2QA2A 2YV7A 2V6OA 3LEFA 1PMTA 1AUCA 3F0IA 2EIQA 4ZL9A 1OC9B 2FHEA 8GSSA 1XXUA 2JU5A 3PR8A 1V2AA 5D73A 3US3A 2C0DA 4WETA 5GSSA 4JBBA 4HZ2A 1Q4JA 3GSSA 1GSQA 3LQ7A 2HI7A 4IP1A 1EZKA 3R2QA 1ERTA 2ES7A 5DALA 1F2EA 3IC8A 4PTSA 3C73A 5IMZA 3ZIJA 3ERFA 2DKHA 2XBIA 5IO2A 3GKMA 4XTSA 2MBSA 1EWXA 1NHYA 4KB3A 1J0FA 5DQYA 2GLRA 3UJ1A 3KD0A 1G7EA 1U6TA 1GLPA 3NZNA 2BTOT 4PQ1A 4YH2A 4POLA 3MWHA 1AQWA 1M7TA 2GSRA 1A0FA 2OE0A 5L71A 5ECMB 2IFQB 4AJ6A 4EO3A 4F9ZA 3UVHA 5ECKB 5DBQA 2PBJA 4YKGA 2MMZA 4F2IA 5BRTA 3CMIA 2B7JA 2RM6A 4NV2A 2KP2A 4FYBA 2PN8A 1OAZA 1TJDA 1GWCA 3N5OA 1SYRA 1YJ6A 2VL3A 3RBTA 2GQMA 5JCUA 4ML1A 1ST9A 4KX4A 3CRTA 4POMA 3WGEA 3NIVA 1NSWA 1E2YA 2FWHA 1USBA 2F51A 2MYGA 4WBRD 1XWCA 4GLTA 2FLSA 1X9WB 2HRFA 1GSSA 3E9JB 3PINA 5EVOA 2YWNA 2H19A 1EOGA 1I9DA 5ECQB 3HJPA 1R4WA 3S9FA 4ULXA 3UL3A 1HD2A 2LEGA 1PX7A 3PH9A 1GNWA 4E8HA 6GSVA 4JEDA 2P31A 2IMFA 2HZEB 1TI3A 5KEJA 4MF5A 2VLUA 4EL1A 3TJBA 4KE3A 1XWAA 1UA5A 2V2GA 3FEUA 2IWTA 2J9HA 3QFAC 2PU9C 3CTFA 5ELGA 5F8BA 3VI7A 1TU7A 5ID2B 4O5QA 4N0VA 3SWLA 3KTLA 1XIYA 2AUVA 4KH7A 3TJJA 4TVEA 1SD9A 3GKXA 3O76A 1TW9A 4DSQA 2YNXA 1O8WA 1Z7PA 2TRXA 1TK0B 2CT6A 2HT9A 4NV5A 4IP6A 1AIUA 3KMOA 2YPMA 4N10A 1SKWB 1S3CA 2B5XA 3GL3A 3KEBA 4TN8A 2D2ZA 2JSZA 1SD8A 4ZBBA 3GV1A 5F06A 2N5BA 3WT2A 3A5IA 2YZUA 5KN2A 2DJKA 3ED3A 1TK8B 3I9V2 3IPZA 1TRWA 2GSSA 5ECPB 3DMLA 4BVXA 3VURA 3QFBC 2ZCTA 3TCOA 2LS5A 4F0BA 1Z6NA 3M9JA 3M1GA 3F4TA 4EVMA 5HR1A 1QMVA 3L9SA 3TKRA 4YQVA 3HYPA 2L5OA 3EPTA 3GTUB 4V2MA 2VM2A 4ZIJA 2IL3A 2R0PA 2CV4A 4IQ1A 1QXHA 3IK9A 1MDJA 2YZHA 3LYKA 4XIHA 1PQNA 5AGYA 1T3BA 1A23A 4PQIA 1BYEA 1YZXA 3GX0A 3LYPA 3L4NA 2C4JA 2CQ9A 4XRDA 2I1UA 5G5EA 3L0HA 2VUPA 1OYJA 4Z2TA 3TJKA 1W89A 1BEDA 2JL4A 1R5PA 2LUSA 4MZWA 3BBYA 3IE3A 2DLXA 4MJEA 1S3AA 4MJAA 12GSA 2H1AA 3TJFA 4BWSA 4KCAA 3UARA 4IN0A 1PX6A 1GTBA 2E2GA 4ZB8A 4LA1A 5ENUA 5AIVA 2OE1A 1MTCA 1K0BA 3A2XA 3DVXA 3UAPA 5IPHA 4JU5A 1O81A 4QL7A 3CSIA 2LQOA 4V2NA 2A2PA 1FG4A 3KH7A 4WXTA 1G6YA 3H8QA 2GDRA 2N5AA 4WKWA 2OE3A 1THOA 3GN3A 3EURA 4KCEA 5D96A 4G19A 3F8UA 3Q18A 3QD9A 3QDNA 2AV4A 5FWGA 3ME8A 1BAYA 5J5NA 2HZEA 3KP8A 4GSSA 1K0OA 19GSA 2OJLA 1OC8A 3EMXA 2V32A 2O7KA 5DCGA 4YQUA 1FVKA 5ID2A 7GSSA 4PX1A 4V1Ag 1GLQA 1F3AA 1YEXA 3HVXA 1AQXA 1PL1A 1T8EB 5IO0A 3IK7A 5DALB 5D93A 3LJRA 4Q5QA 2OADA 2M72A 2R2JA 1B4QA 3TKQA 5A4WA 1BQ7A 1HNCA 1T00A 1KTEA 5H5RA 3GMFA 1ERUA 3GA4A 4KAEA 3QAVA 1I5GA 3BD2A 1B4PA 4MPFA 3QR6A 2HFDA 5ELAA 1M2DA 3RHBA 2LJAA 3E3EA 5IMCA 3VWUA 3QPMA 3MAKA 4KA0A 5C00A 4RQRA 2H66A 1Y25A 4GQFA 5IOWA 2H1DA 3VWXA 3P8WA 5DJMA 4JZQA 5CP1A 3UBKA 4XS1A 2L4CA 3P2AA 4HDEA 1A0RP 3TJGA 2VCTA 3GTUA 1U3AA 1TRUA 2HE3A 3P7XA 4ZL7A 1HNBA 2C0GA 5D9TA 1H75A 1X5DA 5C04A 3WD6A 2CX3A 5J4UA 1EEMA 1T1VA 5G1KA 5IIZA 1X0RA 3I6AA 1E6BA 1A2MA 4X4JA 2EIRA 5CO3A 1LBKA 1N8JA 1SYXA 4HS1A 4YAVA 2HXKA 2A2RA 4L5LA 2MMOA 1XW6A 1JZDA 2I9HA 2WS2A 2GZPA 5IPGA 3HVVA 17GSA 1YDKA 1XWGA 5IM9A 1VF1A 1ILOA 1F37A 1SL0B 4MNNA 4ISDA 5COHA 3DRNA 3LSZA 2FNOA 4ZB9A 2NTOA 4TR1B 3UOMA 1UC7A 1JZRA 1X9MB 2KOKA 4K5SA 2HZFA 2L57A 3F6DA 3Q74A 4OD7A 5D9XA 2DJ3A 3BOAA 2CA8A 3LFLA 3FR6A 4AF2A 4L0UA 2DJ0A 1GTUA 1YKCA 4TR3A 2H6XA 5DAKB 4JE1A 2JADA 10GSA 3HJMA 2NBSA 2LNSA 1OKTA 4GSNA 3WGDA 1XFLA 4V1Ap 1YEPA 3UBLA 5HFGA 5J3RA 4MDCA 1EV4A 1JLWA 1QUWA 3JCML 1U88A 3HVSA 1F3BA 4ZL8A 3TKPA 1ZYNA 1G6WA 2HRNA 4Q5FA 4XRAA 2DIYA 1EOHA 3GKKA 4MA9A 3FR3A 4BVXB 5DQSA 3GNJA 3O3TA 5F07A 4KSOA 2KLXA 3D4MA 5EPFA 1V57A 3M9KA 2LNTA 3GURA 4MJCA 2PVOC 1T7PB 4CHSA 4MABA 1AW9A 1ERWA 1X5CA 3GH9A 3U5RE 3KJYA 3GKNA 2O85A 2RLIA 2C0FA 1K3OA 2OA7A 5HR2A 2B7KA 5HQPA 3LG6A 1BJXA 3F6FA 6GSWA 1SK1A 5CRHA 1XZOA 4MF7A 2X99A 2YANA 2WDUA 3W8SA 2PUKC 2HSYA 2L6DA 4G10A 3MYDA 5D9WA 2ALBA 3RDWA 5B8AA 4N0ZA 3F3QA 1MEKA 4POBA 4ACSA 2MBTA 2H72A 1XBSA 3QCPA 2WRTA 3TUEA 4IQAA 2FWGA 3H4KA 4TR4A 5JCGA 1O85A 2LRNA 2GVPA 3FY7A 4KGIA 4K1FA 1JZWA 1GSEA 1SK2A 2LRTA 1MDKA 2B6MA 5HFKA 2H75A 5GSTA 5JCWA 4EF0A 1S3DA 1WMJA 4HU9A 4LMWA 4CY6A 3H1NA 1Z5YE 6GSSA 3M0FA 3EMPA 11GSA 2X8HA 2YCDA 5IMFA 2YOIA 4TRXA 2HYXA 3IBHA 3QOUA 4K7NA 2M80A 3F4SA 2O87A 2QGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H4O A;  4HI7 A;  3ZRE A;  2X64 A;  3IOS A;  5GAP D;  2CX4 A;  2FGX A;  2CZ3 A;  2H70 A;  4MP4 A;  1FHE A;  2LRC A;  4TR1 A;  2E2M A;  3DEX A;  4OFM A;  4IW9 A;  2MMN A;  4IEL A;  2IIY A;  4EKZ A;  4OFN A;  1TDI A;  2R6K A;  2F3M A;  5DAK A;  1XWK A;  1DUG A;  1CQH A;  3KCM A;  4RQX A;  4XS6 A;  3UMA A;  2LV3 A;  1F6M C;  1TU8 A;  4CW9 A;  4QL9 A;  2R37 A;  2QKE A;  1ZZY A;  2DMM A;  2AHE A;  4XS4 A;  2EIO A;  3F3R A;  3KTB A;  3ZFB A;  1YF1 A;  1M9A A;  2E7P A;  3IV4 A;  1ZMA A;  2GZZ A;  1ERV A;  5G30 A;  3ZZX A;  1WE0 A;  1BX9 A;  3ZTL A;  5B7C A;  4IJ3 A;  4MK3 A;  4O92 A;  5ECN B;  4RI7 A;  2L4Q A;  2DBC A;  5HFI A;  4GWR A;  1Z7R A;  1O7U A;  5DDL A;  5CRE A;  1O8X A;  5JWO B;  2N5F A;  1MD4 A;  2AYT A;  2YWO A;  3TDG A;  1WRY A;  2RUE A;  1YF0 A;  3UVT A;  4ECI A;  1GUL A;  1PSQ A;  1ABA A;  1ZL9 A;  4J57 E;  3DWV A;  3EU4 A;  1T4Z A;  4I8B A;  2WGR A;  2C1Y A;  1RK4 A;  1SJ6 A;  3DIE A;  4J2F A;  5JWR B;  5ECO B;  1IYH A;  2FA8 A;  3WYW A;  1MD3 A;  1TOF A;  6GSY A;  3UEM A;  3RHC A;  1T4Y A;  3RPN A;  3M8N A;  1ZCP A;  2A4V A;  2K9F A;  1ZOF A;  4PNG A;  1GSD A;  1HNA A;  4E8E A;  4KDU A;  1FB0 A;  4POK A;  2IMK A;  3VK9 A;  1K0C A;  3BJ5 A;  5E59 A;  3HA9 A;  5ECI B;  3L9U A;  3IAM 2;  1VGL A;  1WIK A;  3ERW A;  4EUY A;  3FRC A;  4TR0 A;  3D0Z A;  4NAX A;  4IBP A;  3CSH A;  1M9B A;  2E0Q A;  3TRP A;  4NHZ A;  3GRX A;  1B9X C;  2YJ7 A;  1U87 A;  1PA3 A;  4JRR A;  1ON4 A;  4FYU A;  5EY6 A;  3I43 A;  2V6K A;  2VCQ A;  1V58 A;  1PGT A;  1SK0 A;  2GQL A;  4MPG A;  4MZC A;  4Q5R A;  4NWY A;  4KND A;  1PKZ A;  2JZR A;  1WPI A;  2DIZ A;  1EV9 A;  2YWM A;  3ISO A;  1TRV A;  1WWJ A;  1R26 A;  4N11 A;  1KBN A;  2CZ2 A;  2HLS A;  1OKD A;  2P0G A;  3ZL5 A;  3D6I A;  2CAI A;  1NHO A;  3L78 A;  2ON7 A;  2JZT A;  4YAP A;  3GX8 A;  4V2L A;  1EP8 A;  5B6M A;  4LLR A;  2R5G A;  4EXJ A;  4MMM A;  4F0C A;  2VL2 C;  2H74 A;  3EWL A;  4GF0 A;  3G7Y A;  1WOU A;  4DSS B;  3FZ5 A;  4WF5 A;  1Z9H A;  4J56 E;  1U3I A;  5AN1 A;  5IOX A;  3KMN A;  1YY7 A;  1W4V A;  2ON5 A;  3TOT A;  2AJQ B;  1XVW A;  1TP9 A;  2ZNM A;  2VCW A;  4FYC A;  2B5E A;  2FY6 A;  4PUF C;  3G9B A;  1GL8 A;  3IRA A;  3VFI A;  5E4W A;  4O7H A;  3V1W A;  1URM A;  2QC7 A;  4IHU A;  2PPT A;  4I2U A;  1MDI A;  5CNW A;  5J9C A;  2P5R A;  2VO4 A;  3ZFL A;  2GGT A;  5CRD A;  14GS A;  2C0E A;  5H5S A;  1SKS B;  1TKD B;  1VRS D;  1QK8 A;  2VOC A;  4JR4 A;  3HZ8 A;  3RPP A;  1EGR A;  3UIW A;  2KUC A;  4HQS A;  4ZBA A;  2OKA A;  3ZIV A;  5ABR A;  4K9Z A;  2M46 A;  5DVB A;  2R4V A;  3CSJ A;  4JR6 A;  1Q98 A;  2FCH A;  1V40 A;  2XC2 A;  2CVB A;  2VCV A;  4ILF A;  3DXB A;  2X8G A;  1LU4 A;  1K0M A;  1RW1 A;  3ZVJ D;  4G2E A;  2WZ9 A;  4MLY A;  16GS A;  1PRX A;  3HCZ A;  1UVZ A;  4K8M A;  4QQ7 A;  1X9S B;  5D8I A;  5G1L A;  4D73 A;  2FWE A;  4HU7 A;  2IJY A;  1DSB A;  13GS A;  1HYU A;  3F63 A;  3CYN A;  1R5A A;  5LD0 A;  1G0T A;  4YQM A;  2QSI A;  4LMV A;  3LXT A;  1FAA A;  5ECL B;  2X8C A;  4HJM A;  5LNK e;  3BCK A;  2DJJ A;  5J9B A;  2O8V B;  3DKS A;  1DBY A;  2GS3 A;  2VD1 A;  1AAZ A;  3VI5 A;  3OR5 A;  2VCZ A;  9GSS A;  3WT1 A;  3C8E A;  4DEJ A;  4H86 A;  4F03 A;  2XPD A;  2K6V A;  5B8B A;  1K3L A;  2H1B A;  1NM3 A;  1WP0 A;  3ZVJ A;  5AIS A;  3TB2 A;  3C71 A;  1K3Y A;  1TI1 A;  4ZB6 A;  3CTG A;  5G2Z A;  3GHA A;  4I2T A;  2IMD A;  2NVL A;  2J23 A;  4MF6 A;  1SJZ A;  3D4T A;  3GH6 A;  4XS4 B;  1M2A A;  1SL1 B;  1ACV A;  4ZXG A;  3HHV A;  5IMD A;  2VL2 A;  4ID0 A;  1A2J A;  1FOV A;  1ZYE A;  2GSQ A;  1A2L A;  1OE8 A;  3ME7 A;  3IDV A;  2BMX A;  1UN2 A;  3EIN A;  4EDZ A;  4KDX A;  1Y6E A;  4WF4 A;  1PN9 A;  4WBJ A;  2I3Y A;  3IHQ A;  2V1M A;  3G7J A;  3VWW A;  3LOR A;  3RAZ A;  1FW1 A;  3IAS 2;  1JFU A;  1GTI A;  1XPV A;  3N9J A;  4RI6 A;  4OWY A;  4DSS A;  5G31 A;  3EYT A;  3ZIT A;  5ECS A;  4OO4 A;  2JAC A;  1FB6 A;  2XHF A;  1PKW A;  1O73 A;  3Q19 A;  1TTZ A;  3TRQ A;  1XW9 A;  2K8V A;  5CRG A;  5HR0 A;  4TOP A;  1KNG A;  2CAQ A;  4Q5N A;  4IGJ A;  3FZA A;  5B6N A;  2FUG 2;  4OCE A;  4XHM A;  3FHK A;  5A4V A;  22GS A;  3KIJ A;  2L59 A;  1THX A;  2TIR A;  3NOF A;  3VPQ A;  2O89 A;  2GST A;  4K7I A;  3E0U A;  3D21 A;  3TGZ A;  3FK8 A;  4EE0 A;  4WR5 A;  2GQK A;  3I69 A;  3WGX A;  1G7O A;  5AIX A;  3EVI A;  3HXS A;  6GST A;  2L6C A;  3VPT A;  1JZO A;  3KXO A;  4MH3 A;  2OAC A;  4K0N A;  2MMA A;  2VD0 A;  2WJU A;  3A2V A;  2B5Y A;  2PMT A;  3HY2 A;  18GS A;  3O6T A;  2L5L A;  2GZY A;  3A3T A;  2LTK A;  3QAW A;  4X43 A;  1NW2 A;  3D22 A;  5LCZ A;  2IMI A;  2P5Q A;  2VIM A;  4ZBD A;  3ZLP A;  4DVC A;  1CQG A;  3J7Y k;  3C1R A;  3TKS C;  3KM6 A;  3KH9 A;  2H1G A;  3AY8 A;  2LQQ A;  2CVK A;  4HOJ A;  3FZ4 A;  5HR3 A;  3GYK A;  1GSF A;  2PWJ A;  4IS0 A;  2LJK A;  4PUR A;  1V98 A;  2C3Q A;  1A8L A;  2H6Z A;  1GTA A;  1GRX A;  1SU9 A;  4LL1 B;  1TRS A;  3A5W A;  5IMV A;  2PGT A;  3KP9 A;  1AC1 A;  3MNG A;  5JWQ B;  4BPY A;  1XWB A;  2H73 A;  2V41 A;  5CAX A;  2NDO A;  4ZIL A;  1B8X A;  5G5F A;  1SKR B;  2IPA A;  2H0I A;  2C8U A;  4MH2 A;  2FA4 A;  2NPB A;  3IC4 A;  4KDY A;  1X5E A;  1Z6M A;  1YQ1 A;  1K0N A;  4OMV A;  1B48 A;  3CBU A;  3H79 A;  1Z3E A;  3VWV A;  4AJ7 A;  5J41 A;  2PVQ A;  2DJ1 A;  2WFC A;  4PGT A;  5DJL A;  1GUK A;  1M0U A;  1WJK A;  4LL4 B;  2CVD A;  5CRW A;  2RM5 A;  2VAF A;  1XCC A;  3C1S A;  4GRF A;  1LJR A;  2LKU A;  3P90 A;  2B3S A;  1TXX A;  2F8F A;  5H5Q A;  3ZML A;  3L9V A;  2C80 A;  4PUA A;  3ZYW A;  5IMA A;  4K2D A;  3DD3 A;  5FHI A;  4KUN A;  3HZ4 A;  2H6Y A;  3K8N A;  2HSH A;  3ERG A;  4IJI A;  2KP1 A;  1AQV A;  2GT6 A;  3DVW A;  4TW5 A;  1OC9 A;  1AXD A;  1A8Y A;  4P3Y B;  1ZGN A;  3F4R A;  5D9V A;  3FKF A;  3LXZ A;  3KZQ A;  4HUA A;  1GSY A;  3LWA A;  4GXZ A;  1V9W A;  3GL5 A;  3HJO A;  2FWF A;  3GIX A;  1QFN A;  4WR4 A;  1XVQ A;  1EP7 A;  2F8A A;  4O32 A;  2H30 A;  3C7M A;  2H8L A;  2C3T A;  2K8S A;  4D73 B;  2DSA A;  4O5R A;  3DYR A;  4X1U A;  3A2W A;  2A2S A;  1VF4 A;  2DJ2 A;  4F82 A;  4I6X A;  4FH8 A;  3Q6O A;  2H0G A;  2IFQ A;  3TKS A;  1SL2 B;  4NPB A;  4K7O A;  3TOU A;  3F9U A;  3D5J A;  1GP1 A;  4L0W A;  4TKY A;  3TRX A;  4ML6 A;  5ECR B;  1XW5 A;  4OFT A;  1ML6 A;  4TXV A;  3HDC A;  2WCI A;  2GT5 A;  4N30 A;  4BVY A;  3G7I A;  4ECC A;  2LST A;  4RUV A;  1SJI A;  3EE2 A;  3CRU A;  2H76 A;  2HNL A;  2G0F A;  2YN1 A;  2AAW A;  5KN1 A;  4AGS A;  3VLN A;  1PD2 1;  4TXO B;  3M3M A;  3IXR A;  5A4U A;  5EL8 A;  1DE2 A;  4HEA 2;  5CYY A;  6GSU A;  3HKR A;  3FYG A;  3SBC A;  3W8J A;  2IME A;  2C3N A;  1C72 A;  1DE1 A;  1O6J A;  4G9H A;  4NMU A;  1M2B A;  2WUL A;  2OBK A;  1J9B A;  2H01 A;  1VF2 A;  2RUF A;  1QGV A;  5F05 A;  5A5K A;  2YP6 A;  2DML A;  4PNF A;  4GTU A;  4K6X A;  1R7H A;  1QQ2 A;  3TKS E;  5KN3 A;  5INY A;  2VLT A;  1K0D A;  1EGO A;  1SEN A;  2JSY A;  2XPE A;  1A24 A;  4EDY A;  1F9M A;  2VL9 A;  1FO5 A;  4EC0 A;  4BL7 A;  1ZYQ B;  5GAN D;  2TRC P;  2EC4 A;  2G2Q A;  4ECB A;  3FZ9 A;  3APQ A;  2WB9 A;  1PL2 A;  4FO5 A;  2YWI A;  4AJ8 A;  5KN0 A;  2RII A;  4ECJ A;  1KEB A;  4Z7X A;  2H71 A;  3J7Y b;  1BG5 A;  1GH2 A;  4IVF A;  4CDO A;  3MSZ A;  4K0G A;  1GNE A;  2VLV A;  3ZRD A;  3EU3 A;  4L8E A;  5F0G A;  2K18 A;  3IA1 A;  3H93 A;  4L5O A;  4HQZ A;  1B9Y C;  4IKH A;  3APO A;  5ECH B;  4GCI A;  6GSX A;  3U6V A;  3CXG A;  5GZZ B;  2B1L A;  2Z9S A;  4GQC A;  3QMX A;  3GST A;  3ZMK A;  1OC3 A;  1FVJ A;  5DCH A;  4GST A;  3FR9 A;  4PQH A;  5IQY A;  3W6G A;  2IN3 A;  4OO5 A;  1IYI A;  4PXO A;  1GUM A;  2PER A;  2FD3 A;  1XOB A;  4KSM A;  1OE7 A;  1JLV A;  2KHP A;  3QAG A;  3PGT A;  4HJ2 A;  3GFK A;  4DSR A;  2XBQ A;  2REM A;  4WEY A;  3DGQ A;  4MCU A;  3BCI A;  4FIW A;  1K0A A;  3MDK A;  1HQO A;  1N2A A;  2I81 A;  4KW6 A;  2YJH A;  3KGK A;  4I5Q A;  1GUH A;  1TK5 B;  2ZUP A;  2R3X A;  4OCF A;  2GTU A;  1RQM A;  2AB6 A;  3GUS A;  4BA7 A;  1YKA A;  1EEJ A;  3HD5 A;  1M99 A;  2YV9 A;  4NXI A;  4HZ4 A;  2DC5 A;  4BWQ A;  2JZS A;  4MZB A;  4X0X A;  2VM1 A;  4TXO A;  1VF3 A;  1GSU A;  1OVN A;  1J08 A;  3FW2 A;  2VCX A;  3APS A;  2BJX A;  1XOA A;  5FT3 A;  2I4A A;  2F9S A;  4XCS A;  3EC3 A;  3IR4 A;  4NHW A;  20GS A;  2MZC A;  1JHB A;  2LJR A;  3LGC A;  2OBI A;  2B1K A;  4I97 A;  2H0H A;  4MJB A;  2YV7 A;  2V6O A;  3LEF A;  1PMT A;  1AUC A;  3F0I A;  2EIQ A;  4ZL9 A;  1OC9 B;  2FHE A;  8GSS A;  1XXU A;  2JU5 A;  3PR8 A;  1V2A A;  5D73 A;  3US3 A;  2C0D A;  4WET A;  5GSS A;  4JBB A;  4HZ2 A;  1Q4J A;  3GSS A;  1GSQ A;  3LQ7 A;  2HI7 A;  4IP1 A;  1EZK A;  3R2Q A;  1ERT A;  2ES7 A;  5DAL A;  1F2E A;  3C73 A;  5IMZ A;  3ZIJ A;  3ERF A;  2XBI A;  5IO2 A;  3GKM A;  4XTS A;  2MBS A;  1EWX A;  1NHY A;  4KB3 A;  1J0F A;  5DQY A;  2GLR A;  3UJ1 A;  3KD0 A;  1G7E A;  1U6T A;  1GLP A;  3NZN A;  2BTO T;  4PQ1 A;  4YH2 A;  4POL A;  3MWH A;  1AQW A;  1M7T A;  2GSR A;  1A0F A;  2OE0 A;  5L71 A;  5ECM B;  2IFQ B;  4AJ6 A;  4EO3 A;  4F9Z A;  3UVH A;  5ECK B;  5DBQ A;  2PBJ A;  2MMZ A;  4F2I A;  3CMI A;  2B7J A;  2RM6 A;  4NV2 A;  2KP2 A;  4FYB A;  2PN8 A;  1OAZ A;  1TJD A;  1GWC A;  3N5O A;  1SYR A;  1YJ6 A;  2VL3 A;  3RBT A;  2GQM A;  5JCU A;  4ML1 A;  1ST9 A;  4KX4 A;  3CRT A;  4POM A;  3WGE A;  3NIV A;  1NSW A;  1E2Y A;  2FWH A;  1USB A;  2F51 A;  2MYG A;  4WBR D;  1XWC A;  4GLT A;  2FLS A;  1X9W B;  2HRF A;  1GSS A;  3E9J B;  3PIN A;  5EVO A;  2YWN A;  2H19 A;  1EOG A;  1I9D A;  5ECQ B;  3HJP A;  1R4W A;  3S9F A;  4ULX A;  3UL3 A;  1HD2 A;  2LEG A;  1PX7 A;  3PH9 A;  1GNW A;  4E8H A;  6GSV A;  4JED A;  2P31 A;  2IMF A;  2HZE B;  1TI3 A;  5KEJ A;  4MF5 A;  2VLU A;  4EL1 A;  3TJB A;  4KE3 A;  1XWA A;  1UA5 A;  2V2G A;  3FEU A;  2IWT A;  2J9H A;  3QFA C;  2PU9 C;  3CTF A;  5ELG A;  5F8B A;  3VI7 A;  1TU7 A;  5ID2 B;  4N0V A;  3SWL A;  3KTL A;  1XIY A;  2AUV A;  4KH7 A;  3TJJ A;  4TVE A;  1SD9 A;  3GKX A;  3O76 A;  1TW9 A;  4DSQ A;  2YNX A;  1O8W A;  1Z7P A;  2TRX A;  1TK0 B;  2CT6 A;  2HT9 A;  4NV5 A;  4IP6 A;  1AIU A;  3KMO A;  2YPM A;  4N10 A;  1SKW B;  1S3C A;  2B5X A;  3GL3 A;  3KEB A;  4TN8 A;  2D2Z A;  2JSZ A;  1SD8 A;  4ZBB A;  3GV1 A;  5F06 A;  2N5B A;  3WT2 A;  2YZU A;  5KN2 A;  2DJK A;  3ED3 A;  1TK8 B;  3I9V 2;  3IPZ A;  1TRW A;  2GSS A;  5ECP B;  3DML A;  4BVX A;  3VUR A;  3QFB C;  2ZCT A;  3TCO A;  2LS5 A;  4F0B A;  1Z6N A;  3M9J A;  3M1G A;  3F4T A;  4EVM A;  5HR1 A;  1QMV A;  3L9S A;  3TKR A;  4YQV A;  3HYP A;  2L5O A;  3GTU B;  4V2M A;  2VM2 A;  4ZIJ A;  2IL3 A;  2CV4 A;  4IQ1 A;  1QXH A;  3IK9 A;  1MDJ A;  2YZH A;  3LYK A;  4XIH A;  1PQN A;  5AGY A;  1T3B A;  1A23 A;  4PQI A;  1BYE A;  1YZX A;  3GX0 A;  3LYP A;  3L4N A;  2C4J A;  2CQ9 A;  4XRD A;  2I1U A;  5G5E A;  3L0H A;  2VUP A;  1OYJ A;  3TJK A;  1W89 A;  1BED A;  2JL4 A;  1R5P A;  2LUS A;  4MZW A;  3BBY A;  3IE3 A;  2DLX A;  4MJE A;  1S3A A;  4MJA A;  12GS A;  2H1A A;  3TJF A;  4BWS A;  4KCA A;  3UAR A;  4IN0 A;  1PX6 A;  1GTB A;  2E2G A;  4ZB8 A;  4LA1 A;  5ENU A;  5AIV A;  2OE1 A;  1MTC A;  1K0B A;  3A2X A;  3DVX A;  3UAP A;  5IPH A;  4JU5 A;  1O81 A;  4QL7 A;  3CSI A;  2LQO A;  4V2N A;  1FG4 A;  3KH7 A;  4WXT A;  1G6Y A;  3H8Q A;  2GDR A;  2N5A A;  4WKW A;  2OE3 A;  1THO A;  3GN3 A;  3EUR A;  4KCE A;  5D96 A;  4G19 A;  3F8U A;  3Q18 A;  3QD9 A;  3QDN A;  2AV4 A;  5FWG A;  3ME8 A;  1BAY A;  5J5N A;  2HZE A;  3KP8 A;  4GSS A;  1K0O A;  19GS A;  2OJL A;  1OC8 A;  3EMX A;  2V32 A;  2O7K A;  5DCG A;  4YQU A;  1FVK A;  5ID2 A;  7GSS A;  4PX1 A;  4V1A g;  1GLQ A;  1F3A A;  1YEX A;  3HVX A;  1AQX A;  1PL1 A;  1T8E B;  5IO0 A;  3IK7 A;  5DAL B;  5D93 A;  3LJR A;  4Q5Q A;  2OAD A;  2M72 A;  2R2J A;  1B4Q A;  3TKQ A;  5A4W A;  1BQ7 A;  1HNC A;  1T00 A;  1KTE A;  5H5R A;  3GMF A;  1ERU A;  3GA4 A;  4KAE A;  3QAV A;  1I5G A;  3BD2 A;  1B4P A;  4MPF A;  3QR6 A;  2HFD A;  5ELA A;  1M2D A;  3RHB A;  2LJA A;  3E3E A;  5IMC A;  3VWU A;  3QPM A;  3MAK A;  4KA0 A;  5C00 A;  4RQR A;  2H66 A;  1Y25 A;  4GQF A;  5IOW A;  2H1D A;  3VWX A;  3P8W A;  5DJM A;  4JZQ A;  5CP1 A;  3UBK A;  4XS1 A;  2L4C A;  3P2A A;  4HDE A;  1A0R P;  3TJG A;  2VCT A;  3GTU A;  1U3A A;  1TRU A;  2HE3 A;  3P7X A;  4ZL7 A;  1HNB A;  2C0G A;  5D9T A;  1H75 A;  1X5D A;  5C04 A;  3WD6 A;  2CX3 A;  5J4U A;  1EEM A;  1T1V A;  5G1K A;  5IIZ A;  1X0R A;  3I6A A;  1E6B A;  1A2M A;  2EIR A;  5CO3 A;  1LBK A;  1N8J A;  1SYX A;  4HS1 A;  4YAV A;  2HXK A;  2A2R A;  4L5L A;  2MMO A;  1XW6 A;  1JZD A;  2I9H A;  2WS2 A;  2GZP A;  5IPG A;  3HVV A;  17GS A;  1YDK A;  1XWG A;  5IM9 A;  1VF1 A;  1ILO A;  1F37 A;  1SL0 B;  4ISD A;  5COH A;  3DRN A;  3LSZ A;  2FNO A;  4ZB9 A;  2NTO A;  4TR1 B;  3UOM A;  1UC7 A;  1JZR A;  1X9M B;  2KOK A;  2HZF A;  2L57 A;  3F6D A;  3Q74 A;  4OD7 A;  5D9X A;  2DJ3 A;  3BOA A;  2CA8 A;  3LFL A;  3FR6 A;  4AF2 A;  4L0U A;  2DJ0 A;  1GTU A;  1YKC A;  4TR3 A;  2H6X A;  5DAK B;  4JE1 A;  2JAD A;  10GS A;  3HJM A;  2NBS A;  2LNS A;  1OKT A;  4GSN A;  3WGD A;  1XFL A;  4V1A p;  1YEP A;  3UBL A;  5HFG A;  5J3R A;  4MDC A;  1EV4 A;  1JLW A;  1QUW A;  3JCM L;  1U88 A;  3HVS A;  1F3B A;  4ZL8 A;  3TKP A;  1G6W A;  2HRN A;  4Q5F A;  4XRA A;  2DIY A;  1EOH A;  3GKK A;  4MA9 A;  3FR3 A;  5DQS A;  3GNJ A;  3O3T A;  5F07 A;  4KSO A;  2KLX A;  3D4M A;  5EPF A;  1V57 A;  3M9K A;  2LNT A;  3GUR A;  4MJC A;  2PVO C;  1T7P B;  4CHS A;  4MAB A;  1AW9 A;  1ERW A;  1X5C A;  3GH9 A;  3U5R E;  3KJY A;  3GKN A;  2O85 A;  2RLI A;  2C0F A;  1K3O A;  2OA7 A;  5HR2 A;  2B7K A;  5HQP A;  3LG6 A;  1BJX A;  3F6F A;  6GSW A;  1SK1 A;  5CRH A;  1XZO A;  4MF7 A;  2X99 A;  2YAN A;  2WDU A;  3W8S A;  2PUK C;  2HSY A;  2L6D A;  4G10 A;  5D9W A;  2ALB A;  3RDW A;  5B8A A;  4N0Z A;  3F3Q A;  1MEK A;  4POB A;  4ACS A;  2MBT A;  2H72 A;  1XBS A;  3QCP A;  2WRT A;  3TUE A;  4IQA A;  2FWG A;  3H4K A;  4TR4 A;  5JCG A;  1O85 A;  2LRN A;  2GVP A;  3FY7 A;  4KGI A;  4K1F A;  1JZW A;  1GSE A;  1SK2 A;  2LRT A;  1MDK A;  2B6M A;  5HFK A;  2H75 A;  5GST A;  5JCW A;  4EF0 A;  1S3D A;  1WMJ A;  4HU9 A;  4LMW A;  3H1N A;  1Z5Y E;  6GSS A;  3M0F A;  3EMP A;  11GS A;  2X8H A;  2YCD A;  5IMF A;  2YOI A;  4TRX A;  2HYX A;  3IBH A;  3QOU A;  4K7N A;  2M80 A;  3F4S A;  2O87 A;  2QGV A; 
#chains in the Genus database with same CATH topology
 1H4O A;  4HI7 A;  3ZRE A;  2X64 A;  3IOS A;  5GAP D;  2CX4 A;  2FGX A;  2CZ3 A;  2H70 A;  4MP4 A;  1FHE A;  2LRC A;  4TR1 A;  2E2M A;  3DEX A;  4OFM A;  4IW9 A;  2MMN A;  4IEL A;  2IIY A;  4EKZ A;  4OFN A;  1TDI A;  2R6K A;  2F3M A;  5DAK A;  1XWK A;  1DUG A;  1CQH A;  3KCM A;  4RQX A;  4XS6 A;  3UMA A;  2LV3 A;  1F6M C;  1TU8 A;  4CW9 A;  4QL9 A;  2R37 A;  2QKE A;  1ZZY A;  2DMM A;  2AHE A;  4XS4 A;  2EIO A;  3F3R A;  3KTB A;  3ZFB A;  1YF1 A;  1M9A A;  2E7P A;  3IV4 A;  1ZMA A;  2GZZ A;  1ERV A;  5G30 A;  3ZZX A;  1WE0 A;  1BX9 A;  3ZTL A;  5B7C A;  4IJ3 A;  4MK3 A;  4O92 A;  5ECN B;  4RI7 A;  2L4Q A;  2DBC A;  5HFI A;  4GWR A;  4EIQ A;  1Z7R A;  1O7U A;  5DDL A;  5CRE A;  1O8X A;  5JWO B;  2N5F A;  1MD4 A;  2AYT A;  2YWO A;  3TDG A;  1WRY A;  2RUE A;  1YF0 A;  3UVT A;  4ECI A;  1GUL A;  1PSQ A;  1ABA A;  1ZL9 A;  4J57 E;  3DWV A;  3EU4 A;  1T4Z A;  4I8B A;  2WGR A;  2C1Y A;  1RK4 A;  1SJ6 A;  3DIE A;  4J2F A;  5JWR B;  5ECO B;  1IYH A;  2FA8 A;  3WYW A;  4G0I A;  1MD3 A;  1TOF A;  6GSY A;  3UEM A;  3RHC A;  1T4Y A;  3RPN A;  3M8N A;  1ZCP A;  2A4V A;  2K9F A;  1ZOF A;  4Z2U A;  4PNG A;  1GSD A;  1HNA A;  4E8E A;  4KDU A;  1FB0 A;  4POK A;  2IMK A;  3VK9 A;  1K0C A;  3BJ5 A;  5E59 A;  3HA9 A;  5ECI B;  3L9U A;  3IAM 2;  1VGL A;  1WIK A;  3ERW A;  4EUY A;  3FRC A;  4TR0 A;  3D0Z A;  4NAX A;  2DKI A;  4IBP A;  3LW9 A;  3CSH A;  1M9B A;  2E0Q A;  3TRP A;  4NHZ A;  3GRX A;  1B9X C;  2YJ7 A;  1U87 A;  1PA3 A;  4JRR A;  1ON4 A;  4FYU A;  5EY6 A;  3I43 A;  2V6K A;  2VCQ A;  1V58 A;  2R0C A;  1PGT A;  1SK0 A;  2GQL A;  4MPG A;  4MZC A;  4Q5R A;  4NWY A;  4KND A;  1PKZ A;  2JZR A;  1WPI A;  2DIZ A;  1EV9 A;  2YWM A;  3ISO A;  1TRV A;  1WWJ A;  1R26 A;  4N11 A;  1KBN A;  2CZ2 A;  2HLS A;  1OKD A;  2P0G A;  3ZL5 A;  3D6I A;  2CAI A;  1NHO A;  3L78 A;  2ON7 A;  2JZT A;  4YAP A;  3GX8 A;  4V2L A;  1EP8 A;  5B6M A;  4LLR A;  2R5G A;  4EXJ A;  4MMM A;  4F0C A;  2VL2 C;  2H74 A;  3EWL A;  4GF0 A;  3G7Y A;  1WOU A;  4DSS B;  3FZ5 A;  4WF5 A;  1Z9H A;  4J56 E;  1U3I A;  5AN1 A;  5IOX A;  3KMN A;  1YY7 A;  1W4V A;  2ON5 A;  3TOT A;  2AJQ B;  1XVW A;  1TP9 A;  2ZNM A;  2VCW A;  3HVN A;  4FYC A;  2B5E A;  2FY6 A;  4PUF C;  3G9B A;  1GL8 A;  3IRA A;  3VFI A;  5E4W A;  4O7H A;  3V1W A;  1URM A;  2QC7 A;  4IHU A;  2PPT A;  4I2U A;  1MDI A;  5CNW A;  5J9C A;  2P5R A;  2VO4 A;  3ZFL A;  2GGT A;  5CRD A;  14GS A;  2C0E A;  5H5S A;  1SKS B;  1TKD B;  1VRS D;  1QK8 A;  2VOC A;  4JR4 A;  3HZ8 A;  3RPP A;  1EGR A;  3UIW A;  2KUC A;  4HQS A;  4ZBA A;  2OKA A;  3ZIV A;  5ABR A;  4K9Z A;  2M46 A;  5DVB A;  2R4V A;  3CSJ A;  4JR6 A;  1Q98 A;  2FCH A;  1V40 A;  2XC2 A;  2CVB A;  2VCV A;  4ILF A;  3DXB A;  4EIP A;  2X8G A;  1LU4 A;  1K0M A;  1RW1 A;  3ZVJ D;  4A5P A;  4G2E A;  2WZ9 A;  4MLY A;  16GS A;  1PRX A;  3HCZ A;  1UVZ A;  4K8M A;  4QQ7 A;  1X9S B;  5D8I A;  5G1L A;  4D73 A;  2FWE A;  4HU7 A;  2IJY A;  1DSB A;  13GS A;  1HYU A;  3F63 A;  3CYN A;  1R5A A;  5LD0 A;  1G0T A;  4YQM A;  2QSI A;  4LMV A;  3LXT A;  1FAA A;  5ECL B;  2X8C A;  4HJM A;  5LNK e;  3BCK A;  2DJJ A;  5J9B A;  2O8V B;  3DKS A;  1DBY A;  2GS3 A;  2VD1 A;  1AAZ A;  3VI5 A;  4FQU A;  3OR5 A;  2VCZ A;  9GSS A;  3WT1 A;  3C8E A;  4DEJ A;  4H86 A;  4F03 A;  2XPD A;  2K6V A;  5B8B A;  1K3L A;  2H1B A;  1NM3 A;  1WP0 A;  3ZVJ A;  5AIS A;  3TB2 A;  3C71 A;  1K3Y A;  1TI1 A;  4ZB6 A;  3CTG A;  5G2Z A;  3GHA A;  4I2T A;  2IMD A;  2NVL A;  2J23 A;  4MF6 A;  1SJZ A;  3D4T A;  3GH6 A;  4XS4 B;  1M2A A;  1SL1 B;  1ACV A;  4ZXG A;  3HHV A;  5IMD A;  2VL2 A;  4ID0 A;  1A2J A;  1FOV A;  1ZYE A;  2GSQ A;  1A2L A;  1OE8 A;  3ME7 A;  3IDV A;  2BMX A;  1UN2 A;  3EIN A;  4EDZ A;  4KDX A;  1Y6E A;  4WF4 A;  1PN9 A;  4WBJ A;  2I3Y A;  3FMW A;  3IHQ A;  2V1M A;  3G7J A;  3VWW A;  3LOR A;  3RAZ A;  1FW1 A;  3IAS 2;  1JFU A;  1GTI A;  1XPV A;  3N9J A;  4RI6 A;  1S3R A;  4OWY A;  4DSS A;  5G31 A;  3EYT A;  3ZIT A;  4HSC X;  5ECS A;  3MIX A;  4OO4 A;  2JAC A;  1FB6 A;  2XHF A;  1PKW A;  1O73 A;  3Q19 A;  1TTZ A;  3TRQ A;  1XW9 A;  2K8V A;  5CRG A;  5HR0 A;  4TOP A;  1KNG A;  2CAQ A;  4Q5N A;  4IGJ A;  3FZA A;  5B6N A;  2FUG 2;  4OCE A;  4XHM A;  3FHK A;  5A4V A;  22GS A;  3KIJ A;  2L59 A;  1THX A;  2TIR A;  2QA1 A;  3NOF A;  3VPQ A;  2O89 A;  4YKF A;  2GST A;  4K7I A;  3E0U A;  3D21 A;  3TGZ A;  3FK8 A;  4EE0 A;  4WR5 A;  2GQK A;  3I69 A;  3WGX A;  1G7O A;  5AIX A;  3EVI A;  3HXS A;  6GST A;  2L6C A;  3VPT A;  1JZO A;  3KXO A;  4MH3 A;  2OAC A;  4K0N A;  2MMA A;  2VD0 A;  2WJU A;  3A2V A;  2B5Y A;  2PMT A;  3HY2 A;  18GS A;  3O6T A;  2L5L A;  2GZY A;  3A3T A;  2LTK A;  3QAW A;  4X43 A;  1NW2 A;  3D22 A;  4BVY B;  5LCZ A;  2IMI A;  2A4H A;  2P5Q A;  2VIM A;  4ZBD A;  3ZLP A;  4DVC A;  1CQG A;  3J7Y k;  3C1R A;  3TKS C;  3KM6 A;  3KH9 A;  2H1G A;  3AY8 A;  2LQQ A;  2CVK A;  4HOJ A;  3FZ4 A;  5HR3 A;  3GYK A;  4O5U A;  1GSF A;  2PWJ A;  4IS0 A;  2LJK A;  4PUR A;  1V98 A;  2C3Q A;  1A8L A;  2H6Z A;  1GTA A;  1GRX A;  1SU9 A;  4LL1 B;  1TRS A;  3A5W A;  5IMV A;  2PGT A;  3KP9 A;  1AC1 A;  4K5R A;  3MNG A;  5JWQ B;  4BPY A;  1XWB A;  2H73 A;  2V41 A;  5CAX A;  2NDO A;  5KOW A;  4ZIL A;  1B8X A;  5G5F A;  1SKR B;  2IPA A;  2H0I A;  2C8U A;  4MH2 A;  2FA4 A;  2NPB A;  3IC4 A;  4KDY A;  1X5E A;  1Z6M A;  1YQ1 A;  2X49 A;  1K0N A;  4OMV A;  1B48 A;  3CBU A;  3H79 A;  1Z3E A;  3VWV A;  4AJ7 A;  5J41 A;  5BMU A;  2PVQ A;  2DJ1 A;  2WFC A;  4PGT A;  5DJL A;  1GUK A;  1M0U A;  1WJK A;  4LL4 B;  2CVD A;  5CRW A;  2RM5 A;  2VAF A;  1XCC A;  3C1S A;  4BL7 B;  2UZ8 A;  4GRF A;  1LJR A;  2LKU A;  3P90 A;  2B3S A;  1TXX A;  2F8F A;  5H5Q A;  3ZML A;  3L9V A;  2C80 A;  4PUA A;  3ZYW A;  5IMA A;  4K2D A;  3DD3 A;  5FHI A;  4KUN A;  3HZ4 A;  2H6Y A;  3K8N A;  2HSH A;  3ERG A;  4IJI A;  2KP1 A;  1AQV A;  2GT6 A;  3DVW A;  4TW5 A;  1OC9 A;  1AXD A;  1A8Y A;  4P3Y B;  1PN0 A;  1ZGN A;  3F4R A;  5D9V A;  3FKF A;  3LXZ A;  3KZQ A;  4HUA A;  1GSY A;  3LWA A;  4GXZ A;  1V9W A;  3GL5 A;  3HJO A;  2FWF A;  3GIX A;  1QFN A;  4WR4 A;  1XVQ A;  1EP7 A;  2F8A A;  4O32 A;  2H30 A;  3C7M A;  2H8L A;  2C3T A;  2K8S A;  4D73 B;  2DSA A;  4O5R A;  3DYR A;  4X1U A;  3A2W A;  2A2S A;  1VF4 A;  2DJ2 A;  4F82 A;  4I6X A;  4FH8 A;  3Q6O A;  2H0G A;  2IFQ A;  3TKS A;  1SL2 B;  1M3I A;  4NPB A;  1FOH A;  4K7O A;  5KOX A;  3TOU A;  3F9U A;  3D5J A;  1GP1 A;  4L0W A;  4TKY A;  3R3E A;  3TRX A;  4ML6 A;  5ECR B;  1XW5 A;  4OFT A;  1ML6 A;  4TXV A;  1ZYP A;  3HDC A;  2WCI A;  2GT5 A;  4N30 A;  4BVY A;  3G7I A;  4ECC A;  2LST A;  4RUV A;  1SJI A;  2R0G A;  4BIK A;  3EE2 A;  3CRU A;  2H76 A;  2HNL A;  2G0F A;  2YN1 A;  2AAW A;  5KN1 A;  4AGS A;  3VLN A;  1PD2 1;  4TXO B;  3M3M A;  3IXR A;  5A4U A;  5EL8 A;  1DE2 A;  3PPU A;  4HEA 2;  5CYY A;  6GSU A;  3HKR A;  3FYG A;  3SBC A;  3W8J A;  2IME A;  2C3N A;  1C72 A;  1DE1 A;  1PFO A;  1O6J A;  4G9H A;  4NMU A;  1M2B A;  2WUL A;  4ICY A;  2OBK A;  1J9B A;  2H01 A;  1VF2 A;  2RUF A;  1QGV A;  5F05 A;  5A5K A;  2YP6 A;  2DML A;  4PNF A;  4GTU A;  4K6X A;  1R7H A;  1QQ2 A;  2HSM A;  3TKS E;  5KN3 A;  5INY A;  2VLT A;  1K0D A;  1EGO A;  1SEN A;  2JSY A;  2XPE A;  1A24 A;  4EDY A;  1F9M A;  2VL9 A;  1FO5 A;  4EC0 A;  4BL7 A;  1ZYQ B;  5GAN D;  2TRC P;  2EC4 A;  2G2Q A;  4ECB A;  3FZ9 A;  3APQ A;  2WB9 A;  1PL2 A;  4FO5 A;  4K2X A;  2YWI A;  4AJ8 A;  5KN0 A;  2RII A;  4ECJ A;  1KEB A;  4Z7X A;  2H71 A;  3J7Y b;  1BG5 A;  1GH2 A;  2X4A A;  4IVF A;  4CDO A;  3MSZ A;  1XG8 A;  4K0G A;  1GNE A;  2VLV A;  3ZRD A;  3EU3 A;  4L8E A;  5F0G A;  2K18 A;  3IA1 A;  3H93 A;  4L5O A;  4HQZ A;  1B9Y C;  4IKH A;  3APO A;  5ECH B;  4GCI A;  6GSX A;  3U6V A;  3CXG A;  5GZZ B;  3IHG A;  2B1L A;  2Z9S A;  4GQC A;  3QMX A;  3GST A;  3ZMK A;  1OC3 A;  1FVJ A;  5DCH A;  4GST A;  3FR9 A;  4PQH A;  5IQY A;  3W6G A;  2IN3 A;  4OO5 A;  1IYI A;  4PXO A;  1GUM A;  2PER A;  2FD3 A;  1XOB A;  4KSM A;  1OE7 A;  1JLV A;  4USS A;  2KHP A;  3QAG A;  3PGT A;  4HJ2 A;  3GFK A;  4DSR A;  2XBQ A;  2REM A;  4WEY A;  3DGQ A;  4MCU A;  3BCI A;  4FIW A;  4CY8 A;  1K0A A;  3MDK A;  1HQO A;  1N2A A;  2I81 A;  4KW6 A;  2YJH A;  3KGK A;  4I5Q A;  1GUH A;  1TK5 B;  2ZUP A;  2R3X A;  4OCF A;  2GTU A;  1RQM A;  2AB6 A;  3GUS A;  4BA7 A;  1YKA A;  1EEJ A;  3HD5 A;  2HRK A;  1M99 A;  2YV9 A;  4Z2R A;  4NXI A;  4HZ4 A;  4KF9 A;  2DC5 A;  4BWQ A;  2JZS A;  4MZB A;  4X0X A;  2VM1 A;  4TXO A;  1VF3 A;  1GSU A;  1OVN A;  1J08 A;  3FW2 A;  2VCX A;  3APS A;  2BJX A;  1XOA A;  5FT3 A;  4G0L A;  2I4A A;  2F9S A;  4XCS A;  3EC3 A;  3IR4 A;  4NHW A;  20GS A;  2MZC A;  1M3J A;  1JHB A;  2LJR A;  3LGC A;  2OBI A;  2B1K A;  4G0K A;  4I97 A;  2H0H A;  2HRA A;  4MJB A;  2QA2 A;  2YV7 A;  2V6O A;  3LEF A;  1PMT A;  1AUC A;  3F0I A;  2EIQ A;  4ZL9 A;  1OC9 B;  2FHE A;  8GSS A;  1XXU A;  2JU5 A;  3PR8 A;  1V2A A;  5D73 A;  3US3 A;  2C0D A;  4WET A;  5GSS A;  4JBB A;  4HZ2 A;  1Q4J A;  3GSS A;  1GSQ A;  3LQ7 A;  2HI7 A;  4IP1 A;  1EZK A;  3R2Q A;  1ERT A;  2ES7 A;  5DAL A;  1F2E A;  3IC8 A;  4PTS A;  3C73 A;  5IMZ A;  3ZIJ A;  3ERF A;  2DKH A;  2XBI A;  5IO2 A;  3GKM A;  4XTS A;  2MBS A;  1EWX A;  1NHY A;  4KB3 A;  1J0F A;  5DQY A;  2GLR A;  3UJ1 A;  3KD0 A;  1G7E A;  1U6T A;  1GLP A;  3NZN A;  2BTO T;  4PQ1 A;  4YH2 A;  4POL A;  3MWH A;  1AQW A;  1M7T A;  2GSR A;  1A0F A;  2OE0 A;  5L71 A;  5ECM B;  2IFQ B;  4AJ6 A;  4EO3 A;  4F9Z A;  3UVH A;  5ECK B;  5DBQ A;  2PBJ A;  4YKG A;  2MMZ A;  4F2I A;  5BRT A;  3CMI A;  2B7J A;  2RM6 A;  4NV2 A;  2KP2 A;  4FYB A;  2PN8 A;  1OAZ A;  1TJD A;  1GWC A;  3N5O A;  1SYR A;  1YJ6 A;  2VL3 A;  3RBT A;  2GQM A;  5JCU A;  4ML1 A;  1ST9 A;  4KX4 A;  3CRT A;  4POM A;  3WGE A;  3NIV A;  1NSW A;  1E2Y A;  2FWH A;  1USB A;  2F51 A;  2MYG A;  4WBR D;  1XWC A;  4GLT A;  2FLS A;  1X9W B;  2HRF A;  1GSS A;  3E9J B;  3PIN A;  5EVO A;  2YWN A;  2H19 A;  1EOG A;  1I9D A;  5ECQ B;  3HJP A;  1R4W A;  3S9F A;  4ULX A;  3UL3 A;  1HD2 A;  2LEG A;  1PX7 A;  3PH9 A;  1GNW A;  4E8H A;  6GSV A;  4JED A;  2P31 A;  2IMF A;  2HZE B;  1TI3 A;  5KEJ A;  4MF5 A;  2VLU A;  4EL1 A;  3TJB A;  4KE3 A;  1XWA A;  1UA5 A;  2V2G A;  3FEU A;  2IWT A;  2J9H A;  3QFA C;  2PU9 C;  3CTF A;  5ELG A;  5F8B A;  3VI7 A;  1TU7 A;  5ID2 B;  4O5Q A;  4N0V A;  3SWL A;  3KTL A;  1XIY A;  2AUV A;  4KH7 A;  3TJJ A;  4TVE A;  1SD9 A;  3GKX A;  3O76 A;  1TW9 A;  4DSQ A;  2YNX A;  1O8W A;  1Z7P A;  2TRX A;  1TK0 B;  2CT6 A;  2HT9 A;  4NV5 A;  4IP6 A;  1AIU A;  3KMO A;  2YPM A;  4N10 A;  1SKW B;  1S3C A;  2B5X A;  3GL3 A;  3KEB A;  4TN8 A;  2D2Z A;  2JSZ A;  1SD8 A;  4ZBB A;  3GV1 A;  5F06 A;  2N5B A;  3WT2 A;  3A5I A;  2YZU A;  5KN2 A;  2DJK A;  3ED3 A;  1TK8 B;  3I9V 2;  3IPZ A;  1TRW A;  2GSS A;  5ECP B;  3DML A;  4BVX A;  3VUR A;  3QFB C;  2ZCT A;  3TCO A;  2LS5 A;  4F0B A;  1Z6N A;  3M9J A;  3M1G A;  3F4T A;  4EVM A;  5HR1 A;  1QMV A;  3L9S A;  3TKR A;  4YQV A;  3HYP A;  2L5O A;  3EPT A;  3GTU B;  4V2M A;  2VM2 A;  4ZIJ A;  2IL3 A;  2R0P A;  2CV4 A;  4IQ1 A;  1QXH A;  3IK9 A;  1MDJ A;  2YZH A;  3LYK A;  4XIH A;  1PQN A;  5AGY A;  1T3B A;  1A23 A;  4PQI A;  1BYE A;  1YZX A;  3GX0 A;  3LYP A;  3L4N A;  2C4J A;  2CQ9 A;  4XRD A;  2I1U A;  5G5E A;  3L0H A;  2VUP A;  1OYJ A;  4Z2T A;  3TJK A;  1W89 A;  1BED A;  2JL4 A;  1R5P A;  2LUS A;  4MZW A;  3BBY A;  3IE3 A;  2DLX A;  4MJE A;  1S3A A;  4MJA A;  12GS A;  2H1A A;  3TJF A;  4BWS A;  4KCA A;  3UAR A;  4IN0 A;  1PX6 A;  1GTB A;  2E2G A;  4ZB8 A;  4LA1 A;  5ENU A;  5AIV A;  2OE1 A;  1MTC A;  1K0B A;  3A2X A;  3DVX A;  3UAP A;  5IPH A;  4JU5 A;  1O81 A;  4QL7 A;  3CSI A;  2LQO A;  4V2N A;  2A2P A;  1FG4 A;  3KH7 A;  4WXT A;  1G6Y A;  3H8Q A;  2GDR A;  2N5A A;  4WKW A;  2OE3 A;  1THO A;  3GN3 A;  3EUR A;  4KCE A;  5D96 A;  4G19 A;  3F8U A;  3Q18 A;  3QD9 A;  3QDN A;  2AV4 A;  5FWG A;  3ME8 A;  1BAY A;  5J5N A;  2HZE A;  3KP8 A;  4GSS A;  1K0O A;  19GS A;  2OJL A;  1OC8 A;  3EMX A;  2V32 A;  2O7K A;  5DCG A;  4YQU A;  1FVK A;  5ID2 A;  7GSS A;  4PX1 A;  4V1A g;  1GLQ A;  1F3A A;  1YEX A;  3HVX A;  1AQX A;  1PL1 A;  1T8E B;  5IO0 A;  3IK7 A;  5DAL B;  5D93 A;  3LJR A;  4Q5Q A;  2OAD A;  2M72 A;  2R2J A;  1B4Q A;  3TKQ A;  5A4W A;  1BQ7 A;  1HNC A;  1T00 A;  1KTE A;  5H5R A;  3GMF A;  1ERU A;  3GA4 A;  4KAE A;  3QAV A;  1I5G A;  3BD2 A;  1B4P A;  4MPF A;  3QR6 A;  2HFD A;  5ELA A;  1M2D A;  3RHB A;  2LJA A;  3E3E A;  5IMC A;  3VWU A;  3QPM A;  3MAK A;  4KA0 A;  5C00 A;  4RQR A;  2H66 A;  1Y25 A;  4GQF A;  5IOW A;  2H1D A;  3VWX A;  3P8W A;  5DJM A;  4JZQ A;  5CP1 A;  3UBK A;  4XS1 A;  2L4C A;  3P2A A;  4HDE A;  1A0R P;  3TJG A;  2VCT A;  3GTU A;  1U3A A;  1TRU A;  2HE3 A;  3P7X A;  4ZL7 A;  1HNB A;  2C0G A;  5D9T A;  1H75 A;  1X5D A;  5C04 A;  3WD6 A;  2CX3 A;  5J4U A;  1EEM A;  1T1V A;  5G1K A;  5IIZ A;  1X0R A;  3I6A A;  1E6B A;  1A2M A;  4X4J A;  2EIR A;  5CO3 A;  1LBK A;  1N8J A;  1SYX A;  4HS1 A;  4YAV A;  2HXK A;  2A2R A;  4L5L A;  2MMO A;  1XW6 A;  1JZD A;  2I9H A;  2WS2 A;  2GZP A;  5IPG A;  3HVV A;  17GS A;  1YDK A;  1XWG A;  5IM9 A;  1VF1 A;  1ILO A;  1F37 A;  1SL0 B;  4MNN A;  4ISD A;  5COH A;  3DRN A;  3LSZ A;  2FNO A;  4ZB9 A;  2NTO A;  4TR1 B;  3UOM A;  1UC7 A;  1JZR A;  1X9M B;  2KOK A;  4K5S A;  2HZF A;  2L57 A;  3F6D A;  3Q74 A;  4OD7 A;  5D9X A;  2DJ3 A;  3BOA A;  2CA8 A;  3LFL A;  3FR6 A;  4AF2 A;  4L0U A;  2DJ0 A;  1GTU A;  1YKC A;  4TR3 A;  2H6X A;  5DAK B;  4JE1 A;  2JAD A;  10GS A;  3HJM A;  2NBS A;  2LNS A;  1OKT A;  4GSN A;  3WGD A;  1XFL A;  4V1A p;  1YEP A;  3UBL A;  5HFG A;  5J3R A;  4MDC A;  1EV4 A;  1JLW A;  1QUW A;  3JCM L;  1U88 A;  3HVS A;  1F3B A;  4ZL8 A;  3TKP A;  1ZYN A;  1G6W A;  2HRN A;  4Q5F A;  4XRA A;  2DIY A;  1EOH A;  3GKK A;  4MA9 A;  3FR3 A;  4BVX B;  5DQS A;  3GNJ A;  3O3T A;  5F07 A;  4KSO A;  2KLX A;  3D4M A;  5EPF A;  1V57 A;  3M9K A;  2LNT A;  3GUR A;  4MJC A;  2PVO C;  1T7P B;  4CHS A;  4MAB A;  1AW9 A;  1ERW A;  1X5C A;  3GH9 A;  3U5R E;  3KJY A;  3GKN A;  2O85 A;  2RLI A;  2C0F A;  1K3O A;  2OA7 A;  5HR2 A;  2B7K A;  5HQP A;  3LG6 A;  1BJX A;  3F6F A;  6GSW A;  1SK1 A;  5CRH A;  1XZO A;  4MF7 A;  2X99 A;  2YAN A;  2WDU A;  3W8S A;  2PUK C;  2HSY A;  2L6D A;  4G10 A;  3MYD A;  5D9W A;  2ALB A;  3RDW A;  5B8A A;  4N0Z A;  3F3Q A;  1MEK A;  4POB A;  4ACS A;  2MBT A;  2H72 A;  1XBS A;  3QCP A;  2WRT A;  3TUE A;  4IQA A;  2FWG A;  3H4K A;  4TR4 A;  5JCG A;  1O85 A;  2LRN A;  2GVP A;  3FY7 A;  4KGI A;  4K1F A;  1JZW A;  1GSE A;  1SK2 A;  2LRT A;  1MDK A;  2B6M A;  5HFK A;  2H75 A;  5GST A;  5JCW A;  4EF0 A;  1S3D A;  1WMJ A;  4HU9 A;  4LMW A;  4CY6 A;  3H1N A;  1Z5Y E;  3CQF A;  6GSS A;  3M0F A;  3EMP A;  11GS A;  2X8H A;  2YCD A;  5IMF A;  2YOI A;  4TRX A;  2HYX A;  3IBH A;  3QOU A;  4K7N A;  2M80 A;  3F4S A;  2O87 A;  2QGV A; 
#chains in the Genus database with same CATH homology
 1H4O A;  4HI7 A;  3ZRE A;  2X64 A;  3IOS A;  5GAP D;  2CX4 A;  2FGX A;  2CZ3 A;  2H70 A;  4MP4 A;  1FHE A;  2LRC A;  4TR1 A;  2E2M A;  3DEX A;  4OFM A;  4IW9 A;  2MMN A;  4IEL A;  2IIY A;  4EKZ A;  4OFN A;  1TDI A;  2R6K A;  2F3M A;  5DAK A;  1XWK A;  1DUG A;  1CQH A;  3KCM A;  4RQX A;  4XS6 A;  3UMA A;  2LV3 A;  1F6M C;  1TU8 A;  4CW9 A;  4QL9 A;  2R37 A;  2QKE A;  1ZZY A;  2DMM A;  2AHE A;  4XS4 A;  2EIO A;  3F3R A;  3KTB A;  3ZFB A;  1YF1 A;  1M9A A;  2E7P A;  3IV4 A;  1ZMA A;  2GZZ A;  1ERV A;  5G30 A;  3ZZX A;  1WE0 A;  1BX9 A;  3ZTL A;  5B7C A;  4IJ3 A;  4MK3 A;  4O92 A;  5ECN B;  4RI7 A;  2L4Q A;  2DBC A;  5HFI A;  4GWR A;  4EIQ A;  1Z7R A;  1O7U A;  5DDL A;  5CRE A;  1O8X A;  5JWO B;  2N5F A;  1MD4 A;  2AYT A;  2YWO A;  3TDG A;  1WRY A;  2RUE A;  1YF0 A;  3UVT A;  4ECI A;  1GUL A;  1PSQ A;  1ABA A;  1ZL9 A;  4J57 E;  3DWV A;  3EU4 A;  1T4Z A;  4I8B A;  2WGR A;  2C1Y A;  1RK4 A;  1SJ6 A;  3DIE A;  4J2F A;  5JWR B;  5ECO B;  1IYH A;  2FA8 A;  3WYW A;  4G0I A;  1MD3 A;  1TOF A;  6GSY A;  3UEM A;  3RHC A;  1T4Y A;  3RPN A;  3M8N A;  1ZCP A;  2A4V A;  2K9F A;  1ZOF A;  4Z2U A;  4PNG A;  1GSD A;  1HNA A;  4E8E A;  4KDU A;  1FB0 A;  4POK A;  2IMK A;  3VK9 A;  1K0C A;  3BJ5 A;  5E59 A;  3HA9 A;  5ECI B;  3L9U A;  3IAM 2;  1VGL A;  1WIK A;  3ERW A;  4EUY A;  3FRC A;  4TR0 A;  3D0Z A;  4NAX A;  2DKI A;  4IBP A;  3LW9 A;  3CSH A;  1M9B A;  2E0Q A;  3TRP A;  4NHZ A;  3GRX A;  1B9X C;  2YJ7 A;  1U87 A;  1PA3 A;  4JRR A;  1ON4 A;  4FYU A;  5EY6 A;  3I43 A;  2V6K A;  2VCQ A;  1V58 A;  2R0C A;  1PGT A;  1SK0 A;  2GQL A;  4MPG A;  4MZC A;  4Q5R A;  4NWY A;  4KND A;  1PKZ A;  2JZR A;  1WPI A;  2DIZ A;  1EV9 A;  2YWM A;  3ISO A;  1TRV A;  1WWJ A;  1R26 A;  4N11 A;  1KBN A;  2CZ2 A;  2HLS A;  1OKD A;  2P0G A;  3ZL5 A;  3D6I A;  2CAI A;  1NHO A;  3L78 A;  2ON7 A;  2JZT A;  4YAP A;  3GX8 A;  4V2L A;  1EP8 A;  5B6M A;  4LLR A;  2R5G A;  4EXJ A;  4MMM A;  4F0C A;  2VL2 C;  2H74 A;  3EWL A;  4GF0 A;  3G7Y A;  1WOU A;  4DSS B;  3FZ5 A;  4WF5 A;  1Z9H A;  4J56 E;  1U3I A;  5AN1 A;  5IOX A;  3KMN A;  1YY7 A;  1W4V A;  2ON5 A;  3TOT A;  2AJQ B;  1XVW A;  1TP9 A;  2ZNM A;  2VCW A;  4FYC A;  2B5E A;  2FY6 A;  4PUF C;  3G9B A;  1GL8 A;  3IRA A;  3VFI A;  5E4W A;  4O7H A;  3V1W A;  1URM A;  2QC7 A;  4IHU A;  2PPT A;  4I2U A;  1MDI A;  5CNW A;  5J9C A;  2P5R A;  2VO4 A;  3ZFL A;  2GGT A;  5CRD A;  14GS A;  2C0E A;  5H5S A;  1SKS B;  1TKD B;  1VRS D;  1QK8 A;  2VOC A;  4JR4 A;  3HZ8 A;  3RPP A;  1EGR A;  3UIW A;  2KUC A;  4HQS A;  4ZBA A;  2OKA A;  3ZIV A;  5ABR A;  4K9Z A;  2M46 A;  5DVB A;  2R4V A;  3CSJ A;  4JR6 A;  1Q98 A;  2FCH A;  1V40 A;  2XC2 A;  2CVB A;  2VCV A;  4ILF A;  3DXB A;  4EIP A;  2X8G A;  1LU4 A;  1K0M A;  1RW1 A;  3ZVJ D;  4A5P A;  4G2E A;  2WZ9 A;  4MLY A;  16GS A;  1PRX A;  3HCZ A;  1UVZ A;  4K8M A;  4QQ7 A;  1X9S B;  5D8I A;  5G1L A;  4D73 A;  2FWE A;  4HU7 A;  2IJY A;  1DSB A;  13GS A;  1HYU A;  3F63 A;  3CYN A;  1R5A A;  5LD0 A;  1G0T A;  4YQM A;  2QSI A;  4LMV A;  3LXT A;  1FAA A;  5ECL B;  2X8C A;  4HJM A;  5LNK e;  3BCK A;  2DJJ A;  5J9B A;  2O8V B;  3DKS A;  1DBY A;  2GS3 A;  2VD1 A;  1AAZ A;  3VI5 A;  4FQU A;  3OR5 A;  2VCZ A;  9GSS A;  3WT1 A;  3C8E A;  4DEJ A;  4H86 A;  4F03 A;  2XPD A;  2K6V A;  5B8B A;  1K3L A;  2H1B A;  1NM3 A;  1WP0 A;  3ZVJ A;  5AIS A;  3TB2 A;  3C71 A;  1K3Y A;  1TI1 A;  4ZB6 A;  3CTG A;  5G2Z A;  3GHA A;  4I2T A;  2IMD A;  2NVL A;  2J23 A;  4MF6 A;  1SJZ A;  3D4T A;  3GH6 A;  4XS4 B;  1M2A A;  1SL1 B;  1ACV A;  4ZXG A;  3HHV A;  5IMD A;  2VL2 A;  4ID0 A;  1A2J A;  1FOV A;  1ZYE A;  2GSQ A;  1A2L A;  1OE8 A;  3ME7 A;  3IDV A;  2BMX A;  1UN2 A;  3EIN A;  4EDZ A;  4KDX A;  1Y6E A;  4WF4 A;  1PN9 A;  4WBJ A;  2I3Y A;  3FMW A;  3IHQ A;  2V1M A;  3G7J A;  3VWW A;  3LOR A;  3RAZ A;  1FW1 A;  3IAS 2;  1JFU A;  1GTI A;  1XPV A;  3N9J A;  4RI6 A;  4OWY A;  4DSS A;  5G31 A;  3EYT A;  3ZIT A;  5ECS A;  3MIX A;  4OO4 A;  2JAC A;  1FB6 A;  2XHF A;  1PKW A;  1O73 A;  3Q19 A;  1TTZ A;  3TRQ A;  1XW9 A;  2K8V A;  5CRG A;  5HR0 A;  4TOP A;  1KNG A;  2CAQ A;  4Q5N A;  4IGJ A;  3FZA A;  5B6N A;  2FUG 2;  4OCE A;  4XHM A;  3FHK A;  5A4V A;  22GS A;  3KIJ A;  2L59 A;  1THX A;  2TIR A;  2QA1 A;  3NOF A;  3VPQ A;  2O89 A;  4YKF A;  2GST A;  4K7I A;  3E0U A;  3D21 A;  3TGZ A;  3FK8 A;  4EE0 A;  4WR5 A;  2GQK A;  3I69 A;  3WGX A;  1G7O A;  5AIX A;  3EVI A;  3HXS A;  6GST A;  2L6C A;  3VPT A;  1JZO A;  3KXO A;  4MH3 A;  2OAC A;  4K0N A;  2MMA A;  2VD0 A;  2WJU A;  3A2V A;  2B5Y A;  2PMT A;  3HY2 A;  18GS A;  3O6T A;  2L5L A;  2GZY A;  3A3T A;  2LTK A;  3QAW A;  4X43 A;  1NW2 A;  3D22 A;  4BVY B;  5LCZ A;  2IMI A;  2A4H A;  2P5Q A;  2VIM A;  4ZBD A;  3ZLP A;  4DVC A;  1CQG A;  3J7Y k;  3C1R A;  3TKS C;  3KM6 A;  3KH9 A;  2H1G A;  3AY8 A;  2LQQ A;  2CVK A;  4HOJ A;  3FZ4 A;  5HR3 A;  3GYK A;  4O5U A;  1GSF A;  2PWJ A;  4IS0 A;  2LJK A;  4PUR A;  1V98 A;  2C3Q A;  1A8L A;  2H6Z A;  1GTA A;  1GRX A;  1SU9 A;  4LL1 B;  1TRS A;  3A5W A;  5IMV A;  2PGT A;  3KP9 A;  1AC1 A;  4K5R A;  3MNG A;  5JWQ B;  4BPY A;  1XWB A;  2H73 A;  2V41 A;  5CAX A;  2NDO A;  5KOW A;  4ZIL A;  1B8X A;  5G5F A;  1SKR B;  2IPA A;  2H0I A;  2C8U A;  4MH2 A;  2FA4 A;  2NPB A;  3IC4 A;  4KDY A;  1X5E A;  1Z6M A;  1YQ1 A;  2X49 A;  1K0N A;  4OMV A;  1B48 A;  3CBU A;  3H79 A;  1Z3E A;  3VWV A;  4AJ7 A;  5J41 A;  5BMU A;  2PVQ A;  2DJ1 A;  2WFC A;  4PGT A;  5DJL A;  1GUK A;  1M0U A;  1WJK A;  4LL4 B;  2CVD A;  5CRW A;  2RM5 A;  2VAF A;  1XCC A;  3C1S A;  4BL7 B;  2UZ8 A;  4GRF A;  1LJR A;  2LKU A;  3P90 A;  2B3S A;  1TXX A;  2F8F A;  5H5Q A;  3ZML A;  3L9V A;  2C80 A;  4PUA A;  3ZYW A;  5IMA A;  4K2D A;  3DD3 A;  5FHI A;  4KUN A;  3HZ4 A;  2H6Y A;  3K8N A;  2HSH A;  3ERG A;  4IJI A;  2KP1 A;  1AQV A;  2GT6 A;  3DVW A;  4TW5 A;  1OC9 A;  1AXD A;  1A8Y A;  4P3Y B;  1PN0 A;  1ZGN A;  3F4R A;  5D9V A;  3FKF A;  3LXZ A;  3KZQ A;  4HUA A;  1GSY A;  3LWA A;  4GXZ A;  1V9W A;  3GL5 A;  3HJO A;  2FWF A;  3GIX A;  1QFN A;  4WR4 A;  1XVQ A;  1EP7 A;  2F8A A;  4O32 A;  2H30 A;  3C7M A;  2H8L A;  2C3T A;  2K8S A;  4D73 B;  2DSA A;  4O5R A;  3DYR A;  4X1U A;  3A2W A;  2A2S A;  1VF4 A;  2DJ2 A;  4F82 A;  4I6X A;  4FH8 A;  3Q6O A;  2H0G A;  2IFQ A;  3TKS A;  1SL2 B;  4NPB A;  1FOH A;  4K7O A;  5KOX A;  3TOU A;  3F9U A;  3D5J A;  1GP1 A;  4L0W A;  4TKY A;  3R3E A;  3TRX A;  4ML6 A;  5ECR B;  1XW5 A;  4OFT A;  1ML6 A;  4TXV A;  1ZYP A;  3HDC A;  2WCI A;  2GT5 A;  4N30 A;  4BVY A;  3G7I A;  4ECC A;  2LST A;  4RUV A;  1SJI A;  2R0G A;  3EE2 A;  3CRU A;  2H76 A;  2HNL A;  2G0F A;  2YN1 A;  2AAW A;  5KN1 A;  4AGS A;  3VLN A;  1PD2 1;  4TXO B;  3M3M A;  3IXR A;  5A4U A;  5EL8 A;  1DE2 A;  3PPU A;  4HEA 2;  5CYY A;  6GSU A;  3HKR A;  3FYG A;  3SBC A;  3W8J A;  2IME A;  2C3N A;  1C72 A;  1DE1 A;  1O6J A;  4G9H A;  4NMU A;  1M2B A;  2WUL A;  4ICY A;  2OBK A;  1J9B A;  2H01 A;  1VF2 A;  2RUF A;  1QGV A;  5F05 A;  5A5K A;  2YP6 A;  2DML A;  4PNF A;  4GTU A;  4K6X A;  1R7H A;  1QQ2 A;  2HSM A;  3TKS E;  5KN3 A;  5INY A;  2VLT A;  1K0D A;  1EGO A;  1SEN A;  2JSY A;  2XPE A;  1A24 A;  4EDY A;  1F9M A;  2VL9 A;  1FO5 A;  4EC0 A;  4BL7 A;  1ZYQ B;  5GAN D;  2TRC P;  2EC4 A;  2G2Q A;  4ECB A;  3FZ9 A;  3APQ A;  2WB9 A;  1PL2 A;  4FO5 A;  4K2X A;  2YWI A;  4AJ8 A;  5KN0 A;  2RII A;  4ECJ A;  1KEB A;  4Z7X A;  2H71 A;  3J7Y b;  1BG5 A;  1GH2 A;  2X4A A;  4IVF A;  4CDO A;  3MSZ A;  4K0G A;  1GNE A;  2VLV A;  3ZRD A;  3EU3 A;  4L8E A;  5F0G A;  2K18 A;  3IA1 A;  3H93 A;  4L5O A;  4HQZ A;  1B9Y C;  4IKH A;  3APO A;  5ECH B;  4GCI A;  6GSX A;  3U6V A;  3CXG A;  5GZZ B;  3IHG A;  2B1L A;  2Z9S A;  4GQC A;  3QMX A;  3GST A;  3ZMK A;  1OC3 A;  1FVJ A;  5DCH A;  4GST A;  3FR9 A;  4PQH A;  5IQY A;  3W6G A;  2IN3 A;  4OO5 A;  1IYI A;  4PXO A;  1GUM A;  2PER A;  2FD3 A;  1XOB A;  4KSM A;  1OE7 A;  1JLV A;  4USS A;  2KHP A;  3QAG A;  3PGT A;  4HJ2 A;  3GFK A;  4DSR A;  2XBQ A;  2REM A;  4WEY A;  3DGQ A;  4MCU A;  3BCI A;  4FIW A;  4CY8 A;  1K0A A;  3MDK A;  1HQO A;  1N2A A;  2I81 A;  4KW6 A;  2YJH A;  3KGK A;  4I5Q A;  1GUH A;  1TK5 B;  2ZUP A;  2R3X A;  4OCF A;  2GTU A;  1RQM A;  2AB6 A;  3GUS A;  4BA7 A;  1YKA A;  1EEJ A;  3HD5 A;  2HRK A;  1M99 A;  2YV9 A;  4Z2R A;  4NXI A;  4HZ4 A;  4KF9 A;  2DC5 A;  4BWQ A;  2JZS A;  4MZB A;  4X0X A;  2VM1 A;  4TXO A;  1VF3 A;  1GSU A;  1OVN A;  1J08 A;  3FW2 A;  2VCX A;  3APS A;  2BJX A;  1XOA A;  5FT3 A;  4G0L A;  2I4A A;  2F9S A;  4XCS A;  3EC3 A;  3IR4 A;  4NHW A;  20GS A;  2MZC A;  1JHB A;  2LJR A;  3LGC A;  2OBI A;  2B1K A;  4G0K A;  4I97 A;  2H0H A;  2HRA A;  4MJB A;  2QA2 A;  2YV7 A;  2V6O A;  3LEF A;  1PMT A;  1AUC A;  3F0I A;  2EIQ A;  4ZL9 A;  1OC9 B;  2FHE A;  8GSS A;  1XXU A;  2JU5 A;  3PR8 A;  1V2A A;  5D73 A;  3US3 A;  2C0D A;  4WET A;  5GSS A;  4JBB A;  4HZ2 A;  1Q4J A;  3GSS A;  1GSQ A;  3LQ7 A;  2HI7 A;  4IP1 A;  1EZK A;  3R2Q A;  1ERT A;  2ES7 A;  5DAL A;  1F2E A;  3IC8 A;  4PTS A;  3C73 A;  5IMZ A;  3ZIJ A;  3ERF A;  2DKH A;  2XBI A;  5IO2 A;  3GKM A;  4XTS A;  2MBS A;  1EWX A;  1NHY A;  4KB3 A;  1J0F A;  5DQY A;  2GLR A;  3UJ1 A;  3KD0 A;  1G7E A;  1U6T A;  1GLP A;  3NZN A;  2BTO T;  4PQ1 A;  4YH2 A;  4POL A;  3MWH A;  1AQW A;  1M7T A;  2GSR A;  1A0F A;  2OE0 A;  5L71 A;  5ECM B;  2IFQ B;  4AJ6 A;  4EO3 A;  4F9Z A;  3UVH A;  5ECK B;  5DBQ A;  2PBJ A;  4YKG A;  2MMZ A;  4F2I A;  5BRT A;  3CMI A;  2B7J A;  2RM6 A;  4NV2 A;  2KP2 A;  4FYB A;  2PN8 A;  1OAZ A;  1TJD A;  1GWC A;  3N5O A;  1SYR A;  1YJ6 A;  2VL3 A;  3RBT A;  2GQM A;  5JCU A;  4ML1 A;  1ST9 A;  4KX4 A;  3CRT A;  4POM A;  3WGE A;  3NIV A;  1NSW A;  1E2Y A;  2FWH A;  1USB A;  2F51 A;  2MYG A;  4WBR D;  1XWC A;  4GLT A;  2FLS A;  1X9W B;  2HRF A;  1GSS A;  3E9J B;  3PIN A;  5EVO A;  2YWN A;  2H19 A;  1EOG A;  1I9D A;  5ECQ B;  3HJP A;  1R4W A;  3S9F A;  4ULX A;  3UL3 A;  1HD2 A;  2LEG A;  1PX7 A;  3PH9 A;  1GNW A;  4E8H A;  6GSV A;  4JED A;  2P31 A;  2IMF A;  2HZE B;  1TI3 A;  5KEJ A;  4MF5 A;  2VLU A;  4EL1 A;  3TJB A;  4KE3 A;  1XWA A;  1UA5 A;  2V2G A;  3FEU A;  2IWT A;  2J9H A;  3QFA C;  2PU9 C;  3CTF A;  5ELG A;  5F8B A;  3VI7 A;  1TU7 A;  5ID2 B;  4O5Q A;  4N0V A;  3SWL A;  3KTL A;  1XIY A;  2AUV A;  4KH7 A;  3TJJ A;  4TVE A;  1SD9 A;  3GKX A;  3O76 A;  1TW9 A;  4DSQ A;  2YNX A;  1O8W A;  1Z7P A;  2TRX A;  1TK0 B;  2CT6 A;  2HT9 A;  4NV5 A;  4IP6 A;  1AIU A;  3KMO A;  2YPM A;  4N10 A;  1SKW B;  1S3C A;  2B5X A;  3GL3 A;  3KEB A;  4TN8 A;  2D2Z A;  2JSZ A;  1SD8 A;  4ZBB A;  3GV1 A;  5F06 A;  2N5B A;  3WT2 A;  3A5I A;  2YZU A;  5KN2 A;  2DJK A;  3ED3 A;  1TK8 B;  3I9V 2;  3IPZ A;  1TRW A;  2GSS A;  5ECP B;  3DML A;  4BVX A;  3VUR A;  3QFB C;  2ZCT A;  3TCO A;  2LS5 A;  4F0B A;  1Z6N A;  3M9J A;  3M1G A;  3F4T A;  4EVM A;  5HR1 A;  1QMV A;  3L9S A;  3TKR A;  4YQV A;  3HYP A;  2L5O A;  3EPT A;  3GTU B;  4V2M A;  2VM2 A;  4ZIJ A;  2IL3 A;  2R0P A;  2CV4 A;  4IQ1 A;  1QXH A;  3IK9 A;  1MDJ A;  2YZH A;  3LYK A;  4XIH A;  1PQN A;  5AGY A;  1T3B A;  1A23 A;  4PQI A;  1BYE A;  1YZX A;  3GX0 A;  3LYP A;  3L4N A;  2C4J A;  2CQ9 A;  4XRD A;  2I1U A;  5G5E A;  3L0H A;  2VUP A;  1OYJ A;  4Z2T A;  3TJK A;  1W89 A;  1BED A;  2JL4 A;  1R5P A;  2LUS A;  4MZW A;  3BBY A;  3IE3 A;  2DLX A;  4MJE A;  1S3A A;  4MJA A;  12GS A;  2H1A A;  3TJF A;  4BWS A;  4KCA A;  3UAR A;  4IN0 A;  1PX6 A;  1GTB A;  2E2G A;  4ZB8 A;  4LA1 A;  5ENU A;  5AIV A;  2OE1 A;  1MTC A;  1K0B A;  3A2X A;  3DVX A;  3UAP A;  5IPH A;  4JU5 A;  1O81 A;  4QL7 A;  3CSI A;  2LQO A;  4V2N A;  2A2P A;  1FG4 A;  3KH7 A;  4WXT A;  1G6Y A;  3H8Q A;  2GDR A;  2N5A A;  4WKW A;  2OE3 A;  1THO A;  3GN3 A;  3EUR A;  4KCE A;  5D96 A;  4G19 A;  3F8U A;  3Q18 A;  3QD9 A;  3QDN A;  2AV4 A;  5FWG A;  3ME8 A;  1BAY A;  5J5N A;  2HZE A;  3KP8 A;  4GSS A;  1K0O A;  19GS A;  2OJL A;  1OC8 A;  3EMX A;  2V32 A;  2O7K A;  5DCG A;  4YQU A;  1FVK A;  5ID2 A;  7GSS A;  4PX1 A;  4V1A g;  1GLQ A;  1F3A A;  1YEX A;  3HVX A;  1AQX A;  1PL1 A;  1T8E B;  5IO0 A;  3IK7 A;  5DAL B;  5D93 A;  3LJR A;  4Q5Q A;  2OAD A;  2M72 A;  2R2J A;  1B4Q A;  3TKQ A;  5A4W A;  1BQ7 A;  1HNC A;  1T00 A;  1KTE A;  5H5R A;  3GMF A;  1ERU A;  3GA4 A;  4KAE A;  3QAV A;  1I5G A;  3BD2 A;  1B4P A;  4MPF A;  3QR6 A;  2HFD A;  5ELA A;  1M2D A;  3RHB A;  2LJA A;  3E3E A;  5IMC A;  3VWU A;  3QPM A;  3MAK A;  4KA0 A;  5C00 A;  4RQR A;  2H66 A;  1Y25 A;  4GQF A;  5IOW A;  2H1D A;  3VWX A;  3P8W A;  5DJM A;  4JZQ A;  5CP1 A;  3UBK A;  4XS1 A;  2L4C A;  3P2A A;  4HDE A;  1A0R P;  3TJG A;  2VCT A;  3GTU A;  1U3A A;  1TRU A;  2HE3 A;  3P7X A;  4ZL7 A;  1HNB A;  2C0G A;  5D9T A;  1H75 A;  1X5D A;  5C04 A;  3WD6 A;  2CX3 A;  5J4U A;  1EEM A;  1T1V A;  5G1K A;  5IIZ A;  1X0R A;  3I6A A;  1E6B A;  1A2M A;  4X4J A;  2EIR A;  5CO3 A;  1LBK A;  1N8J A;  1SYX A;  4HS1 A;  4YAV A;  2HXK A;  2A2R A;  4L5L A;  2MMO A;  1XW6 A;  1JZD A;  2I9H A;  2WS2 A;  2GZP A;  5IPG A;  3HVV A;  17GS A;  1YDK A;  1XWG A;  5IM9 A;  1VF1 A;  1ILO A;  1F37 A;  1SL0 B;  4MNN A;  4ISD A;  5COH A;  3DRN A;  3LSZ A;  2FNO A;  4ZB9 A;  2NTO A;  4TR1 B;  3UOM A;  1UC7 A;  1JZR A;  1X9M B;  2KOK A;  4K5S A;  2HZF A;  2L57 A;  3F6D A;  3Q74 A;  4OD7 A;  5D9X A;  2DJ3 A;  3BOA A;  2CA8 A;  3LFL A;  3FR6 A;  4AF2 A;  4L0U A;  2DJ0 A;  1GTU A;  1YKC A;  4TR3 A;  2H6X A;  5DAK B;  4JE1 A;  2JAD A;  10GS A;  3HJM A;  2NBS A;  2LNS A;  1OKT A;  4GSN A;  3WGD A;  1XFL A;  4V1A p;  1YEP A;  3UBL A;  5HFG A;  5J3R A;  4MDC A;  1EV4 A;  1JLW A;  1QUW A;  3JCM L;  1U88 A;  3HVS A;  1F3B A;  4ZL8 A;  3TKP A;  1ZYN A;  1G6W A;  2HRN A;  4Q5F A;  4XRA A;  2DIY A;  1EOH A;  3GKK A;  4MA9 A;  3FR3 A;  4BVX B;  5DQS A;  3GNJ A;  3O3T A;  5F07 A;  4KSO A;  2KLX A;  3D4M A;  5EPF A;  1V57 A;  3M9K A;  2LNT A;  3GUR A;  4MJC A;  2PVO C;  1T7P B;  4CHS A;  4MAB A;  1AW9 A;  1ERW A;  1X5C A;  3GH9 A;  3U5R E;  3KJY A;  3GKN A;  2O85 A;  2RLI A;  2C0F A;  1K3O A;  2OA7 A;  5HR2 A;  2B7K A;  5HQP A;  3LG6 A;  1BJX A;  3F6F A;  6GSW A;  1SK1 A;  5CRH A;  1XZO A;  4MF7 A;  2X99 A;  2YAN A;  2WDU A;  3W8S A;  2PUK C;  2HSY A;  2L6D A;  4G10 A;  3MYD A;  5D9W A;  2ALB A;  3RDW A;  5B8A A;  4N0Z A;  3F3Q A;  1MEK A;  4POB A;  4ACS A;  2MBT A;  2H72 A;  1XBS A;  3QCP A;  2WRT A;  3TUE A;  4IQA A;  2FWG A;  3H4K A;  4TR4 A;  5JCG A;  1O85 A;  2LRN A;  2GVP A;  3FY7 A;  4KGI A;  4K1F A;  1JZW A;  1GSE A;  1SK2 A;  2LRT A;  1MDK A;  2B6M A;  5HFK A;  2H75 A;  5GST A;  5JCW A;  4EF0 A;  1S3D A;  1WMJ A;  4HU9 A;  4LMW A;  4CY6 A;  3H1N A;  1Z5Y E;  6GSS A;  3M0F A;  3EMP A;  11GS A;  2X8H A;  2YCD A;  5IMF A;  2YOI A;  4TRX A;  2HYX A;  3IBH A;  3QOU A;  4K7N A;  2M80 A;  3F4S A;  2O87 A;  2QGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...