1XWCA

Drosophila thioredoxin, reduced, p6522
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
b'MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords thioredoxin
publication title Comparative structural analysis of oxidized and reduced thioredoxin from Drosophila melanogaster
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Electron transport
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xwcA00
3KTLA 1TU7A 4F9ZA 4MJBA 1YY7A 1YEPA 2PU9C 3O6TA 3CSHA 2HXKA 5D73A 2NDOA 12GSA 1QUWA 3HKRA 2B5EA 4ZIJA 2H70A 5CNWA 4K0GA 5CREA 5DQSA 1BG5A 4XTSA 6GSXA 2IIYA 4HQZA 3HYPA 2H6XA 1IYHA 4HZ4A 1K0AA 5F8BA 2DIYA 5AIXA 1RW1A 4I2TA 5F0GA 1PKZA 3K8NA 1ML6A 4K7OA 1BX9A 3N9JA 4O5RA 3HA9A 5G2ZA 3OR5A 1MDJA 2LS5A 5FHIA 3HY2A 1K0MA 4KW6A 5G1LA 4L0UA 1TDIA 4ILFA 2N5BA 5A4UA 4EDYA 5F06A 2OE0A 3F3QA 3G7JA 3TJJA 2JZRA 3TKRA 4NMUA 4OFNA 6GSSA 3P2AA 5EPFA 1T7PB 4HU9A 1Q4JA 1SYRA 1HD2A 2H72A 2VOCA 2C4JA 3GTUA 4BVXA 2YJHA 4JE1A 3H4KA 3GTUB 1YZXA 2VM1A 3WGXA 3VWVA 3MWHA 4KX4A 4GLTA 5ELAA 2YPMA 1EEJA 1FO5A 3ZFLA 3TRXA 2V41A 2H8LA 2F51A 3LJRA 4IJ3A 4E8HA 3GFKA 2OJLA 4FYCA 3DGQA 5CO3A 1I9DA 2Z9SA 4X0XA 1WJKA 4QL9A 2PMTA 1V2AA 2LRTA 1LJRA 2H66A 2OA7A 20GSA 3QCPA 1AC1A 3E3EA 4TR4A 2RIIA 3UMAA 3UVHA 1USBA 2BJXA 1M9AA 3BCIA 5IQYA 2JADA 4GCIA 2P0GA 3FYGA 1EV9A 3H1NA 2RM5A 4DSQA 1A24A 2WDUA 3C1RA 3RPNA 2PGTA 1UC7A 4ECCA 1JZRA 3EURA 2MMZA 4IJIA 1WE0A 4V1Ap 5ABRA 1MD4A 4OMVA 5B8AA 4MJEA 3VLNA 2L6DA 2FNOA 2FWGA 3CBUA 3KD0A 3GN3A 3HJPA 2B1LA 3DRNA 1K0BA 3LGCA 3TKPA 2R2JA 1ERVA 3ZL5A 4LMWA 1A23A 1GSQA 1QK8A 3IPZA 4BL7A 5H5QA 3CRTA 1V57A 2CZ3A 2LSTA 5CRGA 3IXRA 2AJQB 4AJ8A 3IRAA 3E0UA 4O7HA 3CMIA 5DVBA 1ACVA 6GSUA 1A2LA 1XIYA 3CSJA 4WXTA 1SENA 2DSAA 3L78A 2P5RA 1OVNA 2RLIA 3RAZA 3EMPA 1SD9A 4OD7A 2A4VA 4GSTA 3GRXA 2K8VA 1PKWA 3D6IA 5IMZA 3UVTA 2N5FA 2WZ9A 4PGTA 4TN8A 1I5GA 2JSZA 2X8GA 2YNXA 2KP1A 3ZMLA 4JEDA 4MLYA 1ZOFA 4I2UA 2WS2A 3EMXA 1XCCA 3M1GA 2ZCTA 3GA4A 1VRSD 1GWCA 1NHYA 2CAIA 3PH9A 1C72A 2X8CA 4RI7A 2RUFA 3BD2A 3D4TA 1AQWA 3I9V2 2WCIA 3LSZA 3IK7A 1PL1A 1VGLA 1HNCA 4XCSA 2H30A 2JL4A 2K6VA 4DVCA 3H79A 3F4RA 5G5FA 4XS4A 1OKDA 1GTIA 4X1UA 1ZCPA 1R5PA 5DBQA 4V2NA 5GAND 1SKWB 4XHMA 1GNWA 2MMAA 2KOKA 5CRHA 3VWUA 4EXJA 1WPIA 1RQMA 1AW9A 3H93A 1XWBA 4KB3A 2O87A 4NAXA 3QFAC 4OFTA 2LNSA 5H5SA 2I81A 3ED3A 1OE8A 5HFGA 5IMDA 16GSA 4Q5NA 1XZOA 1O85A 4K7IA 1FVKA 3D4MA 2H76A 1ZL9A 4F82A 4GF0A 1O73A 2CVBA 3A2WA 4IELA 5HR1A 1XVQA 4HEA2 3APSA 1W89A 2XHFA 2HRFA 2PWJA 5IMAA 2ON7A 1XOAA 1GSYA 1E6BA 4IN0A 4PX1A 2F3MA 3TGZA 3MDKA 3ZITA 1FHEA 1ZYEA 2LKUA 3APOA 5G5EA 1VF4A 2P5QA 2C1YA 2GQKA 2YZUA 1JLWA 4K1FA 3LXZA 1X9WB 4LL1B 1YQ1A 4HI7A 4ZB9A 2WULA 1FOVA 3P8WA 2C80A 2B5XA 3N5OA 3EVIA 2H71A 5HR0A 5JWRB 1VF1A 11GSA 3KH9A 3HDCA 2H1DA 2TIRA 3DVXA 2FA8A 4KSOA 3FHKA 5IO2A 2GS3A 3KIJA 7GSSA 2VD1A 1S3DA 4MZCA 4JR4A 2CQ9A 2DJJA 2M46A 3EE2A 1OC3A 3J7Yk 1TI3A 3CYNA 3QAGA 1ON4A 3EINA 3BBYA 3IAM2 4JRRA 1LBKA 1TJDA 2KHPA 2E2MA 2I4AA 3BJ5A 3P90A 2R37A 2PPTA 2LV3A 2HYXA 2VCWA 5EVOA 1TOFA 3DEXA 1K0NA 2X8HA 1SD8A 2VM2A 2HRNA 5IMVA 4POKA 3LYKA 2AUVA 2JZSA 3KTBA 1G7OA 4KCAA 2VCVA 1M2DA 2CX3A 1JHBA 3MNGA 4KUNA 3TDGA 1PN9A 14GSA 1KTEA 1SYXA 3UAPA 3W6GA 3GH9A 5H5RA 1PRXA 1V98A 5ECSA 1ZZYA 4ZILA 1GSUA 2FWHA 5ECLB 2QC7A 5JCWA 2B7KA 5IM9A 3TKSA 3DWVA 2HI7A 5J3RA 4IW9A 1Z5YE 3TRPA 5D9WA 4ZXGA 2DJKA 4OCEA 3LQ7A 1O8WA 1GUHA 1A8LA 2IMFA 1IYIA 3LG6A 3GKXA 4PUFC 3HHVA 4MP4A 2N5AA 1TK5B 1YKCA 2XPEA 2X99A 1B9YC 2VUPA 5HQPA 3HVSA 1M2AA 4F0BA 4I6XA 1MD3A 3SBCA 3GL3A 1GLPA 3IHQA 3KMOA 2HLSA 1X9SB 4TR0A 2GSRA 2VAFA 3O3TA 1E2YA 1FVJA 5GAPD 1TTZA 4F03A 4QL7A 2GTUA 4YQMA 2VL2C 4NPBA 2NPBA 3ERGA 4JU5A 2F8FA 5EY6A 5JWOB 3H8QA 5INYA 4OCFA 1XXUA 4HJMA 2NTOA 1K3LA 1ERUA 1ILOA 2L57A 1FAAA 1YF1A 3F4SA 5B6MA 1H4OA 4NV5A 2MYGA 1BJXA 2J23A 4CW9A 3R2QA 1G7EA 1G6YA 1ERWA 4N30A 4N11A 3LORA 1MDIA 2DIZA 3CTGA 1SKSB 3GKNA 3M0FA 1A0RP 4PURA 1JLVA 5DDLA 5EL8A 2YWNA 2WB9A 2FLSA 4MF6A 3KH7A 5JCGA 1F6MC 1JZOA 3D0ZA 3CRUA 3UBKA 2IWTA 2V1MA 2C3NA 2OADA 2KLXA 3FKFA 4ZL8A 4ECIA 3V1WA 22GSA 2GZPA 5J9CA 4LLRA 4IQAA 4OWYA 4JBBA 1DE1A 4ZB8A 2M80A 2B1KA 1J9BA 4YQVA 1W4VA 3VWXA 4E8EA 3G7IA 2VL3A 2YWMA 2H1AA 3Q74A 3C71A 2IL3A 4DSSA 5LCZA 1U87A 1M99A 5FWGA 4DSSB 1U6TA 4BWQA 2H6ZA 2LQQA 3WT1A 4IS0A 5AGYA 1DSBA 4G2EA 1GTBA 1B4QA 3L9SA 5DALA 1GTAA 5DALB 1UVZA 2VCZA 2RUEA 1MTCA 1URMA 2HZEA 4Q5FA 2YV9A 2IMDA 2IN3A 2HZEB 3F6DA 2C3TA 3M9KA 4RQXA 1JZDA 4MA9A 3TKSE 2A2RA 1OAZA 4I5QA 2DBCA 3QDNA 1CQHA 3GKMA 2C0DA 5E59A 1EZKA 3HJOA 2BMXA 3PGTA 3CTFA 2L4CA 4CDOA 1TRSA 3FR6A 4ZL9A 3F63A 4J56E 1M7TA 1Z9HA 1PD21 3U6VA 4KDUA 4TR1A 4OO4A 3G7YA 2ES7A 1FB6A 4TR1B 2YOIA 2VLUA 4ZBDA 1R4WA 2IFQA 5A5KA 5E4WA 3IC4A 5G1KA 2IFQB 4PUAA 2GT6A 6GSTA 3RPPA 5KN0A 4EUYA 3FW2A 4K6XA 2E0QA 1T00A 1SK0A 2B5YA 1PX6A 5A4WA 5IIZA 3VWWA 1TI1A 1WMJA 4GQCA 3GNJA 4XIHA 2NVLA 3ZVJA 4BWSA 3DYRA 3KP9A 3VI5A 4K8MA 8GSSA 2H73A 1SU9A 4TXVA 2H1GA 1T8EB 2FA4A 3GH6A 5LNKe 3UL3A 4FO5A 2IMEA 4Q5QA 4WEYA 4K7NA 2C8UA 4XS1A 2LJRA 3GKKA 2H01A 1HYUA 2TRXA 2YV7A 4I97A 4ML1A 3Q19A 3DXBA 3TCOA 3KXOA 1GULA 1F3AA 1XFLA 1J0FA 4BA7A 4BPYA 5DJLA 3MSZA 4HU7A 3F3RA 2CV4A 4K9ZA 3L0HA 2D2ZA 5ECMB 1B8XA 3ZIVA 3ZVJD 1PGTA 3EU3A 4MH2A 5GSTA 1OKTA 5COHA 1LU4A 2LRCA 3EWLA 4HZ2A 4GRFA 2LTKA 1DE2A 4EF0A 3TOTA 1EEMA 2MBSA 4V2LA 2CZ2A 3WGDA 3HCZA 4KH7A 5CP1A 3GHAA 2XC2A 5C00A 2H0IA 3BCKA 3KZQA 3D22A 3SWLA 4YAPA 1SJ6A 1SK2A 1TP9A 4CHSA 2DJ1A 3TJKA 5J41A 2GSTA 5GZZB 2YCDA 3UJ1A 2FGXA 1XWGA 4PXOA 1SL0B 1DUGA 1O8XA 1SJIA 5F05A 1F2EA 2YP6A 5ECQB 4KDYA 3ZREA 3HZ4A 4K0NA 1HQOA 1RK4A 4XRDA 4HJ2A 2C0GA 3D21A 2H0GA 1U88A 2OE3A 5FT3A 3UARA 4EC0A 3APQA 3IV4A 4DSRA 4WR5A 4TOPA 3KP8A 3F6FA 2FHEA 5AIVA 5GSSA 4HQSA 1Y6EA 4TRXA 3IE3A 2JACA 4O32A 3ZYWA 1OYJA 3M3MA 3IR4A 4IBPA 1A2MA 1XWCA 1KNGA 2REMA 1OC8A 4XS6A 1OE7A 2QSIA 4IP6A 2VLTA 4GXZA 4NHZA 4LA1A 4IHUA 4EE0A 2MMOA 2AYTA 2LUSA 5ID2A 1Z7PA 4IQ1A 5ID2B 2FCHA 3M9JA 5IOXA 4PQIA 3ME7A 17GSA 1N2AA 2WGRA 1A2JA 4G10A 1Q98A 3BOAA 4H86A 2LNTA 4EVMA 5KN3A 2PVQA 2BTOT 1PA3A 3C1SA 1PX7A 2GLRA 1BYEA 1XW5A 5DJMA 4I8BA 1NSWA 2H6YA 4F2IA 5G30A 5IOWA 3HVVA 1Y25A 4ML6A 1TKDB 2FD3A 2K18A 1ZGNA 3D5JA 3ZFBA 2OBKA 3HXSA 2GT5A 4N0VA 1GUKA 2ZNMA 1PQNA 2L6CA 2PERA 3FEUA 3C7MA 1K3YA 4JZQA 1BAYA 2QKEA 4WF5A 4AJ6A 2HE3A 5D9TA 4FIWA 2AHEA 2L4QA 2IJYA 3TUEA 4FYBA 3GSSA 1NW2A 1WP0A 5CRWA 4BVYA 1JZWA 4PNFA 1SL2B 4IP1A 1Z3EA 2V32A 5F07A 3Q18A 1T4YA 3DMLA 2PUKC 2R3XA 3I69A 3EC3A 1V40A 2GSQA 4ZBAA 3QD9A 4DEJA 2HSYA 3QAWA 2PN8A 2P31A 2C0EA 2EC4A 3WYWA 1GSEA 2F9SA 3QAVA 3A5WA 4KSMA 2LJAA 2V6KA 4LMVA 1TRVA 1UA5A 1GLQA 1YEXA 3QR6A 1ABAA 4O92A 3FR9A 3C73A 2LRNA 2GQLA 5D9XA 1TK0B 5HFKA 1B4PA 1O81A 3IBHA 3GX0A 4TXOA 4D73A 1X5DA 3TJBA 2E2GA 2MBTA 5L71A 3FZ4A 2CA8A 2IPAA 4TXOB 2H0HA 4HDEA 4D73B 2CVKA 1R26A 5DQYA 3VURA 2AAWA 4MK3A 1QFNA 2GQMA 4MH3A 3ISOA 2EIRA 2OKAA 4X43A 3J7Yb 3IDVA 2YANA 2YZHA 3KCMA 2C3QA 4MPFA 3WT2A 2I1UA 4HOJA 1U3AA 2J9HA 2JSYA 4POMA 4MF7A 3QFBC 3TKSC 5D9VA 2DJ2A 2H1BA 2EIQA 4WKWA 3UEMA 3FZ9A 3AY8A 3TOUA 1YJ6A 2VLVA 3O76A 5IPGA 2B7JA 3GX8A 1YF0A 10GSA 2O8VB 3I43A 2HZFA 1X5CA 3EYTA 3I6AA 4TW5A 4IVFA 2WJUA 3HZ8A 3FY7A 4NWYA 19GSA 1TRUA 2L5OA 2B6MA 1Z7RA 1YDKA 5IMFA 4V1Ag 3W8SA 5D96A 4MJCA 2C0FA 5ELGA 4NV2A 3A3TA 1BQ7A 2HT9A 4MMMA 1XVWA 4IKHA 1PL2A 2VCXA 4GSNA 2MMNA 3ZTLA 3HD5A 4L5LA 2O7KA 6GSWA 5B8BA 4MF5A 1EOGA 13GSA 5HR3A 3DKSA 2YWOA 3FZ5A 1GP1A 2CAQA 3GMFA 2XBQA 5KN1A 4HS1A 2PVOC 1K0CA 5ECHB 3L9UA 3G9BA 1QQ2A 4MPGA 1FW1A 1DBYA 4AF2A 3TRQA 1T3BA 1HNAA 2GVPA 3L4NA 1GUMA 2LEGA 3Q6OA 2FUG2 4G19A 1PMTA 4TR3A 5J4UA 3GSTA 2GDRA 2ZUPA 1GSFA 1CQGA 1X9MB 1XPVA 5ECPB 1AQVA 5DAKA 2OE1A 2XBIA 1GRXA 1GNEA 1M9BA 1K0OA 5DAKB 3VPQA 2XPDA 4PQHA 2CT6A 3DVWA 2RM6A 5JCUA 3LEFA 4HUAA 4ULXA 3KGKA 1AUCA 1SKRB 3DIEA 2K9FA 1MEKA 4KE3A 3NZNA 2H74A 4L5OA 3GV1A 5ECRB 4L8EA 5LD0A 1G0TA 1XWKA 1F3BA 1XWAA 6GSVA 1BEDA 3NIVA 4IGJA 2LJKA 4GQFA 1U3IA 1FG4A 3QOUA 1F37A 4EKZA 2CX4A 2EIOA 1S3CA 1SL1B 5ECOB 1Z6MA 2JU5A 3NOFA 1H75A 1TXXA 1NM3A 4G9HA 3IK9A 4KA0A 4OO5A 4FH8A 1B9XC 4MZWA 4RI6A 2X64A 1AQXA 3FRCA 1B48A 4MCUA 5DCHA 4EL1A 5J5NA 1EP7A 3VPTA 1N8JA 2DJ0A 2VIMA 3FR3A 2GZZA 4TKYA 5IO0A 3KJYA 4MJAA 3E9JB 4WR4A 5IMCA 1M0UA 4NHWA 4J57E 2G0FA 9GSSA 4WETA 5D8IA 3F0IA 2HSHA 2DLXA 1QGVA 2CVDA 2OACA 4JR6A 1FB0A 1XBSA 3QMXA 1HNBA 3PINA 2I3YA 4ECJA 2TRCP 3RDWA 3WGEA 2DMLA 2LQOA 4NXIA 3ZZXA 2H75A 3LFLA 3GIXA 4RQRA 4Z7XA 1T4ZA 3TJGA 1X0RA 1Z6NA 3F8UA 1WIKA 1VF2A 2VCTA 2V6OA 4ISDA 4V2MA 3UOMA 3TB2A 2R6KA 1GL8A 2GGTA 4ECBA 1AAZA 2HFDA 1ERTA 3IA1A 3QPMA 3HVXA 3RHCA 3KEBA 5AISA 4WBRD 4L0WA 4KAEA 2OBIA 5ENUA 2HNLA 5KN2A 2JZTA 1V58A 1KBNA 2L5LA 1R5AA 1XOBA 2VO4A 2GSSA 5D93A 5ECKB 3IOSA 4XS4B 3LXTA 4N10A 4KGIA 2FWEA 1WOUA 3UIWA 1TK8B 2DJ3A 5CRDA 4EDZA 1SK1A 1S3AA 1ZYQB 2M72A 4MABA 2IMKA 3CXGA 4N0ZA 1WRYA 4POLA 3C8EA 3ME8A 4FYUA 4KNDA 1EGOA 4GTUA 1EP8A 3A2VA 5ECIB 4AJ7A 3VFIA 4Q5RA 3PR8A 4ZL7A 2VL9A 3ZLPA 4YH2A 4GWRA 2NBSA 3HJMA 3RBTA 1AXDA 4J2FA 3VI7A 1R7HA 2R5GA 5B7CA 5KEJA 4WBJA 1ST9A 4RUVA 3LWAA 2KP2A 4QQ7A 1F9MA 2VCQA 2YN1A 5C04A 4PNGA 3KMNA 2MZCA 1OC9A 1A0FA 1T1VA 2I9HA 3FK8A 5A4VA 2QGVA 1EOHA 2AV4A 1OC9B 4WF4A 6GSYA 2GZYA 4GSSA 1V9WA 3FZAA 1G6WA 2IMIA 3WD6A 3CSIA 3ZIJA 3LYPA 3ERFA 4LL4B 1J08A 5J9BA 4ZBBA 3TKQA 1PSQA 3P7XA 1YKAA 4ACSA 1MDKA 3EU4A 3F4TA 4EO3A 18GSA 4K2DA 1TU8A 4PQ1A 4ZB6A 5IPHA 1THXA 2H19A 3US3A 3GL5A 1TW9A 2FY6A 1EGRA 4OFMA 4ID0A 2K8SA 5JWQB 2FWFA 2E7PA 1QXHA 5CYYA 2VD0A 4MZBA 3ERWA 3TJFA 1VF3A 1K0DA 3F9UA 4XRAA 4TVEA 3VK9A 3U5RE 2G2QA 2DC5A 2O85A 1WWJA 3L9VA 4AGSA 1QMVA 1KEBA 2ON5A 1UN2A 2ALBA 4YAVA 5HFIA 1GSDA 1JFUA 1M2BA 3GURA 4F0CA 1EV4A 1O6JA 2KUCA 3M8NA 2WRTA 1XW6A 2VL2A 2DMMA 4YQUA 3DD3A 3RHBA 1NHOA 2YWIA 1GH2A 2PBJA 3ZMKA 2B3SA 2WFCA 1O7UA 1XW9A 1EWXA 5G31A 5ECNB 1AIUA 3W8JA 3IAS2 1K3OA 3UBLA 2O89A 3KM6A 1TRWA 2F8AA 4KDXA 4P3YB 5HR2A 2L59A 3GUSA 5B6NA 3MAKA 5AN1A 3JCML 1A8YA 1GTUA 3A2XA 5DCGA 1THOA 2V2GA 4POBA 4KCEA 3ZRDA 3S9FA 1ZMAA 2A2SA 2AB6A 5CAXA 4MDCA 1SJZA 2YJ7A 3GYKA 2R4VA 1GSSA 1X5EA
chains in the Genus database with same CATH superfamily
3KTLA 1TU7A 4F9ZA 5BMUA 4MJBA 1YY7A 1YEPA 2PU9C 3O6TA 3CSHA 2HXKA 5D73A 2NDOA 12GSA 1QUWA 3HKRA 2B5EA 4ZIJA 2H70A 5CNWA 4K0GA 5CREA 5DQSA 1BG5A 4XTSA 6GSXA 2IIYA 4HQZA 3HYPA 2H6XA 1IYHA 4HZ4A 1K0AA 5F8BA 4EIQA 2DIYA 5AIXA 1RW1A 4I2TA 5F0GA 1PKZA 3K8NA 1ML6A 4K7OA 1BX9A 3N9JA 4O5RA 3HA9A 5G2ZA 3OR5A 1MDJA 2LS5A 5FHIA 3HY2A 1K0MA 4KW6A 5G1LA 4L0UA 4K2XA 1TDIA 4ILFA 2N5BA 5A4UA 4EDYA 5F06A 2OE0A 3F3QA 3G7JA 3TJJA 2JZRA 3TKRA 4NMUA 4OFNA 6GSSA 3P2AA 5EPFA 1T7PB 4HU9A 1Q4JA 1SYRA 1HD2A 2H72A 2VOCA 2C4JA 3GTUA 4BVXA 2YJHA 4JE1A 3H4KA 3GTUB 4BVXB 1YZXA 2VM1A 3WGXA 3VWVA 3MWHA 4KX4A 4GLTA 5ELAA 2YPMA 1EEJA 1FO5A 3ZFLA 3TRXA 2V41A 2H8LA 2F51A 3LJRA 4IJ3A 4E8HA 3GFKA 2OJLA 4FYCA 3DGQA 4YKFA 5CO3A 1I9DA 2Z9SA 4X0XA 1WJKA 4QL9A 2PMTA 1V2AA 2LRTA 1LJRA 2H66A 2OA7A 20GSA 3QCPA 1AC1A 3E3EA 4TR4A 2RIIA 3UMAA 3UVHA 1USBA 2BJXA 1M9AA 3BCIA 5IQYA 2JADA 4GCIA 2P0GA 3FYGA 1EV9A 3H1NA 2RM5A 4DSQA 1A24A 2WDUA 3C1RA 3RPNA 2PGTA 1UC7A 4ECCA 1JZRA 3EURA 2MMZA 1M3JA 4IJIA 1WE0A 4V1Ap 5ABRA 1MD4A 4OMVA 5B8AA 4USSA 4MJEA 3VLNA 2L6DA 2FNOA 2FWGA 3CBUA 3KD0A 3GN3A 3HJPA 2B1LA 3DRNA 1K0BA 3LGCA 3TKPA 2R2JA 1ERVA 3ZL5A 4LMWA 1A23A 1GSQA 1QK8A 3IPZA 4BL7A 5H5QA 3CRTA 1V57A 2CZ3A 2LSTA 5CRGA 4BL7B 3IXRA 2AJQB 4AJ8A 3IRAA 3E0UA 4O7HA 3CMIA 5DVBA 1ACVA 6GSUA 1A2LA 1XIYA 3CSJA 4WXTA 1SENA 2DSAA 3L78A 2QA1A 2P5RA 1OVNA 2RLIA 3RAZA 3EMPA 1SD9A 4OD7A 3IHGA 2A4VA 4GSTA 3GRXA 2K8VA 1PKWA 3D6IA 5IMZA 3UVTA 2N5FA 2WZ9A 4PGTA 4TN8A 1I5GA 2JSZA 2X8GA 2YNXA 2KP1A 3ZMLA 4JEDA 2X4AA 4MLYA 1ZOFA 4I2UA 2WS2A 3EMXA 1XCCA 3M1GA 2ZCTA 3GA4A 1VRSD 1GWCA 1NHYA 2CAIA 3PH9A 1C72A 2X8CA 4RI7A 4G0LA 2RUFA 3BD2A 3D4TA 1AQWA 3I9V2 2WCIA 3LSZA 3IK7A 1PL1A 1VGLA 1HNCA 4XCSA 2H30A 2JL4A 2K6VA 4DVCA 3H79A 3F4RA 5G5FA 4XS4A 1OKDA 1GTIA 4X1UA 1ZYNA 1ZCPA 1R5PA 5DBQA 4V2NA 5GAND 1SKWB 4XHMA 1GNWA 2MMAA 2KOKA 5CRHA 3VWUA 4EXJA 1WPIA 1RQMA 1AW9A 3H93A 1XWBA 4KB3A 2O87A 4NAXA 3QFAC 4OFTA 2LNSA 4KF9A 5H5SA 2I81A 3ED3A 1OE8A 5HFGA 5IMDA 16GSA 4Q5NA 1XZOA 4CY8A 1O85A 4K7IA 1FVKA 3D4MA 2H76A 1ZL9A 4F82A 4GF0A 1O73A 2CVBA 3A2WA 4IELA 5HR1A 1XVQA 4HEA2 3APSA 1W89A 4ICYA 2XHFA 2HRFA 2PWJA 5IMAA 2ON7A 1XOAA 1GSYA 1E6BA 4IN0A 4PX1A 2F3MA 2HRKA 3TGZA 3MDKA 3ZITA 1FHEA 1ZYEA 2LKUA 3APOA 5G5EA 1VF4A 1PN0A 2P5QA 2C1YA 2GQKA 2YZUA 1JLWA 4K1FA 3LXZA 1X9WB 4LL1B 1YQ1A 4HI7A 4ZB9A 2WULA 1FOVA 3P8WA 2C80A 2B5XA 3N5OA 3EVIA 2H71A 5HR0A 5JWRB 1VF1A 11GSA 3KH9A 3HDCA 2H1DA 2TIRA 3DVXA 2FA8A 4KSOA 3FHKA 5IO2A 2GS3A 3KIJA 7GSSA 2VD1A 1S3DA 4MZCA 4JR4A 2CQ9A 2DJJA 2M46A 3EE2A 1OC3A 3J7Yk 1TI3A 3CYNA 3QAGA 1ON4A 3EINA 3BBYA 3IAM2 4JRRA 1LBKA 1TJDA 2KHPA 2HSMA 3EPTA 2E2MA 2I4AA 3BJ5A 3P90A 2R37A 2PPTA 2LV3A 2HYXA 2VCWA 5EVOA 3R3EA 1TOFA 3DEXA 1K0NA 2DKIA 2X8HA 1SD8A 2VM2A 2HRNA 4K5SA 5IMVA 4POKA 3LYKA 2AUVA 2JZSA 3KTBA 1G7OA 4KCAA 2VCVA 1M2DA 2CX3A 1JHBA 3MNGA 4KUNA 3TDGA 1PN9A 14GSA 1KTEA 1SYXA 3UAPA 3W6GA 3GH9A 5H5RA 1PRXA 1V98A 5ECSA 1ZZYA 5KOXA 4ZILA 1GSUA 2FWHA 5ECLB 2QC7A 5JCWA 2B7KA 5IM9A 3TKSA 3DWVA 2HI7A 5J3RA 4IW9A 1Z5YE 3TRPA 5D9WA 4ZXGA 2DJKA 4OCEA 3LQ7A 1O8WA 2X49A 1GUHA 1A8LA 2IMFA 1IYIA 3LG6A 3GKXA 3FMWA 3HHVA 4PUFC 4MP4A 2N5AA 2R0GA 1TK5B 1YKCA 2XPEA 2X99A 1B9YC 2VUPA 5HQPA 3HVSA 1M2AA 4F0BA 4I6XA 1MD3A 3SBCA 3GL3A 1GLPA 3IHQA 3KMOA 2HLSA 1X9SB 4TR0A 2GSRA 2VAFA 3O3TA 1E2YA 1FVJA 5GAPD 1TTZA 4F03A 4QL7A 2GTUA 3LW9A 4YQMA 2VL2C 4NPBA 5BRTA 2NPBA 3ERGA 4JU5A 2F8FA 5EY6A 5JWOB 3H8QA 5INYA 4OCFA 1XXUA 4HJMA 2NTOA 1K3LA 1ERUA 1ILOA 2L57A 1FAAA 1YF1A 3F4SA 5B6MA 1H4OA 4NV5A 2MYGA 1BJXA 2J23A 4CW9A 3R2QA 1G7EA 1G6YA 1ERWA 4N30A 4N11A 3LORA 1MDIA 2DIZA 3CTGA 1SKSB 3GKNA 3M0FA 1A0RP 4PURA 1JLVA 5DDLA 5EL8A 2YWNA 2WB9A 2FLSA 4MF6A 3KH7A 5JCGA 1F6MC 1JZOA 3D0ZA 3CRUA 3UBKA 2IWTA 2V1MA 2C3NA 2OADA 2KLXA 3FKFA 4ZL8A 4ECIA 3V1WA 22GSA 2GZPA 5J9CA 4LLRA 4IQAA 4OWYA 4JBBA 1DE1A 4ZB8A 2M80A 2B1KA 1J9BA 4YQVA 1W4VA 3VWXA 4E8EA 3G7IA 2VL3A 2YWMA 2H1AA 4FQUA 3Q74A 3C71A 2IL3A 4DSSA 5LCZA 1U87A 1M99A 5FWGA 4DSSB 1U6TA 4BWQA 2H6ZA 2LQQA 3WT1A 4IS0A 5AGYA 1DSBA 4G2EA 1GTBA 4O5UA 1B4QA 3L9SA 5DALA 1GTAA 5DALB 1UVZA 2VCZA 2RUEA 5KOWA 1MTCA 1URMA 2HZEA 4Q5FA 2YV9A 2IMDA 2IN3A 2HZEB 3F6DA 2C3TA 3M9KA 4RQXA 1JZDA 4MA9A 3TKSE 2A2RA 1OAZA 4I5QA 2DBCA 3QDNA 1CQHA 3GKMA 2C0DA 5E59A 1EZKA 3HJOA 2BMXA 3PGTA 3CTFA 2L4CA 4CDOA 1TRSA 2HRAA 3FR6A 4ZL9A 3F63A 4J56E 1M7TA 1Z9HA 1PD21 3U6VA 4KDUA 4TR1A 4OO4A 3G7YA 2ES7A 1FB6A 4TR1B 2YOIA 2VLUA 4ZBDA 1R4WA 2IFQA 5A5KA 5E4WA 3IC4A 5G1KA 2IFQB 4PUAA 2GT6A 6GSTA 3RPPA 5KN0A 4EUYA 1XG8A 3FW2A 4K6XA 2E0QA 1T00A 1SK0A 2B5YA 1PX6A 5A4WA 5IIZA 3VWWA 1TI1A 1WMJA 4GQCA 3GNJA 4XIHA 2NVLA 3ZVJA 4BWSA 3DYRA 3KP9A 3VI5A 4K8MA 8GSSA 2H73A 1SU9A 4TXVA 2H1GA 1T8EB 2FA4A 3GH6A 5LNKe 3UL3A 4FO5A 2IMEA 4Q5QA 4WEYA 4K7NA 2C8UA 3HVNA 4XS1A 2LJRA 3GKKA 2H01A 1HYUA 2TRXA 2YV7A 4I97A 4ML1A 3Q19A 3DXBA 3TCOA 3KXOA 1GULA 1F3AA 1XFLA 1J0FA 4BA7A 4BPYA 5DJLA 3MSZA 4HU7A 3F3RA 2CV4A 4K9ZA 3L0HA 2D2ZA 5ECMB 1B8XA 3ZIVA 3ZVJD 1PGTA 3EU3A 4MH2A 5GSTA 1OKTA 5COHA 1LU4A 2LRCA 3EWLA 4HZ2A 4GRFA 2LTKA 1DE2A 4EF0A 3TOTA 1EEMA 2MBSA 4V2LA 2CZ2A 3WGDA 3HCZA 4KH7A 5CP1A 3GHAA 2XC2A 5C00A 2H0IA 3BCKA 3KZQA 3D22A 3SWLA 4YAPA 1SJ6A 1SK2A 1TP9A 4CHSA 2DJ1A 4K5RA 3TJKA 5J41A 2GSTA 5GZZB 2YCDA 3UJ1A 2FGXA 1XWGA 4PXOA 1SL0B 3A5IA 1DUGA 1O8XA 1SJIA 5F05A 1F2EA 2YP6A 5ECQB 4KDYA 3ZREA 3HZ4A 4K0NA 1S3RA 1HQOA 1RK4A 4XRDA 4HJ2A 2C0GA 3D21A 2H0GA 1U88A 2OE3A 5FT3A 3UARA 4EC0A 3APQA 3IV4A 4DSRA 4WR5A 4TOPA 3KP8A 3F6FA 2FHEA 5AIVA 5GSSA 4HQSA 1Y6EA 4TRXA 3IE3A 2JACA 4O32A 3ZYWA 1OYJA 3M3MA 3IR4A 4IBPA 1A2MA 1XWCA 1KNGA 1FOHA 2REMA 1OC8A 4XS6A 1OE7A 2QSIA 4IP6A 2VLTA 4GXZA 4NHZA 4LA1A 4IHUA 4EE0A 2MMOA 2AYTA 2LUSA 5ID2A 1Z7PA 4IQ1A 5ID2B 2FCHA 3M9JA 5IOXA 4PQIA 3ME7A 17GSA 1N2AA 2WGRA 1A2JA 4G10A 1Q98A 3BOAA 4H86A 2LNTA 4EVMA 5KN3A 2PVQA 2BTOT 1PA3A 3C1SA 1PX7A 2GLRA 1BYEA 1XW5A 5DJMA 3IC8A 4I8BA 1NSWA 2H6YA 4F2IA 5G30A 5IOWA 3HVVA 1Y25A 4ML6A 1TKDB 2FD3A 2K18A 1ZGNA 3D5JA 3ZFBA 2OBKA 3HXSA 4X4JA 2GT5A 4N0VA 1GUKA 2ZNMA 1PQNA 2L6CA 2PERA 3FEUA 3C7MA 1K3YA 4JZQA 1BAYA 2QKEA 4WF5A 4AJ6A 2HE3A 5D9TA 4FIWA 2AHEA 2L4QA 2IJYA 3TUEA 4FYBA 3GSSA 4Z2UA 1NW2A 1WP0A 5CRWA 4BVYA 1JZWA 2DKHA 4BVYB 4PNFA 1SL2B 4IP1A 1Z3EA 2V32A 5F07A 3Q18A 4Z2RA 1T4YA 3DMLA 2PUKC 2R3XA 3I69A 3EC3A 1V40A 2GSQA 4MNNA 4ZBAA 3QD9A 4DEJA 2HSYA 3QAWA 2PN8A 2P31A 2C0EA 2EC4A 3WYWA 1GSEA 2F9SA 3QAVA 1M3IA 3A5WA 4KSMA 2LJAA 2V6KA 4LMVA 1TRVA 1UA5A 1GLQA 1YEXA 3QR6A 1ABAA 4O92A 3FR9A 3C73A 2LRNA 2GQLA 5D9XA 1TK0B 5HFKA 1B4PA 1O81A 3IBHA 3GX0A 4TXOA 4D73A 1X5DA 3TJBA 2E2GA 2MBTA 5L71A 3FZ4A 2CA8A 2IPAA 4TXOB 2H0HA 4HDEA 4D73B 2CVKA 1R26A 5DQYA 3VURA 2AAWA 4MK3A 1QFNA 2GQMA 4MH3A 3ISOA 2EIRA 2OKAA 4X43A 3J7Yb 3IDVA 2YANA 2YZHA 3KCMA 2C3QA 4MPFA 3WT2A 2I1UA 4HOJA 1U3AA 2J9HA 2JSYA 4POMA 4MF7A 3QFBC 3TKSC 5D9VA 2DJ2A 2H1BA 2EIQA 4WKWA 3UEMA 3FZ9A 3AY8A 3TOUA 1YJ6A 2VLVA 3O76A 5IPGA 2B7JA 3GX8A 1YF0A 10GSA 2O8VB 3I43A 2HZFA 1X5CA 3EYTA 3I6AA 4TW5A 4IVFA 2WJUA 3HZ8A 3FY7A 4NWYA 19GSA 1TRUA 2L5OA 2B6MA 4CY6A 1Z7RA 1YDKA 5IMFA 4V1Ag 3W8SA 5D96A 4MJCA 3MIXA 2C0FA 5ELGA 4G0IA 4NV2A 3A3TA 1BQ7A 2HT9A 4MMMA 1XVWA 4IKHA 1PL2A 2VCXA 4GSNA 2MMNA 3ZTLA 3HD5A 4L5LA 2O7KA 6GSWA 5B8BA 4EIPA 4MF5A 1EOGA 13GSA 5HR3A 3DKSA 2YWOA 3FZ5A 1GP1A 2CAQA 3GMFA 2XBQA 5KN1A 4HS1A 2PVOC 1K0CA 5ECHB 3L9UA 3G9BA 1QQ2A 4MPGA 1FW1A 1DBYA 4AF2A 3TRQA 1T3BA 1HNAA 2GVPA 3L4NA 1GUMA 2LEGA 3Q6OA 2FUG2 4G19A 1PMTA 4TR3A 5J4UA 3GSTA 2GDRA 2ZUPA 1GSFA 1CQGA 1X9MB 1XPVA 5ECPB 1AQVA 5DAKA 2OE1A 2XBIA 1GRXA 1GNEA 1M9BA 1K0OA 5DAKB 3VPQA 4Z2TA 2XPDA 4PQHA 2CT6A 3DVWA 2RM6A 5JCUA 3LEFA 4HUAA 4ULXA 3KGKA 1AUCA 1SKRB 3DIEA 2K9FA 1MEKA 4KE3A 3NZNA 2H74A 4L5OA 3GV1A 5ECRB 4L8EA 5LD0A 1G0TA 1XWKA 1F3BA 1XWAA 6GSVA 1BEDA 3NIVA 4IGJA 2LJKA 4GQFA 1U3IA 3MYDA 1FG4A 3QOUA 1F37A 4EKZA 2CX4A 2EIOA 1S3CA 1SL1B 5ECOB 1Z6MA 2JU5A 3NOFA 1H75A 1TXXA 1NM3A 4G9HA 3IK9A 4KA0A 4OO5A 4FH8A 1B9XC 4MZWA 4RI6A 2X64A 1AQXA 3FRCA 1B48A 4MCUA 5DCHA 4EL1A 5J5NA 1EP7A 3VPTA 1N8JA 2DJ0A 2VIMA 3FR3A 2GZZA 4O5QA 4TKYA 5IO0A 3KJYA 4MJAA 3E9JB 4WR4A 5IMCA 1M0UA 4NHWA 4J57E 2G0FA 9GSSA 4WETA 5D8IA 3F0IA 4A5PA 2HSHA 2DLXA 1QGVA 2CVDA 2OACA 4JR6A 1FB0A 1XBSA 3QMXA 1HNBA 3PINA 2A2PA 2I3YA 4ECJA 2TRCP 2R0PA 3RDWA 3WGEA 2DMLA 2LQOA 4NXIA 3ZZXA 2H75A 3LFLA 3GIXA 4RQRA 4Z7XA 1T4ZA 3TJGA 1X0RA 4BIKA 1Z6NA 3F8UA 1WIKA 1VF2A 2VCTA 2V6OA 4ISDA 4V2MA 3UOMA 3TB2A 2QA2A 2R6KA 1GL8A 2GGTA 4ECBA 1AAZA 2HFDA 1ERTA 3IA1A 3QPMA 3HVXA 3RHCA 3KEBA 5AISA 4WBRD 4L0WA 4KAEA 2OBIA 5ENUA 2HNLA 5KN2A 2JZTA 1V58A 1KBNA 2L5LA 1R5AA 1XOBA 2VO4A 2GSSA 5D93A 3IOSA 5ECKB 4XS4B 3LXTA 4N10A 4KGIA 2FWEA 1WOUA 3UIWA 1TK8B 2DJ3A 5CRDA 4EDZA 1SK1A 1S3AA 1ZYQB 2M72A 4MABA 2IMKA 3CXGA 4N0ZA 4HSCX 1WRYA 4POLA 2R0CA 3C8EA 3ME8A 4FYUA 4KNDA 1EGOA 4GTUA 1EP8A 3A2VA 5ECIB 4AJ7A 3VFIA 4Q5RA 3PR8A 4ZL7A 2VL9A 3ZLPA 4YH2A 4GWRA 2NBSA 3HJMA 3RBTA 1AXDA 4J2FA 3VI7A 1R7HA 2R5GA 2UZ8A 5B7CA 5KEJA 4WBJA 1ST9A 4RUVA 3LWAA 2KP2A 4QQ7A 1F9MA 2VCQA 2YN1A 5C04A 4PNGA 3KMNA 2MZCA 1OC9A 1A0FA 1T1VA 2I9HA 3FK8A 5A4VA 2QGVA 1EOHA 2AV4A 1OC9B 4WF4A 6GSYA 2GZYA 4GSSA 1V9WA 3FZAA 1G6WA 2IMIA 3WD6A 3CSIA 3ZIJA 3LYPA 3ERFA 4LL4B 1J08A 5J9BA 4ZBBA 3TKQA 1PSQA 3P7XA 1YKAA 4ACSA 1MDKA 3EU4A 4G0KA 4YKGA 3F4TA 3CQFA 4EO3A 18GSA 4K2DA 1TU8A 4PQ1A 4ZB6A 5IPHA 1THXA 2H19A 1ZYPA 3US3A 3GL5A 1TW9A 2FY6A 1EGRA 4OFMA 4ID0A 2K8SA 5JWQB 2FWFA 2E7PA 1QXHA 5CYYA 2VD0A 4MZBA 3ERWA 3TJFA 1VF3A 1K0DA 4PTSA 3F9UA 4XRAA 4TVEA 3VK9A 3U5RE 2G2QA 2DC5A 2O85A 1WWJA 3L9VA 4AGSA 1QMVA 1KEBA 2ON5A 1UN2A 2ALBA 4YAVA 5HFIA 1GSDA 1JFUA 1M2BA 3GURA 4F0CA 1EV4A 1O6JA 3PPUA 2KUCA 3M8NA 2WRTA 1XW6A 2VL2A 2DMMA 4YQUA 3DD3A 3RHBA 1NHOA 2YWIA 1GH2A 2PBJA 3ZMKA 2B3SA 2WFCA 1O7UA 1XW9A 1EWXA 5G31A 5ECNB 1AIUA 3W8JA 3IAS2 1K3OA 3UBLA 2O89A 3KM6A 1TRWA 4KDXA 2F8AA 4P3YB 2A4HA 5HR2A 1PFOA 2L59A 3GUSA 5B6NA 3MAKA 5AN1A 3JCML 1A8YA 1GTUA 3A2XA 5DCGA 1THOA 2V2GA 4POBA 4KCEA 3ZRDA 3S9FA 1ZMAA 2A2SA 2AB6A 5CAXA 4MDCA 1SJZA 2YJ7A 3GYKA 2R4VA 1GSSA 1X5EA
chains in the Genus database with same CATH topology
3KTLA 1TU7A 4F9ZA 5BMUA 4MJBA 1YY7A 1YEPA 2PU9C 3O6TA 3CSHA 2HXKA 5D73A 2NDOA 12GSA 1QUWA 3HKRA 2B5EA 4ZIJA 2H70A 5CNWA 4K0GA 5CREA 5DQSA 1BG5A 4XTSA 6GSXA 2IIYA 4HQZA 3HYPA 2H6XA 1IYHA 4HZ4A 1K0AA 5F8BA 4EIQA 2DIYA 5AIXA 1RW1A 4I2TA 5F0GA 1PKZA 3K8NA 1ML6A 4K7OA 1BX9A 3N9JA 4O5RA 3HA9A 5G2ZA 3OR5A 1MDJA 2LS5A 5FHIA 3HY2A 1K0MA 4KW6A 5G1LA 4L0UA 4K2XA 1TDIA 4ILFA 2N5BA 5A4UA 4EDYA 5F06A 2OE0A 3F3QA 3G7JA 3TJJA 2JZRA 3TKRA 4NMUA 4OFNA 6GSSA 3P2AA 5EPFA 1T7PB 4HU9A 1Q4JA 1SYRA 1HD2A 2H72A 2VOCA 2C4JA 3GTUA 4BVXA 2YJHA 4JE1A 3H4KA 3GTUB 4BVXB 1YZXA 2VM1A 3WGXA 3VWVA 3MWHA 4KX4A 4GLTA 5ELAA 2YPMA 1EEJA 1FO5A 3ZFLA 3TRXA 2V41A 2H8LA 2F51A 3LJRA 4IJ3A 4E8HA 3GFKA 2OJLA 4FYCA 3DGQA 4YKFA 5CO3A 1I9DA 2Z9SA 4X0XA 1WJKA 4QL9A 2PMTA 1V2AA 2LRTA 1LJRA 2H66A 2OA7A 20GSA 3QCPA 1AC1A 3E3EA 4TR4A 2RIIA 3UMAA 3UVHA 1USBA 2BJXA 1M9AA 3BCIA 5IQYA 2JADA 4GCIA 2P0GA 3FYGA 1EV9A 3H1NA 2RM5A 4DSQA 1A24A 2WDUA 3C1RA 3RPNA 2PGTA 1UC7A 4ECCA 1JZRA 3EURA 2MMZA 4IJIA 1WE0A 4V1Ap 5ABRA 1MD4A 4OMVA 5B8AA 4USSA 4MJEA 3VLNA 2L6DA 2FNOA 2FWGA 3CBUA 3KD0A 3GN3A 3HJPA 2B1LA 3DRNA 1K0BA 3LGCA 3TKPA 2R2JA 1ERVA 3ZL5A 4LMWA 1A23A 1GSQA 1QK8A 3IPZA 4BL7A 5H5QA 3CRTA 1V57A 2CZ3A 2LSTA 5CRGA 4BL7B 3IXRA 2AJQB 4AJ8A 3IRAA 3E0UA 4O7HA 3CMIA 5DVBA 1ACVA 6GSUA 1A2LA 1XIYA 3CSJA 4WXTA 1SENA 2DSAA 3L78A 2QA1A 2P5RA 1OVNA 2RLIA 3RAZA 3EMPA 1SD9A 4OD7A 3IHGA 2A4VA 4GSTA 3GRXA 2K8VA 1PKWA 3D6IA 5IMZA 3UVTA 2N5FA 2WZ9A 4PGTA 4TN8A 1I5GA 2JSZA 2X8GA 2YNXA 2KP1A 3ZMLA 4JEDA 2X4AA 4MLYA 1ZOFA 4I2UA 2WS2A 3EMXA 1XCCA 3M1GA 2ZCTA 3GA4A 1VRSD 1GWCA 1NHYA 2CAIA 3PH9A 1C72A 2X8CA 4RI7A 4G0LA 2RUFA 3BD2A 3D4TA 1AQWA 3I9V2 2WCIA 3LSZA 3IK7A 1PL1A 1VGLA 1HNCA 4XCSA 2H30A 2JL4A 2K6VA 4DVCA 3H79A 3F4RA 5G5FA 4XS4A 1OKDA 1GTIA 4X1UA 1ZYNA 1ZCPA 1R5PA 5DBQA 4V2NA 5GAND 1SKWB 4XHMA 1GNWA 2MMAA 2KOKA 5CRHA 3VWUA 4EXJA 1WPIA 1RQMA 1AW9A 3H93A 1XWBA 4KB3A 2O87A 4NAXA 3QFAC 4OFTA 2LNSA 4KF9A 5H5SA 2I81A 3ED3A 1OE8A 5HFGA 5IMDA 16GSA 4Q5NA 1XZOA 4CY8A 1O85A 4K7IA 1FVKA 3D4MA 2H76A 1ZL9A 4F82A 4GF0A 1O73A 2CVBA 3A2WA 4IELA 5HR1A 1XVQA 4HEA2 3APSA 1W89A 4ICYA 2XHFA 2HRFA 2PWJA 5IMAA 2ON7A 1XOAA 1GSYA 1E6BA 4IN0A 4PX1A 2F3MA 2HRKA 3TGZA 3MDKA 3ZITA 1FHEA 1ZYEA 2LKUA 3APOA 5G5EA 1VF4A 1PN0A 2P5QA 2C1YA 2GQKA 2YZUA 1JLWA 4K1FA 3LXZA 1X9WB 4LL1B 1YQ1A 4HI7A 4ZB9A 2WULA 1FOVA 3P8WA 2C80A 2B5XA 3N5OA 3EVIA 2H71A 5HR0A 5JWRB 1VF1A 11GSA 3KH9A 3HDCA 2H1DA 2TIRA 3DVXA 2FA8A 4KSOA 3FHKA 5IO2A 2GS3A 3KIJA 7GSSA 2VD1A 1S3DA 4MZCA 4JR4A 2CQ9A 2DJJA 2M46A 3EE2A 1OC3A 3J7Yk 1TI3A 3CYNA 3QAGA 1ON4A 3EINA 3BBYA 3IAM2 4JRRA 1LBKA 1TJDA 2KHPA 2HSMA 3EPTA 2E2MA 2I4AA 3BJ5A 3P90A 2R37A 2PPTA 2LV3A 2HYXA 2VCWA 5EVOA 3R3EA 1TOFA 3DEXA 1K0NA 2DKIA 2X8HA 1SD8A 2VM2A 2HRNA 4K5SA 5IMVA 4POKA 3LYKA 2AUVA 2JZSA 3KTBA 1G7OA 4KCAA 2VCVA 1M2DA 2CX3A 1JHBA 3MNGA 4KUNA 3TDGA 1PN9A 14GSA 1KTEA 1SYXA 3UAPA 3W6GA 3GH9A 5H5RA 1PRXA 1V98A 5ECSA 1ZZYA 5KOXA 4ZILA 1GSUA 2FWHA 5ECLB 2QC7A 5JCWA 2B7KA 5IM9A 3TKSA 3DWVA 2HI7A 5J3RA 4IW9A 1Z5YE 3TRPA 5D9WA 4ZXGA 2DJKA 4OCEA 3LQ7A 1O8WA 2X49A 1GUHA 1A8LA 2IMFA 1IYIA 3LG6A 3GKXA 3FMWA 3HHVA 4PUFC 4MP4A 2N5AA 2R0GA 1TK5B 1YKCA 2XPEA 2X99A 1B9YC 2VUPA 5HQPA 3HVSA 1M2AA 4F0BA 4I6XA 1MD3A 3SBCA 3GL3A 1GLPA 3IHQA 3KMOA 2HLSA 1X9SB 4TR0A 2GSRA 2VAFA 3O3TA 1E2YA 1FVJA 5GAPD 1TTZA 4F03A 4QL7A 2GTUA 3LW9A 4YQMA 2VL2C 4NPBA 5BRTA 2NPBA 3ERGA 4JU5A 2F8FA 5EY6A 5JWOB 3H8QA 5INYA 4OCFA 1XXUA 4HJMA 2NTOA 1K3LA 1ERUA 1ILOA 2L57A 1FAAA 1YF1A 3F4SA 5B6MA 1H4OA 4NV5A 2MYGA 1BJXA 2J23A 4CW9A 3R2QA 1G7EA 1G6YA 1ERWA 4N30A 4N11A 3LORA 1MDIA 2DIZA 3CTGA 1SKSB 3GKNA 3M0FA 1A0RP 4PURA 1JLVA 5DDLA 5EL8A 2YWNA 2WB9A 2FLSA 4MF6A 3KH7A 5JCGA 1F6MC 1JZOA 3D0ZA 3CRUA 3UBKA 2IWTA 2V1MA 2C3NA 2OADA 2KLXA 3FKFA 4ZL8A 4ECIA 3V1WA 22GSA 2GZPA 5J9CA 4LLRA 4IQAA 4OWYA 4JBBA 1DE1A 4ZB8A 2M80A 2B1KA 1J9BA 4YQVA 1W4VA 3VWXA 4E8EA 3G7IA 2VL3A 2YWMA 2H1AA 4FQUA 3Q74A 3C71A 2IL3A 4DSSA 5LCZA 1U87A 1M99A 5FWGA 4DSSB 1U6TA 4BWQA 2H6ZA 2LQQA 3WT1A 4IS0A 5AGYA 1DSBA 4G2EA 1GTBA 4O5UA 1B4QA 3L9SA 5DALA 1GTAA 5DALB 1UVZA 2VCZA 2RUEA 5KOWA 1MTCA 1URMA 2HZEA 4Q5FA 2YV9A 2IMDA 2IN3A 2HZEB 3F6DA 2C3TA 3M9KA 4RQXA 1JZDA 4MA9A 3TKSE 2A2RA 1OAZA 4I5QA 2DBCA 3QDNA 1CQHA 3GKMA 2C0DA 5E59A 1EZKA 3HJOA 2BMXA 3PGTA 3CTFA 2L4CA 4CDOA 1TRSA 2HRAA 3FR6A 4ZL9A 3F63A 4J56E 1M7TA 1Z9HA 1PD21 3U6VA 4KDUA 4TR1A 4OO4A 3G7YA 2ES7A 1FB6A 4TR1B 2YOIA 2VLUA 4ZBDA 1R4WA 2IFQA 5A5KA 5E4WA 3IC4A 5G1KA 2IFQB 4PUAA 2GT6A 6GSTA 3RPPA 5KN0A 4EUYA 3FW2A 4K6XA 2E0QA 1T00A 1SK0A 2B5YA 1PX6A 5A4WA 5IIZA 3VWWA 1TI1A 1WMJA 4GQCA 3GNJA 4XIHA 2NVLA 3ZVJA 4BWSA 3DYRA 3KP9A 3VI5A 4K8MA 8GSSA 2H73A 1SU9A 4TXVA 2H1GA 1T8EB 2FA4A 3GH6A 5LNKe 3UL3A 4FO5A 2IMEA 4Q5QA 4WEYA 4K7NA 2C8UA 4XS1A 2LJRA 3GKKA 2H01A 1HYUA 2TRXA 2YV7A 4I97A 4ML1A 3Q19A 3DXBA 3TCOA 3KXOA 1GULA 1F3AA 1XFLA 1J0FA 4BA7A 4BPYA 5DJLA 3MSZA 4HU7A 3F3RA 2CV4A 4K9ZA 3L0HA 2D2ZA 5ECMB 1B8XA 3ZIVA 3ZVJD 1PGTA 3EU3A 4MH2A 5GSTA 1OKTA 5COHA 1LU4A 2LRCA 3EWLA 4HZ2A 4GRFA 2LTKA 1DE2A 4EF0A 3TOTA 1EEMA 2MBSA 4V2LA 2CZ2A 3WGDA 3HCZA 4KH7A 5CP1A 3GHAA 2XC2A 5C00A 2H0IA 3BCKA 3KZQA 3D22A 3SWLA 4YAPA 1SJ6A 1SK2A 1TP9A 4CHSA 2DJ1A 4K5RA 3TJKA 5J41A 2GSTA 5GZZB 2YCDA 3UJ1A 2FGXA 1XWGA 4PXOA 1SL0B 3A5IA 1DUGA 1O8XA 1SJIA 5F05A 1F2EA 2YP6A 5ECQB 4KDYA 3ZREA 3HZ4A 4K0NA 1HQOA 1RK4A 4XRDA 4HJ2A 2C0GA 3D21A 2H0GA 1U88A 2OE3A 5FT3A 3UARA 4EC0A 3APQA 3IV4A 4DSRA 4WR5A 4TOPA 3KP8A 3F6FA 2FHEA 5AIVA 5GSSA 4HQSA 1Y6EA 4TRXA 3IE3A 2JACA 4O32A 3ZYWA 1OYJA 3M3MA 3IR4A 4IBPA 1A2MA 1XWCA 1KNGA 1FOHA 2REMA 1OC8A 4XS6A 1OE7A 2QSIA 4IP6A 2VLTA 4GXZA 4NHZA 4LA1A 4IHUA 4EE0A 2MMOA 2AYTA 2LUSA 5ID2A 1Z7PA 4IQ1A 5ID2B 2FCHA 3M9JA 5IOXA 4PQIA 3ME7A 17GSA 1N2AA 2WGRA 1A2JA 4G10A 1Q98A 3BOAA 4H86A 2LNTA 4EVMA 5KN3A 2PVQA 2BTOT 1PA3A 3C1SA 1PX7A 2GLRA 1BYEA 1XW5A 5DJMA 3IC8A 4I8BA 1NSWA 2H6YA 4F2IA 5G30A 5IOWA 3HVVA 1Y25A 4ML6A 1TKDB 2FD3A 2K18A 1ZGNA 3D5JA 3ZFBA 2OBKA 3HXSA 4X4JA 2GT5A 4N0VA 1GUKA 2ZNMA 1PQNA 2L6CA 2PERA 3FEUA 3C7MA 1K3YA 4JZQA 1BAYA 2QKEA 4WF5A 4AJ6A 2HE3A 5D9TA 4FIWA 2AHEA 2L4QA 2IJYA 3TUEA 4FYBA 3GSSA 4Z2UA 1NW2A 1WP0A 5CRWA 4BVYA 1JZWA 2DKHA 4BVYB 4PNFA 1SL2B 4IP1A 1Z3EA 2V32A 5F07A 3Q18A 4Z2RA 1T4YA 3DMLA 2PUKC 2R3XA 3I69A 3EC3A 1V40A 2GSQA 4MNNA 4ZBAA 3QD9A 4DEJA 2HSYA 3QAWA 2PN8A 2P31A 2C0EA 2EC4A 3WYWA 1GSEA 2F9SA 3QAVA 3A5WA 4KSMA 2LJAA 2V6KA 4LMVA 1TRVA 1UA5A 1GLQA 1YEXA 3QR6A 1ABAA 4O92A 3FR9A 3C73A 2LRNA 2GQLA 5D9XA 1TK0B 5HFKA 1B4PA 1O81A 3IBHA 3GX0A 4TXOA 4D73A 1X5DA 3TJBA 2E2GA 2MBTA 5L71A 3FZ4A 2CA8A 2IPAA 4TXOB 2H0HA 4HDEA 4D73B 2CVKA 1R26A 5DQYA 3VURA 2AAWA 4MK3A 1QFNA 2GQMA 4MH3A 3ISOA 2EIRA 2OKAA 4X43A 3J7Yb 3IDVA 2YANA 2YZHA 3KCMA 2C3QA 4MPFA 3WT2A 2I1UA 4HOJA 1U3AA 2J9HA 2JSYA 4POMA 4MF7A 3QFBC 3TKSC 5D9VA 2DJ2A 2H1BA 2EIQA 4WKWA 3UEMA 3FZ9A 3AY8A 3TOUA 1YJ6A 2VLVA 3O76A 5IPGA 2B7JA 3GX8A 1YF0A 10GSA 2O8VB 3I43A 2HZFA 1X5CA 3EYTA 3I6AA 4TW5A 4IVFA 2WJUA 3HZ8A 3FY7A 4NWYA 19GSA 1TRUA 2L5OA 2B6MA 4CY6A 1Z7RA 1YDKA 5IMFA 4V1Ag 3W8SA 5D96A 4MJCA 3MIXA 2C0FA 5ELGA 4G0IA 4NV2A 3A3TA 1BQ7A 2HT9A 4MMMA 1XVWA 4IKHA 1PL2A 2VCXA 4GSNA 2MMNA 3ZTLA 3HD5A 4L5LA 2O7KA 6GSWA 5B8BA 4EIPA 4MF5A 1EOGA 13GSA 5HR3A 3DKSA 2YWOA 3FZ5A 1GP1A 2CAQA 3GMFA 2XBQA 5KN1A 4HS1A 2PVOC 1K0CA 5ECHB 3L9UA 3G9BA 1QQ2A 4MPGA 1FW1A 1DBYA 4AF2A 3TRQA 1T3BA 1HNAA 2GVPA 3L4NA 1GUMA 2LEGA 3Q6OA 2FUG2 4G19A 1PMTA 4TR3A 5J4UA 3GSTA 2GDRA 2ZUPA 1GSFA 1CQGA 1X9MB 1XPVA 5ECPB 1AQVA 5DAKA 2OE1A 2XBIA 1GRXA 1GNEA 1M9BA 1K0OA 5DAKB 3VPQA 4Z2TA 2XPDA 4PQHA 2CT6A 3DVWA 2RM6A 5JCUA 3LEFA 4HUAA 4ULXA 3KGKA 1AUCA 1SKRB 3DIEA 2K9FA 1MEKA 4KE3A 3NZNA 2H74A 4L5OA 3GV1A 5ECRB 4L8EA 5LD0A 1G0TA 1XWKA 1F3BA 1XWAA 6GSVA 1BEDA 3NIVA 4IGJA 2LJKA 4GQFA 1U3IA 3MYDA 1FG4A 3QOUA 1F37A 4EKZA 2CX4A 2EIOA 1S3CA 1SL1B 5ECOB 1Z6MA 2JU5A 3NOFA 1H75A 1TXXA 1NM3A 4G9HA 3IK9A 4KA0A 4OO5A 4FH8A 1B9XC 4MZWA 4RI6A 2X64A 1AQXA 3FRCA 1B48A 4MCUA 5DCHA 4EL1A 5J5NA 1EP7A 3VPTA 1N8JA 2DJ0A 2VIMA 3FR3A 2GZZA 4O5QA 4TKYA 5IO0A 3KJYA 4MJAA 3E9JB 4WR4A 5IMCA 1M0UA 4NHWA 4J57E 2G0FA 9GSSA 4WETA 5D8IA 3F0IA 4A5PA 2HSHA 2DLXA 1QGVA 2CVDA 2OACA 4JR6A 1FB0A 1XBSA 3QMXA 1HNBA 3PINA 2A2PA 2I3YA 4ECJA 2TRCP 2R0PA 3RDWA 3WGEA 2DMLA 2LQOA 4NXIA 3ZZXA 2H75A 3LFLA 3GIXA 4RQRA 4Z7XA 1T4ZA 3TJGA 1X0RA 1Z6NA 3F8UA 1WIKA 1VF2A 2VCTA 2V6OA 4ISDA 4V2MA 3UOMA 3TB2A 2QA2A 2R6KA 1GL8A 2GGTA 4ECBA 1AAZA 2HFDA 1ERTA 3IA1A 3QPMA 3HVXA 3RHCA 3KEBA 5AISA 4WBRD 4L0WA 4KAEA 2OBIA 5ENUA 2HNLA 5KN2A 2JZTA 1V58A 1KBNA 2L5LA 1R5AA 1XOBA 2VO4A 2GSSA 5D93A 3IOSA 5ECKB 4XS4B 3LXTA 4N10A 4KGIA 2FWEA 1WOUA 3UIWA 1TK8B 2DJ3A 5CRDA 4EDZA 1SK1A 1S3AA 1ZYQB 2M72A 4MABA 2IMKA 3CXGA 4N0ZA 1WRYA 4POLA 2R0CA 3C8EA 3ME8A 4FYUA 4KNDA 1EGOA 4GTUA 1EP8A 3A2VA 5ECIB 4AJ7A 3VFIA 4Q5RA 3PR8A 4ZL7A 2VL9A 3ZLPA 4YH2A 4GWRA 2NBSA 3HJMA 3RBTA 1AXDA 4J2FA 3VI7A 1R7HA 2R5GA 2UZ8A 5B7CA 5KEJA 4WBJA 1ST9A 4RUVA 3LWAA 2KP2A 4QQ7A 1F9MA 2VCQA 2YN1A 5C04A 4PNGA 3KMNA 2MZCA 1OC9A 1A0FA 1T1VA 2I9HA 3FK8A 5A4VA 2QGVA 1EOHA 2AV4A 1OC9B 4WF4A 6GSYA 2GZYA 4GSSA 1V9WA 3FZAA 1G6WA 2IMIA 3WD6A 3CSIA 3ZIJA 3LYPA 3ERFA 4LL4B 1J08A 5J9BA 4ZBBA 3TKQA 1PSQA 3P7XA 1YKAA 4ACSA 1MDKA 3EU4A 4G0KA 4YKGA 3F4TA 4EO3A 18GSA 4K2DA 1TU8A 4PQ1A 4ZB6A 5IPHA 1THXA 2H19A 1ZYPA 3US3A 3GL5A 1TW9A 2FY6A 1EGRA 4OFMA 4ID0A 2K8SA 5JWQB 2FWFA 2E7PA 1QXHA 5CYYA 2VD0A 4MZBA 3ERWA 3TJFA 1VF3A 1K0DA 4PTSA 3F9UA 4XRAA 4TVEA 3VK9A 3U5RE 2G2QA 2DC5A 2O85A 1WWJA 3L9VA 4AGSA 1QMVA 1KEBA 2ON5A 1UN2A 2ALBA 4YAVA 5HFIA 1GSDA 1JFUA 1M2BA 3GURA 4F0CA 1EV4A 1O6JA 3PPUA 2KUCA 3M8NA 2WRTA 1XW6A 2VL2A 2DMMA 4YQUA 3DD3A 3RHBA 1NHOA 2YWIA 1GH2A 2PBJA 3ZMKA 2B3SA 2WFCA 1O7UA 1XW9A 1EWXA 5G31A 5ECNB 1AIUA 3W8JA 3IAS2 1K3OA 3UBLA 2O89A 3KM6A 1TRWA 4KDXA 2F8AA 4P3YB 2A4HA 5HR2A 2L59A 3GUSA 5B6NA 3MAKA 5AN1A 3JCML 1A8YA 1GTUA 3A2XA 5DCGA 1THOA 2V2GA 4POBA 4KCEA 3ZRDA 3S9FA 1ZMAA 2A2SA 2AB6A 5CAXA 4MDCA 1SJZA 2YJ7A 3GYKA 2R4VA 1GSSA 1X5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTL A;  1TU7 A;  4F9Z A;  4MJB A;  1YY7 A;  1YEP A;  2PU9 C;  3O6T A;  3CSH A;  2HXK A;  5D73 A;  2NDO A;  12GS A;  1QUW A;  3HKR A;  2B5E A;  4ZIJ A;  2H70 A;  5CNW A;  4K0G A;  5CRE A;  5DQS A;  1BG5 A;  4XTS A;  6GSX A;  2IIY A;  4HQZ A;  3HYP A;  2H6X A;  1IYH A;  4HZ4 A;  1K0A A;  5F8B A;  2DIY A;  5AIX A;  1RW1 A;  4I2T A;  5F0G A;  1PKZ A;  3K8N A;  1ML6 A;  4K7O A;  1BX9 A;  3N9J A;  4O5R A;  3HA9 A;  5G2Z A;  3OR5 A;  1MDJ A;  2LS5 A;  5FHI A;  3HY2 A;  1K0M A;  4KW6 A;  5G1L A;  4L0U A;  1TDI A;  4ILF A;  2N5B A;  5A4U A;  4EDY A;  5F06 A;  2OE0 A;  3F3Q A;  3G7J A;  3TJJ A;  2JZR A;  3TKR A;  4NMU A;  4OFN A;  6GSS A;  3P2A A;  5EPF A;  1T7P B;  4HU9 A;  1Q4J A;  1SYR A;  1HD2 A;  2H72 A;  2VOC A;  2C4J A;  3GTU A;  4BVX A;  2YJH A;  4JE1 A;  3H4K A;  3GTU B;  1YZX A;  2VM1 A;  3WGX A;  3VWV A;  3MWH A;  4KX4 A;  4GLT A;  5ELA A;  2YPM A;  1EEJ A;  1FO5 A;  3ZFL A;  3TRX A;  2V41 A;  2H8L A;  2F51 A;  3LJR A;  4IJ3 A;  4E8H A;  3GFK A;  2OJL A;  4FYC A;  3DGQ A;  5CO3 A;  1I9D A;  2Z9S A;  4X0X A;  1WJK A;  4QL9 A;  2PMT A;  1V2A A;  2LRT A;  1LJR A;  2H66 A;  2OA7 A;  20GS A;  3QCP A;  1AC1 A;  3E3E A;  4TR4 A;  2RII A;  3UMA A;  3UVH A;  1USB A;  2BJX A;  1M9A A;  3BCI A;  5IQY A;  2JAD A;  4GCI A;  2P0G A;  3FYG A;  1EV9 A;  3H1N A;  2RM5 A;  4DSQ A;  1A24 A;  2WDU A;  3C1R A;  3RPN A;  2PGT A;  1UC7 A;  4ECC A;  1JZR A;  3EUR A;  2MMZ A;  4IJI A;  1WE0 A;  4V1A p;  5ABR A;  1MD4 A;  4OMV A;  5B8A A;  4MJE A;  3VLN A;  2L6D A;  2FNO A;  2FWG A;  3CBU A;  3KD0 A;  3GN3 A;  3HJP A;  2B1L A;  3DRN A;  1K0B A;  3LGC A;  3TKP A;  2R2J A;  1ERV A;  3ZL5 A;  4LMW A;  1A23 A;  1GSQ A;  1QK8 A;  3IPZ A;  4BL7 A;  5H5Q A;  3CRT A;  1V57 A;  2CZ3 A;  2LST A;  5CRG A;  3IXR A;  2AJQ B;  4AJ8 A;  3IRA A;  3E0U A;  4O7H A;  3CMI A;  5DVB A;  1ACV A;  6GSU A;  1A2L A;  1XIY A;  3CSJ A;  4WXT A;  1SEN A;  2DSA A;  3L78 A;  2P5R A;  1OVN A;  2RLI A;  3RAZ A;  3EMP A;  1SD9 A;  4OD7 A;  2A4V A;  4GST A;  3GRX A;  2K8V A;  1PKW A;  3D6I A;  5IMZ A;  3UVT A;  2N5F A;  2WZ9 A;  4PGT A;  4TN8 A;  1I5G A;  2JSZ A;  2X8G A;  2YNX A;  2KP1 A;  3ZML A;  4JED A;  4MLY A;  1ZOF A;  4I2U A;  2WS2 A;  3EMX A;  1XCC A;  3M1G A;  2ZCT A;  3GA4 A;  1VRS D;  1GWC A;  1NHY A;  2CAI A;  3PH9 A;  1C72 A;  2X8C A;  4RI7 A;  2RUF A;  3BD2 A;  3D4T A;  1AQW A;  3I9V 2;  2WCI A;  3LSZ A;  3IK7 A;  1PL1 A;  1VGL A;  1HNC A;  4XCS A;  2H30 A;  2JL4 A;  2K6V A;  4DVC A;  3H79 A;  3F4R A;  5G5F A;  4XS4 A;  1OKD A;  1GTI A;  4X1U A;  1ZCP A;  1R5P A;  5DBQ A;  4V2N A;  5GAN D;  1SKW B;  4XHM A;  1GNW A;  2MMA A;  2KOK A;  5CRH A;  3VWU A;  4EXJ A;  1WPI A;  1RQM A;  1AW9 A;  3H93 A;  1XWB A;  4KB3 A;  2O87 A;  4NAX A;  3QFA C;  4OFT A;  2LNS A;  5H5S A;  2I81 A;  3ED3 A;  1OE8 A;  5HFG A;  5IMD A;  16GS A;  4Q5N A;  1XZO A;  1O85 A;  4K7I A;  1FVK A;  3D4M A;  2H76 A;  1ZL9 A;  4F82 A;  4GF0 A;  1O73 A;  2CVB A;  3A2W A;  4IEL A;  5HR1 A;  1XVQ A;  4HEA 2;  3APS A;  1W89 A;  2XHF A;  2HRF A;  2PWJ A;  5IMA A;  2ON7 A;  1XOA A;  1GSY A;  1E6B A;  4IN0 A;  4PX1 A;  2F3M A;  3TGZ A;  3MDK A;  3ZIT A;  1FHE A;  1ZYE A;  2LKU A;  3APO A;  5G5E A;  1VF4 A;  2P5Q A;  2C1Y A;  2GQK A;  2YZU A;  1JLW A;  4K1F A;  3LXZ A;  1X9W B;  4LL1 B;  1YQ1 A;  4HI7 A;  4ZB9 A;  2WUL A;  1FOV A;  3P8W A;  2C80 A;  2B5X A;  3N5O A;  3EVI A;  2H71 A;  5HR0 A;  5JWR B;  1VF1 A;  11GS A;  3KH9 A;  3HDC A;  2H1D A;  2TIR A;  3DVX A;  2FA8 A;  4KSO A;  3FHK A;  5IO2 A;  2GS3 A;  3KIJ A;  7GSS A;  2VD1 A;  1S3D A;  4MZC A;  4JR4 A;  2CQ9 A;  2DJJ A;  2M46 A;  3EE2 A;  1OC3 A;  3J7Y k;  1TI3 A;  3CYN A;  3QAG A;  1ON4 A;  3EIN A;  3BBY A;  3IAM 2;  4JRR A;  1LBK A;  1TJD A;  2KHP A;  2E2M A;  2I4A A;  3BJ5 A;  3P90 A;  2R37 A;  2PPT A;  2LV3 A;  2HYX A;  2VCW A;  5EVO A;  1TOF A;  3DEX A;  1K0N A;  2X8H A;  1SD8 A;  2VM2 A;  2HRN A;  5IMV A;  4POK A;  3LYK A;  2AUV A;  2JZS A;  3KTB A;  1G7O A;  4KCA A;  2VCV A;  1M2D A;  2CX3 A;  1JHB A;  3MNG A;  4KUN A;  3TDG A;  1PN9 A;  14GS A;  1KTE A;  1SYX A;  3UAP A;  3W6G A;  3GH9 A;  5H5R A;  1PRX A;  1V98 A;  5ECS A;  1ZZY A;  4ZIL A;  1GSU A;  2FWH A;  5ECL B;  2QC7 A;  5JCW A;  2B7K A;  5IM9 A;  3TKS A;  3DWV A;  2HI7 A;  5J3R A;  4IW9 A;  1Z5Y E;  3TRP A;  5D9W A;  4ZXG A;  2DJK A;  4OCE A;  3LQ7 A;  1O8W A;  1GUH A;  1A8L A;  2IMF A;  1IYI A;  3LG6 A;  3GKX A;  4PUF C;  3HHV A;  4MP4 A;  2N5A A;  1TK5 B;  1YKC A;  2XPE A;  2X99 A;  1B9Y C;  2VUP A;  5HQP A;  3HVS A;  1M2A A;  4F0B A;  4I6X A;  1MD3 A;  3SBC A;  3GL3 A;  1GLP A;  3IHQ A;  3KMO A;  2HLS A;  1X9S B;  4TR0 A;  2GSR A;  2VAF A;  3O3T A;  1E2Y A;  1FVJ A;  5GAP D;  1TTZ A;  4F03 A;  4QL7 A;  2GTU A;  4YQM A;  2VL2 C;  4NPB A;  2NPB A;  3ERG A;  4JU5 A;  2F8F A;  5EY6 A;  5JWO B;  3H8Q A;  5INY A;  4OCF A;  1XXU A;  4HJM A;  2NTO A;  1K3L A;  1ERU A;  1ILO A;  2L57 A;  1FAA A;  1YF1 A;  3F4S A;  5B6M A;  1H4O A;  4NV5 A;  2MYG A;  1BJX A;  2J23 A;  4CW9 A;  3R2Q A;  1G7E A;  1G6Y A;  1ERW A;  4N30 A;  4N11 A;  3LOR A;  1MDI A;  2DIZ A;  3CTG A;  1SKS B;  3GKN A;  3M0F A;  1A0R P;  4PUR A;  1JLV A;  5DDL A;  5EL8 A;  2YWN A;  2WB9 A;  2FLS A;  4MF6 A;  3KH7 A;  5JCG A;  1F6M C;  1JZO A;  3D0Z A;  3CRU A;  3UBK A;  2IWT A;  2V1M A;  2C3N A;  2OAD A;  2KLX A;  3FKF A;  4ZL8 A;  4ECI A;  3V1W A;  22GS A;  2GZP A;  5J9C A;  4LLR A;  4IQA A;  4OWY A;  4JBB A;  1DE1 A;  4ZB8 A;  2M80 A;  2B1K A;  1J9B A;  4YQV A;  1W4V A;  3VWX A;  4E8E A;  3G7I A;  2VL3 A;  2YWM A;  2H1A A;  3Q74 A;  3C71 A;  2IL3 A;  4DSS A;  5LCZ A;  1U87 A;  1M99 A;  5FWG A;  4DSS B;  1U6T A;  4BWQ A;  2H6Z A;  2LQQ A;  3WT1 A;  4IS0 A;  5AGY A;  1DSB A;  4G2E A;  1GTB A;  1B4Q A;  3L9S A;  5DAL A;  1GTA A;  5DAL B;  1UVZ A;  2VCZ A;  2RUE A;  1MTC A;  1URM A;  2HZE A;  4Q5F A;  2YV9 A;  2IMD A;  2IN3 A;  2HZE B;  3F6D A;  2C3T A;  3M9K A;  4RQX A;  1JZD A;  4MA9 A;  3TKS E;  2A2R A;  1OAZ A;  4I5Q A;  2DBC A;  3QDN A;  1CQH A;  3GKM A;  2C0D A;  5E59 A;  1EZK A;  3HJO A;  2BMX A;  3PGT A;  3CTF A;  2L4C A;  4CDO A;  1TRS A;  3FR6 A;  4ZL9 A;  3F63 A;  4J56 E;  1M7T A;  1Z9H A;  1PD2 1;  3U6V A;  4KDU A;  4TR1 A;  4OO4 A;  3G7Y A;  2ES7 A;  1FB6 A;  4TR1 B;  2YOI A;  2VLU A;  4ZBD A;  1R4W A;  2IFQ A;  5A5K A;  5E4W A;  3IC4 A;  5G1K A;  2IFQ B;  4PUA A;  2GT6 A;  6GST A;  3RPP A;  5KN0 A;  4EUY A;  3FW2 A;  4K6X A;  2E0Q A;  1T00 A;  1SK0 A;  2B5Y A;  1PX6 A;  5A4W A;  5IIZ A;  3VWW A;  1TI1 A;  1WMJ A;  4GQC A;  3GNJ A;  4XIH A;  2NVL A;  3ZVJ A;  4BWS A;  3DYR A;  3KP9 A;  3VI5 A;  4K8M A;  8GSS A;  2H73 A;  1SU9 A;  4TXV A;  2H1G A;  1T8E B;  2FA4 A;  3GH6 A;  5LNK e;  3UL3 A;  4FO5 A;  2IME A;  4Q5Q A;  4WEY A;  4K7N A;  2C8U A;  4XS1 A;  2LJR A;  3GKK A;  2H01 A;  1HYU A;  2TRX A;  2YV7 A;  4I97 A;  4ML1 A;  3Q19 A;  3DXB A;  3TCO A;  3KXO A;  1GUL A;  1F3A A;  1XFL A;  1J0F A;  4BA7 A;  4BPY A;  5DJL A;  3MSZ A;  4HU7 A;  3F3R A;  2CV4 A;  4K9Z A;  3L0H A;  2D2Z A;  5ECM B;  1B8X A;  3ZIV A;  3ZVJ D;  1PGT A;  3EU3 A;  4MH2 A;  5GST A;  1OKT A;  5COH A;  1LU4 A;  2LRC A;  3EWL A;  4HZ2 A;  4GRF A;  2LTK A;  1DE2 A;  4EF0 A;  3TOT A;  1EEM A;  2MBS A;  4V2L A;  2CZ2 A;  3WGD A;  3HCZ A;  4KH7 A;  5CP1 A;  3GHA A;  2XC2 A;  5C00 A;  2H0I A;  3BCK A;  3KZQ A;  3D22 A;  3SWL A;  4YAP A;  1SJ6 A;  1SK2 A;  1TP9 A;  4CHS A;  2DJ1 A;  3TJK A;  5J41 A;  2GST A;  5GZZ B;  2YCD A;  3UJ1 A;  2FGX A;  1XWG A;  4PXO A;  1SL0 B;  1DUG A;  1O8X A;  1SJI A;  5F05 A;  1F2E A;  2YP6 A;  5ECQ B;  4KDY A;  3ZRE A;  3HZ4 A;  4K0N A;  1HQO A;  1RK4 A;  4XRD A;  4HJ2 A;  2C0G A;  3D21 A;  2H0G A;  1U88 A;  2OE3 A;  5FT3 A;  3UAR A;  4EC0 A;  3APQ A;  3IV4 A;  4DSR A;  4WR5 A;  4TOP A;  3KP8 A;  3F6F A;  2FHE A;  5AIV A;  5GSS A;  4HQS A;  1Y6E A;  4TRX A;  3IE3 A;  2JAC A;  4O32 A;  3ZYW A;  1OYJ A;  3M3M A;  3IR4 A;  4IBP A;  1A2M A;  1XWC A;  1KNG A;  2REM A;  1OC8 A;  4XS6 A;  1OE7 A;  2QSI A;  4IP6 A;  2VLT A;  4GXZ A;  4NHZ A;  4LA1 A;  4IHU A;  4EE0 A;  2MMO A;  2AYT A;  2LUS A;  5ID2 A;  1Z7P A;  4IQ1 A;  5ID2 B;  2FCH A;  3M9J A;  5IOX A;  4PQI A;  3ME7 A;  17GS A;  1N2A A;  2WGR A;  1A2J A;  4G10 A;  1Q98 A;  3BOA A;  4H86 A;  2LNT A;  4EVM A;  5KN3 A;  2PVQ A;  2BTO T;  1PA3 A;  3C1S A;  1PX7 A;  2GLR A;  1BYE A;  1XW5 A;  5DJM A;  4I8B A;  1NSW A;  2H6Y A;  4F2I A;  5G30 A;  5IOW A;  3HVV A;  1Y25 A;  4ML6 A;  1TKD B;  2FD3 A;  2K18 A;  1ZGN A;  3D5J A;  3ZFB A;  2OBK A;  3HXS A;  2GT5 A;  4N0V A;  1GUK A;  2ZNM A;  1PQN A;  2L6C A;  2PER A;  3FEU A;  3C7M A;  1K3Y A;  4JZQ A;  1BAY A;  2QKE A;  4WF5 A;  4AJ6 A;  2HE3 A;  5D9T A;  4FIW A;  2AHE A;  2L4Q A;  2IJY A;  3TUE A;  4FYB A;  3GSS A;  1NW2 A;  1WP0 A;  5CRW A;  4BVY A;  1JZW A;  4PNF A;  1SL2 B;  4IP1 A;  1Z3E A;  2V32 A;  5F07 A;  3Q18 A;  1T4Y A;  3DML A;  2PUK C;  2R3X A;  3I69 A;  3EC3 A;  1V40 A;  2GSQ A;  4ZBA A;  3QD9 A;  4DEJ A;  2HSY A;  3QAW A;  2PN8 A;  2P31 A;  2C0E A;  2EC4 A;  3WYW A;  1GSE A;  2F9S A;  3QAV A;  3A5W A;  4KSM A;  2LJA A;  2V6K A;  4LMV A;  1TRV A;  1UA5 A;  1GLQ A;  1YEX A;  3QR6 A;  1ABA A;  4O92 A;  3FR9 A;  3C73 A;  2LRN A;  2GQL A;  5D9X A;  1TK0 B;  5HFK A;  1B4P A;  1O81 A;  3IBH A;  3GX0 A;  4TXO A;  4D73 A;  1X5D A;  3TJB A;  2E2G A;  2MBT A;  5L71 A;  3FZ4 A;  2CA8 A;  2IPA A;  4TXO B;  2H0H A;  4HDE A;  4D73 B;  2CVK A;  1R26 A;  5DQY A;  3VUR A;  2AAW A;  4MK3 A;  1QFN A;  2GQM A;  4MH3 A;  3ISO A;  2EIR A;  2OKA A;  4X43 A;  3J7Y b;  3IDV A;  2YAN A;  2YZH A;  3KCM A;  2C3Q A;  4MPF A;  3WT2 A;  2I1U A;  4HOJ A;  1U3A A;  2J9H A;  2JSY A;  4POM A;  4MF7 A;  3QFB C;  3TKS C;  5D9V A;  2DJ2 A;  2H1B A;  2EIQ A;  4WKW A;  3UEM A;  3FZ9 A;  3AY8 A;  3TOU A;  1YJ6 A;  2VLV A;  3O76 A;  5IPG A;  2B7J A;  3GX8 A;  1YF0 A;  10GS A;  2O8V B;  3I43 A;  2HZF A;  1X5C A;  3EYT A;  3I6A A;  4TW5 A;  4IVF A;  2WJU A;  3HZ8 A;  3FY7 A;  4NWY A;  19GS A;  1TRU A;  2L5O A;  2B6M A;  1Z7R A;  1YDK A;  5IMF A;  4V1A g;  3W8S A;  5D96 A;  4MJC A;  2C0F A;  5ELG A;  4NV2 A;  3A3T A;  1BQ7 A;  2HT9 A;  4MMM A;  1XVW A;  4IKH A;  1PL2 A;  2VCX A;  4GSN A;  2MMN A;  3ZTL A;  3HD5 A;  4L5L A;  2O7K A;  6GSW A;  5B8B A;  4MF5 A;  1EOG A;  13GS A;  5HR3 A;  3DKS A;  2YWO A;  3FZ5 A;  1GP1 A;  2CAQ A;  3GMF A;  2XBQ A;  5KN1 A;  4HS1 A;  2PVO C;  1K0C A;  5ECH B;  3L9U A;  3G9B A;  1QQ2 A;  4MPG A;  1FW1 A;  1DBY A;  4AF2 A;  3TRQ A;  1T3B A;  1HNA A;  2GVP A;  3L4N A;  1GUM A;  2LEG A;  3Q6O A;  2FUG 2;  4G19 A;  1PMT A;  4TR3 A;  5J4U A;  3GST A;  2GDR A;  2ZUP A;  1GSF A;  1CQG A;  1X9M B;  1XPV A;  5ECP B;  1AQV A;  5DAK A;  2OE1 A;  2XBI A;  1GRX A;  1GNE A;  1M9B A;  1K0O A;  5DAK B;  3VPQ A;  2XPD A;  4PQH A;  2CT6 A;  3DVW A;  2RM6 A;  5JCU A;  3LEF A;  4HUA A;  4ULX A;  3KGK A;  1AUC A;  1SKR B;  3DIE A;  2K9F A;  1MEK A;  4KE3 A;  3NZN A;  2H74 A;  4L5O A;  3GV1 A;  5ECR B;  4L8E A;  5LD0 A;  1G0T A;  1XWK A;  1F3B A;  1XWA A;  6GSV A;  1BED A;  3NIV A;  4IGJ A;  2LJK A;  4GQF A;  1U3I A;  1FG4 A;  3QOU A;  1F37 A;  4EKZ A;  2CX4 A;  2EIO A;  1S3C A;  1SL1 B;  5ECO B;  1Z6M A;  2JU5 A;  3NOF A;  1H75 A;  1TXX A;  1NM3 A;  4G9H A;  3IK9 A;  4KA0 A;  4OO5 A;  4FH8 A;  1B9X C;  4MZW A;  4RI6 A;  2X64 A;  1AQX A;  3FRC A;  1B48 A;  4MCU A;  5DCH A;  4EL1 A;  5J5N A;  1EP7 A;  3VPT A;  1N8J A;  2DJ0 A;  2VIM A;  3FR3 A;  2GZZ A;  4TKY A;  5IO0 A;  3KJY A;  4MJA A;  3E9J B;  4WR4 A;  5IMC A;  1M0U A;  4NHW A;  4J57 E;  2G0F A;  9GSS A;  4WET A;  5D8I A;  3F0I A;  2HSH A;  2DLX A;  1QGV A;  2CVD A;  2OAC A;  4JR6 A;  1FB0 A;  1XBS A;  3QMX A;  1HNB A;  3PIN A;  2I3Y A;  4ECJ A;  2TRC P;  3RDW A;  3WGE A;  2DML A;  2LQO A;  4NXI A;  3ZZX A;  2H75 A;  3LFL A;  3GIX A;  4RQR A;  4Z7X A;  1T4Z A;  3TJG A;  1X0R A;  1Z6N A;  3F8U A;  1WIK A;  1VF2 A;  2VCT A;  2V6O A;  4ISD A;  4V2M A;  3UOM A;  3TB2 A;  2R6K A;  1GL8 A;  2GGT A;  4ECB A;  1AAZ A;  2HFD A;  1ERT A;  3IA1 A;  3QPM A;  3HVX A;  3RHC A;  3KEB A;  5AIS A;  4WBR D;  4L0W A;  4KAE A;  2OBI A;  5ENU A;  2HNL A;  5KN2 A;  2JZT A;  1V58 A;  1KBN A;  2L5L A;  1R5A A;  1XOB A;  2VO4 A;  2GSS A;  5D93 A;  5ECK B;  3IOS A;  4XS4 B;  3LXT A;  4N10 A;  4KGI A;  2FWE A;  1WOU A;  3UIW A;  1TK8 B;  2DJ3 A;  5CRD A;  4EDZ A;  1SK1 A;  1S3A A;  1ZYQ B;  2M72 A;  4MAB A;  2IMK A;  3CXG A;  4N0Z A;  1WRY A;  4POL A;  3C8E A;  3ME8 A;  4FYU A;  4KND A;  1EGO A;  4GTU A;  1EP8 A;  3A2V A;  5ECI B;  4AJ7 A;  3VFI A;  4Q5R A;  3PR8 A;  4ZL7 A;  2VL9 A;  3ZLP A;  4YH2 A;  4GWR A;  2NBS A;  3HJM A;  3RBT A;  1AXD A;  4J2F A;  3VI7 A;  1R7H A;  2R5G A;  5B7C A;  5KEJ A;  4WBJ A;  1ST9 A;  4RUV A;  3LWA A;  2KP2 A;  4QQ7 A;  1F9M A;  2VCQ A;  2YN1 A;  5C04 A;  4PNG A;  3KMN A;  2MZC A;  1OC9 A;  1A0F A;  1T1V A;  2I9H A;  3FK8 A;  5A4V A;  2QGV A;  1EOH A;  2AV4 A;  1OC9 B;  4WF4 A;  6GSY A;  2GZY A;  4GSS A;  1V9W A;  3FZA A;  1G6W A;  2IMI A;  3WD6 A;  3CSI A;  3ZIJ A;  3LYP A;  3ERF A;  4LL4 B;  1J08 A;  5J9B A;  4ZBB A;  3TKQ A;  1PSQ A;  3P7X A;  1YKA A;  4ACS A;  1MDK A;  3EU4 A;  3F4T A;  4EO3 A;  18GS A;  4K2D A;  1TU8 A;  4PQ1 A;  4ZB6 A;  5IPH A;  1THX A;  2H19 A;  3US3 A;  3GL5 A;  1TW9 A;  2FY6 A;  1EGR A;  4OFM A;  4ID0 A;  2K8S A;  5JWQ B;  2FWF A;  2E7P A;  1QXH A;  5CYY A;  2VD0 A;  4MZB A;  3ERW A;  3TJF A;  1VF3 A;  1K0D A;  3F9U A;  4XRA A;  4TVE A;  3VK9 A;  3U5R E;  2G2Q A;  2DC5 A;  2O85 A;  1WWJ A;  3L9V A;  4AGS A;  1QMV A;  1KEB A;  2ON5 A;  1UN2 A;  2ALB A;  4YAV A;  5HFI A;  1GSD A;  1JFU A;  1M2B A;  3GUR A;  4F0C A;  1EV4 A;  1O6J A;  2KUC A;  3M8N A;  2WRT A;  1XW6 A;  2VL2 A;  2DMM A;  4YQU A;  3DD3 A;  3RHB A;  1NHO A;  2YWI A;  1GH2 A;  2PBJ A;  3ZMK A;  2B3S A;  2WFC A;  1O7U A;  1XW9 A;  1EWX A;  5G31 A;  5ECN B;  1AIU A;  3W8J A;  3IAS 2;  1K3O A;  3UBL A;  2O89 A;  3KM6 A;  1TRW A;  2F8A A;  4KDX A;  4P3Y B;  5HR2 A;  2L59 A;  3GUS A;  5B6N A;  3MAK A;  5AN1 A;  3JCM L;  1A8Y A;  1GTU A;  3A2X A;  5DCG A;  1THO A;  2V2G A;  4POB A;  4KCE A;  3ZRD A;  3S9F A;  1ZMA A;  2A2S A;  2AB6 A;  5CAX A;  4MDC A;  1SJZ A;  2YJ7 A;  3GYK A;  2R4V A;  1GSS A;  1X5E A; 
#chains in the Genus database with same CATH topology
 3KTL A;  1TU7 A;  4F9Z A;  5BMU A;  4MJB A;  1YY7 A;  1YEP A;  2PU9 C;  3O6T A;  3CSH A;  2HXK A;  5D73 A;  2NDO A;  12GS A;  1QUW A;  3HKR A;  2B5E A;  4ZIJ A;  2H70 A;  5CNW A;  4K0G A;  5CRE A;  5DQS A;  1BG5 A;  4XTS A;  6GSX A;  2IIY A;  4HQZ A;  3HYP A;  2H6X A;  1IYH A;  4HZ4 A;  1K0A A;  5F8B A;  4EIQ A;  2DIY A;  5AIX A;  1RW1 A;  4I2T A;  5F0G A;  1PKZ A;  3K8N A;  1ML6 A;  4K7O A;  1BX9 A;  3N9J A;  4O5R A;  3HA9 A;  5G2Z A;  3OR5 A;  1MDJ A;  2LS5 A;  5FHI A;  3HY2 A;  1K0M A;  4KW6 A;  5G1L A;  4L0U A;  4K2X A;  1TDI A;  4ILF A;  2N5B A;  5A4U A;  4EDY A;  5F06 A;  2OE0 A;  3F3Q A;  3G7J A;  3TJJ A;  2JZR A;  3TKR A;  4NMU A;  4OFN A;  6GSS A;  3P2A A;  5EPF A;  1T7P B;  4HU9 A;  1Q4J A;  1SYR A;  1HD2 A;  2H72 A;  2VOC A;  2C4J A;  3GTU A;  4BVX A;  2YJH A;  4JE1 A;  3H4K A;  3GTU B;  4BVX B;  1YZX A;  2VM1 A;  3WGX A;  3VWV A;  3MWH A;  4KX4 A;  4GLT A;  5ELA A;  2YPM A;  1EEJ A;  1FO5 A;  3ZFL A;  3TRX A;  2V41 A;  2H8L A;  2F51 A;  3LJR A;  4IJ3 A;  4E8H A;  3GFK A;  2OJL A;  4FYC A;  3DGQ A;  4YKF A;  5CO3 A;  1I9D A;  2Z9S A;  4X0X A;  1WJK A;  4QL9 A;  2PMT A;  1V2A A;  2LRT A;  1LJR A;  2H66 A;  2OA7 A;  20GS A;  3QCP A;  1AC1 A;  3E3E A;  4TR4 A;  2RII A;  3UMA A;  3UVH A;  1USB A;  2BJX A;  1M9A A;  3BCI A;  5IQY A;  2JAD A;  4GCI A;  2P0G A;  3FYG A;  1EV9 A;  3H1N A;  2RM5 A;  4DSQ A;  1A24 A;  2WDU A;  3C1R A;  3RPN A;  2PGT A;  1UC7 A;  4ECC A;  1JZR A;  3EUR A;  2MMZ A;  1M3J A;  4IJI A;  1WE0 A;  4V1A p;  5ABR A;  1MD4 A;  4OMV A;  5B8A A;  4USS A;  4MJE A;  3VLN A;  2L6D A;  2FNO A;  2FWG A;  3CBU A;  3KD0 A;  3GN3 A;  3HJP A;  2B1L A;  3DRN A;  1K0B A;  3LGC A;  3TKP A;  2R2J A;  1ERV A;  3ZL5 A;  4LMW A;  1A23 A;  1GSQ A;  1QK8 A;  3IPZ A;  4BL7 A;  5H5Q A;  3CRT A;  1V57 A;  2CZ3 A;  2LST A;  5CRG A;  4BL7 B;  3IXR A;  2AJQ B;  4AJ8 A;  3IRA A;  3E0U A;  4O7H A;  3CMI A;  5DVB A;  1ACV A;  6GSU A;  1A2L A;  1XIY A;  3CSJ A;  4WXT A;  1SEN A;  2DSA A;  3L78 A;  2QA1 A;  2P5R A;  1OVN A;  2RLI A;  3RAZ A;  3EMP A;  1SD9 A;  4OD7 A;  3IHG A;  2A4V A;  4GST A;  3GRX A;  2K8V A;  1PKW A;  3D6I A;  5IMZ A;  3UVT A;  2N5F A;  2WZ9 A;  4PGT A;  4TN8 A;  1I5G A;  2JSZ A;  2X8G A;  2YNX A;  2KP1 A;  3ZML A;  4JED A;  2X4A A;  4MLY A;  1ZOF A;  4I2U A;  2WS2 A;  3EMX A;  1XCC A;  3M1G A;  2ZCT A;  3GA4 A;  1VRS D;  1GWC A;  1NHY A;  2CAI A;  3PH9 A;  1C72 A;  2X8C A;  4RI7 A;  4G0L A;  2RUF A;  3BD2 A;  3D4T A;  1AQW A;  3I9V 2;  2WCI A;  3LSZ A;  3IK7 A;  1PL1 A;  1VGL A;  1HNC A;  4XCS A;  2H30 A;  2JL4 A;  2K6V A;  4DVC A;  3H79 A;  3F4R A;  5G5F A;  4XS4 A;  1OKD A;  1GTI A;  4X1U A;  1ZYN A;  1ZCP A;  1R5P A;  5DBQ A;  4V2N A;  5GAN D;  1SKW B;  4XHM A;  1GNW A;  2MMA A;  2KOK A;  5CRH A;  3VWU A;  4EXJ A;  1WPI A;  1RQM A;  1AW9 A;  3H93 A;  1XWB A;  4KB3 A;  2O87 A;  4NAX A;  3QFA C;  4OFT A;  2LNS A;  4KF9 A;  5H5S A;  2I81 A;  3ED3 A;  1OE8 A;  5HFG A;  5IMD A;  16GS A;  4Q5N A;  1XZO A;  4CY8 A;  1O85 A;  4K7I A;  1FVK A;  3D4M A;  2H76 A;  1ZL9 A;  4F82 A;  4GF0 A;  1O73 A;  2CVB A;  3A2W A;  4IEL A;  5HR1 A;  1XVQ A;  4HEA 2;  3APS A;  1W89 A;  4ICY A;  2XHF A;  2HRF A;  2PWJ A;  5IMA A;  2ON7 A;  1XOA A;  1GSY A;  1E6B A;  4IN0 A;  4PX1 A;  2F3M A;  2HRK A;  3TGZ A;  3MDK A;  3ZIT A;  1FHE A;  1ZYE A;  2LKU A;  3APO A;  5G5E A;  1VF4 A;  1PN0 A;  2P5Q A;  2C1Y A;  2GQK A;  2YZU A;  1JLW A;  4K1F A;  3LXZ A;  1X9W B;  4LL1 B;  1YQ1 A;  4HI7 A;  4ZB9 A;  2WUL A;  1FOV A;  3P8W A;  2C80 A;  2B5X A;  3N5O A;  3EVI A;  2H71 A;  5HR0 A;  5JWR B;  1VF1 A;  11GS A;  3KH9 A;  3HDC A;  2H1D A;  2TIR A;  3DVX A;  2FA8 A;  4KSO A;  3FHK A;  5IO2 A;  2GS3 A;  3KIJ A;  7GSS A;  2VD1 A;  1S3D A;  4MZC A;  4JR4 A;  2CQ9 A;  2DJJ A;  2M46 A;  3EE2 A;  1OC3 A;  3J7Y k;  1TI3 A;  3CYN A;  3QAG A;  1ON4 A;  3EIN A;  3BBY A;  3IAM 2;  4JRR A;  1LBK A;  1TJD A;  2KHP A;  2HSM A;  3EPT A;  2E2M A;  2I4A A;  3BJ5 A;  3P90 A;  2R37 A;  2PPT A;  2LV3 A;  2HYX A;  2VCW A;  5EVO A;  3R3E A;  1TOF A;  3DEX A;  1K0N A;  2DKI A;  2X8H A;  1SD8 A;  2VM2 A;  2HRN A;  4K5S A;  5IMV A;  4POK A;  3LYK A;  2AUV A;  2JZS A;  3KTB A;  1G7O A;  4KCA A;  2VCV A;  1M2D A;  2CX3 A;  1JHB A;  3MNG A;  4KUN A;  3TDG A;  1PN9 A;  14GS A;  1KTE A;  1SYX A;  3UAP A;  3W6G A;  3GH9 A;  5H5R A;  1PRX A;  1V98 A;  5ECS A;  1ZZY A;  5KOX A;  4ZIL A;  1GSU A;  2FWH A;  5ECL B;  2QC7 A;  5JCW A;  2B7K A;  5IM9 A;  3TKS A;  3DWV A;  2HI7 A;  5J3R A;  4IW9 A;  1Z5Y E;  3TRP A;  5D9W A;  4ZXG A;  2DJK A;  4OCE A;  3LQ7 A;  1O8W A;  2X49 A;  1GUH A;  1A8L A;  2IMF A;  1IYI A;  3LG6 A;  3GKX A;  3FMW A;  3HHV A;  4PUF C;  4MP4 A;  2N5A A;  2R0G A;  1TK5 B;  1YKC A;  2XPE A;  2X99 A;  1B9Y C;  2VUP A;  5HQP A;  3HVS A;  1M2A A;  4F0B A;  4I6X A;  1MD3 A;  3SBC A;  3GL3 A;  1GLP A;  3IHQ A;  3KMO A;  2HLS A;  1X9S B;  4TR0 A;  2GSR A;  2VAF A;  3O3T A;  1E2Y A;  1FVJ A;  5GAP D;  1TTZ A;  4F03 A;  4QL7 A;  2GTU A;  3LW9 A;  4YQM A;  2VL2 C;  4NPB A;  5BRT A;  2NPB A;  3ERG A;  4JU5 A;  2F8F A;  5EY6 A;  5JWO B;  3H8Q A;  5INY A;  4OCF A;  1XXU A;  4HJM A;  2NTO A;  1K3L A;  1ERU A;  1ILO A;  2L57 A;  1FAA A;  1YF1 A;  3F4S A;  5B6M A;  1H4O A;  4NV5 A;  2MYG A;  1BJX A;  2J23 A;  4CW9 A;  3R2Q A;  1G7E A;  1G6Y A;  1ERW A;  4N30 A;  4N11 A;  3LOR A;  1MDI A;  2DIZ A;  3CTG A;  1SKS B;  3GKN A;  3M0F A;  1A0R P;  4PUR A;  1JLV A;  5DDL A;  5EL8 A;  2YWN A;  2WB9 A;  2FLS A;  4MF6 A;  3KH7 A;  5JCG A;  1F6M C;  1JZO A;  3D0Z A;  3CRU A;  3UBK A;  2IWT A;  2V1M A;  2C3N A;  2OAD A;  2KLX A;  3FKF A;  4ZL8 A;  4ECI A;  3V1W A;  22GS A;  2GZP A;  5J9C A;  4LLR A;  4IQA A;  4OWY A;  4JBB A;  1DE1 A;  4ZB8 A;  2M80 A;  2B1K A;  1J9B A;  4YQV A;  1W4V A;  3VWX A;  4E8E A;  3G7I A;  2VL3 A;  2YWM A;  2H1A A;  4FQU A;  3Q74 A;  3C71 A;  2IL3 A;  4DSS A;  5LCZ A;  1U87 A;  1M99 A;  5FWG A;  4DSS B;  1U6T A;  4BWQ A;  2H6Z A;  2LQQ A;  3WT1 A;  4IS0 A;  5AGY A;  1DSB A;  4G2E A;  1GTB A;  4O5U A;  1B4Q A;  3L9S A;  5DAL A;  1GTA A;  5DAL B;  1UVZ A;  2VCZ A;  2RUE A;  5KOW A;  1MTC A;  1URM A;  2HZE A;  4Q5F A;  2YV9 A;  2IMD A;  2IN3 A;  2HZE B;  3F6D A;  2C3T A;  3M9K A;  4RQX A;  1JZD A;  4MA9 A;  3TKS E;  2A2R A;  1OAZ A;  4I5Q A;  2DBC A;  3QDN A;  1CQH A;  3GKM A;  2C0D A;  5E59 A;  1EZK A;  3HJO A;  2BMX A;  3PGT A;  3CTF A;  2L4C A;  4CDO A;  1TRS A;  2HRA A;  3FR6 A;  4ZL9 A;  3F63 A;  4J56 E;  1M7T A;  1Z9H A;  1PD2 1;  3U6V A;  4KDU A;  4TR1 A;  4OO4 A;  3G7Y A;  2ES7 A;  1FB6 A;  4TR1 B;  2YOI A;  2VLU A;  4ZBD A;  1R4W A;  2IFQ A;  5A5K A;  5E4W A;  3IC4 A;  5G1K A;  2IFQ B;  4PUA A;  2GT6 A;  6GST A;  3RPP A;  5KN0 A;  4EUY A;  1XG8 A;  3FW2 A;  4K6X A;  2E0Q A;  1T00 A;  1SK0 A;  2B5Y A;  1PX6 A;  5A4W A;  5IIZ A;  3VWW A;  1TI1 A;  1WMJ A;  4GQC A;  3GNJ A;  4XIH A;  2NVL A;  3ZVJ A;  4BWS A;  3DYR A;  3KP9 A;  3VI5 A;  4K8M A;  8GSS A;  2H73 A;  1SU9 A;  4TXV A;  2H1G A;  1T8E B;  2FA4 A;  3GH6 A;  5LNK e;  3UL3 A;  4FO5 A;  2IME A;  4Q5Q A;  4WEY A;  4K7N A;  2C8U A;  3HVN A;  4XS1 A;  2LJR A;  3GKK A;  2H01 A;  1HYU A;  2TRX A;  2YV7 A;  4I97 A;  4ML1 A;  3Q19 A;  3DXB A;  3TCO A;  3KXO A;  1GUL A;  1F3A A;  1XFL A;  1J0F A;  4BA7 A;  4BPY A;  5DJL A;  3MSZ A;  4HU7 A;  3F3R A;  2CV4 A;  4K9Z A;  3L0H A;  2D2Z A;  5ECM B;  1B8X A;  3ZIV A;  3ZVJ D;  1PGT A;  3EU3 A;  4MH2 A;  5GST A;  1OKT A;  5COH A;  1LU4 A;  2LRC A;  3EWL A;  4HZ2 A;  4GRF A;  2LTK A;  1DE2 A;  4EF0 A;  3TOT A;  1EEM A;  2MBS A;  4V2L A;  2CZ2 A;  3WGD A;  3HCZ A;  4KH7 A;  5CP1 A;  3GHA A;  2XC2 A;  5C00 A;  2H0I A;  3BCK A;  3KZQ A;  3D22 A;  3SWL A;  4YAP A;  1SJ6 A;  1SK2 A;  1TP9 A;  4CHS A;  2DJ1 A;  4K5R A;  3TJK A;  5J41 A;  2GST A;  5GZZ B;  2YCD A;  3UJ1 A;  2FGX A;  1XWG A;  4PXO A;  1SL0 B;  3A5I A;  1DUG A;  1O8X A;  1SJI A;  5F05 A;  1F2E A;  2YP6 A;  5ECQ B;  4KDY A;  3ZRE A;  3HZ4 A;  4K0N A;  1S3R A;  1HQO A;  1RK4 A;  4XRD A;  4HJ2 A;  2C0G A;  3D21 A;  2H0G A;  1U88 A;  2OE3 A;  5FT3 A;  3UAR A;  4EC0 A;  3APQ A;  3IV4 A;  4DSR A;  4WR5 A;  4TOP A;  3KP8 A;  3F6F A;  2FHE A;  5AIV A;  5GSS A;  4HQS A;  1Y6E A;  4TRX A;  3IE3 A;  2JAC A;  4O32 A;  3ZYW A;  1OYJ A;  3M3M A;  3IR4 A;  4IBP A;  1A2M A;  1XWC A;  1KNG A;  1FOH A;  2REM A;  1OC8 A;  4XS6 A;  1OE7 A;  2QSI A;  4IP6 A;  2VLT A;  4GXZ A;  4NHZ A;  4LA1 A;  4IHU A;  4EE0 A;  2MMO A;  2AYT A;  2LUS A;  5ID2 A;  1Z7P A;  4IQ1 A;  5ID2 B;  2FCH A;  3M9J A;  5IOX A;  4PQI A;  3ME7 A;  17GS A;  1N2A A;  2WGR A;  1A2J A;  4G10 A;  1Q98 A;  3BOA A;  4H86 A;  2LNT A;  4EVM A;  5KN3 A;  2PVQ A;  2BTO T;  1PA3 A;  3C1S A;  1PX7 A;  2GLR A;  1BYE A;  1XW5 A;  5DJM A;  3IC8 A;  4I8B A;  1NSW A;  2H6Y A;  4F2I A;  5G30 A;  5IOW A;  3HVV A;  1Y25 A;  4ML6 A;  1TKD B;  2FD3 A;  2K18 A;  1ZGN A;  3D5J A;  3ZFB A;  2OBK A;  3HXS A;  4X4J A;  2GT5 A;  4N0V A;  1GUK A;  2ZNM A;  1PQN A;  2L6C A;  2PER A;  3FEU A;  3C7M A;  1K3Y A;  4JZQ A;  1BAY A;  2QKE A;  4WF5 A;  4AJ6 A;  2HE3 A;  5D9T A;  4FIW A;  2AHE A;  2L4Q A;  2IJY A;  3TUE A;  4FYB A;  3GSS A;  4Z2U A;  1NW2 A;  1WP0 A;  5CRW A;  4BVY A;  1JZW A;  2DKH A;  4BVY B;  4PNF A;  1SL2 B;  4IP1 A;  1Z3E A;  2V32 A;  5F07 A;  3Q18 A;  4Z2R A;  1T4Y A;  3DML A;  2PUK C;  2R3X A;  3I69 A;  3EC3 A;  1V40 A;  2GSQ A;  4MNN A;  4ZBA A;  3QD9 A;  4DEJ A;  2HSY A;  3QAW A;  2PN8 A;  2P31 A;  2C0E A;  2EC4 A;  3WYW A;  1GSE A;  2F9S A;  3QAV A;  1M3I A;  3A5W A;  4KSM A;  2LJA A;  2V6K A;  4LMV A;  1TRV A;  1UA5 A;  1GLQ A;  1YEX A;  3QR6 A;  1ABA A;  4O92 A;  3FR9 A;  3C73 A;  2LRN A;  2GQL A;  5D9X A;  1TK0 B;  5HFK A;  1B4P A;  1O81 A;  3IBH A;  3GX0 A;  4TXO A;  4D73 A;  1X5D A;  3TJB A;  2E2G A;  2MBT A;  5L71 A;  3FZ4 A;  2CA8 A;  2IPA A;  4TXO B;  2H0H A;  4HDE A;  4D73 B;  2CVK A;  1R26 A;  5DQY A;  3VUR A;  2AAW A;  4MK3 A;  1QFN A;  2GQM A;  4MH3 A;  3ISO A;  2EIR A;  2OKA A;  4X43 A;  3J7Y b;  3IDV A;  2YAN A;  2YZH A;  3KCM A;  2C3Q A;  4MPF A;  3WT2 A;  2I1U A;  4HOJ A;  1U3A A;  2J9H A;  2JSY A;  4POM A;  4MF7 A;  3QFB C;  3TKS C;  5D9V A;  2DJ2 A;  2H1B A;  2EIQ A;  4WKW A;  3UEM A;  3FZ9 A;  3AY8 A;  3TOU A;  1YJ6 A;  2VLV A;  3O76 A;  5IPG A;  2B7J A;  3GX8 A;  1YF0 A;  10GS A;  2O8V B;  3I43 A;  2HZF A;  1X5C A;  3EYT A;  3I6A A;  4TW5 A;  4IVF A;  2WJU A;  3HZ8 A;  3FY7 A;  4NWY A;  19GS A;  1TRU A;  2L5O A;  2B6M A;  4CY6 A;  1Z7R A;  1YDK A;  5IMF A;  4V1A g;  3W8S A;  5D96 A;  4MJC A;  3MIX A;  2C0F A;  5ELG A;  4G0I A;  4NV2 A;  3A3T A;  1BQ7 A;  2HT9 A;  4MMM A;  1XVW A;  4IKH A;  1PL2 A;  2VCX A;  4GSN A;  2MMN A;  3ZTL A;  3HD5 A;  4L5L A;  2O7K A;  6GSW A;  5B8B A;  4EIP A;  4MF5 A;  1EOG A;  13GS A;  5HR3 A;  3DKS A;  2YWO A;  3FZ5 A;  1GP1 A;  2CAQ A;  3GMF A;  2XBQ A;  5KN1 A;  4HS1 A;  2PVO C;  1K0C A;  5ECH B;  3L9U A;  3G9B A;  1QQ2 A;  4MPG A;  1FW1 A;  1DBY A;  4AF2 A;  3TRQ A;  1T3B A;  1HNA A;  2GVP A;  3L4N A;  1GUM A;  2LEG A;  3Q6O A;  2FUG 2;  4G19 A;  1PMT A;  4TR3 A;  5J4U A;  3GST A;  2GDR A;  2ZUP A;  1GSF A;  1CQG A;  1X9M B;  1XPV A;  5ECP B;  1AQV A;  5DAK A;  2OE1 A;  2XBI A;  1GRX A;  1GNE A;  1M9B A;  1K0O A;  5DAK B;  3VPQ A;  4Z2T A;  2XPD A;  4PQH A;  2CT6 A;  3DVW A;  2RM6 A;  5JCU A;  3LEF A;  4HUA A;  4ULX A;  3KGK A;  1AUC A;  1SKR B;  3DIE A;  2K9F A;  1MEK A;  4KE3 A;  3NZN A;  2H74 A;  4L5O A;  3GV1 A;  5ECR B;  4L8E A;  5LD0 A;  1G0T A;  1XWK A;  1F3B A;  1XWA A;  6GSV A;  1BED A;  3NIV A;  4IGJ A;  2LJK A;  4GQF A;  1U3I A;  3MYD A;  1FG4 A;  3QOU A;  1F37 A;  4EKZ A;  2CX4 A;  2EIO A;  1S3C A;  1SL1 B;  5ECO B;  1Z6M A;  2JU5 A;  3NOF A;  1H75 A;  1TXX A;  1NM3 A;  4G9H A;  3IK9 A;  4KA0 A;  4OO5 A;  4FH8 A;  1B9X C;  4MZW A;  4RI6 A;  2X64 A;  1AQX A;  3FRC A;  1B48 A;  4MCU A;  5DCH A;  4EL1 A;  5J5N A;  1EP7 A;  3VPT A;  1N8J A;  2DJ0 A;  2VIM A;  3FR3 A;  2GZZ A;  4O5Q A;  4TKY A;  5IO0 A;  3KJY A;  4MJA A;  3E9J B;  4WR4 A;  5IMC A;  1M0U A;  4NHW A;  4J57 E;  2G0F A;  9GSS A;  4WET A;  5D8I A;  3F0I A;  4A5P A;  2HSH A;  2DLX A;  1QGV A;  2CVD A;  2OAC A;  4JR6 A;  1FB0 A;  1XBS A;  3QMX A;  1HNB A;  3PIN A;  2A2P A;  2I3Y A;  4ECJ A;  2TRC P;  2R0P A;  3RDW A;  3WGE A;  2DML A;  2LQO A;  4NXI A;  3ZZX A;  2H75 A;  3LFL A;  3GIX A;  4RQR A;  4Z7X A;  1T4Z A;  3TJG A;  1X0R A;  4BIK A;  1Z6N A;  3F8U A;  1WIK A;  1VF2 A;  2VCT A;  2V6O A;  4ISD A;  4V2M A;  3UOM A;  3TB2 A;  2QA2 A;  2R6K A;  1GL8 A;  2GGT A;  4ECB A;  1AAZ A;  2HFD A;  1ERT A;  3IA1 A;  3QPM A;  3HVX A;  3RHC A;  3KEB A;  5AIS A;  4WBR D;  4L0W A;  4KAE A;  2OBI A;  5ENU A;  2HNL A;  5KN2 A;  2JZT A;  1V58 A;  1KBN A;  2L5L A;  1R5A A;  1XOB A;  2VO4 A;  2GSS A;  5D93 A;  3IOS A;  5ECK B;  4XS4 B;  3LXT A;  4N10 A;  4KGI A;  2FWE A;  1WOU A;  3UIW A;  1TK8 B;  2DJ3 A;  5CRD A;  4EDZ A;  1SK1 A;  1S3A A;  1ZYQ B;  2M72 A;  4MAB A;  2IMK A;  3CXG A;  4N0Z A;  4HSC X;  1WRY A;  4POL A;  2R0C A;  3C8E A;  3ME8 A;  4FYU A;  4KND A;  1EGO A;  4GTU A;  1EP8 A;  3A2V A;  5ECI B;  4AJ7 A;  3VFI A;  4Q5R A;  3PR8 A;  4ZL7 A;  2VL9 A;  3ZLP A;  4YH2 A;  4GWR A;  2NBS A;  3HJM A;  3RBT A;  1AXD A;  4J2F A;  3VI7 A;  1R7H A;  2R5G A;  2UZ8 A;  5B7C A;  5KEJ A;  4WBJ A;  1ST9 A;  4RUV A;  3LWA A;  2KP2 A;  4QQ7 A;  1F9M A;  2VCQ A;  2YN1 A;  5C04 A;  4PNG A;  3KMN A;  2MZC A;  1OC9 A;  1A0F A;  1T1V A;  2I9H A;  3FK8 A;  5A4V A;  2QGV A;  1EOH A;  2AV4 A;  1OC9 B;  4WF4 A;  6GSY A;  2GZY A;  4GSS A;  1V9W A;  3FZA A;  1G6W A;  2IMI A;  3WD6 A;  3CSI A;  3ZIJ A;  3LYP A;  3ERF A;  4LL4 B;  1J08 A;  5J9B A;  4ZBB A;  3TKQ A;  1PSQ A;  3P7X A;  1YKA A;  4ACS A;  1MDK A;  3EU4 A;  4G0K A;  4YKG A;  3F4T A;  3CQF A;  4EO3 A;  18GS A;  4K2D A;  1TU8 A;  4PQ1 A;  4ZB6 A;  5IPH A;  1THX A;  2H19 A;  1ZYP A;  3US3 A;  3GL5 A;  1TW9 A;  2FY6 A;  1EGR A;  4OFM A;  4ID0 A;  2K8S A;  5JWQ B;  2FWF A;  2E7P A;  1QXH A;  5CYY A;  2VD0 A;  4MZB A;  3ERW A;  3TJF A;  1VF3 A;  1K0D A;  4PTS A;  3F9U A;  4XRA A;  4TVE A;  3VK9 A;  3U5R E;  2G2Q A;  2DC5 A;  2O85 A;  1WWJ A;  3L9V A;  4AGS A;  1QMV A;  1KEB A;  2ON5 A;  1UN2 A;  2ALB A;  4YAV A;  5HFI A;  1GSD A;  1JFU A;  1M2B A;  3GUR A;  4F0C A;  1EV4 A;  1O6J A;  3PPU A;  2KUC A;  3M8N A;  2WRT A;  1XW6 A;  2VL2 A;  2DMM A;  4YQU A;  3DD3 A;  3RHB A;  1NHO A;  2YWI A;  1GH2 A;  2PBJ A;  3ZMK A;  2B3S A;  2WFC A;  1O7U A;  1XW9 A;  1EWX A;  5G31 A;  5ECN B;  1AIU A;  3W8J A;  3IAS 2;  1K3O A;  3UBL A;  2O89 A;  3KM6 A;  1TRW A;  4KDX A;  2F8A A;  4P3Y B;  2A4H A;  5HR2 A;  1PFO A;  2L59 A;  3GUS A;  5B6N A;  3MAK A;  5AN1 A;  3JCM L;  1A8Y A;  1GTU A;  3A2X A;  5DCG A;  1THO A;  2V2G A;  4POB A;  4KCE A;  3ZRD A;  3S9F A;  1ZMA A;  2A2S A;  2AB6 A;  5CAX A;  4MDC A;  1SJZ A;  2YJ7 A;  3GYK A;  2R4V A;  1GSS A;  1X5E A; 
#chains in the Genus database with same CATH homology
 3KTL A;  1TU7 A;  4F9Z A;  5BMU A;  4MJB A;  1YY7 A;  1YEP A;  2PU9 C;  3O6T A;  3CSH A;  2HXK A;  5D73 A;  2NDO A;  12GS A;  1QUW A;  3HKR A;  2B5E A;  4ZIJ A;  2H70 A;  5CNW A;  4K0G A;  5CRE A;  5DQS A;  1BG5 A;  4XTS A;  6GSX A;  2IIY A;  4HQZ A;  3HYP A;  2H6X A;  1IYH A;  4HZ4 A;  1K0A A;  5F8B A;  4EIQ A;  2DIY A;  5AIX A;  1RW1 A;  4I2T A;  5F0G A;  1PKZ A;  3K8N A;  1ML6 A;  4K7O A;  1BX9 A;  3N9J A;  4O5R A;  3HA9 A;  5G2Z A;  3OR5 A;  1MDJ A;  2LS5 A;  5FHI A;  3HY2 A;  1K0M A;  4KW6 A;  5G1L A;  4L0U A;  4K2X A;  1TDI A;  4ILF A;  2N5B A;  5A4U A;  4EDY A;  5F06 A;  2OE0 A;  3F3Q A;  3G7J A;  3TJJ A;  2JZR A;  3TKR A;  4NMU A;  4OFN A;  6GSS A;  3P2A A;  5EPF A;  1T7P B;  4HU9 A;  1Q4J A;  1SYR A;  1HD2 A;  2H72 A;  2VOC A;  2C4J A;  3GTU A;  4BVX A;  2YJH A;  4JE1 A;  3H4K A;  3GTU B;  4BVX B;  1YZX A;  2VM1 A;  3WGX A;  3VWV A;  3MWH A;  4KX4 A;  4GLT A;  5ELA A;  2YPM A;  1EEJ A;  1FO5 A;  3ZFL A;  3TRX A;  2V41 A;  2H8L A;  2F51 A;  3LJR A;  4IJ3 A;  4E8H A;  3GFK A;  2OJL A;  4FYC A;  3DGQ A;  4YKF A;  5CO3 A;  1I9D A;  2Z9S A;  4X0X A;  1WJK A;  4QL9 A;  2PMT A;  1V2A A;  2LRT A;  1LJR A;  2H66 A;  2OA7 A;  20GS A;  3QCP A;  1AC1 A;  3E3E A;  4TR4 A;  2RII A;  3UMA A;  3UVH A;  1USB A;  2BJX A;  1M9A A;  3BCI A;  5IQY A;  2JAD A;  4GCI A;  2P0G A;  3FYG A;  1EV9 A;  3H1N A;  2RM5 A;  4DSQ A;  1A24 A;  2WDU A;  3C1R A;  3RPN A;  2PGT A;  1UC7 A;  4ECC A;  1JZR A;  3EUR A;  2MMZ A;  4IJI A;  1WE0 A;  4V1A p;  5ABR A;  1MD4 A;  4OMV A;  5B8A A;  4USS A;  4MJE A;  3VLN A;  2L6D A;  2FNO A;  2FWG A;  3CBU A;  3KD0 A;  3GN3 A;  3HJP A;  2B1L A;  3DRN A;  1K0B A;  3LGC A;  3TKP A;  2R2J A;  1ERV A;  3ZL5 A;  4LMW A;  1A23 A;  1GSQ A;  1QK8 A;  3IPZ A;  4BL7 A;  5H5Q A;  3CRT A;  1V57 A;  2CZ3 A;  2LST A;  5CRG A;  4BL7 B;  3IXR A;  2AJQ B;  4AJ8 A;  3IRA A;  3E0U A;  4O7H A;  3CMI A;  5DVB A;  1ACV A;  6GSU A;  1A2L A;  1XIY A;  3CSJ A;  4WXT A;  1SEN A;  2DSA A;  3L78 A;  2QA1 A;  2P5R A;  1OVN A;  2RLI A;  3RAZ A;  3EMP A;  1SD9 A;  4OD7 A;  3IHG A;  2A4V A;  4GST A;  3GRX A;  2K8V A;  1PKW A;  3D6I A;  5IMZ A;  3UVT A;  2N5F A;  2WZ9 A;  4PGT A;  4TN8 A;  1I5G A;  2JSZ A;  2X8G A;  2YNX A;  2KP1 A;  3ZML A;  4JED A;  2X4A A;  4MLY A;  1ZOF A;  4I2U A;  2WS2 A;  3EMX A;  1XCC A;  3M1G A;  2ZCT A;  3GA4 A;  1VRS D;  1GWC A;  1NHY A;  2CAI A;  3PH9 A;  1C72 A;  2X8C A;  4RI7 A;  4G0L A;  2RUF A;  3BD2 A;  3D4T A;  1AQW A;  3I9V 2;  2WCI A;  3LSZ A;  3IK7 A;  1PL1 A;  1VGL A;  1HNC A;  4XCS A;  2H30 A;  2JL4 A;  2K6V A;  4DVC A;  3H79 A;  3F4R A;  5G5F A;  4XS4 A;  1OKD A;  1GTI A;  4X1U A;  1ZYN A;  1ZCP A;  1R5P A;  5DBQ A;  4V2N A;  5GAN D;  1SKW B;  4XHM A;  1GNW A;  2MMA A;  2KOK A;  5CRH A;  3VWU A;  4EXJ A;  1WPI A;  1RQM A;  1AW9 A;  3H93 A;  1XWB A;  4KB3 A;  2O87 A;  4NAX A;  3QFA C;  4OFT A;  2LNS A;  4KF9 A;  5H5S A;  2I81 A;  3ED3 A;  1OE8 A;  5HFG A;  5IMD A;  16GS A;  4Q5N A;  1XZO A;  4CY8 A;  1O85 A;  4K7I A;  1FVK A;  3D4M A;  2H76 A;  1ZL9 A;  4F82 A;  4GF0 A;  1O73 A;  2CVB A;  3A2W A;  4IEL A;  5HR1 A;  1XVQ A;  4HEA 2;  3APS A;  1W89 A;  4ICY A;  2XHF A;  2HRF A;  2PWJ A;  5IMA A;  2ON7 A;  1XOA A;  1GSY A;  1E6B A;  4IN0 A;  4PX1 A;  2F3M A;  2HRK A;  3TGZ A;  3MDK A;  3ZIT A;  1FHE A;  1ZYE A;  2LKU A;  3APO A;  5G5E A;  1VF4 A;  1PN0 A;  2P5Q A;  2C1Y A;  2GQK A;  2YZU A;  1JLW A;  4K1F A;  3LXZ A;  1X9W B;  4LL1 B;  1YQ1 A;  4HI7 A;  4ZB9 A;  2WUL A;  1FOV A;  3P8W A;  2C80 A;  2B5X A;  3N5O A;  3EVI A;  2H71 A;  5HR0 A;  5JWR B;  1VF1 A;  11GS A;  3KH9 A;  3HDC A;  2H1D A;  2TIR A;  3DVX A;  2FA8 A;  4KSO A;  3FHK A;  5IO2 A;  2GS3 A;  3KIJ A;  7GSS A;  2VD1 A;  1S3D A;  4MZC A;  4JR4 A;  2CQ9 A;  2DJJ A;  2M46 A;  3EE2 A;  1OC3 A;  3J7Y k;  1TI3 A;  3CYN A;  3QAG A;  1ON4 A;  3EIN A;  3BBY A;  3IAM 2;  4JRR A;  1LBK A;  1TJD A;  2KHP A;  2HSM A;  3EPT A;  2E2M A;  2I4A A;  3BJ5 A;  3P90 A;  2R37 A;  2PPT A;  2LV3 A;  2HYX A;  2VCW A;  5EVO A;  3R3E A;  1TOF A;  3DEX A;  1K0N A;  2DKI A;  2X8H A;  1SD8 A;  2VM2 A;  2HRN A;  4K5S A;  5IMV A;  4POK A;  3LYK A;  2AUV A;  2JZS A;  3KTB A;  1G7O A;  4KCA A;  2VCV A;  1M2D A;  2CX3 A;  1JHB A;  3MNG A;  4KUN A;  3TDG A;  1PN9 A;  14GS A;  1KTE A;  1SYX A;  3UAP A;  3W6G A;  3GH9 A;  5H5R A;  1PRX A;  1V98 A;  5ECS A;  1ZZY A;  5KOX A;  4ZIL A;  1GSU A;  2FWH A;  5ECL B;  2QC7 A;  5JCW A;  2B7K A;  5IM9 A;  3TKS A;  3DWV A;  2HI7 A;  5J3R A;  4IW9 A;  1Z5Y E;  3TRP A;  5D9W A;  4ZXG A;  2DJK A;  4OCE A;  3LQ7 A;  1O8W A;  2X49 A;  1GUH A;  1A8L A;  2IMF A;  1IYI A;  3LG6 A;  3GKX A;  3FMW A;  3HHV A;  4PUF C;  4MP4 A;  2N5A A;  2R0G A;  1TK5 B;  1YKC A;  2XPE A;  2X99 A;  1B9Y C;  2VUP A;  5HQP A;  3HVS A;  1M2A A;  4F0B A;  4I6X A;  1MD3 A;  3SBC A;  3GL3 A;  1GLP A;  3IHQ A;  3KMO A;  2HLS A;  1X9S B;  4TR0 A;  2GSR A;  2VAF A;  3O3T A;  1E2Y A;  1FVJ A;  5GAP D;  1TTZ A;  4F03 A;  4QL7 A;  2GTU A;  3LW9 A;  4YQM A;  2VL2 C;  4NPB A;  5BRT A;  2NPB A;  3ERG A;  4JU5 A;  2F8F A;  5EY6 A;  5JWO B;  3H8Q A;  5INY A;  4OCF A;  1XXU A;  4HJM A;  2NTO A;  1K3L A;  1ERU A;  1ILO A;  2L57 A;  1FAA A;  1YF1 A;  3F4S A;  5B6M A;  1H4O A;  4NV5 A;  2MYG A;  1BJX A;  2J23 A;  4CW9 A;  3R2Q A;  1G7E A;  1G6Y A;  1ERW A;  4N30 A;  4N11 A;  3LOR A;  1MDI A;  2DIZ A;  3CTG A;  1SKS B;  3GKN A;  3M0F A;  1A0R P;  4PUR A;  1JLV A;  5DDL A;  5EL8 A;  2YWN A;  2WB9 A;  2FLS A;  4MF6 A;  3KH7 A;  5JCG A;  1F6M C;  1JZO A;  3D0Z A;  3CRU A;  3UBK A;  2IWT A;  2V1M A;  2C3N A;  2OAD A;  2KLX A;  3FKF A;  4ZL8 A;  4ECI A;  3V1W A;  22GS A;  2GZP A;  5J9C A;  4LLR A;  4IQA A;  4OWY A;  4JBB A;  1DE1 A;  4ZB8 A;  2M80 A;  2B1K A;  1J9B A;  4YQV A;  1W4V A;  3VWX A;  4E8E A;  3G7I A;  2VL3 A;  2YWM A;  2H1A A;  4FQU A;  3Q74 A;  3C71 A;  2IL3 A;  4DSS A;  5LCZ A;  1U87 A;  1M99 A;  5FWG A;  4DSS B;  1U6T A;  4BWQ A;  2H6Z A;  2LQQ A;  3WT1 A;  4IS0 A;  5AGY A;  1DSB A;  4G2E A;  1GTB A;  4O5U A;  1B4Q A;  3L9S A;  5DAL A;  1GTA A;  5DAL B;  1UVZ A;  2VCZ A;  2RUE A;  5KOW A;  1MTC A;  1URM A;  2HZE A;  4Q5F A;  2YV9 A;  2IMD A;  2IN3 A;  2HZE B;  3F6D A;  2C3T A;  3M9K A;  4RQX A;  1JZD A;  4MA9 A;  3TKS E;  2A2R A;  1OAZ A;  4I5Q A;  2DBC A;  3QDN A;  1CQH A;  3GKM A;  2C0D A;  5E59 A;  1EZK A;  3HJO A;  2BMX A;  3PGT A;  3CTF A;  2L4C A;  4CDO A;  1TRS A;  2HRA A;  3FR6 A;  4ZL9 A;  3F63 A;  4J56 E;  1M7T A;  1Z9H A;  1PD2 1;  3U6V A;  4KDU A;  4TR1 A;  4OO4 A;  3G7Y A;  2ES7 A;  1FB6 A;  4TR1 B;  2YOI A;  2VLU A;  4ZBD A;  1R4W A;  2IFQ A;  5A5K A;  5E4W A;  3IC4 A;  5G1K A;  2IFQ B;  4PUA A;  2GT6 A;  6GST A;  3RPP A;  5KN0 A;  4EUY A;  3FW2 A;  4K6X A;  2E0Q A;  1T00 A;  1SK0 A;  2B5Y A;  1PX6 A;  5A4W A;  5IIZ A;  3VWW A;  1TI1 A;  1WMJ A;  4GQC A;  3GNJ A;  4XIH A;  2NVL A;  3ZVJ A;  4BWS A;  3DYR A;  3KP9 A;  3VI5 A;  4K8M A;  8GSS A;  2H73 A;  1SU9 A;  4TXV A;  2H1G A;  1T8E B;  2FA4 A;  3GH6 A;  5LNK e;  3UL3 A;  4FO5 A;  2IME A;  4Q5Q A;  4WEY A;  4K7N A;  2C8U A;  4XS1 A;  2LJR A;  3GKK A;  2H01 A;  1HYU A;  2TRX A;  2YV7 A;  4I97 A;  4ML1 A;  3Q19 A;  3DXB A;  3TCO A;  3KXO A;  1GUL A;  1F3A A;  1XFL A;  1J0F A;  4BA7 A;  4BPY A;  5DJL A;  3MSZ A;  4HU7 A;  3F3R A;  2CV4 A;  4K9Z A;  3L0H A;  2D2Z A;  5ECM B;  1B8X A;  3ZIV A;  3ZVJ D;  1PGT A;  3EU3 A;  4MH2 A;  5GST A;  1OKT A;  5COH A;  1LU4 A;  2LRC A;  3EWL A;  4HZ2 A;  4GRF A;  2LTK A;  1DE2 A;  4EF0 A;  3TOT A;  1EEM A;  2MBS A;  4V2L A;  2CZ2 A;  3WGD A;  3HCZ A;  4KH7 A;  5CP1 A;  3GHA A;  2XC2 A;  5C00 A;  2H0I A;  3BCK A;  3KZQ A;  3D22 A;  3SWL A;  4YAP A;  1SJ6 A;  1SK2 A;  1TP9 A;  4CHS A;  2DJ1 A;  4K5R A;  3TJK A;  5J41 A;  2GST A;  5GZZ B;  2YCD A;  3UJ1 A;  2FGX A;  1XWG A;  4PXO A;  1SL0 B;  3A5I A;  1DUG A;  1O8X A;  1SJI A;  5F05 A;  1F2E A;  2YP6 A;  5ECQ B;  4KDY A;  3ZRE A;  3HZ4 A;  4K0N A;  1HQO A;  1RK4 A;  4XRD A;  4HJ2 A;  2C0G A;  3D21 A;  2H0G A;  1U88 A;  2OE3 A;  5FT3 A;  3UAR A;  4EC0 A;  3APQ A;  3IV4 A;  4DSR A;  4WR5 A;  4TOP A;  3KP8 A;  3F6F A;  2FHE A;  5AIV A;  5GSS A;  4HQS A;  1Y6E A;  4TRX A;  3IE3 A;  2JAC A;  4O32 A;  3ZYW A;  1OYJ A;  3M3M A;  3IR4 A;  4IBP A;  1A2M A;  1XWC A;  1KNG A;  1FOH A;  2REM A;  1OC8 A;  4XS6 A;  1OE7 A;  2QSI A;  4IP6 A;  2VLT A;  4GXZ A;  4NHZ A;  4LA1 A;  4IHU A;  4EE0 A;  2MMO A;  2AYT A;  2LUS A;  5ID2 A;  1Z7P A;  4IQ1 A;  5ID2 B;  2FCH A;  3M9J A;  5IOX A;  4PQI A;  3ME7 A;  17GS A;  1N2A A;  2WGR A;  1A2J A;  4G10 A;  1Q98 A;  3BOA A;  4H86 A;  2LNT A;  4EVM A;  5KN3 A;  2PVQ A;  2BTO T;  1PA3 A;  3C1S A;  1PX7 A;  2GLR A;  1BYE A;  1XW5 A;  5DJM A;  3IC8 A;  4I8B A;  1NSW A;  2H6Y A;  4F2I A;  5G30 A;  5IOW A;  3HVV A;  1Y25 A;  4ML6 A;  1TKD B;  2FD3 A;  2K18 A;  1ZGN A;  3D5J A;  3ZFB A;  2OBK A;  3HXS A;  4X4J A;  2GT5 A;  4N0V A;  1GUK A;  2ZNM A;  1PQN A;  2L6C A;  2PER A;  3FEU A;  3C7M A;  1K3Y A;  4JZQ A;  1BAY A;  2QKE A;  4WF5 A;  4AJ6 A;  2HE3 A;  5D9T A;  4FIW A;  2AHE A;  2L4Q A;  2IJY A;  3TUE A;  4FYB A;  3GSS A;  4Z2U A;  1NW2 A;  1WP0 A;  5CRW A;  4BVY A;  1JZW A;  2DKH A;  4BVY B;  4PNF A;  1SL2 B;  4IP1 A;  1Z3E A;  2V32 A;  5F07 A;  3Q18 A;  4Z2R A;  1T4Y A;  3DML A;  2PUK C;  2R3X A;  3I69 A;  3EC3 A;  1V40 A;  2GSQ A;  4MNN A;  4ZBA A;  3QD9 A;  4DEJ A;  2HSY A;  3QAW A;  2PN8 A;  2P31 A;  2C0E A;  2EC4 A;  3WYW A;  1GSE A;  2F9S A;  3QAV A;  3A5W A;  4KSM A;  2LJA A;  2V6K A;  4LMV A;  1TRV A;  1UA5 A;  1GLQ A;  1YEX A;  3QR6 A;  1ABA A;  4O92 A;  3FR9 A;  3C73 A;  2LRN A;  2GQL A;  5D9X A;  1TK0 B;  5HFK A;  1B4P A;  1O81 A;  3IBH A;  3GX0 A;  4TXO A;  4D73 A;  1X5D A;  3TJB A;  2E2G A;  2MBT A;  5L71 A;  3FZ4 A;  2CA8 A;  2IPA A;  4TXO B;  2H0H A;  4HDE A;  4D73 B;  2CVK A;  1R26 A;  5DQY A;  3VUR A;  2AAW A;  4MK3 A;  1QFN A;  2GQM A;  4MH3 A;  3ISO A;  2EIR A;  2OKA A;  4X43 A;  3J7Y b;  3IDV A;  2YAN A;  2YZH A;  3KCM A;  2C3Q A;  4MPF A;  3WT2 A;  2I1U A;  4HOJ A;  1U3A A;  2J9H A;  2JSY A;  4POM A;  4MF7 A;  3QFB C;  3TKS C;  5D9V A;  2DJ2 A;  2H1B A;  2EIQ A;  4WKW A;  3UEM A;  3FZ9 A;  3AY8 A;  3TOU A;  1YJ6 A;  2VLV A;  3O76 A;  5IPG A;  2B7J A;  3GX8 A;  1YF0 A;  10GS A;  2O8V B;  3I43 A;  2HZF A;  1X5C A;  3EYT A;  3I6A A;  4TW5 A;  4IVF A;  2WJU A;  3HZ8 A;  3FY7 A;  4NWY A;  19GS A;  1TRU A;  2L5O A;  2B6M A;  4CY6 A;  1Z7R A;  1YDK A;  5IMF A;  4V1A g;  3W8S A;  5D96 A;  4MJC A;  3MIX A;  2C0F A;  5ELG A;  4G0I A;  4NV2 A;  3A3T A;  1BQ7 A;  2HT9 A;  4MMM A;  1XVW A;  4IKH A;  1PL2 A;  2VCX A;  4GSN A;  2MMN A;  3ZTL A;  3HD5 A;  4L5L A;  2O7K A;  6GSW A;  5B8B A;  4EIP A;  4MF5 A;  1EOG A;  13GS A;  5HR3 A;  3DKS A;  2YWO A;  3FZ5 A;  1GP1 A;  2CAQ A;  3GMF A;  2XBQ A;  5KN1 A;  4HS1 A;  2PVO C;  1K0C A;  5ECH B;  3L9U A;  3G9B A;  1QQ2 A;  4MPG A;  1FW1 A;  1DBY A;  4AF2 A;  3TRQ A;  1T3B A;  1HNA A;  2GVP A;  3L4N A;  1GUM A;  2LEG A;  3Q6O A;  2FUG 2;  4G19 A;  1PMT A;  4TR3 A;  5J4U A;  3GST A;  2GDR A;  2ZUP A;  1GSF A;  1CQG A;  1X9M B;  1XPV A;  5ECP B;  1AQV A;  5DAK A;  2OE1 A;  2XBI A;  1GRX A;  1GNE A;  1M9B A;  1K0O A;  5DAK B;  3VPQ A;  4Z2T A;  2XPD A;  4PQH A;  2CT6 A;  3DVW A;  2RM6 A;  5JCU A;  3LEF A;  4HUA A;  4ULX A;  3KGK A;  1AUC A;  1SKR B;  3DIE A;  2K9F A;  1MEK A;  4KE3 A;  3NZN A;  2H74 A;  4L5O A;  3GV1 A;  5ECR B;  4L8E A;  5LD0 A;  1G0T A;  1XWK A;  1F3B A;  1XWA A;  6GSV A;  1BED A;  3NIV A;  4IGJ A;  2LJK A;  4GQF A;  1U3I A;  3MYD A;  1FG4 A;  3QOU A;  1F37 A;  4EKZ A;  2CX4 A;  2EIO A;  1S3C A;  1SL1 B;  5ECO B;  1Z6M A;  2JU5 A;  3NOF A;  1H75 A;  1TXX A;  1NM3 A;  4G9H A;  3IK9 A;  4KA0 A;  4OO5 A;  4FH8 A;  1B9X C;  4MZW A;  4RI6 A;  2X64 A;  1AQX A;  3FRC A;  1B48 A;  4MCU A;  5DCH A;  4EL1 A;  5J5N A;  1EP7 A;  3VPT A;  1N8J A;  2DJ0 A;  2VIM A;  3FR3 A;  2GZZ A;  4O5Q A;  4TKY A;  5IO0 A;  3KJY A;  4MJA A;  3E9J B;  4WR4 A;  5IMC A;  1M0U A;  4NHW A;  4J57 E;  2G0F A;  9GSS A;  4WET A;  5D8I A;  3F0I A;  4A5P A;  2HSH A;  2DLX A;  1QGV A;  2CVD A;  2OAC A;  4JR6 A;  1FB0 A;  1XBS A;  3QMX A;  1HNB A;  3PIN A;  2A2P A;  2I3Y A;  4ECJ A;  2TRC P;  2R0P A;  3RDW A;  3WGE A;  2DML A;  2LQO A;  4NXI A;  3ZZX A;  2H75 A;  3LFL A;  3GIX A;  4RQR A;  4Z7X A;  1T4Z A;  3TJG A;  1X0R A;  1Z6N A;  3F8U A;  1WIK A;  1VF2 A;  2VCT A;  2V6O A;  4ISD A;  4V2M A;  3UOM A;  3TB2 A;  2QA2 A;  2R6K A;  1GL8 A;  2GGT A;  4ECB A;  1AAZ A;  2HFD A;  1ERT A;  3IA1 A;  3QPM A;  3HVX A;  3RHC A;  3KEB A;  5AIS A;  4WBR D;  4L0W A;  4KAE A;  2OBI A;  5ENU A;  2HNL A;  5KN2 A;  2JZT A;  1V58 A;  1KBN A;  2L5L A;  1R5A A;  1XOB A;  2VO4 A;  2GSS A;  5D93 A;  3IOS A;  5ECK B;  4XS4 B;  3LXT A;  4N10 A;  4KGI A;  2FWE A;  1WOU A;  3UIW A;  1TK8 B;  2DJ3 A;  5CRD A;  4EDZ A;  1SK1 A;  1S3A A;  1ZYQ B;  2M72 A;  4MAB A;  2IMK A;  3CXG A;  4N0Z A;  1WRY A;  4POL A;  2R0C A;  3C8E A;  3ME8 A;  4FYU A;  4KND A;  1EGO A;  4GTU A;  1EP8 A;  3A2V A;  5ECI B;  4AJ7 A;  3VFI A;  4Q5R A;  3PR8 A;  4ZL7 A;  2VL9 A;  3ZLP A;  4YH2 A;  4GWR A;  2NBS A;  3HJM A;  3RBT A;  1AXD A;  4J2F A;  3VI7 A;  1R7H A;  2R5G A;  2UZ8 A;  5B7C A;  5KEJ A;  4WBJ A;  1ST9 A;  4RUV A;  3LWA A;  2KP2 A;  4QQ7 A;  1F9M A;  2VCQ A;  2YN1 A;  5C04 A;  4PNG A;  3KMN A;  2MZC A;  1OC9 A;  1A0F A;  1T1V A;  2I9H A;  3FK8 A;  5A4V A;  2QGV A;  1EOH A;  2AV4 A;  1OC9 B;  4WF4 A;  6GSY A;  2GZY A;  4GSS A;  1V9W A;  3FZA A;  1G6W A;  2IMI A;  3WD6 A;  3CSI A;  3ZIJ A;  3LYP A;  3ERF A;  4LL4 B;  1J08 A;  5J9B A;  4ZBB A;  3TKQ A;  1PSQ A;  3P7X A;  1YKA A;  4ACS A;  1MDK A;  3EU4 A;  4G0K A;  4YKG A;  3F4T A;  4EO3 A;  18GS A;  4K2D A;  1TU8 A;  4PQ1 A;  4ZB6 A;  5IPH A;  1THX A;  2H19 A;  1ZYP A;  3US3 A;  3GL5 A;  1TW9 A;  2FY6 A;  1EGR A;  4OFM A;  4ID0 A;  2K8S A;  5JWQ B;  2FWF A;  2E7P A;  1QXH A;  5CYY A;  2VD0 A;  4MZB A;  3ERW A;  3TJF A;  1VF3 A;  1K0D A;  4PTS A;  3F9U A;  4XRA A;  4TVE A;  3VK9 A;  3U5R E;  2G2Q A;  2DC5 A;  2O85 A;  1WWJ A;  3L9V A;  4AGS A;  1QMV A;  1KEB A;  2ON5 A;  1UN2 A;  2ALB A;  4YAV A;  5HFI A;  1GSD A;  1JFU A;  1M2B A;  3GUR A;  4F0C A;  1EV4 A;  1O6J A;  3PPU A;  2KUC A;  3M8N A;  2WRT A;  1XW6 A;  2VL2 A;  2DMM A;  4YQU A;  3DD3 A;  3RHB A;  1NHO A;  2YWI A;  1GH2 A;  2PBJ A;  3ZMK A;  2B3S A;  2WFC A;  1O7U A;  1XW9 A;  1EWX A;  5G31 A;  5ECN B;  1AIU A;  3W8J A;  3IAS 2;  1K3O A;  3UBL A;  2O89 A;  3KM6 A;  1TRW A;  4KDX A;  2F8A A;  4P3Y B;  2A4H A;  5HR2 A;  2L59 A;  3GUS A;  5B6N A;  3MAK A;  5AN1 A;  3JCM L;  1A8Y A;  1GTU A;  3A2X A;  5DCG A;  1THO A;  2V2G A;  4POB A;  4KCE A;  3ZRD A;  3S9F A;  1ZMA A;  2A2S A;  2AB6 A;  5CAX A;  4MDC A;  1SJZ A;  2YJ7 A;  3GYK A;  2R4V A;  1GSS A;  1X5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...