1XWCA

Drosophila thioredoxin, reduced, p6522
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords thioredoxin
publication title Comparative structural analysis of oxidized and reduced thioredoxin from Drosophila melanogaster
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 31
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 2004-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1xwcA00
5CO3A 3AY8A 5IMAA 3TUEA 4MF7A 4KAEA 2HZFA 2C3NA 1GSEA 2WULA 3QPMA 3Q18A 5AISA 3HJPA 1AIUA 5J5NA 2O87A 2GT6A 3TDGA 1B9YC 4N11A 4D73A 3IC4A 3GSSA 4OFMA 3BCIA 2WRTA 2HSYA 5IO0A 1A23A 1Z6NA 2IMIA 1MDKA 3GTUB 2IMEA 5ECPB 4EO3A 3VWXA 2JADA 4KDXA 1YJ6A 5D9VA 1QMVA 4LMWA 4QL9A 5JCGA 2IWTA 5D73A 2XPEA 4MJAA 18GSA 3L4NA 3DIEA 4HZ2A 3P8WA 3ZTLA 1PN9A 2OBKA 4MPGA 3H79A 4PQIA 4ZB8A 2LNTA 5D9TA 4HDEA 4RQXA 5LCZA 1T7PB 1XW9A 3FZ5A 1K0BA 3VPQA 5CRDA 3H4KA 3UBKA 2RUFA 3QOUA 4KDYA 4OCEA 7GSSA 1UC7A 3HD5A 1V40A 1GL8A 3MDKA 1GSYA 1AQXA 2GGTA 2G2QA 1ERTA 2GZYA 3A3TA 3UBLA 1U88A 3ZIJA 1EGOA 3ZRDA 3APSA 1N2AA 2AB6A 5G5EA 1KBNA 2LRTA 4EDZA 4XRDA 2YWOA 1ZZYA 3P90A 2KLXA 1PL2A 3IV4A 5JCWA 1KNGA 4K1FA 2VD1A 2F8AA 1IYHA 22GSA 5H5RA 2VCWA 1A8LA 1GNWA 1RK4A 1U87A 2WFCA 3LWAA 3CSJA 1QGVA 1Z6MA 3KGKA 3FZ9A 3IAS2 4MF6A 2GQLA 1X5EA 3TJJA 3J7Yk 4XCSA 4ML1A 4HOJA 3UMAA 4ECBA 2H6ZA 1EOHA 1K3LA 5ID2A 1TK0B 2H19A 4CW9A 3IDVA 1M2BA 2OE3A 5D93A 4MA9A 5HQPA 5DAKB 1ON4A 3H93A 1EEJA 2O8VB 3TRXA 3FR9A 2AUVA 1Y6EA 2CX4A 5KN0A 1TP9A 4NHZA 4NAXA 5IMDA 2GDRA 2C0FA 3MWHA 1THOA 3TKSE 1H4OA 4IQAA 2H1DA 1ZGNA 3EE2A 4O92A 1F3BA 3APQA 1GLPA 5ELAA 4BWSA 4IBPA 2YNXA 4QQ7A 4PQHA 4MF5A 1VF2A 4POBA 4YH2A 2IFQB 2E0QA 1AQWA 3HA9A 3G7YA 2WGRA 4KX4A 2HLSA 3LGCA 4MMMA 5AN1A 5JWOB 1KEBA 1TI3A 5HR1A 5GAPD 4L5LA 2FLSA 4GQFA 2TIRA 1I5GA 3GKNA 1R5AA 3APOA 5KN2A 4OCFA 4F0BA 3FY7A 1T1VA 3FK8A 4MDCA 5EVOA 1HQOA 2VO4A 4MH2A 1PL1A 2FA8A 3WYWA 4KW6A 2JZTA 3C1RA 4K7IA 1FVKA 2E7PA 1TOFA 3WD6A 2B7KA 3TJBA 2XPDA 1V58A 3RHCA 2GSQA 1X9MB 5CRGA 2VLVA 2QSIA 1WIKA 1Z7PA 3TCOA 5B8AA 4V2NA 1NHYA 1GNEA 1SK1A 1UN2A 3PINA 1FG4A 3CYNA 2K6VA 2IMFA 1TW9A 1I9DA 1U6TA 2OADA 3D21A 1VRSD 5IM9A 1VF4A 4Q5NA 5A4WA 1ERVA 5DJLA 2IN3A 2KUCA 4HZ4A 3IOSA 4PNFA 4TR1B 3TOTA 3KEBA 1EGRA 4JR4A 1A24A 1XOAA 1IYIA 4TR0A 5ECQB 3F4TA 2P5RA 4ID0A 3US3A 5B7CA 3TKSC 2AV4A 1GSSA 3DGQA 1X0RA 2VL9A 1EOGA 3P2AA 1FO5A 3QAWA 1T3BA 2NDOA 2VD0A 3E0UA 2V1MA 5C04A 2R3XA 1K0AA 1A2JA 3ZMLA 2F8FA 2J9HA 4HS1A 4N10A 1DUGA 4G19A 2D2ZA 1SKSB 1OKDA 4MP4A 1WPIA 1GP1A 1TTZA 2KHPA 5IQYA 1PMTA 1WP0A 2FY6A 4I5QA 2CZ2A 3PGTA 1DSBA 3F6DA 3ZREA 5ELGA 3F0IA 1A0RP 2BTOT 3ZVJA 2H30A 3CTFA 3WGXA 1PX6A 2PGTA 3EMXA 5DALB 3V1WA 1YKCA 3ZFBA 3WGDA 1XWKA 4E8EA 4AGSA 1M2DA 5A4UA 2ON7A 1WJKA 2LTKA 3UL3A 2HI7A 3GTUA 3HVSA 5D9XA 3HYPA 5D9WA 4IJIA 4G2EA 4MJEA 1O85A 2IMKA 2K9FA 2L57A 4EL1A 4GRFA 1MD4A 2I81A 2B5YA 3O6TA 5IO2A 4ISDA 3HXSA 2RLIA 2PPTA 1RW1A 4GSTA 5LNKe 1OC3A 1SL0B 2V32A 4EC0A 4JU5A 3N5OA 4ZBBA 3DMLA 1DE2A 6GSWA 1BEDA 2DIZA 1OC9B 4JE1A 2FHEA 1JLWA 3TJKA 1TRVA 3JCML 1G7OA 4MJCA 4ULXA 1JLVA 1Z5YE 2VCTA 1URMA 4N0ZA 1V57A 2PERA 3E3EA 1F3AA 3I9V2 3EC3A 5FT3A 2CX3A 2H76A 2YCDA 4FYUA 4IQ1A 2H1BA 4EDYA 2LEGA 4FYBA 2B5XA 3RBTA 4IS0A 3EURA 3HZ4A 2LSTA 1F6MC 2H0IA 1M7TA 3WT2A 5F8BA 2AYTA 1XWBA 2YJHA 4KSMA 2H74A 4G10A 1GUKA 1OAZA 4BWQA 2L59A 4MH3A 5C00A 2LJAA 3ERFA 4BVXA 1H75A 2JZRA 1PRXA 5DCGA 3UVTA 2VAFA 2QC7A 3GIXA 4TXOB 2GS3A 2K18A 3GN3A 4DVCA 2GQKA 4KDUA 2FNOA 1A0FA 2CZ3A 2CVBA 3CRTA 4ML6A 2NTOA 10GSA 1TI1A 4WBRD 4J2FA 3KMOA 1A2MA 2TRXA 1ERUA 1XWAA 2HT9A 3F63A 1PX7A 1XBSA 5IMFA 4GQCA 3L9UA 3FZ4A 2P0GA 2ZNMA 2DLXA 4ECJA 1XFLA 4KGIA 1FW1A 1M9BA 2I1UA 2OJLA 2C3TA 5AIXA 4G9HA 3CSHA 1F37A 4ZXGA 2L4QA 1TU7A 2BJXA 5DAKA 1O8WA 3LG6A 2EIRA 2GVPA 1WWJA 5CRHA 4L0UA 4X1UA 5GAND 4JRRA 5GZZB 1WRYA 3GKXA 5ECMB 1GUHA 2CVDA 3TGZA 4TW5A 2O7KA 1SENA 4DEJA 1SK2A 1AW9A 2H73A 4F9ZA 3IR4A 3QAVA 1O81A 13GSA 4F82A 1TK5B 4DSSB 2LKUA 3VURA 4HQSA 2IFQA 4GCIA 5KEJA 4CDOA 1HNCA 3KP8A 4Q5RA 4V1Ag 4GF0A 2J23A 1FB0A 3D4TA 3DKSA 3HJMA 1SU9A 3KXOA 5ECRB 2XC2A 4TKYA 2AJQB 3GYKA 4KH7A 3BJ5A 2F9SA 5A4VA 2ZUPA 4YAVA 3LYPA 1UVZA 3IPZA 2IJYA 4I6XA 4MZBA 1ACVA 5EPFA 4GSSA 4JZQA 2JL4A 2H72A 1Z7RA 3MNGA 1JZOA 4EKZA 1PA3A 1HNBA 2LJKA 3DVWA 2VCQA 1YY7A 4HI7A 2CAIA 3PH9A 2ES7A 5HFKA 4O5RA 3GHAA 3GMFA 6GSXA 5HR2A 1K3OA 2KOKA 4L0WA 1ILOA 1DBYA 2EIQA 3IRAA 1ZL9A 2YOIA 1G6YA 14GSA 4LMVA 3IXRA 5FHIA 3U6VA 1V2AA 5E4WA 1A2LA 2L4CA 3DWVA 2XBQA 1G6WA 1QK8A 3HZ8A 3UOMA 8GSSA 2HXKA 2VL2C 2C1YA 3M8NA 4ILFA 1K0DA 4X0XA 4TR1A 1BQ7A 1GTAA 4V2MA 4HJMA 3L9VA 4WXTA 4AJ6A 1NM3A 1OVNA 5IOXA 1HNAA 1ZCPA 1GLQA 2H66A 1DE1A 4IN0A 4EE0A 2YPMA 1BAYA 3FW2A 4ECCA 2OBIA 1XW6A 3EU4A 4OFTA 5IPHA 3J7Yb 5ECKB 1WE0A 4WF5A 2HFDA 4HU9A 2A4VA 2R2JA 1ABAA 2MMZA 1EV4A 3GKKA 2HRFA 2CAQA 4XS4B 3RAZA 2JACA 4FH8A 4POMA 2X8HA 3BOAA 2GZZA 4XIHA 2K8VA 1SL2B 3IK7A 2N5AA 3C1SA 5A5KA 5IMZA 4MK3A 2FA4A 1F9MA 2ZCTA 4ECIA 2DJ3A 2M72A 3VLNA 2BMXA 4V2LA 1MD3A 1X5DA 1VF1A 1TRWA 4IGJA 2C3QA 5DALA 2OE0A 2WZ9A 4LLRA 3C7MA 1YF1A 2WDUA 2YJ7A 9GSSA 2DSAA 2H1AA 2H70A 1UA5A 3PR8A 3R2QA 2X8GA 3ERWA 2X8CA 1QUWA 4AJ8A 4ZL7A 3DYRA 2V2GA 3ERGA 1PGTA 1FOVA 1LJRA 3M1GA 3KTBA 5DCHA 5GSSA 1GTUA 5HFGA 5IOWA 2C0DA 2A2RA 4KE3A 3KD0A 5GSTA 4BA7A 2B6MA 2EIOA 2CQ9A 3EU3A 4KNDA 4ZB6A 1OC9A 3KH9A 2C80A 1TK8B 4FYCA 3L0HA 3EWLA 2VUPA 1XZOA 2WS2A 2LRCA 4EF0A 1FB6A 3K8NA 3GKMA 2RUEA 4PXOA 2AHEA 1GULA 2FWFA 3LQ7A 3NIVA 2KP2A 3LSZA 2C8UA 4IELA 3HDCA 1B48A 1AXDA 1EP8A 2CVKA 5IIZA 2TRCP 5CAXA 4OO4A 1XW5A 2YZHA 4IHUA 3IK9A 1T4YA 2NVLA 1OC8A 1EWXA 4TVEA 3SBCA 1JFUA 2H8LA 2N5BA 5AIVA 1GWCA 1XXUA 3F6FA 2F3MA 2JSZA 3GH6A 1O8XA 1PSQA 3M9KA 2GSRA 3MSZA 4ZL8A 4TXOA 1EV9A 1YDKA 6GSUA 2MMAA 2XBIA 5JCUA 4MJBA 4WBJA 4K0GA 5CNWA 1XPVA 3UAPA 4PX1A 2HE3A 4ZBDA 3D0ZA 1ZYQB 2WJUA 2VLUA 1J08A 4BVYA 3QMXA 4K0NA 3WT1A 1ZYEA 2PVOC 4XRAA 1ERWA 1M99A 5ABRA 3QDNA 4AF2A 4FIWA 3ZL5A 4OD7A 1YZXA 2HYXA 1ST9A 3F8UA 1O73A 1TDIA 5J4UA 1GSUA 1S3AA 2QKEA 3CTGA 3GL3A 4BPYA 2H75A 3TJGA 2VCXA 1G7EA 1M9AA 3A2VA 4GSNA 5DVBA 1QQ2A 1OYJA 3TKSA 5F0GA 3G9BA 2C0EA 2JU5A 2PVQA 2P5QA 2F51A 2IL3A 4MZCA 2JSYA 3LYKA 4F2IA 2X99A 2LJRA 2PMTA 4TR4A 1GTIA 4DSSA 3DEXA 2YANA 5H5QA 2CV4A 2M46A 2H0HA 20GSA 6GSTA 2FUG2 3M0FA 3LORA 2H6XA 3FR3A 1JZRA 4NV5A 4FO5A 1WMJA 3QR6A 2RIIA 1USBA 1NSWA 1E2YA 1GUMA 4XS1A 3HCZA 3QAGA 1GSFA 1TKDB 2GTUA 4AJ7A 2YWNA 5B6NA 1X9SB 3QD9A 4ZL9A 4POLA 2IIYA 3DRNA 3F3RA 3CRUA 5ECIB 3M3MA 3FYGA 3NOFA 2YN1A 3OR5A 2K8SA 17GSA 5L71A 3HHVA 2P31A 2CA8A 3A2WA 5B6MA 4RI7A 1X9WB 1SKRB 4E8HA 3W8SA 1U3AA 2A2SA 2OKAA 5INYA 2V6KA 1OE8A 4OO5A 4P3YB 1O7UA 3MAKA 1SKWB 2OACA 4N30A 1F2EA 5AGYA 3VPTA 2PU9C 5DJMA 2OE1A 4H86A 2B1KA 3O76A 4Z7XA 3NZNA 3W6GA 4GTUA 3FHKA 1ML6A 2N5FA 2B3SA 3GH9A 4LL1B 4KA0A 3KMNA 1JZWA 1MDJA 1BJXA 1Z9HA 1THXA 3RPNA 3RHBA 1TXXA 3A2XA 11GSA 1K0CA 2YWIA 4OWYA 1R5PA 3ZYWA 4L8EA 5LD0A 1A8YA 3ZITA 4NWYA 2GLRA 3F4RA 3CMIA 1Q4JA 3BCKA 3ZMKA 2XHFA 1B9XC 1CQGA 1HYUA 4N0VA 2E2GA 1E6BA 2HZEB 4XS4A 3KM6A 2YP6A 5G5FA 4EUYA 4I97A 1BX9A 4MABA 4HQZA 5F05A 4TN8A 4DSQA 4X43A 2V6OA 3EYTA 3LFLA 5CYYA 4EXJA 4K9ZA 2FGXA 3BBYA 1RQMA 5DQYA 4OFNA 4IW9A 3LJRA 4KUNA 6GSYA 4KSOA 1SK0A 3D5JA 4K6XA 3M9JA 1U3IA 5DBQA 5COHA 3ME8A 2IMDA 1TRSA 3N9JA 1R26A 3FEUA 1V9WA 3GSTA 3L78A 2H0GA 4TXVA 2EC4A 1R4WA 1WOUA 3VWWA 4PUFC 1J9BA 4L5OA 3G7JA 4PUAA 1SJ6A 3IBHA 1SD9A 4POKA 4Q5FA 3H8QA 1ZMAA 2LQQA 3F3QA 1S3DA 3C73A 2QGVA 2VM1A 3GNJA 5KN3A 3ED3A 2RM6A 1XOBA 2GT5A 1YQ1A 3VWUA 2WCIA 2DC5A 3TKPA 1SYXA 1GH2A 5DDLA 1SJIA 3C71A 2HRNA 2ALBA 19GSA 4F0CA 4XTSA 1SJZA 2DJ0A 1Q98A 4I2TA 1J0FA 2KP1A 2R37A 3CSIA 4K7OA 4KCEA 2WB9A 3F4SA 4ACSA 3CBUA 3ZLPA 3IHQA 3RDWA 1EZKA 4MLYA 1XWCA 5ECNB 3ZZXA 4KB3A 4NXIA 2LV3A 5D96A 2NBSA 2FD3A 3ZVJD 1B8XA 2PBJA 4RQRA 3KCMA 3H1NA 4WR4A 2HSHA 1W4VA 4ZBAA 3FZAA 4IJ3A 4KCAA 1TJDA 3ME7A 4OMVA 3UEMA 1PKWA 1T00A 1LU4A 4GWRA 3ISOA 6GSSA 1K0MA 3EVIA 1M2AA 2MMNA 1Y25A 1ZOFA 4F03A 1C72A 3LXTA 5FWGA 3TRQA 2FCHA 2H6YA 4WETA 2B1LA 2I3YA 4D73B 1BYEA 3E9JB 1JHBA 2JZSA 4NV2A 6GSVA 2G0FA 5HFIA 3GFKA 4JBBA 2LRNA 1T8EB 3ZFLA 3I43A 4IP6A 2DMMA 3TJFA 5CREA 1AAZA 4O32A 3EMPA 5ECSA 2DIYA 2PWJA 4GLTA 2GSSA 4I2UA 1HD2A 4I8BA 4TOPA 4K7NA 4WEYA 1M0UA 4YAPA 3LEFA 4ZIJA 2VL2A 3P7XA 2B7JA 2PUKC 2DMLA 3HJOA 2VLTA 3TOUA 4HEA2 2DJ2A 4BL7A 3FRCA 1K0NA 1EP7A 3D22A 3G7IA 4TR3A 1VF3A 2C0GA 2LUSA 1PD21 1LBKA 1X5CA 1QXHA 5IMCA 2MZCA 2R6KA 3TRPA 4K2DA 1YEPA 3LXZA 2OA7A 4MCUA 1PQNA 4J57E 4NHWA 2L5LA 2MMOA 1B4QA 2O85A 5HR3A 3QFBC 1XCCA 2GQMA 1YEXA 3A5WA 1Z3EA 3UVHA 3KH7A 2REMA 5CRWA 4PURA 4MZWA 3KZQA 5ENUA 4TRXA 4O7HA 2VIMA 3SWLA 16GSA 2FWEA 3TB2A 4DSRA 4HJ2A 1JZDA 2MYGA 1TRUA 1S3CA 3WGEA 5EY6A 1N8JA 4PGTA 4IVFA 3Q6OA 3BD2A 1T4ZA 3FR6A 1R7HA 4HUAA 1FAAA 2DJ1A 1SYRA 3HKRA 3KJYA 1XVWA 2X64A 2DBCA 4YQVA 2FWGA 1MTCA 5B8BA 4V1Ap 3GX0A 2IPAA 2B5EA 4WR5A 5G30A 3UJ1A 2DJKA 4NPBA 1K0OA 3C8EA 3GV1A 3UIWA 1PKZA 3HY2A 1OKTA 3U5RE 2ON5A 5D8IA 12GSA 5G1KA 2O89A 2FWHA 4XHMA 2L5OA 1FVJA 4JR6A 1NW2A 3I6AA 2V41A 1NHOA 1GSQA 1G0TA 1V98A 5ID2B 2LQOA 1YKAA 1GRXA 5J9CA 5JWQB 4ZB9A 5J3RA 3GA4A 3KP9A 5IMVA 5J41A 3L9SA 3VK9A 3D4MA 4RI6A 4IKHA 4GXZA 2AAWA 2R4VA 3DXBA 3KIJA 4XS6A 1FHEA 3I69A 1VGLA 5JWRB 3EINA 2GZPA 2I9HA 5ECOB 2VCZA 2HZEA 3DVXA 2VL3A 1MDIA 3W8JA 3F9UA 4WKWA 5HR0A 3S9FA 2I4AA 3IE3A 3CXGA 1SD8A 3GX8A 1XVQA 5F06A 1GTBA 2YZUA 3FKFA 3GL5A 2H01A 2HNLA 2VM2A 2C4JA 3D6IA 1EEMA 1MEKA 5ECHB 3Q74A 1TU8A 1SL1B 1BG5A 4HU7A 5KN1A 3HVXA 5F07A 3GUSA 1W89A 3QCPA 4JEDA 1XWGA 3VI7A 4YQMA 5EL8A 2L6DA 3DD3A 2NPBA 2YWMA 2LS5A 4YQUA 5G1LA 2CT6A 3ZIVA 1KTEA 3HVVA 1B4PA 1AUCA 2H1GA 4PQ1A 1GSDA 2MBTA 3GURA 5G2ZA 3RPPA 4LA1A 4J56E 5H5SA 3VWVA 5ECLB 2M80A 5IPGA 3IAM2 4LL4B 1OE7A 2RM5A 3Q19A 3IA1A 4IP1A 5CP1A 4K8MA 3O3TA 4PNGA 1QFNA 1CQHA 1K3YA 5E59A 4ZILA 1YF0A 3TKRA 2YV9A 1AC1A 2E2MA 2PN8A 2GSTA 2H71A 2L6CA 2VOCA 4CHSA 5J9BA 3KTLA 4RUVA 4Q5QA 3VI5A 3QFAC 3VFIA 2LNSA 4WF4A 3TKQA 4MPFA 1XIYA 2Z9SA 3UARA 5G31A 2MBSA 4EVMA 1O6JA 2DJJA 2YV7A 4NMUA 5DQSA 2VCVA 4QL7A 3GRXA 2R5GA 1AQVA
chains in the Genus database with same CATH superfamily
5CO3A 3AY8A 5IMAA 3TUEA 4MF7A 4KAEA 2HZFA 2C3NA 1GSEA 2WULA 3QPMA 3Q18A 5AISA 3HJPA 1AIUA 5J5NA 2O87A 2GT6A 3TDGA 1B9YC 4N11A 4D73A 3IC4A 3GSSA 4OFMA 3BCIA 2WRTA 2HSYA 5IO0A 1A23A 1Z6NA 2IMIA 1MDKA 3GTUB 2IMEA 5ECPB 4EO3A 3VWXA 2JADA 4KDXA 1YJ6A 5D9VA 1QMVA 4LMWA 4QL9A 5JCGA 2IWTA 5D73A 2XPEA 4MJAA 18GSA 3L4NA 3DIEA 4HZ2A 3P8WA 3ZTLA 1PN9A 2OBKA 4MPGA 3H79A 4PQIA 4ZB8A 2LNTA 5D9TA 4HDEA 4RQXA 5LCZA 1T7PB 1XW9A 3FZ5A 1K0BA 3VPQA 5CRDA 3H4KA 3UBKA 2RUFA 3QOUA 4KDYA 4OCEA 7GSSA 1UC7A 3HD5A 1V40A 1GL8A 3MDKA 1GSYA 3LW9A 1AQXA 2GGTA 2G2QA 1ERTA 2GZYA 3A3TA 3UBLA 1U88A 3ZIJA 1EGOA 3ZRDA 3APSA 1N2AA 2AB6A 5G5EA 1KBNA 2LRTA 4EDZA 4XRDA 2YWOA 1ZZYA 3P90A 2KLXA 1PL2A 3IV4A 5JCWA 1KNGA 4K1FA 2VD1A 3MYDA 4BVXB 2F8AA 1IYHA 22GSA 5H5RA 2VCWA 1A8LA 1GNWA 1RK4A 1U87A 2WFCA 3LWAA 3CSJA 1QGVA 1Z6MA 3KGKA 3FZ9A 3IAS2 4MF6A 2GQLA 1X5EA 4YKGA 3TJJA 1S3RA 3J7Yk 4XCSA 4ML1A 4HOJA 3UMAA 1ZYPA 2H6ZA 4ECBA 1EOHA 1K3LA 5ID2A 1TK0B 2H19A 4CW9A 3IDVA 1M2BA 2OE3A 5D93A 4MA9A 5HQPA 5DAKB 1ON4A 3H93A 1EEJA 2O8VB 3TRXA 3FR9A 2AUVA 1Y6EA 2CX4A 5KN0A 1TP9A 4NHZA 4NAXA 5IMDA 2GDRA 2C0FA 3MWHA 1THOA 3TKSE 1H4OA 4IQAA 2H1DA 1ZGNA 3EE2A 4O92A 1F3BA 3APQA 1GLPA 5ELAA 4BWSA 4IBPA 2YNXA 4QQ7A 4PQHA 4MF5A 1VF2A 4POBA 4YH2A 2IFQB 4HSCX 2E0QA 1AQWA 3HA9A 3G7YA 2WGRA 4KX4A 2HLSA 3LGCA 5KOXA 4MMMA 5AN1A 5JWOB 1KEBA 1TI3A 5HR1A 4O5UA 5GAPD 4L5LA 2FLSA 4GQFA 2TIRA 1I5GA 3GKNA 1R5AA 3APOA 5KN2A 4OCFA 4G0IA 4F0BA 3FY7A 1T1VA 3FK8A 2DKIA 4MDCA 5EVOA 1HQOA 2VO4A 4MH2A 1PL1A 2FA8A 3WYWA 4KW6A 3CQFA 2JZTA 3C1RA 4K7IA 1FVKA 2E7PA 1TOFA 3WD6A 2B7KA 3TJBA 2XPDA 1V58A 3RHCA 2GSQA 1X9MB 5CRGA 2VLVA 2QSIA 1WIKA 1Z7PA 3TCOA 5B8AA 4V2NA 1NHYA 1GNEA 1SK1A 1UN2A 3PINA 1FG4A 3CYNA 2K6VA 2IMFA 1TW9A 1I9DA 1U6TA 2OADA 3D21A 1VRSD 5IM9A 1VF4A 4Q5NA 5A4WA 1ERVA 5DJLA 2IN3A 2KUCA 4HZ4A 3IOSA 4PNFA 4TR1B 3TOTA 3KEBA 1EGRA 4JR4A 1A24A 1XOAA 1IYIA 4TR0A 5ECQB 3F4TA 2P5RA 4ID0A 3US3A 5B7CA 3TKSC 2AV4A 1GSSA 3DGQA 1X0RA 2VL9A 1EOGA 3P2AA 1FO5A 3QAWA 1T3BA 2NDOA 2VD0A 3E0UA 2V1MA 5C04A 2R3XA 1K0AA 1A2JA 3ZMLA 2F8FA 2J9HA 4HS1A 4N10A 1DUGA 4G19A 2D2ZA 1SKSB 1OKDA 4MP4A 1WPIA 1GP1A 1TTZA 2KHPA 5IQYA 1PMTA 1WP0A 2FY6A 4I5QA 2CZ2A 3PGTA 1DSBA 3F6DA 3ZREA 5ELGA 3F0IA 1A0RP 2BTOT 3ZVJA 2H30A 3CTFA 3WGXA 1PX6A 2PGTA 3EMXA 5DALB 3V1WA 1YKCA 3ZFBA 3WGDA 1XWKA 4E8EA 4AGSA 1M2DA 5A4UA 2ON7A 1WJKA 2LTKA 3UL3A 2HI7A 3GTUA 3HVSA 5D9XA 3HYPA 2R0GA 5D9WA 4IJIA 4G2EA 4MJEA 1O85A 2IMKA 2K9FA 2L57A 4EL1A 4GRFA 1MD4A 2I81A 2B5YA 3O6TA 5IO2A 4ISDA 3HXSA 2RLIA 2PPTA 1RW1A 4GSTA 5LNKe 1OC3A 1SL0B 2V32A 4EC0A 4JU5A 3N5OA 4ZBBA 3DMLA 1DE2A 6GSWA 1BEDA 2DIZA 1OC9B 4JE1A 2FHEA 1JLWA 3TJKA 1TRVA 3JCML 1G7OA 4MJCA 4ULXA 1JLVA 1Z5YE 2VCTA 1URMA 4N0ZA 1V57A 2PERA 3E3EA 1F3AA 3I9V2 3EC3A 5FT3A 2CX3A 2H76A 2YCDA 4FYUA 4IQ1A 2H1BA 4EDYA 2LEGA 4FYBA 2B5XA 3RBTA 4IS0A 3EURA 3HZ4A 2LSTA 1F6MC 2H0IA 1M7TA 3WT2A 5F8BA 2AYTA 1XWBA 2YJHA 3EPTA 4KSMA 2H74A 4G10A 1GUKA 1OAZA 4BWQA 2L59A 4MH3A 5C00A 2LJAA 3ERFA 4BVXA 1H75A 2JZRA 1PRXA 5DCGA 3UVTA 2VAFA 2QC7A 3GIXA 4TXOB 2GS3A 2K18A 3GN3A 4DVCA 2GQKA 4KDUA 2FNOA 3PPUA 1A0FA 2CZ3A 2CVBA 3CRTA 4ML6A 2NTOA 10GSA 1TI1A 4WBRD 4J2FA 4BVYB 1XG8A 3KMOA 1A2MA 2TRXA 1ERUA 1XWAA 2HT9A 3F63A 1PX7A 1XBSA 5IMFA 4GQCA 3L9UA 3FZ4A 3IHGA 1FOHA 2P0GA 2ZNMA 2DLXA 4ECJA 1XFLA 4KGIA 1FW1A 1M9BA 2I1UA 2OJLA 2C3TA 5AIXA 4G9HA 3CSHA 1F37A 4ZXGA 2L4QA 1TU7A 2BJXA 5DAKA 1O8WA 3LG6A 2EIRA 2GVPA 1PFOA 1WWJA 5CRHA 4L0UA 4X1UA 5GAND 4JRRA 5GZZB 1WRYA 3GKXA 5ECMB 1GUHA 2CVDA 3TGZA 4TW5A 2O7KA 1SENA 4DEJA 1SK2A 1AW9A 2R0CA 2H73A 4F9ZA 3IR4A 3QAVA 1O81A 13GSA 4F82A 1TK5B 4DSSB 2LKUA 3VURA 4HQSA 4Z2UA 2IFQA 4GCIA 5KEJA 4CDOA 1HNCA 3KP8A 4Q5RA 4V1Ag 4GF0A 2J23A 1FB0A 3D4TA 3DKSA 3HJMA 1SU9A 3KXOA 5ECRB 2XC2A 4TKYA 2AJQB 3GYKA 4KH7A 3BJ5A 2F9SA 5A4VA 2ZUPA 4YAVA 3LYPA 1UVZA 3IPZA 2IJYA 4I6XA 4MZBA 1ACVA 5EPFA 4GSSA 4JZQA 2JL4A 2H72A 1Z7RA 3MNGA 1JZOA 4EKZA 1PA3A 1HNBA 2LJKA 3DVWA 2VCQA 1YY7A 4HI7A 2CAIA 3PH9A 2ES7A 5HFKA 4O5RA 3A5IA 3GHAA 3GMFA 6GSXA 5HR2A 1K3OA 2KOKA 4L0WA 1ILOA 1DBYA 2EIQA 3IRAA 1ZL9A 2YOIA 1G6YA 14GSA 4LMVA 3IXRA 5FHIA 3U6VA 1V2AA 5E4WA 1A2LA 2L4CA 3DWVA 2XBQA 1G6WA 1QK8A 3HZ8A 3UOMA 8GSSA 2HXKA 4USSA 2VL2C 2C1YA 3M8NA 4ILFA 1K0DA 4X0XA 4TR1A 1BQ7A 1GTAA 4V2MA 4HJMA 3L9VA 4WXTA 4AJ6A 1NM3A 1OVNA 5IOXA 1HNAA 1ZCPA 4G0LA 1GLQA 2H66A 1DE1A 4IN0A 4EE0A 2YPMA 1BAYA 3FW2A 4ECCA 2OBIA 1XW6A 3EU4A 4OFTA 5IPHA 3J7Yb 5ECKB 1WE0A 4WF5A 2HFDA 4HU9A 2A4VA 2R2JA 1ABAA 2MMZA 1EV4A 3GKKA 2HRFA 2CAQA 4XS4B 3RAZA 5BRTA 2JACA 4FH8A 4POMA 2X8HA 3BOAA 2GZZA 4XIHA 2K8VA 1SL2B 2UZ8A 3IK7A 2N5AA 3C1SA 5A5KA 5IMZA 4MK3A 2HRAA 2FA4A 1F9MA 2ZCTA 4ECIA 2DJ3A 2M72A 3VLNA 2BMXA 4V2LA 1MD3A 1X5DA 1VF1A 1TRWA 4IGJA 2C3QA 5DALA 2OE0A 2WZ9A 4LLRA 3C7MA 1YF1A 2WDUA 2YJ7A 9GSSA 2DSAA 2H1AA 2H70A 1ZYNA 1UA5A 3PR8A 3R2QA 2X8GA 3ERWA 2X8CA 1QUWA 4AJ8A 4ZL7A 3DYRA 2V2GA 3ERGA 1PGTA 1FOVA 1LJRA 3M1GA 3KTBA 5DCHA 5GSSA 1GTUA 5HFGA 5IOWA 2C0DA 2A2RA 4KE3A 3KD0A 5GSTA 4BA7A 2B6MA 2EIOA 2CQ9A 3EU3A 4KNDA 4ZB6A 1OC9A 3KH9A 2C80A 1TK8B 4FYCA 3L0HA 3EWLA 2VUPA 1XZOA 2WS2A 2LRCA 2DKHA 4EF0A 1FB6A 3K8NA 3GKMA 2RUEA 4PXOA 2AHEA 1GULA 2FWFA 3LQ7A 3NIVA 2KP2A 3LSZA 2C8UA 4IELA 3HDCA 1B48A 1AXDA 1EP8A 2CVKA 5IIZA 2TRCP 5CAXA 4OO4A 1XW5A 2YZHA 4IHUA 3IK9A 1T4YA 4YKFA 2NVLA 1OC8A 1EWXA 4TVEA 3SBCA 1JFUA 2H8LA 2N5BA 5AIVA 1GWCA 1XXUA 3F6FA 2F3MA 2JSZA 3GH6A 1O8XA 1PSQA 3M9KA 2GSRA 3MSZA 4ZL8A 4TXOA 1EV9A 1YDKA 6GSUA 2X49A 2MMAA 2XBIA 5JCUA 4MJBA 1PN0A 4WBJA 4K0GA 5CNWA 1XPVA 3UAPA 4PX1A 2HE3A 2HSMA 4ZBDA 3D0ZA 1ZYQB 2WJUA 2VLUA 1J08A 4BVYA 3QMXA 4K0NA 3WT1A 1ZYEA 2PVOC 4XRAA 1ERWA 1M99A 4A5PA 5ABRA 3QDNA 2R0PA 4AF2A 4Z2RA 4FIWA 3ZL5A 4OD7A 1YZXA 2HYXA 1ST9A 3F8UA 1O73A 1TDIA 5J4UA 1GSUA 1S3AA 4PTSA 2QKEA 3CTGA 4BL7B 3MIXA 3GL3A 4BPYA 2H75A 3TJGA 2VCXA 1G7EA 1M9AA 3A2VA 4GSNA 5DVBA 1QQ2A 1OYJA 3TKSA 5F0GA 3G9BA 2C0EA 2JU5A 2PVQA 2P5QA 2F51A 2IL3A 4MZCA 2JSYA 3LYKA 4F2IA 2X99A 2LJRA 2PMTA 4TR4A 1GTIA 4DSSA 3DEXA 2YANA 5H5QA 2CV4A 2M46A 2H0HA 20GSA 6GSTA 2FUG2 4FQUA 3M0FA 3LORA 2H6XA 3FR3A 1JZRA 4NV5A 4FO5A 1WMJA 3QR6A 2RIIA 1USBA 1NSWA 1E2YA 1GUMA 4XS1A 3HCZA 3QAGA 1GSFA 1TKDB 2GTUA 4AJ7A 2YWNA 5B6NA 1X9SB 3QD9A 4ZL9A 4POLA 2IIYA 3DRNA 3F3RA 3CRUA 5ECIB 3M3MA 3FYGA 3NOFA 4K5SA 2YN1A 3OR5A 2K8SA 17GSA 5L71A 3HHVA 2P31A 2CA8A 3A2WA 4EIPA 5B6MA 4RI7A 1X9WB 1SKRB 4E8HA 3W8SA 1U3AA 2A2SA 2OKAA 5INYA 2V6KA 1OE8A 4OO5A 4P3YB 1O7UA 3MAKA 1SKWB 2OACA 4N30A 1F2EA 5AGYA 3VPTA 2PU9C 5DJMA 2OE1A 4H86A 2B1KA 3O76A 4Z7XA 3NZNA 3W6GA 4GTUA 3FHKA 1ML6A 2N5FA 2B3SA 3GH9A 4LL1B 4KA0A 3KMNA 1JZWA 1MDJA 1BJXA 1Z9HA 1THXA 3RPNA 3RHBA 1TXXA 3A2XA 11GSA 1K0CA 2YWIA 4OWYA 1R5PA 3ZYWA 4L8EA 5LD0A 1A8YA 3ZITA 1M3JA 4NWYA 2GLRA 4CY6A 3F4RA 3CMIA 1Q4JA 3BCKA 3ZMKA 2XHFA 1B9XC 1CQGA 1HYUA 4N0VA 2E2GA 1E6BA 2HZEB 4XS4A 3KM6A 2YP6A 5G5FA 4EUYA 4I97A 1BX9A 4MABA 4HQZA 5F05A 4TN8A 4DSQA 4X43A 2V6OA 3EYTA 3LFLA 5CYYA 3IC8A 4EXJA 4K9ZA 2FGXA 3BBYA 1RQMA 5DQYA 4OFNA 4IW9A 3LJRA 4KUNA 6GSYA 4KSOA 1SK0A 2QA1A 3D5JA 4K6XA 2HRKA 3M9JA 1U3IA 5DBQA 5COHA 3ME8A 2IMDA 1TRSA 3N9JA 1R26A 4EIQA 3FEUA 1V9WA 3GSTA 3L78A 2H0GA 4TXVA 2EC4A 1R4WA 1WOUA 2X4AA 3VWWA 4PUFC 1J9BA 4L5OA 3G7JA 4PUAA 1SJ6A 3IBHA 1SD9A 5KOWA 4POKA 4Q5FA 3H8QA 1ZMAA 2LQQA 3F3QA 1S3DA 3C73A 2QGVA 2VM1A 3GNJA 4K2XA 5KN3A 3ED3A 2RM6A 1XOBA 2GT5A 1YQ1A 3VWUA 2WCIA 2DC5A 3TKPA 1SYXA 1GH2A 5DDLA 1SJIA 3C71A 2HRNA 2ALBA 19GSA 4F0CA 4XTSA 1SJZA 2DJ0A 1Q98A 4I2TA 1J0FA 2KP1A 2R37A 3CSIA 4K7OA 4KCEA 3R3EA 2WB9A 3F4SA 4ACSA 3CBUA 3ZLPA 3IHQA 3RDWA 1EZKA 4MLYA 1XWCA 5ECNB 3ZZXA 4KB3A 2QA2A 4NXIA 2LV3A 5D96A 4Z2TA 2NBSA 2FD3A 3ZVJD 1B8XA 2PBJA 4RQRA 3KCMA 3H1NA 4WR4A 2HSHA 1W4VA 4ZBAA 3FZAA 4IJ3A 4KCAA 4O5QA 1TJDA 3ME7A 4OMVA 3UEMA 1PKWA 1T00A 1LU4A 4GWRA 3ISOA 6GSSA 1K0MA 3EVIA 1M2AA 2MMNA 1Y25A 1ZOFA 4F03A 1C72A 3LXTA 5FWGA 3TRQA 2FCHA 2H6YA 4WETA 2B1LA 2I3YA 4D73B 1BYEA 3E9JB 1JHBA 2JZSA 4NV2A 6GSVA 2G0FA 5HFIA 2A4HA 3GFKA 4JBBA 2LRNA 1T8EB 3ZFLA 3I43A 4IP6A 2DMMA 3TJFA 5CREA 1AAZA 4O32A 3EMPA 5ECSA 2DIYA 2PWJA 4GLTA 2GSSA 4I2UA 1HD2A 4I8BA 4TOPA 4K7NA 4WEYA 1M0UA 4YAPA 3LEFA 4ZIJA 2VL2A 3P7XA 2B7JA 2PUKC 2DMLA 3HJOA 2VLTA 3TOUA 4HEA2 2DJ2A 4BL7A 3FRCA 1K0NA 1EP7A 3D22A 3G7IA 4TR3A 1VF3A 2C0GA 2LUSA 1PD21 1LBKA 1X5CA 4K5RA 1QXHA 5IMCA 2MZCA 2R6KA 3TRPA 4K2DA 1YEPA 3LXZA 2OA7A 4MCUA 1PQNA 4J57E 4NHWA 2L5LA 2MMOA 1B4QA 2O85A 5HR3A 3QFBC 1XCCA 2GQMA 1YEXA 3A5WA 1Z3EA 3UVHA 3KH7A 2REMA 5CRWA 4PURA 4MZWA 3KZQA 5ENUA 4TRXA 4O7HA 2VIMA 3SWLA 16GSA 2FWEA 3TB2A 4DSRA 4HJ2A 1JZDA 2MYGA 1TRUA 1S3CA 3WGEA 5EY6A 1N8JA 4PGTA 4IVFA 3Q6OA 3BD2A 1T4ZA 3FR6A 1R7HA 4HUAA 1FAAA 2DJ1A 1SYRA 3HKRA 3KJYA 1XVWA 2X64A 2DBCA 4YQVA 2FWGA 1MTCA 5B8BA 4V1Ap 3GX0A 2IPAA 2B5EA 4WR5A 5G30A 3UJ1A 2DJKA 4NPBA 1K0OA 3C8EA 3GV1A 3UIWA 1PKZA 3HY2A 1OKTA 3U5RE 2ON5A 5D8IA 4X4JA 12GSA 5G1KA 2O89A 2FWHA 4XHMA 2L5OA 1FVJA 4JR6A 1NW2A 3I6AA 2V41A 1NHOA 1GSQA 1G0TA 1V98A 5ID2B 2LQOA 1YKAA 1GRXA 5J9CA 5JWQB 4ZB9A 5J3RA 3GA4A 3KP9A 5IMVA 5J41A 3L9SA 4CY8A 3VK9A 3D4MA 4RI6A 4IKHA 4GXZA 2AAWA 2R4VA 3DXBA 3KIJA 4XS6A 1FHEA 3I69A 1VGLA 5JWRB 3EINA 2GZPA 2I9HA 5ECOB 2VCZA 2HZEA 3DVXA 2VL3A 1MDIA 3W8JA 3F9UA 4WKWA 5HR0A 3S9FA 2I4AA 3IE3A 3CXGA 2A2PA 1SD8A 4G0KA 3GX8A 1XVQA 5F06A 1GTBA 2YZUA 3FKFA 3GL5A 2H01A 2HNLA 2VM2A 2C4JA 3D6IA 1EEMA 1MEKA 5ECHB 3Q74A 1TU8A 1SL1B 1BG5A 4HU7A 5KN1A 3HVXA 5F07A 3GUSA 1W89A 3QCPA 4JEDA 1XWGA 3VI7A 4YQMA 5EL8A 2L6DA 3DD3A 2NPBA 2YWMA 2LS5A 4YQUA 5G1LA 2CT6A 3ZIVA 1KTEA 3HVVA 1B4PA 1AUCA 2H1GA 4PQ1A 1GSDA 2MBTA 3GURA 5G2ZA 3RPPA 4LA1A 4J56E 5H5SA 1M3IA 3VWVA 5ECLB 2M80A 5IPGA 3IAM2 4LL4B 1OE7A 2RM5A 3Q19A 3IA1A 4ICYA 4IP1A 5CP1A 4K8MA 3O3TA 4PNGA 1QFNA 5BMUA 1CQHA 1K3YA 5E59A 4ZILA 3HVNA 1YF0A 3TKRA 2YV9A 1AC1A 2E2MA 4KF9A 2PN8A 2GSTA 2H71A 2L6CA 2VOCA 4BIKA 4CHSA 4MNNA 5J9BA 3KTLA 4RUVA 4Q5QA 3VI5A 3QFAC 3VFIA 2LNSA 4WF4A 3TKQA 4MPFA 1XIYA 2Z9SA 3UARA 5G31A 2MBSA 4EVMA 1O6JA 2DJJA 2YV7A 4NMUA 5DQSA 3FMWA 2VCVA 4QL7A 3GRXA 2R5GA 1AQVA
chains in the Genus database with same CATH topology
5CO3A 3AY8A 5IMAA 3TUEA 4MF7A 4KAEA 2HZFA 2C3NA 1GSEA 2WULA 3QPMA 3Q18A 5AISA 3HJPA 1AIUA 5J5NA 2O87A 2GT6A 3TDGA 1B9YC 4N11A 4D73A 3IC4A 3GSSA 4OFMA 3BCIA 2WRTA 2HSYA 5IO0A 1A23A 1Z6NA 2IMIA 1MDKA 3GTUB 2IMEA 5ECPB 4EO3A 3VWXA 2JADA 4KDXA 1YJ6A 5D9VA 1QMVA 4LMWA 4QL9A 5JCGA 2IWTA 5D73A 2XPEA 4MJAA 18GSA 3L4NA 3DIEA 4HZ2A 3P8WA 3ZTLA 1PN9A 2OBKA 4MPGA 3H79A 4PQIA 4ZB8A 2LNTA 5D9TA 4HDEA 4RQXA 5LCZA 1T7PB 1XW9A 3FZ5A 1K0BA 3VPQA 5CRDA 3H4KA 3UBKA 2RUFA 3QOUA 4KDYA 4OCEA 7GSSA 1UC7A 3HD5A 1V40A 1GL8A 3MDKA 1GSYA 3LW9A 1AQXA 2GGTA 2G2QA 1ERTA 2GZYA 3A3TA 3UBLA 1U88A 3ZIJA 1EGOA 3ZRDA 3APSA 1N2AA 2AB6A 5G5EA 1KBNA 2LRTA 4EDZA 4XRDA 2YWOA 1ZZYA 3P90A 2KLXA 1PL2A 3IV4A 5JCWA 1KNGA 4K1FA 2VD1A 3MYDA 4BVXB 2F8AA 1IYHA 22GSA 5H5RA 2VCWA 1A8LA 1GNWA 1RK4A 1U87A 2WFCA 3LWAA 3CSJA 1QGVA 1Z6MA 3KGKA 3FZ9A 3IAS2 4MF6A 2GQLA 1X5EA 4YKGA 3TJJA 3J7Yk 4XCSA 4ML1A 4HOJA 3UMAA 1ZYPA 2H6ZA 4ECBA 1EOHA 1K3LA 5ID2A 1TK0B 2H19A 4CW9A 3IDVA 1M2BA 2OE3A 5D93A 4MA9A 5HQPA 5DAKB 1ON4A 3H93A 1EEJA 2O8VB 3TRXA 3FR9A 2AUVA 1Y6EA 2CX4A 5KN0A 1TP9A 4NHZA 4NAXA 5IMDA 2GDRA 2C0FA 3MWHA 1THOA 3TKSE 1H4OA 4IQAA 2H1DA 1ZGNA 3EE2A 4O92A 1F3BA 3APQA 1GLPA 5ELAA 4BWSA 4IBPA 2YNXA 4QQ7A 4PQHA 4MF5A 1VF2A 4POBA 4YH2A 2IFQB 2E0QA 1AQWA 3HA9A 3G7YA 2WGRA 4KX4A 2HLSA 3LGCA 5KOXA 4MMMA 5AN1A 5JWOB 1KEBA 1TI3A 5HR1A 4O5UA 5GAPD 4L5LA 2FLSA 4GQFA 2TIRA 1I5GA 3GKNA 1R5AA 3APOA 5KN2A 4OCFA 4G0IA 4F0BA 3FY7A 1T1VA 3FK8A 2DKIA 4MDCA 5EVOA 1HQOA 2VO4A 4MH2A 1PL1A 2FA8A 3WYWA 4KW6A 2JZTA 3C1RA 4K7IA 1FVKA 2E7PA 1TOFA 3WD6A 2B7KA 3TJBA 2XPDA 1V58A 3RHCA 2GSQA 1X9MB 5CRGA 2VLVA 2QSIA 1WIKA 1Z7PA 3TCOA 5B8AA 4V2NA 1NHYA 1GNEA 1SK1A 1UN2A 3PINA 1FG4A 3CYNA 2K6VA 2IMFA 1TW9A 1I9DA 1U6TA 2OADA 3D21A 1VRSD 5IM9A 1VF4A 4Q5NA 5A4WA 1ERVA 5DJLA 2IN3A 2KUCA 4HZ4A 3IOSA 4PNFA 4TR1B 3TOTA 3KEBA 1EGRA 4JR4A 1A24A 1XOAA 1IYIA 4TR0A 5ECQB 3F4TA 2P5RA 4ID0A 3US3A 5B7CA 3TKSC 2AV4A 1GSSA 3DGQA 1X0RA 2VL9A 1EOGA 3P2AA 1FO5A 3QAWA 1T3BA 2NDOA 2VD0A 3E0UA 2V1MA 5C04A 2R3XA 1K0AA 1A2JA 3ZMLA 2F8FA 2J9HA 4HS1A 4N10A 1DUGA 4G19A 2D2ZA 1SKSB 1OKDA 4MP4A 1WPIA 1GP1A 1TTZA 2KHPA 5IQYA 1PMTA 1WP0A 2FY6A 4I5QA 2CZ2A 3PGTA 1DSBA 3F6DA 3ZREA 5ELGA 3F0IA 1A0RP 2BTOT 3ZVJA 2H30A 3CTFA 3WGXA 1PX6A 2PGTA 3EMXA 5DALB 3V1WA 1YKCA 3ZFBA 3WGDA 1XWKA 4E8EA 4AGSA 1M2DA 5A4UA 2ON7A 1WJKA 2LTKA 3UL3A 2HI7A 3GTUA 3HVSA 5D9XA 3HYPA 2R0GA 5D9WA 4IJIA 4G2EA 4MJEA 1O85A 2IMKA 2K9FA 2L57A 4EL1A 4GRFA 1MD4A 2I81A 2B5YA 3O6TA 5IO2A 4ISDA 3HXSA 2RLIA 2PPTA 1RW1A 4GSTA 5LNKe 1OC3A 1SL0B 2V32A 4EC0A 4JU5A 3N5OA 4ZBBA 3DMLA 1DE2A 6GSWA 1BEDA 2DIZA 1OC9B 4JE1A 2FHEA 1JLWA 3TJKA 1TRVA 3JCML 1G7OA 4MJCA 4ULXA 1JLVA 1Z5YE 2VCTA 1URMA 4N0ZA 1V57A 2PERA 3E3EA 1F3AA 3I9V2 3EC3A 5FT3A 2CX3A 2H76A 2YCDA 4FYUA 4IQ1A 2H1BA 4EDYA 2LEGA 4FYBA 2B5XA 3RBTA 4IS0A 3EURA 3HZ4A 2LSTA 1F6MC 2H0IA 1M7TA 3WT2A 5F8BA 2AYTA 1XWBA 2YJHA 3EPTA 4KSMA 2H74A 4G10A 1GUKA 1OAZA 4BWQA 2L59A 4MH3A 5C00A 2LJAA 3ERFA 4BVXA 1H75A 2JZRA 1PRXA 5DCGA 3UVTA 2VAFA 2QC7A 3GIXA 4TXOB 2GS3A 2K18A 3GN3A 4DVCA 2GQKA 4KDUA 2FNOA 3PPUA 1A0FA 2CZ3A 2CVBA 3CRTA 4ML6A 2NTOA 10GSA 1TI1A 4WBRD 4J2FA 4BVYB 3KMOA 1A2MA 2TRXA 1ERUA 1XWAA 2HT9A 3F63A 1PX7A 1XBSA 5IMFA 4GQCA 3L9UA 3FZ4A 3IHGA 1FOHA 2P0GA 2ZNMA 2DLXA 4ECJA 1XFLA 4KGIA 1FW1A 1M9BA 2I1UA 2OJLA 2C3TA 5AIXA 4G9HA 3CSHA 1F37A 4ZXGA 2L4QA 1TU7A 2BJXA 5DAKA 1O8WA 3LG6A 2EIRA 2GVPA 1WWJA 5CRHA 4L0UA 4X1UA 5GAND 4JRRA 5GZZB 1WRYA 3GKXA 5ECMB 1GUHA 2CVDA 3TGZA 4TW5A 2O7KA 1SENA 4DEJA 1SK2A 1AW9A 2R0CA 2H73A 4F9ZA 3IR4A 3QAVA 1O81A 13GSA 4F82A 1TK5B 4DSSB 2LKUA 3VURA 4HQSA 4Z2UA 2IFQA 4GCIA 5KEJA 4CDOA 1HNCA 3KP8A 4Q5RA 4V1Ag 4GF0A 2J23A 1FB0A 3D4TA 3DKSA 3HJMA 1SU9A 3KXOA 5ECRB 2XC2A 4TKYA 2AJQB 3GYKA 4KH7A 3BJ5A 2F9SA 5A4VA 2ZUPA 4YAVA 3LYPA 1UVZA 3IPZA 2IJYA 4I6XA 4MZBA 1ACVA 5EPFA 4GSSA 4JZQA 2JL4A 2H72A 1Z7RA 3MNGA 1JZOA 4EKZA 1PA3A 1HNBA 2LJKA 3DVWA 2VCQA 1YY7A 4HI7A 2CAIA 3PH9A 2ES7A 5HFKA 4O5RA 3A5IA 3GHAA 3GMFA 6GSXA 5HR2A 1K3OA 2KOKA 4L0WA 1ILOA 1DBYA 2EIQA 3IRAA 1ZL9A 2YOIA 1G6YA 14GSA 4LMVA 3IXRA 5FHIA 3U6VA 1V2AA 5E4WA 1A2LA 2L4CA 3DWVA 2XBQA 1G6WA 1QK8A 3HZ8A 3UOMA 8GSSA 2HXKA 4USSA 2VL2C 2C1YA 3M8NA 4ILFA 1K0DA 4X0XA 4TR1A 1BQ7A 1GTAA 4V2MA 4HJMA 3L9VA 4WXTA 4AJ6A 1NM3A 1OVNA 5IOXA 1HNAA 1ZCPA 4G0LA 1GLQA 2H66A 1DE1A 4IN0A 4EE0A 2YPMA 1BAYA 3FW2A 4ECCA 2OBIA 1XW6A 3EU4A 4OFTA 5IPHA 3J7Yb 5ECKB 1WE0A 4WF5A 2HFDA 4HU9A 2A4VA 2R2JA 1ABAA 2MMZA 1EV4A 3GKKA 2HRFA 2CAQA 4XS4B 3RAZA 5BRTA 2JACA 4FH8A 4POMA 2X8HA 3BOAA 2GZZA 4XIHA 2K8VA 1SL2B 2UZ8A 3IK7A 2N5AA 3C1SA 5A5KA 5IMZA 4MK3A 2HRAA 2FA4A 1F9MA 2ZCTA 4ECIA 2DJ3A 2M72A 3VLNA 2BMXA 4V2LA 1MD3A 1X5DA 1VF1A 1TRWA 4IGJA 2C3QA 5DALA 2OE0A 2WZ9A 4LLRA 3C7MA 1YF1A 2WDUA 2YJ7A 9GSSA 2DSAA 2H1AA 2H70A 1ZYNA 1UA5A 3PR8A 3R2QA 2X8GA 3ERWA 2X8CA 1QUWA 4AJ8A 4ZL7A 3DYRA 2V2GA 3ERGA 1PGTA 1FOVA 1LJRA 3M1GA 3KTBA 5DCHA 5GSSA 1GTUA 5HFGA 5IOWA 2C0DA 2A2RA 4KE3A 3KD0A 5GSTA 4BA7A 2B6MA 2EIOA 2CQ9A 3EU3A 4KNDA 4ZB6A 1OC9A 3KH9A 2C80A 1TK8B 4FYCA 3L0HA 3EWLA 2VUPA 1XZOA 2WS2A 2LRCA 2DKHA 4EF0A 1FB6A 3K8NA 3GKMA 2RUEA 4PXOA 2AHEA 1GULA 2FWFA 3LQ7A 3NIVA 2KP2A 3LSZA 2C8UA 4IELA 3HDCA 1B48A 1AXDA 1EP8A 2CVKA 5IIZA 2TRCP 5CAXA 4OO4A 1XW5A 2YZHA 4IHUA 3IK9A 1T4YA 4YKFA 2NVLA 1OC8A 1EWXA 4TVEA 3SBCA 1JFUA 2H8LA 2N5BA 5AIVA 1GWCA 1XXUA 3F6FA 2F3MA 2JSZA 3GH6A 1O8XA 1PSQA 3M9KA 2GSRA 3MSZA 4ZL8A 4TXOA 1EV9A 1YDKA 6GSUA 2X49A 2MMAA 2XBIA 5JCUA 4MJBA 1PN0A 4WBJA 4K0GA 5CNWA 1XPVA 3UAPA 4PX1A 2HE3A 2HSMA 4ZBDA 3D0ZA 1ZYQB 2WJUA 2VLUA 1J08A 4BVYA 3QMXA 4K0NA 3WT1A 1ZYEA 2PVOC 4XRAA 1ERWA 1M99A 4A5PA 5ABRA 3QDNA 2R0PA 4AF2A 4Z2RA 4FIWA 3ZL5A 4OD7A 1YZXA 2HYXA 1ST9A 3F8UA 1O73A 1TDIA 5J4UA 1GSUA 1S3AA 4PTSA 2QKEA 3CTGA 4BL7B 3MIXA 3GL3A 4BPYA 2H75A 3TJGA 2VCXA 1G7EA 1M9AA 3A2VA 4GSNA 5DVBA 1QQ2A 1OYJA 3TKSA 5F0GA 3G9BA 2C0EA 2JU5A 2PVQA 2P5QA 2F51A 2IL3A 4MZCA 2JSYA 3LYKA 4F2IA 2X99A 2LJRA 2PMTA 4TR4A 1GTIA 4DSSA 3DEXA 2YANA 5H5QA 2CV4A 2M46A 2H0HA 20GSA 6GSTA 2FUG2 4FQUA 3M0FA 3LORA 2H6XA 3FR3A 1JZRA 4NV5A 4FO5A 1WMJA 3QR6A 2RIIA 1USBA 1NSWA 1E2YA 1GUMA 4XS1A 3HCZA 3QAGA 1GSFA 1TKDB 2GTUA 4AJ7A 2YWNA 5B6NA 1X9SB 3QD9A 4ZL9A 4POLA 2IIYA 3DRNA 3F3RA 3CRUA 5ECIB 3M3MA 3FYGA 3NOFA 4K5SA 2YN1A 3OR5A 2K8SA 17GSA 5L71A 3HHVA 2P31A 2CA8A 3A2WA 4EIPA 5B6MA 4RI7A 1X9WB 1SKRB 4E8HA 3W8SA 1U3AA 2A2SA 2OKAA 5INYA 2V6KA 1OE8A 4OO5A 4P3YB 1O7UA 3MAKA 1SKWB 2OACA 4N30A 1F2EA 5AGYA 3VPTA 2PU9C 5DJMA 2OE1A 4H86A 2B1KA 3O76A 4Z7XA 3NZNA 3W6GA 4GTUA 3FHKA 1ML6A 2N5FA 2B3SA 3GH9A 4LL1B 4KA0A 3KMNA 1JZWA 1MDJA 1BJXA 1Z9HA 1THXA 3RPNA 3RHBA 1TXXA 3A2XA 11GSA 1K0CA 2YWIA 4OWYA 1R5PA 3ZYWA 4L8EA 5LD0A 1A8YA 3ZITA 4NWYA 2GLRA 4CY6A 3F4RA 3CMIA 1Q4JA 3BCKA 3ZMKA 2XHFA 1B9XC 1CQGA 1HYUA 4N0VA 2E2GA 1E6BA 2HZEB 4XS4A 3KM6A 2YP6A 5G5FA 4EUYA 4I97A 1BX9A 4MABA 4HQZA 5F05A 4TN8A 4DSQA 4X43A 2V6OA 3EYTA 3LFLA 5CYYA 3IC8A 4EXJA 4K9ZA 2FGXA 3BBYA 1RQMA 5DQYA 4OFNA 4IW9A 3LJRA 4KUNA 6GSYA 4KSOA 1SK0A 2QA1A 3D5JA 4K6XA 2HRKA 3M9JA 1U3IA 5DBQA 5COHA 3ME8A 2IMDA 1TRSA 3N9JA 1R26A 4EIQA 3FEUA 1V9WA 3GSTA 3L78A 2H0GA 4TXVA 2EC4A 1R4WA 1WOUA 2X4AA 3VWWA 4PUFC 1J9BA 4L5OA 3G7JA 4PUAA 1SJ6A 3IBHA 1SD9A 5KOWA 4POKA 4Q5FA 3H8QA 1ZMAA 2LQQA 3F3QA 1S3DA 3C73A 2QGVA 2VM1A 3GNJA 4K2XA 5KN3A 3ED3A 2RM6A 1XOBA 2GT5A 1YQ1A 3VWUA 2WCIA 2DC5A 3TKPA 1SYXA 1GH2A 5DDLA 1SJIA 3C71A 2HRNA 2ALBA 19GSA 4F0CA 4XTSA 1SJZA 2DJ0A 1Q98A 4I2TA 1J0FA 2KP1A 2R37A 3CSIA 4K7OA 4KCEA 3R3EA 2WB9A 3F4SA 4ACSA 3CBUA 3ZLPA 3IHQA 3RDWA 1EZKA 4MLYA 1XWCA 5ECNB 3ZZXA 4KB3A 2QA2A 4NXIA 2LV3A 5D96A 4Z2TA 2NBSA 2FD3A 3ZVJD 1B8XA 2PBJA 4RQRA 3KCMA 3H1NA 4WR4A 2HSHA 1W4VA 4ZBAA 3FZAA 4IJ3A 4KCAA 4O5QA 1TJDA 3ME7A 4OMVA 3UEMA 1PKWA 1T00A 1LU4A 4GWRA 3ISOA 6GSSA 1K0MA 3EVIA 1M2AA 2MMNA 1Y25A 1ZOFA 4F03A 1C72A 3LXTA 5FWGA 3TRQA 2FCHA 2H6YA 4WETA 2B1LA 2I3YA 4D73B 1BYEA 3E9JB 1JHBA 2JZSA 4NV2A 6GSVA 2G0FA 5HFIA 2A4HA 3GFKA 4JBBA 2LRNA 1T8EB 3ZFLA 3I43A 4IP6A 2DMMA 3TJFA 5CREA 1AAZA 4O32A 3EMPA 5ECSA 2DIYA 2PWJA 4GLTA 2GSSA 4I2UA 1HD2A 4I8BA 4TOPA 4K7NA 4WEYA 1M0UA 4YAPA 3LEFA 4ZIJA 2VL2A 3P7XA 2B7JA 2PUKC 2DMLA 3HJOA 2VLTA 3TOUA 4HEA2 2DJ2A 4BL7A 3FRCA 1K0NA 1EP7A 3D22A 3G7IA 4TR3A 1VF3A 2C0GA 2LUSA 1PD21 1LBKA 1X5CA 4K5RA 1QXHA 5IMCA 2MZCA 2R6KA 3TRPA 4K2DA 1YEPA 3LXZA 2OA7A 4MCUA 1PQNA 4J57E 4NHWA 2L5LA 2MMOA 1B4QA 2O85A 5HR3A 3QFBC 1XCCA 2GQMA 1YEXA 3A5WA 1Z3EA 3UVHA 3KH7A 2REMA 5CRWA 4PURA 4MZWA 3KZQA 5ENUA 4TRXA 4O7HA 2VIMA 3SWLA 16GSA 2FWEA 3TB2A 4DSRA 4HJ2A 1JZDA 2MYGA 1TRUA 1S3CA 3WGEA 5EY6A 1N8JA 4PGTA 4IVFA 3Q6OA 3BD2A 1T4ZA 3FR6A 1R7HA 4HUAA 1FAAA 2DJ1A 1SYRA 3HKRA 3KJYA 1XVWA 2X64A 2DBCA 4YQVA 2FWGA 1MTCA 5B8BA 4V1Ap 3GX0A 2IPAA 2B5EA 4WR5A 5G30A 3UJ1A 2DJKA 4NPBA 1K0OA 3C8EA 3GV1A 3UIWA 1PKZA 3HY2A 1OKTA 3U5RE 2ON5A 5D8IA 4X4JA 12GSA 5G1KA 2O89A 2FWHA 4XHMA 2L5OA 1FVJA 4JR6A 1NW2A 3I6AA 2V41A 1NHOA 1GSQA 1G0TA 1V98A 5ID2B 2LQOA 1YKAA 1GRXA 5J9CA 5JWQB 4ZB9A 5J3RA 3GA4A 3KP9A 5IMVA 5J41A 3L9SA 4CY8A 3VK9A 3D4MA 4RI6A 4IKHA 4GXZA 2AAWA 2R4VA 3DXBA 3KIJA 4XS6A 1FHEA 3I69A 1VGLA 5JWRB 3EINA 2GZPA 2I9HA 5ECOB 2VCZA 2HZEA 3DVXA 2VL3A 1MDIA 3W8JA 3F9UA 4WKWA 5HR0A 3S9FA 2I4AA 3IE3A 3CXGA 2A2PA 1SD8A 4G0KA 3GX8A 1XVQA 5F06A 1GTBA 2YZUA 3FKFA 3GL5A 2H01A 2HNLA 2VM2A 2C4JA 3D6IA 1EEMA 1MEKA 5ECHB 3Q74A 1TU8A 1SL1B 1BG5A 4HU7A 5KN1A 3HVXA 5F07A 3GUSA 1W89A 3QCPA 4JEDA 1XWGA 3VI7A 4YQMA 5EL8A 2L6DA 3DD3A 2NPBA 2YWMA 2LS5A 4YQUA 5G1LA 2CT6A 3ZIVA 1KTEA 3HVVA 1B4PA 1AUCA 2H1GA 4PQ1A 1GSDA 2MBTA 3GURA 5G2ZA 3RPPA 4LA1A 4J56E 5H5SA 3VWVA 5ECLB 2M80A 5IPGA 3IAM2 4LL4B 1OE7A 2RM5A 3Q19A 3IA1A 4ICYA 4IP1A 5CP1A 4K8MA 3O3TA 4PNGA 1QFNA 5BMUA 1CQHA 1K3YA 5E59A 4ZILA 1YF0A 3TKRA 2YV9A 1AC1A 2E2MA 4KF9A 2PN8A 2GSTA 2H71A 2L6CA 2VOCA 4CHSA 4MNNA 5J9BA 3KTLA 4RUVA 4Q5QA 3VI5A 3QFAC 3VFIA 2LNSA 4WF4A 3TKQA 4MPFA 1XIYA 2Z9SA 3UARA 5G31A 2MBSA 4EVMA 1O6JA 2DJJA 2YV7A 4NMUA 5DQSA 3FMWA 2VCVA 4QL7A 3GRXA 2R5GA 1AQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CO3 A;  3AY8 A;  5IMA A;  3TUE A;  4MF7 A;  4KAE A;  2HZF A;  2C3N A;  1GSE A;  2WUL A;  3QPM A;  3Q18 A;  5AIS A;  3HJP A;  1AIU A;  5J5N A;  2O87 A;  2GT6 A;  3TDG A;  1B9Y C;  4N11 A;  4D73 A;  3IC4 A;  3GSS A;  4OFM A;  3BCI A;  2WRT A;  2HSY A;  5IO0 A;  1A23 A;  1Z6N A;  2IMI A;  1MDK A;  3GTU B;  2IME A;  5ECP B;  4EO3 A;  3VWX A;  2JAD A;  4KDX A;  1YJ6 A;  5D9V A;  1QMV A;  4LMW A;  4QL9 A;  5JCG A;  2IWT A;  5D73 A;  2XPE A;  4MJA A;  18GS A;  3L4N A;  3DIE A;  4HZ2 A;  3P8W A;  3ZTL A;  1PN9 A;  2OBK A;  4MPG A;  3H79 A;  4PQI A;  4ZB8 A;  2LNT A;  5D9T A;  4HDE A;  4RQX A;  5LCZ A;  1T7P B;  1XW9 A;  3FZ5 A;  1K0B A;  3VPQ A;  5CRD A;  3H4K A;  3UBK A;  2RUF A;  3QOU A;  4KDY A;  4OCE A;  7GSS A;  1UC7 A;  3HD5 A;  1V40 A;  1GL8 A;  3MDK A;  1GSY A;  1AQX A;  2GGT A;  2G2Q A;  1ERT A;  2GZY A;  3A3T A;  3UBL A;  1U88 A;  3ZIJ A;  1EGO A;  3ZRD A;  3APS A;  1N2A A;  2AB6 A;  5G5E A;  1KBN A;  2LRT A;  4EDZ A;  4XRD A;  2YWO A;  1ZZY A;  3P90 A;  2KLX A;  1PL2 A;  3IV4 A;  5JCW A;  1KNG A;  4K1F A;  2VD1 A;  2F8A A;  1IYH A;  22GS A;  5H5R A;  2VCW A;  1A8L A;  1GNW A;  1RK4 A;  1U87 A;  2WFC A;  3LWA A;  3CSJ A;  1QGV A;  1Z6M A;  3KGK A;  3FZ9 A;  3IAS 2;  4MF6 A;  2GQL A;  1X5E A;  3TJJ A;  3J7Y k;  4XCS A;  4ML1 A;  4HOJ A;  3UMA A;  4ECB A;  2H6Z A;  1EOH A;  1K3L A;  5ID2 A;  1TK0 B;  2H19 A;  4CW9 A;  3IDV A;  1M2B A;  2OE3 A;  5D93 A;  4MA9 A;  5HQP A;  5DAK B;  1ON4 A;  3H93 A;  1EEJ A;  2O8V B;  3TRX A;  3FR9 A;  2AUV A;  1Y6E A;  2CX4 A;  5KN0 A;  1TP9 A;  4NHZ A;  4NAX A;  5IMD A;  2GDR A;  2C0F A;  3MWH A;  1THO A;  3TKS E;  1H4O A;  4IQA A;  2H1D A;  1ZGN A;  3EE2 A;  4O92 A;  1F3B A;  3APQ A;  1GLP A;  5ELA A;  4BWS A;  4IBP A;  2YNX A;  4QQ7 A;  4PQH A;  4MF5 A;  1VF2 A;  4POB A;  4YH2 A;  2IFQ B;  2E0Q A;  1AQW A;  3HA9 A;  3G7Y A;  2WGR A;  4KX4 A;  2HLS A;  3LGC A;  4MMM A;  5AN1 A;  5JWO B;  1KEB A;  1TI3 A;  5HR1 A;  5GAP D;  4L5L A;  2FLS A;  4GQF A;  2TIR A;  1I5G A;  3GKN A;  1R5A A;  3APO A;  5KN2 A;  4OCF A;  4F0B A;  3FY7 A;  1T1V A;  3FK8 A;  4MDC A;  5EVO A;  1HQO A;  2VO4 A;  4MH2 A;  1PL1 A;  2FA8 A;  3WYW A;  4KW6 A;  2JZT A;  3C1R A;  4K7I A;  1FVK A;  2E7P A;  1TOF A;  3WD6 A;  2B7K A;  3TJB A;  2XPD A;  1V58 A;  3RHC A;  2GSQ A;  1X9M B;  5CRG A;  2VLV A;  2QSI A;  1WIK A;  1Z7P A;  3TCO A;  5B8A A;  4V2N A;  1NHY A;  1GNE A;  1SK1 A;  1UN2 A;  3PIN A;  1FG4 A;  3CYN A;  2K6V A;  2IMF A;  1TW9 A;  1I9D A;  1U6T A;  2OAD A;  3D21 A;  1VRS D;  5IM9 A;  1VF4 A;  4Q5N A;  5A4W A;  1ERV A;  5DJL A;  2IN3 A;  2KUC A;  4HZ4 A;  3IOS A;  4PNF A;  4TR1 B;  3TOT A;  3KEB A;  1EGR A;  4JR4 A;  1A24 A;  1XOA A;  1IYI A;  4TR0 A;  5ECQ B;  3F4T A;  2P5R A;  4ID0 A;  3US3 A;  5B7C A;  3TKS C;  2AV4 A;  1GSS A;  3DGQ A;  1X0R A;  2VL9 A;  1EOG A;  3P2A A;  1FO5 A;  3QAW A;  1T3B A;  2NDO A;  2VD0 A;  3E0U A;  2V1M A;  5C04 A;  2R3X A;  1K0A A;  1A2J A;  3ZML A;  2F8F A;  2J9H A;  4HS1 A;  4N10 A;  1DUG A;  4G19 A;  2D2Z A;  1SKS B;  1OKD A;  4MP4 A;  1WPI A;  1GP1 A;  1TTZ A;  2KHP A;  5IQY A;  1PMT A;  1WP0 A;  2FY6 A;  4I5Q A;  2CZ2 A;  3PGT A;  1DSB A;  3F6D A;  3ZRE A;  5ELG A;  3F0I A;  1A0R P;  2BTO T;  3ZVJ A;  2H30 A;  3CTF A;  3WGX A;  1PX6 A;  2PGT A;  3EMX A;  5DAL B;  3V1W A;  1YKC A;  3ZFB A;  3WGD A;  1XWK A;  4E8E A;  4AGS A;  1M2D A;  5A4U A;  2ON7 A;  1WJK A;  2LTK A;  3UL3 A;  2HI7 A;  3GTU A;  3HVS A;  5D9X A;  3HYP A;  5D9W A;  4IJI A;  4G2E A;  4MJE A;  1O85 A;  2IMK A;  2K9F A;  2L57 A;  4EL1 A;  4GRF A;  1MD4 A;  2I81 A;  2B5Y A;  3O6T A;  5IO2 A;  4ISD A;  3HXS A;  2RLI A;  2PPT A;  1RW1 A;  4GST A;  5LNK e;  1OC3 A;  1SL0 B;  2V32 A;  4EC0 A;  4JU5 A;  3N5O A;  4ZBB A;  3DML A;  1DE2 A;  6GSW A;  1BED A;  2DIZ A;  1OC9 B;  4JE1 A;  2FHE A;  1JLW A;  3TJK A;  1TRV A;  3JCM L;  1G7O A;  4MJC A;  4ULX A;  1JLV A;  1Z5Y E;  2VCT A;  1URM A;  4N0Z A;  1V57 A;  2PER A;  3E3E A;  1F3A A;  3I9V 2;  3EC3 A;  5FT3 A;  2CX3 A;  2H76 A;  2YCD A;  4FYU A;  4IQ1 A;  2H1B A;  4EDY A;  2LEG A;  4FYB A;  2B5X A;  3RBT A;  4IS0 A;  3EUR A;  3HZ4 A;  2LST A;  1F6M C;  2H0I A;  1M7T A;  3WT2 A;  5F8B A;  2AYT A;  1XWB A;  2YJH A;  4KSM A;  2H74 A;  4G10 A;  1GUK A;  1OAZ A;  4BWQ A;  2L59 A;  4MH3 A;  5C00 A;  2LJA A;  3ERF A;  4BVX A;  1H75 A;  2JZR A;  1PRX A;  5DCG A;  3UVT A;  2VAF A;  2QC7 A;  3GIX A;  4TXO B;  2GS3 A;  2K18 A;  3GN3 A;  4DVC A;  2GQK A;  4KDU A;  2FNO A;  1A0F A;  2CZ3 A;  2CVB A;  3CRT A;  4ML6 A;  2NTO A;  10GS A;  1TI1 A;  4WBR D;  4J2F A;  3KMO A;  1A2M A;  2TRX A;  1ERU A;  1XWA A;  2HT9 A;  3F63 A;  1PX7 A;  1XBS A;  5IMF A;  4GQC A;  3L9U A;  3FZ4 A;  2P0G A;  2ZNM A;  2DLX A;  4ECJ A;  1XFL A;  4KGI A;  1FW1 A;  1M9B A;  2I1U A;  2OJL A;  2C3T A;  5AIX A;  4G9H A;  3CSH A;  1F37 A;  4ZXG A;  2L4Q A;  1TU7 A;  2BJX A;  5DAK A;  1O8W A;  3LG6 A;  2EIR A;  2GVP A;  1WWJ A;  5CRH A;  4L0U A;  4X1U A;  5GAN D;  4JRR A;  5GZZ B;  1WRY A;  3GKX A;  5ECM B;  1GUH A;  2CVD A;  3TGZ A;  4TW5 A;  2O7K A;  1SEN A;  4DEJ A;  1SK2 A;  1AW9 A;  2H73 A;  4F9Z A;  3IR4 A;  3QAV A;  1O81 A;  13GS A;  4F82 A;  1TK5 B;  4DSS B;  2LKU A;  3VUR A;  4HQS A;  2IFQ A;  4GCI A;  5KEJ A;  4CDO A;  1HNC A;  3KP8 A;  4Q5R A;  4V1A g;  4GF0 A;  2J23 A;  1FB0 A;  3D4T A;  3DKS A;  3HJM A;  1SU9 A;  3KXO A;  5ECR B;  2XC2 A;  4TKY A;  2AJQ B;  3GYK A;  4KH7 A;  3BJ5 A;  2F9S A;  5A4V A;  2ZUP A;  4YAV A;  3LYP A;  1UVZ A;  3IPZ A;  2IJY A;  4I6X A;  4MZB A;  1ACV A;  5EPF A;  4GSS A;  4JZQ A;  2JL4 A;  2H72 A;  1Z7R A;  3MNG A;  1JZO A;  4EKZ A;  1PA3 A;  1HNB A;  2LJK A;  3DVW A;  2VCQ A;  1YY7 A;  4HI7 A;  2CAI A;  3PH9 A;  2ES7 A;  5HFK A;  4O5R A;  3GHA A;  3GMF A;  6GSX A;  5HR2 A;  1K3O A;  2KOK A;  4L0W A;  1ILO A;  1DBY A;  2EIQ A;  3IRA A;  1ZL9 A;  2YOI A;  1G6Y A;  14GS A;  4LMV A;  3IXR A;  5FHI A;  3U6V A;  1V2A A;  5E4W A;  1A2L A;  2L4C A;  3DWV A;  2XBQ A;  1G6W A;  1QK8 A;  3HZ8 A;  3UOM A;  8GSS A;  2HXK A;  2VL2 C;  2C1Y A;  3M8N A;  4ILF A;  1K0D A;  4X0X A;  4TR1 A;  1BQ7 A;  1GTA A;  4V2M A;  4HJM A;  3L9V A;  4WXT A;  4AJ6 A;  1NM3 A;  1OVN A;  5IOX A;  1HNA A;  1ZCP A;  1GLQ A;  2H66 A;  1DE1 A;  4IN0 A;  4EE0 A;  2YPM A;  1BAY A;  3FW2 A;  4ECC A;  2OBI A;  1XW6 A;  3EU4 A;  4OFT A;  5IPH A;  3J7Y b;  5ECK B;  1WE0 A;  4WF5 A;  2HFD A;  4HU9 A;  2A4V A;  2R2J A;  1ABA A;  2MMZ A;  1EV4 A;  3GKK A;  2HRF A;  2CAQ A;  4XS4 B;  3RAZ A;  2JAC A;  4FH8 A;  4POM A;  2X8H A;  3BOA A;  2GZZ A;  4XIH A;  2K8V A;  1SL2 B;  3IK7 A;  2N5A A;  3C1S A;  5A5K A;  5IMZ A;  4MK3 A;  2FA4 A;  1F9M A;  2ZCT A;  4ECI A;  2DJ3 A;  2M72 A;  3VLN A;  2BMX A;  4V2L A;  1MD3 A;  1X5D A;  1VF1 A;  1TRW A;  4IGJ A;  2C3Q A;  5DAL A;  2OE0 A;  2WZ9 A;  4LLR A;  3C7M A;  1YF1 A;  2WDU A;  2YJ7 A;  9GSS A;  2DSA A;  2H1A A;  2H70 A;  1UA5 A;  3PR8 A;  3R2Q A;  2X8G A;  3ERW A;  2X8C A;  1QUW A;  4AJ8 A;  4ZL7 A;  3DYR A;  2V2G A;  3ERG A;  1PGT A;  1FOV A;  1LJR A;  3M1G A;  3KTB A;  5DCH A;  5GSS A;  1GTU A;  5HFG A;  5IOW A;  2C0D A;  2A2R A;  4KE3 A;  3KD0 A;  5GST A;  4BA7 A;  2B6M A;  2EIO A;  2CQ9 A;  3EU3 A;  4KND A;  4ZB6 A;  1OC9 A;  3KH9 A;  2C80 A;  1TK8 B;  4FYC A;  3L0H A;  3EWL A;  2VUP A;  1XZO A;  2WS2 A;  2LRC A;  4EF0 A;  1FB6 A;  3K8N A;  3GKM A;  2RUE A;  4PXO A;  2AHE A;  1GUL A;  2FWF A;  3LQ7 A;  3NIV A;  2KP2 A;  3LSZ A;  2C8U A;  4IEL A;  3HDC A;  1B48 A;  1AXD A;  1EP8 A;  2CVK A;  5IIZ A;  2TRC P;  5CAX A;  4OO4 A;  1XW5 A;  2YZH A;  4IHU A;  3IK9 A;  1T4Y A;  2NVL A;  1OC8 A;  1EWX A;  4TVE A;  3SBC A;  1JFU A;  2H8L A;  2N5B A;  5AIV A;  1GWC A;  1XXU A;  3F6F A;  2F3M A;  2JSZ A;  3GH6 A;  1O8X A;  1PSQ A;  3M9K A;  2GSR A;  3MSZ A;  4ZL8 A;  4TXO A;  1EV9 A;  1YDK A;  6GSU A;  2MMA A;  2XBI A;  5JCU A;  4MJB A;  4WBJ A;  4K0G A;  5CNW A;  1XPV A;  3UAP A;  4PX1 A;  2HE3 A;  4ZBD A;  3D0Z A;  1ZYQ B;  2WJU A;  2VLU A;  1J08 A;  4BVY A;  3QMX A;  4K0N A;  3WT1 A;  1ZYE A;  2PVO C;  4XRA A;  1ERW A;  1M99 A;  5ABR A;  3QDN A;  4AF2 A;  4FIW A;  3ZL5 A;  4OD7 A;  1YZX A;  2HYX A;  1ST9 A;  3F8U A;  1O73 A;  1TDI A;  5J4U A;  1GSU A;  1S3A A;  2QKE A;  3CTG A;  3GL3 A;  4BPY A;  2H75 A;  3TJG A;  2VCX A;  1G7E A;  1M9A A;  3A2V A;  4GSN A;  5DVB A;  1QQ2 A;  1OYJ A;  3TKS A;  5F0G A;  3G9B A;  2C0E A;  2JU5 A;  2PVQ A;  2P5Q A;  2F51 A;  2IL3 A;  4MZC A;  2JSY A;  3LYK A;  4F2I A;  2X99 A;  2LJR A;  2PMT A;  4TR4 A;  1GTI A;  4DSS A;  3DEX A;  2YAN A;  5H5Q A;  2CV4 A;  2M46 A;  2H0H A;  20GS A;  6GST A;  2FUG 2;  3M0F A;  3LOR A;  2H6X A;  3FR3 A;  1JZR A;  4NV5 A;  4FO5 A;  1WMJ A;  3QR6 A;  2RII A;  1USB A;  1NSW A;  1E2Y A;  1GUM A;  4XS1 A;  3HCZ A;  3QAG A;  1GSF A;  1TKD B;  2GTU A;  4AJ7 A;  2YWN A;  5B6N A;  1X9S B;  3QD9 A;  4ZL9 A;  4POL A;  2IIY A;  3DRN A;  3F3R A;  3CRU A;  5ECI B;  3M3M A;  3FYG A;  3NOF A;  2YN1 A;  3OR5 A;  2K8S A;  17GS A;  5L71 A;  3HHV A;  2P31 A;  2CA8 A;  3A2W A;  5B6M A;  4RI7 A;  1X9W B;  1SKR B;  4E8H A;  3W8S A;  1U3A A;  2A2S A;  2OKA A;  5INY A;  2V6K A;  1OE8 A;  4OO5 A;  4P3Y B;  1O7U A;  3MAK A;  1SKW B;  2OAC A;  4N30 A;  1F2E A;  5AGY A;  3VPT A;  2PU9 C;  5DJM A;  2OE1 A;  4H86 A;  2B1K A;  3O76 A;  4Z7X A;  3NZN A;  3W6G A;  4GTU A;  3FHK A;  1ML6 A;  2N5F A;  2B3S A;  3GH9 A;  4LL1 B;  4KA0 A;  3KMN A;  1JZW A;  1MDJ A;  1BJX A;  1Z9H A;  1THX A;  3RPN A;  3RHB A;  1TXX A;  3A2X A;  11GS A;  1K0C A;  2YWI A;  4OWY A;  1R5P A;  3ZYW A;  4L8E A;  5LD0 A;  1A8Y A;  3ZIT A;  4NWY A;  2GLR A;  3F4R A;  3CMI A;  1Q4J A;  3BCK A;  3ZMK A;  2XHF A;  1B9X C;  1CQG A;  1HYU A;  4N0V A;  2E2G A;  1E6B A;  2HZE B;  4XS4 A;  3KM6 A;  2YP6 A;  5G5F A;  4EUY A;  4I97 A;  1BX9 A;  4MAB A;  4HQZ A;  5F05 A;  4TN8 A;  4DSQ A;  4X43 A;  2V6O A;  3EYT A;  3LFL A;  5CYY A;  4EXJ A;  4K9Z A;  2FGX A;  3BBY A;  1RQM A;  5DQY A;  4OFN A;  4IW9 A;  3LJR A;  4KUN A;  6GSY A;  4KSO A;  1SK0 A;  3D5J A;  4K6X A;  3M9J A;  1U3I A;  5DBQ A;  5COH A;  3ME8 A;  2IMD A;  1TRS A;  3N9J A;  1R26 A;  3FEU A;  1V9W A;  3GST A;  3L78 A;  2H0G A;  4TXV A;  2EC4 A;  1R4W A;  1WOU A;  3VWW A;  4PUF C;  1J9B A;  4L5O A;  3G7J A;  4PUA A;  1SJ6 A;  3IBH A;  1SD9 A;  4POK A;  4Q5F A;  3H8Q A;  1ZMA A;  2LQQ A;  3F3Q A;  1S3D A;  3C73 A;  2QGV A;  2VM1 A;  3GNJ A;  5KN3 A;  3ED3 A;  2RM6 A;  1XOB A;  2GT5 A;  1YQ1 A;  3VWU A;  2WCI A;  2DC5 A;  3TKP A;  1SYX A;  1GH2 A;  5DDL A;  1SJI A;  3C71 A;  2HRN A;  2ALB A;  19GS A;  4F0C A;  4XTS A;  1SJZ A;  2DJ0 A;  1Q98 A;  4I2T A;  1J0F A;  2KP1 A;  2R37 A;  3CSI A;  4K7O A;  4KCE A;  2WB9 A;  3F4S A;  4ACS A;  3CBU A;  3ZLP A;  3IHQ A;  3RDW A;  1EZK A;  4MLY A;  1XWC A;  5ECN B;  3ZZX A;  4KB3 A;  4NXI A;  2LV3 A;  5D96 A;  2NBS A;  2FD3 A;  3ZVJ D;  1B8X A;  2PBJ A;  4RQR A;  3KCM A;  3H1N A;  4WR4 A;  2HSH A;  1W4V A;  4ZBA A;  3FZA A;  4IJ3 A;  4KCA A;  1TJD A;  3ME7 A;  4OMV A;  3UEM A;  1PKW A;  1T00 A;  1LU4 A;  4GWR A;  3ISO A;  6GSS A;  1K0M A;  3EVI A;  1M2A A;  2MMN A;  1Y25 A;  1ZOF A;  4F03 A;  1C72 A;  3LXT A;  5FWG A;  3TRQ A;  2FCH A;  2H6Y A;  4WET A;  2B1L A;  2I3Y A;  4D73 B;  1BYE A;  3E9J B;  1JHB A;  2JZS A;  4NV2 A;  6GSV A;  2G0F A;  5HFI A;  3GFK A;  4JBB A;  2LRN A;  1T8E B;  3ZFL A;  3I43 A;  4IP6 A;  2DMM A;  3TJF A;  5CRE A;  1AAZ A;  4O32 A;  3EMP A;  5ECS A;  2DIY A;  2PWJ A;  4GLT A;  2GSS A;  4I2U A;  1HD2 A;  4I8B A;  4TOP A;  4K7N A;  4WEY A;  1M0U A;  4YAP A;  3LEF A;  4ZIJ A;  2VL2 A;  3P7X A;  2B7J A;  2PUK C;  2DML A;  3HJO A;  2VLT A;  3TOU A;  4HEA 2;  2DJ2 A;  4BL7 A;  3FRC A;  1K0N A;  1EP7 A;  3D22 A;  3G7I A;  4TR3 A;  1VF3 A;  2C0G A;  2LUS A;  1PD2 1;  1LBK A;  1X5C A;  1QXH A;  5IMC A;  2MZC A;  2R6K A;  3TRP A;  4K2D A;  1YEP A;  3LXZ A;  2OA7 A;  4MCU A;  1PQN A;  4J57 E;  4NHW A;  2L5L A;  2MMO A;  1B4Q A;  2O85 A;  5HR3 A;  3QFB C;  1XCC A;  2GQM A;  1YEX A;  3A5W A;  1Z3E A;  3UVH A;  3KH7 A;  2REM A;  5CRW A;  4PUR A;  4MZW A;  3KZQ A;  5ENU A;  4TRX A;  4O7H A;  2VIM A;  3SWL A;  16GS A;  2FWE A;  3TB2 A;  4DSR A;  4HJ2 A;  1JZD A;  2MYG A;  1TRU A;  1S3C A;  3WGE A;  5EY6 A;  1N8J A;  4PGT A;  4IVF A;  3Q6O A;  3BD2 A;  1T4Z A;  3FR6 A;  1R7H A;  4HUA A;  1FAA A;  2DJ1 A;  1SYR A;  3HKR A;  3KJY A;  1XVW A;  2X64 A;  2DBC A;  4YQV A;  2FWG A;  1MTC A;  5B8B A;  4V1A p;  3GX0 A;  2IPA A;  2B5E A;  4WR5 A;  5G30 A;  3UJ1 A;  2DJK A;  4NPB A;  1K0O A;  3C8E A;  3GV1 A;  3UIW A;  1PKZ A;  3HY2 A;  1OKT A;  3U5R E;  2ON5 A;  5D8I A;  12GS A;  5G1K A;  2O89 A;  2FWH A;  4XHM A;  2L5O A;  1FVJ A;  4JR6 A;  1NW2 A;  3I6A A;  2V41 A;  1NHO A;  1GSQ A;  1G0T A;  1V98 A;  5ID2 B;  2LQO A;  1YKA A;  1GRX A;  5J9C A;  5JWQ B;  4ZB9 A;  5J3R A;  3GA4 A;  3KP9 A;  5IMV A;  5J41 A;  3L9S A;  3VK9 A;  3D4M A;  4RI6 A;  4IKH A;  4GXZ A;  2AAW A;  2R4V A;  3DXB A;  3KIJ A;  4XS6 A;  1FHE A;  3I69 A;  1VGL A;  5JWR B;  3EIN A;  2GZP A;  2I9H A;  5ECO B;  2VCZ A;  2HZE A;  3DVX A;  2VL3 A;  1MDI A;  3W8J A;  3F9U A;  4WKW A;  5HR0 A;  3S9F A;  2I4A A;  3IE3 A;  3CXG A;  1SD8 A;  3GX8 A;  1XVQ A;  5F06 A;  1GTB A;  2YZU A;  3FKF A;  3GL5 A;  2H01 A;  2HNL A;  2VM2 A;  2C4J A;  3D6I A;  1EEM A;  1MEK A;  5ECH B;  3Q74 A;  1TU8 A;  1SL1 B;  1BG5 A;  4HU7 A;  5KN1 A;  3HVX A;  5F07 A;  3GUS A;  1W89 A;  3QCP A;  4JED A;  1XWG A;  3VI7 A;  4YQM A;  5EL8 A;  2L6D A;  3DD3 A;  2NPB A;  2YWM A;  2LS5 A;  4YQU A;  5G1L A;  2CT6 A;  3ZIV A;  1KTE A;  3HVV A;  1B4P A;  1AUC A;  2H1G A;  4PQ1 A;  1GSD A;  2MBT A;  3GUR A;  5G2Z A;  3RPP A;  4LA1 A;  4J56 E;  5H5S A;  3VWV A;  5ECL B;  2M80 A;  5IPG A;  3IAM 2;  4LL4 B;  1OE7 A;  2RM5 A;  3Q19 A;  3IA1 A;  4IP1 A;  5CP1 A;  4K8M A;  3O3T A;  4PNG A;  1QFN A;  1CQH A;  1K3Y A;  5E59 A;  4ZIL A;  1YF0 A;  3TKR A;  2YV9 A;  1AC1 A;  2E2M A;  2PN8 A;  2GST A;  2H71 A;  2L6C A;  2VOC A;  4CHS A;  5J9B A;  3KTL A;  4RUV A;  4Q5Q A;  3VI5 A;  3QFA C;  3VFI A;  2LNS A;  4WF4 A;  3TKQ A;  4MPF A;  1XIY A;  2Z9S A;  3UAR A;  5G31 A;  2MBS A;  4EVM A;  1O6J A;  2DJJ A;  2YV7 A;  4NMU A;  5DQS A;  2VCV A;  4QL7 A;  3GRX A;  2R5G A;  1AQV A; 
#chains in the Genus database with same CATH topology
 5CO3 A;  3AY8 A;  5IMA A;  3TUE A;  4MF7 A;  4KAE A;  2HZF A;  2C3N A;  1GSE A;  2WUL A;  3QPM A;  3Q18 A;  5AIS A;  3HJP A;  1AIU A;  5J5N A;  2O87 A;  2GT6 A;  3TDG A;  1B9Y C;  4N11 A;  4D73 A;  3IC4 A;  3GSS A;  4OFM A;  3BCI A;  2WRT A;  2HSY A;  5IO0 A;  1A23 A;  1Z6N A;  2IMI A;  1MDK A;  3GTU B;  2IME A;  5ECP B;  4EO3 A;  3VWX A;  2JAD A;  4KDX A;  1YJ6 A;  5D9V A;  1QMV A;  4LMW A;  4QL9 A;  5JCG A;  2IWT A;  5D73 A;  2XPE A;  4MJA A;  18GS A;  3L4N A;  3DIE A;  4HZ2 A;  3P8W A;  3ZTL A;  1PN9 A;  2OBK A;  4MPG A;  3H79 A;  4PQI A;  4ZB8 A;  2LNT A;  5D9T A;  4HDE A;  4RQX A;  5LCZ A;  1T7P B;  1XW9 A;  3FZ5 A;  1K0B A;  3VPQ A;  5CRD A;  3H4K A;  3UBK A;  2RUF A;  3QOU A;  4KDY A;  4OCE A;  7GSS A;  1UC7 A;  3HD5 A;  1V40 A;  1GL8 A;  3MDK A;  1GSY A;  3LW9 A;  1AQX A;  2GGT A;  2G2Q A;  1ERT A;  2GZY A;  3A3T A;  3UBL A;  1U88 A;  3ZIJ A;  1EGO A;  3ZRD A;  3APS A;  1N2A A;  2AB6 A;  5G5E A;  1KBN A;  2LRT A;  4EDZ A;  4XRD A;  2YWO A;  1ZZY A;  3P90 A;  2KLX A;  1PL2 A;  3IV4 A;  5JCW A;  1KNG A;  4K1F A;  2VD1 A;  3MYD A;  4BVX B;  2F8A A;  1IYH A;  22GS A;  5H5R A;  2VCW A;  1A8L A;  1GNW A;  1RK4 A;  1U87 A;  2WFC A;  3LWA A;  3CSJ A;  1QGV A;  1Z6M A;  3KGK A;  3FZ9 A;  3IAS 2;  4MF6 A;  2GQL A;  1X5E A;  4YKG A;  3TJJ A;  1S3R A;  3J7Y k;  4XCS A;  4ML1 A;  4HOJ A;  3UMA A;  1ZYP A;  2H6Z A;  4ECB A;  1EOH A;  1K3L A;  5ID2 A;  1TK0 B;  2H19 A;  4CW9 A;  3IDV A;  1M2B A;  2OE3 A;  5D93 A;  4MA9 A;  5HQP A;  5DAK B;  1ON4 A;  3H93 A;  1EEJ A;  2O8V B;  3TRX A;  3FR9 A;  2AUV A;  1Y6E A;  2CX4 A;  5KN0 A;  1TP9 A;  4NHZ A;  4NAX A;  5IMD A;  2GDR A;  2C0F A;  3MWH A;  1THO A;  3TKS E;  1H4O A;  4IQA A;  2H1D A;  1ZGN A;  3EE2 A;  4O92 A;  1F3B A;  3APQ A;  1GLP A;  5ELA A;  4BWS A;  4IBP A;  2YNX A;  4QQ7 A;  4PQH A;  4MF5 A;  1VF2 A;  4POB A;  4YH2 A;  2IFQ B;  4HSC X;  2E0Q A;  1AQW A;  3HA9 A;  3G7Y A;  2WGR A;  4KX4 A;  2HLS A;  3LGC A;  5KOX A;  4MMM A;  5AN1 A;  5JWO B;  1KEB A;  1TI3 A;  5HR1 A;  4O5U A;  5GAP D;  4L5L A;  2FLS A;  4GQF A;  2TIR A;  1I5G A;  3GKN A;  1R5A A;  3APO A;  5KN2 A;  4OCF A;  4G0I A;  4F0B A;  3FY7 A;  1T1V A;  3FK8 A;  2DKI A;  4MDC A;  5EVO A;  1HQO A;  2VO4 A;  4MH2 A;  1PL1 A;  2FA8 A;  3WYW A;  4KW6 A;  3CQF A;  2JZT A;  3C1R A;  4K7I A;  1FVK A;  2E7P A;  1TOF A;  3WD6 A;  2B7K A;  3TJB A;  2XPD A;  1V58 A;  3RHC A;  2GSQ A;  1X9M B;  5CRG A;  2VLV A;  2QSI A;  1WIK A;  1Z7P A;  3TCO A;  5B8A A;  4V2N A;  1NHY A;  1GNE A;  1SK1 A;  1UN2 A;  3PIN A;  1FG4 A;  3CYN A;  2K6V A;  2IMF A;  1TW9 A;  1I9D A;  1U6T A;  2OAD A;  3D21 A;  1VRS D;  5IM9 A;  1VF4 A;  4Q5N A;  5A4W A;  1ERV A;  5DJL A;  2IN3 A;  2KUC A;  4HZ4 A;  3IOS A;  4PNF A;  4TR1 B;  3TOT A;  3KEB A;  1EGR A;  4JR4 A;  1A24 A;  1XOA A;  1IYI A;  4TR0 A;  5ECQ B;  3F4T A;  2P5R A;  4ID0 A;  3US3 A;  5B7C A;  3TKS C;  2AV4 A;  1GSS A;  3DGQ A;  1X0R A;  2VL9 A;  1EOG A;  3P2A A;  1FO5 A;  3QAW A;  1T3B A;  2NDO A;  2VD0 A;  3E0U A;  2V1M A;  5C04 A;  2R3X A;  1K0A A;  1A2J A;  3ZML A;  2F8F A;  2J9H A;  4HS1 A;  4N10 A;  1DUG A;  4G19 A;  2D2Z A;  1SKS B;  1OKD A;  4MP4 A;  1WPI A;  1GP1 A;  1TTZ A;  2KHP A;  5IQY A;  1PMT A;  1WP0 A;  2FY6 A;  4I5Q A;  2CZ2 A;  3PGT A;  1DSB A;  3F6D A;  3ZRE A;  5ELG A;  3F0I A;  1A0R P;  2BTO T;  3ZVJ A;  2H30 A;  3CTF A;  3WGX A;  1PX6 A;  2PGT A;  3EMX A;  5DAL B;  3V1W A;  1YKC A;  3ZFB A;  3WGD A;  1XWK A;  4E8E A;  4AGS A;  1M2D A;  5A4U A;  2ON7 A;  1WJK A;  2LTK A;  3UL3 A;  2HI7 A;  3GTU A;  3HVS A;  5D9X A;  3HYP A;  2R0G A;  5D9W A;  4IJI A;  4G2E A;  4MJE A;  1O85 A;  2IMK A;  2K9F A;  2L57 A;  4EL1 A;  4GRF A;  1MD4 A;  2I81 A;  2B5Y A;  3O6T A;  5IO2 A;  4ISD A;  3HXS A;  2RLI A;  2PPT A;  1RW1 A;  4GST A;  5LNK e;  1OC3 A;  1SL0 B;  2V32 A;  4EC0 A;  4JU5 A;  3N5O A;  4ZBB A;  3DML A;  1DE2 A;  6GSW A;  1BED A;  2DIZ A;  1OC9 B;  4JE1 A;  2FHE A;  1JLW A;  3TJK A;  1TRV A;  3JCM L;  1G7O A;  4MJC A;  4ULX A;  1JLV A;  1Z5Y E;  2VCT A;  1URM A;  4N0Z A;  1V57 A;  2PER A;  3E3E A;  1F3A A;  3I9V 2;  3EC3 A;  5FT3 A;  2CX3 A;  2H76 A;  2YCD A;  4FYU A;  4IQ1 A;  2H1B A;  4EDY A;  2LEG A;  4FYB A;  2B5X A;  3RBT A;  4IS0 A;  3EUR A;  3HZ4 A;  2LST A;  1F6M C;  2H0I A;  1M7T A;  3WT2 A;  5F8B A;  2AYT A;  1XWB A;  2YJH A;  3EPT A;  4KSM A;  2H74 A;  4G10 A;  1GUK A;  1OAZ A;  4BWQ A;  2L59 A;  4MH3 A;  5C00 A;  2LJA A;  3ERF A;  4BVX A;  1H75 A;  2JZR A;  1PRX A;  5DCG A;  3UVT A;  2VAF A;  2QC7 A;  3GIX A;  4TXO B;  2GS3 A;  2K18 A;  3GN3 A;  4DVC A;  2GQK A;  4KDU A;  2FNO A;  3PPU A;  1A0F A;  2CZ3 A;  2CVB A;  3CRT A;  4ML6 A;  2NTO A;  10GS A;  1TI1 A;  4WBR D;  4J2F A;  4BVY B;  1XG8 A;  3KMO A;  1A2M A;  2TRX A;  1ERU A;  1XWA A;  2HT9 A;  3F63 A;  1PX7 A;  1XBS A;  5IMF A;  4GQC A;  3L9U A;  3FZ4 A;  3IHG A;  1FOH A;  2P0G A;  2ZNM A;  2DLX A;  4ECJ A;  1XFL A;  4KGI A;  1FW1 A;  1M9B A;  2I1U A;  2OJL A;  2C3T A;  5AIX A;  4G9H A;  3CSH A;  1F37 A;  4ZXG A;  2L4Q A;  1TU7 A;  2BJX A;  5DAK A;  1O8W A;  3LG6 A;  2EIR A;  2GVP A;  1PFO A;  1WWJ A;  5CRH A;  4L0U A;  4X1U A;  5GAN D;  4JRR A;  5GZZ B;  1WRY A;  3GKX A;  5ECM B;  1GUH A;  2CVD A;  3TGZ A;  4TW5 A;  2O7K A;  1SEN A;  4DEJ A;  1SK2 A;  1AW9 A;  2R0C A;  2H73 A;  4F9Z A;  3IR4 A;  3QAV A;  1O81 A;  13GS A;  4F82 A;  1TK5 B;  4DSS B;  2LKU A;  3VUR A;  4HQS A;  4Z2U A;  2IFQ A;  4GCI A;  5KEJ A;  4CDO A;  1HNC A;  3KP8 A;  4Q5R A;  4V1A g;  4GF0 A;  2J23 A;  1FB0 A;  3D4T A;  3DKS A;  3HJM A;  1SU9 A;  3KXO A;  5ECR B;  2XC2 A;  4TKY A;  2AJQ B;  3GYK A;  4KH7 A;  3BJ5 A;  2F9S A;  5A4V A;  2ZUP A;  4YAV A;  3LYP A;  1UVZ A;  3IPZ A;  2IJY A;  4I6X A;  4MZB A;  1ACV A;  5EPF A;  4GSS A;  4JZQ A;  2JL4 A;  2H72 A;  1Z7R A;  3MNG A;  1JZO A;  4EKZ A;  1PA3 A;  1HNB A;  2LJK A;  3DVW A;  2VCQ A;  1YY7 A;  4HI7 A;  2CAI A;  3PH9 A;  2ES7 A;  5HFK A;  4O5R A;  3A5I A;  3GHA A;  3GMF A;  6GSX A;  5HR2 A;  1K3O A;  2KOK A;  4L0W A;  1ILO A;  1DBY A;  2EIQ A;  3IRA A;  1ZL9 A;  2YOI A;  1G6Y A;  14GS A;  4LMV A;  3IXR A;  5FHI A;  3U6V A;  1V2A A;  5E4W A;  1A2L A;  2L4C A;  3DWV A;  2XBQ A;  1G6W A;  1QK8 A;  3HZ8 A;  3UOM A;  8GSS A;  2HXK A;  4USS A;  2VL2 C;  2C1Y A;  3M8N A;  4ILF A;  1K0D A;  4X0X A;  4TR1 A;  1BQ7 A;  1GTA A;  4V2M A;  4HJM A;  3L9V A;  4WXT A;  4AJ6 A;  1NM3 A;  1OVN A;  5IOX A;  1HNA A;  1ZCP A;  4G0L A;  1GLQ A;  2H66 A;  1DE1 A;  4IN0 A;  4EE0 A;  2YPM A;  1BAY A;  3FW2 A;  4ECC A;  2OBI A;  1XW6 A;  3EU4 A;  4OFT A;  5IPH A;  3J7Y b;  5ECK B;  1WE0 A;  4WF5 A;  2HFD A;  4HU9 A;  2A4V A;  2R2J A;  1ABA A;  2MMZ A;  1EV4 A;  3GKK A;  2HRF A;  2CAQ A;  4XS4 B;  3RAZ A;  5BRT A;  2JAC A;  4FH8 A;  4POM A;  2X8H A;  3BOA A;  2GZZ A;  4XIH A;  2K8V A;  1SL2 B;  2UZ8 A;  3IK7 A;  2N5A A;  3C1S A;  5A5K A;  5IMZ A;  4MK3 A;  2HRA A;  2FA4 A;  1F9M A;  2ZCT A;  4ECI A;  2DJ3 A;  2M72 A;  3VLN A;  2BMX A;  4V2L A;  1MD3 A;  1X5D A;  1VF1 A;  1TRW A;  4IGJ A;  2C3Q A;  5DAL A;  2OE0 A;  2WZ9 A;  4LLR A;  3C7M A;  1YF1 A;  2WDU A;  2YJ7 A;  9GSS A;  2DSA A;  2H1A A;  2H70 A;  1ZYN A;  1UA5 A;  3PR8 A;  3R2Q A;  2X8G A;  3ERW A;  2X8C A;  1QUW A;  4AJ8 A;  4ZL7 A;  3DYR A;  2V2G A;  3ERG A;  1PGT A;  1FOV A;  1LJR A;  3M1G A;  3KTB A;  5DCH A;  5GSS A;  1GTU A;  5HFG A;  5IOW A;  2C0D A;  2A2R A;  4KE3 A;  3KD0 A;  5GST A;  4BA7 A;  2B6M A;  2EIO A;  2CQ9 A;  3EU3 A;  4KND A;  4ZB6 A;  1OC9 A;  3KH9 A;  2C80 A;  1TK8 B;  4FYC A;  3L0H A;  3EWL A;  2VUP A;  1XZO A;  2WS2 A;  2LRC A;  2DKH A;  4EF0 A;  1FB6 A;  3K8N A;  3GKM A;  2RUE A;  4PXO A;  2AHE A;  1GUL A;  2FWF A;  3LQ7 A;  3NIV A;  2KP2 A;  3LSZ A;  2C8U A;  4IEL A;  3HDC A;  1B48 A;  1AXD A;  1EP8 A;  2CVK A;  5IIZ A;  2TRC P;  5CAX A;  4OO4 A;  1XW5 A;  2YZH A;  4IHU A;  3IK9 A;  1T4Y A;  4YKF A;  2NVL A;  1OC8 A;  1EWX A;  4TVE A;  3SBC A;  1JFU A;  2H8L A;  2N5B A;  5AIV A;  1GWC A;  1XXU A;  3F6F A;  2F3M A;  2JSZ A;  3GH6 A;  1O8X A;  1PSQ A;  3M9K A;  2GSR A;  3MSZ A;  4ZL8 A;  4TXO A;  1EV9 A;  1YDK A;  6GSU A;  2X49 A;  2MMA A;  2XBI A;  5JCU A;  4MJB A;  1PN0 A;  4WBJ A;  4K0G A;  5CNW A;  1XPV A;  3UAP A;  4PX1 A;  2HE3 A;  2HSM A;  4ZBD A;  3D0Z A;  1ZYQ B;  2WJU A;  2VLU A;  1J08 A;  4BVY A;  3QMX A;  4K0N A;  3WT1 A;  1ZYE A;  2PVO C;  4XRA A;  1ERW A;  1M99 A;  4A5P A;  5ABR A;  3QDN A;  2R0P A;  4AF2 A;  4Z2R A;  4FIW A;  3ZL5 A;  4OD7 A;  1YZX A;  2HYX A;  1ST9 A;  3F8U A;  1O73 A;  1TDI A;  5J4U A;  1GSU A;  1S3A A;  4PTS A;  2QKE A;  3CTG A;  4BL7 B;  3MIX A;  3GL3 A;  4BPY A;  2H75 A;  3TJG A;  2VCX A;  1G7E A;  1M9A A;  3A2V A;  4GSN A;  5DVB A;  1QQ2 A;  1OYJ A;  3TKS A;  5F0G A;  3G9B A;  2C0E A;  2JU5 A;  2PVQ A;  2P5Q A;  2F51 A;  2IL3 A;  4MZC A;  2JSY A;  3LYK A;  4F2I A;  2X99 A;  2LJR A;  2PMT A;  4TR4 A;  1GTI A;  4DSS A;  3DEX A;  2YAN A;  5H5Q A;  2CV4 A;  2M46 A;  2H0H A;  20GS A;  6GST A;  2FUG 2;  4FQU A;  3M0F A;  3LOR A;  2H6X A;  3FR3 A;  1JZR A;  4NV5 A;  4FO5 A;  1WMJ A;  3QR6 A;  2RII A;  1USB A;  1NSW A;  1E2Y A;  1GUM A;  4XS1 A;  3HCZ A;  3QAG A;  1GSF A;  1TKD B;  2GTU A;  4AJ7 A;  2YWN A;  5B6N A;  1X9S B;  3QD9 A;  4ZL9 A;  4POL A;  2IIY A;  3DRN A;  3F3R A;  3CRU A;  5ECI B;  3M3M A;  3FYG A;  3NOF A;  4K5S A;  2YN1 A;  3OR5 A;  2K8S A;  17GS A;  5L71 A;  3HHV A;  2P31 A;  2CA8 A;  3A2W A;  4EIP A;  5B6M A;  4RI7 A;  1X9W B;  1SKR B;  4E8H A;  3W8S A;  1U3A A;  2A2S A;  2OKA A;  5INY A;  2V6K A;  1OE8 A;  4OO5 A;  4P3Y B;  1O7U A;  3MAK A;  1SKW B;  2OAC A;  4N30 A;  1F2E A;  5AGY A;  3VPT A;  2PU9 C;  5DJM A;  2OE1 A;  4H86 A;  2B1K A;  3O76 A;  4Z7X A;  3NZN A;  3W6G A;  4GTU A;  3FHK A;  1ML6 A;  2N5F A;  2B3S A;  3GH9 A;  4LL1 B;  4KA0 A;  3KMN A;  1JZW A;  1MDJ A;  1BJX A;  1Z9H A;  1THX A;  3RPN A;  3RHB A;  1TXX A;  3A2X A;  11GS A;  1K0C A;  2YWI A;  4OWY A;  1R5P A;  3ZYW A;  4L8E A;  5LD0 A;  1A8Y A;  3ZIT A;  1M3J A;  4NWY A;  2GLR A;  4CY6 A;  3F4R A;  3CMI A;  1Q4J A;  3BCK A;  3ZMK A;  2XHF A;  1B9X C;  1CQG A;  1HYU A;  4N0V A;  2E2G A;  1E6B A;  2HZE B;  4XS4 A;  3KM6 A;  2YP6 A;  5G5F A;  4EUY A;  4I97 A;  1BX9 A;  4MAB A;  4HQZ A;  5F05 A;  4TN8 A;  4DSQ A;  4X43 A;  2V6O A;  3EYT A;  3LFL A;  5CYY A;  3IC8 A;  4EXJ A;  4K9Z A;  2FGX A;  3BBY A;  1RQM A;  5DQY A;  4OFN A;  4IW9 A;  3LJR A;  4KUN A;  6GSY A;  4KSO A;  1SK0 A;  2QA1 A;  3D5J A;  4K6X A;  2HRK A;  3M9J A;  1U3I A;  5DBQ A;  5COH A;  3ME8 A;  2IMD A;  1TRS A;  3N9J A;  1R26 A;  4EIQ A;  3FEU A;  1V9W A;  3GST A;  3L78 A;  2H0G A;  4TXV A;  2EC4 A;  1R4W A;  1WOU A;  2X4A A;  3VWW A;  4PUF C;  1J9B A;  4L5O A;  3G7J A;  4PUA A;  1SJ6 A;  3IBH A;  1SD9 A;  5KOW A;  4POK A;  4Q5F A;  3H8Q A;  1ZMA A;  2LQQ A;  3F3Q A;  1S3D A;  3C73 A;  2QGV A;  2VM1 A;  3GNJ A;  4K2X A;  5KN3 A;  3ED3 A;  2RM6 A;  1XOB A;  2GT5 A;  1YQ1 A;  3VWU A;  2WCI A;  2DC5 A;  3TKP A;  1SYX A;  1GH2 A;  5DDL A;  1SJI A;  3C71 A;  2HRN A;  2ALB A;  19GS A;  4F0C A;  4XTS A;  1SJZ A;  2DJ0 A;  1Q98 A;  4I2T A;  1J0F A;  2KP1 A;  2R37 A;  3CSI A;  4K7O A;  4KCE A;  3R3E A;  2WB9 A;  3F4S A;  4ACS A;  3CBU A;  3ZLP A;  3IHQ A;  3RDW A;  1EZK A;  4MLY A;  1XWC A;  5ECN B;  3ZZX A;  4KB3 A;  2QA2 A;  4NXI A;  2LV3 A;  5D96 A;  4Z2T A;  2NBS A;  2FD3 A;  3ZVJ D;  1B8X A;  2PBJ A;  4RQR A;  3KCM A;  3H1N A;  4WR4 A;  2HSH A;  1W4V A;  4ZBA A;  3FZA A;  4IJ3 A;  4KCA A;  4O5Q A;  1TJD A;  3ME7 A;  4OMV A;  3UEM A;  1PKW A;  1T00 A;  1LU4 A;  4GWR A;  3ISO A;  6GSS A;  1K0M A;  3EVI A;  1M2A A;  2MMN A;  1Y25 A;  1ZOF A;  4F03 A;  1C72 A;  3LXT A;  5FWG A;  3TRQ A;  2FCH A;  2H6Y A;  4WET A;  2B1L A;  2I3Y A;  4D73 B;  1BYE A;  3E9J B;  1JHB A;  2JZS A;  4NV2 A;  6GSV A;  2G0F A;  5HFI A;  2A4H A;  3GFK A;  4JBB A;  2LRN A;  1T8E B;  3ZFL A;  3I43 A;  4IP6 A;  2DMM A;  3TJF A;  5CRE A;  1AAZ A;  4O32 A;  3EMP A;  5ECS A;  2DIY A;  2PWJ A;  4GLT A;  2GSS A;  4I2U A;  1HD2 A;  4I8B A;  4TOP A;  4K7N A;  4WEY A;  1M0U A;  4YAP A;  3LEF A;  4ZIJ A;  2VL2 A;  3P7X A;  2B7J A;  2PUK C;  2DML A;  3HJO A;  2VLT A;  3TOU A;  4HEA 2;  2DJ2 A;  4BL7 A;  3FRC A;  1K0N A;  1EP7 A;  3D22 A;  3G7I A;  4TR3 A;  1VF3 A;  2C0G A;  2LUS A;  1PD2 1;  1LBK A;  1X5C A;  4K5R A;  1QXH A;  5IMC A;  2MZC A;  2R6K A;  3TRP A;  4K2D A;  1YEP A;  3LXZ A;  2OA7 A;  4MCU A;  1PQN A;  4J57 E;  4NHW A;  2L5L A;  2MMO A;  1B4Q A;  2O85 A;  5HR3 A;  3QFB C;  1XCC A;  2GQM A;  1YEX A;  3A5W A;  1Z3E A;  3UVH A;  3KH7 A;  2REM A;  5CRW A;  4PUR A;  4MZW A;  3KZQ A;  5ENU A;  4TRX A;  4O7H A;  2VIM A;  3SWL A;  16GS A;  2FWE A;  3TB2 A;  4DSR A;  4HJ2 A;  1JZD A;  2MYG A;  1TRU A;  1S3C A;  3WGE A;  5EY6 A;  1N8J A;  4PGT A;  4IVF A;  3Q6O A;  3BD2 A;  1T4Z A;  3FR6 A;  1R7H A;  4HUA A;  1FAA A;  2DJ1 A;  1SYR A;  3HKR A;  3KJY A;  1XVW A;  2X64 A;  2DBC A;  4YQV A;  2FWG A;  1MTC A;  5B8B A;  4V1A p;  3GX0 A;  2IPA A;  2B5E A;  4WR5 A;  5G30 A;  3UJ1 A;  2DJK A;  4NPB A;  1K0O A;  3C8E A;  3GV1 A;  3UIW A;  1PKZ A;  3HY2 A;  1OKT A;  3U5R E;  2ON5 A;  5D8I A;  4X4J A;  12GS A;  5G1K A;  2O89 A;  2FWH A;  4XHM A;  2L5O A;  1FVJ A;  4JR6 A;  1NW2 A;  3I6A A;  2V41 A;  1NHO A;  1GSQ A;  1G0T A;  1V98 A;  5ID2 B;  2LQO A;  1YKA A;  1GRX A;  5J9C A;  5JWQ B;  4ZB9 A;  5J3R A;  3GA4 A;  3KP9 A;  5IMV A;  5J41 A;  3L9S A;  4CY8 A;  3VK9 A;  3D4M A;  4RI6 A;  4IKH A;  4GXZ A;  2AAW A;  2R4V A;  3DXB A;  3KIJ A;  4XS6 A;  1FHE A;  3I69 A;  1VGL A;  5JWR B;  3EIN A;  2GZP A;  2I9H A;  5ECO B;  2VCZ A;  2HZE A;  3DVX A;  2VL3 A;  1MDI A;  3W8J A;  3F9U A;  4WKW A;  5HR0 A;  3S9F A;  2I4A A;  3IE3 A;  3CXG A;  2A2P A;  1SD8 A;  4G0K A;  3GX8 A;  1XVQ A;  5F06 A;  1GTB A;  2YZU A;  3FKF A;  3GL5 A;  2H01 A;  2HNL A;  2VM2 A;  2C4J A;  3D6I A;  1EEM A;  1MEK A;  5ECH B;  3Q74 A;  1TU8 A;  1SL1 B;  1BG5 A;  4HU7 A;  5KN1 A;  3HVX A;  5F07 A;  3GUS A;  1W89 A;  3QCP A;  4JED A;  1XWG A;  3VI7 A;  4YQM A;  5EL8 A;  2L6D A;  3DD3 A;  2NPB A;  2YWM A;  2LS5 A;  4YQU A;  5G1L A;  2CT6 A;  3ZIV A;  1KTE A;  3HVV A;  1B4P A;  1AUC A;  2H1G A;  4PQ1 A;  1GSD A;  2MBT A;  3GUR A;  5G2Z A;  3RPP A;  4LA1 A;  4J56 E;  5H5S A;  1M3I A;  3VWV A;  5ECL B;  2M80 A;  5IPG A;  3IAM 2;  4LL4 B;  1OE7 A;  2RM5 A;  3Q19 A;  3IA1 A;  4ICY A;  4IP1 A;  5CP1 A;  4K8M A;  3O3T A;  4PNG A;  1QFN A;  5BMU A;  1CQH A;  1K3Y A;  5E59 A;  4ZIL A;  3HVN A;  1YF0 A;  3TKR A;  2YV9 A;  1AC1 A;  2E2M A;  4KF9 A;  2PN8 A;  2GST A;  2H71 A;  2L6C A;  2VOC A;  4BIK A;  4CHS A;  4MNN A;  5J9B A;  3KTL A;  4RUV A;  4Q5Q A;  3VI5 A;  3QFA C;  3VFI A;  2LNS A;  4WF4 A;  3TKQ A;  4MPF A;  1XIY A;  2Z9S A;  3UAR A;  5G31 A;  2MBS A;  4EVM A;  1O6J A;  2DJJ A;  2YV7 A;  4NMU A;  5DQS A;  3FMW A;  2VCV A;  4QL7 A;  3GRX A;  2R5G A;  1AQV A; 
#chains in the Genus database with same CATH homology
 5CO3 A;  3AY8 A;  5IMA A;  3TUE A;  4MF7 A;  4KAE A;  2HZF A;  2C3N A;  1GSE A;  2WUL A;  3QPM A;  3Q18 A;  5AIS A;  3HJP A;  1AIU A;  5J5N A;  2O87 A;  2GT6 A;  3TDG A;  1B9Y C;  4N11 A;  4D73 A;  3IC4 A;  3GSS A;  4OFM A;  3BCI A;  2WRT A;  2HSY A;  5IO0 A;  1A23 A;  1Z6N A;  2IMI A;  1MDK A;  3GTU B;  2IME A;  5ECP B;  4EO3 A;  3VWX A;  2JAD A;  4KDX A;  1YJ6 A;  5D9V A;  1QMV A;  4LMW A;  4QL9 A;  5JCG A;  2IWT A;  5D73 A;  2XPE A;  4MJA A;  18GS A;  3L4N A;  3DIE A;  4HZ2 A;  3P8W A;  3ZTL A;  1PN9 A;  2OBK A;  4MPG A;  3H79 A;  4PQI A;  4ZB8 A;  2LNT A;  5D9T A;  4HDE A;  4RQX A;  5LCZ A;  1T7P B;  1XW9 A;  3FZ5 A;  1K0B A;  3VPQ A;  5CRD A;  3H4K A;  3UBK A;  2RUF A;  3QOU A;  4KDY A;  4OCE A;  7GSS A;  1UC7 A;  3HD5 A;  1V40 A;  1GL8 A;  3MDK A;  1GSY A;  3LW9 A;  1AQX A;  2GGT A;  2G2Q A;  1ERT A;  2GZY A;  3A3T A;  3UBL A;  1U88 A;  3ZIJ A;  1EGO A;  3ZRD A;  3APS A;  1N2A A;  2AB6 A;  5G5E A;  1KBN A;  2LRT A;  4EDZ A;  4XRD A;  2YWO A;  1ZZY A;  3P90 A;  2KLX A;  1PL2 A;  3IV4 A;  5JCW A;  1KNG A;  4K1F A;  2VD1 A;  3MYD A;  4BVX B;  2F8A A;  1IYH A;  22GS A;  5H5R A;  2VCW A;  1A8L A;  1GNW A;  1RK4 A;  1U87 A;  2WFC A;  3LWA A;  3CSJ A;  1QGV A;  1Z6M A;  3KGK A;  3FZ9 A;  3IAS 2;  4MF6 A;  2GQL A;  1X5E A;  4YKG A;  3TJJ A;  3J7Y k;  4XCS A;  4ML1 A;  4HOJ A;  3UMA A;  1ZYP A;  2H6Z A;  4ECB A;  1EOH A;  1K3L A;  5ID2 A;  1TK0 B;  2H19 A;  4CW9 A;  3IDV A;  1M2B A;  2OE3 A;  5D93 A;  4MA9 A;  5HQP A;  5DAK B;  1ON4 A;  3H93 A;  1EEJ A;  2O8V B;  3TRX A;  3FR9 A;  2AUV A;  1Y6E A;  2CX4 A;  5KN0 A;  1TP9 A;  4NHZ A;  4NAX A;  5IMD A;  2GDR A;  2C0F A;  3MWH A;  1THO A;  3TKS E;  1H4O A;  4IQA A;  2H1D A;  1ZGN A;  3EE2 A;  4O92 A;  1F3B A;  3APQ A;  1GLP A;  5ELA A;  4BWS A;  4IBP A;  2YNX A;  4QQ7 A;  4PQH A;  4MF5 A;  1VF2 A;  4POB A;  4YH2 A;  2IFQ B;  2E0Q A;  1AQW A;  3HA9 A;  3G7Y A;  2WGR A;  4KX4 A;  2HLS A;  3LGC A;  5KOX A;  4MMM A;  5AN1 A;  5JWO B;  1KEB A;  1TI3 A;  5HR1 A;  4O5U A;  5GAP D;  4L5L A;  2FLS A;  4GQF A;  2TIR A;  1I5G A;  3GKN A;  1R5A A;  3APO A;  5KN2 A;  4OCF A;  4G0I A;  4F0B A;  3FY7 A;  1T1V A;  3FK8 A;  2DKI A;  4MDC A;  5EVO A;  1HQO A;  2VO4 A;  4MH2 A;  1PL1 A;  2FA8 A;  3WYW A;  4KW6 A;  2JZT A;  3C1R A;  4K7I A;  1FVK A;  2E7P A;  1TOF A;  3WD6 A;  2B7K A;  3TJB A;  2XPD A;  1V58 A;  3RHC A;  2GSQ A;  1X9M B;  5CRG A;  2VLV A;  2QSI A;  1WIK A;  1Z7P A;  3TCO A;  5B8A A;  4V2N A;  1NHY A;  1GNE A;  1SK1 A;  1UN2 A;  3PIN A;  1FG4 A;  3CYN A;  2K6V A;  2IMF A;  1TW9 A;  1I9D A;  1U6T A;  2OAD A;  3D21 A;  1VRS D;  5IM9 A;  1VF4 A;  4Q5N A;  5A4W A;  1ERV A;  5DJL A;  2IN3 A;  2KUC A;  4HZ4 A;  3IOS A;  4PNF A;  4TR1 B;  3TOT A;  3KEB A;  1EGR A;  4JR4 A;  1A24 A;  1XOA A;  1IYI A;  4TR0 A;  5ECQ B;  3F4T A;  2P5R A;  4ID0 A;  3US3 A;  5B7C A;  3TKS C;  2AV4 A;  1GSS A;  3DGQ A;  1X0R A;  2VL9 A;  1EOG A;  3P2A A;  1FO5 A;  3QAW A;  1T3B A;  2NDO A;  2VD0 A;  3E0U A;  2V1M A;  5C04 A;  2R3X A;  1K0A A;  1A2J A;  3ZML A;  2F8F A;  2J9H A;  4HS1 A;  4N10 A;  1DUG A;  4G19 A;  2D2Z A;  1SKS B;  1OKD A;  4MP4 A;  1WPI A;  1GP1 A;  1TTZ A;  2KHP A;  5IQY A;  1PMT A;  1WP0 A;  2FY6 A;  4I5Q A;  2CZ2 A;  3PGT A;  1DSB A;  3F6D A;  3ZRE A;  5ELG A;  3F0I A;  1A0R P;  2BTO T;  3ZVJ A;  2H30 A;  3CTF A;  3WGX A;  1PX6 A;  2PGT A;  3EMX A;  5DAL B;  3V1W A;  1YKC A;  3ZFB A;  3WGD A;  1XWK A;  4E8E A;  4AGS A;  1M2D A;  5A4U A;  2ON7 A;  1WJK A;  2LTK A;  3UL3 A;  2HI7 A;  3GTU A;  3HVS A;  5D9X A;  3HYP A;  2R0G A;  5D9W A;  4IJI A;  4G2E A;  4MJE A;  1O85 A;  2IMK A;  2K9F A;  2L57 A;  4EL1 A;  4GRF A;  1MD4 A;  2I81 A;  2B5Y A;  3O6T A;  5IO2 A;  4ISD A;  3HXS A;  2RLI A;  2PPT A;  1RW1 A;  4GST A;  5LNK e;  1OC3 A;  1SL0 B;  2V32 A;  4EC0 A;  4JU5 A;  3N5O A;  4ZBB A;  3DML A;  1DE2 A;  6GSW A;  1BED A;  2DIZ A;  1OC9 B;  4JE1 A;  2FHE A;  1JLW A;  3TJK A;  1TRV A;  3JCM L;  1G7O A;  4MJC A;  4ULX A;  1JLV A;  1Z5Y E;  2VCT A;  1URM A;  4N0Z A;  1V57 A;  2PER A;  3E3E A;  1F3A A;  3I9V 2;  3EC3 A;  5FT3 A;  2CX3 A;  2H76 A;  2YCD A;  4FYU A;  4IQ1 A;  2H1B A;  4EDY A;  2LEG A;  4FYB A;  2B5X A;  3RBT A;  4IS0 A;  3EUR A;  3HZ4 A;  2LST A;  1F6M C;  2H0I A;  1M7T A;  3WT2 A;  5F8B A;  2AYT A;  1XWB A;  2YJH A;  3EPT A;  4KSM A;  2H74 A;  4G10 A;  1GUK A;  1OAZ A;  4BWQ A;  2L59 A;  4MH3 A;  5C00 A;  2LJA A;  3ERF A;  4BVX A;  1H75 A;  2JZR A;  1PRX A;  5DCG A;  3UVT A;  2VAF A;  2QC7 A;  3GIX A;  4TXO B;  2GS3 A;  2K18 A;  3GN3 A;  4DVC A;  2GQK A;  4KDU A;  2FNO A;  3PPU A;  1A0F A;  2CZ3 A;  2CVB A;  3CRT A;  4ML6 A;  2NTO A;  10GS A;  1TI1 A;  4WBR D;  4J2F A;  4BVY B;  3KMO A;  1A2M A;  2TRX A;  1ERU A;  1XWA A;  2HT9 A;  3F63 A;  1PX7 A;  1XBS A;  5IMF A;  4GQC A;  3L9U A;  3FZ4 A;  3IHG A;  1FOH A;  2P0G A;  2ZNM A;  2DLX A;  4ECJ A;  1XFL A;  4KGI A;  1FW1 A;  1M9B A;  2I1U A;  2OJL A;  2C3T A;  5AIX A;  4G9H A;  3CSH A;  1F37 A;  4ZXG A;  2L4Q A;  1TU7 A;  2BJX A;  5DAK A;  1O8W A;  3LG6 A;  2EIR A;  2GVP A;  1WWJ A;  5CRH A;  4L0U A;  4X1U A;  5GAN D;  4JRR A;  5GZZ B;  1WRY A;  3GKX A;  5ECM B;  1GUH A;  2CVD A;  3TGZ A;  4TW5 A;  2O7K A;  1SEN A;  4DEJ A;  1SK2 A;  1AW9 A;  2R0C A;  2H73 A;  4F9Z A;  3IR4 A;  3QAV A;  1O81 A;  13GS A;  4F82 A;  1TK5 B;  4DSS B;  2LKU A;  3VUR A;  4HQS A;  4Z2U A;  2IFQ A;  4GCI A;  5KEJ A;  4CDO A;  1HNC A;  3KP8 A;  4Q5R A;  4V1A g;  4GF0 A;  2J23 A;  1FB0 A;  3D4T A;  3DKS A;  3HJM A;  1SU9 A;  3KXO A;  5ECR B;  2XC2 A;  4TKY A;  2AJQ B;  3GYK A;  4KH7 A;  3BJ5 A;  2F9S A;  5A4V A;  2ZUP A;  4YAV A;  3LYP A;  1UVZ A;  3IPZ A;  2IJY A;  4I6X A;  4MZB A;  1ACV A;  5EPF A;  4GSS A;  4JZQ A;  2JL4 A;  2H72 A;  1Z7R A;  3MNG A;  1JZO A;  4EKZ A;  1PA3 A;  1HNB A;  2LJK A;  3DVW A;  2VCQ A;  1YY7 A;  4HI7 A;  2CAI A;  3PH9 A;  2ES7 A;  5HFK A;  4O5R A;  3A5I A;  3GHA A;  3GMF A;  6GSX A;  5HR2 A;  1K3O A;  2KOK A;  4L0W A;  1ILO A;  1DBY A;  2EIQ A;  3IRA A;  1ZL9 A;  2YOI A;  1G6Y A;  14GS A;  4LMV A;  3IXR A;  5FHI A;  3U6V A;  1V2A A;  5E4W A;  1A2L A;  2L4C A;  3DWV A;  2XBQ A;  1G6W A;  1QK8 A;  3HZ8 A;  3UOM A;  8GSS A;  2HXK A;  4USS A;  2VL2 C;  2C1Y A;  3M8N A;  4ILF A;  1K0D A;  4X0X A;  4TR1 A;  1BQ7 A;  1GTA A;  4V2M A;  4HJM A;  3L9V A;  4WXT A;  4AJ6 A;  1NM3 A;  1OVN A;  5IOX A;  1HNA A;  1ZCP A;  4G0L A;  1GLQ A;  2H66 A;  1DE1 A;  4IN0 A;  4EE0 A;  2YPM A;  1BAY A;  3FW2 A;  4ECC A;  2OBI A;  1XW6 A;  3EU4 A;  4OFT A;  5IPH A;  3J7Y b;  5ECK B;  1WE0 A;  4WF5 A;  2HFD A;  4HU9 A;  2A4V A;  2R2J A;  1ABA A;  2MMZ A;  1EV4 A;  3GKK A;  2HRF A;  2CAQ A;  4XS4 B;  3RAZ A;  5BRT A;  2JAC A;  4FH8 A;  4POM A;  2X8H A;  3BOA A;  2GZZ A;  4XIH A;  2K8V A;  1SL2 B;  2UZ8 A;  3IK7 A;  2N5A A;  3C1S A;  5A5K A;  5IMZ A;  4MK3 A;  2HRA A;  2FA4 A;  1F9M A;  2ZCT A;  4ECI A;  2DJ3 A;  2M72 A;  3VLN A;  2BMX A;  4V2L A;  1MD3 A;  1X5D A;  1VF1 A;  1TRW A;  4IGJ A;  2C3Q A;  5DAL A;  2OE0 A;  2WZ9 A;  4LLR A;  3C7M A;  1YF1 A;  2WDU A;  2YJ7 A;  9GSS A;  2DSA A;  2H1A A;  2H70 A;  1ZYN A;  1UA5 A;  3PR8 A;  3R2Q A;  2X8G A;  3ERW A;  2X8C A;  1QUW A;  4AJ8 A;  4ZL7 A;  3DYR A;  2V2G A;  3ERG A;  1PGT A;  1FOV A;  1LJR A;  3M1G A;  3KTB A;  5DCH A;  5GSS A;  1GTU A;  5HFG A;  5IOW A;  2C0D A;  2A2R A;  4KE3 A;  3KD0 A;  5GST A;  4BA7 A;  2B6M A;  2EIO A;  2CQ9 A;  3EU3 A;  4KND A;  4ZB6 A;  1OC9 A;  3KH9 A;  2C80 A;  1TK8 B;  4FYC A;  3L0H A;  3EWL A;  2VUP A;  1XZO A;  2WS2 A;  2LRC A;  2DKH A;  4EF0 A;  1FB6 A;  3K8N A;  3GKM A;  2RUE A;  4PXO A;  2AHE A;  1GUL A;  2FWF A;  3LQ7 A;  3NIV A;  2KP2 A;  3LSZ A;  2C8U A;  4IEL A;  3HDC A;  1B48 A;  1AXD A;  1EP8 A;  2CVK A;  5IIZ A;  2TRC P;  5CAX A;  4OO4 A;  1XW5 A;  2YZH A;  4IHU A;  3IK9 A;  1T4Y A;  4YKF A;  2NVL A;  1OC8 A;  1EWX A;  4TVE A;  3SBC A;  1JFU A;  2H8L A;  2N5B A;  5AIV A;  1GWC A;  1XXU A;  3F6F A;  2F3M A;  2JSZ A;  3GH6 A;  1O8X A;  1PSQ A;  3M9K A;  2GSR A;  3MSZ A;  4ZL8 A;  4TXO A;  1EV9 A;  1YDK A;  6GSU A;  2X49 A;  2MMA A;  2XBI A;  5JCU A;  4MJB A;  1PN0 A;  4WBJ A;  4K0G A;  5CNW A;  1XPV A;  3UAP A;  4PX1 A;  2HE3 A;  2HSM A;  4ZBD A;  3D0Z A;  1ZYQ B;  2WJU A;  2VLU A;  1J08 A;  4BVY A;  3QMX A;  4K0N A;  3WT1 A;  1ZYE A;  2PVO C;  4XRA A;  1ERW A;  1M99 A;  4A5P A;  5ABR A;  3QDN A;  2R0P A;  4AF2 A;  4Z2R A;  4FIW A;  3ZL5 A;  4OD7 A;  1YZX A;  2HYX A;  1ST9 A;  3F8U A;  1O73 A;  1TDI A;  5J4U A;  1GSU A;  1S3A A;  4PTS A;  2QKE A;  3CTG A;  4BL7 B;  3MIX A;  3GL3 A;  4BPY A;  2H75 A;  3TJG A;  2VCX A;  1G7E A;  1M9A A;  3A2V A;  4GSN A;  5DVB A;  1QQ2 A;  1OYJ A;  3TKS A;  5F0G A;  3G9B A;  2C0E A;  2JU5 A;  2PVQ A;  2P5Q A;  2F51 A;  2IL3 A;  4MZC A;  2JSY A;  3LYK A;  4F2I A;  2X99 A;  2LJR A;  2PMT A;  4TR4 A;  1GTI A;  4DSS A;  3DEX A;  2YAN A;  5H5Q A;  2CV4 A;  2M46 A;  2H0H A;  20GS A;  6GST A;  2FUG 2;  4FQU A;  3M0F A;  3LOR A;  2H6X A;  3FR3 A;  1JZR A;  4NV5 A;  4FO5 A;  1WMJ A;  3QR6 A;  2RII A;  1USB A;  1NSW A;  1E2Y A;  1GUM A;  4XS1 A;  3HCZ A;  3QAG A;  1GSF A;  1TKD B;  2GTU A;  4AJ7 A;  2YWN A;  5B6N A;  1X9S B;  3QD9 A;  4ZL9 A;  4POL A;  2IIY A;  3DRN A;  3F3R A;  3CRU A;  5ECI B;  3M3M A;  3FYG A;  3NOF A;  4K5S A;  2YN1 A;  3OR5 A;  2K8S A;  17GS A;  5L71 A;  3HHV A;  2P31 A;  2CA8 A;  3A2W A;  4EIP A;  5B6M A;  4RI7 A;  1X9W B;  1SKR B;  4E8H A;  3W8S A;  1U3A A;  2A2S A;  2OKA A;  5INY A;  2V6K A;  1OE8 A;  4OO5 A;  4P3Y B;  1O7U A;  3MAK A;  1SKW B;  2OAC A;  4N30 A;  1F2E A;  5AGY A;  3VPT A;  2PU9 C;  5DJM A;  2OE1 A;  4H86 A;  2B1K A;  3O76 A;  4Z7X A;  3NZN A;  3W6G A;  4GTU A;  3FHK A;  1ML6 A;  2N5F A;  2B3S A;  3GH9 A;  4LL1 B;  4KA0 A;  3KMN A;  1JZW A;  1MDJ A;  1BJX A;  1Z9H A;  1THX A;  3RPN A;  3RHB A;  1TXX A;  3A2X A;  11GS A;  1K0C A;  2YWI A;  4OWY A;  1R5P A;  3ZYW A;  4L8E A;  5LD0 A;  1A8Y A;  3ZIT A;  4NWY A;  2GLR A;  4CY6 A;  3F4R A;  3CMI A;  1Q4J A;  3BCK A;  3ZMK A;  2XHF A;  1B9X C;  1CQG A;  1HYU A;  4N0V A;  2E2G A;  1E6B A;  2HZE B;  4XS4 A;  3KM6 A;  2YP6 A;  5G5F A;  4EUY A;  4I97 A;  1BX9 A;  4MAB A;  4HQZ A;  5F05 A;  4TN8 A;  4DSQ A;  4X43 A;  2V6O A;  3EYT A;  3LFL A;  5CYY A;  3IC8 A;  4EXJ A;  4K9Z A;  2FGX A;  3BBY A;  1RQM A;  5DQY A;  4OFN A;  4IW9 A;  3LJR A;  4KUN A;  6GSY A;  4KSO A;  1SK0 A;  2QA1 A;  3D5J A;  4K6X A;  2HRK A;  3M9J A;  1U3I A;  5DBQ A;  5COH A;  3ME8 A;  2IMD A;  1TRS A;  3N9J A;  1R26 A;  4EIQ A;  3FEU A;  1V9W A;  3GST A;  3L78 A;  2H0G A;  4TXV A;  2EC4 A;  1R4W A;  1WOU A;  2X4A A;  3VWW A;  4PUF C;  1J9B A;  4L5O A;  3G7J A;  4PUA A;  1SJ6 A;  3IBH A;  1SD9 A;  5KOW A;  4POK A;  4Q5F A;  3H8Q A;  1ZMA A;  2LQQ A;  3F3Q A;  1S3D A;  3C73 A;  2QGV A;  2VM1 A;  3GNJ A;  4K2X A;  5KN3 A;  3ED3 A;  2RM6 A;  1XOB A;  2GT5 A;  1YQ1 A;  3VWU A;  2WCI A;  2DC5 A;  3TKP A;  1SYX A;  1GH2 A;  5DDL A;  1SJI A;  3C71 A;  2HRN A;  2ALB A;  19GS A;  4F0C A;  4XTS A;  1SJZ A;  2DJ0 A;  1Q98 A;  4I2T A;  1J0F A;  2KP1 A;  2R37 A;  3CSI A;  4K7O A;  4KCE A;  3R3E A;  2WB9 A;  3F4S A;  4ACS A;  3CBU A;  3ZLP A;  3IHQ A;  3RDW A;  1EZK A;  4MLY A;  1XWC A;  5ECN B;  3ZZX A;  4KB3 A;  2QA2 A;  4NXI A;  2LV3 A;  5D96 A;  4Z2T A;  2NBS A;  2FD3 A;  3ZVJ D;  1B8X A;  2PBJ A;  4RQR A;  3KCM A;  3H1N A;  4WR4 A;  2HSH A;  1W4V A;  4ZBA A;  3FZA A;  4IJ3 A;  4KCA A;  4O5Q A;  1TJD A;  3ME7 A;  4OMV A;  3UEM A;  1PKW A;  1T00 A;  1LU4 A;  4GWR A;  3ISO A;  6GSS A;  1K0M A;  3EVI A;  1M2A A;  2MMN A;  1Y25 A;  1ZOF A;  4F03 A;  1C72 A;  3LXT A;  5FWG A;  3TRQ A;  2FCH A;  2H6Y A;  4WET A;  2B1L A;  2I3Y A;  4D73 B;  1BYE A;  3E9J B;  1JHB A;  2JZS A;  4NV2 A;  6GSV A;  2G0F A;  5HFI A;  2A4H A;  3GFK A;  4JBB A;  2LRN A;  1T8E B;  3ZFL A;  3I43 A;  4IP6 A;  2DMM A;  3TJF A;  5CRE A;  1AAZ A;  4O32 A;  3EMP A;  5ECS A;  2DIY A;  2PWJ A;  4GLT A;  2GSS A;  4I2U A;  1HD2 A;  4I8B A;  4TOP A;  4K7N A;  4WEY A;  1M0U A;  4YAP A;  3LEF A;  4ZIJ A;  2VL2 A;  3P7X A;  2B7J A;  2PUK C;  2DML A;  3HJO A;  2VLT A;  3TOU A;  4HEA 2;  2DJ2 A;  4BL7 A;  3FRC A;  1K0N A;  1EP7 A;  3D22 A;  3G7I A;  4TR3 A;  1VF3 A;  2C0G A;  2LUS A;  1PD2 1;  1LBK A;  1X5C A;  4K5R A;  1QXH A;  5IMC A;  2MZC A;  2R6K A;  3TRP A;  4K2D A;  1YEP A;  3LXZ A;  2OA7 A;  4MCU A;  1PQN A;  4J57 E;  4NHW A;  2L5L A;  2MMO A;  1B4Q A;  2O85 A;  5HR3 A;  3QFB C;  1XCC A;  2GQM A;  1YEX A;  3A5W A;  1Z3E A;  3UVH A;  3KH7 A;  2REM A;  5CRW A;  4PUR A;  4MZW A;  3KZQ A;  5ENU A;  4TRX A;  4O7H A;  2VIM A;  3SWL A;  16GS A;  2FWE A;  3TB2 A;  4DSR A;  4HJ2 A;  1JZD A;  2MYG A;  1TRU A;  1S3C A;  3WGE A;  5EY6 A;  1N8J A;  4PGT A;  4IVF A;  3Q6O A;  3BD2 A;  1T4Z A;  3FR6 A;  1R7H A;  4HUA A;  1FAA A;  2DJ1 A;  1SYR A;  3HKR A;  3KJY A;  1XVW A;  2X64 A;  2DBC A;  4YQV A;  2FWG A;  1MTC A;  5B8B A;  4V1A p;  3GX0 A;  2IPA A;  2B5E A;  4WR5 A;  5G30 A;  3UJ1 A;  2DJK A;  4NPB A;  1K0O A;  3C8E A;  3GV1 A;  3UIW A;  1PKZ A;  3HY2 A;  1OKT A;  3U5R E;  2ON5 A;  5D8I A;  4X4J A;  12GS A;  5G1K A;  2O89 A;  2FWH A;  4XHM A;  2L5O A;  1FVJ A;  4JR6 A;  1NW2 A;  3I6A A;  2V41 A;  1NHO A;  1GSQ A;  1G0T A;  1V98 A;  5ID2 B;  2LQO A;  1YKA A;  1GRX A;  5J9C A;  5JWQ B;  4ZB9 A;  5J3R A;  3GA4 A;  3KP9 A;  5IMV A;  5J41 A;  3L9S A;  4CY8 A;  3VK9 A;  3D4M A;  4RI6 A;  4IKH A;  4GXZ A;  2AAW A;  2R4V A;  3DXB A;  3KIJ A;  4XS6 A;  1FHE A;  3I69 A;  1VGL A;  5JWR B;  3EIN A;  2GZP A;  2I9H A;  5ECO B;  2VCZ A;  2HZE A;  3DVX A;  2VL3 A;  1MDI A;  3W8J A;  3F9U A;  4WKW A;  5HR0 A;  3S9F A;  2I4A A;  3IE3 A;  3CXG A;  2A2P A;  1SD8 A;  4G0K A;  3GX8 A;  1XVQ A;  5F06 A;  1GTB A;  2YZU A;  3FKF A;  3GL5 A;  2H01 A;  2HNL A;  2VM2 A;  2C4J A;  3D6I A;  1EEM A;  1MEK A;  5ECH B;  3Q74 A;  1TU8 A;  1SL1 B;  1BG5 A;  4HU7 A;  5KN1 A;  3HVX A;  5F07 A;  3GUS A;  1W89 A;  3QCP A;  4JED A;  1XWG A;  3VI7 A;  4YQM A;  5EL8 A;  2L6D A;  3DD3 A;  2NPB A;  2YWM A;  2LS5 A;  4YQU A;  5G1L A;  2CT6 A;  3ZIV A;  1KTE A;  3HVV A;  1B4P A;  1AUC A;  2H1G A;  4PQ1 A;  1GSD A;  2MBT A;  3GUR A;  5G2Z A;  3RPP A;  4LA1 A;  4J56 E;  5H5S A;  3VWV A;  5ECL B;  2M80 A;  5IPG A;  3IAM 2;  4LL4 B;  1OE7 A;  2RM5 A;  3Q19 A;  3IA1 A;  4ICY A;  4IP1 A;  5CP1 A;  4K8M A;  3O3T A;  4PNG A;  1QFN A;  5BMU A;  1CQH A;  1K3Y A;  5E59 A;  4ZIL A;  1YF0 A;  3TKR A;  2YV9 A;  1AC1 A;  2E2M A;  4KF9 A;  2PN8 A;  2GST A;  2H71 A;  2L6C A;  2VOC A;  4CHS A;  4MNN A;  5J9B A;  3KTL A;  4RUV A;  4Q5Q A;  3VI5 A;  3QFA C;  3VFI A;  2LNS A;  4WF4 A;  3TKQ A;  4MPF A;  1XIY A;  2Z9S A;  3UAR A;  5G31 A;  2MBS A;  4EVM A;  1O6J A;  2DJJ A;  2YV7 A;  4NMU A;  5DQS A;  3FMW A;  2VCV A;  4QL7 A;  3GRX A;  2R5G A;  1AQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...