1F6MC

Crystal structure of a complex between thioredoxin reductase, thioredoxin, and the nadp+ analog, aadp+
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPSKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN REDUCTASE
publication title Twists in catalysis: alternating conformations of Escherichia coli thioredoxin reductase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 21
structure length 108
sequence length 108
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2000-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1f6mC00
1AW9A 4GSSA 3R2QA 2GZZA 1JFUA 2PVOC 1EOHA 2IMKA 2FWHA 1BX9A 5DQYA 18GSA 3D0ZA 4PGTA 5DCGA 2R6KA 1OAZA 1V57A 4ULXA 2V6OA 4OWYA 4HI7A 4MF5A 5ECRB 5IMZA 5DALA 2FGXA 3WT1A 5DAKA 2VM1A 3A3TA 3DVXA 2YN1A 1KBNA 1SKSB 1SJ6A 2PERA 11GSA 1QQ2A 2KP2A 2VCVA 5CRWA 2DIZA 6GSVA 3NZNA 4KA0A 4O92A 3FR9A 3FR6A 3IR4A 4OFNA 4MH3A 4NWYA 3C8EA 2L6DA 1K0OA 3F0IA 1EEMA 2EIOA 1XPVA 5IMDA 2N5AA 1U6TA 1OVNA 1TW9A 1NHYA 2H6ZA 1SYXA 5D8IA 3US3A 2P5RA 1YEPA 2YOIA 4FO5A 3ZTLA 2VL9A 3G9BA 2L4QA 1BQ7A 1MD3A 3ZIJA 1QMVA 3UVTA 3L0HA 3ERFA 3IE3A 2IFQA 4IP1A 3VPTA 1O81A 3KJYA 5F8BA 1GTUA 1K3OA 4Q5NA 3ZYWA 4PQ1A 1X0RA 4OCEA 5J3RA 4K9ZA 19GSA 1JZWA 3APSA 3M1GA 1T4YA 4OO5A 5IQYA 4Q5FA 4V1Ap 3HJOA 2CZ2A 1G6WA 4ML1A 6GSSA 2F3MA 1AUCA 2H30A 3RAZA 1GH2A 1M99A 3LWAA 4K0GA 1TRWA 1XWAA 3F6DA 2E7PA 3KEBA 2X8GA 4TR1B 2P0GA 3LXTA 3L9SA 3MDKA 4HQSA 3HJPA 1GUMA 2IMEA 2V32A 1ZOFA 5H5RA 1Y25A 2DLXA 1TP9A 3KGKA 2FA8A 1ZGNA 1PRXA 3KMNA 5HQPA 3U5RE 3P90A 2TRXA 2H8LA 2LV3A 3M3MA 2VAFA 3VLNA 2C3TA 3FW2A 1ZCPA 1S3AA 3FZ9A 2L5OA 3CSIA 2VCZA 3GX8A 1S3CA 2PGTA 4IGJA 4F82A 2ALBA 5IO2A 3HHVA 4X43A 2JZSA 4KH7A 4ZIJA 4TN8A 4POMA 4YQMA 2CVKA 3N9JA 1EWXA 17GSA 5AGYA 1AXDA 1YF1A 3ED3A 1GWCA 4F0BA 2IN3A 5IM9A 2YZUA 2WRTA 2YANA 4IVFA 2HZFA 2HXKA 1JZDA 2REMA 4MF6A 1R5AA 3ME8A 3BOAA 3TB2A 2ZCTA 6GSYA 4HQZA 2LKUA 1HD2A 2I3YA 3ZIVA 4JR6A 1HYUA 4ECIA 3I69A 1FB0A 1GULA 3F3RA 3PGTA 1M7TA 4HDEA 2DJKA 3UIWA 3M8NA 4GCIA 4N11A 1B48A 3L9VA 2H19A 2GGTA 4WETA 4XS4A 3BJ5A 1X5CA 1DE2A 2E0QA 5DVBA 4ZL8A 4XRDA 2RLIA 2DJ2A 3EMPA 4EDZA 1XVQA 3H1NA 2GSTA 3TGZA 4MZWA 2AYTA 3EC3A 4BWQA 5J5NA 4JE1A 4NPBA 1JZRA 1QGVA 2CV4A 1UVZA 2RM5A 3KIJA 3GA4A 2C4JA 5EPFA 5KN1A 2CX4A 4NV5A 2PPTA 2JZTA 3I43A 3GSTA 1FHEA 1AC1A 4O7HA 1Z3EA 20GSA 3QR6A 3G7IA 3Q74A 2GTUA 1FVJA 2VCXA 2CQ9A 4NV2A 1TRUA 1X9MB 1LBKA 3IAM2 2C3NA 3PINA 3ERWA 1AQXA 3F6FA 3KM6A 1EEJA 5ECOB 1AQWA 2JU5A 2LSTA 2FWFA 4XCSA 1XWKA 3CRUA 2H76A 5D9VA 2VCQA 5D9XA 1B9XC 2H74A 10GSA 1F9MA 1A2JA 1F37A 3UVHA 4OFMA 2KOKA 4MH2A 4POKA 5JWOB 4CDOA 5D96A 3TRQA 4IKHA 5ABRA 1V2AA 6GSTA 5IMCA 2LQOA 3CSJA 2YJ7A 4YH2A 3FK8A 4KDUA 5B8AA 1OC9B 4IQAA 3DRNA 4HOJA 3UEMA 2B5EA 4IELA 3E9JB 1B4PA 4TR3A 3ME7A 1F3AA 1PL2A 1TRVA 5GAPD 3KMOA 5IMAA 3LSZA 3MNGA 4YQUA 2F8AA 1N8JA 2X99A 1G6YA 4HJMA 5DJMA 5J9CA 2PMTA 4H86A 1Z7RA 2FCHA 3ERGA 1J0FA 2FLSA 2CAIA 2DIYA 1URMA 3D6IA 3EMXA 3JCML 4HUAA 5G31A 3GKNA 4PQHA 3APOA 2J9HA 4O32A 2JADA 3UBLA 2HZEB 3MWHA 3KP9A 1ST9A 1ERUA 3LEFA 4E8EA 4POBA 5D93A 1OC3A 1KEBA 2O7KA 4MJAA 3KZQA 3WGDA 2R2JA 4IS0A 2X8CA 5B6NA 1JHBA 3KD0A 5CREA 3O76A 2TIRA 2FY6A 5CNWA 2JSZA 4TOPA 5IIZA 2OJLA 5KEJA 2HSYA 3GL3A 1BG5A 2B5XA 3QD9A 3TKSA 3TJFA 2FWGA 2H66A 4LL1B 1H75A 4RQXA 4PQIA 3TCOA 4QL9A 5E4WA 4ML6A 3GIXA 5ECQB 1YDKA 4G19A 1O85A 3FKFA 2OE1A 3WYWA 5G5FA 3BD2A 2OACA 5CO3A 1E6BA 3GTUB 3EE2A 4V2NA 5FWGA 1I9DA 2OKAA 2CA8A 3ZREA 3D21A 3D4TA 2GQLA 5EY6A 4GTUA 5D73A 3IK7A 1U87A 4BPYA 5B6MA 5ECIB 2IMFA 1SJZA 3IHQA 3QFAC 3MSZA 4EL1A 3QAGA 1XXUA 3SWLA 1EV9A 1QFNA 4IQ1A 2QC7A 2FNOA 4ZBAA 4ECJA 4AGSA 5ELGA 3VURA 3CMIA 3L9UA 3CXGA 3E3EA 3W6GA 4HJ2A 2XPDA 1K0MA 1VF3A 1GTAA 4K1FA 1O8WA 1Z7PA 3C1SA 1YEXA 1BYEA 2ES7A 5J4UA 2HI7A 3M0FA 1X5EA 1GNEA 2O89A 4ZXGA 2DJ1A 1GTIA 2IPAA 1SK0A 2FUG2 4MJBA 3UBKA 3VPQA 5GSSA 3EURA 3F63A 4TW5A 4PXOA 3LG6A 2YV7A 5E59A 2DBCA 5D9WA 1Y6EA 1YY7A 4EUYA 4RUVA 5AN1A 1GSUA 3QPMA 4MMMA 3UAPA 1ZZYA 5A4UA 2K8SA 3DD3A 3IXRA 4HU7A 1WE0A 2VUPA 3ZFBA 4G2EA 3TOTA 1SD9A 3GHAA 5H5SA 2AAWA 1XW9A 2AUVA 2WFCA 4JRRA 2B1KA 3GURA 5DDLA 5COHA 3GX0A 4NMUA 4AJ8A 14GSA 1E2YA 1FB6A 1QUWA 4JEDA 3S9FA 2HLSA 4TR4A 4XTSA 4IW9A 4V1Ag 5IMVA 4KAEA 1W89A 2DC5A 1FG4A 5DBQA 1M0UA 4LMVA 4ZB9A 2MBSA 5A4WA 8GSSA 3VWWA 4YAPA 3RHCA 4ZL9A 3QFBC 4KDXA 3D5JA 4N0VA 2YWNA 2VM2A 4DSQA 4RQRA 1K0BA 4BL7A 4ILFA 2ZNMA 4ECCA 1T8EB 2GSRA 4L0UA 3P2AA 1TJDA 1JLVA 1OC9A 1AQVA 2WDUA 4BWSA 5G5EA 4E8HA 1OE8A 1WOUA 5CP1A 2L6CA 4X0XA 2VL2C 5HFGA 1H4OA 1SKRB 1B8XA 4HS1A 3DIEA 4IHUA 4LLRA 6GSWA 1TI1A 3GKXA 2HT9A 1O73A 1YF0A 5JCUA 1MD4A 2IWTA 2R4VA 3HCZA 3L4NA 3L78A 2MMNA 2GVPA 2LJRA 5AIVA 1OKTA 1EP7A 3FR3A 1HQOA 2VCTA 3D22A 5FT3A 2NPBA 4BA7A 2BMXA 2C0DA 4MF7A 4L8EA 1XOBA 4OO4A 5ID2B 3TKSE 2LJAA 5B7CA 2RUFA 2RIIA 1XWGA 3UMAA 2YWMA 1AIUA 4D73A 3VI7A 4MZBA 5IOXA 2CX3A 5A5KA 1THXA 3MAKA 4FYBA 1J9BA 3GRXA 1GLPA 1O6JA 4TXVA 4EVMA 3M9JA 4TXOB 5ECHB 3ZL5A 1SK2A 2HYXA 1K0NA 3QAWA 1YKAA 4ZL7A 2EC4A 3IOSA 2PWJA 1O7UA 4GXZA 1OC8A 2N5FA 1GRXA 3ZMLA 1S3DA 3FY7A 3C7MA 4EDYA 4J57E 1UC7A 1QK8A 1G7OA 4WBRD 3HVXA 2H73A 3FZ5A 4EO3A 2PBJA 3GTUA 1M2AA 4POLA 1GUHA 3HYPA 2MBTA 1TU7A 1MDIA 1G0TA 1O8XA 4DSSB 1XBSA 3A2VA 3BBYA 2C1YA 3NIVA 3FYGA 1GUKA 1YKCA 3F4TA 3VFIA 4N0ZA 3V1WA 2VD0A 2WB9A 2WZ9A 5L71A 1JZOA 3UARA 5ECLB 4F2IA 1MEKA 5GSTA 4I97A 3H8QA 2WCIA 2R3XA 3QMXA 4MJCA 2OA7A 5G1KA 2B1LA 1WJKA 5AIXA 1MDKA 1TDIA 3LXZA 3F9UA 1PN9A 3UL3A 1TK0B 2GSQA 3TRXA 3HVVA 3EYTA 3ZLPA 1TOFA 3RDWA 5CYYA 4KUNA 3W8SA 1CQHA 2LRTA 3IPZA 4LA1A 4PUFC 3DGQA 5CRDA 1T4ZA 16GSA 3FHKA 1WWJA 3KH9A 4AJ6A 4I8BA 1T7PB 1PL1A 1K0AA 4KCAA 1DE1A 4XRAA 4EC0A 2HRNA 1PD21 4HZ2A 5F0GA 5DALB 1R7HA 5DAKB 3KCMA 3VWUA 4GLTA 1M2DA 2K6VA 3O3TA 1VF4A 2MYGA 1A0RP 2X64A 3CRTA 3WGXA 3GNJA 1CQGA 3IRAA 1F3BA 5C00A 2YP6A 2YWOA 5HR3A 3TJJA 5IPHA 1EOGA 2IJYA 4JZQA 3IV4A 3CYNA 1DSBA 2A2SA 2C0FA 3GMFA 1PKZA 2B5YA 1Z6MA 1Q4JA 1OKDA 5FHIA 4HEA2 1FW1A 2F9SA 3ZVJD 2K9FA 4OFTA 1XVWA 2NTOA 3NOFA 3GUSA 2EIRA 6GSUA 2XBIA 3TKPA 4FYUA 4Q5RA 2VCWA 1GSSA 3E0UA 4K2DA 3K8NA 3F3QA 3LGCA 5EVOA 7GSSA 5J9BA 5G2ZA 3BCIA 1XWBA 4L5OA 1M9BA 5HFIA 2KUCA 1ACVA 13GSA 5JWRB 2RUEA 1GL8A 1R4WA 1SL0B 1HNAA 4IN0A 2DJ3A 1W4VA 2DMLA 2L57A 2VL3A 1DBYA 3GH6A 1EGOA 1GSFA 4TR1A 3TOUA 3RPPA 1XW6A 2ZUPA 2HNLA 2YNXA 1SK1A 2BJXA 2HRFA 1ERTA 5DJLA 3WD6A 3DEXA 2B6MA 1X5DA 3A2XA 3P7XA 1GSDA 3G7YA 3DVWA 4K7OA 4GQCA 4GRFA 4KNDA 4ID0A 2VL2A 1A2LA 2WGRA 4MPGA 1B9YC 4GSNA 1A8LA 4V2LA 3ZZXA 4JR4A 4GQFA 3CBUA 4CW9A 4I6XA 3FZAA 2F51A 2I81A 2LNTA 5G30A 4GSTA 5KN3A 1M2BA 1HNBA 5DQSA 4K7NA 2GQKA 6GSXA 1AAZA 1LJRA 1A0FA 5CRGA 2OE3A 4N30A 1PX7A 4TVEA 2I9HA 2YWIA 3DWVA 1ON4A 5AISA 3UJ1A 1PA3A 1MDJA 5F05A 4WEYA 3A5WA 2O85A 3ISOA 2VOCA 4YAVA 1TK8B 3RPNA 2MMOA 3GL5A 3CTGA 2FD3A 2HSHA 5D9TA 4QQ7A 4WF4A 4XS4B 3PH9A 4MZCA 2YZHA 5IMFA 5IOWA 2CVBA 3TJKA 2H72A 4K7IA 3H93A 2AV4A 2MMZA 1A2MA 4KDYA 12GSA 2P31A 2IMIA 3C1RA 2E2MA 5EL8A 5HR2A 4EE0A 4WKWA 1PGTA 1ILOA 2X8HA 1I5GA 1MTCA 4BVXA 2CAQA 3KTLA 1V58A 1GP1A 1C72A 1BJXA 1ERVA 3GV1A 4NHWA 5INYA 3O6TA 3AY8A 3GH9A 5ELAA 3TKQA 2J23A 4HU9A 4XS6A 5KN2A 1V98A 3QOUA 2IMDA 5ECPB 2PU9C 1XZOA 3D4MA 2B7KA 4ZB6A 3KP8A 2H1BA 2H6YA 2ON7A 1TRSA 3UOMA 4IBPA 1RQMA 2MZCA 2QKEA 1BEDA 2BTOT 4XS1A 2LQQA 4MPFA 2GQMA 2IL3A 2HE3A 1SL2B 4TR0A 2DJJA 1GLQA 1WP0A 1GNWA 2FHEA 1A8YA 3GKKA 2WULA 3LFLA 3G7JA 4ZBBA 2VIMA 2G2QA 4I2UA 1SENA 1NW2A 2JACA 4P3YB 3DMLA 2K8VA 1R26A 4F03A 1T1VA 2JL4A 3H79A 3KTBA 3I6AA 2RM6A 3HY2A 4HZ4A 1A24A 1XFLA 2GZYA 3C73A 2F8FA 4G10A 4EKZA 3VWXA 5ECKB 1Q98A 4WF5A 2N5BA 3TKSC 1JLWA 4DSRA 2XC2A 5GAND 3IBHA 5LD0A 4L0WA 3W8JA 2H70A 3BCKA 3I9V2 4TKYA 3GSSA 2JSYA 2L59A 2MMAA 5LNKe 2CT6A 1XWCA 2K18A 4MABA 4PURA 3ZITA 3EU4A 5F06A 4LMWA 4AF2A 2HZEA 4RI6A 2WJUA 3LQ7A 3TJGA 3HA9A 4MK3A 2LTKA 1OE7A 4K8MA 4ZB8A 4I5QA 3WT2A 3IA1A 2L4CA 1PX6A 4WXTA 4K0NA 1VF1A 2PN8A 4OMVA 1YQ1A 4IJIA 4LL4B 1NM3A 3TKRA 1U3AA 2IIYA 5C04A 2YCDA 3Q6OA 2GLRA 1ABAA 1FVKA 3LYKA 2CVDA 3KH7A 3TRPA 1GTBA 3VWVA 1FAAA 4MDCA 4DVCA 4MA9A 1XW5A 2LRNA 3GFKA 2I1UA 2LS5A 9GSSA 3EU3A 3APQA 3FEUA 1KNGA 5IPGA 1EP8A 3Q19A 4KGIA 3F4SA 1YZXA 1Z9HA 4ACSA 2H6XA 1WPIA 2O8VB 2DSAA 2H0HA 1PKWA 2H01A 3U6VA 1ZL9A 2VLTA 3DXBA 1G7EA 2LRCA 4J2FA 3HZ8A 2C0EA 4XIHA 2QGVA 4G9HA 2B3SA 2JZRA 4KCEA 1M9AA 4K6XA 2Z9SA 1TKDB 2CZ3A 2R5GA 4F9ZA 2AJQB 1ZYEA 2VO4A 2GSSA 1Z6NA 4PNFA 2GDRA 4FYCA 1VGLA 5HR1A 4YQVA 2XHFA 4MCUA 1ML6A 1U88A 1Z5YE 3GN3A 1TTZA 3TUEA 1K3YA 3VK9A 4TRXA 1LU4A 3Q18A 4EF0A 2DMMA 4CHSA 4WR4A 3ZMKA 4MP4A 5IO0A 4PX1A 1B4QA 1N2AA 1TI3A 2V6KA 2HFDA 3HXSA 4NXIA 1T00A 3P8WA 2E2GA 5HR0A 4JBBA 3IC4A 1QXHA 5GZZB 2C3QA 3TDGA 2VLUA 5CAXA 3SBCA 2AB6A 4KSOA 1EGRA 5JCWA 3RHBA 2V41A 2ON5A 1XOAA 1R5PA 3DYRA 1PQNA 3ZFLA 1FO5A 1SKWB 1VF2A 1U3IA 2A4VA 1A23A 3A2WA 3F4RA 3ZVJA 3LYPA 2YV9A 2NBSA 1XIYA 4EXJA 1T3BA 4ZBDA 1GSEA 1F6MC 4KW6A 5A4VA 1IYHA 2H1DA 2DJ0A 2NDOA 2XPEA 4FH8A 2VLVA 4BVYA 4N10A 2GT6A 3LJRA 2GT5A 4QL7A 2GS3A 1EV4A 3F8UA 3M9KA 1ERWA 2M46A 3J7Yb 1TK5B 1NHOA 2H1AA 2WS2A 2EIQA 2IFQB 4WR5A 3HKRA 2H71A 2V1MA 4J56E 4NHZA 2G0FA 1X9WB 5HFKA 3PR8A 1USBA 4V2MA 1PMTA 3QDNA 1NSWA 4F0CA 2AHEA 1ZMAA 2M80A 1GSYA 3N5OA 4PNGA 5LCZA 4PUAA 5KN0A 5H5QA 1OYJA 1IYIA 2H0IA 4IP6A 2GZPA 4RI7A 2V2GA 22GSA 2C0GA 4JU5A 3HD5A 1RW1A 3HVSA 2H0GA 3EINA 4OD7A 1WMJA 2L5LA 1UA5A 2D2ZA 4L5LA 1SYRA 3KXOA 1K0CA 1V9WA 2KLXA 3DKSA 5ECMB 1TU8A 1HNCA 3LORA 3RBTA 4O5RA 2OBKA 1RK4A 2KP1A 5ENUA 3HDCA 2OADA 3EVIA 3WGEA 1BAYA 2C80A 4D73B 1V40A 4GF0A 4I2TA 2XBQA 4ECBA 2YPMA 1SL1B 2VD1A 3J7Yk 2KHPA 1TXXA 1F2EA 5ID2A 3VI5A 2LNSA 1THOA 3OR5A 3H4KA 4WBJA 2P5QA 5F07A 5B8BA 1PSQA 3HZ4A 3IAS2 5DCHA 3GYKA 2O87A 3FRCA 1WIKA 1ZYQB 1XCCA 4DEJA 4OCFA 1YJ6A 5JWQB 4TXOA 2YJHA 5CRHA 4XHMA 1X9SB 2OBIA 4KE3A 2FA4A 4MJEA 4IJ3A 3TJBA 1VRSD 2M72A 2LEGA 3QAVA 3QCPA 3IK9A 2I4AA 2NVLA 1K3LA 2B7JA 2FWEA 1GSQA 3CSHA 1KTEA 2H75A 1DUGA 1EZKA 4ZILA 2OE0A 4GWRA 1J08A 2TRCP 3ZRDA 4Q5QA 1K0DA 1FOVA 3EWLA 3CTFA 1UN2A 2R37A 2H1GA 1WRYA 5ECSA 5ECNB 4DSSA 3GKMA 2LUSA 5J41A 5G1LA 2C8UA 3C71A 2A2RA 4AJ7A 2PUKC 4X1UA 3HJMA 4ISDA 1SU9A 3FZ4A 4KX4A 4MLYA 3IDVA 1SJIA 4FIWA 2PVQA 2QSIA 4Z7XA 4KSMA 5JCGA 2LJKA 4KB3A 4NAXA 1SD8A
chains in the Genus database with same CATH superfamily
1AW9A 4GSSA 3R2QA 2GZZA 1JFUA 2PVOC 1EOHA 2IMKA 2FWHA 1BX9A 5DQYA 18GSA 3D0ZA 4PGTA 5DCGA 2R6KA 1OAZA 1V57A 4ULXA 2V6OA 4OWYA 4HI7A 4MF5A 2UZ8A 5ECRB 5IMZA 5DALA 2FGXA 3WT1A 5DAKA 2VM1A 3A3TA 3DVXA 2YN1A 1KBNA 1SKSB 1SJ6A 2PERA 11GSA 5BMUA 1QQ2A 2KP2A 2VCVA 5CRWA 2DIZA 6GSVA 2A4HA 3NZNA 4KA0A 4O92A 3FR9A 3FR6A 3IR4A 4OFNA 4MH3A 4NWYA 3C8EA 2L6DA 1K0OA 3F0IA 1EEMA 2EIOA 1XPVA 5IMDA 2N5AA 1U6TA 1OVNA 1TW9A 1NHYA 2H6ZA 1SYXA 5D8IA 3US3A 2P5RA 1YEPA 1PN0A 2YOIA 4FO5A 3ZTLA 2VL9A 3G9BA 2L4QA 1BQ7A 1MD3A 3ZIJA 1QMVA 3UVTA 3L0HA 3ERFA 3IE3A 2IFQA 4IP1A 3VPTA 1O81A 3KJYA 5F8BA 1GTUA 1K3OA 4Q5NA 3ZYWA 4PQ1A 1X0RA 4OCEA 5J3RA 4K9ZA 19GSA 1M3JA 1JZWA 3APSA 3M1GA 1T4YA 4OO5A 5IQYA 4Q5FA 4V1Ap 3HJOA 2CZ2A 1G6WA 4ML1A 6GSSA 2F3MA 2HRKA 1AUCA 2H30A 3RAZA 1GH2A 2HRAA 1M99A 3LWAA 4K0GA 1TRWA 1XWAA 3F6DA 2E7PA 3KEBA 2X8GA 4TR1B 2P0GA 3LXTA 3L9SA 3MDKA 4HQSA 3HJPA 1GUMA 2IMEA 2V32A 1ZOFA 5H5RA 1Y25A 2DLXA 1TP9A 3KGKA 2FA8A 1ZGNA 1PRXA 3KMNA 5HQPA 4O5UA 3U5RE 3P90A 2TRXA 2H8LA 2LV3A 3M3MA 2VAFA 3VLNA 2C3TA 3FW2A 1ZCPA 1S3AA 3FZ9A 2L5OA 3CSIA 2VCZA 3GX8A 1S3CA 2PGTA 4IGJA 4F82A 2ALBA 5IO2A 3HHVA 4X43A 2JZSA 4KH7A 4ZIJA 4TN8A 4G0LA 4POMA 4YQMA 2CVKA 3N9JA 1EWXA 17GSA 5AGYA 1AXDA 1YF1A 3ED3A 1GWCA 4F0BA 2IN3A 2X49A 5IM9A 2YZUA 2WRTA 2YANA 4IVFA 2HZFA 2HXKA 1JZDA 2REMA 4MF6A 1R5AA 3ME8A 3BOAA 3TB2A 2ZCTA 6GSYA 4HQZA 2LKUA 1HD2A 2I3YA 3ZIVA 4JR6A 1HYUA 4ECIA 3I69A 1FB0A 1GULA 3F3RA 3PGTA 1M7TA 4HDEA 2DJKA 3UIWA 3M8NA 4GCIA 4N11A 1B48A 3L9VA 2H19A 2GGTA 4WETA 4XS4A 3BJ5A 1X5CA 1DE2A 2E0QA 5DVBA 4ZL8A 4XRDA 2RLIA 2DJ2A 3EMPA 4EDZA 1XVQA 3H1NA 2DKIA 2GSTA 3TGZA 4MZWA 2AYTA 3EC3A 4BWQA 5J5NA 4BVXB 4JE1A 4EIQA 4NPBA 1JZRA 1QGVA 2CV4A 1UVZA 2RM5A 3KIJA 3GA4A 2C4JA 5EPFA 5KN1A 2CX4A 4NV5A 2PPTA 2JZTA 3I43A 3GSTA 1FHEA 1AC1A 4O7HA 1Z3EA 20GSA 3QR6A 3G7IA 3Q74A 2GTUA 3IHGA 1FVJA 2VCXA 2CQ9A 4NV2A 1TRUA 1X9MB 1LBKA 3IAM2 2C3NA 3PINA 3ERWA 1AQXA 3F6FA 3KM6A 1EEJA 5ECOB 1AQWA 2JU5A 2LSTA 2FWFA 4XCSA 1XWKA 3CRUA 2H76A 5D9VA 2VCQA 5D9XA 1B9XC 2H74A 10GSA 1F9MA 1A2JA 1F37A 3UVHA 4OFMA 4HSCX 2KOKA 4MH2A 4POKA 5JWOB 4CDOA 5D96A 3TRQA 4IKHA 5ABRA 1V2AA 6GSTA 5IMCA 2LQOA 3CSJA 2YJ7A 4YH2A 3FK8A 4EIPA 4KDUA 5B8AA 1OC9B 4IQAA 3DRNA 4HOJA 3UEMA 2B5EA 4IELA 3E9JB 1B4PA 4TR3A 3ME7A 1F3AA 1PL2A 4O5QA 1TRVA 5GAPD 3KMOA 5IMAA 3LSZA 3MNGA 4YQUA 2F8AA 2R0GA 1N8JA 2X99A 1G6YA 4HJMA 5DJMA 5J9CA 2PMTA 4KF9A 4H86A 1Z7RA 2FCHA 3ERGA 1J0FA 5KOWA 2FLSA 2CAIA 2DIYA 1URMA 3D6IA 3EMXA 3JCML 4HUAA 5G31A 3GKNA 4PQHA 3APOA 2J9HA 4O32A 2JADA 3UBLA 2HZEB 3MWHA 3MIXA 3KP9A 1ST9A 1ERUA 3LEFA 4E8EA 4POBA 5D93A 1OC3A 1KEBA 2O7KA 4MJAA 3KZQA 3WGDA 2R2JA 4IS0A 2X8CA 5B6NA 1JHBA 3KD0A 5CREA 3O76A 2TIRA 2FY6A 5CNWA 2JSZA 4TOPA 5IIZA 2OJLA 5KEJA 2HSYA 3GL3A 1BG5A 2B5XA 3QD9A 3TKSA 3TJFA 2FWGA 2H66A 4LL1B 1H75A 4RQXA 4PQIA 3TCOA 4QL9A 5E4WA 4ML6A 3GIXA 5ECQB 1YDKA 3HVNA 4G19A 1O85A 3FKFA 2OE1A 3WYWA 5G5FA 3BD2A 2OACA 3R3EA 5CO3A 1E6BA 3GTUB 3EE2A 4V2NA 5FWGA 1I9DA 2OKAA 2CA8A 3ZREA 3D21A 3D4TA 2GQLA 4GTUA 5EY6A 5D73A 3IK7A 1U87A 4BPYA 5B6MA 5ECIB 2IMFA 1SJZA 3IHQA 3QFAC 3MSZA 4EL1A 4X4JA 3QAGA 1XXUA 3SWLA 1EV9A 1QFNA 4IQ1A 2QC7A 2FNOA 4ZBAA 4ECJA 4AGSA 5ELGA 3VURA 3CMIA 3L9UA 3CXGA 3E3EA 3W6GA 4HJ2A 2XPDA 1K0MA 1VF3A 1GTAA 4K1FA 1O8WA 1Z7PA 3C1SA 1YEXA 1BYEA 2ES7A 5J4UA 2HI7A 3M0FA 1X5EA 1GNEA 2O89A 4ZXGA 2DJ1A 1GTIA 2QA1A 2IPAA 1SK0A 2FUG2 4MJBA 3UBKA 3VPQA 5GSSA 3EURA 3F63A 4TW5A 4PXOA 3LG6A 2YV7A 5E59A 2DBCA 5D9WA 1Y6EA 1YY7A 4EUYA 4RUVA 5AN1A 1GSUA 3QPMA 4MMMA 3UAPA 1ZZYA 5A4UA 2K8SA 3DD3A 3IXRA 4HU7A 1WE0A 2VUPA 3ZFBA 4G2EA 3TOTA 1SD9A 3GHAA 5H5SA 2AAWA 1XW9A 2AUVA 2WFCA 4JRRA 2B1KA 3GURA 5DDLA 5COHA 3GX0A 4NMUA 4AJ8A 14GSA 1E2YA 4BVYB 1FB6A 1QUWA 4JEDA 3S9FA 2HLSA 4TR4A 1XG8A 4XTSA 4IW9A 4V1Ag 5IMVA 4KAEA 1W89A 2DC5A 1FG4A 5DBQA 1M0UA 4LMVA 4ZB9A 2MBSA 5A4WA 8GSSA 3VWWA 4YAPA 3RHCA 4ZL9A 3QFBC 4KDXA 3D5JA 4N0VA 2YWNA 2VM2A 4DSQA 3IC8A 4RQRA 1K0BA 4BL7A 3MYDA 4CY8A 4ILFA 2ZNMA 4ECCA 1T8EB 2GSRA 4L0UA 3P2AA 1TJDA 1JLVA 3A5IA 1OC9A 1AQVA 2WDUA 4BWSA 5G5EA 4E8HA 1OE8A 1WOUA 5CP1A 2L6CA 4X0XA 2VL2C 5HFGA 1H4OA 1SKRB 1B8XA 4HS1A 3DIEA 4IHUA 4LLRA 6GSWA 1TI1A 3GKXA 1M3IA 2HT9A 1O73A 1YF0A 5JCUA 1MD4A 2IWTA 2R4VA 3HCZA 3L4NA 3L78A 2MMNA 2GVPA 4USSA 2LJRA 5AIVA 1OKTA 1EP7A 3FR3A 1HQOA 2VCTA 3D22A 5FT3A 2NPBA 4BA7A 2BMXA 2C0DA 4MF7A 4L8EA 1XOBA 4OO4A 5ID2B 3TKSE 2LJAA 5B7CA 2RUFA 2RIIA 1XWGA 3UMAA 2YWMA 1AIUA 4D73A 3VI7A 4MZBA 5IOXA 2CX3A 5A5KA 1THXA 3MAKA 4FYBA 4Z2TA 1J9BA 3GRXA 1GLPA 1O6JA 4TXVA 4EVMA 3M9JA 4TXOB 5ECHB 3ZL5A 1SK2A 2HYXA 1K0NA 3QAWA 1YKAA 4ZL7A 2EC4A 3IOSA 2PWJA 1O7UA 4GXZA 1OC8A 2N5FA 1GRXA 3ZMLA 1S3DA 3FY7A 3C7MA 4EDYA 4J57E 1UC7A 1QK8A 1G7OA 4WBRD 3HVXA 2H73A 3FZ5A 4EO3A 2PBJA 3GTUA 1M2AA 4POLA 1GUHA 3HYPA 2MBTA 1TU7A 1MDIA 1G0TA 1O8XA 4DSSB 1XBSA 3A2VA 3BBYA 2C1YA 3NIVA 3FYGA 1GUKA 1YKCA 3F4TA 3VFIA 4N0ZA 3V1WA 2VD0A 2WB9A 2WZ9A 5L71A 1JZOA 3UARA 5ECLB 4F2IA 1MEKA 5GSTA 4I97A 3H8QA 2WCIA 2R3XA 3QMXA 4MJCA 2OA7A 5G1KA 2B1LA 1WJKA 5AIXA 1MDKA 1TDIA 3LXZA 3F9UA 1PN9A 3UL3A 1TK0B 2GSQA 3TRXA 3HVVA 3EYTA 3ZLPA 1TOFA 3RDWA 5CYYA 4KUNA 3W8SA 1CQHA 1PFOA 2LRTA 3IPZA 4LA1A 4PUFC 3DGQA 5CRDA 1T4ZA 16GSA 3FHKA 1WWJA 3KH9A 4AJ6A 4I8BA 4CY6A 1T7PB 1PL1A 1K0AA 4KCAA 1DE1A 4XRAA 4EC0A 2HRNA 1PD21 4HZ2A 5F0GA 5DALB 1R7HA 5DAKB 3KCMA 3VWUA 4GLTA 1M2DA 2K6VA 3O3TA 1VF4A 2MYGA 1A0RP 2X64A 3CRTA 3WGXA 3GNJA 1CQGA 3IRAA 1F3BA 5C00A 2YP6A 2YWOA 5HR3A 3TJJA 5IPHA 1EOGA 2IJYA 4K2XA 4JZQA 3IV4A 3CYNA 2DKHA 1DSBA 2A2SA 2C0FA 3GMFA 1PKZA 2B5YA 1Z6MA 1Q4JA 1OKDA 5FHIA 4HEA2 1FW1A 2F9SA 3ZVJD 2K9FA 4OFTA 1XVWA 2NTOA 4BIKA 3NOFA 3GUSA 2EIRA 6GSUA 2XBIA 3TKPA 4FYUA 4Q5RA 2A2PA 2VCWA 1GSSA 3E0UA 4K2DA 3K8NA 3F3QA 3LGCA 5EVOA 7GSSA 5J9BA 5G2ZA 3BCIA 1XWBA 2R0PA 4L5OA 1M9BA 5HFIA 2KUCA 1ACVA 13GSA 5JWRB 2RUEA 1GL8A 1R4WA 1SL0B 1HNAA 4IN0A 2DJ3A 1W4VA 2DMLA 2L57A 2VL3A 1DBYA 3GH6A 1EGOA 1GSFA 4TR1A 3TOUA 3RPPA 1XW6A 2ZUPA 2HNLA 2YNXA 4K5RA 1SK1A 2BJXA 2HRFA 1ERTA 5DJLA 3WD6A 3DEXA 2B6MA 1X5DA 3A2XA 3P7XA 1GSDA 4G0IA 3G7YA 3DVWA 4K7OA 4GQCA 4GRFA 4KNDA 4ID0A 2VL2A 1A2LA 2WGRA 4MPGA 1B9YC 4GSNA 1A8LA 4V2LA 3ZZXA 4JR4A 4GQFA 3CBUA 4CW9A 4I6XA 3FZAA 2F51A 2I81A 2LNTA 5G30A 4GSTA 5KN3A 1M2BA 1HNBA 5DQSA 4K7NA 2GQKA 6GSXA 1AAZA 1LJRA 1A0FA 4PTSA 5CRGA 2OE3A 4N30A 1PX7A 4TVEA 2I9HA 2YWIA 3DWVA 1ON4A 5AISA 3UJ1A 1PA3A 1MDJA 5F05A 4WEYA 3A5WA 2O85A 3ISOA 2VOCA 4YAVA 1TK8B 3RPNA 2MMOA 3GL5A 3CTGA 2FD3A 2HSHA 5D9TA 4QQ7A 4WF4A 4Z2RA 4XS4B 3PH9A 4MZCA 2YZHA 5IMFA 5IOWA 2CVBA 3TJKA 2H72A 4K7IA 3H93A 2AV4A 2MMZA 1A2MA 4KDYA 12GSA 2P31A 2IMIA 3C1RA 2E2MA 5KOXA 5EL8A 5HR2A 4EE0A 4WKWA 1PGTA 1ILOA 2X8HA 1I5GA 1MTCA 4BVXA 2CAQA 3KTLA 1V58A 1GP1A 1C72A 1BJXA 1ERVA 3GV1A 4NHWA 5INYA 3O6TA 3AY8A 3GH9A 5ELAA 3TKQA 2J23A 4HU9A 4XS6A 5KN2A 1V98A 3QOUA 2IMDA 5ECPB 2PU9C 1XZOA 3D4MA 2B7KA 4ZB6A 3KP8A 2H1BA 2H6YA 2ON7A 1TRSA 3UOMA 4IBPA 1RQMA 2MZCA 2QKEA 1BEDA 2BTOT 4XS1A 2LQQA 4MPFA 2GQMA 2IL3A 2HE3A 1SL2B 4TR0A 2DJJA 1GLQA 1WP0A 1GNWA 2FHEA 1A8YA 3GKKA 2WULA 3LFLA 3G7JA 4ZBBA 2VIMA 2G2QA 4I2UA 1SENA 1NW2A 2JACA 4P3YB 3DMLA 2K8VA 1R26A 4F03A 1T1VA 2QA2A 2JL4A 3H79A 3KTBA 3I6AA 4YKFA 4K5SA 2RM6A 3HY2A 4HZ4A 1A24A 1XFLA 2GZYA 3C73A 2F8FA 4G10A 4EKZA 3VWXA 5ECKB 1Q98A 4WF5A 2N5BA 3TKSC 1JLWA 4DSRA 2XC2A 5GAND 3IBHA 5LD0A 4L0WA 3W8JA 3CQFA 2H70A 3BCKA 3I9V2 3FMWA 4TKYA 3GSSA 2JSYA 2L59A 2MMAA 5LNKe 2CT6A 1XWCA 2K18A 4MABA 4PURA 3ZITA 3EU4A 5F06A 4LMWA 4AF2A 2HZEA 4RI6A 2WJUA 3LQ7A 3TJGA 3HA9A 4MK3A 2LTKA 1OE7A 4K8MA 4ZB8A 4I5QA 3WT2A 3IA1A 2L4CA 1PX6A 4WXTA 4K0NA 1VF1A 2PN8A 4OMVA 1YQ1A 4G0KA 4IJIA 4LL4B 1NM3A 3TKRA 1U3AA 2IIYA 5C04A 2YCDA 3Q6OA 2GLRA 1ABAA 1FVKA 3LYKA 2CVDA 3KH7A 3TRPA 1GTBA 3VWVA 1FAAA 4MDCA 4DVCA 4MA9A 1XW5A 2LRNA 3GFKA 2I1UA 2LS5A 9GSSA 3EU3A 3APQA 3FEUA 1KNGA 5IPGA 1EP8A 3Q19A 4KGIA 3F4SA 1YZXA 1Z9HA 4ACSA 2H6XA 1WPIA 2O8VB 2DSAA 2H0HA 1PKWA 2H01A 3U6VA 1ZL9A 2VLTA 3DXBA 4A5PA 1G7EA 2LRCA 4J2FA 3HZ8A 2C0EA 4XIHA 2QGVA 4G9HA 2B3SA 2JZRA 4KCEA 1M9AA 4K6XA 2Z9SA 1TKDB 2CZ3A 2R5GA 2X4AA 4F9ZA 2AJQB 1ZYEA 2VO4A 2GSSA 1Z6NA 4PNFA 2GDRA 5BRTA 1FOHA 4FYCA 1VGLA 5HR1A 4YQVA 2XHFA 4MCUA 4FQUA 1ML6A 1U88A 1Z5YE 3GN3A 1TTZA 3TUEA 1K3YA 3VK9A 4TRXA 1LU4A 3Q18A 4EF0A 2DMMA 4CHSA 4WR4A 3ZMKA 4MP4A 5IO0A 4Z2UA 4PX1A 1B4QA 1N2AA 1TI3A 2V6KA 2HFDA 3HXSA 4NXIA 1T00A 3P8WA 2E2GA 5HR0A 4JBBA 3IC4A 1QXHA 5GZZB 2C3QA 3TDGA 2VLUA 5CAXA 4MNNA 3SBCA 2AB6A 4KSOA 1EGRA 5JCWA 3RHBA 2V41A 2ON5A 1XOAA 1R5PA 3DYRA 1PQNA 3ZFLA 1FO5A 1SKWB 1VF2A 1U3IA 2A4VA 1A23A 3A2WA 3F4RA 3ZVJA 3LYPA 2YV9A 2NBSA 1XIYA 4EXJA 1T3BA 4ZBDA 1GSEA 1F6MC 4KW6A 5A4VA 1IYHA 2H1DA 2DJ0A 2NDOA 4YKGA 2XPEA 4FH8A 2VLVA 4BVYA 4N10A 2GT6A 3LJRA 2GT5A 4QL7A 2GS3A 1EV4A 3F8UA 3M9KA 1ERWA 2M46A 3J7Yb 1TK5B 4BL7B 1NHOA 2H1AA 2WS2A 2EIQA 2IFQB 4WR5A 1S3RA 3HKRA 2H71A 2V1MA 4J56E 4NHZA 2G0FA 1X9WB 5HFKA 3PR8A 1USBA 4V2MA 1PMTA 3QDNA 1NSWA 4F0CA 2AHEA 4ICYA 1ZMAA 2M80A 1GSYA 3N5OA 4PNGA 5LCZA 4PUAA 5KN0A 5H5QA 1OYJA 1IYIA 2H0IA 4IP6A 2GZPA 3PPUA 4RI7A 2V2GA 22GSA 2C0GA 4JU5A 3HD5A 1RW1A 3HVSA 2H0GA 3EINA 4OD7A 1WMJA 2L5LA 1UA5A 2D2ZA 4L5LA 1SYRA 3KXOA 1K0CA 1V9WA 2KLXA 3DKSA 5ECMB 1TU8A 1HNCA 3LORA 3RBTA 4O5RA 2OBKA 1RK4A 2KP1A 5ENUA 3HDCA 2OADA 3EVIA 3WGEA 1BAYA 2C80A 4D73B 1V40A 4GF0A 4I2TA 2XBQA 4ECBA 2YPMA 1SL1B 2VD1A 3J7Yk 2KHPA 1TXXA 1ZYNA 1F2EA 5ID2A 3VI5A 2LNSA 1THOA 3OR5A 3H4KA 4WBJA 2P5QA 5F07A 2R0CA 5B8BA 1PSQA 3HZ4A 3IAS2 5DCHA 3GYKA 2O87A 3FRCA 1WIKA 1ZYQB 1XCCA 4DEJA 4OCFA 1YJ6A 5JWQB 4TXOA 2YJHA 5CRHA 1ZYPA 4XHMA 1X9SB 2OBIA 4KE3A 2FA4A 4MJEA 4IJ3A 3TJBA 1VRSD 2M72A 2LEGA 3QAVA 3QCPA 3IK9A 2I4AA 2NVLA 3EPTA 1K3LA 2B7JA 2FWEA 1GSQA 3CSHA 1KTEA 2H75A 1DUGA 1EZKA 4ZILA 2OE0A 4GWRA 2HSMA 1J08A 2TRCP 3ZRDA 4Q5QA 1K0DA 1FOVA 3EWLA 3CTFA 1UN2A 2R37A 2H1GA 1WRYA 5ECSA 5ECNB 4DSSA 3GKMA 2LUSA 5J41A 5G1LA 2C8UA 3C71A 2A2RA 4AJ7A 2PUKC 4X1UA 3HJMA 3LW9A 4ISDA 1SU9A 3FZ4A 4KX4A 4MLYA 3IDVA 1SJIA 4FIWA 2PVQA 2QSIA 4Z7XA 4KSMA 5JCGA 2LJKA 4KB3A 4NAXA 1SD8A
chains in the Genus database with same CATH topology
1AW9A 4GSSA 3R2QA 2GZZA 1JFUA 2PVOC 1EOHA 2IMKA 2FWHA 1BX9A 5DQYA 18GSA 3D0ZA 4PGTA 5DCGA 2R6KA 1OAZA 1V57A 4ULXA 2V6OA 4OWYA 4HI7A 4MF5A 2UZ8A 5ECRB 5IMZA 5DALA 2FGXA 3WT1A 5DAKA 2VM1A 3A3TA 3DVXA 2YN1A 1KBNA 1SKSB 1SJ6A 2PERA 11GSA 5BMUA 1QQ2A 2KP2A 2VCVA 5CRWA 2DIZA 6GSVA 2A4HA 3NZNA 4KA0A 4O92A 3FR9A 3FR6A 3IR4A 4OFNA 4MH3A 4NWYA 3C8EA 2L6DA 1K0OA 3F0IA 1EEMA 2EIOA 1XPVA 5IMDA 2N5AA 1U6TA 1OVNA 1TW9A 1NHYA 2H6ZA 1SYXA 5D8IA 3US3A 2P5RA 1YEPA 1PN0A 2YOIA 4FO5A 3ZTLA 2VL9A 3G9BA 2L4QA 1BQ7A 1MD3A 3ZIJA 1QMVA 3UVTA 3L0HA 3ERFA 3IE3A 2IFQA 4IP1A 3VPTA 1O81A 3KJYA 5F8BA 1GTUA 1K3OA 4Q5NA 3ZYWA 4PQ1A 1X0RA 4OCEA 5J3RA 4K9ZA 19GSA 1JZWA 3APSA 3M1GA 1T4YA 4OO5A 5IQYA 4Q5FA 4V1Ap 3HJOA 2CZ2A 1G6WA 4ML1A 6GSSA 2F3MA 2HRKA 1AUCA 2H30A 3RAZA 1GH2A 2HRAA 1M99A 3LWAA 4K0GA 1TRWA 1XWAA 3F6DA 2E7PA 3KEBA 2X8GA 4TR1B 2P0GA 3LXTA 3L9SA 3MDKA 4HQSA 3HJPA 1GUMA 2IMEA 2V32A 1ZOFA 5H5RA 1Y25A 2DLXA 1TP9A 3KGKA 2FA8A 1ZGNA 1PRXA 3KMNA 5HQPA 4O5UA 3U5RE 3P90A 2TRXA 2H8LA 2LV3A 3M3MA 2VAFA 3VLNA 2C3TA 3FW2A 1ZCPA 1S3AA 3FZ9A 2L5OA 3CSIA 2VCZA 3GX8A 1S3CA 2PGTA 4IGJA 4F82A 2ALBA 5IO2A 3HHVA 4X43A 2JZSA 4KH7A 4ZIJA 4TN8A 4G0LA 4POMA 4YQMA 2CVKA 3N9JA 1EWXA 17GSA 5AGYA 1AXDA 1YF1A 3ED3A 1GWCA 4F0BA 2IN3A 2X49A 5IM9A 2YZUA 2WRTA 2YANA 4IVFA 2HZFA 2HXKA 1JZDA 2REMA 4MF6A 1R5AA 3ME8A 3BOAA 3TB2A 2ZCTA 6GSYA 4HQZA 2LKUA 1HD2A 2I3YA 3ZIVA 4JR6A 1HYUA 4ECIA 3I69A 1FB0A 1GULA 3F3RA 3PGTA 1M7TA 4HDEA 2DJKA 3UIWA 3M8NA 4GCIA 4N11A 1B48A 3L9VA 2H19A 2GGTA 4WETA 4XS4A 3BJ5A 1X5CA 1DE2A 2E0QA 5DVBA 4ZL8A 4XRDA 2RLIA 2DJ2A 3EMPA 4EDZA 1XVQA 3H1NA 2DKIA 2GSTA 3TGZA 4MZWA 2AYTA 3EC3A 4BWQA 5J5NA 4BVXB 4JE1A 4EIQA 4NPBA 1JZRA 1QGVA 2CV4A 1UVZA 2RM5A 3KIJA 3GA4A 2C4JA 5EPFA 5KN1A 2CX4A 4NV5A 2PPTA 2JZTA 3I43A 3GSTA 1FHEA 1AC1A 4O7HA 1Z3EA 20GSA 3QR6A 3G7IA 3Q74A 2GTUA 3IHGA 1FVJA 2VCXA 2CQ9A 4NV2A 1TRUA 1X9MB 1LBKA 3IAM2 2C3NA 3PINA 3ERWA 1AQXA 3F6FA 3KM6A 1EEJA 5ECOB 1AQWA 2JU5A 2LSTA 2FWFA 4XCSA 1XWKA 3CRUA 2H76A 5D9VA 2VCQA 5D9XA 1B9XC 2H74A 10GSA 1F9MA 1A2JA 1F37A 3UVHA 4OFMA 2KOKA 4MH2A 4POKA 5JWOB 4CDOA 5D96A 3TRQA 4IKHA 5ABRA 1V2AA 6GSTA 5IMCA 2LQOA 3CSJA 2YJ7A 4YH2A 3FK8A 4EIPA 4KDUA 5B8AA 1OC9B 4IQAA 3DRNA 4HOJA 3UEMA 2B5EA 4IELA 3E9JB 1B4PA 4TR3A 3ME7A 1F3AA 1PL2A 4O5QA 1TRVA 5GAPD 3KMOA 5IMAA 3LSZA 3MNGA 4YQUA 2F8AA 2R0GA 1N8JA 2X99A 1G6YA 4HJMA 5DJMA 5J9CA 2PMTA 4KF9A 4H86A 1Z7RA 2FCHA 3ERGA 1J0FA 5KOWA 2FLSA 2CAIA 2DIYA 1URMA 3D6IA 3EMXA 3JCML 4HUAA 5G31A 3GKNA 4PQHA 3APOA 2J9HA 4O32A 2JADA 3UBLA 2HZEB 3MWHA 3MIXA 3KP9A 1ST9A 1ERUA 3LEFA 4E8EA 4POBA 5D93A 1OC3A 1KEBA 2O7KA 4MJAA 3KZQA 3WGDA 2R2JA 4IS0A 2X8CA 5B6NA 1JHBA 3KD0A 5CREA 3O76A 2TIRA 2FY6A 5CNWA 2JSZA 4TOPA 5IIZA 2OJLA 5KEJA 2HSYA 3GL3A 1BG5A 2B5XA 3QD9A 3TKSA 3TJFA 2FWGA 2H66A 4LL1B 1H75A 4RQXA 4PQIA 3TCOA 4QL9A 5E4WA 4ML6A 3GIXA 5ECQB 1YDKA 4G19A 1O85A 3FKFA 2OE1A 3WYWA 5G5FA 3BD2A 2OACA 3R3EA 5CO3A 1E6BA 3GTUB 3EE2A 4V2NA 5FWGA 1I9DA 2OKAA 2CA8A 3ZREA 3D21A 3D4TA 2GQLA 4GTUA 5EY6A 5D73A 3IK7A 1U87A 4BPYA 5B6MA 5ECIB 2IMFA 1SJZA 3IHQA 3QFAC 3MSZA 4EL1A 4X4JA 3QAGA 1XXUA 3SWLA 1EV9A 1QFNA 4IQ1A 2QC7A 2FNOA 4ZBAA 4ECJA 4AGSA 5ELGA 3VURA 3CMIA 3L9UA 3CXGA 3E3EA 3W6GA 4HJ2A 2XPDA 1K0MA 1VF3A 1GTAA 4K1FA 1O8WA 1Z7PA 3C1SA 1YEXA 1BYEA 2ES7A 5J4UA 2HI7A 3M0FA 1X5EA 1GNEA 2O89A 4ZXGA 2DJ1A 1GTIA 2QA1A 2IPAA 1SK0A 2FUG2 4MJBA 3UBKA 3VPQA 5GSSA 3EURA 3F63A 4TW5A 4PXOA 3LG6A 2YV7A 5E59A 2DBCA 5D9WA 1Y6EA 1YY7A 4EUYA 4RUVA 5AN1A 1GSUA 3QPMA 4MMMA 3UAPA 1ZZYA 5A4UA 2K8SA 3DD3A 3IXRA 4HU7A 1WE0A 2VUPA 3ZFBA 4G2EA 3TOTA 1SD9A 3GHAA 5H5SA 2AAWA 1XW9A 2AUVA 2WFCA 4JRRA 2B1KA 3GURA 5DDLA 5COHA 3GX0A 4NMUA 4AJ8A 14GSA 1E2YA 4BVYB 1FB6A 1QUWA 4JEDA 3S9FA 2HLSA 4TR4A 4XTSA 4IW9A 4V1Ag 5IMVA 4KAEA 1W89A 2DC5A 1FG4A 5DBQA 1M0UA 4LMVA 4ZB9A 2MBSA 5A4WA 8GSSA 3VWWA 4YAPA 3RHCA 4ZL9A 3QFBC 4KDXA 3D5JA 4N0VA 2YWNA 2VM2A 4DSQA 3IC8A 4RQRA 1K0BA 4BL7A 3MYDA 4CY8A 4ILFA 2ZNMA 4ECCA 1T8EB 2GSRA 4L0UA 3P2AA 1TJDA 1JLVA 3A5IA 1OC9A 1AQVA 2WDUA 4BWSA 5G5EA 4E8HA 1OE8A 1WOUA 5CP1A 2L6CA 4X0XA 2VL2C 5HFGA 1H4OA 1SKRB 1B8XA 4HS1A 3DIEA 4IHUA 4LLRA 6GSWA 1TI1A 3GKXA 2HT9A 1O73A 1YF0A 5JCUA 1MD4A 2IWTA 2R4VA 3HCZA 3L4NA 3L78A 2MMNA 2GVPA 4USSA 2LJRA 5AIVA 1OKTA 1EP7A 3FR3A 1HQOA 2VCTA 3D22A 5FT3A 2NPBA 4BA7A 2BMXA 2C0DA 4MF7A 4L8EA 1XOBA 4OO4A 5ID2B 3TKSE 2LJAA 5B7CA 2RUFA 2RIIA 1XWGA 3UMAA 2YWMA 1AIUA 4D73A 3VI7A 4MZBA 5IOXA 2CX3A 5A5KA 1THXA 3MAKA 4FYBA 4Z2TA 1J9BA 3GRXA 1GLPA 1O6JA 4TXVA 4EVMA 3M9JA 4TXOB 5ECHB 3ZL5A 1SK2A 2HYXA 1K0NA 3QAWA 1YKAA 4ZL7A 2EC4A 3IOSA 2PWJA 1O7UA 4GXZA 1OC8A 2N5FA 1GRXA 3ZMLA 1S3DA 3FY7A 3C7MA 4EDYA 4J57E 1UC7A 1QK8A 1G7OA 4WBRD 3HVXA 2H73A 3FZ5A 4EO3A 2PBJA 3GTUA 1M2AA 4POLA 1GUHA 3HYPA 2MBTA 1TU7A 1MDIA 1G0TA 1O8XA 4DSSB 1XBSA 3A2VA 3BBYA 2C1YA 3NIVA 3FYGA 1GUKA 1YKCA 3F4TA 3VFIA 4N0ZA 3V1WA 2VD0A 2WB9A 2WZ9A 5L71A 1JZOA 3UARA 5ECLB 4F2IA 1MEKA 5GSTA 4I97A 3H8QA 2WCIA 2R3XA 3QMXA 4MJCA 2OA7A 5G1KA 2B1LA 1WJKA 5AIXA 1MDKA 1TDIA 3LXZA 3F9UA 1PN9A 3UL3A 1TK0B 2GSQA 3TRXA 3HVVA 3EYTA 3ZLPA 1TOFA 3RDWA 5CYYA 4KUNA 3W8SA 1CQHA 2LRTA 3IPZA 4LA1A 4PUFC 3DGQA 5CRDA 1T4ZA 16GSA 3FHKA 1WWJA 3KH9A 4AJ6A 4I8BA 4CY6A 1T7PB 1PL1A 1K0AA 4KCAA 1DE1A 4XRAA 4EC0A 2HRNA 1PD21 4HZ2A 5F0GA 5DALB 1R7HA 5DAKB 3KCMA 3VWUA 4GLTA 1M2DA 2K6VA 3O3TA 1VF4A 2MYGA 1A0RP 2X64A 3CRTA 3WGXA 3GNJA 1CQGA 3IRAA 1F3BA 5C00A 2YP6A 2YWOA 5HR3A 3TJJA 5IPHA 1EOGA 2IJYA 4K2XA 4JZQA 3IV4A 3CYNA 2DKHA 1DSBA 2A2SA 2C0FA 3GMFA 1PKZA 2B5YA 1Z6MA 1Q4JA 1OKDA 5FHIA 4HEA2 1FW1A 2F9SA 3ZVJD 2K9FA 4OFTA 1XVWA 2NTOA 3NOFA 3GUSA 2EIRA 6GSUA 2XBIA 3TKPA 4FYUA 4Q5RA 2A2PA 2VCWA 1GSSA 3E0UA 4K2DA 3K8NA 3F3QA 3LGCA 5EVOA 7GSSA 5J9BA 5G2ZA 3BCIA 1XWBA 2R0PA 4L5OA 1M9BA 5HFIA 2KUCA 1ACVA 13GSA 5JWRB 2RUEA 1GL8A 1R4WA 1SL0B 1HNAA 4IN0A 2DJ3A 1W4VA 2DMLA 2L57A 2VL3A 1DBYA 3GH6A 1EGOA 1GSFA 4TR1A 3TOUA 3RPPA 1XW6A 2ZUPA 2HNLA 2YNXA 4K5RA 1SK1A 2BJXA 2HRFA 1ERTA 5DJLA 3WD6A 3DEXA 2B6MA 1X5DA 3A2XA 3P7XA 1GSDA 4G0IA 3G7YA 3DVWA 4K7OA 4GQCA 4GRFA 4KNDA 4ID0A 2VL2A 1A2LA 2WGRA 4MPGA 1B9YC 4GSNA 1A8LA 4V2LA 3ZZXA 4JR4A 4GQFA 3CBUA 4CW9A 4I6XA 3FZAA 2F51A 2I81A 2LNTA 5G30A 4GSTA 5KN3A 1M2BA 1HNBA 5DQSA 4K7NA 2GQKA 6GSXA 1AAZA 1LJRA 1A0FA 4PTSA 5CRGA 2OE3A 4N30A 1PX7A 4TVEA 2I9HA 2YWIA 3DWVA 1ON4A 5AISA 3UJ1A 1PA3A 1MDJA 5F05A 4WEYA 3A5WA 2O85A 3ISOA 2VOCA 4YAVA 1TK8B 3RPNA 2MMOA 3GL5A 3CTGA 2FD3A 2HSHA 5D9TA 4QQ7A 4WF4A 4Z2RA 4XS4B 3PH9A 4MZCA 2YZHA 5IMFA 5IOWA 2CVBA 3TJKA 2H72A 4K7IA 3H93A 2AV4A 2MMZA 1A2MA 4KDYA 12GSA 2P31A 2IMIA 3C1RA 2E2MA 5KOXA 5EL8A 5HR2A 4EE0A 4WKWA 1PGTA 1ILOA 2X8HA 1I5GA 1MTCA 4BVXA 2CAQA 3KTLA 1V58A 1GP1A 1C72A 1BJXA 1ERVA 3GV1A 4NHWA 5INYA 3O6TA 3AY8A 3GH9A 5ELAA 3TKQA 2J23A 4HU9A 4XS6A 5KN2A 1V98A 3QOUA 2IMDA 5ECPB 2PU9C 1XZOA 3D4MA 2B7KA 4ZB6A 3KP8A 2H1BA 2H6YA 2ON7A 1TRSA 3UOMA 4IBPA 1RQMA 2MZCA 2QKEA 1BEDA 2BTOT 4XS1A 2LQQA 4MPFA 2GQMA 2IL3A 2HE3A 1SL2B 4TR0A 2DJJA 1GLQA 1WP0A 1GNWA 2FHEA 1A8YA 3GKKA 2WULA 3LFLA 3G7JA 4ZBBA 2VIMA 2G2QA 4I2UA 1SENA 1NW2A 2JACA 4P3YB 3DMLA 2K8VA 1R26A 4F03A 1T1VA 2QA2A 2JL4A 3H79A 3KTBA 3I6AA 4YKFA 4K5SA 2RM6A 3HY2A 4HZ4A 1A24A 1XFLA 2GZYA 3C73A 2F8FA 4G10A 4EKZA 3VWXA 5ECKB 1Q98A 4WF5A 2N5BA 3TKSC 1JLWA 4DSRA 2XC2A 5GAND 3IBHA 5LD0A 4L0WA 3W8JA 2H70A 3BCKA 3I9V2 3FMWA 4TKYA 3GSSA 2JSYA 2L59A 2MMAA 5LNKe 2CT6A 1XWCA 2K18A 4MABA 4PURA 3ZITA 3EU4A 5F06A 4LMWA 4AF2A 2HZEA 4RI6A 2WJUA 3LQ7A 3TJGA 3HA9A 4MK3A 2LTKA 1OE7A 4K8MA 4ZB8A 4I5QA 3WT2A 3IA1A 2L4CA 1PX6A 4WXTA 4K0NA 1VF1A 2PN8A 4OMVA 1YQ1A 4G0KA 4IJIA 4LL4B 1NM3A 3TKRA 1U3AA 2IIYA 5C04A 2YCDA 3Q6OA 2GLRA 1ABAA 1FVKA 3LYKA 2CVDA 3KH7A 3TRPA 1GTBA 3VWVA 1FAAA 4MDCA 4DVCA 4MA9A 1XW5A 2LRNA 3GFKA 2I1UA 2LS5A 9GSSA 3EU3A 3APQA 3FEUA 1KNGA 5IPGA 1EP8A 3Q19A 4KGIA 3F4SA 1YZXA 1Z9HA 4ACSA 2H6XA 1WPIA 2O8VB 2DSAA 2H0HA 1PKWA 2H01A 3U6VA 1ZL9A 2VLTA 3DXBA 4A5PA 1G7EA 2LRCA 4J2FA 3HZ8A 2C0EA 4XIHA 2QGVA 4G9HA 2B3SA 2JZRA 4KCEA 1M9AA 4K6XA 2Z9SA 1TKDB 2CZ3A 2R5GA 2X4AA 4F9ZA 2AJQB 1ZYEA 2VO4A 2GSSA 1Z6NA 4PNFA 2GDRA 5BRTA 1FOHA 4FYCA 1VGLA 5HR1A 4YQVA 2XHFA 4MCUA 4FQUA 1ML6A 1U88A 1Z5YE 3GN3A 1TTZA 3TUEA 1K3YA 3VK9A 4TRXA 1LU4A 3Q18A 4EF0A 2DMMA 4CHSA 4WR4A 3ZMKA 4MP4A 5IO0A 4Z2UA 4PX1A 1B4QA 1N2AA 1TI3A 2V6KA 2HFDA 3HXSA 4NXIA 1T00A 3P8WA 2E2GA 5HR0A 4JBBA 3IC4A 1QXHA 5GZZB 2C3QA 3TDGA 2VLUA 5CAXA 4MNNA 3SBCA 2AB6A 4KSOA 1EGRA 5JCWA 3RHBA 2V41A 2ON5A 1XOAA 1R5PA 3DYRA 1PQNA 3ZFLA 1FO5A 1SKWB 1VF2A 1U3IA 2A4VA 1A23A 3A2WA 3F4RA 3ZVJA 3LYPA 2YV9A 2NBSA 1XIYA 4EXJA 1T3BA 4ZBDA 1GSEA 1F6MC 4KW6A 5A4VA 1IYHA 2H1DA 2DJ0A 2NDOA 4YKGA 2XPEA 4FH8A 2VLVA 4BVYA 4N10A 2GT6A 3LJRA 2GT5A 4QL7A 2GS3A 1EV4A 3F8UA 3M9KA 1ERWA 2M46A 3J7Yb 1TK5B 4BL7B 1NHOA 2H1AA 2WS2A 2EIQA 2IFQB 4WR5A 3HKRA 2H71A 2V1MA 4J56E 4NHZA 2G0FA 1X9WB 5HFKA 3PR8A 1USBA 4V2MA 1PMTA 3QDNA 1NSWA 4F0CA 2AHEA 4ICYA 1ZMAA 2M80A 1GSYA 3N5OA 4PNGA 5LCZA 4PUAA 5KN0A 5H5QA 1OYJA 1IYIA 2H0IA 4IP6A 2GZPA 3PPUA 4RI7A 2V2GA 22GSA 2C0GA 4JU5A 3HD5A 1RW1A 3HVSA 2H0GA 3EINA 4OD7A 1WMJA 2L5LA 1UA5A 2D2ZA 4L5LA 1SYRA 3KXOA 1K0CA 1V9WA 2KLXA 3DKSA 5ECMB 1TU8A 1HNCA 3LORA 3RBTA 4O5RA 2OBKA 1RK4A 2KP1A 5ENUA 3HDCA 2OADA 3EVIA 3WGEA 1BAYA 2C80A 4D73B 1V40A 4GF0A 4I2TA 2XBQA 4ECBA 2YPMA 1SL1B 2VD1A 3J7Yk 2KHPA 1TXXA 1ZYNA 1F2EA 5ID2A 3VI5A 2LNSA 1THOA 3OR5A 3H4KA 4WBJA 2P5QA 5F07A 2R0CA 5B8BA 1PSQA 3HZ4A 3IAS2 5DCHA 3GYKA 2O87A 3FRCA 1WIKA 1ZYQB 1XCCA 4DEJA 4OCFA 1YJ6A 5JWQB 4TXOA 2YJHA 5CRHA 1ZYPA 4XHMA 1X9SB 2OBIA 4KE3A 2FA4A 4MJEA 4IJ3A 3TJBA 1VRSD 2M72A 2LEGA 3QAVA 3QCPA 3IK9A 2I4AA 2NVLA 3EPTA 1K3LA 2B7JA 2FWEA 1GSQA 3CSHA 1KTEA 2H75A 1DUGA 1EZKA 4ZILA 2OE0A 4GWRA 2HSMA 1J08A 2TRCP 3ZRDA 4Q5QA 1K0DA 1FOVA 3EWLA 3CTFA 1UN2A 2R37A 2H1GA 1WRYA 5ECSA 5ECNB 4DSSA 3GKMA 2LUSA 5J41A 5G1LA 2C8UA 3C71A 2A2RA 4AJ7A 2PUKC 4X1UA 3HJMA 3LW9A 4ISDA 1SU9A 3FZ4A 4KX4A 4MLYA 3IDVA 1SJIA 4FIWA 2PVQA 2QSIA 4Z7XA 4KSMA 5JCGA 2LJKA 4KB3A 4NAXA 1SD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AW9 A;  4GSS A;  3R2Q A;  2GZZ A;  1JFU A;  2PVO C;  1EOH A;  2IMK A;  2FWH A;  1BX9 A;  5DQY A;  18GS A;  3D0Z A;  4PGT A;  5DCG A;  2R6K A;  1OAZ A;  1V57 A;  4ULX A;  2V6O A;  4OWY A;  4HI7 A;  4MF5 A;  5ECR B;  5IMZ A;  5DAL A;  2FGX A;  3WT1 A;  5DAK A;  2VM1 A;  3A3T A;  3DVX A;  2YN1 A;  1KBN A;  1SKS B;  1SJ6 A;  2PER A;  11GS A;  1QQ2 A;  2KP2 A;  2VCV A;  5CRW A;  2DIZ A;  6GSV A;  3NZN A;  4KA0 A;  4O92 A;  3FR9 A;  3FR6 A;  3IR4 A;  4OFN A;  4MH3 A;  4NWY A;  3C8E A;  2L6D A;  1K0O A;  3F0I A;  1EEM A;  2EIO A;  1XPV A;  5IMD A;  2N5A A;  1U6T A;  1OVN A;  1TW9 A;  1NHY A;  2H6Z A;  1SYX A;  5D8I A;  3US3 A;  2P5R A;  1YEP A;  2YOI A;  4FO5 A;  3ZTL A;  2VL9 A;  3G9B A;  2L4Q A;  1BQ7 A;  1MD3 A;  3ZIJ A;  1QMV A;  3UVT A;  3L0H A;  3ERF A;  3IE3 A;  2IFQ A;  4IP1 A;  3VPT A;  1O81 A;  3KJY A;  5F8B A;  1GTU A;  1K3O A;  4Q5N A;  3ZYW A;  4PQ1 A;  1X0R A;  4OCE A;  5J3R A;  4K9Z A;  19GS A;  1JZW A;  3APS A;  3M1G A;  1T4Y A;  4OO5 A;  5IQY A;  4Q5F A;  4V1A p;  3HJO A;  2CZ2 A;  1G6W A;  4ML1 A;  6GSS A;  2F3M A;  1AUC A;  2H30 A;  3RAZ A;  1GH2 A;  1M99 A;  3LWA A;  4K0G A;  1TRW A;  1XWA A;  3F6D A;  2E7P A;  3KEB A;  2X8G A;  4TR1 B;  2P0G A;  3LXT A;  3L9S A;  3MDK A;  4HQS A;  3HJP A;  1GUM A;  2IME A;  2V32 A;  1ZOF A;  5H5R A;  1Y25 A;  2DLX A;  1TP9 A;  3KGK A;  2FA8 A;  1ZGN A;  1PRX A;  3KMN A;  5HQP A;  3U5R E;  3P90 A;  2TRX A;  2H8L A;  2LV3 A;  3M3M A;  2VAF A;  3VLN A;  2C3T A;  3FW2 A;  1ZCP A;  1S3A A;  3FZ9 A;  2L5O A;  3CSI A;  2VCZ A;  3GX8 A;  1S3C A;  2PGT A;  4IGJ A;  4F82 A;  2ALB A;  5IO2 A;  3HHV A;  4X43 A;  2JZS A;  4KH7 A;  4ZIJ A;  4TN8 A;  4POM A;  4YQM A;  2CVK A;  3N9J A;  1EWX A;  17GS A;  5AGY A;  1AXD A;  1YF1 A;  3ED3 A;  1GWC A;  4F0B A;  2IN3 A;  5IM9 A;  2YZU A;  2WRT A;  2YAN A;  4IVF A;  2HZF A;  2HXK A;  1JZD A;  2REM A;  4MF6 A;  1R5A A;  3ME8 A;  3BOA A;  3TB2 A;  2ZCT A;  6GSY A;  4HQZ A;  2LKU A;  1HD2 A;  2I3Y A;  3ZIV A;  4JR6 A;  1HYU A;  4ECI A;  3I69 A;  1FB0 A;  1GUL A;  3F3R A;  3PGT A;  1M7T A;  4HDE A;  2DJK A;  3UIW A;  3M8N A;  4GCI A;  4N11 A;  1B48 A;  3L9V A;  2H19 A;  2GGT A;  4WET A;  4XS4 A;  3BJ5 A;  1X5C A;  1DE2 A;  2E0Q A;  5DVB A;  4ZL8 A;  4XRD A;  2RLI A;  2DJ2 A;  3EMP A;  4EDZ A;  1XVQ A;  3H1N A;  2GST A;  3TGZ A;  4MZW A;  2AYT A;  3EC3 A;  4BWQ A;  5J5N A;  4JE1 A;  4NPB A;  1JZR A;  1QGV A;  2CV4 A;  1UVZ A;  2RM5 A;  3KIJ A;  3GA4 A;  2C4J A;  5EPF A;  5KN1 A;  2CX4 A;  4NV5 A;  2PPT A;  2JZT A;  3I43 A;  3GST A;  1FHE A;  1AC1 A;  4O7H A;  1Z3E A;  20GS A;  3QR6 A;  3G7I A;  3Q74 A;  2GTU A;  1FVJ A;  2VCX A;  2CQ9 A;  4NV2 A;  1TRU A;  1X9M B;  1LBK A;  3IAM 2;  2C3N A;  3PIN A;  3ERW A;  1AQX A;  3F6F A;  3KM6 A;  1EEJ A;  5ECO B;  1AQW A;  2JU5 A;  2LST A;  2FWF A;  4XCS A;  1XWK A;  3CRU A;  2H76 A;  5D9V A;  2VCQ A;  5D9X A;  1B9X C;  2H74 A;  10GS A;  1F9M A;  1A2J A;  1F37 A;  3UVH A;  4OFM A;  2KOK A;  4MH2 A;  4POK A;  5JWO B;  4CDO A;  5D96 A;  3TRQ A;  4IKH A;  5ABR A;  1V2A A;  6GST A;  5IMC A;  2LQO A;  3CSJ A;  2YJ7 A;  4YH2 A;  3FK8 A;  4KDU A;  5B8A A;  1OC9 B;  4IQA A;  3DRN A;  4HOJ A;  3UEM A;  2B5E A;  4IEL A;  3E9J B;  1B4P A;  4TR3 A;  3ME7 A;  1F3A A;  1PL2 A;  1TRV A;  5GAP D;  3KMO A;  5IMA A;  3LSZ A;  3MNG A;  4YQU A;  2F8A A;  1N8J A;  2X99 A;  1G6Y A;  4HJM A;  5DJM A;  5J9C A;  2PMT A;  4H86 A;  1Z7R A;  2FCH A;  3ERG A;  1J0F A;  2FLS A;  2CAI A;  2DIY A;  1URM A;  3D6I A;  3EMX A;  3JCM L;  4HUA A;  5G31 A;  3GKN A;  4PQH A;  3APO A;  2J9H A;  4O32 A;  2JAD A;  3UBL A;  2HZE B;  3MWH A;  3KP9 A;  1ST9 A;  1ERU A;  3LEF A;  4E8E A;  4POB A;  5D93 A;  1OC3 A;  1KEB A;  2O7K A;  4MJA A;  3KZQ A;  3WGD A;  2R2J A;  4IS0 A;  2X8C A;  5B6N A;  1JHB A;  3KD0 A;  5CRE A;  3O76 A;  2TIR A;  2FY6 A;  5CNW A;  2JSZ A;  4TOP A;  5IIZ A;  2OJL A;  5KEJ A;  2HSY A;  3GL3 A;  1BG5 A;  2B5X A;  3QD9 A;  3TKS A;  3TJF A;  2FWG A;  2H66 A;  4LL1 B;  1H75 A;  4RQX A;  4PQI A;  3TCO A;  4QL9 A;  5E4W A;  4ML6 A;  3GIX A;  5ECQ B;  1YDK A;  4G19 A;  1O85 A;  3FKF A;  2OE1 A;  3WYW A;  5G5F A;  3BD2 A;  2OAC A;  5CO3 A;  1E6B A;  3GTU B;  3EE2 A;  4V2N A;  5FWG A;  1I9D A;  2OKA A;  2CA8 A;  3ZRE A;  3D21 A;  3D4T A;  2GQL A;  5EY6 A;  4GTU A;  5D73 A;  3IK7 A;  1U87 A;  4BPY A;  5B6M A;  5ECI B;  2IMF A;  1SJZ A;  3IHQ A;  3QFA C;  3MSZ A;  4EL1 A;  3QAG A;  1XXU A;  3SWL A;  1EV9 A;  1QFN A;  4IQ1 A;  2QC7 A;  2FNO A;  4ZBA A;  4ECJ A;  4AGS A;  5ELG A;  3VUR A;  3CMI A;  3L9U A;  3CXG A;  3E3E A;  3W6G A;  4HJ2 A;  2XPD A;  1K0M A;  1VF3 A;  1GTA A;  4K1F A;  1O8W A;  1Z7P A;  3C1S A;  1YEX A;  1BYE A;  2ES7 A;  5J4U A;  2HI7 A;  3M0F A;  1X5E A;  1GNE A;  2O89 A;  4ZXG A;  2DJ1 A;  1GTI A;  2IPA A;  1SK0 A;  2FUG 2;  4MJB A;  3UBK A;  3VPQ A;  5GSS A;  3EUR A;  3F63 A;  4TW5 A;  4PXO A;  3LG6 A;  2YV7 A;  5E59 A;  2DBC A;  5D9W A;  1Y6E A;  1YY7 A;  4EUY A;  4RUV A;  5AN1 A;  1GSU A;  3QPM A;  4MMM A;  3UAP A;  1ZZY A;  5A4U A;  2K8S A;  3DD3 A;  3IXR A;  4HU7 A;  1WE0 A;  2VUP A;  3ZFB A;  4G2E A;  3TOT A;  1SD9 A;  3GHA A;  5H5S A;  2AAW A;  1XW9 A;  2AUV A;  2WFC A;  4JRR A;  2B1K A;  3GUR A;  5DDL A;  5COH A;  3GX0 A;  4NMU A;  4AJ8 A;  14GS A;  1E2Y A;  1FB6 A;  1QUW A;  4JED A;  3S9F A;  2HLS A;  4TR4 A;  4XTS A;  4IW9 A;  4V1A g;  5IMV A;  4KAE A;  1W89 A;  2DC5 A;  1FG4 A;  5DBQ A;  1M0U A;  4LMV A;  4ZB9 A;  2MBS A;  5A4W A;  8GSS A;  3VWW A;  4YAP A;  3RHC A;  4ZL9 A;  3QFB C;  4KDX A;  3D5J A;  4N0V A;  2YWN A;  2VM2 A;  4DSQ A;  4RQR A;  1K0B A;  4BL7 A;  4ILF A;  2ZNM A;  4ECC A;  1T8E B;  2GSR A;  4L0U A;  3P2A A;  1TJD A;  1JLV A;  1OC9 A;  1AQV A;  2WDU A;  4BWS A;  5G5E A;  4E8H A;  1OE8 A;  1WOU A;  5CP1 A;  2L6C A;  4X0X A;  2VL2 C;  5HFG A;  1H4O A;  1SKR B;  1B8X A;  4HS1 A;  3DIE A;  4IHU A;  4LLR A;  6GSW A;  1TI1 A;  3GKX A;  2HT9 A;  1O73 A;  1YF0 A;  5JCU A;  1MD4 A;  2IWT A;  2R4V A;  3HCZ A;  3L4N A;  3L78 A;  2MMN A;  2GVP A;  2LJR A;  5AIV A;  1OKT A;  1EP7 A;  3FR3 A;  1HQO A;  2VCT A;  3D22 A;  5FT3 A;  2NPB A;  4BA7 A;  2BMX A;  2C0D A;  4MF7 A;  4L8E A;  1XOB A;  4OO4 A;  5ID2 B;  3TKS E;  2LJA A;  5B7C A;  2RUF A;  2RII A;  1XWG A;  3UMA A;  2YWM A;  1AIU A;  4D73 A;  3VI7 A;  4MZB A;  5IOX A;  2CX3 A;  5A5K A;  1THX A;  3MAK A;  4FYB A;  1J9B A;  3GRX A;  1GLP A;  1O6J A;  4TXV A;  4EVM A;  3M9J A;  4TXO B;  5ECH B;  3ZL5 A;  1SK2 A;  2HYX A;  1K0N A;  3QAW A;  1YKA A;  4ZL7 A;  2EC4 A;  3IOS A;  2PWJ A;  1O7U A;  4GXZ A;  1OC8 A;  2N5F A;  1GRX A;  3ZML A;  1S3D A;  3FY7 A;  3C7M A;  4EDY A;  4J57 E;  1UC7 A;  1QK8 A;  1G7O A;  4WBR D;  3HVX A;  2H73 A;  3FZ5 A;  4EO3 A;  2PBJ A;  3GTU A;  1M2A A;  4POL A;  1GUH A;  3HYP A;  2MBT A;  1TU7 A;  1MDI A;  1G0T A;  1O8X A;  4DSS B;  1XBS A;  3A2V A;  3BBY A;  2C1Y A;  3NIV A;  3FYG A;  1GUK A;  1YKC A;  3F4T A;  3VFI A;  4N0Z A;  3V1W A;  2VD0 A;  2WB9 A;  2WZ9 A;  5L71 A;  1JZO A;  3UAR A;  5ECL B;  4F2I A;  1MEK A;  5GST A;  4I97 A;  3H8Q A;  2WCI A;  2R3X A;  3QMX A;  4MJC A;  2OA7 A;  5G1K A;  2B1L A;  1WJK A;  5AIX A;  1MDK A;  1TDI A;  3LXZ A;  3F9U A;  1PN9 A;  3UL3 A;  1TK0 B;  2GSQ A;  3TRX A;  3HVV A;  3EYT A;  3ZLP A;  1TOF A;  3RDW A;  5CYY A;  4KUN A;  3W8S A;  1CQH A;  2LRT A;  3IPZ A;  4LA1 A;  4PUF C;  3DGQ A;  5CRD A;  1T4Z A;  16GS A;  3FHK A;  1WWJ A;  3KH9 A;  4AJ6 A;  4I8B A;  1T7P B;  1PL1 A;  1K0A A;  4KCA A;  1DE1 A;  4XRA A;  4EC0 A;  2HRN A;  1PD2 1;  4HZ2 A;  5F0G A;  5DAL B;  1R7H A;  5DAK B;  3KCM A;  3VWU A;  4GLT A;  1M2D A;  2K6V A;  3O3T A;  1VF4 A;  2MYG A;  1A0R P;  2X64 A;  3CRT A;  3WGX A;  3GNJ A;  1CQG A;  3IRA A;  1F3B A;  5C00 A;  2YP6 A;  2YWO A;  5HR3 A;  3TJJ A;  5IPH A;  1EOG A;  2IJY A;  4JZQ A;  3IV4 A;  3CYN A;  1DSB A;  2A2S A;  2C0F A;  3GMF A;  1PKZ A;  2B5Y A;  1Z6M A;  1Q4J A;  1OKD A;  5FHI A;  4HEA 2;  1FW1 A;  2F9S A;  3ZVJ D;  2K9F A;  4OFT A;  1XVW A;  2NTO A;  3NOF A;  3GUS A;  2EIR A;  6GSU A;  2XBI A;  3TKP A;  4FYU A;  4Q5R A;  2VCW A;  1GSS A;  3E0U A;  4K2D A;  3K8N A;  3F3Q A;  3LGC A;  5EVO A;  7GSS A;  5J9B A;  5G2Z A;  3BCI A;  1XWB A;  4L5O A;  1M9B A;  5HFI A;  2KUC A;  1ACV A;  13GS A;  5JWR B;  2RUE A;  1GL8 A;  1R4W A;  1SL0 B;  1HNA A;  4IN0 A;  2DJ3 A;  1W4V A;  2DML A;  2L57 A;  2VL3 A;  1DBY A;  3GH6 A;  1EGO A;  1GSF A;  4TR1 A;  3TOU A;  3RPP A;  1XW6 A;  2ZUP A;  2HNL A;  2YNX A;  1SK1 A;  2BJX A;  2HRF A;  1ERT A;  5DJL A;  3WD6 A;  3DEX A;  2B6M A;  1X5D A;  3A2X A;  3P7X A;  1GSD A;  3G7Y A;  3DVW A;  4K7O A;  4GQC A;  4GRF A;  4KND A;  4ID0 A;  2VL2 A;  1A2L A;  2WGR A;  4MPG A;  1B9Y C;  4GSN A;  1A8L A;  4V2L A;  3ZZX A;  4JR4 A;  4GQF A;  3CBU A;  4CW9 A;  4I6X A;  3FZA A;  2F51 A;  2I81 A;  2LNT A;  5G30 A;  4GST A;  5KN3 A;  1M2B A;  1HNB A;  5DQS A;  4K7N A;  2GQK A;  6GSX A;  1AAZ A;  1LJR A;  1A0F A;  5CRG A;  2OE3 A;  4N30 A;  1PX7 A;  4TVE A;  2I9H A;  2YWI A;  3DWV A;  1ON4 A;  5AIS A;  3UJ1 A;  1PA3 A;  1MDJ A;  5F05 A;  4WEY A;  3A5W A;  2O85 A;  3ISO A;  2VOC A;  4YAV A;  1TK8 B;  3RPN A;  2MMO A;  3GL5 A;  3CTG A;  2FD3 A;  2HSH A;  5D9T A;  4QQ7 A;  4WF4 A;  4XS4 B;  3PH9 A;  4MZC A;  2YZH A;  5IMF A;  5IOW A;  2CVB A;  3TJK A;  2H72 A;  4K7I A;  3H93 A;  2AV4 A;  2MMZ A;  1A2M A;  4KDY A;  12GS A;  2P31 A;  2IMI A;  3C1R A;  2E2M A;  5EL8 A;  5HR2 A;  4EE0 A;  4WKW A;  1PGT A;  1ILO A;  2X8H A;  1I5G A;  1MTC A;  4BVX A;  2CAQ A;  3KTL A;  1V58 A;  1GP1 A;  1C72 A;  1BJX A;  1ERV A;  3GV1 A;  4NHW A;  5INY A;  3O6T A;  3AY8 A;  3GH9 A;  5ELA A;  3TKQ A;  2J23 A;  4HU9 A;  4XS6 A;  5KN2 A;  1V98 A;  3QOU A;  2IMD A;  5ECP B;  2PU9 C;  1XZO A;  3D4M A;  2B7K A;  4ZB6 A;  3KP8 A;  2H1B A;  2H6Y A;  2ON7 A;  1TRS A;  3UOM A;  4IBP A;  1RQM A;  2MZC A;  2QKE A;  1BED A;  2BTO T;  4XS1 A;  2LQQ A;  4MPF A;  2GQM A;  2IL3 A;  2HE3 A;  1SL2 B;  4TR0 A;  2DJJ A;  1GLQ A;  1WP0 A;  1GNW A;  2FHE A;  1A8Y A;  3GKK A;  2WUL A;  3LFL A;  3G7J A;  4ZBB A;  2VIM A;  2G2Q A;  4I2U A;  1SEN A;  1NW2 A;  2JAC A;  4P3Y B;  3DML A;  2K8V A;  1R26 A;  4F03 A;  1T1V A;  2JL4 A;  3H79 A;  3KTB A;  3I6A A;  2RM6 A;  3HY2 A;  4HZ4 A;  1A24 A;  1XFL A;  2GZY A;  3C73 A;  2F8F A;  4G10 A;  4EKZ A;  3VWX A;  5ECK B;  1Q98 A;  4WF5 A;  2N5B A;  3TKS C;  1JLW A;  4DSR A;  2XC2 A;  5GAN D;  3IBH A;  5LD0 A;  4L0W A;  3W8J A;  2H70 A;  3BCK A;  3I9V 2;  4TKY A;  3GSS A;  2JSY A;  2L59 A;  2MMA A;  5LNK e;  2CT6 A;  1XWC A;  2K18 A;  4MAB A;  4PUR A;  3ZIT A;  3EU4 A;  5F06 A;  4LMW A;  4AF2 A;  2HZE A;  4RI6 A;  2WJU A;  3LQ7 A;  3TJG A;  3HA9 A;  4MK3 A;  2LTK A;  1OE7 A;  4K8M A;  4ZB8 A;  4I5Q A;  3WT2 A;  3IA1 A;  2L4C A;  1PX6 A;  4WXT A;  4K0N A;  1VF1 A;  2PN8 A;  4OMV A;  1YQ1 A;  4IJI A;  4LL4 B;  1NM3 A;  3TKR A;  1U3A A;  2IIY A;  5C04 A;  2YCD A;  3Q6O A;  2GLR A;  1ABA A;  1FVK A;  3LYK A;  2CVD A;  3KH7 A;  3TRP A;  1GTB A;  3VWV A;  1FAA A;  4MDC A;  4DVC A;  4MA9 A;  1XW5 A;  2LRN A;  3GFK A;  2I1U A;  2LS5 A;  9GSS A;  3EU3 A;  3APQ A;  3FEU A;  1KNG A;  5IPG A;  1EP8 A;  3Q19 A;  4KGI A;  3F4S A;  1YZX A;  1Z9H A;  4ACS A;  2H6X A;  1WPI A;  2O8V B;  2DSA A;  2H0H A;  1PKW A;  2H01 A;  3U6V A;  1ZL9 A;  2VLT A;  3DXB A;  1G7E A;  2LRC A;  4J2F A;  3HZ8 A;  2C0E A;  4XIH A;  2QGV A;  4G9H A;  2B3S A;  2JZR A;  4KCE A;  1M9A A;  4K6X A;  2Z9S A;  1TKD B;  2CZ3 A;  2R5G A;  4F9Z A;  2AJQ B;  1ZYE A;  2VO4 A;  2GSS A;  1Z6N A;  4PNF A;  2GDR A;  4FYC A;  1VGL A;  5HR1 A;  4YQV A;  2XHF A;  4MCU A;  1ML6 A;  1U88 A;  1Z5Y E;  3GN3 A;  1TTZ A;  3TUE A;  1K3Y A;  3VK9 A;  4TRX A;  1LU4 A;  3Q18 A;  4EF0 A;  2DMM A;  4CHS A;  4WR4 A;  3ZMK A;  4MP4 A;  5IO0 A;  4PX1 A;  1B4Q A;  1N2A A;  1TI3 A;  2V6K A;  2HFD A;  3HXS A;  4NXI A;  1T00 A;  3P8W A;  2E2G A;  5HR0 A;  4JBB A;  3IC4 A;  1QXH A;  5GZZ B;  2C3Q A;  3TDG A;  2VLU A;  5CAX A;  3SBC A;  2AB6 A;  4KSO A;  1EGR A;  5JCW A;  3RHB A;  2V41 A;  2ON5 A;  1XOA A;  1R5P A;  3DYR A;  1PQN A;  3ZFL A;  1FO5 A;  1SKW B;  1VF2 A;  1U3I A;  2A4V A;  1A23 A;  3A2W A;  3F4R A;  3ZVJ A;  3LYP A;  2YV9 A;  2NBS A;  1XIY A;  4EXJ A;  1T3B A;  4ZBD A;  1GSE A;  1F6M C;  4KW6 A;  5A4V A;  1IYH A;  2H1D A;  2DJ0 A;  2NDO A;  2XPE A;  4FH8 A;  2VLV A;  4BVY A;  4N10 A;  2GT6 A;  3LJR A;  2GT5 A;  4QL7 A;  2GS3 A;  1EV4 A;  3F8U A;  3M9K A;  1ERW A;  2M46 A;  3J7Y b;  1TK5 B;  1NHO A;  2H1A A;  2WS2 A;  2EIQ A;  2IFQ B;  4WR5 A;  3HKR A;  2H71 A;  2V1M A;  4J56 E;  4NHZ A;  2G0F A;  1X9W B;  5HFK A;  3PR8 A;  1USB A;  4V2M A;  1PMT A;  3QDN A;  1NSW A;  4F0C A;  2AHE A;  1ZMA A;  2M80 A;  1GSY A;  3N5O A;  4PNG A;  5LCZ A;  4PUA A;  5KN0 A;  5H5Q A;  1OYJ A;  1IYI A;  2H0I A;  4IP6 A;  2GZP A;  4RI7 A;  2V2G A;  22GS A;  2C0G A;  4JU5 A;  3HD5 A;  1RW1 A;  3HVS A;  2H0G A;  3EIN A;  4OD7 A;  1WMJ A;  2L5L A;  1UA5 A;  2D2Z A;  4L5L A;  1SYR A;  3KXO A;  1K0C A;  1V9W A;  2KLX A;  3DKS A;  5ECM B;  1TU8 A;  1HNC A;  3LOR A;  3RBT A;  4O5R A;  2OBK A;  1RK4 A;  2KP1 A;  5ENU A;  3HDC A;  2OAD A;  3EVI A;  3WGE A;  1BAY A;  2C80 A;  4D73 B;  1V40 A;  4GF0 A;  4I2T A;  2XBQ A;  4ECB A;  2YPM A;  1SL1 B;  2VD1 A;  3J7Y k;  2KHP A;  1TXX A;  1F2E A;  5ID2 A;  3VI5 A;  2LNS A;  1THO A;  3OR5 A;  3H4K A;  4WBJ A;  2P5Q A;  5F07 A;  5B8B A;  1PSQ A;  3HZ4 A;  3IAS 2;  5DCH A;  3GYK A;  2O87 A;  3FRC A;  1WIK A;  1ZYQ B;  1XCC A;  4DEJ A;  4OCF A;  1YJ6 A;  5JWQ B;  4TXO A;  2YJH A;  5CRH A;  4XHM A;  1X9S B;  2OBI A;  4KE3 A;  2FA4 A;  4MJE A;  4IJ3 A;  3TJB A;  1VRS D;  2M72 A;  2LEG A;  3QAV A;  3QCP A;  3IK9 A;  2I4A A;  2NVL A;  1K3L A;  2B7J A;  2FWE A;  1GSQ A;  3CSH A;  1KTE A;  2H75 A;  1DUG A;  1EZK A;  4ZIL A;  2OE0 A;  4GWR A;  1J08 A;  2TRC P;  3ZRD A;  4Q5Q A;  1K0D A;  1FOV A;  3EWL A;  3CTF A;  1UN2 A;  2R37 A;  2H1G A;  1WRY A;  5ECS A;  5ECN B;  4DSS A;  3GKM A;  2LUS A;  5J41 A;  5G1L A;  2C8U A;  3C71 A;  2A2R A;  4AJ7 A;  2PUK C;  4X1U A;  3HJM A;  4ISD A;  1SU9 A;  3FZ4 A;  4KX4 A;  4MLY A;  3IDV A;  1SJI A;  4FIW A;  2PVQ A;  2QSI A;  4Z7X A;  4KSM A;  5JCG A;  2LJK A;  4KB3 A;  4NAX A;  1SD8 A; 
#chains in the Genus database with same CATH topology
 1AW9 A;  4GSS A;  3R2Q A;  2GZZ A;  1JFU A;  2PVO C;  1EOH A;  2IMK A;  2FWH A;  1BX9 A;  5DQY A;  18GS A;  3D0Z A;  4PGT A;  5DCG A;  2R6K A;  1OAZ A;  1V57 A;  4ULX A;  2V6O A;  4OWY A;  4HI7 A;  4MF5 A;  2UZ8 A;  5ECR B;  5IMZ A;  5DAL A;  2FGX A;  3WT1 A;  5DAK A;  2VM1 A;  3A3T A;  3DVX A;  2YN1 A;  1KBN A;  1SKS B;  1SJ6 A;  2PER A;  11GS A;  5BMU A;  1QQ2 A;  2KP2 A;  2VCV A;  5CRW A;  2DIZ A;  6GSV A;  2A4H A;  3NZN A;  4KA0 A;  4O92 A;  3FR9 A;  3FR6 A;  3IR4 A;  4OFN A;  4MH3 A;  4NWY A;  3C8E A;  2L6D A;  1K0O A;  3F0I A;  1EEM A;  2EIO A;  1XPV A;  5IMD A;  2N5A A;  1U6T A;  1OVN A;  1TW9 A;  1NHY A;  2H6Z A;  1SYX A;  5D8I A;  3US3 A;  2P5R A;  1YEP A;  1PN0 A;  2YOI A;  4FO5 A;  3ZTL A;  2VL9 A;  3G9B A;  2L4Q A;  1BQ7 A;  1MD3 A;  3ZIJ A;  1QMV A;  3UVT A;  3L0H A;  3ERF A;  3IE3 A;  2IFQ A;  4IP1 A;  3VPT A;  1O81 A;  3KJY A;  5F8B A;  1GTU A;  1K3O A;  4Q5N A;  3ZYW A;  4PQ1 A;  1X0R A;  4OCE A;  5J3R A;  4K9Z A;  19GS A;  1M3J A;  1JZW A;  3APS A;  3M1G A;  1T4Y A;  4OO5 A;  5IQY A;  4Q5F A;  4V1A p;  3HJO A;  2CZ2 A;  1G6W A;  4ML1 A;  6GSS A;  2F3M A;  2HRK A;  1AUC A;  2H30 A;  3RAZ A;  1GH2 A;  2HRA A;  1M99 A;  3LWA A;  4K0G A;  1TRW A;  1XWA A;  3F6D A;  2E7P A;  3KEB A;  2X8G A;  4TR1 B;  2P0G A;  3LXT A;  3L9S A;  3MDK A;  4HQS A;  3HJP A;  1GUM A;  2IME A;  2V32 A;  1ZOF A;  5H5R A;  1Y25 A;  2DLX A;  1TP9 A;  3KGK A;  2FA8 A;  1ZGN A;  1PRX A;  3KMN A;  5HQP A;  4O5U A;  3U5R E;  3P90 A;  2TRX A;  2H8L A;  2LV3 A;  3M3M A;  2VAF A;  3VLN A;  2C3T A;  3FW2 A;  1ZCP A;  1S3A A;  3FZ9 A;  2L5O A;  3CSI A;  2VCZ A;  3GX8 A;  1S3C A;  2PGT A;  4IGJ A;  4F82 A;  2ALB A;  5IO2 A;  3HHV A;  4X43 A;  2JZS A;  4KH7 A;  4ZIJ A;  4TN8 A;  4G0L A;  4POM A;  4YQM A;  2CVK A;  3N9J A;  1EWX A;  17GS A;  5AGY A;  1AXD A;  1YF1 A;  3ED3 A;  1GWC A;  4F0B A;  2IN3 A;  2X49 A;  5IM9 A;  2YZU A;  2WRT A;  2YAN A;  4IVF A;  2HZF A;  2HXK A;  1JZD A;  2REM A;  4MF6 A;  1R5A A;  3ME8 A;  3BOA A;  3TB2 A;  2ZCT A;  6GSY A;  4HQZ A;  2LKU A;  1HD2 A;  2I3Y A;  3ZIV A;  4JR6 A;  1HYU A;  4ECI A;  3I69 A;  1FB0 A;  1GUL A;  3F3R A;  3PGT A;  1M7T A;  4HDE A;  2DJK A;  3UIW A;  3M8N A;  4GCI A;  4N11 A;  1B48 A;  3L9V A;  2H19 A;  2GGT A;  4WET A;  4XS4 A;  3BJ5 A;  1X5C A;  1DE2 A;  2E0Q A;  5DVB A;  4ZL8 A;  4XRD A;  2RLI A;  2DJ2 A;  3EMP A;  4EDZ A;  1XVQ A;  3H1N A;  2DKI A;  2GST A;  3TGZ A;  4MZW A;  2AYT A;  3EC3 A;  4BWQ A;  5J5N A;  4BVX B;  4JE1 A;  4EIQ A;  4NPB A;  1JZR A;  1QGV A;  2CV4 A;  1UVZ A;  2RM5 A;  3KIJ A;  3GA4 A;  2C4J A;  5EPF A;  5KN1 A;  2CX4 A;  4NV5 A;  2PPT A;  2JZT A;  3I43 A;  3GST A;  1FHE A;  1AC1 A;  4O7H A;  1Z3E A;  20GS A;  3QR6 A;  3G7I A;  3Q74 A;  2GTU A;  3IHG A;  1FVJ A;  2VCX A;  2CQ9 A;  4NV2 A;  1TRU A;  1X9M B;  1LBK A;  3IAM 2;  2C3N A;  3PIN A;  3ERW A;  1AQX A;  3F6F A;  3KM6 A;  1EEJ A;  5ECO B;  1AQW A;  2JU5 A;  2LST A;  2FWF A;  4XCS A;  1XWK A;  3CRU A;  2H76 A;  5D9V A;  2VCQ A;  5D9X A;  1B9X C;  2H74 A;  10GS A;  1F9M A;  1A2J A;  1F37 A;  3UVH A;  4OFM A;  4HSC X;  2KOK A;  4MH2 A;  4POK A;  5JWO B;  4CDO A;  5D96 A;  3TRQ A;  4IKH A;  5ABR A;  1V2A A;  6GST A;  5IMC A;  2LQO A;  3CSJ A;  2YJ7 A;  4YH2 A;  3FK8 A;  4EIP A;  4KDU A;  5B8A A;  1OC9 B;  4IQA A;  3DRN A;  4HOJ A;  3UEM A;  2B5E A;  4IEL A;  3E9J B;  1B4P A;  4TR3 A;  3ME7 A;  1F3A A;  1PL2 A;  4O5Q A;  1TRV A;  5GAP D;  3KMO A;  5IMA A;  3LSZ A;  3MNG A;  4YQU A;  2F8A A;  2R0G A;  1N8J A;  2X99 A;  1G6Y A;  4HJM A;  5DJM A;  5J9C A;  2PMT A;  4KF9 A;  4H86 A;  1Z7R A;  2FCH A;  3ERG A;  1J0F A;  5KOW A;  2FLS A;  2CAI A;  2DIY A;  1URM A;  3D6I A;  3EMX A;  3JCM L;  4HUA A;  5G31 A;  3GKN A;  4PQH A;  3APO A;  2J9H A;  4O32 A;  2JAD A;  3UBL A;  2HZE B;  3MWH A;  3MIX A;  3KP9 A;  1ST9 A;  1ERU A;  3LEF A;  4E8E A;  4POB A;  5D93 A;  1OC3 A;  1KEB A;  2O7K A;  4MJA A;  3KZQ A;  3WGD A;  2R2J A;  4IS0 A;  2X8C A;  5B6N A;  1JHB A;  3KD0 A;  5CRE A;  3O76 A;  2TIR A;  2FY6 A;  5CNW A;  2JSZ A;  4TOP A;  5IIZ A;  2OJL A;  5KEJ A;  2HSY A;  3GL3 A;  1BG5 A;  2B5X A;  3QD9 A;  3TKS A;  3TJF A;  2FWG A;  2H66 A;  4LL1 B;  1H75 A;  4RQX A;  4PQI A;  3TCO A;  4QL9 A;  5E4W A;  4ML6 A;  3GIX A;  5ECQ B;  1YDK A;  3HVN A;  4G19 A;  1O85 A;  3FKF A;  2OE1 A;  3WYW A;  5G5F A;  3BD2 A;  2OAC A;  3R3E A;  5CO3 A;  1E6B A;  3GTU B;  3EE2 A;  4V2N A;  5FWG A;  1I9D A;  2OKA A;  2CA8 A;  3ZRE A;  3D21 A;  3D4T A;  2GQL A;  4GTU A;  5EY6 A;  5D73 A;  3IK7 A;  1U87 A;  4BPY A;  5B6M A;  5ECI B;  2IMF A;  1SJZ A;  3IHQ A;  3QFA C;  3MSZ A;  4EL1 A;  4X4J A;  3QAG A;  1XXU A;  3SWL A;  1EV9 A;  1QFN A;  4IQ1 A;  2QC7 A;  2FNO A;  4ZBA A;  4ECJ A;  4AGS A;  5ELG A;  3VUR A;  3CMI A;  3L9U A;  3CXG A;  3E3E A;  3W6G A;  4HJ2 A;  2XPD A;  1K0M A;  1VF3 A;  1GTA A;  4K1F A;  1O8W A;  1Z7P A;  3C1S A;  1YEX A;  1BYE A;  2ES7 A;  5J4U A;  2HI7 A;  3M0F A;  1X5E A;  1GNE A;  2O89 A;  4ZXG A;  2DJ1 A;  1GTI A;  2QA1 A;  2IPA A;  1SK0 A;  2FUG 2;  4MJB A;  3UBK A;  3VPQ A;  5GSS A;  3EUR A;  3F63 A;  4TW5 A;  4PXO A;  3LG6 A;  2YV7 A;  5E59 A;  2DBC A;  5D9W A;  1Y6E A;  1YY7 A;  4EUY A;  4RUV A;  5AN1 A;  1GSU A;  3QPM A;  4MMM A;  3UAP A;  1ZZY A;  5A4U A;  2K8S A;  3DD3 A;  3IXR A;  4HU7 A;  1WE0 A;  2VUP A;  3ZFB A;  4G2E A;  3TOT A;  1SD9 A;  3GHA A;  5H5S A;  2AAW A;  1XW9 A;  2AUV A;  2WFC A;  4JRR A;  2B1K A;  3GUR A;  5DDL A;  5COH A;  3GX0 A;  4NMU A;  4AJ8 A;  14GS A;  1E2Y A;  4BVY B;  1FB6 A;  1QUW A;  4JED A;  3S9F A;  2HLS A;  4TR4 A;  1XG8 A;  4XTS A;  4IW9 A;  4V1A g;  5IMV A;  4KAE A;  1W89 A;  2DC5 A;  1FG4 A;  5DBQ A;  1M0U A;  4LMV A;  4ZB9 A;  2MBS A;  5A4W A;  8GSS A;  3VWW A;  4YAP A;  3RHC A;  4ZL9 A;  3QFB C;  4KDX A;  3D5J A;  4N0V A;  2YWN A;  2VM2 A;  4DSQ A;  3IC8 A;  4RQR A;  1K0B A;  4BL7 A;  3MYD A;  4CY8 A;  4ILF A;  2ZNM A;  4ECC A;  1T8E B;  2GSR A;  4L0U A;  3P2A A;  1TJD A;  1JLV A;  3A5I A;  1OC9 A;  1AQV A;  2WDU A;  4BWS A;  5G5E A;  4E8H A;  1OE8 A;  1WOU A;  5CP1 A;  2L6C A;  4X0X A;  2VL2 C;  5HFG A;  1H4O A;  1SKR B;  1B8X A;  4HS1 A;  3DIE A;  4IHU A;  4LLR A;  6GSW A;  1TI1 A;  3GKX A;  1M3I A;  2HT9 A;  1O73 A;  1YF0 A;  5JCU A;  1MD4 A;  2IWT A;  2R4V A;  3HCZ A;  3L4N A;  3L78 A;  2MMN A;  2GVP A;  4USS A;  2LJR A;  5AIV A;  1OKT A;  1EP7 A;  3FR3 A;  1HQO A;  2VCT A;  3D22 A;  5FT3 A;  2NPB A;  4BA7 A;  2BMX A;  2C0D A;  4MF7 A;  4L8E A;  1XOB A;  4OO4 A;  5ID2 B;  3TKS E;  2LJA A;  5B7C A;  2RUF A;  2RII A;  1XWG A;  3UMA A;  2YWM A;  1AIU A;  4D73 A;  3VI7 A;  4MZB A;  5IOX A;  2CX3 A;  5A5K A;  1THX A;  3MAK A;  4FYB A;  4Z2T A;  1J9B A;  3GRX A;  1GLP A;  1O6J A;  4TXV A;  4EVM A;  3M9J A;  4TXO B;  5ECH B;  3ZL5 A;  1SK2 A;  2HYX A;  1K0N A;  3QAW A;  1YKA A;  4ZL7 A;  2EC4 A;  3IOS A;  2PWJ A;  1O7U A;  4GXZ A;  1OC8 A;  2N5F A;  1GRX A;  3ZML A;  1S3D A;  3FY7 A;  3C7M A;  4EDY A;  4J57 E;  1UC7 A;  1QK8 A;  1G7O A;  4WBR D;  3HVX A;  2H73 A;  3FZ5 A;  4EO3 A;  2PBJ A;  3GTU A;  1M2A A;  4POL A;  1GUH A;  3HYP A;  2MBT A;  1TU7 A;  1MDI A;  1G0T A;  1O8X A;  4DSS B;  1XBS A;  3A2V A;  3BBY A;  2C1Y A;  3NIV A;  3FYG A;  1GUK A;  1YKC A;  3F4T A;  3VFI A;  4N0Z A;  3V1W A;  2VD0 A;  2WB9 A;  2WZ9 A;  5L71 A;  1JZO A;  3UAR A;  5ECL B;  4F2I A;  1MEK A;  5GST A;  4I97 A;  3H8Q A;  2WCI A;  2R3X A;  3QMX A;  4MJC A;  2OA7 A;  5G1K A;  2B1L A;  1WJK A;  5AIX A;  1MDK A;  1TDI A;  3LXZ A;  3F9U A;  1PN9 A;  3UL3 A;  1TK0 B;  2GSQ A;  3TRX A;  3HVV A;  3EYT A;  3ZLP A;  1TOF A;  3RDW A;  5CYY A;  4KUN A;  3W8S A;  1CQH A;  1PFO A;  2LRT A;  3IPZ A;  4LA1 A;  4PUF C;  3DGQ A;  5CRD A;  1T4Z A;  16GS A;  3FHK A;  1WWJ A;  3KH9 A;  4AJ6 A;  4I8B A;  4CY6 A;  1T7P B;  1PL1 A;  1K0A A;  4KCA A;  1DE1 A;  4XRA A;  4EC0 A;  2HRN A;  1PD2 1;  4HZ2 A;  5F0G A;  5DAL B;  1R7H A;  5DAK B;  3KCM A;  3VWU A;  4GLT A;  1M2D A;  2K6V A;  3O3T A;  1VF4 A;  2MYG A;  1A0R P;  2X64 A;  3CRT A;  3WGX A;  3GNJ A;  1CQG A;  3IRA A;  1F3B A;  5C00 A;  2YP6 A;  2YWO A;  5HR3 A;  3TJJ A;  5IPH A;  1EOG A;  2IJY A;  4K2X A;  4JZQ A;  3IV4 A;  3CYN A;  2DKH A;  1DSB A;  2A2S A;  2C0F A;  3GMF A;  1PKZ A;  2B5Y A;  1Z6M A;  1Q4J A;  1OKD A;  5FHI A;  4HEA 2;  1FW1 A;  2F9S A;  3ZVJ D;  2K9F A;  4OFT A;  1XVW A;  2NTO A;  4BIK A;  3NOF A;  3GUS A;  2EIR A;  6GSU A;  2XBI A;  3TKP A;  4FYU A;  4Q5R A;  2A2P A;  2VCW A;  1GSS A;  3E0U A;  4K2D A;  3K8N A;  3F3Q A;  3LGC A;  5EVO A;  7GSS A;  5J9B A;  5G2Z A;  3BCI A;  1XWB A;  2R0P A;  4L5O A;  1M9B A;  5HFI A;  2KUC A;  1ACV A;  13GS A;  5JWR B;  2RUE A;  1GL8 A;  1R4W A;  1SL0 B;  1HNA A;  4IN0 A;  2DJ3 A;  1W4V A;  2DML A;  2L57 A;  2VL3 A;  1DBY A;  3GH6 A;  1EGO A;  1GSF A;  4TR1 A;  3TOU A;  3RPP A;  1XW6 A;  2ZUP A;  2HNL A;  2YNX A;  4K5R A;  1SK1 A;  2BJX A;  2HRF A;  1ERT A;  5DJL A;  3WD6 A;  3DEX A;  2B6M A;  1X5D A;  3A2X A;  3P7X A;  1GSD A;  4G0I A;  3G7Y A;  3DVW A;  4K7O A;  4GQC A;  4GRF A;  4KND A;  4ID0 A;  2VL2 A;  1A2L A;  2WGR A;  4MPG A;  1B9Y C;  4GSN A;  1A8L A;  4V2L A;  3ZZX A;  4JR4 A;  4GQF A;  3CBU A;  4CW9 A;  4I6X A;  3FZA A;  2F51 A;  2I81 A;  2LNT A;  5G30 A;  4GST A;  5KN3 A;  1M2B A;  1HNB A;  5DQS A;  4K7N A;  2GQK A;  6GSX A;  1AAZ A;  1LJR A;  1A0F A;  4PTS A;  5CRG A;  2OE3 A;  4N30 A;  1PX7 A;  4TVE A;  2I9H A;  2YWI A;  3DWV A;  1ON4 A;  5AIS A;  3UJ1 A;  1PA3 A;  1MDJ A;  5F05 A;  4WEY A;  3A5W A;  2O85 A;  3ISO A;  2VOC A;  4YAV A;  1TK8 B;  3RPN A;  2MMO A;  3GL5 A;  3CTG A;  2FD3 A;  2HSH A;  5D9T A;  4QQ7 A;  4WF4 A;  4Z2R A;  4XS4 B;  3PH9 A;  4MZC A;  2YZH A;  5IMF A;  5IOW A;  2CVB A;  3TJK A;  2H72 A;  4K7I A;  3H93 A;  2AV4 A;  2MMZ A;  1A2M A;  4KDY A;  12GS A;  2P31 A;  2IMI A;  3C1R A;  2E2M A;  5KOX A;  5EL8 A;  5HR2 A;  4EE0 A;  4WKW A;  1PGT A;  1ILO A;  2X8H A;  1I5G A;  1MTC A;  4BVX A;  2CAQ A;  3KTL A;  1V58 A;  1GP1 A;  1C72 A;  1BJX A;  1ERV A;  3GV1 A;  4NHW A;  5INY A;  3O6T A;  3AY8 A;  3GH9 A;  5ELA A;  3TKQ A;  2J23 A;  4HU9 A;  4XS6 A;  5KN2 A;  1V98 A;  3QOU A;  2IMD A;  5ECP B;  2PU9 C;  1XZO A;  3D4M A;  2B7K A;  4ZB6 A;  3KP8 A;  2H1B A;  2H6Y A;  2ON7 A;  1TRS A;  3UOM A;  4IBP A;  1RQM A;  2MZC A;  2QKE A;  1BED A;  2BTO T;  4XS1 A;  2LQQ A;  4MPF A;  2GQM A;  2IL3 A;  2HE3 A;  1SL2 B;  4TR0 A;  2DJJ A;  1GLQ A;  1WP0 A;  1GNW A;  2FHE A;  1A8Y A;  3GKK A;  2WUL A;  3LFL A;  3G7J A;  4ZBB A;  2VIM A;  2G2Q A;  4I2U A;  1SEN A;  1NW2 A;  2JAC A;  4P3Y B;  3DML A;  2K8V A;  1R26 A;  4F03 A;  1T1V A;  2QA2 A;  2JL4 A;  3H79 A;  3KTB A;  3I6A A;  4YKF A;  4K5S A;  2RM6 A;  3HY2 A;  4HZ4 A;  1A24 A;  1XFL A;  2GZY A;  3C73 A;  2F8F A;  4G10 A;  4EKZ A;  3VWX A;  5ECK B;  1Q98 A;  4WF5 A;  2N5B A;  3TKS C;  1JLW A;  4DSR A;  2XC2 A;  5GAN D;  3IBH A;  5LD0 A;  4L0W A;  3W8J A;  3CQF A;  2H70 A;  3BCK A;  3I9V 2;  3FMW A;  4TKY A;  3GSS A;  2JSY A;  2L59 A;  2MMA A;  5LNK e;  2CT6 A;  1XWC A;  2K18 A;  4MAB A;  4PUR A;  3ZIT A;  3EU4 A;  5F06 A;  4LMW A;  4AF2 A;  2HZE A;  4RI6 A;  2WJU A;  3LQ7 A;  3TJG A;  3HA9 A;  4MK3 A;  2LTK A;  1OE7 A;  4K8M A;  4ZB8 A;  4I5Q A;  3WT2 A;  3IA1 A;  2L4C A;  1PX6 A;  4WXT A;  4K0N A;  1VF1 A;  2PN8 A;  4OMV A;  1YQ1 A;  4G0K A;  4IJI A;  4LL4 B;  1NM3 A;  3TKR A;  1U3A A;  2IIY A;  5C04 A;  2YCD A;  3Q6O A;  2GLR A;  1ABA A;  1FVK A;  3LYK A;  2CVD A;  3KH7 A;  3TRP A;  1GTB A;  3VWV A;  1FAA A;  4MDC A;  4DVC A;  4MA9 A;  1XW5 A;  2LRN A;  3GFK A;  2I1U A;  2LS5 A;  9GSS A;  3EU3 A;  3APQ A;  3FEU A;  1KNG A;  5IPG A;  1EP8 A;  3Q19 A;  4KGI A;  3F4S A;  1YZX A;  1Z9H A;  4ACS A;  2H6X A;  1WPI A;  2O8V B;  2DSA A;  2H0H A;  1PKW A;  2H01 A;  3U6V A;  1ZL9 A;  2VLT A;  3DXB A;  4A5P A;  1G7E A;  2LRC A;  4J2F A;  3HZ8 A;  2C0E A;  4XIH A;  2QGV A;  4G9H A;  2B3S A;  2JZR A;  4KCE A;  1M9A A;  4K6X A;  2Z9S A;  1TKD B;  2CZ3 A;  2R5G A;  2X4A A;  4F9Z A;  2AJQ B;  1ZYE A;  2VO4 A;  2GSS A;  1Z6N A;  4PNF A;  2GDR A;  5BRT A;  1FOH A;  4FYC A;  1VGL A;  5HR1 A;  4YQV A;  2XHF A;  4MCU A;  4FQU A;  1ML6 A;  1U88 A;  1Z5Y E;  3GN3 A;  1TTZ A;  3TUE A;  1K3Y A;  3VK9 A;  4TRX A;  1LU4 A;  3Q18 A;  4EF0 A;  2DMM A;  4CHS A;  4WR4 A;  3ZMK A;  4MP4 A;  5IO0 A;  4Z2U A;  4PX1 A;  1B4Q A;  1N2A A;  1TI3 A;  2V6K A;  2HFD A;  3HXS A;  4NXI A;  1T00 A;  3P8W A;  2E2G A;  5HR0 A;  4JBB A;  3IC4 A;  1QXH A;  5GZZ B;  2C3Q A;  3TDG A;  2VLU A;  5CAX A;  4MNN A;  3SBC A;  2AB6 A;  4KSO A;  1EGR A;  5JCW A;  3RHB A;  2V41 A;  2ON5 A;  1XOA A;  1R5P A;  3DYR A;  1PQN A;  3ZFL A;  1FO5 A;  1SKW B;  1VF2 A;  1U3I A;  2A4V A;  1A23 A;  3A2W A;  3F4R A;  3ZVJ A;  3LYP A;  2YV9 A;  2NBS A;  1XIY A;  4EXJ A;  1T3B A;  4ZBD A;  1GSE A;  1F6M C;  4KW6 A;  5A4V A;  1IYH A;  2H1D A;  2DJ0 A;  2NDO A;  4YKG A;  2XPE A;  4FH8 A;  2VLV A;  4BVY A;  4N10 A;  2GT6 A;  3LJR A;  2GT5 A;  4QL7 A;  2GS3 A;  1EV4 A;  3F8U A;  3M9K A;  1ERW A;  2M46 A;  3J7Y b;  1TK5 B;  4BL7 B;  1NHO A;  2H1A A;  2WS2 A;  2EIQ A;  2IFQ B;  4WR5 A;  1S3R A;  3HKR A;  2H71 A;  2V1M A;  4J56 E;  4NHZ A;  2G0F A;  1X9W B;  5HFK A;  3PR8 A;  1USB A;  4V2M A;  1PMT A;  3QDN A;  1NSW A;  4F0C A;  2AHE A;  4ICY A;  1ZMA A;  2M80 A;  1GSY A;  3N5O A;  4PNG A;  5LCZ A;  4PUA A;  5KN0 A;  5H5Q A;  1OYJ A;  1IYI A;  2H0I A;  4IP6 A;  2GZP A;  3PPU A;  4RI7 A;  2V2G A;  22GS A;  2C0G A;  4JU5 A;  3HD5 A;  1RW1 A;  3HVS A;  2H0G A;  3EIN A;  4OD7 A;  1WMJ A;  2L5L A;  1UA5 A;  2D2Z A;  4L5L A;  1SYR A;  3KXO A;  1K0C A;  1V9W A;  2KLX A;  3DKS A;  5ECM B;  1TU8 A;  1HNC A;  3LOR A;  3RBT A;  4O5R A;  2OBK A;  1RK4 A;  2KP1 A;  5ENU A;  3HDC A;  2OAD A;  3EVI A;  3WGE A;  1BAY A;  2C80 A;  4D73 B;  1V40 A;  4GF0 A;  4I2T A;  2XBQ A;  4ECB A;  2YPM A;  1SL1 B;  2VD1 A;  3J7Y k;  2KHP A;  1TXX A;  1ZYN A;  1F2E A;  5ID2 A;  3VI5 A;  2LNS A;  1THO A;  3OR5 A;  3H4K A;  4WBJ A;  2P5Q A;  5F07 A;  2R0C A;  5B8B A;  1PSQ A;  3HZ4 A;  3IAS 2;  5DCH A;  3GYK A;  2O87 A;  3FRC A;  1WIK A;  1ZYQ B;  1XCC A;  4DEJ A;  4OCF A;  1YJ6 A;  5JWQ B;  4TXO A;  2YJH A;  5CRH A;  1ZYP A;  4XHM A;  1X9S B;  2OBI A;  4KE3 A;  2FA4 A;  4MJE A;  4IJ3 A;  3TJB A;  1VRS D;  2M72 A;  2LEG A;  3QAV A;  3QCP A;  3IK9 A;  2I4A A;  2NVL A;  3EPT A;  1K3L A;  2B7J A;  2FWE A;  1GSQ A;  3CSH A;  1KTE A;  2H75 A;  1DUG A;  1EZK A;  4ZIL A;  2OE0 A;  4GWR A;  2HSM A;  1J08 A;  2TRC P;  3ZRD A;  4Q5Q A;  1K0D A;  1FOV A;  3EWL A;  3CTF A;  1UN2 A;  2R37 A;  2H1G A;  1WRY A;  5ECS A;  5ECN B;  4DSS A;  3GKM A;  2LUS A;  5J41 A;  5G1L A;  2C8U A;  3C71 A;  2A2R A;  4AJ7 A;  2PUK C;  4X1U A;  3HJM A;  3LW9 A;  4ISD A;  1SU9 A;  3FZ4 A;  4KX4 A;  4MLY A;  3IDV A;  1SJI A;  4FIW A;  2PVQ A;  2QSI A;  4Z7X A;  4KSM A;  5JCG A;  2LJK A;  4KB3 A;  4NAX A;  1SD8 A; 
#chains in the Genus database with same CATH homology
 1AW9 A;  4GSS A;  3R2Q A;  2GZZ A;  1JFU A;  2PVO C;  1EOH A;  2IMK A;  2FWH A;  1BX9 A;  5DQY A;  18GS A;  3D0Z A;  4PGT A;  5DCG A;  2R6K A;  1OAZ A;  1V57 A;  4ULX A;  2V6O A;  4OWY A;  4HI7 A;  4MF5 A;  2UZ8 A;  5ECR B;  5IMZ A;  5DAL A;  2FGX A;  3WT1 A;  5DAK A;  2VM1 A;  3A3T A;  3DVX A;  2YN1 A;  1KBN A;  1SKS B;  1SJ6 A;  2PER A;  11GS A;  5BMU A;  1QQ2 A;  2KP2 A;  2VCV A;  5CRW A;  2DIZ A;  6GSV A;  2A4H A;  3NZN A;  4KA0 A;  4O92 A;  3FR9 A;  3FR6 A;  3IR4 A;  4OFN A;  4MH3 A;  4NWY A;  3C8E A;  2L6D A;  1K0O A;  3F0I A;  1EEM A;  2EIO A;  1XPV A;  5IMD A;  2N5A A;  1U6T A;  1OVN A;  1TW9 A;  1NHY A;  2H6Z A;  1SYX A;  5D8I A;  3US3 A;  2P5R A;  1YEP A;  1PN0 A;  2YOI A;  4FO5 A;  3ZTL A;  2VL9 A;  3G9B A;  2L4Q A;  1BQ7 A;  1MD3 A;  3ZIJ A;  1QMV A;  3UVT A;  3L0H A;  3ERF A;  3IE3 A;  2IFQ A;  4IP1 A;  3VPT A;  1O81 A;  3KJY A;  5F8B A;  1GTU A;  1K3O A;  4Q5N A;  3ZYW A;  4PQ1 A;  1X0R A;  4OCE A;  5J3R A;  4K9Z A;  19GS A;  1JZW A;  3APS A;  3M1G A;  1T4Y A;  4OO5 A;  5IQY A;  4Q5F A;  4V1A p;  3HJO A;  2CZ2 A;  1G6W A;  4ML1 A;  6GSS A;  2F3M A;  2HRK A;  1AUC A;  2H30 A;  3RAZ A;  1GH2 A;  2HRA A;  1M99 A;  3LWA A;  4K0G A;  1TRW A;  1XWA A;  3F6D A;  2E7P A;  3KEB A;  2X8G A;  4TR1 B;  2P0G A;  3LXT A;  3L9S A;  3MDK A;  4HQS A;  3HJP A;  1GUM A;  2IME A;  2V32 A;  1ZOF A;  5H5R A;  1Y25 A;  2DLX A;  1TP9 A;  3KGK A;  2FA8 A;  1ZGN A;  1PRX A;  3KMN A;  5HQP A;  4O5U A;  3U5R E;  3P90 A;  2TRX A;  2H8L A;  2LV3 A;  3M3M A;  2VAF A;  3VLN A;  2C3T A;  3FW2 A;  1ZCP A;  1S3A A;  3FZ9 A;  2L5O A;  3CSI A;  2VCZ A;  3GX8 A;  1S3C A;  2PGT A;  4IGJ A;  4F82 A;  2ALB A;  5IO2 A;  3HHV A;  4X43 A;  2JZS A;  4KH7 A;  4ZIJ A;  4TN8 A;  4G0L A;  4POM A;  4YQM A;  2CVK A;  3N9J A;  1EWX A;  17GS A;  5AGY A;  1AXD A;  1YF1 A;  3ED3 A;  1GWC A;  4F0B A;  2IN3 A;  2X49 A;  5IM9 A;  2YZU A;  2WRT A;  2YAN A;  4IVF A;  2HZF A;  2HXK A;  1JZD A;  2REM A;  4MF6 A;  1R5A A;  3ME8 A;  3BOA A;  3TB2 A;  2ZCT A;  6GSY A;  4HQZ A;  2LKU A;  1HD2 A;  2I3Y A;  3ZIV A;  4JR6 A;  1HYU A;  4ECI A;  3I69 A;  1FB0 A;  1GUL A;  3F3R A;  3PGT A;  1M7T A;  4HDE A;  2DJK A;  3UIW A;  3M8N A;  4GCI A;  4N11 A;  1B48 A;  3L9V A;  2H19 A;  2GGT A;  4WET A;  4XS4 A;  3BJ5 A;  1X5C A;  1DE2 A;  2E0Q A;  5DVB A;  4ZL8 A;  4XRD A;  2RLI A;  2DJ2 A;  3EMP A;  4EDZ A;  1XVQ A;  3H1N A;  2DKI A;  2GST A;  3TGZ A;  4MZW A;  2AYT A;  3EC3 A;  4BWQ A;  5J5N A;  4BVX B;  4JE1 A;  4EIQ A;  4NPB A;  1JZR A;  1QGV A;  2CV4 A;  1UVZ A;  2RM5 A;  3KIJ A;  3GA4 A;  2C4J A;  5EPF A;  5KN1 A;  2CX4 A;  4NV5 A;  2PPT A;  2JZT A;  3I43 A;  3GST A;  1FHE A;  1AC1 A;  4O7H A;  1Z3E A;  20GS A;  3QR6 A;  3G7I A;  3Q74 A;  2GTU A;  3IHG A;  1FVJ A;  2VCX A;  2CQ9 A;  4NV2 A;  1TRU A;  1X9M B;  1LBK A;  3IAM 2;  2C3N A;  3PIN A;  3ERW A;  1AQX A;  3F6F A;  3KM6 A;  1EEJ A;  5ECO B;  1AQW A;  2JU5 A;  2LST A;  2FWF A;  4XCS A;  1XWK A;  3CRU A;  2H76 A;  5D9V A;  2VCQ A;  5D9X A;  1B9X C;  2H74 A;  10GS A;  1F9M A;  1A2J A;  1F37 A;  3UVH A;  4OFM A;  2KOK A;  4MH2 A;  4POK A;  5JWO B;  4CDO A;  5D96 A;  3TRQ A;  4IKH A;  5ABR A;  1V2A A;  6GST A;  5IMC A;  2LQO A;  3CSJ A;  2YJ7 A;  4YH2 A;  3FK8 A;  4EIP A;  4KDU A;  5B8A A;  1OC9 B;  4IQA A;  3DRN A;  4HOJ A;  3UEM A;  2B5E A;  4IEL A;  3E9J B;  1B4P A;  4TR3 A;  3ME7 A;  1F3A A;  1PL2 A;  4O5Q A;  1TRV A;  5GAP D;  3KMO A;  5IMA A;  3LSZ A;  3MNG A;  4YQU A;  2F8A A;  2R0G A;  1N8J A;  2X99 A;  1G6Y A;  4HJM A;  5DJM A;  5J9C A;  2PMT A;  4KF9 A;  4H86 A;  1Z7R A;  2FCH A;  3ERG A;  1J0F A;  5KOW A;  2FLS A;  2CAI A;  2DIY A;  1URM A;  3D6I A;  3EMX A;  3JCM L;  4HUA A;  5G31 A;  3GKN A;  4PQH A;  3APO A;  2J9H A;  4O32 A;  2JAD A;  3UBL A;  2HZE B;  3MWH A;  3MIX A;  3KP9 A;  1ST9 A;  1ERU A;  3LEF A;  4E8E A;  4POB A;  5D93 A;  1OC3 A;  1KEB A;  2O7K A;  4MJA A;  3KZQ A;  3WGD A;  2R2J A;  4IS0 A;  2X8C A;  5B6N A;  1JHB A;  3KD0 A;  5CRE A;  3O76 A;  2TIR A;  2FY6 A;  5CNW A;  2JSZ A;  4TOP A;  5IIZ A;  2OJL A;  5KEJ A;  2HSY A;  3GL3 A;  1BG5 A;  2B5X A;  3QD9 A;  3TKS A;  3TJF A;  2FWG A;  2H66 A;  4LL1 B;  1H75 A;  4RQX A;  4PQI A;  3TCO A;  4QL9 A;  5E4W A;  4ML6 A;  3GIX A;  5ECQ B;  1YDK A;  4G19 A;  1O85 A;  3FKF A;  2OE1 A;  3WYW A;  5G5F A;  3BD2 A;  2OAC A;  3R3E A;  5CO3 A;  1E6B A;  3GTU B;  3EE2 A;  4V2N A;  5FWG A;  1I9D A;  2OKA A;  2CA8 A;  3ZRE A;  3D21 A;  3D4T A;  2GQL A;  4GTU A;  5EY6 A;  5D73 A;  3IK7 A;  1U87 A;  4BPY A;  5B6M A;  5ECI B;  2IMF A;  1SJZ A;  3IHQ A;  3QFA C;  3MSZ A;  4EL1 A;  4X4J A;  3QAG A;  1XXU A;  3SWL A;  1EV9 A;  1QFN A;  4IQ1 A;  2QC7 A;  2FNO A;  4ZBA A;  4ECJ A;  4AGS A;  5ELG A;  3VUR A;  3CMI A;  3L9U A;  3CXG A;  3E3E A;  3W6G A;  4HJ2 A;  2XPD A;  1K0M A;  1VF3 A;  1GTA A;  4K1F A;  1O8W A;  1Z7P A;  3C1S A;  1YEX A;  1BYE A;  2ES7 A;  5J4U A;  2HI7 A;  3M0F A;  1X5E A;  1GNE A;  2O89 A;  4ZXG A;  2DJ1 A;  1GTI A;  2QA1 A;  2IPA A;  1SK0 A;  2FUG 2;  4MJB A;  3UBK A;  3VPQ A;  5GSS A;  3EUR A;  3F63 A;  4TW5 A;  4PXO A;  3LG6 A;  2YV7 A;  5E59 A;  2DBC A;  5D9W A;  1Y6E A;  1YY7 A;  4EUY A;  4RUV A;  5AN1 A;  1GSU A;  3QPM A;  4MMM A;  3UAP A;  1ZZY A;  5A4U A;  2K8S A;  3DD3 A;  3IXR A;  4HU7 A;  1WE0 A;  2VUP A;  3ZFB A;  4G2E A;  3TOT A;  1SD9 A;  3GHA A;  5H5S A;  2AAW A;  1XW9 A;  2AUV A;  2WFC A;  4JRR A;  2B1K A;  3GUR A;  5DDL A;  5COH A;  3GX0 A;  4NMU A;  4AJ8 A;  14GS A;  1E2Y A;  4BVY B;  1FB6 A;  1QUW A;  4JED A;  3S9F A;  2HLS A;  4TR4 A;  4XTS A;  4IW9 A;  4V1A g;  5IMV A;  4KAE A;  1W89 A;  2DC5 A;  1FG4 A;  5DBQ A;  1M0U A;  4LMV A;  4ZB9 A;  2MBS A;  5A4W A;  8GSS A;  3VWW A;  4YAP A;  3RHC A;  4ZL9 A;  3QFB C;  4KDX A;  3D5J A;  4N0V A;  2YWN A;  2VM2 A;  4DSQ A;  3IC8 A;  4RQR A;  1K0B A;  4BL7 A;  3MYD A;  4CY8 A;  4ILF A;  2ZNM A;  4ECC A;  1T8E B;  2GSR A;  4L0U A;  3P2A A;  1TJD A;  1JLV A;  3A5I A;  1OC9 A;  1AQV A;  2WDU A;  4BWS A;  5G5E A;  4E8H A;  1OE8 A;  1WOU A;  5CP1 A;  2L6C A;  4X0X A;  2VL2 C;  5HFG A;  1H4O A;  1SKR B;  1B8X A;  4HS1 A;  3DIE A;  4IHU A;  4LLR A;  6GSW A;  1TI1 A;  3GKX A;  2HT9 A;  1O73 A;  1YF0 A;  5JCU A;  1MD4 A;  2IWT A;  2R4V A;  3HCZ A;  3L4N A;  3L78 A;  2MMN A;  2GVP A;  4USS A;  2LJR A;  5AIV A;  1OKT A;  1EP7 A;  3FR3 A;  1HQO A;  2VCT A;  3D22 A;  5FT3 A;  2NPB A;  4BA7 A;  2BMX A;  2C0D A;  4MF7 A;  4L8E A;  1XOB A;  4OO4 A;  5ID2 B;  3TKS E;  2LJA A;  5B7C A;  2RUF A;  2RII A;  1XWG A;  3UMA A;  2YWM A;  1AIU A;  4D73 A;  3VI7 A;  4MZB A;  5IOX A;  2CX3 A;  5A5K A;  1THX A;  3MAK A;  4FYB A;  4Z2T A;  1J9B A;  3GRX A;  1GLP A;  1O6J A;  4TXV A;  4EVM A;  3M9J A;  4TXO B;  5ECH B;  3ZL5 A;  1SK2 A;  2HYX A;  1K0N A;  3QAW A;  1YKA A;  4ZL7 A;  2EC4 A;  3IOS A;  2PWJ A;  1O7U A;  4GXZ A;  1OC8 A;  2N5F A;  1GRX A;  3ZML A;  1S3D A;  3FY7 A;  3C7M A;  4EDY A;  4J57 E;  1UC7 A;  1QK8 A;  1G7O A;  4WBR D;  3HVX A;  2H73 A;  3FZ5 A;  4EO3 A;  2PBJ A;  3GTU A;  1M2A A;  4POL A;  1GUH A;  3HYP A;  2MBT A;  1TU7 A;  1MDI A;  1G0T A;  1O8X A;  4DSS B;  1XBS A;  3A2V A;  3BBY A;  2C1Y A;  3NIV A;  3FYG A;  1GUK A;  1YKC A;  3F4T A;  3VFI A;  4N0Z A;  3V1W A;  2VD0 A;  2WB9 A;  2WZ9 A;  5L71 A;  1JZO A;  3UAR A;  5ECL B;  4F2I A;  1MEK A;  5GST A;  4I97 A;  3H8Q A;  2WCI A;  2R3X A;  3QMX A;  4MJC A;  2OA7 A;  5G1K A;  2B1L A;  1WJK A;  5AIX A;  1MDK A;  1TDI A;  3LXZ A;  3F9U A;  1PN9 A;  3UL3 A;  1TK0 B;  2GSQ A;  3TRX A;  3HVV A;  3EYT A;  3ZLP A;  1TOF A;  3RDW A;  5CYY A;  4KUN A;  3W8S A;  1CQH A;  2LRT A;  3IPZ A;  4LA1 A;  4PUF C;  3DGQ A;  5CRD A;  1T4Z A;  16GS A;  3FHK A;  1WWJ A;  3KH9 A;  4AJ6 A;  4I8B A;  4CY6 A;  1T7P B;  1PL1 A;  1K0A A;  4KCA A;  1DE1 A;  4XRA A;  4EC0 A;  2HRN A;  1PD2 1;  4HZ2 A;  5F0G A;  5DAL B;  1R7H A;  5DAK B;  3KCM A;  3VWU A;  4GLT A;  1M2D A;  2K6V A;  3O3T A;  1VF4 A;  2MYG A;  1A0R P;  2X64 A;  3CRT A;  3WGX A;  3GNJ A;  1CQG A;  3IRA A;  1F3B A;  5C00 A;  2YP6 A;  2YWO A;  5HR3 A;  3TJJ A;  5IPH A;  1EOG A;  2IJY A;  4K2X A;  4JZQ A;  3IV4 A;  3CYN A;  2DKH A;  1DSB A;  2A2S A;  2C0F A;  3GMF A;  1PKZ A;  2B5Y A;  1Z6M A;  1Q4J A;  1OKD A;  5FHI A;  4HEA 2;  1FW1 A;  2F9S A;  3ZVJ D;  2K9F A;  4OFT A;  1XVW A;  2NTO A;  3NOF A;  3GUS A;  2EIR A;  6GSU A;  2XBI A;  3TKP A;  4FYU A;  4Q5R A;  2A2P A;  2VCW A;  1GSS A;  3E0U A;  4K2D A;  3K8N A;  3F3Q A;  3LGC A;  5EVO A;  7GSS A;  5J9B A;  5G2Z A;  3BCI A;  1XWB A;  2R0P A;  4L5O A;  1M9B A;  5HFI A;  2KUC A;  1ACV A;  13GS A;  5JWR B;  2RUE A;  1GL8 A;  1R4W A;  1SL0 B;  1HNA A;  4IN0 A;  2DJ3 A;  1W4V A;  2DML A;  2L57 A;  2VL3 A;  1DBY A;  3GH6 A;  1EGO A;  1GSF A;  4TR1 A;  3TOU A;  3RPP A;  1XW6 A;  2ZUP A;  2HNL A;  2YNX A;  4K5R A;  1SK1 A;  2BJX A;  2HRF A;  1ERT A;  5DJL A;  3WD6 A;  3DEX A;  2B6M A;  1X5D A;  3A2X A;  3P7X A;  1GSD A;  4G0I A;  3G7Y A;  3DVW A;  4K7O A;  4GQC A;  4GRF A;  4KND A;  4ID0 A;  2VL2 A;  1A2L A;  2WGR A;  4MPG A;  1B9Y C;  4GSN A;  1A8L A;  4V2L A;  3ZZX A;  4JR4 A;  4GQF A;  3CBU A;  4CW9 A;  4I6X A;  3FZA A;  2F51 A;  2I81 A;  2LNT A;  5G30 A;  4GST A;  5KN3 A;  1M2B A;  1HNB A;  5DQS A;  4K7N A;  2GQK A;  6GSX A;  1AAZ A;  1LJR A;  1A0F A;  4PTS A;  5CRG A;  2OE3 A;  4N30 A;  1PX7 A;  4TVE A;  2I9H A;  2YWI A;  3DWV A;  1ON4 A;  5AIS A;  3UJ1 A;  1PA3 A;  1MDJ A;  5F05 A;  4WEY A;  3A5W A;  2O85 A;  3ISO A;  2VOC A;  4YAV A;  1TK8 B;  3RPN A;  2MMO A;  3GL5 A;  3CTG A;  2FD3 A;  2HSH A;  5D9T A;  4QQ7 A;  4WF4 A;  4Z2R A;  4XS4 B;  3PH9 A;  4MZC A;  2YZH A;  5IMF A;  5IOW A;  2CVB A;  3TJK A;  2H72 A;  4K7I A;  3H93 A;  2AV4 A;  2MMZ A;  1A2M A;  4KDY A;  12GS A;  2P31 A;  2IMI A;  3C1R A;  2E2M A;  5KOX A;  5EL8 A;  5HR2 A;  4EE0 A;  4WKW A;  1PGT A;  1ILO A;  2X8H A;  1I5G A;  1MTC A;  4BVX A;  2CAQ A;  3KTL A;  1V58 A;  1GP1 A;  1C72 A;  1BJX A;  1ERV A;  3GV1 A;  4NHW A;  5INY A;  3O6T A;  3AY8 A;  3GH9 A;  5ELA A;  3TKQ A;  2J23 A;  4HU9 A;  4XS6 A;  5KN2 A;  1V98 A;  3QOU A;  2IMD A;  5ECP B;  2PU9 C;  1XZO A;  3D4M A;  2B7K A;  4ZB6 A;  3KP8 A;  2H1B A;  2H6Y A;  2ON7 A;  1TRS A;  3UOM A;  4IBP A;  1RQM A;  2MZC A;  2QKE A;  1BED A;  2BTO T;  4XS1 A;  2LQQ A;  4MPF A;  2GQM A;  2IL3 A;  2HE3 A;  1SL2 B;  4TR0 A;  2DJJ A;  1GLQ A;  1WP0 A;  1GNW A;  2FHE A;  1A8Y A;  3GKK A;  2WUL A;  3LFL A;  3G7J A;  4ZBB A;  2VIM A;  2G2Q A;  4I2U A;  1SEN A;  1NW2 A;  2JAC A;  4P3Y B;  3DML A;  2K8V A;  1R26 A;  4F03 A;  1T1V A;  2QA2 A;  2JL4 A;  3H79 A;  3KTB A;  3I6A A;  4YKF A;  4K5S A;  2RM6 A;  3HY2 A;  4HZ4 A;  1A24 A;  1XFL A;  2GZY A;  3C73 A;  2F8F A;  4G10 A;  4EKZ A;  3VWX A;  5ECK B;  1Q98 A;  4WF5 A;  2N5B A;  3TKS C;  1JLW A;  4DSR A;  2XC2 A;  5GAN D;  3IBH A;  5LD0 A;  4L0W A;  3W8J A;  2H70 A;  3BCK A;  3I9V 2;  3FMW A;  4TKY A;  3GSS A;  2JSY A;  2L59 A;  2MMA A;  5LNK e;  2CT6 A;  1XWC A;  2K18 A;  4MAB A;  4PUR A;  3ZIT A;  3EU4 A;  5F06 A;  4LMW A;  4AF2 A;  2HZE A;  4RI6 A;  2WJU A;  3LQ7 A;  3TJG A;  3HA9 A;  4MK3 A;  2LTK A;  1OE7 A;  4K8M A;  4ZB8 A;  4I5Q A;  3WT2 A;  3IA1 A;  2L4C A;  1PX6 A;  4WXT A;  4K0N A;  1VF1 A;  2PN8 A;  4OMV A;  1YQ1 A;  4G0K A;  4IJI A;  4LL4 B;  1NM3 A;  3TKR A;  1U3A A;  2IIY A;  5C04 A;  2YCD A;  3Q6O A;  2GLR A;  1ABA A;  1FVK A;  3LYK A;  2CVD A;  3KH7 A;  3TRP A;  1GTB A;  3VWV A;  1FAA A;  4MDC A;  4DVC A;  4MA9 A;  1XW5 A;  2LRN A;  3GFK A;  2I1U A;  2LS5 A;  9GSS A;  3EU3 A;  3APQ A;  3FEU A;  1KNG A;  5IPG A;  1EP8 A;  3Q19 A;  4KGI A;  3F4S A;  1YZX A;  1Z9H A;  4ACS A;  2H6X A;  1WPI A;  2O8V B;  2DSA A;  2H0H A;  1PKW A;  2H01 A;  3U6V A;  1ZL9 A;  2VLT A;  3DXB A;  4A5P A;  1G7E A;  2LRC A;  4J2F A;  3HZ8 A;  2C0E A;  4XIH A;  2QGV A;  4G9H A;  2B3S A;  2JZR A;  4KCE A;  1M9A A;  4K6X A;  2Z9S A;  1TKD B;  2CZ3 A;  2R5G A;  2X4A A;  4F9Z A;  2AJQ B;  1ZYE A;  2VO4 A;  2GSS A;  1Z6N A;  4PNF A;  2GDR A;  5BRT A;  1FOH A;  4FYC A;  1VGL A;  5HR1 A;  4YQV A;  2XHF A;  4MCU A;  4FQU A;  1ML6 A;  1U88 A;  1Z5Y E;  3GN3 A;  1TTZ A;  3TUE A;  1K3Y A;  3VK9 A;  4TRX A;  1LU4 A;  3Q18 A;  4EF0 A;  2DMM A;  4CHS A;  4WR4 A;  3ZMK A;  4MP4 A;  5IO0 A;  4Z2U A;  4PX1 A;  1B4Q A;  1N2A A;  1TI3 A;  2V6K A;  2HFD A;  3HXS A;  4NXI A;  1T00 A;  3P8W A;  2E2G A;  5HR0 A;  4JBB A;  3IC4 A;  1QXH A;  5GZZ B;  2C3Q A;  3TDG A;  2VLU A;  5CAX A;  4MNN A;  3SBC A;  2AB6 A;  4KSO A;  1EGR A;  5JCW A;  3RHB A;  2V41 A;  2ON5 A;  1XOA A;  1R5P A;  3DYR A;  1PQN A;  3ZFL A;  1FO5 A;  1SKW B;  1VF2 A;  1U3I A;  2A4V A;  1A23 A;  3A2W A;  3F4R A;  3ZVJ A;  3LYP A;  2YV9 A;  2NBS A;  1XIY A;  4EXJ A;  1T3B A;  4ZBD A;  1GSE A;  1F6M C;  4KW6 A;  5A4V A;  1IYH A;  2H1D A;  2DJ0 A;  2NDO A;  4YKG A;  2XPE A;  4FH8 A;  2VLV A;  4BVY A;  4N10 A;  2GT6 A;  3LJR A;  2GT5 A;  4QL7 A;  2GS3 A;  1EV4 A;  3F8U A;  3M9K A;  1ERW A;  2M46 A;  3J7Y b;  1TK5 B;  4BL7 B;  1NHO A;  2H1A A;  2WS2 A;  2EIQ A;  2IFQ B;  4WR5 A;  3HKR A;  2H71 A;  2V1M A;  4J56 E;  4NHZ A;  2G0F A;  1X9W B;  5HFK A;  3PR8 A;  1USB A;  4V2M A;  1PMT A;  3QDN A;  1NSW A;  4F0C A;  2AHE A;  4ICY A;  1ZMA A;  2M80 A;  1GSY A;  3N5O A;  4PNG A;  5LCZ A;  4PUA A;  5KN0 A;  5H5Q A;  1OYJ A;  1IYI A;  2H0I A;  4IP6 A;  2GZP A;  3PPU A;  4RI7 A;  2V2G A;  22GS A;  2C0G A;  4JU5 A;  3HD5 A;  1RW1 A;  3HVS A;  2H0G A;  3EIN A;  4OD7 A;  1WMJ A;  2L5L A;  1UA5 A;  2D2Z A;  4L5L A;  1SYR A;  3KXO A;  1K0C A;  1V9W A;  2KLX A;  3DKS A;  5ECM B;  1TU8 A;  1HNC A;  3LOR A;  3RBT A;  4O5R A;  2OBK A;  1RK4 A;  2KP1 A;  5ENU A;  3HDC A;  2OAD A;  3EVI A;  3WGE A;  1BAY A;  2C80 A;  4D73 B;  1V40 A;  4GF0 A;  4I2T A;  2XBQ A;  4ECB A;  2YPM A;  1SL1 B;  2VD1 A;  3J7Y k;  2KHP A;  1TXX A;  1ZYN A;  1F2E A;  5ID2 A;  3VI5 A;  2LNS A;  1THO A;  3OR5 A;  3H4K A;  4WBJ A;  2P5Q A;  5F07 A;  2R0C A;  5B8B A;  1PSQ A;  3HZ4 A;  3IAS 2;  5DCH A;  3GYK A;  2O87 A;  3FRC A;  1WIK A;  1ZYQ B;  1XCC A;  4DEJ A;  4OCF A;  1YJ6 A;  5JWQ B;  4TXO A;  2YJH A;  5CRH A;  1ZYP A;  4XHM A;  1X9S B;  2OBI A;  4KE3 A;  2FA4 A;  4MJE A;  4IJ3 A;  3TJB A;  1VRS D;  2M72 A;  2LEG A;  3QAV A;  3QCP A;  3IK9 A;  2I4A A;  2NVL A;  3EPT A;  1K3L A;  2B7J A;  2FWE A;  1GSQ A;  3CSH A;  1KTE A;  2H75 A;  1DUG A;  1EZK A;  4ZIL A;  2OE0 A;  4GWR A;  2HSM A;  1J08 A;  2TRC P;  3ZRD A;  4Q5Q A;  1K0D A;  1FOV A;  3EWL A;  3CTF A;  1UN2 A;  2R37 A;  2H1G A;  1WRY A;  5ECS A;  5ECN B;  4DSS A;  3GKM A;  2LUS A;  5J41 A;  5G1L A;  2C8U A;  3C71 A;  2A2R A;  4AJ7 A;  2PUK C;  4X1U A;  3HJM A;  3LW9 A;  4ISD A;  1SU9 A;  3FZ4 A;  4KX4 A;  4MLY A;  3IDV A;  1SJI A;  4FIW A;  2PVQ A;  2QSI A;  4Z7X A;  4KSM A;  5JCG A;  2LJK A;  4KB3 A;  4NAX A;  1SD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...