1F6MC

Crystal structure of a complex between thioredoxin reductase, thioredoxin, and the nadp+ analog, aadp+
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
108
structure length
108
Chain Sequence
SDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPSKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN REDUCTASE
publication title Twists in catalysis: alternating conformations of Escherichia coli thioredoxin reductase.
pubmed doi rcsb
source organism Escherichia coli
total genus 21
structure length 108
sequence length 108
chains with identical sequence D, G, H
ec nomenclature
pdb deposition date 2000-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1f6mC00
4PGTA 1DBYA 1EOHA 3L9VA 3QFBC 1M2DA 3C73A 4YQVA 3C1SA 3G7YA 1BG5A 4ZILA 1ZL9A 1URMA 1KEBA 1NM3A 2FCHA 1XZOA 3KM6A 4ID0A 5AIXA 3DYRA 4KDYA 1XVQA 1UN2A 3NIVA 3UIWA 4FH8A 2VCVA 1F3BA 4I97A 5G31A 1GUMA 3BOAA 2C0EA 3LGCA 4PX1A 3F4TA 4E8EA 3IA1A 3HZ8A 3P90A 3FZ4A 4Q5QA 2J23A 2DJ1A 4K7NA 2L59A 2MMAA 4G2EA 3G9BA 3QDNA 1GTUA 1DSBA 2L6CA 2VL3A 5A4VA 2J9HA 4V2NA 4F2IA 1J0FA 1CQHA 1T1VA 2PGTA 4Q5NA 2DJ0A 2N5BA 5IPGA 1G6WA 2JL4A 1MTCA 3VK9A 1OKTA 5IM9A 3HVXA 4HQZA 3ZMLA 4NHWA 2VL2A 2GZZA 1XOAA 4BVYA 3EMPA 1TRVA 4BPYA 12GSA 3VLNA 1VF3A 1EP7A 4HDEA 4KDUA 1OC9B 4L5LA 3GX0A 5D9TA 4GQCA 4K7OA 4ECIA 2OA7A 4N0VA 1R5AA 2VIMA 1TK5B 3CTGA 2DJ3A 3GTUB 1ERTA 1JZDA 3GYKA 4BWQA 2EIQA 1VF4A 4J56E 1R4WA 2C4JA 3P2AA 2WS2A 4MP4A 4I8BA 2DIYA 2LRNA 1R5PA 1K0CA 3GKNA 4HOJA 3L9SA 3V1WA 2C80A 5C00A 2H70A 3QOUA 1B4QA 4POLA 2FHEA 3DMLA 2DBCA 3UBLA 3GH6A 2CV4A 5B8BA 1T8EB 4HJMA 2MMNA 5ECRB 1GTIA 5IO2A 4F0BA 4P3YB 5KN1A 3ZYWA 2L5OA 4HU9A 5D9XA 4IP6A 1OYJA 4F0CA 5CAXA 1BEDA 2A2SA 1AW9A 1NW2A 4NHZA 4EVMA 3F8UA 1E2YA 2HI7A 3EC3A 4OMVA 4IW9A 1K0MA 1M99A 3M0FA 1IYHA 5DBQA 4KAEA 3MNGA 4TR1B 2IMKA 2GTUA 5IMAA 4OCFA 5ECLB 1XWKA 4EL1A 1T4ZA 3KXOA 2H71A 1FW1A 5ECKB 20GSA 5DJMA 2IN3A 1MD3A 3GN3A 1PGTA 2LRTA 4XTSA 18GSA 4ML1A 4AF2A 2QSIA 3LYKA 5IMDA 2C1YA 5GSSA 3IDVA 2LS5A 3C8EA 3NZNA 1ACVA 2VCXA 1O6JA 3VI7A 4JE1A 1XWAA 1H75A 8GSSA 1SU9A 1VF2A 3GL5A 3ZTLA 4MA9A 1M9BA 1GUKA 1XFLA 4IBPA 5H5RA 4XS6A 5ECPB 5B6NA 1OC8A 4NWYA 4KW6A 3ZITA 1F9MA 4G10A 2GGTA 2IMEA 3TOUA 6GSVA 1K0DA 1EGOA 3R2QA 4K6XA 1HNBA 4G9HA 1A2MA 4LL4B 1M9AA 4JRRA 1JZWA 2HE3A 3KMOA 4KUNA 4IJIA 1AQWA 2O8VB 1XBSA 2P5RA 4HZ4A 1SKRB 1Y6EA 4TXOB 3FKFA 3BCIA 5ECOB 5DAKB 2WB9A 4EKZA 2V6KA 1GSYA 3IAS2 3KMNA 2WZ9A 3ZLPA 2B7KA 1SJ6A 4IHUA 3TJGA 4KCAA 3QR6A 2GSSA 3M9KA 4MF7A 1GSSA 4POMA 2NDOA 4OFTA 1B9YC 1F2EA 3D6IA 2IFQA 2HYXA 1HD2A 5CNWA 1EOGA 3IR4A 3PGTA 4K2DA 2PWJA 3VWWA 5JWOB 3TJFA 3RAZA 4PNGA 5GAPD 4MJAA 1X5CA 1OE7A 2LSTA 2HZEA 1XW9A 3ZIJA 1JFUA 2VM1A 2OJLA 3APQA 3UVHA 4QL7A 3QAGA 3A2XA 2OE3A 5A5KA 2V41A 3TKSC 1JZRA 2RUFA 2LRCA 1ZOFA 1Z7RA 2FA8A 3C71A 3RHBA 1N2AA 1S3CA 2X8HA 2KP2A 5ECIB 4XRAA 1ST9A 3D4MA 1BYEA 1ZMAA 2VCTA 2B1KA 5COHA 2E2GA 3VWXA 4YQMA 1PL1A 2R3XA 2KUCA 3L0HA 6GSWA 4MPGA 4JR4A 4ZB6A 1U87A 3HCZA 3PH9A 4L8EA 1O73A 4L0WA 1SENA 1WP0A 5DJLA 2CA8A 2N5AA 4NMUA 3IXRA 2FWFA 4V2MA 2JACA 4WF4A 2RLIA 1XXUA 4DSRA 1ERVA 22GSA 3W6GA 3PR8A 4EXJA 1RQMA 4TVEA 4EC0A 3EVIA 2HZFA 5AGYA 2RM6A 2R5GA 3WT1A 3CSHA 1OE8A 4MH3A 1TI1A 2PMTA 5IMVA 4ZB9A 5IIZA 1X5EA 3CRUA 4MZWA 1YY7A 1Y25A 1JLWA 1YEPA 4OO5A 4BL7A 2F8AA 3LSZA 3MWHA 2G0FA 2L4QA 1C72A 3GMFA 3HHVA 3FRCA 2H66A 3E9JB 1YF1A 1ZGNA 5JCWA 4DSSA 5F05A 2ON7A 3F9UA 6GSSA 5A4UA 1JLVA 2HLSA 3A2VA 4AJ8A 3LEFA 2VCZA 3FHKA 7GSSA 1FB6A 3TKSE 2CX4A 2C3NA 5CYYA 2GT6A 4OFMA 2OE1A 2F3MA 2LV3A 4I2UA 2K9FA 3CYNA 3TJJA 4GQFA 3FZ5A 2REMA 4KCEA 1YKCA 3GKMA 2P5QA 1B9XC 3Q6OA 2PPTA 4WETA 3HJMA 5AN1A 2AB6A 1K3LA 5D9WA 4ZBDA 5ECNB 4EUYA 1TXXA 1GH2A 2N5FA 1N8JA 2H76A 1V57A 1TI3A 1M7TA 2Z9SA 3UVTA 4XS4B 3I9V2 3GRXA 1THXA 2CVBA 3KCMA 1W4VA 5GSTA 4IGJA 3CMIA 4KB3A 5DVBA 2O87A 1J08A 1SKSB 2GZPA 3GV1A 3RHCA 4LL1B 4O32A 1XWGA 1M2BA 4NV2A 4XS1A 3WYWA 5B6MA 1Q98A 2O85A 3FR6A 2PBJA 1F6MC 2L57A 1PL2A 1V2AA 5G30A 2LTKA 1XWBA 1BX9A 1K0AA 1GSEA 1KBNA 1ML6A 5F0GA 4EDYA 1TK8B 4I2TA 4ML6A 5E59A 1OAZA 4PQIA 4KSMA 4JEDA 11GSA 5HR3A 3HYPA 1YKAA 1HYUA 3ZFBA 5AIVA 4WR5A 3L78A 4EE0A 5DQSA 3VURA 2MBSA 5ECHB 3HXSA 3D5JA 2OBKA 1PD21 1A0RP 2HNLA 1I5GA 2YCDA 3MAKA 2YWNA 4LA1A 1UA5A 3UL3A 4IELA 3ED3A 5KN2A 4AGSA 19GSA 3DEXA 1T00A 4MCUA 2IPAA 1EP8A 2GQKA 2F8FA 4MABA 4GTUA 1G7OA 4MDCA 4MF5A 2MMOA 3CSIA 2ZUPA 5H5QA 3E3EA 1YEXA 1UVZA 3ERWA 4OFNA 2K8SA 1PSQA 4RI6A 4NPBA 2HXKA 3LJRA 5J9CA 1X5DA 1MEKA 3LXTA 4LMVA 2O7KA 4AJ6A 2VM2A 2H72A 3WD6A 1LU4A 2ALBA 1YZXA 3UBKA 2JSYA 3HZ4A 4OD7A 3MSZA 4HJ2A 3FR9A 5G1KA 3M9JA 4ZIJA 3IAM2 2XC2A 5DALA 2FWHA 3TRPA 1FG4A 1GNWA 4ECBA 1BJXA 2JU5A 2VD1A 2E2MA 3GURA 4FO5A 2K8VA 4FYUA 5ID2B 2MYGA 3RDWA 5B8AA 2V2GA 1T3BA 5G5EA 3EE2A 3QMXA 2VL2C 4MMMA 4IQAA 3P8WA 1W89A 1B4PA 3P7XA 3CBUA 1YJ6A 4KX4A 5HFKA 2JADA 3TOTA 3DRNA 3C7MA 4MLYA 3O3TA 3WT2A 2KHPA 4XCSA 3IBHA 2VLUA 3IK7A 3O6TA 3F4RA 3ZMKA 3DVWA 3EU4A 4POKA 2GVPA 2IMIA 1AC1A 1FO5A 3UJ1A 1OVNA 2WJUA 3TB2A 3F6DA 4GSNA 4F03A 4K0GA 2VLTA 3ZVJA 2PVQA 1SJIA 1A0FA 4CW9A 5HFIA 5CO3A 3ERGA 3GIXA 2VLVA 4IJ3A 1M0UA 1RK4A 1WMJA 3GSSA 1A8YA 1EGRA 4X1UA 5IOXA 2M46A 2DMMA 2B1LA 3I43A 2B7JA 4JU5A 3Q19A 1YQ1A 4G19A 2E7PA 4MZCA 4TW5A 4ZBAA 5DCHA 5CRGA 4GCIA 2LUSA 3FYGA 2GSQA 1NHOA 5ENUA 1V58A 5ELGA 4PUFC 3C1RA 1TP9A 2H1DA 3ZREA 2B5XA 3EURA 1SYXA 2X8GA 1AQXA 2YJ7A 5ELAA 4MH2A 2RIIA 1SJZA 3TDGA 3TKQA 3QFAC 4AJ7A 2WULA 5IMCA 1PKWA 3CXGA 4F82A 2WRTA 4KA0A 5F07A 4D73A 2YOIA 4POBA 1GUHA 4J57E 1TU7A 4K9ZA 5IQYA 3OR5A 2YWOA 4PURA 2LJRA 4WBRD 2TRCP 1WIKA 3I69A 1QQ2A 4MJCA 4V2LA 5KEJA 3KJYA 17GSA 2VD0A 3ISOA 2IMDA 5IOWA 5J41A 3Q74A 4GWRA 2K18A 4BA7A 1G7EA 2I81A 2QKEA 1NHYA 3W8SA 4O92A 2MMZA 2HFDA 3H8QA 3ME7A 1S3AA 1THOA 2QC7A 4DSQA 4H86A 5HFGA 2LNSA 4N11A 2TIRA 3APSA 2NVLA 1X9MB 1GTAA 2DLXA 6GSUA 1PQNA 4TN8A 2I4AA 2GQLA 4MZBA 1TTZA 1SD9A 5CRDA 2TRXA 4I6XA 2G2QA 5FHIA 3KTBA 1QXHA 1BQ7A 2CQ9A 1V9WA 2JZRA 3M1GA 1HNAA 2YV9A 5CRHA 4KH7A 2F9SA 3FEUA 4RQRA 1Z9HA 3ERFA 4OWYA 3ZL5A 4J2FA 4V1Ap 1GNEA 1TOFA 1GLQA 1H4OA 4KE3A 1OC9A 2YNXA 3BD2A 5GZZB 4FIWA 4PQHA 2DJ2A 3SWLA 4BVXA 1FHEA 2I1UA 5IO0A 3NOFA 2CAIA 4X0XA 1K3OA 3GTUA 2VCQA 2I3YA 3L9UA 2WFCA 3EMXA 1YDKA 1EEMA 2H1GA 2BMXA 2DIZA 2B5EA 3GUSA 4HZ2A 2LJKA 3WGXA 1PKZA 1GULA 2CX3A 3CRTA 1K0BA 2OKAA 3LXZA 1VGLA 4L0UA 1RW1A 2VAFA 3TJKA 5AISA 1SK0A 2WCIA 3BJ5A 2CZ2A 4N30A 1O7UA 5EPFA 3G7JA 5DQYA 2C0FA 3TCOA 1QFNA 4HUAA 5KN3A 4GSTA 1FVJA 1TKDB 2DJJA 4ZL8A 4Q5RA 5J3RA 2FUG2 4N10A 1R7HA 2K6VA 1WE0A 1G0TA 4HU7A 2EIRA 4TR4A 4NAXA 2AAWA 1KTEA 2OBIA 3KGKA 4CDOA 2P0GA 4YAPA 2CT6A 4K7IA 2VO4A 1JHBA 5CRWA 4CHSA 1A2JA 1K0NA 3L4NA 4L5OA 1U3IA 5F8BA 1Z7PA 3US3A 2H0GA 4RUVA 2V6OA 4MJEA 2GSRA 2IJYA 3ZVJD 5J5NA 4TR1A 2L4CA 2YZHA 4GF0A 5INYA 3GKXA 3KD0A 4TRXA 3ME8A 1U6TA 2OADA 1TK0B 1EWXA 3RBTA 2AUVA 3WGEA 2WGRA 2XHFA 1TW9A 1WRYA 1VF1A 2AHEA 2XPEA 2PN8A 2BTOT 1SD8A 1XCCA 4WR4A 1GL8A 1DUGA 1LJRA 4XIHA 1FVKA 1LBKA 1AIUA 1O81A 4RQXA 2GDRA 3H93A 4XHMA 1QK8A 2FD3A 5EL8A 1B48A 4LMWA 3FK8A 4IKHA 4FYCA 4YAVA 3TKRA 2CAQA 1ABAA 2JZSA 2ON5A 3F63A 3J7Yk 1XWCA 3HA9A 3UMAA 2GS3A 3AY8A 4WF5A 1A8LA 2IWTA 2XBQA 3ZFLA 3U6VA 1BAYA 1PN9A 4MK3A 3TUEA 4TOPA 3RPNA 3GSTA 2XBIA 4TXOA 3LORA 1ZYEA 3DWVA 2LQOA 1EV4A 10GSA 5DAKA 3MDKA 13GSA 6GSXA 2IIYA 4BWSA 5F06A 5IMZA 2VOCA 3KH9A 1SK1A 2IFQB 4IVFA 3F6FA 2B5YA 2H0HA 2H6XA 5G5FA 3EYTA 1K0OA 1EV9A 4YQUA 2ES7A 1IYIA 2A2RA 2AYTA 1TU8A 14GSA 2I9HA 1X9SB 3N9JA 3CSJA 2C3TA 2HZEB 2PERA 2XPDA 5J9BA 5CREA 4JBBA 1TRUA 1GSQA 3DIEA 3G7IA 5D96A 1J9BA 3HDCA 3LWAA 4ILFA 3ZZXA 1NSWA 4NXIA 2FNOA 2H8LA 5DDLA 4RI7A 4ACSA 3EINA 4O7HA 3GA4A 1HNCA 1O8XA 1XIYA 2MBTA 1QUWA 3VPTA 3VWUA 4IN0A 1XW6A 2FWGA 3BBYA 4OCEA 4F9ZA 1A24A 3KZQA 5L71A 3GNJA 4GSSA 2YZUA 4TKYA 3GH9A 3TRQA 2BJXA 4WBJA 5JWQB 2DSAA 1ERUA 1ZCPA 4OO4A 4ZBBA 4ISDA 4MJBA 2NPBA 4O5RA 1DE2A 3LFLA 3KH7A 4WEYA 1ZYQB 5JCUA 3VFIA 1T4YA 4GLTA 2LKUA 2H74A 2NTOA 3D0ZA 3UARA 1A2LA 2MZCA 3H1NA 2OACA 1TDIA 3FY7A 2R4VA 2FY6A 2DMLA 3IHQA 5HR1A 3O76A 3QAVA 3H4KA 9GSSA 5HR0A 1X9WB 4TR0A 2R2JA 3JCML 3UOMA 2RM5A 2WDUA 1DE1A 5FWGA 4KNDA 1Z3EA 2VCWA 2V1MA 2GLRA 1SYRA 5H5SA 3W8JA 3HD5A 1PX6A 1B8XA 2H73A 5LCZA 4HQSA 1GSFA 2PUKC 3Q18A 4QL9A 1Q4JA 4ZL7A 1ERWA 1V40A 1WOUA 2YV7A 4K8MA 3GFKA 4TR3A 4XRDA 4DSSB 4HEA2 4JR6A 5KN0A 3IK9A 3QD9A 5EVOA 2C8UA 3E0UA 1SL0B 4WKWA 1XPVA 1T7PB 1U3AA 1Z6MA 2HSYA 4IP1A 16GSA 1QMVA 2H30A 1AAZA 2FA4A 4NV5A 3VWVA 2H1AA 3TGZA 1WJKA 1PRXA 1U88A 2KLXA 2HT9A 1XOBA 4I5QA 4X43A 3CTFA 2H75A 2EIOA 2C3QA 4JZQA 3GHAA 1A23A 4ECCA 2IL3A 2DC5A 5C04A 2CZ3A 4K0NA 1EEJA 5ECMB 1R26A 2NBSA 2FWEA 2YWMA 1ILOA 1GLPA 3F0IA 3VPQA 3IRAA 1I9DA 1V98A 1M2AA 4EF0A 1GP1A 5JWRB 2ZCTA 3TJBA 1XW5A 3A5WA 3FZAA 3IE3A 4MF6A 1TRWA 2H6ZA 1FOVA 2V32A 4KDXA 5GAND 4IS0A 1QGVA 2X99A 5JCGA 2C0GA 4EO3A 2M72A 3HJOA 5ECQB 4XS4A 3TKSA 1MDJA 2PU9C 2CVDA 1F37A 2CVKA 4FYBA 2LNTA 1X0RA 4Q5FA 2FLSA 2B6MA 3WGDA 6GSTA 2H1BA 4ZB8A 3D21A 2HRFA 3LQ7A 5IPHA 1PX7A 3HKRA 1Z5YE 3EU3A 5LNKe 3BCKA 5D93A 2B3SA 4HS1A 4DVCA 3UEMA 3J7Yb 2H6YA 3K8NA 1GSUA 4PUAA 2YPMA 3D4TA 1OC3A 3N5OA 1AQVA 2JSZA 3IOSA 3PINA 5FT3A 2D2ZA 2H19A 2X8CA 3I6AA 3A2WA 3HVSA 3IV4A 1E6BA 2C0DA 3M3MA 4GRFA 3VI5A 3LG6A 3DGQA 3QCPA 1UC7A 2YWIA 3KP8A 4QQ7A 4DEJA 1PMTA 4ECJA 5DCGA 3F4SA 5D73A 5LD0A 3QAWA 1JZOA 2EC4A 1SKWB 2KP1A 2P31A 3D22A 4WXTA 4V1Ag 1GRXA 2VL9A 1MDKA 3IC4A 3FZ9A 1PA3A 1VRSD 5ABRA 2VUPA 3DXBA 5D9VA 5IMFA 1O8WA 2DJKA 4MPFA 1GWCA 1Z6NA 2R37A 5DALB 1TRSA 4IQ1A 2GSTA 5J4UA 4HI7A 2O89A 1AUCA 1S3DA 1SK2A 1OKDA 3LYPA 5G1LA 3ZRDA 3DVXA 2H0IA 3S9FA 4YH2A 1XVWA 3HJPA 3KTLA 2LJAA 1GSDA 3FR3A 5D8IA 5EY6A 2FGXA 3A3TA 5ID2A 1WWJA 1F3AA 1G6YA 3TKPA 3M8NA 1KNGA 4ULXA 4PNFA 2L6DA 2E0QA 4EDZA 1SL2B 1MDIA 4KGIA 4PXOA 2GZYA 2A4VA 5G2ZA 1FAAA 2HSHA 2YP6A 2IMFA 2LQQA 2OE0A 2JZTA 1USBA 5HR2A 1HQOA 3F3RA 3FW2A 2AV4A 5ECSA 1GTBA 2F51A 5B7CA 4LLRA 4ZL9A 4K1FA 1ZZYA 1ON4A 1SL1B 3KP9A 4GXZA 2YANA 3H79A 3DKSA 3U5RE 2GT5A 6GSYA 1WPIA 4PQ1A 2H01A 3KEBA 2HRNA 4N0ZA 2QGVA 2M80A 2ZNMA 2PVOC 2R6KA 2YJHA 1K3YA 3IPZA 3GKKA 4TXVA 3RPPA 3TRXA 4Z7XA 2LEGA 2GQMA 5CP1A 5HQPA 2X64A 2RUEA 3EWLA 1O85A 3UAPA 1YF0A 2L5LA 1EZKA 2YN1A 1CQGA 3HY2A 3HVVA 2KOKA 3APOA 3QPMA 1FB0A 3F3QA 4E8HA 2AJQB 1AXDA 3GX8A 4KSOA 3SBCA 4ZXGA 3ZIVA 5A4WA 3GL3A 1TJDA 3KIJA 1MD4A 3DD3A 5E4WA 4D73B
chains in the Genus database with same CATH superfamily
4PGTA 1DBYA 1EOHA 3L9VA 3QFBC 1M2DA 3C73A 4YQVA 3C1SA 3G7YA 1BG5A 2HRAA 4ZILA 1ZL9A 1URMA 1KEBA 1NM3A 2FCHA 1XZOA 3KM6A 4ID0A 5AIXA 4CY6A 3DYRA 4KDYA 1XVQA 1UN2A 3NIVA 3UIWA 4FH8A 2VCVA 1F3BA 4I97A 5G31A 1GUMA 3BOAA 2C0EA 3LGCA 4PX1A 3F4TA 4E8EA 3IA1A 3HZ8A 3FMWA 3P90A 3FZ4A 4Q5QA 2J23A 2DJ1A 4K7NA 2L59A 2MMAA 4G2EA 3G9BA 3QDNA 1GTUA 1DSBA 2L6CA 2VL3A 5A4VA 2J9HA 4V2NA 4F2IA 1J0FA 1CQHA 1T1VA 2PGTA 4Q5NA 2DJ0A 2N5BA 5IPGA 1G6WA 2JL4A 1MTCA 1FOHA 1OKTA 3VK9A 5IM9A 3HVXA 4HQZA 3ZMLA 4NHWA 2VL2A 2GZZA 1XOAA 4BVYA 3EMPA 1TRVA 4BPYA 12GSA 3VLNA 1VF3A 1EP7A 4HDEA 4KDUA 1OC9B 4L5LA 3GX0A 5D9TA 4GQCA 4K7OA 4ECIA 4BVXB 2OA7A 4N0VA 1R5AA 2VIMA 1TK5B 2X49A 3CTGA 2DJ3A 3GTUB 1ERTA 1JZDA 3GYKA 4BWQA 2EIQA 4USSA 4Z2UA 1VF4A 4J56E 1R4WA 2C4JA 3P2AA 2WS2A 4MP4A 2R0CA 4I8BA 2DIYA 2LRNA 1R5PA 1K0CA 3GKNA 4HOJA 3L9SA 3V1WA 2C80A 5C00A 2H70A 3QOUA 1B4QA 4POLA 2FHEA 3DMLA 2DBCA 3UBLA 3GH6A 2CV4A 5B8BA 1T8EB 4HJMA 2MMNA 5ECRB 1GTIA 5IO2A 4F0BA 4P3YB 2R0PA 5KN1A 3ZYWA 2L5OA 4HU9A 5D9XA 4IP6A 1OYJA 4F0CA 5CAXA 1BEDA 2A2SA 1AW9A 1NW2A 4NHZA 4EVMA 3F8UA 1E2YA 2HI7A 3EC3A 4OMVA 4IW9A 1K0MA 1M99A 3M0FA 1IYHA 5DBQA 4KAEA 3MNGA 4TR1B 2IMKA 2GTUA 5IMAA 4OCFA 5ECLB 1XWKA 4EL1A 1T4ZA 3KXOA 2H71A 1FW1A 5ECKB 20GSA 5DJMA 2IN3A 1MD3A 3GN3A 1PGTA 2LRTA 4XTSA 18GSA 4ML1A 4AF2A 2QSIA 3LYKA 5IMDA 2C1YA 5GSSA 3IDVA 2LS5A 3C8EA 3NZNA 1ACVA 2VCXA 4O5QA 1O6JA 3VI7A 4JE1A 1XWAA 1H75A 8GSSA 1SU9A 1VF2A 3GL5A 3ZTLA 4MA9A 1M9BA 1GUKA 1XFLA 4IBPA 5H5RA 4XS6A 5ECPB 5B6NA 1OC8A 4NWYA 4KW6A 3ZITA 1F9MA 4G10A 2GGTA 2IMEA 3TOUA 6GSVA 1K0DA 1EGOA 3R2QA 4K6XA 1HNBA 4G9HA 1A2MA 4LL4B 1M9AA 4JRRA 1JZWA 2HE3A 3KMOA 4KUNA 4IJIA 1AQWA 2O8VB 1XBSA 2P5RA 4HZ4A 1SKRB 1Y6EA 4X4JA 4TXOB 3FKFA 3BCIA 5ECOB 5DAKB 2WB9A 2A2PA 4EKZA 2V6KA 1GSYA 3IAS2 3KMNA 2WZ9A 3ZLPA 2B7KA 1SJ6A 4IHUA 3TJGA 4KCAA 3QR6A 2GSSA 3M9KA 4MF7A 1GSSA 4POMA 2NDOA 4OFTA 1B9YC 1F2EA 3D6IA 2IFQA 2HYXA 1HD2A 5CNWA 1EOGA 3IR4A 3PGTA 4Z2RA 4K2DA 2PWJA 3VWWA 5JWOB 3TJFA 3RAZA 4CY8A 4PNGA 5GAPD 4MJAA 1X5CA 1OE7A 2LSTA 2HZEA 1M3JA 2UZ8A 1XW9A 3ZIJA 3A5IA 2HSMA 1JFUA 2VM1A 2OJLA 3APQA 3UVHA 4QL7A 3QAGA 3A2XA 2OE3A 5A5KA 2V41A 3TKSC 1JZRA 2RUFA 2LRCA 1ZOFA 1Z7RA 2FA8A 3C71A 3RHBA 1N2AA 1S3CA 2X8HA 2KP2A 5ECIB 4XRAA 1ST9A 1ZYNA 3D4MA 1BYEA 4EIQA 1ZMAA 2VCTA 2B1KA 5COHA 2E2GA 3VWXA 4YQMA 1PL1A 2R3XA 2KUCA 3L0HA 6GSWA 4MPGA 4JR4A 4ZB6A 1U87A 3HCZA 3PH9A 4L8EA 1O73A 4L0WA 1SENA 1WP0A 5DJLA 2CA8A 2N5AA 4NMUA 3IXRA 4HSCX 2FWFA 4V2MA 2JACA 4WF4A 2RLIA 1XXUA 4DSRA 1ERVA 22GSA 3W6GA 3PR8A 4EXJA 1RQMA 4TVEA 4EC0A 3EVIA 2HZFA 5AGYA 2RM6A 2R5GA 3WT1A 3CSHA 1OE8A 4MH3A 1TI1A 2PMTA 5IMVA 4ZB9A 5IIZA 1X5EA 3CRUA 4MZWA 1YY7A 1Y25A 1JLWA 1YEPA 4OO5A 4BL7A 2F8AA 3LSZA 3MWHA 2G0FA 4BIKA 2L4QA 1C72A 3GMFA 3HHVA 3FRCA 3EPTA 2H66A 3E9JB 1YF1A 1ZGNA 5JCWA 4DSSA 5F05A 2ON7A 3F9UA 6GSSA 1M3IA 1JLVA 5A4UA 2HLSA 3A2VA 4AJ8A 3LEFA 2VCZA 3FHKA 7GSSA 1FB6A 3TKSE 2CX4A 2C3NA 5CYYA 2GT6A 4OFMA 2OE1A 2F3MA 2LV3A 4I2UA 2K9FA 3CYNA 3TJJA 4GQFA 3FZ5A 2REMA 4KCEA 1YKCA 3GKMA 2P5QA 1B9XC 3Q6OA 2PPTA 4WETA 3HJMA 5AN1A 2AB6A 3MIXA 1K3LA 5D9WA 4ZBDA 5ECNB 4EUYA 1TXXA 1GH2A 2N5FA 1N8JA 2H76A 1V57A 1TI3A 1M7TA 2Z9SA 3UVTA 4XS4B 3I9V2 3GRXA 4Z2TA 1THXA 2CVBA 3KCMA 1W4VA 5GSTA 4IGJA 3CMIA 4KB3A 5DVBA 2O87A 1J08A 1SKSB 2GZPA 3GV1A 3RHCA 4LL1B 1PFOA 4O32A 1XWGA 1M2BA 4NV2A 4XS1A 3WYWA 5B6MA 1Q98A 2O85A 3FR6A 2PBJA 1F6MC 2L57A 1PL2A 1V2AA 5G30A 2LTKA 1XWBA 1BX9A 1K0AA 1GSEA 1KBNA 1ML6A 5F0GA 4EDYA 1TK8B 4I2TA 4ML6A 5E59A 1OAZA 4PQIA 4KSMA 4JEDA 11GSA 5HR3A 3HYPA 1YKAA 1HYUA 3ZFBA 5AIVA 4WR5A 3L78A 4EE0A 5DQSA 3VURA 2MBSA 5ECHB 3HXSA 3D5JA 2OBKA 1PD21 1A0RP 2HNLA 1I5GA 2YCDA 3MAKA 2YWNA 4LA1A 1UA5A 3UL3A 4IELA 3ED3A 5KN2A 4AGSA 19GSA 3DEXA 1T00A 4MCUA 2IPAA 1EP8A 2GQKA 2F8FA 4MABA 4GTUA 1G7OA 4MDCA 4MF5A 2MMOA 3CSIA 2ZUPA 5H5QA 3E3EA 1YEXA 1UVZA 3ERWA 4OFNA 2K8SA 2QA2A 1PSQA 4RI6A 4NPBA 2HXKA 3LJRA 5J9CA 1X5DA 1MEKA 3LXTA 4LMVA 2O7KA 4AJ6A 2VM2A 2H72A 3WD6A 1LU4A 2ALBA 1YZXA 3UBKA 2JSYA 3HZ4A 4OD7A 3MSZA 4HJ2A 3FR9A 1S3RA 5G1KA 3M9JA 4ZIJA 3IAM2 2XC2A 5DALA 2FWHA 3TRPA 1FG4A 1GNWA 4ECBA 1BJXA 2JU5A 2VD1A 2E2MA 3GURA 4FO5A 2K8VA 4FYUA 5ID2B 2MYGA 3RDWA 5B8AA 2V2GA 1T3BA 5G5EA 3EE2A 3LW9A 2VL2C 3QMXA 4MMMA 4IQAA 3P8WA 1W89A 1B4PA 3P7XA 3CBUA 1YJ6A 4KX4A 5HFKA 2JADA 3TOTA 3DRNA 3C7MA 4MLYA 3O3TA 2QA1A 2DKIA 3WT2A 2KHPA 4XCSA 3IBHA 2VLUA 3IK7A 3O6TA 3F4RA 3ZMKA 3DVWA 3EU4A 4POKA 2GVPA 2IMIA 1AC1A 1FO5A 3UJ1A 1OVNA 2WJUA 3TB2A 3F6DA 4GSNA 4F03A 4K0GA 2VLTA 5BMUA 3ZVJA 2PVQA 1SJIA 1A0FA 4CW9A 5HFIA 5CO3A 3ERGA 3GIXA 2VLVA 4KF9A 4IJ3A 1M0UA 1RK4A 1WMJA 3GSSA 1A8YA 1EGRA 4X1UA 5IOXA 2M46A 2DMMA 2B1LA 3I43A 2B7JA 4JU5A 3Q19A 1YQ1A 4G19A 2E7PA 4ICYA 4MZCA 4TW5A 4ZBAA 5DCHA 5CRGA 4GCIA 2LUSA 3FYGA 2GSQA 1NHOA 5ENUA 1V58A 5ELGA 4PUFC 3C1RA 1TP9A 2H1DA 3ZREA 2B5XA 3EURA 1SYXA 2X8GA 1AQXA 2YJ7A 5ELAA 4MH2A 2RIIA 1SJZA 3TDGA 3TKQA 3QFAC 4AJ7A 2WULA 5IMCA 1PKWA 3CXGA 4F82A 2WRTA 4KA0A 5F07A 4D73A 2YOIA 4POBA 1GUHA 2HRKA 4J57E 1TU7A 4K9ZA 5IQYA 3OR5A 2YWOA 4PURA 2LJRA 4WBRD 1ZYPA 2TRCP 1WIKA 3I69A 3CQFA 1QQ2A 4MJCA 4V2LA 5KEJA 3KJYA 17GSA 2VD0A 3ISOA 2IMDA 5IOWA 5J41A 3Q74A 4GWRA 2K18A 4BA7A 1G7EA 2I81A 2QKEA 4PTSA 1NHYA 3W8SA 4O92A 2MMZA 2HFDA 3H8QA 3ME7A 1S3AA 1THOA 2QC7A 4DSQA 4H86A 5HFGA 2LNSA 4N11A 2TIRA 3APSA 2NVLA 1X9MB 1GTAA 2DLXA 6GSUA 1PQNA 4TN8A 2I4AA 2GQLA 4MZBA 1TTZA 1SD9A 5CRDA 2TRXA 4I6XA 2G2QA 5FHIA 4BVYB 3KTBA 1QXHA 1BQ7A 2CQ9A 1V9WA 2JZRA 3M1GA 1HNAA 2YV9A 5CRHA 4KH7A 2F9SA 3FEUA 4RQRA 1Z9HA 3ERFA 4OWYA 3ZL5A 4J2FA 4V1Ap 1GNEA 1TOFA 1GLQA 1H4OA 4KE3A 1OC9A 2YNXA 3BD2A 5GZZB 4FIWA 4PQHA 2DJ2A 3SWLA 4BVXA 2A4HA 1FHEA 2I1UA 5IO0A 3NOFA 2CAIA 4X0XA 1K3OA 3GTUA 2VCQA 2I3YA 3L9UA 2WFCA 3EMXA 1YDKA 1EEMA 2H1GA 2BMXA 2DIZA 2B5EA 3GUSA 4HZ2A 2LJKA 3WGXA 1PKZA 1GULA 2CX3A 3CRTA 1K0BA 2OKAA 3LXZA 1VGLA 4L0UA 1RW1A 2VAFA 3TJKA 5AISA 1SK0A 2WCIA 3BJ5A 2CZ2A 4N30A 1O7UA 5EPFA 3G7JA 5DQYA 2C0FA 3TCOA 1QFNA 4HUAA 5KN3A 4GSTA 1FVJA 1TKDB 2DJJA 4ZL8A 4Q5RA 5J3RA 2FUG2 4N10A 1R7HA 2K6VA 1WE0A 1G0TA 4HU7A 2EIRA 4TR4A 4NAXA 2AAWA 1KTEA 2OBIA 3KGKA 4CDOA 2P0GA 4YAPA 2CT6A 4K7IA 2VO4A 1JHBA 5CRWA 4CHSA 1A2JA 1K0NA 3L4NA 4L5OA 1U3IA 5F8BA 1Z7PA 3US3A 2H0GA 4RUVA 2V6OA 4MJEA 2GSRA 2IJYA 3ZVJD 5J5NA 4TR1A 4K5SA 2L4CA 2YZHA 4GF0A 5INYA 3GKXA 3KD0A 4TRXA 3ME8A 1U6TA 2OADA 1TK0B 1EWXA 3RBTA 2AUVA 3WGEA 2WGRA 2XHFA 1TW9A 1WRYA 1VF1A 2AHEA 2XPEA 2PN8A 2BTOT 1SD8A 1XCCA 4WR4A 1GL8A 1DUGA 1LJRA 4XIHA 1FVKA 1LBKA 1AIUA 1O81A 4RQXA 2GDRA 3H93A 3R3EA 4XHMA 1QK8A 2FD3A 5EL8A 1B48A 4LMWA 3FK8A 4IKHA 4FYCA 4YAVA 4G0IA 3TKRA 2CAQA 1ABAA 2JZSA 2ON5A 3F63A 3J7Yk 1XWCA 3HA9A 3UMAA 2GS3A 3AY8A 4O5UA 4WF5A 1A8LA 2IWTA 2XBQA 3ZFLA 3U6VA 1BAYA 1PN9A 4MK3A 3TUEA 4TOPA 3RPNA 3GSTA 2XBIA 4TXOA 3LORA 1ZYEA 3DWVA 2LQOA 1EV4A 10GSA 5DAKA 3MDKA 13GSA 6GSXA 2IIYA 2DKHA 4G0KA 4BWSA 5F06A 5IMZA 2VOCA 3KH9A 1SK1A 2IFQB 4IVFA 3F6FA 2B5YA 2H0HA 2H6XA 5G5FA 3EYTA 1K0OA 1EV9A 4YQUA 2ES7A 1IYIA 2A2RA 2AYTA 1TU8A 14GSA 2I9HA 1X9SB 3N9JA 3CSJA 2C3TA 2HZEB 2PERA 2XPDA 5J9BA 5CREA 4JBBA 1TRUA 1GSQA 3DIEA 3G7IA 5D96A 1J9BA 3HDCA 3LWAA 4ILFA 3ZZXA 1NSWA 4NXIA 2FNOA 2H8LA 5DDLA 4RI7A 4ACSA 3EINA 4O7HA 3GA4A 1HNCA 1O8XA 1XIYA 2MBTA 1QUWA 3VPTA 3VWUA 4IN0A 1XW6A 2FWGA 3BBYA 4OCEA 4F9ZA 1A24A 3KZQA 5L71A 3GNJA 4GSSA 2YZUA 4TKYA 3GH9A 3TRQA 2BJXA 4WBJA 5JWQB 2DSAA 1ERUA 1ZCPA 4OO4A 4ZBBA 1PN0A 4ISDA 4MJBA 2NPBA 4O5RA 4YKGA 1DE2A 3LFLA 3KH7A 4WEYA 1ZYQB 5JCUA 3VFIA 1T4YA 1XG8A 3HVNA 4GLTA 2LKUA 2H74A 2NTOA 3D0ZA 3UARA 1A2LA 2MZCA 3H1NA 2OACA 1TDIA 3FY7A 2R4VA 2FY6A 2DMLA 3IHQA 5HR1A 3O76A 3QAVA 4K5RA 3H4KA 9GSSA 5HR0A 3PPUA 1X9WB 4TR0A 2R2JA 3JCML 3UOMA 2RM5A 2WDUA 1DE1A 5FWGA 4KNDA 1Z3EA 2VCWA 2V1MA 2GLRA 1SYRA 5H5SA 3W8JA 4BL7B 3HD5A 1PX6A 1B8XA 2H73A 5LCZA 4HQSA 5KOXA 1GSFA 2PUKC 3Q18A 4QL9A 1Q4JA 4ZL7A 1ERWA 1V40A 1WOUA 2YV7A 4K8MA 3GFKA 4TR3A 4XRDA 4DSSB 4HEA2 4JR6A 5KN0A 3IK9A 3QD9A 5EVOA 2C8UA 3E0UA 1SL0B 4WKWA 1XPVA 1T7PB 1U3AA 1Z6MA 2HSYA 4IP1A 16GSA 1QMVA 2H30A 1AAZA 2FA4A 4NV5A 3VWVA 2H1AA 3TGZA 1WJKA 1PRXA 1U88A 4FQUA 2KLXA 2HT9A 1XOBA 4I5QA 4X43A 3CTFA 2H75A 2EIOA 2C3QA 4JZQA 3GHAA 1A23A 4ECCA 2IL3A 2DC5A 3MYDA 5C04A 2CZ3A 4K0NA 1EEJA 5ECMB 1R26A 2NBSA 2FWEA 2YWMA 1ILOA 1GLPA 3F0IA 3VPQA 3IRAA 1I9DA 1V98A 1M2AA 4EF0A 1GP1A 5JWRB 2ZCTA 3TJBA 1XW5A 2X4AA 3A5WA 3FZAA 3IE3A 4MF6A 1TRWA 2H6ZA 1FOVA 2V32A 4KDXA 5GAND 4IS0A 1QGVA 2X99A 4YKFA 5JCGA 2C0GA 4EO3A 2M72A 3HJOA 5ECQB 4XS4A 3TKSA 1MDJA 2PU9C 2CVDA 1F37A 2CVKA 4FYBA 2LNTA 1X0RA 5KOWA 4Q5FA 2FLSA 2B6MA 3WGDA 6GSTA 4K2XA 2H1BA 4ZB8A 3D21A 2HRFA 3LQ7A 5IPHA 1PX7A 3HKRA 1Z5YE 3EU3A 5LNKe 3BCKA 5D93A 2B3SA 4HS1A 4DVCA 3UEMA 3J7Yb 2H6YA 3K8NA 1GSUA 4PUAA 2YPMA 3D4TA 1OC3A 3N5OA 1AQVA 2JSZA 3IOSA 3PINA 5FT3A 2D2ZA 2H19A 2X8CA 3I6AA 3A2WA 3HVSA 3IV4A 1E6BA 2C0DA 3M3MA 4GRFA 3VI5A 3LG6A 3DGQA 3QCPA 1UC7A 2YWIA 3KP8A 4QQ7A 4DEJA 1PMTA 4ECJA 5DCGA 3F4SA 5D73A 5LD0A 3QAWA 1JZOA 2EC4A 1SKWB 2KP1A 2P31A 3D22A 4WXTA 4V1Ag 1GRXA 2VL9A 1MDKA 3IC4A 3FZ9A 1PA3A 1VRSD 5ABRA 2VUPA 3DXBA 5D9VA 2R0GA 5IMFA 1O8WA 2DJKA 4MPFA 1GWCA 4G0LA 1Z6NA 2R37A 5DALB 1TRSA 4IQ1A 2GSTA 5J4UA 4HI7A 2O89A 1AUCA 1S3DA 1SK2A 1OKDA 3LYPA 5G1LA 3ZRDA 3DVXA 2H0IA 3S9FA 3IC8A 4YH2A 4MNNA 1XVWA 3HJPA 3KTLA 2LJAA 1GSDA 3FR3A 5D8IA 5EY6A 2FGXA 3A3TA 5BRTA 5ID2A 1WWJA 1F3AA 1G6YA 3TKPA 3M8NA 1KNGA 4ULXA 4PNFA 2L6DA 2E0QA 4EDZA 1SL2B 1MDIA 4KGIA 4PXOA 2GZYA 2A4VA 5G2ZA 1FAAA 2HSHA 3IHGA 2YP6A 2IMFA 2LQQA 2OE0A 2JZTA 1USBA 5HR2A 1HQOA 3F3RA 3FW2A 2AV4A 5ECSA 1GTBA 2F51A 5B7CA 4LLRA 4ZL9A 4K1FA 1ZZYA 1ON4A 1SL1B 3KP9A 4GXZA 4A5PA 2YANA 3H79A 3DKSA 3U5RE 2GT5A 6GSYA 1WPIA 4PQ1A 2H01A 3KEBA 2HRNA 4N0ZA 2QGVA 2M80A 2ZNMA 2PVOC 2R6KA 2YJHA 1K3YA 3IPZA 3GKKA 4TXVA 3RPPA 3TRXA 4Z7XA 2LEGA 2GQMA 5CP1A 5HQPA 2X64A 2RUEA 3EWLA 1O85A 3UAPA 1YF0A 2L5LA 1EZKA 2YN1A 1CQGA 3HY2A 3HVVA 2KOKA 3APOA 3QPMA 1FB0A 3F3QA 4E8HA 2AJQB 1AXDA 3GX8A 4KSOA 3SBCA 4ZXGA 3ZIVA 4EIPA 5A4WA 3GL3A 1TJDA 3KIJA 1MD4A 3DD3A 5E4WA 4D73B
chains in the Genus database with same CATH topology
4PGTA 1DBYA 1EOHA 3L9VA 3QFBC 1M2DA 3C73A 4YQVA 3C1SA 3G7YA 1BG5A 2HRAA 4ZILA 1ZL9A 1URMA 1KEBA 1NM3A 2FCHA 1XZOA 3KM6A 4ID0A 5AIXA 4CY6A 3DYRA 4KDYA 1XVQA 1UN2A 3NIVA 3UIWA 4FH8A 2VCVA 1F3BA 4I97A 5G31A 1GUMA 3BOAA 2C0EA 3LGCA 4PX1A 3F4TA 4E8EA 3IA1A 3HZ8A 3FMWA 3P90A 3FZ4A 4Q5QA 2J23A 2DJ1A 4K7NA 2L59A 2MMAA 4G2EA 3G9BA 3QDNA 1GTUA 1DSBA 2L6CA 2VL3A 5A4VA 2J9HA 4V2NA 4F2IA 1J0FA 1CQHA 1T1VA 2PGTA 4Q5NA 2DJ0A 2N5BA 5IPGA 1G6WA 2JL4A 1MTCA 1FOHA 1OKTA 3VK9A 5IM9A 3HVXA 4HQZA 3ZMLA 4NHWA 2VL2A 2GZZA 1XOAA 4BVYA 3EMPA 1TRVA 4BPYA 12GSA 3VLNA 1VF3A 1EP7A 4HDEA 4KDUA 1OC9B 4L5LA 3GX0A 5D9TA 4GQCA 4K7OA 4ECIA 4BVXB 2OA7A 4N0VA 1R5AA 2VIMA 1TK5B 2X49A 3CTGA 2DJ3A 3GTUB 1ERTA 1JZDA 3GYKA 4BWQA 2EIQA 4USSA 4Z2UA 1VF4A 4J56E 1R4WA 2C4JA 3P2AA 2WS2A 4MP4A 2R0CA 4I8BA 2DIYA 2LRNA 1R5PA 1K0CA 3GKNA 4HOJA 3L9SA 3V1WA 2C80A 5C00A 2H70A 3QOUA 1B4QA 4POLA 2FHEA 3DMLA 2DBCA 3UBLA 3GH6A 2CV4A 5B8BA 1T8EB 4HJMA 2MMNA 5ECRB 1GTIA 5IO2A 4F0BA 4P3YB 2R0PA 5KN1A 3ZYWA 2L5OA 4HU9A 5D9XA 4IP6A 1OYJA 4F0CA 5CAXA 1BEDA 2A2SA 1AW9A 1NW2A 4NHZA 4EVMA 3F8UA 1E2YA 2HI7A 3EC3A 4OMVA 4IW9A 1K0MA 1M99A 3M0FA 1IYHA 5DBQA 4KAEA 3MNGA 4TR1B 2IMKA 2GTUA 5IMAA 4OCFA 5ECLB 1XWKA 4EL1A 1T4ZA 3KXOA 2H71A 1FW1A 5ECKB 20GSA 5DJMA 2IN3A 1MD3A 3GN3A 1PGTA 2LRTA 4XTSA 18GSA 4ML1A 4AF2A 2QSIA 3LYKA 5IMDA 2C1YA 5GSSA 3IDVA 2LS5A 3C8EA 3NZNA 1ACVA 2VCXA 4O5QA 1O6JA 3VI7A 4JE1A 1XWAA 1H75A 8GSSA 1SU9A 1VF2A 3GL5A 3ZTLA 4MA9A 1M9BA 1GUKA 1XFLA 4IBPA 5H5RA 4XS6A 5ECPB 5B6NA 1OC8A 4NWYA 4KW6A 3ZITA 1F9MA 4G10A 2GGTA 2IMEA 3TOUA 6GSVA 1K0DA 1EGOA 3R2QA 4K6XA 1HNBA 4G9HA 1A2MA 4LL4B 1M9AA 4JRRA 1JZWA 2HE3A 3KMOA 4KUNA 4IJIA 1AQWA 2O8VB 1XBSA 2P5RA 4HZ4A 1SKRB 1Y6EA 4X4JA 4TXOB 3FKFA 3BCIA 5ECOB 5DAKB 2WB9A 2A2PA 4EKZA 2V6KA 1GSYA 3IAS2 3KMNA 2WZ9A 3ZLPA 2B7KA 1SJ6A 4IHUA 3TJGA 4KCAA 3QR6A 2GSSA 3M9KA 4MF7A 1GSSA 4POMA 2NDOA 4OFTA 1B9YC 1F2EA 3D6IA 2IFQA 2HYXA 1HD2A 5CNWA 1EOGA 3IR4A 3PGTA 4Z2RA 4K2DA 2PWJA 3VWWA 5JWOB 3TJFA 3RAZA 4CY8A 4PNGA 5GAPD 4MJAA 1X5CA 1OE7A 2LSTA 2HZEA 2UZ8A 1XW9A 3ZIJA 3A5IA 2HSMA 1JFUA 2VM1A 2OJLA 3APQA 3UVHA 4QL7A 3QAGA 3A2XA 2OE3A 5A5KA 2V41A 3TKSC 1JZRA 2RUFA 2LRCA 1ZOFA 1Z7RA 2FA8A 3C71A 3RHBA 1N2AA 1S3CA 2X8HA 2KP2A 5ECIB 4XRAA 1ST9A 1ZYNA 3D4MA 1BYEA 4EIQA 1ZMAA 2VCTA 2B1KA 5COHA 2E2GA 3VWXA 4YQMA 1PL1A 2R3XA 2KUCA 3L0HA 6GSWA 4MPGA 4JR4A 4ZB6A 1U87A 3HCZA 3PH9A 4L8EA 1O73A 4L0WA 1SENA 1WP0A 5DJLA 2CA8A 2N5AA 4NMUA 3IXRA 2FWFA 4V2MA 2JACA 4WF4A 2RLIA 1XXUA 4DSRA 1ERVA 22GSA 3W6GA 3PR8A 4EXJA 1RQMA 4TVEA 4EC0A 3EVIA 2HZFA 5AGYA 2RM6A 2R5GA 3WT1A 3CSHA 1OE8A 4MH3A 1TI1A 2PMTA 5IMVA 4ZB9A 5IIZA 1X5EA 3CRUA 4MZWA 1YY7A 1Y25A 1JLWA 1YEPA 4OO5A 4BL7A 2F8AA 3LSZA 3MWHA 2G0FA 2L4QA 1C72A 3GMFA 3HHVA 3FRCA 3EPTA 2H66A 3E9JB 1YF1A 1ZGNA 5JCWA 4DSSA 5F05A 2ON7A 3F9UA 6GSSA 5A4UA 1JLVA 2HLSA 3A2VA 4AJ8A 3LEFA 2VCZA 3FHKA 7GSSA 1FB6A 3TKSE 2CX4A 2C3NA 5CYYA 2GT6A 4OFMA 2OE1A 2F3MA 2LV3A 4I2UA 2K9FA 3CYNA 3TJJA 4GQFA 3FZ5A 2REMA 4KCEA 1YKCA 3GKMA 2P5QA 1B9XC 3Q6OA 2PPTA 4WETA 3HJMA 5AN1A 2AB6A 3MIXA 1K3LA 5D9WA 4ZBDA 5ECNB 4EUYA 1TXXA 1GH2A 2N5FA 1N8JA 2H76A 1V57A 1TI3A 1M7TA 2Z9SA 3UVTA 4XS4B 3I9V2 3GRXA 4Z2TA 1THXA 2CVBA 3KCMA 1W4VA 5GSTA 4IGJA 3CMIA 4KB3A 5DVBA 2O87A 1J08A 1SKSB 2GZPA 3GV1A 3RHCA 4LL1B 4O32A 1XWGA 1M2BA 4NV2A 4XS1A 3WYWA 5B6MA 1Q98A 2O85A 3FR6A 2PBJA 1F6MC 2L57A 1PL2A 1V2AA 5G30A 2LTKA 1XWBA 1BX9A 1K0AA 1GSEA 1KBNA 1ML6A 5F0GA 4EDYA 1TK8B 4I2TA 4ML6A 5E59A 1OAZA 4PQIA 4KSMA 4JEDA 11GSA 5HR3A 3HYPA 1YKAA 1HYUA 3ZFBA 5AIVA 4WR5A 3L78A 4EE0A 5DQSA 3VURA 2MBSA 5ECHB 3HXSA 3D5JA 2OBKA 1PD21 1A0RP 2HNLA 1I5GA 2YCDA 3MAKA 2YWNA 4LA1A 1UA5A 3UL3A 4IELA 3ED3A 5KN2A 4AGSA 19GSA 3DEXA 1T00A 4MCUA 2IPAA 1EP8A 2GQKA 2F8FA 4MABA 4GTUA 1G7OA 4MDCA 4MF5A 2MMOA 3CSIA 2ZUPA 5H5QA 3E3EA 1YEXA 1UVZA 3ERWA 4OFNA 2K8SA 2QA2A 1PSQA 4RI6A 4NPBA 2HXKA 3LJRA 5J9CA 1X5DA 1MEKA 3LXTA 4LMVA 2O7KA 4AJ6A 2VM2A 2H72A 3WD6A 1LU4A 2ALBA 1YZXA 3UBKA 2JSYA 3HZ4A 4OD7A 3MSZA 4HJ2A 3FR9A 5G1KA 3M9JA 4ZIJA 3IAM2 2XC2A 5DALA 2FWHA 3TRPA 1FG4A 1GNWA 4ECBA 1BJXA 2JU5A 2VD1A 2E2MA 3GURA 4FO5A 2K8VA 4FYUA 5ID2B 2MYGA 3RDWA 5B8AA 2V2GA 1T3BA 5G5EA 3EE2A 3LW9A 2VL2C 3QMXA 4MMMA 4IQAA 3P8WA 1W89A 1B4PA 3P7XA 3CBUA 1YJ6A 4KX4A 5HFKA 2JADA 3TOTA 3DRNA 3C7MA 4MLYA 3O3TA 2QA1A 2DKIA 3WT2A 2KHPA 4XCSA 3IBHA 2VLUA 3IK7A 3O6TA 3F4RA 3ZMKA 3DVWA 3EU4A 4POKA 2GVPA 2IMIA 1AC1A 1FO5A 3UJ1A 1OVNA 2WJUA 3TB2A 3F6DA 4GSNA 4F03A 4K0GA 2VLTA 5BMUA 3ZVJA 2PVQA 1SJIA 1A0FA 4CW9A 5HFIA 5CO3A 3ERGA 3GIXA 2VLVA 4KF9A 4IJ3A 1M0UA 1RK4A 1WMJA 3GSSA 1A8YA 1EGRA 4X1UA 5IOXA 2M46A 2DMMA 2B1LA 3I43A 2B7JA 4JU5A 3Q19A 1YQ1A 4G19A 2E7PA 4ICYA 4MZCA 4TW5A 4ZBAA 5DCHA 5CRGA 4GCIA 2LUSA 3FYGA 2GSQA 1NHOA 5ENUA 1V58A 5ELGA 4PUFC 3C1RA 1TP9A 2H1DA 3ZREA 2B5XA 3EURA 1SYXA 2X8GA 1AQXA 2YJ7A 5ELAA 4MH2A 2RIIA 1SJZA 3TDGA 3TKQA 3QFAC 4AJ7A 2WULA 5IMCA 1PKWA 3CXGA 4F82A 2WRTA 4KA0A 5F07A 4D73A 2YOIA 4POBA 1GUHA 2HRKA 4J57E 1TU7A 4K9ZA 5IQYA 3OR5A 2YWOA 4PURA 2LJRA 4WBRD 1ZYPA 2TRCP 1WIKA 3I69A 1QQ2A 4MJCA 4V2LA 5KEJA 3KJYA 17GSA 2VD0A 3ISOA 2IMDA 5IOWA 5J41A 3Q74A 4GWRA 2K18A 4BA7A 1G7EA 2I81A 2QKEA 4PTSA 1NHYA 3W8SA 4O92A 2MMZA 2HFDA 3H8QA 3ME7A 1S3AA 1THOA 2QC7A 4DSQA 4H86A 5HFGA 2LNSA 4N11A 2TIRA 3APSA 2NVLA 1X9MB 1GTAA 2DLXA 6GSUA 1PQNA 4TN8A 2I4AA 2GQLA 4MZBA 1TTZA 1SD9A 5CRDA 2TRXA 4I6XA 2G2QA 5FHIA 4BVYB 3KTBA 1QXHA 1BQ7A 2CQ9A 1V9WA 2JZRA 3M1GA 1HNAA 2YV9A 5CRHA 4KH7A 2F9SA 3FEUA 4RQRA 1Z9HA 3ERFA 4OWYA 3ZL5A 4J2FA 4V1Ap 1GNEA 1TOFA 1GLQA 1H4OA 4KE3A 1OC9A 2YNXA 3BD2A 5GZZB 4FIWA 4PQHA 2DJ2A 3SWLA 4BVXA 2A4HA 1FHEA 2I1UA 5IO0A 3NOFA 2CAIA 4X0XA 1K3OA 3GTUA 2VCQA 2I3YA 3L9UA 2WFCA 3EMXA 1YDKA 1EEMA 2H1GA 2BMXA 2DIZA 2B5EA 3GUSA 4HZ2A 2LJKA 3WGXA 1PKZA 1GULA 2CX3A 3CRTA 1K0BA 2OKAA 3LXZA 1VGLA 4L0UA 1RW1A 2VAFA 3TJKA 5AISA 1SK0A 2WCIA 3BJ5A 2CZ2A 4N30A 1O7UA 5EPFA 3G7JA 5DQYA 2C0FA 3TCOA 1QFNA 4HUAA 5KN3A 4GSTA 1FVJA 1TKDB 2DJJA 4ZL8A 4Q5RA 5J3RA 2FUG2 4N10A 1R7HA 2K6VA 1WE0A 1G0TA 4HU7A 2EIRA 4TR4A 4NAXA 2AAWA 1KTEA 2OBIA 3KGKA 4CDOA 2P0GA 4YAPA 2CT6A 4K7IA 2VO4A 1JHBA 5CRWA 4CHSA 1A2JA 1K0NA 3L4NA 4L5OA 1U3IA 5F8BA 1Z7PA 3US3A 2H0GA 4RUVA 2V6OA 4MJEA 2GSRA 2IJYA 3ZVJD 5J5NA 4TR1A 4K5SA 2L4CA 2YZHA 4GF0A 5INYA 3GKXA 3KD0A 4TRXA 3ME8A 1U6TA 2OADA 1TK0B 1EWXA 3RBTA 2AUVA 3WGEA 2WGRA 2XHFA 1TW9A 1WRYA 1VF1A 2AHEA 2XPEA 2PN8A 2BTOT 1SD8A 1XCCA 4WR4A 1GL8A 1DUGA 1LJRA 4XIHA 1FVKA 1LBKA 1AIUA 1O81A 4RQXA 2GDRA 3H93A 3R3EA 4XHMA 1QK8A 2FD3A 5EL8A 1B48A 4LMWA 3FK8A 4IKHA 4FYCA 4YAVA 4G0IA 3TKRA 2CAQA 1ABAA 2JZSA 2ON5A 3F63A 3J7Yk 1XWCA 3HA9A 3UMAA 2GS3A 3AY8A 4O5UA 4WF5A 1A8LA 2IWTA 2XBQA 3ZFLA 3U6VA 1BAYA 1PN9A 4MK3A 3TUEA 4TOPA 3RPNA 3GSTA 2XBIA 4TXOA 3LORA 1ZYEA 3DWVA 2LQOA 1EV4A 10GSA 5DAKA 3MDKA 13GSA 6GSXA 2IIYA 2DKHA 4G0KA 4BWSA 5F06A 5IMZA 2VOCA 3KH9A 1SK1A 2IFQB 4IVFA 3F6FA 2B5YA 2H0HA 2H6XA 5G5FA 3EYTA 1K0OA 1EV9A 4YQUA 2ES7A 1IYIA 2A2RA 2AYTA 1TU8A 14GSA 2I9HA 1X9SB 3N9JA 3CSJA 2C3TA 2HZEB 2PERA 2XPDA 5J9BA 5CREA 4JBBA 1TRUA 1GSQA 3DIEA 3G7IA 5D96A 1J9BA 3HDCA 3LWAA 4ILFA 3ZZXA 1NSWA 4NXIA 2FNOA 2H8LA 5DDLA 4RI7A 4ACSA 3EINA 4O7HA 3GA4A 1HNCA 1O8XA 1XIYA 2MBTA 1QUWA 3VPTA 3VWUA 4IN0A 1XW6A 2FWGA 3BBYA 4OCEA 4F9ZA 1A24A 3KZQA 5L71A 3GNJA 4GSSA 2YZUA 4TKYA 3GH9A 3TRQA 2BJXA 4WBJA 5JWQB 2DSAA 1ERUA 1ZCPA 4OO4A 4ZBBA 1PN0A 4ISDA 4MJBA 2NPBA 4O5RA 4YKGA 1DE2A 3LFLA 3KH7A 4WEYA 1ZYQB 5JCUA 3VFIA 1T4YA 4GLTA 2LKUA 2H74A 2NTOA 3D0ZA 3UARA 1A2LA 2MZCA 3H1NA 2OACA 1TDIA 3FY7A 2R4VA 2FY6A 2DMLA 3IHQA 5HR1A 3O76A 3QAVA 4K5RA 3H4KA 9GSSA 5HR0A 3PPUA 1X9WB 4TR0A 2R2JA 3JCML 3UOMA 2RM5A 2WDUA 1DE1A 5FWGA 4KNDA 1Z3EA 2VCWA 2V1MA 2GLRA 1SYRA 5H5SA 3W8JA 4BL7B 3HD5A 1PX6A 1B8XA 2H73A 5LCZA 4HQSA 5KOXA 1GSFA 2PUKC 3Q18A 4QL9A 1Q4JA 4ZL7A 1ERWA 1V40A 1WOUA 2YV7A 4K8MA 3GFKA 4TR3A 4XRDA 4DSSB 4HEA2 4JR6A 5KN0A 3IK9A 3QD9A 5EVOA 2C8UA 3E0UA 1SL0B 4WKWA 1XPVA 1T7PB 1U3AA 1Z6MA 2HSYA 4IP1A 16GSA 1QMVA 2H30A 1AAZA 2FA4A 4NV5A 3VWVA 2H1AA 3TGZA 1WJKA 1PRXA 1U88A 4FQUA 2KLXA 2HT9A 1XOBA 4I5QA 4X43A 3CTFA 2H75A 2EIOA 2C3QA 4JZQA 3GHAA 1A23A 4ECCA 2IL3A 2DC5A 3MYDA 5C04A 2CZ3A 4K0NA 1EEJA 5ECMB 1R26A 2NBSA 2FWEA 2YWMA 1ILOA 1GLPA 3F0IA 3VPQA 3IRAA 1I9DA 1V98A 1M2AA 4EF0A 1GP1A 5JWRB 2ZCTA 3TJBA 1XW5A 2X4AA 3A5WA 3FZAA 3IE3A 4MF6A 1TRWA 2H6ZA 1FOVA 2V32A 4KDXA 5GAND 4IS0A 1QGVA 2X99A 4YKFA 5JCGA 2C0GA 4EO3A 2M72A 3HJOA 5ECQB 4XS4A 3TKSA 1MDJA 2PU9C 2CVDA 1F37A 2CVKA 4FYBA 2LNTA 1X0RA 5KOWA 4Q5FA 2FLSA 2B6MA 3WGDA 6GSTA 4K2XA 2H1BA 4ZB8A 3D21A 2HRFA 3LQ7A 5IPHA 1PX7A 3HKRA 1Z5YE 3EU3A 5LNKe 3BCKA 5D93A 2B3SA 4HS1A 4DVCA 3UEMA 3J7Yb 2H6YA 3K8NA 1GSUA 4PUAA 2YPMA 3D4TA 1OC3A 3N5OA 1AQVA 2JSZA 3IOSA 3PINA 5FT3A 2D2ZA 2H19A 2X8CA 3I6AA 3A2WA 3HVSA 3IV4A 1E6BA 2C0DA 3M3MA 4GRFA 3VI5A 3LG6A 3DGQA 3QCPA 1UC7A 2YWIA 3KP8A 4QQ7A 4DEJA 1PMTA 4ECJA 5DCGA 3F4SA 5D73A 5LD0A 3QAWA 1JZOA 2EC4A 1SKWB 2KP1A 2P31A 3D22A 4WXTA 4V1Ag 1GRXA 2VL9A 1MDKA 3IC4A 3FZ9A 1PA3A 1VRSD 5ABRA 2VUPA 3DXBA 5D9VA 2R0GA 5IMFA 1O8WA 2DJKA 4MPFA 1GWCA 4G0LA 1Z6NA 2R37A 5DALB 1TRSA 4IQ1A 2GSTA 5J4UA 4HI7A 2O89A 1AUCA 1S3DA 1SK2A 1OKDA 3LYPA 5G1LA 3ZRDA 3DVXA 2H0IA 3S9FA 3IC8A 4YH2A 4MNNA 1XVWA 3HJPA 3KTLA 2LJAA 1GSDA 3FR3A 5D8IA 5EY6A 2FGXA 3A3TA 5BRTA 5ID2A 1WWJA 1F3AA 1G6YA 3TKPA 3M8NA 1KNGA 4ULXA 4PNFA 2L6DA 2E0QA 4EDZA 1SL2B 1MDIA 4KGIA 4PXOA 2GZYA 2A4VA 5G2ZA 1FAAA 2HSHA 3IHGA 2YP6A 2IMFA 2LQQA 2OE0A 2JZTA 1USBA 5HR2A 1HQOA 3F3RA 3FW2A 2AV4A 5ECSA 1GTBA 2F51A 5B7CA 4LLRA 4ZL9A 4K1FA 1ZZYA 1ON4A 1SL1B 3KP9A 4GXZA 4A5PA 2YANA 3H79A 3DKSA 3U5RE 2GT5A 6GSYA 1WPIA 4PQ1A 2H01A 3KEBA 2HRNA 4N0ZA 2QGVA 2M80A 2ZNMA 2PVOC 2R6KA 2YJHA 1K3YA 3IPZA 3GKKA 4TXVA 3RPPA 3TRXA 4Z7XA 2LEGA 2GQMA 5CP1A 5HQPA 2X64A 2RUEA 3EWLA 1O85A 3UAPA 1YF0A 2L5LA 1EZKA 2YN1A 1CQGA 3HY2A 3HVVA 2KOKA 3APOA 3QPMA 1FB0A 3F3QA 4E8HA 2AJQB 1AXDA 3GX8A 4KSOA 3SBCA 4ZXGA 3ZIVA 4EIPA 5A4WA 3GL3A 1TJDA 3KIJA 1MD4A 3DD3A 5E4WA 4D73B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PGT A;  1DBY A;  1EOH A;  3L9V A;  3QFB C;  1M2D A;  3C73 A;  4YQV A;  3C1S A;  3G7Y A;  1BG5 A;  4ZIL A;  1ZL9 A;  1URM A;  1KEB A;  1NM3 A;  2FCH A;  1XZO A;  3KM6 A;  4ID0 A;  5AIX A;  3DYR A;  4KDY A;  1XVQ A;  1UN2 A;  3NIV A;  3UIW A;  4FH8 A;  2VCV A;  1F3B A;  4I97 A;  5G31 A;  1GUM A;  3BOA A;  2C0E A;  3LGC A;  4PX1 A;  3F4T A;  4E8E A;  3IA1 A;  3HZ8 A;  3P90 A;  3FZ4 A;  4Q5Q A;  2J23 A;  2DJ1 A;  4K7N A;  2L59 A;  2MMA A;  4G2E A;  3G9B A;  3QDN A;  1GTU A;  1DSB A;  2L6C A;  2VL3 A;  5A4V A;  2J9H A;  4V2N A;  4F2I A;  1J0F A;  1CQH A;  1T1V A;  2PGT A;  4Q5N A;  2DJ0 A;  2N5B A;  5IPG A;  1G6W A;  2JL4 A;  1MTC A;  3VK9 A;  1OKT A;  5IM9 A;  3HVX A;  4HQZ A;  3ZML A;  4NHW A;  2VL2 A;  2GZZ A;  1XOA A;  4BVY A;  3EMP A;  1TRV A;  4BPY A;  12GS A;  3VLN A;  1VF3 A;  1EP7 A;  4HDE A;  4KDU A;  1OC9 B;  4L5L A;  3GX0 A;  5D9T A;  4GQC A;  4K7O A;  4ECI A;  2OA7 A;  4N0V A;  1R5A A;  2VIM A;  1TK5 B;  3CTG A;  2DJ3 A;  3GTU B;  1ERT A;  1JZD A;  3GYK A;  4BWQ A;  2EIQ A;  1VF4 A;  4J56 E;  1R4W A;  2C4J A;  3P2A A;  2WS2 A;  4MP4 A;  4I8B A;  2DIY A;  2LRN A;  1R5P A;  1K0C A;  3GKN A;  4HOJ A;  3L9S A;  3V1W A;  2C80 A;  5C00 A;  2H70 A;  3QOU A;  1B4Q A;  4POL A;  2FHE A;  3DML A;  2DBC A;  3UBL A;  3GH6 A;  2CV4 A;  5B8B A;  1T8E B;  4HJM A;  2MMN A;  5ECR B;  1GTI A;  5IO2 A;  4F0B A;  4P3Y B;  5KN1 A;  3ZYW A;  2L5O A;  4HU9 A;  5D9X A;  4IP6 A;  1OYJ A;  4F0C A;  5CAX A;  1BED A;  2A2S A;  1AW9 A;  1NW2 A;  4NHZ A;  4EVM A;  3F8U A;  1E2Y A;  2HI7 A;  3EC3 A;  4OMV A;  4IW9 A;  1K0M A;  1M99 A;  3M0F A;  1IYH A;  5DBQ A;  4KAE A;  3MNG A;  4TR1 B;  2IMK A;  2GTU A;  5IMA A;  4OCF A;  5ECL B;  1XWK A;  4EL1 A;  1T4Z A;  3KXO A;  2H71 A;  1FW1 A;  5ECK B;  20GS A;  5DJM A;  2IN3 A;  1MD3 A;  3GN3 A;  1PGT A;  2LRT A;  4XTS A;  18GS A;  4ML1 A;  4AF2 A;  2QSI A;  3LYK A;  5IMD A;  2C1Y A;  5GSS A;  3IDV A;  2LS5 A;  3C8E A;  3NZN A;  1ACV A;  2VCX A;  1O6J A;  3VI7 A;  4JE1 A;  1XWA A;  1H75 A;  8GSS A;  1SU9 A;  1VF2 A;  3GL5 A;  3ZTL A;  4MA9 A;  1M9B A;  1GUK A;  1XFL A;  4IBP A;  5H5R A;  4XS6 A;  5ECP B;  5B6N A;  1OC8 A;  4NWY A;  4KW6 A;  3ZIT A;  1F9M A;  4G10 A;  2GGT A;  2IME A;  3TOU A;  6GSV A;  1K0D A;  1EGO A;  3R2Q A;  4K6X A;  1HNB A;  4G9H A;  1A2M A;  4LL4 B;  1M9A A;  4JRR A;  1JZW A;  2HE3 A;  3KMO A;  4KUN A;  4IJI A;  1AQW A;  2O8V B;  1XBS A;  2P5R A;  4HZ4 A;  1SKR B;  1Y6E A;  4TXO B;  3FKF A;  3BCI A;  5ECO B;  5DAK B;  2WB9 A;  4EKZ A;  2V6K A;  1GSY A;  3IAS 2;  3KMN A;  2WZ9 A;  3ZLP A;  2B7K A;  1SJ6 A;  4IHU A;  3TJG A;  4KCA A;  3QR6 A;  2GSS A;  3M9K A;  4MF7 A;  1GSS A;  4POM A;  2NDO A;  4OFT A;  1B9Y C;  1F2E A;  3D6I A;  2IFQ A;  2HYX A;  1HD2 A;  5CNW A;  1EOG A;  3IR4 A;  3PGT A;  4K2D A;  2PWJ A;  3VWW A;  5JWO B;  3TJF A;  3RAZ A;  4PNG A;  5GAP D;  4MJA A;  1X5C A;  1OE7 A;  2LST A;  2HZE A;  1XW9 A;  3ZIJ A;  1JFU A;  2VM1 A;  2OJL A;  3APQ A;  3UVH A;  4QL7 A;  3QAG A;  3A2X A;  2OE3 A;  5A5K A;  2V41 A;  3TKS C;  1JZR A;  2RUF A;  2LRC A;  1ZOF A;  1Z7R A;  2FA8 A;  3C71 A;  3RHB A;  1N2A A;  1S3C A;  2X8H A;  2KP2 A;  5ECI B;  4XRA A;  1ST9 A;  3D4M A;  1BYE A;  1ZMA A;  2VCT A;  2B1K A;  5COH A;  2E2G A;  3VWX A;  4YQM A;  1PL1 A;  2R3X A;  2KUC A;  3L0H A;  6GSW A;  4MPG A;  4JR4 A;  4ZB6 A;  1U87 A;  3HCZ A;  3PH9 A;  4L8E A;  1O73 A;  4L0W A;  1SEN A;  1WP0 A;  5DJL A;  2CA8 A;  2N5A A;  4NMU A;  3IXR A;  2FWF A;  4V2M A;  2JAC A;  4WF4 A;  2RLI A;  1XXU A;  4DSR A;  1ERV A;  22GS A;  3W6G A;  3PR8 A;  4EXJ A;  1RQM A;  4TVE A;  4EC0 A;  3EVI A;  2HZF A;  5AGY A;  2RM6 A;  2R5G A;  3WT1 A;  3CSH A;  1OE8 A;  4MH3 A;  1TI1 A;  2PMT A;  5IMV A;  4ZB9 A;  5IIZ A;  1X5E A;  3CRU A;  4MZW A;  1YY7 A;  1Y25 A;  1JLW A;  1YEP A;  4OO5 A;  4BL7 A;  2F8A A;  3LSZ A;  3MWH A;  2G0F A;  2L4Q A;  1C72 A;  3GMF A;  3HHV A;  3FRC A;  2H66 A;  3E9J B;  1YF1 A;  1ZGN A;  5JCW A;  4DSS A;  5F05 A;  2ON7 A;  3F9U A;  6GSS A;  5A4U A;  1JLV A;  2HLS A;  3A2V A;  4AJ8 A;  3LEF A;  2VCZ A;  3FHK A;  7GSS A;  1FB6 A;  3TKS E;  2CX4 A;  2C3N A;  5CYY A;  2GT6 A;  4OFM A;  2OE1 A;  2F3M A;  2LV3 A;  4I2U A;  2K9F A;  3CYN A;  3TJJ A;  4GQF A;  3FZ5 A;  2REM A;  4KCE A;  1YKC A;  3GKM A;  2P5Q A;  1B9X C;  3Q6O A;  2PPT A;  4WET A;  3HJM A;  5AN1 A;  2AB6 A;  1K3L A;  5D9W A;  4ZBD A;  5ECN B;  4EUY A;  1TXX A;  1GH2 A;  2N5F A;  1N8J A;  2H76 A;  1V57 A;  1TI3 A;  1M7T A;  2Z9S A;  3UVT A;  4XS4 B;  3I9V 2;  3GRX A;  1THX A;  2CVB A;  3KCM A;  1W4V A;  5GST A;  4IGJ A;  3CMI A;  4KB3 A;  5DVB A;  2O87 A;  1J08 A;  1SKS B;  2GZP A;  3GV1 A;  3RHC A;  4LL1 B;  4O32 A;  1XWG A;  1M2B A;  4NV2 A;  4XS1 A;  3WYW A;  5B6M A;  1Q98 A;  2O85 A;  3FR6 A;  2PBJ A;  1F6M C;  2L57 A;  1PL2 A;  1V2A A;  5G30 A;  2LTK A;  1XWB A;  1BX9 A;  1K0A A;  1GSE A;  1KBN A;  1ML6 A;  5F0G A;  4EDY A;  1TK8 B;  4I2T A;  4ML6 A;  5E59 A;  1OAZ A;  4PQI A;  4KSM A;  4JED A;  11GS A;  5HR3 A;  3HYP A;  1YKA A;  1HYU A;  3ZFB A;  5AIV A;  4WR5 A;  3L78 A;  4EE0 A;  5DQS A;  3VUR A;  2MBS A;  5ECH B;  3HXS A;  3D5J A;  2OBK A;  1PD2 1;  1A0R P;  2HNL A;  1I5G A;  2YCD A;  3MAK A;  2YWN A;  4LA1 A;  1UA5 A;  3UL3 A;  4IEL A;  3ED3 A;  5KN2 A;  4AGS A;  19GS A;  3DEX A;  1T00 A;  4MCU A;  2IPA A;  1EP8 A;  2GQK A;  2F8F A;  4MAB A;  4GTU A;  1G7O A;  4MDC A;  4MF5 A;  2MMO A;  3CSI A;  2ZUP A;  5H5Q A;  3E3E A;  1YEX A;  1UVZ A;  3ERW A;  4OFN A;  2K8S A;  1PSQ A;  4RI6 A;  4NPB A;  2HXK A;  3LJR A;  5J9C A;  1X5D A;  1MEK A;  3LXT A;  4LMV A;  2O7K A;  4AJ6 A;  2VM2 A;  2H72 A;  3WD6 A;  1LU4 A;  2ALB A;  1YZX A;  3UBK A;  2JSY A;  3HZ4 A;  4OD7 A;  3MSZ A;  4HJ2 A;  3FR9 A;  5G1K A;  3M9J A;  4ZIJ A;  3IAM 2;  2XC2 A;  5DAL A;  2FWH A;  3TRP A;  1FG4 A;  1GNW A;  4ECB A;  1BJX A;  2JU5 A;  2VD1 A;  2E2M A;  3GUR A;  4FO5 A;  2K8V A;  4FYU A;  5ID2 B;  2MYG A;  3RDW A;  5B8A A;  2V2G A;  1T3B A;  5G5E A;  3EE2 A;  3QMX A;  2VL2 C;  4MMM A;  4IQA A;  3P8W A;  1W89 A;  1B4P A;  3P7X A;  3CBU A;  1YJ6 A;  4KX4 A;  5HFK A;  2JAD A;  3TOT A;  3DRN A;  3C7M A;  4MLY A;  3O3T A;  3WT2 A;  2KHP A;  4XCS A;  3IBH A;  2VLU A;  3IK7 A;  3O6T A;  3F4R A;  3ZMK A;  3DVW A;  3EU4 A;  4POK A;  2GVP A;  2IMI A;  1AC1 A;  1FO5 A;  3UJ1 A;  1OVN A;  2WJU A;  3TB2 A;  3F6D A;  4GSN A;  4F03 A;  4K0G A;  2VLT A;  3ZVJ A;  2PVQ A;  1SJI A;  1A0F A;  4CW9 A;  5HFI A;  5CO3 A;  3ERG A;  3GIX A;  2VLV A;  4IJ3 A;  1M0U A;  1RK4 A;  1WMJ A;  3GSS A;  1A8Y A;  1EGR A;  4X1U A;  5IOX A;  2M46 A;  2DMM A;  2B1L A;  3I43 A;  2B7J A;  4JU5 A;  3Q19 A;  1YQ1 A;  4G19 A;  2E7P A;  4MZC A;  4TW5 A;  4ZBA A;  5DCH A;  5CRG A;  4GCI A;  2LUS A;  3FYG A;  2GSQ A;  1NHO A;  5ENU A;  1V58 A;  5ELG A;  4PUF C;  3C1R A;  1TP9 A;  2H1D A;  3ZRE A;  2B5X A;  3EUR A;  1SYX A;  2X8G A;  1AQX A;  2YJ7 A;  5ELA A;  4MH2 A;  2RII A;  1SJZ A;  3TDG A;  3TKQ A;  3QFA C;  4AJ7 A;  2WUL A;  5IMC A;  1PKW A;  3CXG A;  4F82 A;  2WRT A;  4KA0 A;  5F07 A;  4D73 A;  2YOI A;  4POB A;  1GUH A;  4J57 E;  1TU7 A;  4K9Z A;  5IQY A;  3OR5 A;  2YWO A;  4PUR A;  2LJR A;  4WBR D;  2TRC P;  1WIK A;  3I69 A;  1QQ2 A;  4MJC A;  4V2L A;  5KEJ A;  3KJY A;  17GS A;  2VD0 A;  3ISO A;  2IMD A;  5IOW A;  5J41 A;  3Q74 A;  4GWR A;  2K18 A;  4BA7 A;  1G7E A;  2I81 A;  2QKE A;  1NHY A;  3W8S A;  4O92 A;  2MMZ A;  2HFD A;  3H8Q A;  3ME7 A;  1S3A A;  1THO A;  2QC7 A;  4DSQ A;  4H86 A;  5HFG A;  2LNS A;  4N11 A;  2TIR A;  3APS A;  2NVL A;  1X9M B;  1GTA A;  2DLX A;  6GSU A;  1PQN A;  4TN8 A;  2I4A A;  2GQL A;  4MZB A;  1TTZ A;  1SD9 A;  5CRD A;  2TRX A;  4I6X A;  2G2Q A;  5FHI A;  3KTB A;  1QXH A;  1BQ7 A;  2CQ9 A;  1V9W A;  2JZR A;  3M1G A;  1HNA A;  2YV9 A;  5CRH A;  4KH7 A;  2F9S A;  3FEU A;  4RQR A;  1Z9H A;  3ERF A;  4OWY A;  3ZL5 A;  4J2F A;  4V1A p;  1GNE A;  1TOF A;  1GLQ A;  1H4O A;  4KE3 A;  1OC9 A;  2YNX A;  3BD2 A;  5GZZ B;  4FIW A;  4PQH A;  2DJ2 A;  3SWL A;  4BVX A;  1FHE A;  2I1U A;  5IO0 A;  3NOF A;  2CAI A;  4X0X A;  1K3O A;  3GTU A;  2VCQ A;  2I3Y A;  3L9U A;  2WFC A;  3EMX A;  1YDK A;  1EEM A;  2H1G A;  2BMX A;  2DIZ A;  2B5E A;  3GUS A;  4HZ2 A;  2LJK A;  3WGX A;  1PKZ A;  1GUL A;  2CX3 A;  3CRT A;  1K0B A;  2OKA A;  3LXZ A;  1VGL A;  4L0U A;  1RW1 A;  2VAF A;  3TJK A;  5AIS A;  1SK0 A;  2WCI A;  3BJ5 A;  2CZ2 A;  4N30 A;  1O7U A;  5EPF A;  3G7J A;  5DQY A;  2C0F A;  3TCO A;  1QFN A;  4HUA A;  5KN3 A;  4GST A;  1FVJ A;  1TKD B;  2DJJ A;  4ZL8 A;  4Q5R A;  5J3R A;  2FUG 2;  4N10 A;  1R7H A;  2K6V A;  1WE0 A;  1G0T A;  4HU7 A;  2EIR A;  4TR4 A;  4NAX A;  2AAW A;  1KTE A;  2OBI A;  3KGK A;  4CDO A;  2P0G A;  4YAP A;  2CT6 A;  4K7I A;  2VO4 A;  1JHB A;  5CRW A;  4CHS A;  1A2J A;  1K0N A;  3L4N A;  4L5O A;  1U3I A;  5F8B A;  1Z7P A;  3US3 A;  2H0G A;  4RUV A;  2V6O A;  4MJE A;  2GSR A;  2IJY A;  3ZVJ D;  5J5N A;  4TR1 A;  2L4C A;  2YZH A;  4GF0 A;  5INY A;  3GKX A;  3KD0 A;  4TRX A;  3ME8 A;  1U6T A;  2OAD A;  1TK0 B;  1EWX A;  3RBT A;  2AUV A;  3WGE A;  2WGR A;  2XHF A;  1TW9 A;  1WRY A;  1VF1 A;  2AHE A;  2XPE A;  2PN8 A;  2BTO T;  1SD8 A;  1XCC A;  4WR4 A;  1GL8 A;  1DUG A;  1LJR A;  4XIH A;  1FVK A;  1LBK A;  1AIU A;  1O81 A;  4RQX A;  2GDR A;  3H93 A;  4XHM A;  1QK8 A;  2FD3 A;  5EL8 A;  1B48 A;  4LMW A;  3FK8 A;  4IKH A;  4FYC A;  4YAV A;  3TKR A;  2CAQ A;  1ABA A;  2JZS A;  2ON5 A;  3F63 A;  3J7Y k;  1XWC A;  3HA9 A;  3UMA A;  2GS3 A;  3AY8 A;  4WF5 A;  1A8L A;  2IWT A;  2XBQ A;  3ZFL A;  3U6V A;  1BAY A;  1PN9 A;  4MK3 A;  3TUE A;  4TOP A;  3RPN A;  3GST A;  2XBI A;  4TXO A;  3LOR A;  1ZYE A;  3DWV A;  2LQO A;  1EV4 A;  10GS A;  5DAK A;  3MDK A;  13GS A;  6GSX A;  2IIY A;  4BWS A;  5F06 A;  5IMZ A;  2VOC A;  3KH9 A;  1SK1 A;  2IFQ B;  4IVF A;  3F6F A;  2B5Y A;  2H0H A;  2H6X A;  5G5F A;  3EYT A;  1K0O A;  1EV9 A;  4YQU A;  2ES7 A;  1IYI A;  2A2R A;  2AYT A;  1TU8 A;  14GS A;  2I9H A;  1X9S B;  3N9J A;  3CSJ A;  2C3T A;  2HZE B;  2PER A;  2XPD A;  5J9B A;  5CRE A;  4JBB A;  1TRU A;  1GSQ A;  3DIE A;  3G7I A;  5D96 A;  1J9B A;  3HDC A;  3LWA A;  4ILF A;  3ZZX A;  1NSW A;  4NXI A;  2FNO A;  2H8L A;  5DDL A;  4RI7 A;  4ACS A;  3EIN A;  4O7H A;  3GA4 A;  1HNC A;  1O8X A;  1XIY A;  2MBT A;  1QUW A;  3VPT A;  3VWU A;  4IN0 A;  1XW6 A;  2FWG A;  3BBY A;  4OCE A;  4F9Z A;  1A24 A;  3KZQ A;  5L71 A;  3GNJ A;  4GSS A;  2YZU A;  4TKY A;  3GH9 A;  3TRQ A;  2BJX A;  4WBJ A;  5JWQ B;  2DSA A;  1ERU A;  1ZCP A;  4OO4 A;  4ZBB A;  4ISD A;  4MJB A;  2NPB A;  4O5R A;  1DE2 A;  3LFL A;  3KH7 A;  4WEY A;  1ZYQ B;  5JCU A;  3VFI A;  1T4Y A;  4GLT A;  2LKU A;  2H74 A;  2NTO A;  3D0Z A;  3UAR A;  1A2L A;  2MZC A;  3H1N A;  2OAC A;  1TDI A;  3FY7 A;  2R4V A;  2FY6 A;  2DML A;  3IHQ A;  5HR1 A;  3O76 A;  3QAV A;  3H4K A;  9GSS A;  5HR0 A;  1X9W B;  4TR0 A;  2R2J A;  3JCM L;  3UOM A;  2RM5 A;  2WDU A;  1DE1 A;  5FWG A;  4KND A;  1Z3E A;  2VCW A;  2V1M A;  2GLR A;  1SYR A;  5H5S A;  3W8J A;  3HD5 A;  1PX6 A;  1B8X A;  2H73 A;  5LCZ A;  4HQS A;  1GSF A;  2PUK C;  3Q18 A;  4QL9 A;  1Q4J A;  4ZL7 A;  1ERW A;  1V40 A;  1WOU A;  2YV7 A;  4K8M A;  3GFK A;  4TR3 A;  4XRD A;  4DSS B;  4HEA 2;  4JR6 A;  5KN0 A;  3IK9 A;  3QD9 A;  5EVO A;  2C8U A;  3E0U A;  1SL0 B;  4WKW A;  1XPV A;  1T7P B;  1U3A A;  1Z6M A;  2HSY A;  4IP1 A;  16GS A;  1QMV A;  2H30 A;  1AAZ A;  2FA4 A;  4NV5 A;  3VWV A;  2H1A A;  3TGZ A;  1WJK A;  1PRX A;  1U88 A;  2KLX A;  2HT9 A;  1XOB A;  4I5Q A;  4X43 A;  3CTF A;  2H75 A;  2EIO A;  2C3Q A;  4JZQ A;  3GHA A;  1A23 A;  4ECC A;  2IL3 A;  2DC5 A;  5C04 A;  2CZ3 A;  4K0N A;  1EEJ A;  5ECM B;  1R26 A;  2NBS A;  2FWE A;  2YWM A;  1ILO A;  1GLP A;  3F0I A;  3VPQ A;  3IRA A;  1I9D A;  1V98 A;  1M2A A;  4EF0 A;  1GP1 A;  5JWR B;  2ZCT A;  3TJB A;  1XW5 A;  3A5W A;  3FZA A;  3IE3 A;  4MF6 A;  1TRW A;  2H6Z A;  1FOV A;  2V32 A;  4KDX A;  5GAN D;  4IS0 A;  1QGV A;  2X99 A;  5JCG A;  2C0G A;  4EO3 A;  2M72 A;  3HJO A;  5ECQ B;  4XS4 A;  3TKS A;  1MDJ A;  2PU9 C;  2CVD A;  1F37 A;  2CVK A;  4FYB A;  2LNT A;  1X0R A;  4Q5F A;  2FLS A;  2B6M A;  3WGD A;  6GST A;  2H1B A;  4ZB8 A;  3D21 A;  2HRF A;  3LQ7 A;  5IPH A;  1PX7 A;  3HKR A;  1Z5Y E;  3EU3 A;  5LNK e;  3BCK A;  5D93 A;  2B3S A;  4HS1 A;  4DVC A;  3UEM A;  3J7Y b;  2H6Y A;  3K8N A;  1GSU A;  4PUA A;  2YPM A;  3D4T A;  1OC3 A;  3N5O A;  1AQV A;  2JSZ A;  3IOS A;  3PIN A;  5FT3 A;  2D2Z A;  2H19 A;  2X8C A;  3I6A A;  3A2W A;  3HVS A;  3IV4 A;  1E6B A;  2C0D A;  3M3M A;  4GRF A;  3VI5 A;  3LG6 A;  3DGQ A;  3QCP A;  1UC7 A;  2YWI A;  3KP8 A;  4QQ7 A;  4DEJ A;  1PMT A;  4ECJ A;  5DCG A;  3F4S A;  5D73 A;  5LD0 A;  3QAW A;  1JZO A;  2EC4 A;  1SKW B;  2KP1 A;  2P31 A;  3D22 A;  4WXT A;  4V1A g;  1GRX A;  2VL9 A;  1MDK A;  3IC4 A;  3FZ9 A;  1PA3 A;  1VRS D;  5ABR A;  2VUP A;  3DXB A;  5D9V A;  5IMF A;  1O8W A;  2DJK A;  4MPF A;  1GWC A;  1Z6N A;  2R37 A;  5DAL B;  1TRS A;  4IQ1 A;  2GST A;  5J4U A;  4HI7 A;  2O89 A;  1AUC A;  1S3D A;  1SK2 A;  1OKD A;  3LYP A;  5G1L A;  3ZRD A;  3DVX A;  2H0I A;  3S9F A;  4YH2 A;  1XVW A;  3HJP A;  3KTL A;  2LJA A;  1GSD A;  3FR3 A;  5D8I A;  5EY6 A;  2FGX A;  3A3T A;  5ID2 A;  1WWJ A;  1F3A A;  1G6Y A;  3TKP A;  3M8N A;  1KNG A;  4ULX A;  4PNF A;  2L6D A;  2E0Q A;  4EDZ A;  1SL2 B;  1MDI A;  4KGI A;  4PXO A;  2GZY A;  2A4V A;  5G2Z A;  1FAA A;  2HSH A;  2YP6 A;  2IMF A;  2LQQ A;  2OE0 A;  2JZT A;  1USB A;  5HR2 A;  1HQO A;  3F3R A;  3FW2 A;  2AV4 A;  5ECS A;  1GTB A;  2F51 A;  5B7C A;  4LLR A;  4ZL9 A;  4K1F A;  1ZZY A;  1ON4 A;  1SL1 B;  3KP9 A;  4GXZ A;  2YAN A;  3H79 A;  3DKS A;  3U5R E;  2GT5 A;  6GSY A;  1WPI A;  4PQ1 A;  2H01 A;  3KEB A;  2HRN A;  4N0Z A;  2QGV A;  2M80 A;  2ZNM A;  2PVO C;  2R6K A;  2YJH A;  1K3Y A;  3IPZ A;  3GKK A;  4TXV A;  3RPP A;  3TRX A;  4Z7X A;  2LEG A;  2GQM A;  5CP1 A;  5HQP A;  2X64 A;  2RUE A;  3EWL A;  1O85 A;  3UAP A;  1YF0 A;  2L5L A;  1EZK A;  2YN1 A;  1CQG A;  3HY2 A;  3HVV A;  2KOK A;  3APO A;  3QPM A;  1FB0 A;  3F3Q A;  4E8H A;  2AJQ B;  1AXD A;  3GX8 A;  4KSO A;  3SBC A;  4ZXG A;  3ZIV A;  5A4W A;  3GL3 A;  1TJD A;  3KIJ A;  1MD4 A;  3DD3 A;  5E4W A;  4D73 B; 
#chains in the Genus database with same CATH topology
 4PGT A;  1DBY A;  1EOH A;  3L9V A;  3QFB C;  1M2D A;  3C73 A;  4YQV A;  3C1S A;  3G7Y A;  1BG5 A;  2HRA A;  4ZIL A;  1ZL9 A;  1URM A;  1KEB A;  1NM3 A;  2FCH A;  1XZO A;  3KM6 A;  4ID0 A;  5AIX A;  4CY6 A;  3DYR A;  4KDY A;  1XVQ A;  1UN2 A;  3NIV A;  3UIW A;  4FH8 A;  2VCV A;  1F3B A;  4I97 A;  5G31 A;  1GUM A;  3BOA A;  2C0E A;  3LGC A;  4PX1 A;  3F4T A;  4E8E A;  3IA1 A;  3HZ8 A;  3FMW A;  3P90 A;  3FZ4 A;  4Q5Q A;  2J23 A;  2DJ1 A;  4K7N A;  2L59 A;  2MMA A;  4G2E A;  3G9B A;  3QDN A;  1GTU A;  1DSB A;  2L6C A;  2VL3 A;  5A4V A;  2J9H A;  4V2N A;  4F2I A;  1J0F A;  1CQH A;  1T1V A;  2PGT A;  4Q5N A;  2DJ0 A;  2N5B A;  5IPG A;  1G6W A;  2JL4 A;  1MTC A;  1FOH A;  1OKT A;  3VK9 A;  5IM9 A;  3HVX A;  4HQZ A;  3ZML A;  4NHW A;  2VL2 A;  2GZZ A;  1XOA A;  4BVY A;  3EMP A;  1TRV A;  4BPY A;  12GS A;  3VLN A;  1VF3 A;  1EP7 A;  4HDE A;  4KDU A;  1OC9 B;  4L5L A;  3GX0 A;  5D9T A;  4GQC A;  4K7O A;  4ECI A;  4BVX B;  2OA7 A;  4N0V A;  1R5A A;  2VIM A;  1TK5 B;  2X49 A;  3CTG A;  2DJ3 A;  3GTU B;  1ERT A;  1JZD A;  3GYK A;  4BWQ A;  2EIQ A;  4USS A;  4Z2U A;  1VF4 A;  4J56 E;  1R4W A;  2C4J A;  3P2A A;  2WS2 A;  4MP4 A;  2R0C A;  4I8B A;  2DIY A;  2LRN A;  1R5P A;  1K0C A;  3GKN A;  4HOJ A;  3L9S A;  3V1W A;  2C80 A;  5C00 A;  2H70 A;  3QOU A;  1B4Q A;  4POL A;  2FHE A;  3DML A;  2DBC A;  3UBL A;  3GH6 A;  2CV4 A;  5B8B A;  1T8E B;  4HJM A;  2MMN A;  5ECR B;  1GTI A;  5IO2 A;  4F0B A;  4P3Y B;  2R0P A;  5KN1 A;  3ZYW A;  2L5O A;  4HU9 A;  5D9X A;  4IP6 A;  1OYJ A;  4F0C A;  5CAX A;  1BED A;  2A2S A;  1AW9 A;  1NW2 A;  4NHZ A;  4EVM A;  3F8U A;  1E2Y A;  2HI7 A;  3EC3 A;  4OMV A;  4IW9 A;  1K0M A;  1M99 A;  3M0F A;  1IYH A;  5DBQ A;  4KAE A;  3MNG A;  4TR1 B;  2IMK A;  2GTU A;  5IMA A;  4OCF A;  5ECL B;  1XWK A;  4EL1 A;  1T4Z A;  3KXO A;  2H71 A;  1FW1 A;  5ECK B;  20GS A;  5DJM A;  2IN3 A;  1MD3 A;  3GN3 A;  1PGT A;  2LRT A;  4XTS A;  18GS A;  4ML1 A;  4AF2 A;  2QSI A;  3LYK A;  5IMD A;  2C1Y A;  5GSS A;  3IDV A;  2LS5 A;  3C8E A;  3NZN A;  1ACV A;  2VCX A;  4O5Q A;  1O6J A;  3VI7 A;  4JE1 A;  1XWA A;  1H75 A;  8GSS A;  1SU9 A;  1VF2 A;  3GL5 A;  3ZTL A;  4MA9 A;  1M9B A;  1GUK A;  1XFL A;  4IBP A;  5H5R A;  4XS6 A;  5ECP B;  5B6N A;  1OC8 A;  4NWY A;  4KW6 A;  3ZIT A;  1F9M A;  4G10 A;  2GGT A;  2IME A;  3TOU A;  6GSV A;  1K0D A;  1EGO A;  3R2Q A;  4K6X A;  1HNB A;  4G9H A;  1A2M A;  4LL4 B;  1M9A A;  4JRR A;  1JZW A;  2HE3 A;  3KMO A;  4KUN A;  4IJI A;  1AQW A;  2O8V B;  1XBS A;  2P5R A;  4HZ4 A;  1SKR B;  1Y6E A;  4X4J A;  4TXO B;  3FKF A;  3BCI A;  5ECO B;  5DAK B;  2WB9 A;  2A2P A;  4EKZ A;  2V6K A;  1GSY A;  3IAS 2;  3KMN A;  2WZ9 A;  3ZLP A;  2B7K A;  1SJ6 A;  4IHU A;  3TJG A;  4KCA A;  3QR6 A;  2GSS A;  3M9K A;  4MF7 A;  1GSS A;  4POM A;  2NDO A;  4OFT A;  1B9Y C;  1F2E A;  3D6I A;  2IFQ A;  2HYX A;  1HD2 A;  5CNW A;  1EOG A;  3IR4 A;  3PGT A;  4Z2R A;  4K2D A;  2PWJ A;  3VWW A;  5JWO B;  3TJF A;  3RAZ A;  4CY8 A;  4PNG A;  5GAP D;  4MJA A;  1X5C A;  1OE7 A;  2LST A;  2HZE A;  1M3J A;  2UZ8 A;  1XW9 A;  3ZIJ A;  3A5I A;  2HSM A;  1JFU A;  2VM1 A;  2OJL A;  3APQ A;  3UVH A;  4QL7 A;  3QAG A;  3A2X A;  2OE3 A;  5A5K A;  2V41 A;  3TKS C;  1JZR A;  2RUF A;  2LRC A;  1ZOF A;  1Z7R A;  2FA8 A;  3C71 A;  3RHB A;  1N2A A;  1S3C A;  2X8H A;  2KP2 A;  5ECI B;  4XRA A;  1ST9 A;  1ZYN A;  3D4M A;  1BYE A;  4EIQ A;  1ZMA A;  2VCT A;  2B1K A;  5COH A;  2E2G A;  3VWX A;  4YQM A;  1PL1 A;  2R3X A;  2KUC A;  3L0H A;  6GSW A;  4MPG A;  4JR4 A;  4ZB6 A;  1U87 A;  3HCZ A;  3PH9 A;  4L8E A;  1O73 A;  4L0W A;  1SEN A;  1WP0 A;  5DJL A;  2CA8 A;  2N5A A;  4NMU A;  3IXR A;  4HSC X;  2FWF A;  4V2M A;  2JAC A;  4WF4 A;  2RLI A;  1XXU A;  4DSR A;  1ERV A;  22GS A;  3W6G A;  3PR8 A;  4EXJ A;  1RQM A;  4TVE A;  4EC0 A;  3EVI A;  2HZF A;  5AGY A;  2RM6 A;  2R5G A;  3WT1 A;  3CSH A;  1OE8 A;  4MH3 A;  1TI1 A;  2PMT A;  5IMV A;  4ZB9 A;  5IIZ A;  1X5E A;  3CRU A;  4MZW A;  1YY7 A;  1Y25 A;  1JLW A;  1YEP A;  4OO5 A;  4BL7 A;  2F8A A;  3LSZ A;  3MWH A;  2G0F A;  4BIK A;  2L4Q A;  1C72 A;  3GMF A;  3HHV A;  3FRC A;  3EPT A;  2H66 A;  3E9J B;  1YF1 A;  1ZGN A;  5JCW A;  4DSS A;  5F05 A;  2ON7 A;  3F9U A;  6GSS A;  1M3I A;  1JLV A;  5A4U A;  2HLS A;  3A2V A;  4AJ8 A;  3LEF A;  2VCZ A;  3FHK A;  7GSS A;  1FB6 A;  3TKS E;  2CX4 A;  2C3N A;  5CYY A;  2GT6 A;  4OFM A;  2OE1 A;  2F3M A;  2LV3 A;  4I2U A;  2K9F A;  3CYN A;  3TJJ A;  4GQF A;  3FZ5 A;  2REM A;  4KCE A;  1YKC A;  3GKM A;  2P5Q A;  1B9X C;  3Q6O A;  2PPT A;  4WET A;  3HJM A;  5AN1 A;  2AB6 A;  3MIX A;  1K3L A;  5D9W A;  4ZBD A;  5ECN B;  4EUY A;  1TXX A;  1GH2 A;  2N5F A;  1N8J A;  2H76 A;  1V57 A;  1TI3 A;  1M7T A;  2Z9S A;  3UVT A;  4XS4 B;  3I9V 2;  3GRX A;  4Z2T A;  1THX A;  2CVB A;  3KCM A;  1W4V A;  5GST A;  4IGJ A;  3CMI A;  4KB3 A;  5DVB A;  2O87 A;  1J08 A;  1SKS B;  2GZP A;  3GV1 A;  3RHC A;  4LL1 B;  1PFO A;  4O32 A;  1XWG A;  1M2B A;  4NV2 A;  4XS1 A;  3WYW A;  5B6M A;  1Q98 A;  2O85 A;  3FR6 A;  2PBJ A;  1F6M C;  2L57 A;  1PL2 A;  1V2A A;  5G30 A;  2LTK A;  1XWB A;  1BX9 A;  1K0A A;  1GSE A;  1KBN A;  1ML6 A;  5F0G A;  4EDY A;  1TK8 B;  4I2T A;  4ML6 A;  5E59 A;  1OAZ A;  4PQI A;  4KSM A;  4JED A;  11GS A;  5HR3 A;  3HYP A;  1YKA A;  1HYU A;  3ZFB A;  5AIV A;  4WR5 A;  3L78 A;  4EE0 A;  5DQS A;  3VUR A;  2MBS A;  5ECH B;  3HXS A;  3D5J A;  2OBK A;  1PD2 1;  1A0R P;  2HNL A;  1I5G A;  2YCD A;  3MAK A;  2YWN A;  4LA1 A;  1UA5 A;  3UL3 A;  4IEL A;  3ED3 A;  5KN2 A;  4AGS A;  19GS A;  3DEX A;  1T00 A;  4MCU A;  2IPA A;  1EP8 A;  2GQK A;  2F8F A;  4MAB A;  4GTU A;  1G7O A;  4MDC A;  4MF5 A;  2MMO A;  3CSI A;  2ZUP A;  5H5Q A;  3E3E A;  1YEX A;  1UVZ A;  3ERW A;  4OFN A;  2K8S A;  2QA2 A;  1PSQ A;  4RI6 A;  4NPB A;  2HXK A;  3LJR A;  5J9C A;  1X5D A;  1MEK A;  3LXT A;  4LMV A;  2O7K A;  4AJ6 A;  2VM2 A;  2H72 A;  3WD6 A;  1LU4 A;  2ALB A;  1YZX A;  3UBK A;  2JSY A;  3HZ4 A;  4OD7 A;  3MSZ A;  4HJ2 A;  3FR9 A;  1S3R A;  5G1K A;  3M9J A;  4ZIJ A;  3IAM 2;  2XC2 A;  5DAL A;  2FWH A;  3TRP A;  1FG4 A;  1GNW A;  4ECB A;  1BJX A;  2JU5 A;  2VD1 A;  2E2M A;  3GUR A;  4FO5 A;  2K8V A;  4FYU A;  5ID2 B;  2MYG A;  3RDW A;  5B8A A;  2V2G A;  1T3B A;  5G5E A;  3EE2 A;  3LW9 A;  2VL2 C;  3QMX A;  4MMM A;  4IQA A;  3P8W A;  1W89 A;  1B4P A;  3P7X A;  3CBU A;  1YJ6 A;  4KX4 A;  5HFK A;  2JAD A;  3TOT A;  3DRN A;  3C7M A;  4MLY A;  3O3T A;  2QA1 A;  2DKI A;  3WT2 A;  2KHP A;  4XCS A;  3IBH A;  2VLU A;  3IK7 A;  3O6T A;  3F4R A;  3ZMK A;  3DVW A;  3EU4 A;  4POK A;  2GVP A;  2IMI A;  1AC1 A;  1FO5 A;  3UJ1 A;  1OVN A;  2WJU A;  3TB2 A;  3F6D A;  4GSN A;  4F03 A;  4K0G A;  2VLT A;  5BMU A;  3ZVJ A;  2PVQ A;  1SJI A;  1A0F A;  4CW9 A;  5HFI A;  5CO3 A;  3ERG A;  3GIX A;  2VLV A;  4KF9 A;  4IJ3 A;  1M0U A;  1RK4 A;  1WMJ A;  3GSS A;  1A8Y A;  1EGR A;  4X1U A;  5IOX A;  2M46 A;  2DMM A;  2B1L A;  3I43 A;  2B7J A;  4JU5 A;  3Q19 A;  1YQ1 A;  4G19 A;  2E7P A;  4ICY A;  4MZC A;  4TW5 A;  4ZBA A;  5DCH A;  5CRG A;  4GCI A;  2LUS A;  3FYG A;  2GSQ A;  1NHO A;  5ENU A;  1V58 A;  5ELG A;  4PUF C;  3C1R A;  1TP9 A;  2H1D A;  3ZRE A;  2B5X A;  3EUR A;  1SYX A;  2X8G A;  1AQX A;  2YJ7 A;  5ELA A;  4MH2 A;  2RII A;  1SJZ A;  3TDG A;  3TKQ A;  3QFA C;  4AJ7 A;  2WUL A;  5IMC A;  1PKW A;  3CXG A;  4F82 A;  2WRT A;  4KA0 A;  5F07 A;  4D73 A;  2YOI A;  4POB A;  1GUH A;  2HRK A;  4J57 E;  1TU7 A;  4K9Z A;  5IQY A;  3OR5 A;  2YWO A;  4PUR A;  2LJR A;  4WBR D;  1ZYP A;  2TRC P;  1WIK A;  3I69 A;  3CQF A;  1QQ2 A;  4MJC A;  4V2L A;  5KEJ A;  3KJY A;  17GS A;  2VD0 A;  3ISO A;  2IMD A;  5IOW A;  5J41 A;  3Q74 A;  4GWR A;  2K18 A;  4BA7 A;  1G7E A;  2I81 A;  2QKE A;  4PTS A;  1NHY A;  3W8S A;  4O92 A;  2MMZ A;  2HFD A;  3H8Q A;  3ME7 A;  1S3A A;  1THO A;  2QC7 A;  4DSQ A;  4H86 A;  5HFG A;  2LNS A;  4N11 A;  2TIR A;  3APS A;  2NVL A;  1X9M B;  1GTA A;  2DLX A;  6GSU A;  1PQN A;  4TN8 A;  2I4A A;  2GQL A;  4MZB A;  1TTZ A;  1SD9 A;  5CRD A;  2TRX A;  4I6X A;  2G2Q A;  5FHI A;  4BVY B;  3KTB A;  1QXH A;  1BQ7 A;  2CQ9 A;  1V9W A;  2JZR A;  3M1G A;  1HNA A;  2YV9 A;  5CRH A;  4KH7 A;  2F9S A;  3FEU A;  4RQR A;  1Z9H A;  3ERF A;  4OWY A;  3ZL5 A;  4J2F A;  4V1A p;  1GNE A;  1TOF A;  1GLQ A;  1H4O A;  4KE3 A;  1OC9 A;  2YNX A;  3BD2 A;  5GZZ B;  4FIW A;  4PQH A;  2DJ2 A;  3SWL A;  4BVX A;  2A4H A;  1FHE A;  2I1U A;  5IO0 A;  3NOF A;  2CAI A;  4X0X A;  1K3O A;  3GTU A;  2VCQ A;  2I3Y A;  3L9U A;  2WFC A;  3EMX A;  1YDK A;  1EEM A;  2H1G A;  2BMX A;  2DIZ A;  2B5E A;  3GUS A;  4HZ2 A;  2LJK A;  3WGX A;  1PKZ A;  1GUL A;  2CX3 A;  3CRT A;  1K0B A;  2OKA A;  3LXZ A;  1VGL A;  4L0U A;  1RW1 A;  2VAF A;  3TJK A;  5AIS A;  1SK0 A;  2WCI A;  3BJ5 A;  2CZ2 A;  4N30 A;  1O7U A;  5EPF A;  3G7J A;  5DQY A;  2C0F A;  3TCO A;  1QFN A;  4HUA A;  5KN3 A;  4GST A;  1FVJ A;  1TKD B;  2DJJ A;  4ZL8 A;  4Q5R A;  5J3R A;  2FUG 2;  4N10 A;  1R7H A;  2K6V A;  1WE0 A;  1G0T A;  4HU7 A;  2EIR A;  4TR4 A;  4NAX A;  2AAW A;  1KTE A;  2OBI A;  3KGK A;  4CDO A;  2P0G A;  4YAP A;  2CT6 A;  4K7I A;  2VO4 A;  1JHB A;  5CRW A;  4CHS A;  1A2J A;  1K0N A;  3L4N A;  4L5O A;  1U3I A;  5F8B A;  1Z7P A;  3US3 A;  2H0G A;  4RUV A;  2V6O A;  4MJE A;  2GSR A;  2IJY A;  3ZVJ D;  5J5N A;  4TR1 A;  4K5S A;  2L4C A;  2YZH A;  4GF0 A;  5INY A;  3GKX A;  3KD0 A;  4TRX A;  3ME8 A;  1U6T A;  2OAD A;  1TK0 B;  1EWX A;  3RBT A;  2AUV A;  3WGE A;  2WGR A;  2XHF A;  1TW9 A;  1WRY A;  1VF1 A;  2AHE A;  2XPE A;  2PN8 A;  2BTO T;  1SD8 A;  1XCC A;  4WR4 A;  1GL8 A;  1DUG A;  1LJR A;  4XIH A;  1FVK A;  1LBK A;  1AIU A;  1O81 A;  4RQX A;  2GDR A;  3H93 A;  3R3E A;  4XHM A;  1QK8 A;  2FD3 A;  5EL8 A;  1B48 A;  4LMW A;  3FK8 A;  4IKH A;  4FYC A;  4YAV A;  4G0I A;  3TKR A;  2CAQ A;  1ABA A;  2JZS A;  2ON5 A;  3F63 A;  3J7Y k;  1XWC A;  3HA9 A;  3UMA A;  2GS3 A;  3AY8 A;  4O5U A;  4WF5 A;  1A8L A;  2IWT A;  2XBQ A;  3ZFL A;  3U6V A;  1BAY A;  1PN9 A;  4MK3 A;  3TUE A;  4TOP A;  3RPN A;  3GST A;  2XBI A;  4TXO A;  3LOR A;  1ZYE A;  3DWV A;  2LQO A;  1EV4 A;  10GS A;  5DAK A;  3MDK A;  13GS A;  6GSX A;  2IIY A;  2DKH A;  4G0K A;  4BWS A;  5F06 A;  5IMZ A;  2VOC A;  3KH9 A;  1SK1 A;  2IFQ B;  4IVF A;  3F6F A;  2B5Y A;  2H0H A;  2H6X A;  5G5F A;  3EYT A;  1K0O A;  1EV9 A;  4YQU A;  2ES7 A;  1IYI A;  2A2R A;  2AYT A;  1TU8 A;  14GS A;  2I9H A;  1X9S B;  3N9J A;  3CSJ A;  2C3T A;  2HZE B;  2PER A;  2XPD A;  5J9B A;  5CRE A;  4JBB A;  1TRU A;  1GSQ A;  3DIE A;  3G7I A;  5D96 A;  1J9B A;  3HDC A;  3LWA A;  4ILF A;  3ZZX A;  1NSW A;  4NXI A;  2FNO A;  2H8L A;  5DDL A;  4RI7 A;  4ACS A;  3EIN A;  4O7H A;  3GA4 A;  1HNC A;  1O8X A;  1XIY A;  2MBT A;  1QUW A;  3VPT A;  3VWU A;  4IN0 A;  1XW6 A;  2FWG A;  3BBY A;  4OCE A;  4F9Z A;  1A24 A;  3KZQ A;  5L71 A;  3GNJ A;  4GSS A;  2YZU A;  4TKY A;  3GH9 A;  3TRQ A;  2BJX A;  4WBJ A;  5JWQ B;  2DSA A;  1ERU A;  1ZCP A;  4OO4 A;  4ZBB A;  1PN0 A;  4ISD A;  4MJB A;  2NPB A;  4O5R A;  4YKG A;  1DE2 A;  3LFL A;  3KH7 A;  4WEY A;  1ZYQ B;  5JCU A;  3VFI A;  1T4Y A;  1XG8 A;  3HVN A;  4GLT A;  2LKU A;  2H74 A;  2NTO A;  3D0Z A;  3UAR A;  1A2L A;  2MZC A;  3H1N A;  2OAC A;  1TDI A;  3FY7 A;  2R4V A;  2FY6 A;  2DML A;  3IHQ A;  5HR1 A;  3O76 A;  3QAV A;  4K5R A;  3H4K A;  9GSS A;  5HR0 A;  3PPU A;  1X9W B;  4TR0 A;  2R2J A;  3JCM L;  3UOM A;  2RM5 A;  2WDU A;  1DE1 A;  5FWG A;  4KND A;  1Z3E A;  2VCW A;  2V1M A;  2GLR A;  1SYR A;  5H5S A;  3W8J A;  4BL7 B;  3HD5 A;  1PX6 A;  1B8X A;  2H73 A;  5LCZ A;  4HQS A;  5KOX A;  1GSF A;  2PUK C;  3Q18 A;  4QL9 A;  1Q4J A;  4ZL7 A;  1ERW A;  1V40 A;  1WOU A;  2YV7 A;  4K8M A;  3GFK A;  4TR3 A;  4XRD A;  4DSS B;  4HEA 2;  4JR6 A;  5KN0 A;  3IK9 A;  3QD9 A;  5EVO A;  2C8U A;  3E0U A;  1SL0 B;  4WKW A;  1XPV A;  1T7P B;  1U3A A;  1Z6M A;  2HSY A;  4IP1 A;  16GS A;  1QMV A;  2H30 A;  1AAZ A;  2FA4 A;  4NV5 A;  3VWV A;  2H1A A;  3TGZ A;  1WJK A;  1PRX A;  1U88 A;  4FQU A;  2KLX A;  2HT9 A;  1XOB A;  4I5Q A;  4X43 A;  3CTF A;  2H75 A;  2EIO A;  2C3Q A;  4JZQ A;  3GHA A;  1A23 A;  4ECC A;  2IL3 A;  2DC5 A;  3MYD A;  5C04 A;  2CZ3 A;  4K0N A;  1EEJ A;  5ECM B;  1R26 A;  2NBS A;  2FWE A;  2YWM A;  1ILO A;  1GLP A;  3F0I A;  3VPQ A;  3IRA A;  1I9D A;  1V98 A;  1M2A A;  4EF0 A;  1GP1 A;  5JWR B;  2ZCT A;  3TJB A;  1XW5 A;  2X4A A;  3A5W A;  3FZA A;  3IE3 A;  4MF6 A;  1TRW A;  2H6Z A;  1FOV A;  2V32 A;  4KDX A;  5GAN D;  4IS0 A;  1QGV A;  2X99 A;  4YKF A;  5JCG A;  2C0G A;  4EO3 A;  2M72 A;  3HJO A;  5ECQ B;  4XS4 A;  3TKS A;  1MDJ A;  2PU9 C;  2CVD A;  1F37 A;  2CVK A;  4FYB A;  2LNT A;  1X0R A;  5KOW A;  4Q5F A;  2FLS A;  2B6M A;  3WGD A;  6GST A;  4K2X A;  2H1B A;  4ZB8 A;  3D21 A;  2HRF A;  3LQ7 A;  5IPH A;  1PX7 A;  3HKR A;  1Z5Y E;  3EU3 A;  5LNK e;  3BCK A;  5D93 A;  2B3S A;  4HS1 A;  4DVC A;  3UEM A;  3J7Y b;  2H6Y A;  3K8N A;  1GSU A;  4PUA A;  2YPM A;  3D4T A;  1OC3 A;  3N5O A;  1AQV A;  2JSZ A;  3IOS A;  3PIN A;  5FT3 A;  2D2Z A;  2H19 A;  2X8C A;  3I6A A;  3A2W A;  3HVS A;  3IV4 A;  1E6B A;  2C0D A;  3M3M A;  4GRF A;  3VI5 A;  3LG6 A;  3DGQ A;  3QCP A;  1UC7 A;  2YWI A;  3KP8 A;  4QQ7 A;  4DEJ A;  1PMT A;  4ECJ A;  5DCG A;  3F4S A;  5D73 A;  5LD0 A;  3QAW A;  1JZO A;  2EC4 A;  1SKW B;  2KP1 A;  2P31 A;  3D22 A;  4WXT A;  4V1A g;  1GRX A;  2VL9 A;  1MDK A;  3IC4 A;  3FZ9 A;  1PA3 A;  1VRS D;  5ABR A;  2VUP A;  3DXB A;  5D9V A;  2R0G A;  5IMF A;  1O8W A;  2DJK A;  4MPF A;  1GWC A;  4G0L A;  1Z6N A;  2R37 A;  5DAL B;  1TRS A;  4IQ1 A;  2GST A;  5J4U A;  4HI7 A;  2O89 A;  1AUC A;  1S3D A;  1SK2 A;  1OKD A;  3LYP A;  5G1L A;  3ZRD A;  3DVX A;  2H0I A;  3S9F A;  3IC8 A;  4YH2 A;  4MNN A;  1XVW A;  3HJP A;  3KTL A;  2LJA A;  1GSD A;  3FR3 A;  5D8I A;  5EY6 A;  2FGX A;  3A3T A;  5BRT A;  5ID2 A;  1WWJ A;  1F3A A;  1G6Y A;  3TKP A;  3M8N A;  1KNG A;  4ULX A;  4PNF A;  2L6D A;  2E0Q A;  4EDZ A;  1SL2 B;  1MDI A;  4KGI A;  4PXO A;  2GZY A;  2A4V A;  5G2Z A;  1FAA A;  2HSH A;  3IHG A;  2YP6 A;  2IMF A;  2LQQ A;  2OE0 A;  2JZT A;  1USB A;  5HR2 A;  1HQO A;  3F3R A;  3FW2 A;  2AV4 A;  5ECS A;  1GTB A;  2F51 A;  5B7C A;  4LLR A;  4ZL9 A;  4K1F A;  1ZZY A;  1ON4 A;  1SL1 B;  3KP9 A;  4GXZ A;  4A5P A;  2YAN A;  3H79 A;  3DKS A;  3U5R E;  2GT5 A;  6GSY A;  1WPI A;  4PQ1 A;  2H01 A;  3KEB A;  2HRN A;  4N0Z A;  2QGV A;  2M80 A;  2ZNM A;  2PVO C;  2R6K A;  2YJH A;  1K3Y A;  3IPZ A;  3GKK A;  4TXV A;  3RPP A;  3TRX A;  4Z7X A;  2LEG A;  2GQM A;  5CP1 A;  5HQP A;  2X64 A;  2RUE A;  3EWL A;  1O85 A;  3UAP A;  1YF0 A;  2L5L A;  1EZK A;  2YN1 A;  1CQG A;  3HY2 A;  3HVV A;  2KOK A;  3APO A;  3QPM A;  1FB0 A;  3F3Q A;  4E8H A;  2AJQ B;  1AXD A;  3GX8 A;  4KSO A;  3SBC A;  4ZXG A;  3ZIV A;  4EIP A;  5A4W A;  3GL3 A;  1TJD A;  3KIJ A;  1MD4 A;  3DD3 A;  5E4W A;  4D73 B; 
#chains in the Genus database with same CATH homology
 4PGT A;  1DBY A;  1EOH A;  3L9V A;  3QFB C;  1M2D A;  3C73 A;  4YQV A;  3C1S A;  3G7Y A;  1BG5 A;  2HRA A;  4ZIL A;  1ZL9 A;  1URM A;  1KEB A;  1NM3 A;  2FCH A;  1XZO A;  3KM6 A;  4ID0 A;  5AIX A;  4CY6 A;  3DYR A;  4KDY A;  1XVQ A;  1UN2 A;  3NIV A;  3UIW A;  4FH8 A;  2VCV A;  1F3B A;  4I97 A;  5G31 A;  1GUM A;  3BOA A;  2C0E A;  3LGC A;  4PX1 A;  3F4T A;  4E8E A;  3IA1 A;  3HZ8 A;  3FMW A;  3P90 A;  3FZ4 A;  4Q5Q A;  2J23 A;  2DJ1 A;  4K7N A;  2L59 A;  2MMA A;  4G2E A;  3G9B A;  3QDN A;  1GTU A;  1DSB A;  2L6C A;  2VL3 A;  5A4V A;  2J9H A;  4V2N A;  4F2I A;  1J0F A;  1CQH A;  1T1V A;  2PGT A;  4Q5N A;  2DJ0 A;  2N5B A;  5IPG A;  1G6W A;  2JL4 A;  1MTC A;  1FOH A;  1OKT A;  3VK9 A;  5IM9 A;  3HVX A;  4HQZ A;  3ZML A;  4NHW A;  2VL2 A;  2GZZ A;  1XOA A;  4BVY A;  3EMP A;  1TRV A;  4BPY A;  12GS A;  3VLN A;  1VF3 A;  1EP7 A;  4HDE A;  4KDU A;  1OC9 B;  4L5L A;  3GX0 A;  5D9T A;  4GQC A;  4K7O A;  4ECI A;  4BVX B;  2OA7 A;  4N0V A;  1R5A A;  2VIM A;  1TK5 B;  2X49 A;  3CTG A;  2DJ3 A;  3GTU B;  1ERT A;  1JZD A;  3GYK A;  4BWQ A;  2EIQ A;  4USS A;  4Z2U A;  1VF4 A;  4J56 E;  1R4W A;  2C4J A;  3P2A A;  2WS2 A;  4MP4 A;  2R0C A;  4I8B A;  2DIY A;  2LRN A;  1R5P A;  1K0C A;  3GKN A;  4HOJ A;  3L9S A;  3V1W A;  2C80 A;  5C00 A;  2H70 A;  3QOU A;  1B4Q A;  4POL A;  2FHE A;  3DML A;  2DBC A;  3UBL A;  3GH6 A;  2CV4 A;  5B8B A;  1T8E B;  4HJM A;  2MMN A;  5ECR B;  1GTI A;  5IO2 A;  4F0B A;  4P3Y B;  2R0P A;  5KN1 A;  3ZYW A;  2L5O A;  4HU9 A;  5D9X A;  4IP6 A;  1OYJ A;  4F0C A;  5CAX A;  1BED A;  2A2S A;  1AW9 A;  1NW2 A;  4NHZ A;  4EVM A;  3F8U A;  1E2Y A;  2HI7 A;  3EC3 A;  4OMV A;  4IW9 A;  1K0M A;  1M99 A;  3M0F A;  1IYH A;  5DBQ A;  4KAE A;  3MNG A;  4TR1 B;  2IMK A;  2GTU A;  5IMA A;  4OCF A;  5ECL B;  1XWK A;  4EL1 A;  1T4Z A;  3KXO A;  2H71 A;  1FW1 A;  5ECK B;  20GS A;  5DJM A;  2IN3 A;  1MD3 A;  3GN3 A;  1PGT A;  2LRT A;  4XTS A;  18GS A;  4ML1 A;  4AF2 A;  2QSI A;  3LYK A;  5IMD A;  2C1Y A;  5GSS A;  3IDV A;  2LS5 A;  3C8E A;  3NZN A;  1ACV A;  2VCX A;  4O5Q A;  1O6J A;  3VI7 A;  4JE1 A;  1XWA A;  1H75 A;  8GSS A;  1SU9 A;  1VF2 A;  3GL5 A;  3ZTL A;  4MA9 A;  1M9B A;  1GUK A;  1XFL A;  4IBP A;  5H5R A;  4XS6 A;  5ECP B;  5B6N A;  1OC8 A;  4NWY A;  4KW6 A;  3ZIT A;  1F9M A;  4G10 A;  2GGT A;  2IME A;  3TOU A;  6GSV A;  1K0D A;  1EGO A;  3R2Q A;  4K6X A;  1HNB A;  4G9H A;  1A2M A;  4LL4 B;  1M9A A;  4JRR A;  1JZW A;  2HE3 A;  3KMO A;  4KUN A;  4IJI A;  1AQW A;  2O8V B;  1XBS A;  2P5R A;  4HZ4 A;  1SKR B;  1Y6E A;  4X4J A;  4TXO B;  3FKF A;  3BCI A;  5ECO B;  5DAK B;  2WB9 A;  2A2P A;  4EKZ A;  2V6K A;  1GSY A;  3IAS 2;  3KMN A;  2WZ9 A;  3ZLP A;  2B7K A;  1SJ6 A;  4IHU A;  3TJG A;  4KCA A;  3QR6 A;  2GSS A;  3M9K A;  4MF7 A;  1GSS A;  4POM A;  2NDO A;  4OFT A;  1B9Y C;  1F2E A;  3D6I A;  2IFQ A;  2HYX A;  1HD2 A;  5CNW A;  1EOG A;  3IR4 A;  3PGT A;  4Z2R A;  4K2D A;  2PWJ A;  3VWW A;  5JWO B;  3TJF A;  3RAZ A;  4CY8 A;  4PNG A;  5GAP D;  4MJA A;  1X5C A;  1OE7 A;  2LST A;  2HZE A;  2UZ8 A;  1XW9 A;  3ZIJ A;  3A5I A;  2HSM A;  1JFU A;  2VM1 A;  2OJL A;  3APQ A;  3UVH A;  4QL7 A;  3QAG A;  3A2X A;  2OE3 A;  5A5K A;  2V41 A;  3TKS C;  1JZR A;  2RUF A;  2LRC A;  1ZOF A;  1Z7R A;  2FA8 A;  3C71 A;  3RHB A;  1N2A A;  1S3C A;  2X8H A;  2KP2 A;  5ECI B;  4XRA A;  1ST9 A;  1ZYN A;  3D4M A;  1BYE A;  4EIQ A;  1ZMA A;  2VCT A;  2B1K A;  5COH A;  2E2G A;  3VWX A;  4YQM A;  1PL1 A;  2R3X A;  2KUC A;  3L0H A;  6GSW A;  4MPG A;  4JR4 A;  4ZB6 A;  1U87 A;  3HCZ A;  3PH9 A;  4L8E A;  1O73 A;  4L0W A;  1SEN A;  1WP0 A;  5DJL A;  2CA8 A;  2N5A A;  4NMU A;  3IXR A;  2FWF A;  4V2M A;  2JAC A;  4WF4 A;  2RLI A;  1XXU A;  4DSR A;  1ERV A;  22GS A;  3W6G A;  3PR8 A;  4EXJ A;  1RQM A;  4TVE A;  4EC0 A;  3EVI A;  2HZF A;  5AGY A;  2RM6 A;  2R5G A;  3WT1 A;  3CSH A;  1OE8 A;  4MH3 A;  1TI1 A;  2PMT A;  5IMV A;  4ZB9 A;  5IIZ A;  1X5E A;  3CRU A;  4MZW A;  1YY7 A;  1Y25 A;  1JLW A;  1YEP A;  4OO5 A;  4BL7 A;  2F8A A;  3LSZ A;  3MWH A;  2G0F A;  2L4Q A;  1C72 A;  3GMF A;  3HHV A;  3FRC A;  3EPT A;  2H66 A;  3E9J B;  1YF1 A;  1ZGN A;  5JCW A;  4DSS A;  5F05 A;  2ON7 A;  3F9U A;  6GSS A;  5A4U A;  1JLV A;  2HLS A;  3A2V A;  4AJ8 A;  3LEF A;  2VCZ A;  3FHK A;  7GSS A;  1FB6 A;  3TKS E;  2CX4 A;  2C3N A;  5CYY A;  2GT6 A;  4OFM A;  2OE1 A;  2F3M A;  2LV3 A;  4I2U A;  2K9F A;  3CYN A;  3TJJ A;  4GQF A;  3FZ5 A;  2REM A;  4KCE A;  1YKC A;  3GKM A;  2P5Q A;  1B9X C;  3Q6O A;  2PPT A;  4WET A;  3HJM A;  5AN1 A;  2AB6 A;  3MIX A;  1K3L A;  5D9W A;  4ZBD A;  5ECN B;  4EUY A;  1TXX A;  1GH2 A;  2N5F A;  1N8J A;  2H76 A;  1V57 A;  1TI3 A;  1M7T A;  2Z9S A;  3UVT A;  4XS4 B;  3I9V 2;  3GRX A;  4Z2T A;  1THX A;  2CVB A;  3KCM A;  1W4V A;  5GST A;  4IGJ A;  3CMI A;  4KB3 A;  5DVB A;  2O87 A;  1J08 A;  1SKS B;  2GZP A;  3GV1 A;  3RHC A;  4LL1 B;  4O32 A;  1XWG A;  1M2B A;  4NV2 A;  4XS1 A;  3WYW A;  5B6M A;  1Q98 A;  2O85 A;  3FR6 A;  2PBJ A;  1F6M C;  2L57 A;  1PL2 A;  1V2A A;  5G30 A;  2LTK A;  1XWB A;  1BX9 A;  1K0A A;  1GSE A;  1KBN A;  1ML6 A;  5F0G A;  4EDY A;  1TK8 B;  4I2T A;  4ML6 A;  5E59 A;  1OAZ A;  4PQI A;  4KSM A;  4JED A;  11GS A;  5HR3 A;  3HYP A;  1YKA A;  1HYU A;  3ZFB A;  5AIV A;  4WR5 A;  3L78 A;  4EE0 A;  5DQS A;  3VUR A;  2MBS A;  5ECH B;  3HXS A;  3D5J A;  2OBK A;  1PD2 1;  1A0R P;  2HNL A;  1I5G A;  2YCD A;  3MAK A;  2YWN A;  4LA1 A;  1UA5 A;  3UL3 A;  4IEL A;  3ED3 A;  5KN2 A;  4AGS A;  19GS A;  3DEX A;  1T00 A;  4MCU A;  2IPA A;  1EP8 A;  2GQK A;  2F8F A;  4MAB A;  4GTU A;  1G7O A;  4MDC A;  4MF5 A;  2MMO A;  3CSI A;  2ZUP A;  5H5Q A;  3E3E A;  1YEX A;  1UVZ A;  3ERW A;  4OFN A;  2K8S A;  2QA2 A;  1PSQ A;  4RI6 A;  4NPB A;  2HXK A;  3LJR A;  5J9C A;  1X5D A;  1MEK A;  3LXT A;  4LMV A;  2O7K A;  4AJ6 A;  2VM2 A;  2H72 A;  3WD6 A;  1LU4 A;  2ALB A;  1YZX A;  3UBK A;  2JSY A;  3HZ4 A;  4OD7 A;  3MSZ A;  4HJ2 A;  3FR9 A;  5G1K A;  3M9J A;  4ZIJ A;  3IAM 2;  2XC2 A;  5DAL A;  2FWH A;  3TRP A;  1FG4 A;  1GNW A;  4ECB A;  1BJX A;  2JU5 A;  2VD1 A;  2E2M A;  3GUR A;  4FO5 A;  2K8V A;  4FYU A;  5ID2 B;  2MYG A;  3RDW A;  5B8A A;  2V2G A;  1T3B A;  5G5E A;  3EE2 A;  3LW9 A;  2VL2 C;  3QMX A;  4MMM A;  4IQA A;  3P8W A;  1W89 A;  1B4P A;  3P7X A;  3CBU A;  1YJ6 A;  4KX4 A;  5HFK A;  2JAD A;  3TOT A;  3DRN A;  3C7M A;  4MLY A;  3O3T A;  2QA1 A;  2DKI A;  3WT2 A;  2KHP A;  4XCS A;  3IBH A;  2VLU A;  3IK7 A;  3O6T A;  3F4R A;  3ZMK A;  3DVW A;  3EU4 A;  4POK A;  2GVP A;  2IMI A;  1AC1 A;  1FO5 A;  3UJ1 A;  1OVN A;  2WJU A;  3TB2 A;  3F6D A;  4GSN A;  4F03 A;  4K0G A;  2VLT A;  5BMU A;  3ZVJ A;  2PVQ A;  1SJI A;  1A0F A;  4CW9 A;  5HFI A;  5CO3 A;  3ERG A;  3GIX A;  2VLV A;  4KF9 A;  4IJ3 A;  1M0U A;  1RK4 A;  1WMJ A;  3GSS A;  1A8Y A;  1EGR A;  4X1U A;  5IOX A;  2M46 A;  2DMM A;  2B1L A;  3I43 A;  2B7J A;  4JU5 A;  3Q19 A;  1YQ1 A;  4G19 A;  2E7P A;  4ICY A;  4MZC A;  4TW5 A;  4ZBA A;  5DCH A;  5CRG A;  4GCI A;  2LUS A;  3FYG A;  2GSQ A;  1NHO A;  5ENU A;  1V58 A;  5ELG A;  4PUF C;  3C1R A;  1TP9 A;  2H1D A;  3ZRE A;  2B5X A;  3EUR A;  1SYX A;  2X8G A;  1AQX A;  2YJ7 A;  5ELA A;  4MH2 A;  2RII A;  1SJZ A;  3TDG A;  3TKQ A;  3QFA C;  4AJ7 A;  2WUL A;  5IMC A;  1PKW A;  3CXG A;  4F82 A;  2WRT A;  4KA0 A;  5F07 A;  4D73 A;  2YOI A;  4POB A;  1GUH A;  2HRK A;  4J57 E;  1TU7 A;  4K9Z A;  5IQY A;  3OR5 A;  2YWO A;  4PUR A;  2LJR A;  4WBR D;  1ZYP A;  2TRC P;  1WIK A;  3I69 A;  1QQ2 A;  4MJC A;  4V2L A;  5KEJ A;  3KJY A;  17GS A;  2VD0 A;  3ISO A;  2IMD A;  5IOW A;  5J41 A;  3Q74 A;  4GWR A;  2K18 A;  4BA7 A;  1G7E A;  2I81 A;  2QKE A;  4PTS A;  1NHY A;  3W8S A;  4O92 A;  2MMZ A;  2HFD A;  3H8Q A;  3ME7 A;  1S3A A;  1THO A;  2QC7 A;  4DSQ A;  4H86 A;  5HFG A;  2LNS A;  4N11 A;  2TIR A;  3APS A;  2NVL A;  1X9M B;  1GTA A;  2DLX A;  6GSU A;  1PQN A;  4TN8 A;  2I4A A;  2GQL A;  4MZB A;  1TTZ A;  1SD9 A;  5CRD A;  2TRX A;  4I6X A;  2G2Q A;  5FHI A;  4BVY B;  3KTB A;  1QXH A;  1BQ7 A;  2CQ9 A;  1V9W A;  2JZR A;  3M1G A;  1HNA A;  2YV9 A;  5CRH A;  4KH7 A;  2F9S A;  3FEU A;  4RQR A;  1Z9H A;  3ERF A;  4OWY A;  3ZL5 A;  4J2F A;  4V1A p;  1GNE A;  1TOF A;  1GLQ A;  1H4O A;  4KE3 A;  1OC9 A;  2YNX A;  3BD2 A;  5GZZ B;  4FIW A;  4PQH A;  2DJ2 A;  3SWL A;  4BVX A;  2A4H A;  1FHE A;  2I1U A;  5IO0 A;  3NOF A;  2CAI A;  4X0X A;  1K3O A;  3GTU A;  2VCQ A;  2I3Y A;  3L9U A;  2WFC A;  3EMX A;  1YDK A;  1EEM A;  2H1G A;  2BMX A;  2DIZ A;  2B5E A;  3GUS A;  4HZ2 A;  2LJK A;  3WGX A;  1PKZ A;  1GUL A;  2CX3 A;  3CRT A;  1K0B A;  2OKA A;  3LXZ A;  1VGL A;  4L0U A;  1RW1 A;  2VAF A;  3TJK A;  5AIS A;  1SK0 A;  2WCI A;  3BJ5 A;  2CZ2 A;  4N30 A;  1O7U A;  5EPF A;  3G7J A;  5DQY A;  2C0F A;  3TCO A;  1QFN A;  4HUA A;  5KN3 A;  4GST A;  1FVJ A;  1TKD B;  2DJJ A;  4ZL8 A;  4Q5R A;  5J3R A;  2FUG 2;  4N10 A;  1R7H A;  2K6V A;  1WE0 A;  1G0T A;  4HU7 A;  2EIR A;  4TR4 A;  4NAX A;  2AAW A;  1KTE A;  2OBI A;  3KGK A;  4CDO A;  2P0G A;  4YAP A;  2CT6 A;  4K7I A;  2VO4 A;  1JHB A;  5CRW A;  4CHS A;  1A2J A;  1K0N A;  3L4N A;  4L5O A;  1U3I A;  5F8B A;  1Z7P A;  3US3 A;  2H0G A;  4RUV A;  2V6O A;  4MJE A;  2GSR A;  2IJY A;  3ZVJ D;  5J5N A;  4TR1 A;  4K5S A;  2L4C A;  2YZH A;  4GF0 A;  5INY A;  3GKX A;  3KD0 A;  4TRX A;  3ME8 A;  1U6T A;  2OAD A;  1TK0 B;  1EWX A;  3RBT A;  2AUV A;  3WGE A;  2WGR A;  2XHF A;  1TW9 A;  1WRY A;  1VF1 A;  2AHE A;  2XPE A;  2PN8 A;  2BTO T;  1SD8 A;  1XCC A;  4WR4 A;  1GL8 A;  1DUG A;  1LJR A;  4XIH A;  1FVK A;  1LBK A;  1AIU A;  1O81 A;  4RQX A;  2GDR A;  3H93 A;  3R3E A;  4XHM A;  1QK8 A;  2FD3 A;  5EL8 A;  1B48 A;  4LMW A;  3FK8 A;  4IKH A;  4FYC A;  4YAV A;  4G0I A;  3TKR A;  2CAQ A;  1ABA A;  2JZS A;  2ON5 A;  3F63 A;  3J7Y k;  1XWC A;  3HA9 A;  3UMA A;  2GS3 A;  3AY8 A;  4O5U A;  4WF5 A;  1A8L A;  2IWT A;  2XBQ A;  3ZFL A;  3U6V A;  1BAY A;  1PN9 A;  4MK3 A;  3TUE A;  4TOP A;  3RPN A;  3GST A;  2XBI A;  4TXO A;  3LOR A;  1ZYE A;  3DWV A;  2LQO A;  1EV4 A;  10GS A;  5DAK A;  3MDK A;  13GS A;  6GSX A;  2IIY A;  2DKH A;  4G0K A;  4BWS A;  5F06 A;  5IMZ A;  2VOC A;  3KH9 A;  1SK1 A;  2IFQ B;  4IVF A;  3F6F A;  2B5Y A;  2H0H A;  2H6X A;  5G5F A;  3EYT A;  1K0O A;  1EV9 A;  4YQU A;  2ES7 A;  1IYI A;  2A2R A;  2AYT A;  1TU8 A;  14GS A;  2I9H A;  1X9S B;  3N9J A;  3CSJ A;  2C3T A;  2HZE B;  2PER A;  2XPD A;  5J9B A;  5CRE A;  4JBB A;  1TRU A;  1GSQ A;  3DIE A;  3G7I A;  5D96 A;  1J9B A;  3HDC A;  3LWA A;  4ILF A;  3ZZX A;  1NSW A;  4NXI A;  2FNO A;  2H8L A;  5DDL A;  4RI7 A;  4ACS A;  3EIN A;  4O7H A;  3GA4 A;  1HNC A;  1O8X A;  1XIY A;  2MBT A;  1QUW A;  3VPT A;  3VWU A;  4IN0 A;  1XW6 A;  2FWG A;  3BBY A;  4OCE A;  4F9Z A;  1A24 A;  3KZQ A;  5L71 A;  3GNJ A;  4GSS A;  2YZU A;  4TKY A;  3GH9 A;  3TRQ A;  2BJX A;  4WBJ A;  5JWQ B;  2DSA A;  1ERU A;  1ZCP A;  4OO4 A;  4ZBB A;  1PN0 A;  4ISD A;  4MJB A;  2NPB A;  4O5R A;  4YKG A;  1DE2 A;  3LFL A;  3KH7 A;  4WEY A;  1ZYQ B;  5JCU A;  3VFI A;  1T4Y A;  4GLT A;  2LKU A;  2H74 A;  2NTO A;  3D0Z A;  3UAR A;  1A2L A;  2MZC A;  3H1N A;  2OAC A;  1TDI A;  3FY7 A;  2R4V A;  2FY6 A;  2DML A;  3IHQ A;  5HR1 A;  3O76 A;  3QAV A;  4K5R A;  3H4K A;  9GSS A;  5HR0 A;  3PPU A;  1X9W B;  4TR0 A;  2R2J A;  3JCM L;  3UOM A;  2RM5 A;  2WDU A;  1DE1 A;  5FWG A;  4KND A;  1Z3E A;  2VCW A;  2V1M A;  2GLR A;  1SYR A;  5H5S A;  3W8J A;  4BL7 B;  3HD5 A;  1PX6 A;  1B8X A;  2H73 A;  5LCZ A;  4HQS A;  5KOX A;  1GSF A;  2PUK C;  3Q18 A;  4QL9 A;  1Q4J A;  4ZL7 A;  1ERW A;  1V40 A;  1WOU A;  2YV7 A;  4K8M A;  3GFK A;  4TR3 A;  4XRD A;  4DSS B;  4HEA 2;  4JR6 A;  5KN0 A;  3IK9 A;  3QD9 A;  5EVO A;  2C8U A;  3E0U A;  1SL0 B;  4WKW A;  1XPV A;  1T7P B;  1U3A A;  1Z6M A;  2HSY A;  4IP1 A;  16GS A;  1QMV A;  2H30 A;  1AAZ A;  2FA4 A;  4NV5 A;  3VWV A;  2H1A A;  3TGZ A;  1WJK A;  1PRX A;  1U88 A;  4FQU A;  2KLX A;  2HT9 A;  1XOB A;  4I5Q A;  4X43 A;  3CTF A;  2H75 A;  2EIO A;  2C3Q A;  4JZQ A;  3GHA A;  1A23 A;  4ECC A;  2IL3 A;  2DC5 A;  3MYD A;  5C04 A;  2CZ3 A;  4K0N A;  1EEJ A;  5ECM B;  1R26 A;  2NBS A;  2FWE A;  2YWM A;  1ILO A;  1GLP A;  3F0I A;  3VPQ A;  3IRA A;  1I9D A;  1V98 A;  1M2A A;  4EF0 A;  1GP1 A;  5JWR B;  2ZCT A;  3TJB A;  1XW5 A;  2X4A A;  3A5W A;  3FZA A;  3IE3 A;  4MF6 A;  1TRW A;  2H6Z A;  1FOV A;  2V32 A;  4KDX A;  5GAN D;  4IS0 A;  1QGV A;  2X99 A;  4YKF A;  5JCG A;  2C0G A;  4EO3 A;  2M72 A;  3HJO A;  5ECQ B;  4XS4 A;  3TKS A;  1MDJ A;  2PU9 C;  2CVD A;  1F37 A;  2CVK A;  4FYB A;  2LNT A;  1X0R A;  5KOW A;  4Q5F A;  2FLS A;  2B6M A;  3WGD A;  6GST A;  4K2X A;  2H1B A;  4ZB8 A;  3D21 A;  2HRF A;  3LQ7 A;  5IPH A;  1PX7 A;  3HKR A;  1Z5Y E;  3EU3 A;  5LNK e;  3BCK A;  5D93 A;  2B3S A;  4HS1 A;  4DVC A;  3UEM A;  3J7Y b;  2H6Y A;  3K8N A;  1GSU A;  4PUA A;  2YPM A;  3D4T A;  1OC3 A;  3N5O A;  1AQV A;  2JSZ A;  3IOS A;  3PIN A;  5FT3 A;  2D2Z A;  2H19 A;  2X8C A;  3I6A A;  3A2W A;  3HVS A;  3IV4 A;  1E6B A;  2C0D A;  3M3M A;  4GRF A;  3VI5 A;  3LG6 A;  3DGQ A;  3QCP A;  1UC7 A;  2YWI A;  3KP8 A;  4QQ7 A;  4DEJ A;  1PMT A;  4ECJ A;  5DCG A;  3F4S A;  5D73 A;  5LD0 A;  3QAW A;  1JZO A;  2EC4 A;  1SKW B;  2KP1 A;  2P31 A;  3D22 A;  4WXT A;  4V1A g;  1GRX A;  2VL9 A;  1MDK A;  3IC4 A;  3FZ9 A;  1PA3 A;  1VRS D;  5ABR A;  2VUP A;  3DXB A;  5D9V A;  2R0G A;  5IMF A;  1O8W A;  2DJK A;  4MPF A;  1GWC A;  4G0L A;  1Z6N A;  2R37 A;  5DAL B;  1TRS A;  4IQ1 A;  2GST A;  5J4U A;  4HI7 A;  2O89 A;  1AUC A;  1S3D A;  1SK2 A;  1OKD A;  3LYP A;  5G1L A;  3ZRD A;  3DVX A;  2H0I A;  3S9F A;  3IC8 A;  4YH2 A;  4MNN A;  1XVW A;  3HJP A;  3KTL A;  2LJA A;  1GSD A;  3FR3 A;  5D8I A;  5EY6 A;  2FGX A;  3A3T A;  5BRT A;  5ID2 A;  1WWJ A;  1F3A A;  1G6Y A;  3TKP A;  3M8N A;  1KNG A;  4ULX A;  4PNF A;  2L6D A;  2E0Q A;  4EDZ A;  1SL2 B;  1MDI A;  4KGI A;  4PXO A;  2GZY A;  2A4V A;  5G2Z A;  1FAA A;  2HSH A;  3IHG A;  2YP6 A;  2IMF A;  2LQQ A;  2OE0 A;  2JZT A;  1USB A;  5HR2 A;  1HQO A;  3F3R A;  3FW2 A;  2AV4 A;  5ECS A;  1GTB A;  2F51 A;  5B7C A;  4LLR A;  4ZL9 A;  4K1F A;  1ZZY A;  1ON4 A;  1SL1 B;  3KP9 A;  4GXZ A;  4A5P A;  2YAN A;  3H79 A;  3DKS A;  3U5R E;  2GT5 A;  6GSY A;  1WPI A;  4PQ1 A;  2H01 A;  3KEB A;  2HRN A;  4N0Z A;  2QGV A;  2M80 A;  2ZNM A;  2PVO C;  2R6K A;  2YJH A;  1K3Y A;  3IPZ A;  3GKK A;  4TXV A;  3RPP A;  3TRX A;  4Z7X A;  2LEG A;  2GQM A;  5CP1 A;  5HQP A;  2X64 A;  2RUE A;  3EWL A;  1O85 A;  3UAP A;  1YF0 A;  2L5L A;  1EZK A;  2YN1 A;  1CQG A;  3HY2 A;  3HVV A;  2KOK A;  3APO A;  3QPM A;  1FB0 A;  3F3Q A;  4E8H A;  2AJQ B;  1AXD A;  3GX8 A;  4KSO A;  3SBC A;  4ZXG A;  3ZIV A;  4EIP A;  5A4W A;  3GL3 A;  1TJD A;  3KIJ A;  1MD4 A;  3DD3 A;  5E4W A;  4D73 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...