2VM1A

Crystal structure of barley thioredoxin h isoform 1 crystallized using ammonium sulfate as precipitant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
110
structure length
110
Chain Sequence
EGAVIACHTKQEFDTHMANGKDTGKLVIIDFTASWCGPCRVIAPVFAEYAKKFPGAIFLKVDVDELKDVAEAYNVEAMPTFLFIKDGEKVDSVVGGRKDDIHTKIVALMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN H ISOFORM 1.
publication title Crystal Structures of Barley Thioredoxin H Isoforms Hvtrxh1 and Hvtrxh2 Reveal Features Involved in Protein Recognition and Possibly in Discriminating the Isoform Specificity.
pubmed doi rcsb
source organism Hordeum vulgare var. distichum
total genus 32
structure length 110
sequence length 110
chains with identical sequence B, C, D
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2008-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2vm1A01
3NOFA 2IMFA 2B7KA 3GTUB 4MK3A 2XBQA 3VWXA 6GSUA 2DJKA 4AJ6A 5IMZA 3IHQA 3TJJA 4K9ZA 1XW9A 5D73A 3L0HA 5ELAA 1TK5B 1SK2A 1XW5A 4N30A 2IFQB 2MMZA 1SYRA 4GRFA 4FYCA 4V1Ag 3TJBA 1A0RP 1K0OA 2PWJA 1MDKA 1F37A 3TGZA 3CBUA 3I9V2 2GSRA 4DVCA 2N5AA 2FA4A 2JL4A 1Q4JA 1I9DA 1GSFA 4BWQA 2BMXA 3D0ZA 3UOMA 2FLSA 2LRNA 4FH8A 4HU7A 6GSWA 2HYXA 1FB6A 1OKDA 2MMNA 4IP1A 1SL2B 2CX3A 4L0UA 5A4WA 1ACVA 1TI3A 4IQ1A 5DAKA 4F82A 1THOA 5A4UA 2WCIA 3KM6A 5H5QA 2YJHA 3FRCA 2JU5A 4MP4A 2IMKA 5C00A 5HR1A 2YCDA 2CX4A 3LWAA 1ZL9A 2DC5A 1F3AA 4F0BA 5H5RA 3FY7A 3QMXA 2L6CA 2H1BA 4IN0A 2OJLA 1ZCPA 4Q5RA 2NDOA 3WGDA 11GSA 2F8FA 5J41A 4QL9A 2IN3A 3QFBC 1XWCA 2CAIA 2QKEA 5D9TA 2MYGA 4IVFA 4G10A 4E8EA 2E2MA 1XVQA 3U6VA 2HNLA 4MZCA 4TKYA 3EURA 1KNGA 5IO2A 4D73B 2IMIA 3FEUA 3ZVJD 2C80A 1M7TA 2DSAA 1OYJA 5IQYA 17GSA 3ISOA 1X5CA 1KTEA 2H1AA 1U6TA 2HRNA 1GTUA 2I3YA 1IYHA 4MJAA 5CRGA 3VFIA 1NW2A 2WB9A 4DSQA 1XBSA 4MH3A 5B8AA 1YKAA 5CRWA 2TRXA 1ZZYA 2FUG2 4QL7A 3MNGA 4IJIA 2FWGA 2FHEA 3HY2A 1TU8A 2QSIA 1M2BA 1A8YA 1ZOFA 2NPBA 1CQHA 1N8JA 1GLPA 1FW1A 2VO4A 2CZ3A 2LV3A 3A2WA 2YZUA 3CSHA 4XRDA 4NHZA 1GTIA 3UMAA 5ECKB 1YY7A 3GNJA 2VCXA 3IK9A 1XWAA 4MJCA 1ZMAA 3P2AA 3ZMLA 3HJOA 3KP9A 4HU9A 4HS1A 2VLUA 4V2LA 1SL1B 2ES7A 3GH9A 2IMEA 2VAFA 2H71A 4X43A 3GKMA 4NWYA 3F6FA 2FWFA 1GSUA 3VPTA 1SJ6A 5IOXA 5F07A 2J9HA 3VWUA 4KB3A 1K0MA 2OKAA 4KGIA 4MZBA 3KTLA 2OACA 3ME8A 4L8EA 2RM6A 1EGOA 1GNWA 1JFUA 1AUCA 3Q18A 4MDCA 2LTKA 1LBKA 3WT2A 4OD7A 4K1FA 1GSQA 5DVBA 5A5KA 2RLIA 3UVTA 5DAKB 3DD3A 3K8NA 3LJRA 3WD6A 1SD8A 3VWVA 2LS5A 2YWIA 4O92A 3ED3A 3EC3A 1W89A 3GN3A 4GXZA 3S9FA 2DJ2A 2WDUA 1SKWB 3HVXA 4ID0A 2R3XA 4NV2A 3EMXA 1SYXA 3BCKA 2PERA 2F8AA 3LYPA 4BL7A 4L5LA 2JZTA 4I6XA 2H6XA 1AC1A 2WRTA 2H0HA 3HXSA 5LNKe 1SK0A 1FG4A 1SD9A 3VK9A 2M80A 4HUAA 4WBJA 1XWBA 3IC4A 2B6MA 5ECHB 2XBIA 1A24A 1VGLA 4K8MA 4LLRA 1S3DA 3C1RA 2H1DA 1V40A 3N9JA 2H72A 3APSA 5CNWA 4POLA 5HR2A 2LQOA 5GZZB 1UC7A 1K3LA 4EC0A 4J2FA 1HNBA 2EIQA 3HVVA 3TKSA 4KW6A 3SBCA 1USBA 5KEJA 1SJZA 2DJJA 1GSDA 3P90A 4IELA 1C72A 1QMVA 2KHPA 2WFCA 4I2TA 1R4WA 5FWGA 2J23A 2DMLA 4JR4A 4F0CA 5ECLB 2KOKA 4OO4A 5D9WA 2MMAA 4ZB6A 2Z9SA 2DBCA 4WKWA 14GSA 4PNFA 1THXA 3FZ9A 4EL1A 2YWMA 1YF0A 1MD3A 5ECNB 2M46A 2YV7A 3KEBA 3DVXA 4OO5A 1ML6A 2LJRA 3Q74A 1T7PB 1F3BA 3KD0A 1XOBA 3NIVA 3DEXA 2E2GA 3MAKA 5D8IA 4ZIJA 2I9HA 1TKDB 1O7UA 4GQCA 5GSTA 2LEGA 2V6OA 2GDRA 4KSMA 1YKCA 3I69A 5ECOB 1A2JA 6GSYA 5HFIA 4IBPA 1EOGA 2YNXA 3GFKA 4IGJA 3QDNA 2AHEA 2JZRA 1YF1A 3F4TA 3LFLA 5IMVA 2C0EA 1G7OA 4DSRA 2H19A 3EVIA 3IPZA 4HJ2A 4MABA 4TR3A 1OC3A 4V1Ap 2E7PA 3H8QA 3KH7A 3TRQA 3VLNA 1GULA 3DXBA 4MH2A 1OC9B 3UAPA 3ERWA 2AV4A 3HZ4A 1MDJA 4YQUA 5HQPA 5ECIB 4AJ8A 2K9FA 1X5EA 2R6KA 2RUFA 5CP1A 2VL3A 3DIEA 4GQFA 2A2SA 1EP7A 2HRFA 3IAM2 5IOWA 4FYUA 2WJUA 2EC4A 2H76A 2VL9A 2QGVA 1GWCA 4EE0A 2H1GA 5JWQB 3GX8A 3LXTA 3G7IA 4TVEA 4PUFC 1EOHA 3E9JB 3MDKA 4EVMA 1WMJA 4OFMA 5KN0A 2HFDA 2DIYA 3RHCA 3TUEA 3EINA 4J57E 1PRXA 1JLVA 2O7KA 1QGVA 2L6DA 4AJ7A 1OC8A 4K7OA 1Z7PA 3HA9A 4JRRA 4HJMA 2GSSA 2H6ZA 4N11A 3E3EA 2VUPA 5INYA 1GTBA 3KH9A 3Q6OA 1V58A 4CW9A 3MWHA 3TKRA 4TXVA 5HFKA 3BOAA 3RAZA 4IHUA 2D2ZA 1XXUA 2GSTA 3ZIVA 2VLVA 2L4QA 3QOUA 1OKTA 3RPPA 5IO0A 1XWGA 3TRPA 3HYPA 4HOJA 4EUYA 1ILOA 3GKXA 4XRAA 4Q5NA 5ECQB 2ZUPA 1ERWA 1OAZA 3L9SA 1BX9A 13GSA 1M0UA 5D93A 1XWKA 5DCGA 1F6MC 4XS4A 1EEMA 3F3RA 2FA8A 1H4OA 1WRYA 5IPGA 2LRCA 5D9VA 1ST9A 1AQWA 3F0IA 2FY6A 3GKNA 2PVQA 2C3NA 4JBBA 4WR4A 3Q19A 5J4UA 3D6IA 2B5YA 1F2EA 4RQRA 2AJQB 3EYTA 22GSA 1A23A 2VIMA 5AIVA 1T3BA 4NPBA 3DMLA 4TR1B 2YN1A 4LL4B 5IIZA 2CQ9A 4OFNA 1R7HA 4BA7A 2GZPA 3F8UA 1TK0B 1BJXA 1DSBA 2R5GA 3GL5A 4MF6A 2PUKC 1GNEA 4YAPA 3UBLA 2H0GA 2YANA 1M2DA 1WPIA 5AIXA 5AN1A 3PGTA 2WS2A 3QD9A 4RUVA 2LNTA 3SWLA 3TKSE 2L59A 5D9XA 4HI7A 3LXZA 2YZHA 3IK7A 4BVYA 1PA3A 3FHKA 3GRXA 1G6WA 3IAS2 5JWRB 1A0FA 1TRWA 3DGQA 1YZXA 1YDKA 4MPFA 2F9SA 1BYEA 4ECCA 4YH2A 1RK4A 1FOVA 2VL2C 1ERVA 2A4VA 4POBA 1AXDA 3TJKA 3FKFA 3GYKA 1WJKA 3ZREA 3IA1A 2TRCP 2CAQA 5DALA 1XOAA 4KDXA 5LD0A 4MLYA 1GLQA 3IDVA 2JZSA 2KLXA 3E0UA 1AAZA 5IMCA 2FGXA 6GSXA 1QUWA 4FIWA 4TW5A 5B7CA 1JZRA 1UN2A 2RM5A 2CVDA 1AW9A 4IJ3A 1YJ6A 4XS6A 3TCOA 2G2QA 3D5JA 2F51A 2H70A 2GQLA 3M3MA 3O76A 1SU9A 5JCGA 4JEDA 5DJMA 2A2RA 3IRAA 4ZL8A 4L0WA 1FVJA 3ERFA 5G1KA 1VF3A 3GHAA 3RHBA 5GAPD 3EU4A 4N0VA 1DE1A 2IIYA 1O85A 6GSTA 4XS4B 3JCML 3CSJA 4Q5FA 1TJDA 1EV4A 1TTZA 2VOCA 4IP6A 4J56E 1BAYA 1O8WA 3L9UA 1O8XA 2AUVA 2H75A 2FD3A 2K18A 5G5FA 5G2ZA 5B8BA 3GA4A 5ECPB 3ZFLA 2N5FA 2CV4A 3M9JA 3F9UA 5J3RA 3H1NA 2HE3A 5C04A 2REMA 5G1LA 1K0CA 1T00A 1SJIA 5G5EA 1V9WA 3IXRA 3C1SA 3EU3A 3CTFA 3IOSA 3D22A 6GSSA 5L71A 3ME7A 4MZWA 2IPAA 4TN8A 5KN2A 1T4ZA 1O81A 2L4CA 4ZILA 2HI7A 4KNDA 12GSA 2H74A 1HD2A 1PGTA 2YWOA 1K3YA 3F63A 2B7JA 4TXOA 5IMDA 5ENUA 3ZITA 1QFNA 1JZWA 4AF2A 19GSA 1TU7A 18GSA 3DRNA 5GAND 3ZZXA 1G6YA 2PGTA 2V41A 1U88A 3FZ5A 5E4WA 3LQ7A 3MSZA 2I4AA 3PR8A 8GSSA 4KE3A 4RQXA 3KJYA 2NVLA 3NZNA 3PH9A 4WEYA 1SENA 4GSSA 1XPVA 2B3SA 4XTSA 5FHIA 5DALB 1KEBA 1X9MB 4F03A 1SL0B 2LQQA 3QCPA 3D4MA 1BEDA 4XCSA 3J7Yk 1XCCA 4KDUA 2OBIA 4LMWA 3C71A 2XPDA 2VCZA 1VF4A 2I1UA 1Z5YE 4WF5A 3I43A 4JR6A 5F8BA 3QFAC 2CVKA 3UIWA 1WOUA 1SKSB 4GSTA 5IMFA 3RBTA 3TOUA 2DJ3A 4DSSA 2VCWA 4IKHA 2AYTA 6GSVA 2HZEA 4DEJA 2WGRA 1NHYA 2KUCA 4N0ZA 3C7MA 3LORA 4KCEA 2IWTA 3FR9A 2PPTA 1NM3A 2B5EA 2VLTA 2TIRA 3GMFA 1GUMA 2L5LA 3M9KA 5G31A 3H93A 3LYKA 2GSQA 3F3QA 1XFLA 4EXJA 3TKQA 4K0GA 1A2LA 1EGRA 1GRXA 5HR0A 3UL3A 2V2GA 3L9VA 3G7YA 20GSA 7GSSA 3R2QA 2LSTA 1A2MA 3A5WA 1AQVA 3A2VA 10GSA 1GSSA 3M8NA 1Z6MA 5D96A 1PSQA 1UVZA 3ERGA 1W4VA 2PN8A 4GCIA 2GT6A 3KGKA 3GURA 2O85A 4PUAA 1U87A 4MA9A 3QAGA 2B1LA 3N5OA 2PMTA 4WBRD 2FCHA 2HLSA 2O87A 4N10A 3UVHA 5ECMB 1ZYQB 4NHWA 5DBQA 2X8GA 2OE1A 4TRXA 4X1UA 2X64A 1Z9HA 2JADA 3ZTLA 1XVWA 2OE0A 3UEMA 4OFTA 4RI6A 4ECBA 3H79A 3UBKA 1XZOA 4PURA 4YAVA 3G9BA 1JLWA 2C3QA 5J9BA 4ECJA 2XHFA 5F0GA 2WZ9A 3HHVA 1X9WB 4TXOB 3BJ5A 1TXXA 1T8EB 2IMDA 4YQMA 1FHEA 1ERUA 3W6GA 2YJ7A 2DJ1A 2HSYA 1Z6NA 4PGTA 4ZXGA 2GZZA 4G9HA 3EWLA 4FO5A 3TJGA 2LJKA 2HXKA 3APQA 5F06A 1KBNA 5CRDA 1S3AA 4MJEA 2VD1A 5EL8A 4D73A 4O5RA 1B8XA 4RI7A 2C4JA 4QQ7A 2JSYA 3L4NA 2VL2A 2YWNA 1PL1A 4XIHA 1GSYA 5KN3A 2H73A 5J5NA 3TRXA 3P8WA 3H4KA 5B6NA 1E2YA 4GWRA 4XHMA 4X0XA 4PQHA 3GSTA 1ZGNA 4HQZA 3FR6A 1K0DA 4EKZA 5JCWA 1ON4A 5ECSA 2DLXA 3W8SA 3HCZA 5AISA 2K8VA 2HT9A 1HNAA 2GQMA 3QR6A 5DQSA 1B4QA 3A3TA 4ML6A 3GKKA 3TKPA 2HZFA 1TP9A 2LRTA 4DSSB 4K6XA 3UARA 2F3MA 3L78A 4K7IA 1QXHA 2B5XA 4NAXA 2HZEB 3HKRA 1T4YA 2GLRA 4ULXA 2CVBA 5IMAA 1R5PA 4ACSA 4PX1A 2H01A 4I97A 1CQGA 1TRUA 1E6BA 5HFGA 2N5BA 3ZMKA 4MMMA 2GS3A 4EO3A 5HR3A 1YEPA 1TI1A 2JACA 2VCVA 2ZNMA 3O6TA 4GLTA 4NMUA 2YPMA 3HZ8A 2PBJA 4HEA2 2H0IA 2DIZA 1OE7A 2PVOC 1J0FA 4H86A 1X5DA 1S3CA 5DCHA 2OBKA 5JCUA 4HZ2A 3RPNA 4OWYA 4Q5QA 1K3OA 1H75A 1ABAA 1V98A 2YV9A 5KN1A 1EV9A 2BTOT 1J9BA 4V2MA 5CAXA 2C0DA 1LJRA 5EVOA 4TR4A 3FZ4A 3FR3A 4ML1A 1SK1A 2CZ2A 4I5QA 3KXOA 3F6DA 1U3AA 2OE3A 1XW6A 3HVSA 1K0NA 3US3A 1FO5A 3GH6A 4CDOA 4PQ1A 1WIKA 2H6YA 4TOPA 1NSWA 3BD2A 2VCTA 2FWEA 4CHSA 2K8SA 4G19A 4YQVA 3DKSA 4F9ZA 2VCQA 3CTGA 3RDWA 3DYRA 2LNSA 4NXIA 1JZOA 2MMOA 5GSSA 3CRTA 4KH7A 4O7HA 1V2AA 5J9CA 1PX7A 1R5AA 3TB2A 2AAWA 5ID2A 4MF5A 1Y25A 2DJ0A 4ZBBA 2LUSA 3C8EA 1WWJA 3A2XA 1EZKA 4MJBA 4OCEA 4TR0A 4JU5A 1F9MA 2H66A 4K0NA 1B4PA 3QAVA 4I2UA 3KP8A 2MBSA 4HDEA 4KCAA 4IS0A 1U3IA 1Z7RA 1ERTA 3DVWA 1DUGA 3DWVA 4MCUA 4PXOA 3ZFBA 1K0AA 1M2AA 2GQKA 1GUKA 4OMVA 4OCFA 3FZAA 2X8HA 1RQMA 3D4TA 3ZRDA 1BQ7A 2YOIA 4FYBA 3V1WA 3VPQA 1GUHA 1EP8A 3VWWA 1TK8B 2H30A 5F05A 5COHA 5JWOB 2X8CA 2VM2A 3WGEA 5DJLA 5E59A 3HJMA 1DBYA 1T1VA 4BWSA 5DQYA 1VRSD 4WETA 1EEJA 1JHBA 4WF4A 1TDIA 4PQIA 4ZB8A 9GSSA 4GSNA 4AGSA 5EY6A 1K0BA 4NV5A 4KSOA 16GSA 3IE3A 2IL3A 2ON5A 3BCIA 3G7JA 1XIYA 4POMA 2NBSA 4JE1A 4WR5A 1FB0A 3KCMA 3VI5A 1MDIA 1M99A 3F4SA 2R4VA 5IM9A 3KMOA 3QPMA 4V2NA 3EE2A 2JSZA 2GZYA 1R26A 4P3YB 2RIIA 3AY8A 1DE2A 3WT1A 2GT5A 3EMPA 2O89A 4IW9A 3ZYWA 4G2EA 1OC9A 4HZ4A 3FW2A 1O6JA 3IR4A 3J7Yb 3VI7A 1GH2A 1NHOA 1JZDA 1B9XC 3F4RA 3M1GA 3QAWA 1I5GA 2BJXA 2FWHA 3D21A 2PU9C 2GGTA 2K6VA 1J08A 2ZCTA 1ZYEA 2ON7A 2EIRA 5ELGA 3I6AA 4Z7XA 3TJFA 2OADA 3HD5A 3U5RE 4F2IA 3LEFA 5ECRB 2KP2A 1O73A 1URMA 4BPYA 1MD4A 2QC7A 1FAAA 5ID2B 2AB6A 5CYYA 1VF2A 4LMVA 5G30A 3ZVJA 3APOA 1YEXA 1X0RA 1PL2A 4IQAA 4EDZA 4KA0A 4MF7A 1MTCA 4ZBAA 2ALBA 3CRUA 1PX6A 3KTBA 2KP1A 4ILFA 5FT3A 4ZB9A 1LU4A 5LCZA 3GSSA 2XPEA 3BBYA 2MZCA 2YP6A 4KUNA 3GX0A 3OR5A 1B48A 2FNOA 1WP0A 1TRVA 3WYWA 5DDLA 5CO3A 3HDCA 5CRHA 2HSHA 4KAEA 4K2DA 4POKA 1RW1A 2P0GA 1FVKA 3GTUA 2E0QA 1TW9A 4XS1A 2P31A 2GTUA 1AQXA 1YQ1A 1A8LA 3O3TA 2V32A 3KZQA 2M72A 4GTUA 3LG6A 3CYNA 4KDYA 2P5RA 3KIJA 4HQSA 2IFQA 3P7XA 2XC2A 1TRSA 1GP1A 2B1KA 1IYIA 1N2AA 1X9SB 2LKUA 4PNGA 1WE0A 2C0FA 2DMMA 3TDGA 2X99A 2MBTA 1HQOA 1HYUA 3CXGA 4I8BA 1OVNA 4WXTA 1M9AA 4LA1A 4MPGA 4ECIA 1GSEA 1Z3EA 1TOFA 1QK8A 2V6KA 1V57A 3IV4A 4ISDA 2LJAA 2C0GA 5A4VA 2RUEA 3GL3A 5B6MA 3ZIJA 5EPFA 4TR1A 1MEKA 5IPHA 3GV1A 1OE8A 3LGCA 2OA7A 4LL1B 1Q98A 1VF1A 2G0FA 2L5OA 1Y6EA 4L5OA 3TOTA 2EIOA 1PD21 2C8UA 2C1YA 3GIXA 2CA8A 5AGYA 5ABRA 1PQNA 3HJPA 2P5QA 2R2JA 5CREA 3CSIA 3FK8A 3C73A 3M0FA 3W8JA 5H5SA 1M9BA 2IJYA 1GTAA 2H8LA 2R37A 3LSZA 2GVPA 1PMTA 3CMIA 3GUSA 2V1MA 1UA5A 3UJ1A 2O8VB 2WULA 1BG5A 4JZQA 4ZBDA 3VURA 2NTOA 3TKSC 1G0TA 2CT6A 4BVXA 4O32A 1GL8A 3KMNA 3PINA 4GF0A 1SKRB 4KX4A 1QQ2A 4K7NA 3WGXA 3IBHA 4ZL9A 4ZL7A 1G7EA 1PKWA 4E8HA 3FYGA 1HNCA 3ZLPA 2VM1A 2L57A 4EF0A 2I81A 1AIUA 4EDYA 2VD0A 2C3TA 1PKZA 3ZL5A 1B9YC 1EWXA 1PN9A
chains in the Genus database with same CATH superfamily
3NOFA 2IMFA 2B7KA 3GTUB 4MK3A 2XBQA 3VWXA 6GSUA 2DJKA 4AJ6A 5IMZA 3IHQA 3TJJA 4K9ZA 1XW9A 5D73A 3L0HA 5ELAA 1TK5B 1SK2A 1XW5A 4N30A 2IFQB 2MMZA 1SYRA 4GRFA 4FYCA 4V1Ag 3TJBA 1A0RP 1K0OA 2PWJA 1MDKA 1F37A 3TGZA 3CBUA 3I9V2 2GSRA 4DVCA 2N5AA 2FA4A 2JL4A 1Q4JA 1I9DA 1GSFA 4BWQA 2R0PA 2BMXA 3D0ZA 3UOMA 2FLSA 2LRNA 4FH8A 4HU7A 6GSWA 2HYXA 1FB6A 1OKDA 2MMNA 4IP1A 1SL2B 2CX3A 4L0UA 5A4WA 1ACVA 1TI3A 4IQ1A 5DAKA 4F82A 1THOA 5A4UA 2WCIA 3KM6A 5H5QA 2YJHA 3FRCA 2JU5A 3PPUA 2X4AA 4MP4A 2IMKA 5C00A 5HR1A 2YCDA 2CX4A 3LWAA 1ZL9A 2DC5A 1F3AA 4F0BA 5H5RA 3FY7A 3QMXA 5KOWA 2L6CA 2H1BA 4IN0A 2OJLA 1ZCPA 4Q5RA 2NDOA 3WGDA 11GSA 2F8FA 5J41A 4QL9A 2IN3A 3QFBC 1XWCA 2CAIA 2QKEA 5D9TA 2MYGA 4IVFA 4G10A 4E8EA 2E2MA 1XVQA 3U6VA 2HNLA 4MZCA 4TKYA 3EURA 1KNGA 5IO2A 4D73B 2IMIA 3FEUA 3ZVJD 2C80A 1M7TA 2DSAA 1OYJA 5IQYA 17GSA 3ISOA 1X5CA 1KTEA 2H1AA 1U6TA 2HRNA 1GTUA 2I3YA 1IYHA 4MJAA 5CRGA 3VFIA 1NW2A 2WB9A 4DSQA 1XBSA 4MH3A 5B8AA 1YKAA 5CRWA 2TRXA 1ZZYA 2FUG2 4QL7A 3MNGA 4IJIA 2FWGA 2FHEA 3HY2A 1TU8A 2QSIA 1M2BA 1A8YA 1ZOFA 2NPBA 1CQHA 1N8JA 1GLPA 1FW1A 2VO4A 2CZ3A 2LV3A 3A2WA 2YZUA 3CSHA 4XRDA 4NHZA 1GTIA 3UMAA 5ECKB 1YY7A 3GNJA 2VCXA 3IK9A 1XWAA 4MJCA 1ZMAA 3P2AA 3ZMLA 3HJOA 3KP9A 4HU9A 4HS1A 2VLUA 4V2LA 1SL1B 2ES7A 3GH9A 2IMEA 2VAFA 2H71A 4X43A 3GKMA 4NWYA 3F6FA 2FWFA 1GSUA 3VPTA 1SJ6A 5IOXA 5F07A 2J9HA 3VWUA 4KB3A 1K0MA 2OKAA 4KGIA 4MZBA 3KTLA 2OACA 3ME8A 4L8EA 2RM6A 1EGOA 1GNWA 1JFUA 1AUCA 3Q18A 4MDCA 2LTKA 1LBKA 3WT2A 4OD7A 4K1FA 4ICYA 1GSQA 5DVBA 5A5KA 2RLIA 3UVTA 5DAKB 3DD3A 3K8NA 3LJRA 3WD6A 1SD8A 3VWVA 2LS5A 2YWIA 4O92A 3ED3A 3EC3A 1W89A 2HRAA 3GN3A 4GXZA 3S9FA 2DJ2A 2WDUA 1SKWB 3HVXA 4ID0A 2R3XA 4NV2A 3EMXA 1SYXA 3BCKA 2PERA 2F8AA 3LYPA 4BL7A 4L5LA 2JZTA 4I6XA 2H6XA 1AC1A 2WRTA 2H0HA 3HXSA 5LNKe 1SK0A 1FG4A 1SD9A 3VK9A 2M80A 4HUAA 4WBJA 1XWBA 2R0GA 3IC4A 2B6MA 5ECHB 2XBIA 1A24A 1VGLA 2QA2A 4K8MA 4Z2TA 4LLRA 1S3DA 3C1RA 2H1DA 1V40A 3N9JA 2H72A 3APSA 5CNWA 4POLA 5HR2A 2LQOA 5GZZB 1UC7A 1K3LA 4EC0A 4G0KA 4J2FA 1HNBA 2EIQA 3HVVA 3TKSA 4KW6A 3SBCA 1USBA 5KEJA 1SJZA 2DJJA 1GSDA 3P90A 3FMWA 1C72A 4IELA 1QMVA 2KHPA 2WFCA 4I2TA 1R4WA 5FWGA 2J23A 2DMLA 4JR4A 4F0CA 5ECLB 2KOKA 4OO4A 5D9WA 2MMAA 4ZB6A 2Z9SA 2DBCA 4WKWA 14GSA 4PNFA 1THXA 3FZ9A 4EL1A 2YWMA 1YF0A 1MD3A 5ECNB 2M46A 2YV7A 3KEBA 3DVXA 4OO5A 1XG8A 1ML6A 2LJRA 3Q74A 1T7PB 4K5RA 1F3BA 3KD0A 2QA1A 1XOBA 3NIVA 4K5SA 3DEXA 2E2GA 3MAKA 5D8IA 4ZIJA 2I9HA 1TKDB 1O7UA 4GQCA 5GSTA 2LEGA 2V6OA 2GDRA 4KSMA 1YKCA 3I69A 5ECOB 1A2JA 6GSYA 5HFIA 4IBPA 1EOGA 2YNXA 3GFKA 4IGJA 3QDNA 2AHEA 2JZRA 1YF1A 3F4TA 3LFLA 5IMVA 2C0EA 1G7OA 4DSRA 2H19A 3EVIA 3IPZA 4HJ2A 4MABA 4TR3A 1OC3A 4V1Ap 2E7PA 3H8QA 3KH7A 3TRQA 3VLNA 1GULA 3DXBA 4MH2A 1OC9B 3UAPA 1M3IA 3IHGA 3ERWA 2AV4A 3HZ4A 1MDJA 4YQUA 5HQPA 4BL7B 5ECIB 4AJ8A 2K9FA 1X5EA 2R6KA 2RUFA 5CP1A 2VL3A 3DIEA 4GQFA 2A2SA 1EP7A 2HRFA 3IAM2 3MIXA 5IOWA 4FYUA 2WJUA 2EC4A 2H76A 2VL9A 2QGVA 1GWCA 4EE0A 2H1GA 5JWQB 3GX8A 3LXTA 3G7IA 4TVEA 4PUFC 1EOHA 3E9JB 3MDKA 4EVMA 1WMJA 4OFMA 5KN0A 2HFDA 2DIYA 3RHCA 3TUEA 3EINA 4J57E 1PRXA 1JLVA 2O7KA 1QGVA 2L6DA 4AJ7A 1OC8A 4K7OA 1Z7PA 3HA9A 1FOHA 4JRRA 4HJMA 2GSSA 2H6ZA 4N11A 3E3EA 2VUPA 5INYA 1GTBA 3KH9A 3Q6OA 1V58A 4CW9A 3MWHA 3TKRA 4TXVA 5HFKA 3BOAA 3RAZA 4IHUA 2D2ZA 1XXUA 2X49A 2GSTA 5KOXA 2DKHA 3ZIVA 2VLVA 2L4QA 3QOUA 1OKTA 3RPPA 5IO0A 1XWGA 3TRPA 3HYPA 4HOJA 4EUYA 1ILOA 3GKXA 4MNNA 4XRAA 4Q5NA 5ECQB 2ZUPA 1ERWA 1OAZA 3L9SA 1BX9A 13GSA 1M0UA 5D93A 1XWKA 5DCGA 1F6MC 4XS4A 1EEMA 3F3RA 2FA8A 1H4OA 1WRYA 5IPGA 2LRCA 5D9VA 1ST9A 1AQWA 3F0IA 2FY6A 3GKNA 2PVQA 2C3NA 4JBBA 4WR4A 3Q19A 5J4UA 4HSCX 3D6IA 2B5YA 1F2EA 4RQRA 2AJQB 3EYTA 22GSA 1A23A 2VIMA 5AIVA 1T3BA 4NPBA 3DMLA 4TR1B 2YN1A 4LL4B 5IIZA 2CQ9A 4OFNA 1R7HA 4BA7A 2GZPA 3F8UA 1TK0B 1BJXA 1DSBA 2R5GA 3GL5A 4MF6A 2PUKC 1GNEA 4YAPA 3UBLA 2H0GA 2YANA 1M2DA 1WPIA 5AIXA 5AN1A 3PGTA 2WS2A 3QD9A 4RUVA 2LNTA 3SWLA 3TKSE 2L59A 5D9XA 4HI7A 3LXZA 2YZHA 3IK7A 4BVYA 1PA3A 3FHKA 3GRXA 1G6WA 3IAS2 5JWRB 1A0FA 1TRWA 3DGQA 1YZXA 1YDKA 4MPFA 2F9SA 1BYEA 4ECCA 4YH2A 1RK4A 1FOVA 2VL2C 1ERVA 4BVXB 2A4VA 4POBA 1AXDA 3TJKA 3FKFA 3GYKA 1WJKA 3ZREA 3IA1A 2TRCP 2CAQA 5DALA 1XOAA 4Z2UA 4KDXA 5LD0A 4MLYA 1GLQA 3IDVA 2JZSA 2KLXA 3E0UA 4G0LA 1AAZA 5IMCA 2FGXA 6GSXA 3MYDA 1QUWA 4FIWA 4TW5A 5B7CA 1JZRA 1UN2A 2RM5A 2CVDA 1AW9A 4IJ3A 1YJ6A 4XS6A 1M3JA 3TCOA 2G2QA 3D5JA 2F51A 2H70A 2GQLA 3M3MA 3O76A 1SU9A 5JCGA 4JEDA 5DJMA 2A2RA 3IRAA 4ZL8A 4L0WA 1FVJA 3ERFA 5G1KA 1VF3A 3GHAA 3RHBA 5GAPD 3EU4A 4N0VA 1DE1A 3A5IA 2IIYA 1O85A 6GSTA 4XS4B 3JCML 3CSJA 4Q5FA 1TJDA 1EV4A 1TTZA 2VOCA 4IP6A 4J56E 1BAYA 1O8WA 3L9UA 1O8XA 2AUVA 2H75A 2FD3A 2K18A 5G5FA 5G2ZA 5B8BA 3GA4A 5ECPB 3ZFLA 2N5FA 2CV4A 3M9JA 3F9UA 5J3RA 3H1NA 2HE3A 5C04A 2REMA 5G1LA 1K0CA 1T00A 1SJIA 5G5EA 1V9WA 2HRKA 3IXRA 3C1SA 3EU3A 3CTFA 3IOSA 3D22A 6GSSA 5L71A 3ME7A 4MZWA 2IPAA 4TN8A 5KN2A 1T4ZA 1O81A 2L4CA 4ZILA 2HI7A 4KNDA 12GSA 2H74A 1HD2A 1PGTA 4BIKA 2YWOA 1K3YA 3F63A 4PTSA 2B7JA 4TXOA 5IMDA 2R0CA 5ENUA 3ZITA 1QFNA 1JZWA 4AF2A 19GSA 1TU7A 18GSA 3DRNA 5GAND 3ZZXA 1G6YA 2PGTA 3R3EA 2V41A 1U88A 3FZ5A 5E4WA 3LQ7A 3MSZA 2I4AA 3PR8A 8GSSA 4KE3A 4RQXA 3KJYA 2NVLA 3NZNA 3PH9A 4WEYA 1SENA 4GSSA 1XPVA 2B3SA 4XTSA 1PN0A 5FHIA 5DALB 1KEBA 1X9MB 4F03A 1SL0B 2LQQA 3QCPA 3D4MA 1BEDA 4XCSA 3J7Yk 1XCCA 4KDUA 2OBIA 4LMWA 3C71A 2XPDA 3LW9A 2VCZA 1VF4A 2I1UA 1Z5YE 4WF5A 3I43A 4JR6A 5F8BA 3QFAC 2CVKA 3UIWA 1WOUA 1SKSB 4GSTA 5IMFA 3RBTA 3TOUA 2DJ3A 4DSSA 2VCWA 4IKHA 2AYTA 6GSVA 2HZEA 4DEJA 2WGRA 1NHYA 2KUCA 4N0ZA 3C7MA 3LORA 4KCEA 2IWTA 3FR9A 2PPTA 1NM3A 2B5EA 2VLTA 2TIRA 3GMFA 1GUMA 2L5LA 3M9KA 5G31A 3H93A 3LYKA 2GSQA 3F3QA 1XFLA 4EXJA 3TKQA 4K0GA 1A2LA 1EGRA 1GRXA 5HR0A 3UL3A 2V2GA 3L9VA 3G7YA 20GSA 7GSSA 3R2QA 2LSTA 1A2MA 3A5WA 1AQVA 3A2VA 10GSA 1GSSA 3M8NA 1Z6MA 5D96A 1PSQA 1UVZA 4A5PA 3ERGA 1W4VA 2PN8A 4GCIA 2GT6A 3KGKA 3GURA 2O85A 4O5QA 4PUAA 1U87A 4MA9A 3QAGA 2B1LA 3N5OA 2PMTA 4WBRD 2FCHA 2HLSA 2O87A 4N10A 3UVHA 5ECMB 1ZYQB 4NHWA 5DBQA 2X8GA 2OE1A 4TRXA 4X1UA 2X64A 1Z9HA 2JADA 3ZTLA 1XVWA 2OE0A 3UEMA 4OFTA 4RI6A 4YKGA 4ECBA 3H79A 3UBKA 1XZOA 4PURA 4YAVA 3G9BA 1JLWA 2C3QA 5J9BA 4ECJA 2XHFA 5F0GA 2WZ9A 3HHVA 1X9WB 4TXOB 3BJ5A 1TXXA 1T8EB 2IMDA 4YQMA 1FHEA 1ERUA 3W6GA 2YJ7A 2DJ1A 2HSYA 1Z6NA 4K2XA 3IC8A 4PGTA 4ZXGA 2GZZA 4G9HA 3EWLA 4FO5A 3TJGA 2LJKA 2HXKA 3APQA 5F06A 1KBNA 5CRDA 1S3AA 4MJEA 1PFOA 2VD1A 5EL8A 4D73A 4O5RA 1B8XA 4RI7A 4KF9A 2C4JA 4QQ7A 2JSYA 4CY8A 4EIQA 3L4NA 2VL2A 2YWNA 1PL1A 4XIHA 1GSYA 5KN3A 2H73A 5J5NA 3TRXA 3P8WA 3H4KA 5B6NA 1E2YA 4GWRA 4XHMA 4X0XA 4PQHA 3GSTA 1ZGNA 4HQZA 3FR6A 1K0DA 4EKZA 5JCWA 1ON4A 5ECSA 2DLXA 3W8SA 3HCZA 5AISA 2K8VA 2HT9A 1HNAA 2GQMA 3QR6A 5DQSA 1B4QA 3A3TA 4ML6A 3GKKA 3TKPA 2HZFA 1TP9A 2LRTA 4DSSB 4K6XA 3UARA 2F3MA 3L78A 4K7IA 1QXHA 2B5XA 4NAXA 2HZEB 3HKRA 1T4YA 2GLRA 4ULXA 2CVBA 5IMAA 1R5PA 4ACSA 4PX1A 2H01A 4I97A 1CQGA 1TRUA 1E6BA 1S3RA 2N5BA 4USSA 5HFGA 4MMMA 3ZMKA 2GS3A 4EO3A 5HR3A 1YEPA 1TI1A 2JACA 2VCVA 2ZNMA 3O6TA 4GLTA 4NMUA 2YPMA 3HZ8A 2PBJA 4HEA2 2H0IA 2DIZA 1OE7A 2PVOC 1J0FA 4H86A 1X5DA 1S3CA 5DCHA 2OBKA 5JCUA 4HZ2A 3RPNA 4OWYA 4Q5QA 1K3OA 3HVNA 1H75A 1ABAA 1V98A 2YV9A 5KN1A 1EV9A 2BTOT 1J9BA 4V2MA 5CAXA 2C0DA 1LJRA 5EVOA 4TR4A 3FZ4A 3FR3A 4ML1A 1SK1A 2CZ2A 4I5QA 3KXOA 3F6DA 1U3AA 2OE3A 1XW6A 3HVSA 1K0NA 3US3A 1FO5A 3GH6A 4CDOA 4PQ1A 1WIKA 2H6YA 4TOPA 1NSWA 3BD2A 2VCTA 2FWEA 3CQFA 4CHSA 2K8SA 4YKFA 4G19A 1ZYPA 4YQVA 3DKSA 4F9ZA 2VCQA 3CTGA 3RDWA 3DYRA 2LNSA 4NXIA 1JZOA 2MMOA 5GSSA 3CRTA 4KH7A 4O7HA 1V2AA 5J9CA 1PX7A 1R5AA 3TB2A 2AAWA 5ID2A 4MF5A 2A2PA 1Y25A 2DJ0A 4ZBBA 2LUSA 3C8EA 4G0IA 1WWJA 3A2XA 1EZKA 4MJBA 4OCEA 4TR0A 4JU5A 1F9MA 2H66A 4K0NA 1B4PA 3QAVA 4I2UA 3KP8A 2MBSA 4HDEA 4KCAA 4IS0A 1U3IA 1Z7RA 1ERTA 3DVWA 1DUGA 3DWVA 4MCUA 4PXOA 3ZFBA 1K0AA 1M2AA 2GQKA 1GUKA 4OMVA 4OCFA 3FZAA 2X8HA 4O5UA 1RQMA 3D4TA 3ZRDA 1BQ7A 2YOIA 4FYBA 3V1WA 3VPQA 1GUHA 1EP8A 3VWWA 1TK8B 2H30A 5F05A 5COHA 5JWOB 2X8CA 2VM2A 3WGEA 5DJLA 2DKIA 5E59A 3HJMA 1DBYA 1T1VA 4BWSA 2A4HA 4X4JA 4EIPA 5DQYA 1VRSD 4WETA 1EEJA 1JHBA 4WF4A 1TDIA 4PQIA 4ZB8A 9GSSA 4GSNA 4AGSA 5EY6A 1K0BA 4NV5A 4KSOA 16GSA 3IE3A 2IL3A 2ON5A 3BCIA 3G7JA 1XIYA 4POMA 2NBSA 4JE1A 4WR5A 1FB0A 3KCMA 3VI5A 1ZYNA 1MDIA 1M99A 3F4SA 2R4VA 5IM9A 3KMOA 3QPMA 4V2NA 3EE2A 2JSZA 2GZYA 1R26A 4P3YB 2RIIA 3AY8A 1DE2A 3WT1A 2GT5A 3EMPA 2O89A 4IW9A 3ZYWA 4G2EA 1OC9A 4HZ4A 3FW2A 1O6JA 3IR4A 3J7Yb 3VI7A 1GH2A 1NHOA 1JZDA 4BVYB 1B9XC 3F4RA 3M1GA 3QAWA 1I5GA 2BJXA 2FWHA 3D21A 2UZ8A 2PU9C 2GGTA 2K6VA 1J08A 2ZCTA 1ZYEA 2ON7A 2EIRA 5ELGA 3I6AA 4Z7XA 3TJFA 2OADA 3HD5A 3U5RE 4F2IA 3LEFA 5ECRB 2KP2A 1O73A 1URMA 4BPYA 1MD4A 2QC7A 1FAAA 5ID2B 2AB6A 5CYYA 1VF2A 4LMVA 5G30A 3ZVJA 3APOA 1YEXA 1X0RA 1PL2A 4IQAA 4EDZA 4KA0A 4MF7A 2HSMA 1MTCA 4ZBAA 2ALBA 3CRUA 1PX6A 3KTBA 2KP1A 4ILFA 5FT3A 4ZB9A 1LU4A 5LCZA 3GSSA 2XPEA 3BBYA 2MZCA 2YP6A 4KUNA 3GX0A 3OR5A 1B48A 2FNOA 1WP0A 1TRVA 3WYWA 5DDLA 5CO3A 3HDCA 5CRHA 2HSHA 4KAEA 4K2DA 4POKA 1RW1A 2P0GA 1FVKA 5BRTA 3GTUA 2E0QA 1TW9A 4XS1A 2P31A 2GTUA 1AQXA 1YQ1A 1A8LA 3O3TA 2V32A 3KZQA 2M72A 4GTUA 3LG6A 3CYNA 4KDYA 2P5RA 3KIJA 4HQSA 2IFQA 3P7XA 2XC2A 1TRSA 1GP1A 2B1KA 1IYIA 1N2AA 1X9SB 2LKUA 4PNGA 1WE0A 2C0FA 2DMMA 3TDGA 2X99A 2MBTA 1HQOA 1HYUA 3CXGA 4Z2RA 4I8BA 1OVNA 4WXTA 1M9AA 4LA1A 4MPGA 4ECIA 1GSEA 1Z3EA 3EPTA 1TOFA 1QK8A 2V6KA 1V57A 3IV4A 4ISDA 2LJAA 2C0GA 5A4VA 2RUEA 3GL3A 5B6MA 3ZIJA 5EPFA 4TR1A 1MEKA 5IPHA 3GV1A 1OE8A 3LGCA 2OA7A 4LL1B 1Q98A 1VF1A 2G0FA 2L5OA 1Y6EA 4L5OA 3TOTA 2EIOA 1PD21 4CY6A 2C8UA 2C1YA 3GIXA 2CA8A 5AGYA 5ABRA 1PQNA 3HJPA 2P5QA 2R2JA 5CREA 3CSIA 3FK8A 3C73A 3M0FA 3W8JA 5H5SA 1M9BA 2IJYA 1GTAA 2H8LA 2R37A 3LSZA 2GVPA 1PMTA 3CMIA 3GUSA 2V1MA 1UA5A 3UJ1A 4FQUA 2O8VB 2WULA 1BG5A 4JZQA 4ZBDA 3VURA 2NTOA 3TKSC 1G0TA 2CT6A 5BMUA 4BVXA 4O32A 1GL8A 3KMNA 3PINA 4GF0A 1SKRB 4KX4A 1QQ2A 4K7NA 3WGXA 3IBHA 4ZL9A 4ZL7A 1G7EA 1PKWA 4E8HA 3FYGA 1HNCA 3ZLPA 2VM1A 2L57A 4EF0A 2I81A 1AIUA 4EDYA 2VD0A 2C3TA 1PKZA 3ZL5A 1B9YC 1EWXA 1PN9A
chains in the Genus database with same CATH topology
3NOFA 2IMFA 2B7KA 3GTUB 4MK3A 2XBQA 3VWXA 6GSUA 2DJKA 4AJ6A 5IMZA 3IHQA 3TJJA 4K9ZA 1XW9A 5D73A 3L0HA 5ELAA 1TK5B 1SK2A 1XW5A 4N30A 2IFQB 2MMZA 1SYRA 4GRFA 4FYCA 4V1Ag 3TJBA 1A0RP 1K0OA 2PWJA 1MDKA 1F37A 3TGZA 3CBUA 3I9V2 2GSRA 4DVCA 2N5AA 2FA4A 2JL4A 1Q4JA 1I9DA 1GSFA 4BWQA 2R0PA 2BMXA 3D0ZA 3UOMA 2FLSA 2LRNA 4FH8A 4HU7A 6GSWA 2HYXA 1FB6A 1OKDA 2MMNA 4IP1A 1SL2B 2CX3A 4L0UA 5A4WA 1ACVA 1TI3A 4IQ1A 5DAKA 4F82A 1THOA 5A4UA 2WCIA 3KM6A 5H5QA 2YJHA 3FRCA 2JU5A 3PPUA 2X4AA 4MP4A 2IMKA 5C00A 5HR1A 2YCDA 2CX4A 3LWAA 1ZL9A 2DC5A 1F3AA 4F0BA 5H5RA 3FY7A 3QMXA 5KOWA 2L6CA 2H1BA 4IN0A 2OJLA 1ZCPA 4Q5RA 2NDOA 3WGDA 11GSA 2F8FA 5J41A 4QL9A 2IN3A 3QFBC 1XWCA 2CAIA 2QKEA 5D9TA 2MYGA 4IVFA 4G10A 4E8EA 2E2MA 1XVQA 3U6VA 2HNLA 4MZCA 4TKYA 3EURA 1KNGA 5IO2A 4D73B 2IMIA 3FEUA 3ZVJD 2C80A 1M7TA 2DSAA 1OYJA 5IQYA 17GSA 3ISOA 1X5CA 1KTEA 2H1AA 1U6TA 2HRNA 1GTUA 2I3YA 1IYHA 4MJAA 5CRGA 3VFIA 1NW2A 2WB9A 4DSQA 1XBSA 4MH3A 5B8AA 1YKAA 5CRWA 2TRXA 1ZZYA 2FUG2 4QL7A 3MNGA 4IJIA 2FWGA 2FHEA 3HY2A 1TU8A 2QSIA 1M2BA 1A8YA 1ZOFA 2NPBA 1CQHA 1N8JA 1GLPA 1FW1A 2VO4A 2CZ3A 2LV3A 3A2WA 2YZUA 3CSHA 4XRDA 4NHZA 1GTIA 3UMAA 5ECKB 1YY7A 3GNJA 2VCXA 3IK9A 1XWAA 4MJCA 1ZMAA 3P2AA 3ZMLA 3HJOA 3KP9A 4HU9A 4HS1A 2VLUA 4V2LA 1SL1B 2ES7A 3GH9A 2IMEA 2VAFA 2H71A 4X43A 3GKMA 4NWYA 3F6FA 2FWFA 1GSUA 3VPTA 1SJ6A 5IOXA 5F07A 2J9HA 3VWUA 4KB3A 1K0MA 2OKAA 4KGIA 4MZBA 3KTLA 2OACA 3ME8A 4L8EA 2RM6A 1EGOA 1GNWA 1JFUA 1AUCA 3Q18A 4MDCA 2LTKA 1LBKA 3WT2A 4OD7A 4K1FA 4ICYA 1GSQA 5DVBA 5A5KA 2RLIA 3UVTA 5DAKB 3DD3A 3K8NA 3LJRA 3WD6A 1SD8A 3VWVA 2LS5A 2YWIA 4O92A 3ED3A 3EC3A 1W89A 2HRAA 3GN3A 4GXZA 3S9FA 2DJ2A 2WDUA 1SKWB 3HVXA 4ID0A 2R3XA 4NV2A 3EMXA 1SYXA 3BCKA 2PERA 2F8AA 3LYPA 4BL7A 4L5LA 2JZTA 4I6XA 2H6XA 1AC1A 2WRTA 2H0HA 3HXSA 5LNKe 1SK0A 1FG4A 1SD9A 3VK9A 2M80A 4HUAA 4WBJA 1XWBA 2R0GA 3IC4A 2B6MA 5ECHB 2XBIA 1A24A 1VGLA 2QA2A 4K8MA 4Z2TA 4LLRA 1S3DA 3C1RA 2H1DA 1V40A 3N9JA 2H72A 3APSA 5CNWA 4POLA 5HR2A 2LQOA 5GZZB 1UC7A 1K3LA 4EC0A 4G0KA 4J2FA 1HNBA 2EIQA 3HVVA 3TKSA 4KW6A 3SBCA 1USBA 5KEJA 1SJZA 2DJJA 1GSDA 3P90A 3FMWA 1C72A 4IELA 1QMVA 2KHPA 2WFCA 4I2TA 1R4WA 5FWGA 2J23A 2DMLA 4JR4A 4F0CA 5ECLB 2KOKA 4OO4A 5D9WA 2MMAA 4ZB6A 2Z9SA 2DBCA 4WKWA 14GSA 4PNFA 1THXA 3FZ9A 4EL1A 2YWMA 1YF0A 1MD3A 5ECNB 2M46A 2YV7A 3KEBA 3DVXA 4OO5A 1ML6A 2LJRA 3Q74A 1T7PB 4K5RA 1F3BA 3KD0A 2QA1A 1XOBA 3NIVA 4K5SA 3DEXA 2E2GA 3MAKA 5D8IA 4ZIJA 2I9HA 1TKDB 1O7UA 4GQCA 5GSTA 2LEGA 2V6OA 2GDRA 4KSMA 1YKCA 3I69A 5ECOB 1A2JA 6GSYA 5HFIA 4IBPA 1EOGA 2YNXA 3GFKA 4IGJA 3QDNA 2AHEA 2JZRA 1YF1A 3F4TA 3LFLA 5IMVA 2C0EA 1G7OA 4DSRA 2H19A 3EVIA 3IPZA 4HJ2A 4MABA 4TR3A 1OC3A 4V1Ap 2E7PA 3H8QA 3KH7A 3TRQA 3VLNA 1GULA 3DXBA 4MH2A 1OC9B 3UAPA 3IHGA 3ERWA 2AV4A 3HZ4A 1MDJA 4YQUA 5HQPA 4BL7B 5ECIB 4AJ8A 2K9FA 1X5EA 2R6KA 2RUFA 5CP1A 2VL3A 3DIEA 4GQFA 2A2SA 1EP7A 2HRFA 3IAM2 3MIXA 5IOWA 4FYUA 2WJUA 2EC4A 2H76A 2VL9A 2QGVA 1GWCA 4EE0A 2H1GA 5JWQB 3GX8A 3LXTA 3G7IA 4TVEA 4PUFC 1EOHA 3E9JB 3MDKA 4EVMA 1WMJA 4OFMA 5KN0A 2HFDA 2DIYA 3RHCA 3TUEA 3EINA 4J57E 1PRXA 1JLVA 2O7KA 1QGVA 2L6DA 4AJ7A 1OC8A 4K7OA 1Z7PA 3HA9A 1FOHA 4JRRA 4HJMA 2GSSA 2H6ZA 4N11A 3E3EA 2VUPA 5INYA 1GTBA 3KH9A 3Q6OA 1V58A 4CW9A 3MWHA 3TKRA 4TXVA 5HFKA 3BOAA 3RAZA 4IHUA 2D2ZA 1XXUA 2X49A 2GSTA 5KOXA 2DKHA 3ZIVA 2VLVA 2L4QA 3QOUA 1OKTA 3RPPA 5IO0A 1XWGA 3TRPA 3HYPA 4HOJA 4EUYA 1ILOA 3GKXA 4MNNA 4XRAA 4Q5NA 5ECQB 2ZUPA 1ERWA 1OAZA 3L9SA 1BX9A 13GSA 1M0UA 5D93A 1XWKA 5DCGA 1F6MC 4XS4A 1EEMA 3F3RA 2FA8A 1H4OA 1WRYA 5IPGA 2LRCA 5D9VA 1ST9A 1AQWA 3F0IA 2FY6A 3GKNA 2PVQA 2C3NA 4JBBA 4WR4A 3Q19A 5J4UA 3D6IA 2B5YA 1F2EA 4RQRA 2AJQB 3EYTA 22GSA 1A23A 2VIMA 5AIVA 1T3BA 4NPBA 3DMLA 4TR1B 2YN1A 4LL4B 5IIZA 2CQ9A 4OFNA 1R7HA 4BA7A 2GZPA 3F8UA 1TK0B 1BJXA 1DSBA 2R5GA 3GL5A 4MF6A 2PUKC 1GNEA 4YAPA 3UBLA 2H0GA 2YANA 1M2DA 1WPIA 5AIXA 5AN1A 3PGTA 2WS2A 3QD9A 4RUVA 2LNTA 3SWLA 3TKSE 2L59A 5D9XA 4HI7A 3LXZA 2YZHA 3IK7A 4BVYA 1PA3A 3FHKA 3GRXA 1G6WA 3IAS2 5JWRB 1A0FA 1TRWA 3DGQA 1YZXA 1YDKA 4MPFA 2F9SA 1BYEA 4ECCA 4YH2A 1RK4A 1FOVA 2VL2C 1ERVA 4BVXB 2A4VA 4POBA 1AXDA 3TJKA 3FKFA 3GYKA 1WJKA 3ZREA 3IA1A 2TRCP 2CAQA 5DALA 1XOAA 4Z2UA 4KDXA 5LD0A 4MLYA 1GLQA 3IDVA 2JZSA 2KLXA 3E0UA 4G0LA 1AAZA 5IMCA 2FGXA 6GSXA 3MYDA 1QUWA 4FIWA 4TW5A 5B7CA 1JZRA 1UN2A 2RM5A 2CVDA 1AW9A 4IJ3A 1YJ6A 4XS6A 3TCOA 2G2QA 3D5JA 2F51A 2H70A 2GQLA 3M3MA 3O76A 1SU9A 5JCGA 4JEDA 5DJMA 2A2RA 3IRAA 4ZL8A 4L0WA 1FVJA 3ERFA 5G1KA 1VF3A 3GHAA 3RHBA 5GAPD 3EU4A 4N0VA 1DE1A 3A5IA 2IIYA 1O85A 6GSTA 4XS4B 3JCML 3CSJA 4Q5FA 1TJDA 1EV4A 1TTZA 2VOCA 4IP6A 4J56E 1BAYA 1O8WA 3L9UA 1O8XA 2AUVA 2H75A 2FD3A 2K18A 5G5FA 5G2ZA 5B8BA 3GA4A 5ECPB 3ZFLA 2N5FA 2CV4A 3M9JA 3F9UA 5J3RA 3H1NA 2HE3A 5C04A 2REMA 5G1LA 1K0CA 1T00A 1SJIA 5G5EA 1V9WA 2HRKA 3IXRA 3C1SA 3EU3A 3CTFA 3IOSA 3D22A 6GSSA 5L71A 3ME7A 4MZWA 2IPAA 4TN8A 5KN2A 1T4ZA 1O81A 2L4CA 4ZILA 2HI7A 4KNDA 12GSA 2H74A 1HD2A 1PGTA 2YWOA 1K3YA 3F63A 4PTSA 2B7JA 4TXOA 5IMDA 2R0CA 5ENUA 3ZITA 1QFNA 1JZWA 4AF2A 19GSA 1TU7A 18GSA 3DRNA 5GAND 3ZZXA 1G6YA 2PGTA 3R3EA 2V41A 1U88A 3FZ5A 5E4WA 3LQ7A 3MSZA 2I4AA 3PR8A 8GSSA 4KE3A 4RQXA 3KJYA 2NVLA 3NZNA 3PH9A 4WEYA 1SENA 4GSSA 1XPVA 2B3SA 4XTSA 1PN0A 5FHIA 5DALB 1KEBA 1X9MB 4F03A 1SL0B 2LQQA 3QCPA 3D4MA 1BEDA 4XCSA 3J7Yk 1XCCA 4KDUA 2OBIA 4LMWA 3C71A 2XPDA 3LW9A 2VCZA 1VF4A 2I1UA 1Z5YE 4WF5A 3I43A 4JR6A 5F8BA 3QFAC 2CVKA 3UIWA 1WOUA 1SKSB 4GSTA 5IMFA 3RBTA 3TOUA 2DJ3A 4DSSA 2VCWA 4IKHA 2AYTA 6GSVA 2HZEA 4DEJA 2WGRA 1NHYA 2KUCA 4N0ZA 3C7MA 3LORA 4KCEA 2IWTA 3FR9A 2PPTA 1NM3A 2B5EA 2VLTA 2TIRA 3GMFA 1GUMA 2L5LA 3M9KA 5G31A 3H93A 3LYKA 2GSQA 3F3QA 1XFLA 4EXJA 3TKQA 4K0GA 1A2LA 1EGRA 1GRXA 5HR0A 3UL3A 2V2GA 3L9VA 3G7YA 20GSA 7GSSA 3R2QA 2LSTA 1A2MA 3A5WA 1AQVA 3A2VA 10GSA 1GSSA 3M8NA 1Z6MA 5D96A 1PSQA 1UVZA 4A5PA 3ERGA 1W4VA 2PN8A 4GCIA 2GT6A 3KGKA 3GURA 2O85A 4O5QA 4PUAA 1U87A 4MA9A 3QAGA 2B1LA 3N5OA 2PMTA 4WBRD 2FCHA 2HLSA 2O87A 4N10A 3UVHA 5ECMB 1ZYQB 4NHWA 5DBQA 2X8GA 2OE1A 4TRXA 4X1UA 2X64A 1Z9HA 2JADA 3ZTLA 1XVWA 2OE0A 3UEMA 4OFTA 4RI6A 4YKGA 4ECBA 3H79A 3UBKA 1XZOA 4PURA 4YAVA 3G9BA 1JLWA 2C3QA 5J9BA 4ECJA 2XHFA 5F0GA 2WZ9A 3HHVA 1X9WB 4TXOB 3BJ5A 1TXXA 1T8EB 2IMDA 4YQMA 1FHEA 1ERUA 3W6GA 2YJ7A 2DJ1A 2HSYA 1Z6NA 4K2XA 3IC8A 4PGTA 4ZXGA 2GZZA 4G9HA 3EWLA 4FO5A 3TJGA 2LJKA 2HXKA 3APQA 5F06A 1KBNA 5CRDA 1S3AA 4MJEA 2VD1A 5EL8A 4D73A 4O5RA 1B8XA 4RI7A 4KF9A 2C4JA 4QQ7A 2JSYA 4CY8A 4EIQA 3L4NA 2VL2A 2YWNA 1PL1A 4XIHA 1GSYA 5KN3A 2H73A 5J5NA 3TRXA 3P8WA 3H4KA 5B6NA 1E2YA 4GWRA 4XHMA 4X0XA 4PQHA 3GSTA 1ZGNA 4HQZA 3FR6A 1K0DA 4EKZA 5JCWA 1ON4A 5ECSA 2DLXA 3W8SA 3HCZA 5AISA 2K8VA 2HT9A 1HNAA 2GQMA 3QR6A 5DQSA 1B4QA 3A3TA 4ML6A 3GKKA 3TKPA 2HZFA 1TP9A 2LRTA 4DSSB 4K6XA 3UARA 2F3MA 3L78A 4K7IA 1QXHA 2B5XA 4NAXA 2HZEB 3HKRA 1T4YA 2GLRA 4ULXA 2CVBA 5IMAA 1R5PA 4ACSA 4PX1A 2H01A 4I97A 1CQGA 1TRUA 1E6BA 4USSA 2N5BA 5HFGA 3ZMKA 4MMMA 2GS3A 4EO3A 5HR3A 1YEPA 1TI1A 2JACA 2VCVA 2ZNMA 3O6TA 4GLTA 4NMUA 2YPMA 3HZ8A 2PBJA 4HEA2 2H0IA 2DIZA 1OE7A 2PVOC 1J0FA 4H86A 1X5DA 1S3CA 5DCHA 2OBKA 5JCUA 4HZ2A 3RPNA 4OWYA 4Q5QA 1K3OA 1H75A 1ABAA 1V98A 2YV9A 5KN1A 1EV9A 2BTOT 1J9BA 4V2MA 5CAXA 2C0DA 1LJRA 5EVOA 4TR4A 3FZ4A 3FR3A 4ML1A 1SK1A 2CZ2A 4I5QA 3KXOA 3F6DA 1U3AA 2OE3A 1XW6A 3HVSA 1K0NA 3US3A 1FO5A 3GH6A 4CDOA 4PQ1A 1WIKA 2H6YA 4TOPA 1NSWA 3BD2A 2VCTA 2FWEA 4CHSA 2K8SA 4YKFA 4G19A 1ZYPA 4YQVA 3DKSA 4F9ZA 2VCQA 3CTGA 3RDWA 3DYRA 2LNSA 4NXIA 1JZOA 2MMOA 5GSSA 3CRTA 4KH7A 4O7HA 1V2AA 5J9CA 1PX7A 1R5AA 3TB2A 2AAWA 5ID2A 4MF5A 2A2PA 1Y25A 2DJ0A 4ZBBA 2LUSA 3C8EA 4G0IA 1WWJA 3A2XA 1EZKA 4MJBA 4OCEA 4TR0A 4JU5A 1F9MA 2H66A 4K0NA 1B4PA 3QAVA 4I2UA 3KP8A 2MBSA 4HDEA 4KCAA 4IS0A 1U3IA 1Z7RA 1ERTA 3DVWA 1DUGA 3DWVA 4MCUA 4PXOA 3ZFBA 1K0AA 1M2AA 2GQKA 1GUKA 4OMVA 4OCFA 3FZAA 2X8HA 4O5UA 1RQMA 3D4TA 3ZRDA 1BQ7A 2YOIA 4FYBA 3V1WA 3VPQA 1GUHA 1EP8A 3VWWA 1TK8B 2H30A 5F05A 5COHA 5JWOB 2X8CA 2VM2A 3WGEA 5DJLA 2DKIA 5E59A 3HJMA 1DBYA 1T1VA 4BWSA 2A4HA 4X4JA 4EIPA 5DQYA 1VRSD 4WETA 1EEJA 1JHBA 4WF4A 1TDIA 4PQIA 4ZB8A 9GSSA 4GSNA 4AGSA 5EY6A 1K0BA 4NV5A 4KSOA 16GSA 3IE3A 2IL3A 2ON5A 3BCIA 3G7JA 1XIYA 4POMA 2NBSA 4JE1A 4WR5A 1FB0A 3KCMA 3VI5A 1ZYNA 1MDIA 1M99A 3F4SA 2R4VA 5IM9A 3KMOA 3QPMA 4V2NA 3EE2A 2JSZA 2GZYA 1R26A 4P3YB 2RIIA 3AY8A 1DE2A 3WT1A 2GT5A 3EMPA 2O89A 4IW9A 3ZYWA 4G2EA 1OC9A 4HZ4A 3FW2A 1O6JA 3IR4A 3J7Yb 3VI7A 1GH2A 1NHOA 1JZDA 4BVYB 1B9XC 3F4RA 3M1GA 3QAWA 1I5GA 2BJXA 2FWHA 3D21A 2UZ8A 2PU9C 2GGTA 2K6VA 1J08A 2ZCTA 1ZYEA 2ON7A 2EIRA 5ELGA 3I6AA 4Z7XA 3TJFA 2OADA 3HD5A 3U5RE 4F2IA 3LEFA 5ECRB 2KP2A 1O73A 1URMA 4BPYA 1MD4A 2QC7A 1FAAA 5ID2B 2AB6A 5CYYA 1VF2A 4LMVA 5G30A 3ZVJA 3APOA 1YEXA 1X0RA 1PL2A 4IQAA 4EDZA 4KA0A 4MF7A 2HSMA 1MTCA 4ZBAA 2ALBA 3CRUA 1PX6A 3KTBA 2KP1A 4ILFA 5FT3A 4ZB9A 1LU4A 5LCZA 3GSSA 2XPEA 3BBYA 2MZCA 2YP6A 4KUNA 3GX0A 3OR5A 1B48A 2FNOA 1WP0A 1TRVA 3WYWA 5DDLA 5CO3A 3HDCA 5CRHA 2HSHA 4KAEA 4K2DA 4POKA 1RW1A 2P0GA 1FVKA 5BRTA 3GTUA 2E0QA 1TW9A 4XS1A 2P31A 2GTUA 1AQXA 1YQ1A 1A8LA 3O3TA 2V32A 3KZQA 2M72A 4GTUA 3LG6A 3CYNA 4KDYA 2P5RA 3KIJA 4HQSA 2IFQA 3P7XA 2XC2A 1TRSA 1GP1A 2B1KA 1IYIA 1N2AA 1X9SB 2LKUA 4PNGA 1WE0A 2C0FA 2DMMA 3TDGA 2X99A 2MBTA 1HQOA 1HYUA 3CXGA 4Z2RA 4I8BA 1OVNA 4WXTA 1M9AA 4LA1A 4MPGA 4ECIA 1GSEA 1Z3EA 3EPTA 1TOFA 1QK8A 2V6KA 1V57A 3IV4A 4ISDA 2LJAA 2C0GA 5A4VA 2RUEA 3GL3A 5B6MA 3ZIJA 5EPFA 4TR1A 1MEKA 5IPHA 3GV1A 1OE8A 3LGCA 2OA7A 4LL1B 1Q98A 1VF1A 2G0FA 2L5OA 1Y6EA 4L5OA 3TOTA 2EIOA 1PD21 4CY6A 2C8UA 2C1YA 3GIXA 2CA8A 5AGYA 5ABRA 1PQNA 3HJPA 2P5QA 2R2JA 5CREA 3CSIA 3FK8A 3C73A 3M0FA 3W8JA 5H5SA 1M9BA 2IJYA 1GTAA 2H8LA 2R37A 3LSZA 2GVPA 1PMTA 3CMIA 3GUSA 2V1MA 1UA5A 3UJ1A 4FQUA 2O8VB 2WULA 1BG5A 4JZQA 4ZBDA 3VURA 2NTOA 3TKSC 1G0TA 2CT6A 5BMUA 4BVXA 4O32A 1GL8A 3KMNA 3PINA 4GF0A 1SKRB 4KX4A 1QQ2A 4K7NA 3WGXA 3IBHA 4ZL9A 4ZL7A 1G7EA 1PKWA 4E8HA 3FYGA 1HNCA 3ZLPA 2VM1A 2L57A 4EF0A 2I81A 1AIUA 4EDYA 2VD0A 2C3TA 1PKZA 3ZL5A 1B9YC 1EWXA 1PN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOF A;  2IMF A;  2B7K A;  3GTU B;  4MK3 A;  2XBQ A;  3VWX A;  6GSU A;  2DJK A;  4AJ6 A;  5IMZ A;  3IHQ A;  3TJJ A;  4K9Z A;  1XW9 A;  5D73 A;  3L0H A;  5ELA A;  1TK5 B;  1SK2 A;  1XW5 A;  4N30 A;  2IFQ B;  2MMZ A;  1SYR A;  4GRF A;  4FYC A;  4V1A g;  3TJB A;  1A0R P;  1K0O A;  2PWJ A;  1MDK A;  1F37 A;  3TGZ A;  3CBU A;  3I9V 2;  2GSR A;  4DVC A;  2N5A A;  2FA4 A;  2JL4 A;  1Q4J A;  1I9D A;  1GSF A;  4BWQ A;  2BMX A;  3D0Z A;  3UOM A;  2FLS A;  2LRN A;  4FH8 A;  4HU7 A;  6GSW A;  2HYX A;  1FB6 A;  1OKD A;  2MMN A;  4IP1 A;  1SL2 B;  2CX3 A;  4L0U A;  5A4W A;  1ACV A;  1TI3 A;  4IQ1 A;  5DAK A;  4F82 A;  1THO A;  5A4U A;  2WCI A;  3KM6 A;  5H5Q A;  2YJH A;  3FRC A;  2JU5 A;  4MP4 A;  2IMK A;  5C00 A;  5HR1 A;  2YCD A;  2CX4 A;  3LWA A;  1ZL9 A;  2DC5 A;  1F3A A;  4F0B A;  5H5R A;  3FY7 A;  3QMX A;  2L6C A;  2H1B A;  4IN0 A;  2OJL A;  1ZCP A;  4Q5R A;  2NDO A;  3WGD A;  11GS A;  2F8F A;  5J41 A;  4QL9 A;  2IN3 A;  3QFB C;  1XWC A;  2CAI A;  2QKE A;  5D9T A;  2MYG A;  4IVF A;  4G10 A;  4E8E A;  2E2M A;  1XVQ A;  3U6V A;  2HNL A;  4MZC A;  4TKY A;  3EUR A;  1KNG A;  5IO2 A;  4D73 B;  2IMI A;  3FEU A;  3ZVJ D;  2C80 A;  1M7T A;  2DSA A;  1OYJ A;  5IQY A;  17GS A;  3ISO A;  1X5C A;  1KTE A;  2H1A A;  1U6T A;  2HRN A;  1GTU A;  2I3Y A;  1IYH A;  4MJA A;  5CRG A;  3VFI A;  1NW2 A;  2WB9 A;  4DSQ A;  1XBS A;  4MH3 A;  5B8A A;  1YKA A;  5CRW A;  2TRX A;  1ZZY A;  2FUG 2;  4QL7 A;  3MNG A;  4IJI A;  2FWG A;  2FHE A;  3HY2 A;  1TU8 A;  2QSI A;  1M2B A;  1A8Y A;  1ZOF A;  2NPB A;  1CQH A;  1N8J A;  1GLP A;  1FW1 A;  2VO4 A;  2CZ3 A;  2LV3 A;  3A2W A;  2YZU A;  3CSH A;  4XRD A;  4NHZ A;  1GTI A;  3UMA A;  5ECK B;  1YY7 A;  3GNJ A;  2VCX A;  3IK9 A;  1XWA A;  4MJC A;  1ZMA A;  3P2A A;  3ZML A;  3HJO A;  3KP9 A;  4HU9 A;  4HS1 A;  2VLU A;  4V2L A;  1SL1 B;  2ES7 A;  3GH9 A;  2IME A;  2VAF A;  2H71 A;  4X43 A;  3GKM A;  4NWY A;  3F6F A;  2FWF A;  1GSU A;  3VPT A;  1SJ6 A;  5IOX A;  5F07 A;  2J9H A;  3VWU A;  4KB3 A;  1K0M A;  2OKA A;  4KGI A;  4MZB A;  3KTL A;  2OAC A;  3ME8 A;  4L8E A;  2RM6 A;  1EGO A;  1GNW A;  1JFU A;  1AUC A;  3Q18 A;  4MDC A;  2LTK A;  1LBK A;  3WT2 A;  4OD7 A;  4K1F A;  1GSQ A;  5DVB A;  5A5K A;  2RLI A;  3UVT A;  5DAK B;  3DD3 A;  3K8N A;  3LJR A;  3WD6 A;  1SD8 A;  3VWV A;  2LS5 A;  2YWI A;  4O92 A;  3ED3 A;  3EC3 A;  1W89 A;  3GN3 A;  4GXZ A;  3S9F A;  2DJ2 A;  2WDU A;  1SKW B;  3HVX A;  4ID0 A;  2R3X A;  4NV2 A;  3EMX A;  1SYX A;  3BCK A;  2PER A;  2F8A A;  3LYP A;  4BL7 A;  4L5L A;  2JZT A;  4I6X A;  2H6X A;  1AC1 A;  2WRT A;  2H0H A;  3HXS A;  5LNK e;  1SK0 A;  1FG4 A;  1SD9 A;  3VK9 A;  2M80 A;  4HUA A;  4WBJ A;  1XWB A;  3IC4 A;  2B6M A;  5ECH B;  2XBI A;  1A24 A;  1VGL A;  4K8M A;  4LLR A;  1S3D A;  3C1R A;  2H1D A;  1V40 A;  3N9J A;  2H72 A;  3APS A;  5CNW A;  4POL A;  5HR2 A;  2LQO A;  5GZZ B;  1UC7 A;  1K3L A;  4EC0 A;  4J2F A;  1HNB A;  2EIQ A;  3HVV A;  3TKS A;  4KW6 A;  3SBC A;  1USB A;  5KEJ A;  1SJZ A;  2DJJ A;  1GSD A;  3P90 A;  4IEL A;  1C72 A;  1QMV A;  2KHP A;  2WFC A;  4I2T A;  1R4W A;  5FWG A;  2J23 A;  2DML A;  4JR4 A;  4F0C A;  5ECL B;  2KOK A;  4OO4 A;  5D9W A;  2MMA A;  4ZB6 A;  2Z9S A;  2DBC A;  4WKW A;  14GS A;  4PNF A;  1THX A;  3FZ9 A;  4EL1 A;  2YWM A;  1YF0 A;  1MD3 A;  5ECN B;  2M46 A;  2YV7 A;  3KEB A;  3DVX A;  4OO5 A;  1ML6 A;  2LJR A;  3Q74 A;  1T7P B;  1F3B A;  3KD0 A;  1XOB A;  3NIV A;  3DEX A;  2E2G A;  3MAK A;  5D8I A;  4ZIJ A;  2I9H A;  1TKD B;  1O7U A;  4GQC A;  5GST A;  2LEG A;  2V6O A;  2GDR A;  4KSM A;  1YKC A;  3I69 A;  5ECO B;  1A2J A;  6GSY A;  5HFI A;  4IBP A;  1EOG A;  2YNX A;  3GFK A;  4IGJ A;  3QDN A;  2AHE A;  2JZR A;  1YF1 A;  3F4T A;  3LFL A;  5IMV A;  2C0E A;  1G7O A;  4DSR A;  2H19 A;  3EVI A;  3IPZ A;  4HJ2 A;  4MAB A;  4TR3 A;  1OC3 A;  4V1A p;  2E7P A;  3H8Q A;  3KH7 A;  3TRQ A;  3VLN A;  1GUL A;  3DXB A;  4MH2 A;  1OC9 B;  3UAP A;  3ERW A;  2AV4 A;  3HZ4 A;  1MDJ A;  4YQU A;  5HQP A;  5ECI B;  4AJ8 A;  2K9F A;  1X5E A;  2R6K A;  2RUF A;  5CP1 A;  2VL3 A;  3DIE A;  4GQF A;  2A2S A;  1EP7 A;  2HRF A;  3IAM 2;  5IOW A;  4FYU A;  2WJU A;  2EC4 A;  2H76 A;  2VL9 A;  2QGV A;  1GWC A;  4EE0 A;  2H1G A;  5JWQ B;  3GX8 A;  3LXT A;  3G7I A;  4TVE A;  4PUF C;  1EOH A;  3E9J B;  3MDK A;  4EVM A;  1WMJ A;  4OFM A;  5KN0 A;  2HFD A;  2DIY A;  3RHC A;  3TUE A;  3EIN A;  4J57 E;  1PRX A;  1JLV A;  2O7K A;  1QGV A;  2L6D A;  4AJ7 A;  1OC8 A;  4K7O A;  1Z7P A;  3HA9 A;  4JRR A;  4HJM A;  2GSS A;  2H6Z A;  4N11 A;  3E3E A;  2VUP A;  5INY A;  1GTB A;  3KH9 A;  3Q6O A;  1V58 A;  4CW9 A;  3MWH A;  3TKR A;  4TXV A;  5HFK A;  3BOA A;  3RAZ A;  4IHU A;  2D2Z A;  1XXU A;  2GST A;  3ZIV A;  2VLV A;  2L4Q A;  3QOU A;  1OKT A;  3RPP A;  5IO0 A;  1XWG A;  3TRP A;  3HYP A;  4HOJ A;  4EUY A;  1ILO A;  3GKX A;  4XRA A;  4Q5N A;  5ECQ B;  2ZUP A;  1ERW A;  1OAZ A;  3L9S A;  1BX9 A;  13GS A;  1M0U A;  5D93 A;  1XWK A;  5DCG A;  1F6M C;  4XS4 A;  1EEM A;  3F3R A;  2FA8 A;  1H4O A;  1WRY A;  5IPG A;  2LRC A;  5D9V A;  1ST9 A;  1AQW A;  3F0I A;  2FY6 A;  3GKN A;  2PVQ A;  2C3N A;  4JBB A;  4WR4 A;  3Q19 A;  5J4U A;  3D6I A;  2B5Y A;  1F2E A;  4RQR A;  2AJQ B;  3EYT A;  22GS A;  1A23 A;  2VIM A;  5AIV A;  1T3B A;  4NPB A;  3DML A;  4TR1 B;  2YN1 A;  4LL4 B;  5IIZ A;  2CQ9 A;  4OFN A;  1R7H A;  4BA7 A;  2GZP A;  3F8U A;  1TK0 B;  1BJX A;  1DSB A;  2R5G A;  3GL5 A;  4MF6 A;  2PUK C;  1GNE A;  4YAP A;  3UBL A;  2H0G A;  2YAN A;  1M2D A;  1WPI A;  5AIX A;  5AN1 A;  3PGT A;  2WS2 A;  3QD9 A;  4RUV A;  2LNT A;  3SWL A;  3TKS E;  2L59 A;  5D9X A;  4HI7 A;  3LXZ A;  2YZH A;  3IK7 A;  4BVY A;  1PA3 A;  3FHK A;  3GRX A;  1G6W A;  3IAS 2;  5JWR B;  1A0F A;  1TRW A;  3DGQ A;  1YZX A;  1YDK A;  4MPF A;  2F9S A;  1BYE A;  4ECC A;  4YH2 A;  1RK4 A;  1FOV A;  2VL2 C;  1ERV A;  2A4V A;  4POB A;  1AXD A;  3TJK A;  3FKF A;  3GYK A;  1WJK A;  3ZRE A;  3IA1 A;  2TRC P;  2CAQ A;  5DAL A;  1XOA A;  4KDX A;  5LD0 A;  4MLY A;  1GLQ A;  3IDV A;  2JZS A;  2KLX A;  3E0U A;  1AAZ A;  5IMC A;  2FGX A;  6GSX A;  1QUW A;  4FIW A;  4TW5 A;  5B7C A;  1JZR A;  1UN2 A;  2RM5 A;  2CVD A;  1AW9 A;  4IJ3 A;  1YJ6 A;  4XS6 A;  3TCO A;  2G2Q A;  3D5J A;  2F51 A;  2H70 A;  2GQL A;  3M3M A;  3O76 A;  1SU9 A;  5JCG A;  4JED A;  5DJM A;  2A2R A;  3IRA A;  4ZL8 A;  4L0W A;  1FVJ A;  3ERF A;  5G1K A;  1VF3 A;  3GHA A;  3RHB A;  5GAP D;  3EU4 A;  4N0V A;  1DE1 A;  2IIY A;  1O85 A;  6GST A;  4XS4 B;  3JCM L;  3CSJ A;  4Q5F A;  1TJD A;  1EV4 A;  1TTZ A;  2VOC A;  4IP6 A;  4J56 E;  1BAY A;  1O8W A;  3L9U A;  1O8X A;  2AUV A;  2H75 A;  2FD3 A;  2K18 A;  5G5F A;  5G2Z A;  5B8B A;  3GA4 A;  5ECP B;  3ZFL A;  2N5F A;  2CV4 A;  3M9J A;  3F9U A;  5J3R A;  3H1N A;  2HE3 A;  5C04 A;  2REM A;  5G1L A;  1K0C A;  1T00 A;  1SJI A;  5G5E A;  1V9W A;  3IXR A;  3C1S A;  3EU3 A;  3CTF A;  3IOS A;  3D22 A;  6GSS A;  5L71 A;  3ME7 A;  4MZW A;  2IPA A;  4TN8 A;  5KN2 A;  1T4Z A;  1O81 A;  2L4C A;  4ZIL A;  2HI7 A;  4KND A;  12GS A;  2H74 A;  1HD2 A;  1PGT A;  2YWO A;  1K3Y A;  3F63 A;  2B7J A;  4TXO A;  5IMD A;  5ENU A;  3ZIT A;  1QFN A;  1JZW A;  4AF2 A;  19GS A;  1TU7 A;  18GS A;  3DRN A;  5GAN D;  3ZZX A;  1G6Y A;  2PGT A;  2V41 A;  1U88 A;  3FZ5 A;  5E4W A;  3LQ7 A;  3MSZ A;  2I4A A;  3PR8 A;  8GSS A;  4KE3 A;  4RQX A;  3KJY A;  2NVL A;  3NZN A;  3PH9 A;  4WEY A;  1SEN A;  4GSS A;  1XPV A;  2B3S A;  4XTS A;  5FHI A;  5DAL B;  1KEB A;  1X9M B;  4F03 A;  1SL0 B;  2LQQ A;  3QCP A;  3D4M A;  1BED A;  4XCS A;  3J7Y k;  1XCC A;  4KDU A;  2OBI A;  4LMW A;  3C71 A;  2XPD A;  2VCZ A;  1VF4 A;  2I1U A;  1Z5Y E;  4WF5 A;  3I43 A;  4JR6 A;  5F8B A;  3QFA C;  2CVK A;  3UIW A;  1WOU A;  1SKS B;  4GST A;  5IMF A;  3RBT A;  3TOU A;  2DJ3 A;  4DSS A;  2VCW A;  4IKH A;  2AYT A;  6GSV A;  2HZE A;  4DEJ A;  2WGR A;  1NHY A;  2KUC A;  4N0Z A;  3C7M A;  3LOR A;  4KCE A;  2IWT A;  3FR9 A;  2PPT A;  1NM3 A;  2B5E A;  2VLT A;  2TIR A;  3GMF A;  1GUM A;  2L5L A;  3M9K A;  5G31 A;  3H93 A;  3LYK A;  2GSQ A;  3F3Q A;  1XFL A;  4EXJ A;  3TKQ A;  4K0G A;  1A2L A;  1EGR A;  1GRX A;  5HR0 A;  3UL3 A;  2V2G A;  3L9V A;  3G7Y A;  20GS A;  7GSS A;  3R2Q A;  2LST A;  1A2M A;  3A5W A;  1AQV A;  3A2V A;  10GS A;  1GSS A;  3M8N A;  1Z6M A;  5D96 A;  1PSQ A;  1UVZ A;  3ERG A;  1W4V A;  2PN8 A;  4GCI A;  2GT6 A;  3KGK A;  3GUR A;  2O85 A;  4PUA A;  1U87 A;  4MA9 A;  3QAG A;  2B1L A;  3N5O A;  2PMT A;  4WBR D;  2FCH A;  2HLS A;  2O87 A;  4N10 A;  3UVH A;  5ECM B;  1ZYQ B;  4NHW A;  5DBQ A;  2X8G A;  2OE1 A;  4TRX A;  4X1U A;  2X64 A;  1Z9H A;  2JAD A;  3ZTL A;  1XVW A;  2OE0 A;  3UEM A;  4OFT A;  4RI6 A;  4ECB A;  3H79 A;  3UBK A;  1XZO A;  4PUR A;  4YAV A;  3G9B A;  1JLW A;  2C3Q A;  5J9B A;  4ECJ A;  2XHF A;  5F0G A;  2WZ9 A;  3HHV A;  1X9W B;  4TXO B;  3BJ5 A;  1TXX A;  1T8E B;  2IMD A;  4YQM A;  1FHE A;  1ERU A;  3W6G A;  2YJ7 A;  2DJ1 A;  2HSY A;  1Z6N A;  4PGT A;  4ZXG A;  2GZZ A;  4G9H A;  3EWL A;  4FO5 A;  3TJG A;  2LJK A;  2HXK A;  3APQ A;  5F06 A;  1KBN A;  5CRD A;  1S3A A;  4MJE A;  2VD1 A;  5EL8 A;  4D73 A;  4O5R A;  1B8X A;  4RI7 A;  2C4J A;  4QQ7 A;  2JSY A;  3L4N A;  2VL2 A;  2YWN A;  1PL1 A;  4XIH A;  1GSY A;  5KN3 A;  2H73 A;  5J5N A;  3TRX A;  3P8W A;  3H4K A;  5B6N A;  1E2Y A;  4GWR A;  4XHM A;  4X0X A;  4PQH A;  3GST A;  1ZGN A;  4HQZ A;  3FR6 A;  1K0D A;  4EKZ A;  5JCW A;  1ON4 A;  5ECS A;  2DLX A;  3W8S A;  3HCZ A;  5AIS A;  2K8V A;  2HT9 A;  1HNA A;  2GQM A;  3QR6 A;  5DQS A;  1B4Q A;  3A3T A;  4ML6 A;  3GKK A;  3TKP A;  2HZF A;  1TP9 A;  2LRT A;  4DSS B;  4K6X A;  3UAR A;  2F3M A;  3L78 A;  4K7I A;  1QXH A;  2B5X A;  4NAX A;  2HZE B;  3HKR A;  1T4Y A;  2GLR A;  4ULX A;  2CVB A;  5IMA A;  1R5P A;  4ACS A;  4PX1 A;  2H01 A;  4I97 A;  1CQG A;  1TRU A;  1E6B A;  5HFG A;  2N5B A;  3ZMK A;  4MMM A;  2GS3 A;  4EO3 A;  5HR3 A;  1YEP A;  1TI1 A;  2JAC A;  2VCV A;  2ZNM A;  3O6T A;  4GLT A;  4NMU A;  2YPM A;  3HZ8 A;  2PBJ A;  4HEA 2;  2H0I A;  2DIZ A;  1OE7 A;  2PVO C;  1J0F A;  4H86 A;  1X5D A;  1S3C A;  5DCH A;  2OBK A;  5JCU A;  4HZ2 A;  3RPN A;  4OWY A;  4Q5Q A;  1K3O A;  1H75 A;  1ABA A;  1V98 A;  2YV9 A;  5KN1 A;  1EV9 A;  2BTO T;  1J9B A;  4V2M A;  5CAX A;  2C0D A;  1LJR A;  5EVO A;  4TR4 A;  3FZ4 A;  3FR3 A;  4ML1 A;  1SK1 A;  2CZ2 A;  4I5Q A;  3KXO A;  3F6D A;  1U3A A;  2OE3 A;  1XW6 A;  3HVS A;  1K0N A;  3US3 A;  1FO5 A;  3GH6 A;  4CDO A;  4PQ1 A;  1WIK A;  2H6Y A;  4TOP A;  1NSW A;  3BD2 A;  2VCT A;  2FWE A;  4CHS A;  2K8S A;  4G19 A;  4YQV A;  3DKS A;  4F9Z A;  2VCQ A;  3CTG A;  3RDW A;  3DYR A;  2LNS A;  4NXI A;  1JZO A;  2MMO A;  5GSS A;  3CRT A;  4KH7 A;  4O7H A;  1V2A A;  5J9C A;  1PX7 A;  1R5A A;  3TB2 A;  2AAW A;  5ID2 A;  4MF5 A;  1Y25 A;  2DJ0 A;  4ZBB A;  2LUS A;  3C8E A;  1WWJ A;  3A2X A;  1EZK A;  4MJB A;  4OCE A;  4TR0 A;  4JU5 A;  1F9M A;  2H66 A;  4K0N A;  1B4P A;  3QAV A;  4I2U A;  3KP8 A;  2MBS A;  4HDE A;  4KCA A;  4IS0 A;  1U3I A;  1Z7R A;  1ERT A;  3DVW A;  1DUG A;  3DWV A;  4MCU A;  4PXO A;  3ZFB A;  1K0A A;  1M2A A;  2GQK A;  1GUK A;  4OMV A;  4OCF A;  3FZA A;  2X8H A;  1RQM A;  3D4T A;  3ZRD A;  1BQ7 A;  2YOI A;  4FYB A;  3V1W A;  3VPQ A;  1GUH A;  1EP8 A;  3VWW A;  1TK8 B;  2H30 A;  5F05 A;  5COH A;  5JWO B;  2X8C A;  2VM2 A;  3WGE A;  5DJL A;  5E59 A;  3HJM A;  1DBY A;  1T1V A;  4BWS A;  5DQY A;  1VRS D;  4WET A;  1EEJ A;  1JHB A;  4WF4 A;  1TDI A;  4PQI A;  4ZB8 A;  9GSS A;  4GSN A;  4AGS A;  5EY6 A;  1K0B A;  4NV5 A;  4KSO A;  16GS A;  3IE3 A;  2IL3 A;  2ON5 A;  3BCI A;  3G7J A;  1XIY A;  4POM A;  2NBS A;  4JE1 A;  4WR5 A;  1FB0 A;  3KCM A;  3VI5 A;  1MDI A;  1M99 A;  3F4S A;  2R4V A;  5IM9 A;  3KMO A;  3QPM A;  4V2N A;  3EE2 A;  2JSZ A;  2GZY A;  1R26 A;  4P3Y B;  2RII A;  3AY8 A;  1DE2 A;  3WT1 A;  2GT5 A;  3EMP A;  2O89 A;  4IW9 A;  3ZYW A;  4G2E A;  1OC9 A;  4HZ4 A;  3FW2 A;  1O6J A;  3IR4 A;  3J7Y b;  3VI7 A;  1GH2 A;  1NHO A;  1JZD A;  1B9X C;  3F4R A;  3M1G A;  3QAW A;  1I5G A;  2BJX A;  2FWH A;  3D21 A;  2PU9 C;  2GGT A;  2K6V A;  1J08 A;  2ZCT A;  1ZYE A;  2ON7 A;  2EIR A;  5ELG A;  3I6A A;  4Z7X A;  3TJF A;  2OAD A;  3HD5 A;  3U5R E;  4F2I A;  3LEF A;  5ECR B;  2KP2 A;  1O73 A;  1URM A;  4BPY A;  1MD4 A;  2QC7 A;  1FAA A;  5ID2 B;  2AB6 A;  5CYY A;  1VF2 A;  4LMV A;  5G30 A;  3ZVJ A;  3APO A;  1YEX A;  1X0R A;  1PL2 A;  4IQA A;  4EDZ A;  4KA0 A;  4MF7 A;  1MTC A;  4ZBA A;  2ALB A;  3CRU A;  1PX6 A;  3KTB A;  2KP1 A;  4ILF A;  5FT3 A;  4ZB9 A;  1LU4 A;  5LCZ A;  3GSS A;  2XPE A;  3BBY A;  2MZC A;  2YP6 A;  4KUN A;  3GX0 A;  3OR5 A;  1B48 A;  2FNO A;  1WP0 A;  1TRV A;  3WYW A;  5DDL A;  5CO3 A;  3HDC A;  5CRH A;  2HSH A;  4KAE A;  4K2D A;  4POK A;  1RW1 A;  2P0G A;  1FVK A;  3GTU A;  2E0Q A;  1TW9 A;  4XS1 A;  2P31 A;  2GTU A;  1AQX A;  1YQ1 A;  1A8L A;  3O3T A;  2V32 A;  3KZQ A;  2M72 A;  4GTU A;  3LG6 A;  3CYN A;  4KDY A;  2P5R A;  3KIJ A;  4HQS A;  2IFQ A;  3P7X A;  2XC2 A;  1TRS A;  1GP1 A;  2B1K A;  1IYI A;  1N2A A;  1X9S B;  2LKU A;  4PNG A;  1WE0 A;  2C0F A;  2DMM A;  3TDG A;  2X99 A;  2MBT A;  1HQO A;  1HYU A;  3CXG A;  4I8B A;  1OVN A;  4WXT A;  1M9A A;  4LA1 A;  4MPG A;  4ECI A;  1GSE A;  1Z3E A;  1TOF A;  1QK8 A;  2V6K A;  1V57 A;  3IV4 A;  4ISD A;  2LJA A;  2C0G A;  5A4V A;  2RUE A;  3GL3 A;  5B6M A;  3ZIJ A;  5EPF A;  4TR1 A;  1MEK A;  5IPH A;  3GV1 A;  1OE8 A;  3LGC A;  2OA7 A;  4LL1 B;  1Q98 A;  1VF1 A;  2G0F A;  2L5O A;  1Y6E A;  4L5O A;  3TOT A;  2EIO A;  1PD2 1;  2C8U A;  2C1Y A;  3GIX A;  2CA8 A;  5AGY A;  5ABR A;  1PQN A;  3HJP A;  2P5Q A;  2R2J A;  5CRE A;  3CSI A;  3FK8 A;  3C73 A;  3M0F A;  3W8J A;  5H5S A;  1M9B A;  2IJY A;  1GTA A;  2H8L A;  2R37 A;  3LSZ A;  2GVP A;  1PMT A;  3CMI A;  3GUS A;  2V1M A;  1UA5 A;  3UJ1 A;  2O8V B;  2WUL A;  1BG5 A;  4JZQ A;  4ZBD A;  3VUR A;  2NTO A;  3TKS C;  1G0T A;  2CT6 A;  4BVX A;  4O32 A;  1GL8 A;  3KMN A;  3PIN A;  4GF0 A;  1SKR B;  4KX4 A;  1QQ2 A;  4K7N A;  3WGX A;  3IBH A;  4ZL9 A;  4ZL7 A;  1G7E A;  1PKW A;  4E8H A;  3FYG A;  1HNC A;  3ZLP A;  2VM1 A;  2L57 A;  4EF0 A;  2I81 A;  1AIU A;  4EDY A;  2VD0 A;  2C3T A;  1PKZ A;  3ZL5 A;  1B9Y C;  1EWX A;  1PN9 A; 
#chains in the Genus database with same CATH topology
 3NOF A;  2IMF A;  2B7K A;  3GTU B;  4MK3 A;  2XBQ A;  3VWX A;  6GSU A;  2DJK A;  4AJ6 A;  5IMZ A;  3IHQ A;  3TJJ A;  4K9Z A;  1XW9 A;  5D73 A;  3L0H A;  5ELA A;  1TK5 B;  1SK2 A;  1XW5 A;  4N30 A;  2IFQ B;  2MMZ A;  1SYR A;  4GRF A;  4FYC A;  4V1A g;  3TJB A;  1A0R P;  1K0O A;  2PWJ A;  1MDK A;  1F37 A;  3TGZ A;  3CBU A;  3I9V 2;  2GSR A;  4DVC A;  2N5A A;  2FA4 A;  2JL4 A;  1Q4J A;  1I9D A;  1GSF A;  4BWQ A;  2R0P A;  2BMX A;  3D0Z A;  3UOM A;  2FLS A;  2LRN A;  4FH8 A;  4HU7 A;  6GSW A;  2HYX A;  1FB6 A;  1OKD A;  2MMN A;  4IP1 A;  1SL2 B;  2CX3 A;  4L0U A;  5A4W A;  1ACV A;  1TI3 A;  4IQ1 A;  5DAK A;  4F82 A;  1THO A;  5A4U A;  2WCI A;  3KM6 A;  5H5Q A;  2YJH A;  3FRC A;  2JU5 A;  3PPU A;  2X4A A;  4MP4 A;  2IMK A;  5C00 A;  5HR1 A;  2YCD A;  2CX4 A;  3LWA A;  1ZL9 A;  2DC5 A;  1F3A A;  4F0B A;  5H5R A;  3FY7 A;  3QMX A;  5KOW A;  2L6C A;  2H1B A;  4IN0 A;  2OJL A;  1ZCP A;  4Q5R A;  2NDO A;  3WGD A;  11GS A;  2F8F A;  5J41 A;  4QL9 A;  2IN3 A;  3QFB C;  1XWC A;  2CAI A;  2QKE A;  5D9T A;  2MYG A;  4IVF A;  4G10 A;  4E8E A;  2E2M A;  1XVQ A;  3U6V A;  2HNL A;  4MZC A;  4TKY A;  3EUR A;  1KNG A;  5IO2 A;  4D73 B;  2IMI A;  3FEU A;  3ZVJ D;  2C80 A;  1M7T A;  2DSA A;  1OYJ A;  5IQY A;  17GS A;  3ISO A;  1X5C A;  1KTE A;  2H1A A;  1U6T A;  2HRN A;  1GTU A;  2I3Y A;  1IYH A;  4MJA A;  5CRG A;  3VFI A;  1NW2 A;  2WB9 A;  4DSQ A;  1XBS A;  4MH3 A;  5B8A A;  1YKA A;  5CRW A;  2TRX A;  1ZZY A;  2FUG 2;  4QL7 A;  3MNG A;  4IJI A;  2FWG A;  2FHE A;  3HY2 A;  1TU8 A;  2QSI A;  1M2B A;  1A8Y A;  1ZOF A;  2NPB A;  1CQH A;  1N8J A;  1GLP A;  1FW1 A;  2VO4 A;  2CZ3 A;  2LV3 A;  3A2W A;  2YZU A;  3CSH A;  4XRD A;  4NHZ A;  1GTI A;  3UMA A;  5ECK B;  1YY7 A;  3GNJ A;  2VCX A;  3IK9 A;  1XWA A;  4MJC A;  1ZMA A;  3P2A A;  3ZML A;  3HJO A;  3KP9 A;  4HU9 A;  4HS1 A;  2VLU A;  4V2L A;  1SL1 B;  2ES7 A;  3GH9 A;  2IME A;  2VAF A;  2H71 A;  4X43 A;  3GKM A;  4NWY A;  3F6F A;  2FWF A;  1GSU A;  3VPT A;  1SJ6 A;  5IOX A;  5F07 A;  2J9H A;  3VWU A;  4KB3 A;  1K0M A;  2OKA A;  4KGI A;  4MZB A;  3KTL A;  2OAC A;  3ME8 A;  4L8E A;  2RM6 A;  1EGO A;  1GNW A;  1JFU A;  1AUC A;  3Q18 A;  4MDC A;  2LTK A;  1LBK A;  3WT2 A;  4OD7 A;  4K1F A;  4ICY A;  1GSQ A;  5DVB A;  5A5K A;  2RLI A;  3UVT A;  5DAK B;  3DD3 A;  3K8N A;  3LJR A;  3WD6 A;  1SD8 A;  3VWV A;  2LS5 A;  2YWI A;  4O92 A;  3ED3 A;  3EC3 A;  1W89 A;  2HRA A;  3GN3 A;  4GXZ A;  3S9F A;  2DJ2 A;  2WDU A;  1SKW B;  3HVX A;  4ID0 A;  2R3X A;  4NV2 A;  3EMX A;  1SYX A;  3BCK A;  2PER A;  2F8A A;  3LYP A;  4BL7 A;  4L5L A;  2JZT A;  4I6X A;  2H6X A;  1AC1 A;  2WRT A;  2H0H A;  3HXS A;  5LNK e;  1SK0 A;  1FG4 A;  1SD9 A;  3VK9 A;  2M80 A;  4HUA A;  4WBJ A;  1XWB A;  2R0G A;  3IC4 A;  2B6M A;  5ECH B;  2XBI A;  1A24 A;  1VGL A;  2QA2 A;  4K8M A;  4Z2T A;  4LLR A;  1S3D A;  3C1R A;  2H1D A;  1V40 A;  3N9J A;  2H72 A;  3APS A;  5CNW A;  4POL A;  5HR2 A;  2LQO A;  5GZZ B;  1UC7 A;  1K3L A;  4EC0 A;  4G0K A;  4J2F A;  1HNB A;  2EIQ A;  3HVV A;  3TKS A;  4KW6 A;  3SBC A;  1USB A;  5KEJ A;  1SJZ A;  2DJJ A;  1GSD A;  3P90 A;  3FMW A;  1C72 A;  4IEL A;  1QMV A;  2KHP A;  2WFC A;  4I2T A;  1R4W A;  5FWG A;  2J23 A;  2DML A;  4JR4 A;  4F0C A;  5ECL B;  2KOK A;  4OO4 A;  5D9W A;  2MMA A;  4ZB6 A;  2Z9S A;  2DBC A;  4WKW A;  14GS A;  4PNF A;  1THX A;  3FZ9 A;  4EL1 A;  2YWM A;  1YF0 A;  1MD3 A;  5ECN B;  2M46 A;  2YV7 A;  3KEB A;  3DVX A;  4OO5 A;  1XG8 A;  1ML6 A;  2LJR A;  3Q74 A;  1T7P B;  4K5R A;  1F3B A;  3KD0 A;  2QA1 A;  1XOB A;  3NIV A;  4K5S A;  3DEX A;  2E2G A;  3MAK A;  5D8I A;  4ZIJ A;  2I9H A;  1TKD B;  1O7U A;  4GQC A;  5GST A;  2LEG A;  2V6O A;  2GDR A;  4KSM A;  1YKC A;  3I69 A;  5ECO B;  1A2J A;  6GSY A;  5HFI A;  4IBP A;  1EOG A;  2YNX A;  3GFK A;  4IGJ A;  3QDN A;  2AHE A;  2JZR A;  1YF1 A;  3F4T A;  3LFL A;  5IMV A;  2C0E A;  1G7O A;  4DSR A;  2H19 A;  3EVI A;  3IPZ A;  4HJ2 A;  4MAB A;  4TR3 A;  1OC3 A;  4V1A p;  2E7P A;  3H8Q A;  3KH7 A;  3TRQ A;  3VLN A;  1GUL A;  3DXB A;  4MH2 A;  1OC9 B;  3UAP A;  1M3I A;  3IHG A;  3ERW A;  2AV4 A;  3HZ4 A;  1MDJ A;  4YQU A;  5HQP A;  4BL7 B;  5ECI B;  4AJ8 A;  2K9F A;  1X5E A;  2R6K A;  2RUF A;  5CP1 A;  2VL3 A;  3DIE A;  4GQF A;  2A2S A;  1EP7 A;  2HRF A;  3IAM 2;  3MIX A;  5IOW A;  4FYU A;  2WJU A;  2EC4 A;  2H76 A;  2VL9 A;  2QGV A;  1GWC A;  4EE0 A;  2H1G A;  5JWQ B;  3GX8 A;  3LXT A;  3G7I A;  4TVE A;  4PUF C;  1EOH A;  3E9J B;  3MDK A;  4EVM A;  1WMJ A;  4OFM A;  5KN0 A;  2HFD A;  2DIY A;  3RHC A;  3TUE A;  3EIN A;  4J57 E;  1PRX A;  1JLV A;  2O7K A;  1QGV A;  2L6D A;  4AJ7 A;  1OC8 A;  4K7O A;  1Z7P A;  3HA9 A;  1FOH A;  4JRR A;  4HJM A;  2GSS A;  2H6Z A;  4N11 A;  3E3E A;  2VUP A;  5INY A;  1GTB A;  3KH9 A;  3Q6O A;  1V58 A;  4CW9 A;  3MWH A;  3TKR A;  4TXV A;  5HFK A;  3BOA A;  3RAZ A;  4IHU A;  2D2Z A;  1XXU A;  2X49 A;  2GST A;  5KOX A;  2DKH A;  3ZIV A;  2VLV A;  2L4Q A;  3QOU A;  1OKT A;  3RPP A;  5IO0 A;  1XWG A;  3TRP A;  3HYP A;  4HOJ A;  4EUY A;  1ILO A;  3GKX A;  4MNN A;  4XRA A;  4Q5N A;  5ECQ B;  2ZUP A;  1ERW A;  1OAZ A;  3L9S A;  1BX9 A;  13GS A;  1M0U A;  5D93 A;  1XWK A;  5DCG A;  1F6M C;  4XS4 A;  1EEM A;  3F3R A;  2FA8 A;  1H4O A;  1WRY A;  5IPG A;  2LRC A;  5D9V A;  1ST9 A;  1AQW A;  3F0I A;  2FY6 A;  3GKN A;  2PVQ A;  2C3N A;  4JBB A;  4WR4 A;  3Q19 A;  5J4U A;  4HSC X;  3D6I A;  2B5Y A;  1F2E A;  4RQR A;  2AJQ B;  3EYT A;  22GS A;  1A23 A;  2VIM A;  5AIV A;  1T3B A;  4NPB A;  3DML A;  4TR1 B;  2YN1 A;  4LL4 B;  5IIZ A;  2CQ9 A;  4OFN A;  1R7H A;  4BA7 A;  2GZP A;  3F8U A;  1TK0 B;  1BJX A;  1DSB A;  2R5G A;  3GL5 A;  4MF6 A;  2PUK C;  1GNE A;  4YAP A;  3UBL A;  2H0G A;  2YAN A;  1M2D A;  1WPI A;  5AIX A;  5AN1 A;  3PGT A;  2WS2 A;  3QD9 A;  4RUV A;  2LNT A;  3SWL A;  3TKS E;  2L59 A;  5D9X A;  4HI7 A;  3LXZ A;  2YZH A;  3IK7 A;  4BVY A;  1PA3 A;  3FHK A;  3GRX A;  1G6W A;  3IAS 2;  5JWR B;  1A0F A;  1TRW A;  3DGQ A;  1YZX A;  1YDK A;  4MPF A;  2F9S A;  1BYE A;  4ECC A;  4YH2 A;  1RK4 A;  1FOV A;  2VL2 C;  1ERV A;  4BVX B;  2A4V A;  4POB A;  1AXD A;  3TJK A;  3FKF A;  3GYK A;  1WJK A;  3ZRE A;  3IA1 A;  2TRC P;  2CAQ A;  5DAL A;  1XOA A;  4Z2U A;  4KDX A;  5LD0 A;  4MLY A;  1GLQ A;  3IDV A;  2JZS A;  2KLX A;  3E0U A;  4G0L A;  1AAZ A;  5IMC A;  2FGX A;  6GSX A;  3MYD A;  1QUW A;  4FIW A;  4TW5 A;  5B7C A;  1JZR A;  1UN2 A;  2RM5 A;  2CVD A;  1AW9 A;  4IJ3 A;  1YJ6 A;  4XS6 A;  1M3J A;  3TCO A;  2G2Q A;  3D5J A;  2F51 A;  2H70 A;  2GQL A;  3M3M A;  3O76 A;  1SU9 A;  5JCG A;  4JED A;  5DJM A;  2A2R A;  3IRA A;  4ZL8 A;  4L0W A;  1FVJ A;  3ERF A;  5G1K A;  1VF3 A;  3GHA A;  3RHB A;  5GAP D;  3EU4 A;  4N0V A;  1DE1 A;  3A5I A;  2IIY A;  1O85 A;  6GST A;  4XS4 B;  3JCM L;  3CSJ A;  4Q5F A;  1TJD A;  1EV4 A;  1TTZ A;  2VOC A;  4IP6 A;  4J56 E;  1BAY A;  1O8W A;  3L9U A;  1O8X A;  2AUV A;  2H75 A;  2FD3 A;  2K18 A;  5G5F A;  5G2Z A;  5B8B A;  3GA4 A;  5ECP B;  3ZFL A;  2N5F A;  2CV4 A;  3M9J A;  3F9U A;  5J3R A;  3H1N A;  2HE3 A;  5C04 A;  2REM A;  5G1L A;  1K0C A;  1T00 A;  1SJI A;  5G5E A;  1V9W A;  2HRK A;  3IXR A;  3C1S A;  3EU3 A;  3CTF A;  3IOS A;  3D22 A;  6GSS A;  5L71 A;  3ME7 A;  4MZW A;  2IPA A;  4TN8 A;  5KN2 A;  1T4Z A;  1O81 A;  2L4C A;  4ZIL A;  2HI7 A;  4KND A;  12GS A;  2H74 A;  1HD2 A;  1PGT A;  4BIK A;  2YWO A;  1K3Y A;  3F63 A;  4PTS A;  2B7J A;  4TXO A;  5IMD A;  2R0C A;  5ENU A;  3ZIT A;  1QFN A;  1JZW A;  4AF2 A;  19GS A;  1TU7 A;  18GS A;  3DRN A;  5GAN D;  3ZZX A;  1G6Y A;  2PGT A;  3R3E A;  2V41 A;  1U88 A;  3FZ5 A;  5E4W A;  3LQ7 A;  3MSZ A;  2I4A A;  3PR8 A;  8GSS A;  4KE3 A;  4RQX A;  3KJY A;  2NVL A;  3NZN A;  3PH9 A;  4WEY A;  1SEN A;  4GSS A;  1XPV A;  2B3S A;  4XTS A;  1PN0 A;  5FHI A;  5DAL B;  1KEB A;  1X9M B;  4F03 A;  1SL0 B;  2LQQ A;  3QCP A;  3D4M A;  1BED A;  4XCS A;  3J7Y k;  1XCC A;  4KDU A;  2OBI A;  4LMW A;  3C71 A;  2XPD A;  3LW9 A;  2VCZ A;  1VF4 A;  2I1U A;  1Z5Y E;  4WF5 A;  3I43 A;  4JR6 A;  5F8B A;  3QFA C;  2CVK A;  3UIW A;  1WOU A;  1SKS B;  4GST A;  5IMF A;  3RBT A;  3TOU A;  2DJ3 A;  4DSS A;  2VCW A;  4IKH A;  2AYT A;  6GSV A;  2HZE A;  4DEJ A;  2WGR A;  1NHY A;  2KUC A;  4N0Z A;  3C7M A;  3LOR A;  4KCE A;  2IWT A;  3FR9 A;  2PPT A;  1NM3 A;  2B5E A;  2VLT A;  2TIR A;  3GMF A;  1GUM A;  2L5L A;  3M9K A;  5G31 A;  3H93 A;  3LYK A;  2GSQ A;  3F3Q A;  1XFL A;  4EXJ A;  3TKQ A;  4K0G A;  1A2L A;  1EGR A;  1GRX A;  5HR0 A;  3UL3 A;  2V2G A;  3L9V A;  3G7Y A;  20GS A;  7GSS A;  3R2Q A;  2LST A;  1A2M A;  3A5W A;  1AQV A;  3A2V A;  10GS A;  1GSS A;  3M8N A;  1Z6M A;  5D96 A;  1PSQ A;  1UVZ A;  4A5P A;  3ERG A;  1W4V A;  2PN8 A;  4GCI A;  2GT6 A;  3KGK A;  3GUR A;  2O85 A;  4O5Q A;  4PUA A;  1U87 A;  4MA9 A;  3QAG A;  2B1L A;  3N5O A;  2PMT A;  4WBR D;  2FCH A;  2HLS A;  2O87 A;  4N10 A;  3UVH A;  5ECM B;  1ZYQ B;  4NHW A;  5DBQ A;  2X8G A;  2OE1 A;  4TRX A;  4X1U A;  2X64 A;  1Z9H A;  2JAD A;  3ZTL A;  1XVW A;  2OE0 A;  3UEM A;  4OFT A;  4RI6 A;  4YKG A;  4ECB A;  3H79 A;  3UBK A;  1XZO A;  4PUR A;  4YAV A;  3G9B A;  1JLW A;  2C3Q A;  5J9B A;  4ECJ A;  2XHF A;  5F0G A;  2WZ9 A;  3HHV A;  1X9W B;  4TXO B;  3BJ5 A;  1TXX A;  1T8E B;  2IMD A;  4YQM A;  1FHE A;  1ERU A;  3W6G A;  2YJ7 A;  2DJ1 A;  2HSY A;  1Z6N A;  4K2X A;  3IC8 A;  4PGT A;  4ZXG A;  2GZZ A;  4G9H A;  3EWL A;  4FO5 A;  3TJG A;  2LJK A;  2HXK A;  3APQ A;  5F06 A;  1KBN A;  5CRD A;  1S3A A;  4MJE A;  1PFO A;  2VD1 A;  5EL8 A;  4D73 A;  4O5R A;  1B8X A;  4RI7 A;  4KF9 A;  2C4J A;  4QQ7 A;  2JSY A;  4CY8 A;  4EIQ A;  3L4N A;  2VL2 A;  2YWN A;  1PL1 A;  4XIH A;  1GSY A;  5KN3 A;  2H73 A;  5J5N A;  3TRX A;  3P8W A;  3H4K A;  5B6N A;  1E2Y A;  4GWR A;  4XHM A;  4X0X A;  4PQH A;  3GST A;  1ZGN A;  4HQZ A;  3FR6 A;  1K0D A;  4EKZ A;  5JCW A;  1ON4 A;  5ECS A;  2DLX A;  3W8S A;  3HCZ A;  5AIS A;  2K8V A;  2HT9 A;  1HNA A;  2GQM A;  3QR6 A;  5DQS A;  1B4Q A;  3A3T A;  4ML6 A;  3GKK A;  3TKP A;  2HZF A;  1TP9 A;  2LRT A;  4DSS B;  4K6X A;  3UAR A;  2F3M A;  3L78 A;  4K7I A;  1QXH A;  2B5X A;  4NAX A;  2HZE B;  3HKR A;  1T4Y A;  2GLR A;  4ULX A;  2CVB A;  5IMA A;  1R5P A;  4ACS A;  4PX1 A;  2H01 A;  4I97 A;  1CQG A;  1TRU A;  1E6B A;  1S3R A;  2N5B A;  4USS A;  5HFG A;  4MMM A;  3ZMK A;  2GS3 A;  4EO3 A;  5HR3 A;  1YEP A;  1TI1 A;  2JAC A;  2VCV A;  2ZNM A;  3O6T A;  4GLT A;  4NMU A;  2YPM A;  3HZ8 A;  2PBJ A;  4HEA 2;  2H0I A;  2DIZ A;  1OE7 A;  2PVO C;  1J0F A;  4H86 A;  1X5D A;  1S3C A;  5DCH A;  2OBK A;  5JCU A;  4HZ2 A;  3RPN A;  4OWY A;  4Q5Q A;  1K3O A;  3HVN A;  1H75 A;  1ABA A;  1V98 A;  2YV9 A;  5KN1 A;  1EV9 A;  2BTO T;  1J9B A;  4V2M A;  5CAX A;  2C0D A;  1LJR A;  5EVO A;  4TR4 A;  3FZ4 A;  3FR3 A;  4ML1 A;  1SK1 A;  2CZ2 A;  4I5Q A;  3KXO A;  3F6D A;  1U3A A;  2OE3 A;  1XW6 A;  3HVS A;  1K0N A;  3US3 A;  1FO5 A;  3GH6 A;  4CDO A;  4PQ1 A;  1WIK A;  2H6Y A;  4TOP A;  1NSW A;  3BD2 A;  2VCT A;  2FWE A;  3CQF A;  4CHS A;  2K8S A;  4YKF A;  4G19 A;  1ZYP A;  4YQV A;  3DKS A;  4F9Z A;  2VCQ A;  3CTG A;  3RDW A;  3DYR A;  2LNS A;  4NXI A;  1JZO A;  2MMO A;  5GSS A;  3CRT A;  4KH7 A;  4O7H A;  1V2A A;  5J9C A;  1PX7 A;  1R5A A;  3TB2 A;  2AAW A;  5ID2 A;  4MF5 A;  2A2P A;  1Y25 A;  2DJ0 A;  4ZBB A;  2LUS A;  3C8E A;  4G0I A;  1WWJ A;  3A2X A;  1EZK A;  4MJB A;  4OCE A;  4TR0 A;  4JU5 A;  1F9M A;  2H66 A;  4K0N A;  1B4P A;  3QAV A;  4I2U A;  3KP8 A;  2MBS A;  4HDE A;  4KCA A;  4IS0 A;  1U3I A;  1Z7R A;  1ERT A;  3DVW A;  1DUG A;  3DWV A;  4MCU A;  4PXO A;  3ZFB A;  1K0A A;  1M2A A;  2GQK A;  1GUK A;  4OMV A;  4OCF A;  3FZA A;  2X8H A;  4O5U A;  1RQM A;  3D4T A;  3ZRD A;  1BQ7 A;  2YOI A;  4FYB A;  3V1W A;  3VPQ A;  1GUH A;  1EP8 A;  3VWW A;  1TK8 B;  2H30 A;  5F05 A;  5COH A;  5JWO B;  2X8C A;  2VM2 A;  3WGE A;  5DJL A;  2DKI A;  5E59 A;  3HJM A;  1DBY A;  1T1V A;  4BWS A;  2A4H A;  4X4J A;  4EIP A;  5DQY A;  1VRS D;  4WET A;  1EEJ A;  1JHB A;  4WF4 A;  1TDI A;  4PQI A;  4ZB8 A;  9GSS A;  4GSN A;  4AGS A;  5EY6 A;  1K0B A;  4NV5 A;  4KSO A;  16GS A;  3IE3 A;  2IL3 A;  2ON5 A;  3BCI A;  3G7J A;  1XIY A;  4POM A;  2NBS A;  4JE1 A;  4WR5 A;  1FB0 A;  3KCM A;  3VI5 A;  1ZYN A;  1MDI A;  1M99 A;  3F4S A;  2R4V A;  5IM9 A;  3KMO A;  3QPM A;  4V2N A;  3EE2 A;  2JSZ A;  2GZY A;  1R26 A;  4P3Y B;  2RII A;  3AY8 A;  1DE2 A;  3WT1 A;  2GT5 A;  3EMP A;  2O89 A;  4IW9 A;  3ZYW A;  4G2E A;  1OC9 A;  4HZ4 A;  3FW2 A;  1O6J A;  3IR4 A;  3J7Y b;  3VI7 A;  1GH2 A;  1NHO A;  1JZD A;  4BVY B;  1B9X C;  3F4R A;  3M1G A;  3QAW A;  1I5G A;  2BJX A;  2FWH A;  3D21 A;  2UZ8 A;  2PU9 C;  2GGT A;  2K6V A;  1J08 A;  2ZCT A;  1ZYE A;  2ON7 A;  2EIR A;  5ELG A;  3I6A A;  4Z7X A;  3TJF A;  2OAD A;  3HD5 A;  3U5R E;  4F2I A;  3LEF A;  5ECR B;  2KP2 A;  1O73 A;  1URM A;  4BPY A;  1MD4 A;  2QC7 A;  1FAA A;  5ID2 B;  2AB6 A;  5CYY A;  1VF2 A;  4LMV A;  5G30 A;  3ZVJ A;  3APO A;  1YEX A;  1X0R A;  1PL2 A;  4IQA A;  4EDZ A;  4KA0 A;  4MF7 A;  2HSM A;  1MTC A;  4ZBA A;  2ALB A;  3CRU A;  1PX6 A;  3KTB A;  2KP1 A;  4ILF A;  5FT3 A;  4ZB9 A;  1LU4 A;  5LCZ A;  3GSS A;  2XPE A;  3BBY A;  2MZC A;  2YP6 A;  4KUN A;  3GX0 A;  3OR5 A;  1B48 A;  2FNO A;  1WP0 A;  1TRV A;  3WYW A;  5DDL A;  5CO3 A;  3HDC A;  5CRH A;  2HSH A;  4KAE A;  4K2D A;  4POK A;  1RW1 A;  2P0G A;  1FVK A;  5BRT A;  3GTU A;  2E0Q A;  1TW9 A;  4XS1 A;  2P31 A;  2GTU A;  1AQX A;  1YQ1 A;  1A8L A;  3O3T A;  2V32 A;  3KZQ A;  2M72 A;  4GTU A;  3LG6 A;  3CYN A;  4KDY A;  2P5R A;  3KIJ A;  4HQS A;  2IFQ A;  3P7X A;  2XC2 A;  1TRS A;  1GP1 A;  2B1K A;  1IYI A;  1N2A A;  1X9S B;  2LKU A;  4PNG A;  1WE0 A;  2C0F A;  2DMM A;  3TDG A;  2X99 A;  2MBT A;  1HQO A;  1HYU A;  3CXG A;  4Z2R A;  4I8B A;  1OVN A;  4WXT A;  1M9A A;  4LA1 A;  4MPG A;  4ECI A;  1GSE A;  1Z3E A;  3EPT A;  1TOF A;  1QK8 A;  2V6K A;  1V57 A;  3IV4 A;  4ISD A;  2LJA A;  2C0G A;  5A4V A;  2RUE A;  3GL3 A;  5B6M A;  3ZIJ A;  5EPF A;  4TR1 A;  1MEK A;  5IPH A;  3GV1 A;  1OE8 A;  3LGC A;  2OA7 A;  4LL1 B;  1Q98 A;  1VF1 A;  2G0F A;  2L5O A;  1Y6E A;  4L5O A;  3TOT A;  2EIO A;  1PD2 1;  4CY6 A;  2C8U A;  2C1Y A;  3GIX A;  2CA8 A;  5AGY A;  5ABR A;  1PQN A;  3HJP A;  2P5Q A;  2R2J A;  5CRE A;  3CSI A;  3FK8 A;  3C73 A;  3M0F A;  3W8J A;  5H5S A;  1M9B A;  2IJY A;  1GTA A;  2H8L A;  2R37 A;  3LSZ A;  2GVP A;  1PMT A;  3CMI A;  3GUS A;  2V1M A;  1UA5 A;  3UJ1 A;  4FQU A;  2O8V B;  2WUL A;  1BG5 A;  4JZQ A;  4ZBD A;  3VUR A;  2NTO A;  3TKS C;  1G0T A;  2CT6 A;  5BMU A;  4BVX A;  4O32 A;  1GL8 A;  3KMN A;  3PIN A;  4GF0 A;  1SKR B;  4KX4 A;  1QQ2 A;  4K7N A;  3WGX A;  3IBH A;  4ZL9 A;  4ZL7 A;  1G7E A;  1PKW A;  4E8H A;  3FYG A;  1HNC A;  3ZLP A;  2VM1 A;  2L57 A;  4EF0 A;  2I81 A;  1AIU A;  4EDY A;  2VD0 A;  2C3T A;  1PKZ A;  3ZL5 A;  1B9Y C;  1EWX A;  1PN9 A; 
#chains in the Genus database with same CATH homology
 3NOF A;  2IMF A;  2B7K A;  3GTU B;  4MK3 A;  2XBQ A;  3VWX A;  6GSU A;  2DJK A;  4AJ6 A;  5IMZ A;  3IHQ A;  3TJJ A;  4K9Z A;  1XW9 A;  5D73 A;  3L0H A;  5ELA A;  1TK5 B;  1SK2 A;  1XW5 A;  4N30 A;  2IFQ B;  2MMZ A;  1SYR A;  4GRF A;  4FYC A;  4V1A g;  3TJB A;  1A0R P;  1K0O A;  2PWJ A;  1MDK A;  1F37 A;  3TGZ A;  3CBU A;  3I9V 2;  2GSR A;  4DVC A;  2N5A A;  2FA4 A;  2JL4 A;  1Q4J A;  1I9D A;  1GSF A;  4BWQ A;  2R0P A;  2BMX A;  3D0Z A;  3UOM A;  2FLS A;  2LRN A;  4FH8 A;  4HU7 A;  6GSW A;  2HYX A;  1FB6 A;  1OKD A;  2MMN A;  4IP1 A;  1SL2 B;  2CX3 A;  4L0U A;  5A4W A;  1ACV A;  1TI3 A;  4IQ1 A;  5DAK A;  4F82 A;  1THO A;  5A4U A;  2WCI A;  3KM6 A;  5H5Q A;  2YJH A;  3FRC A;  2JU5 A;  3PPU A;  2X4A A;  4MP4 A;  2IMK A;  5C00 A;  5HR1 A;  2YCD A;  2CX4 A;  3LWA A;  1ZL9 A;  2DC5 A;  1F3A A;  4F0B A;  5H5R A;  3FY7 A;  3QMX A;  5KOW A;  2L6C A;  2H1B A;  4IN0 A;  2OJL A;  1ZCP A;  4Q5R A;  2NDO A;  3WGD A;  11GS A;  2F8F A;  5J41 A;  4QL9 A;  2IN3 A;  3QFB C;  1XWC A;  2CAI A;  2QKE A;  5D9T A;  2MYG A;  4IVF A;  4G10 A;  4E8E A;  2E2M A;  1XVQ A;  3U6V A;  2HNL A;  4MZC A;  4TKY A;  3EUR A;  1KNG A;  5IO2 A;  4D73 B;  2IMI A;  3FEU A;  3ZVJ D;  2C80 A;  1M7T A;  2DSA A;  1OYJ A;  5IQY A;  17GS A;  3ISO A;  1X5C A;  1KTE A;  2H1A A;  1U6T A;  2HRN A;  1GTU A;  2I3Y A;  1IYH A;  4MJA A;  5CRG A;  3VFI A;  1NW2 A;  2WB9 A;  4DSQ A;  1XBS A;  4MH3 A;  5B8A A;  1YKA A;  5CRW A;  2TRX A;  1ZZY A;  2FUG 2;  4QL7 A;  3MNG A;  4IJI A;  2FWG A;  2FHE A;  3HY2 A;  1TU8 A;  2QSI A;  1M2B A;  1A8Y A;  1ZOF A;  2NPB A;  1CQH A;  1N8J A;  1GLP A;  1FW1 A;  2VO4 A;  2CZ3 A;  2LV3 A;  3A2W A;  2YZU A;  3CSH A;  4XRD A;  4NHZ A;  1GTI A;  3UMA A;  5ECK B;  1YY7 A;  3GNJ A;  2VCX A;  3IK9 A;  1XWA A;  4MJC A;  1ZMA A;  3P2A A;  3ZML A;  3HJO A;  3KP9 A;  4HU9 A;  4HS1 A;  2VLU A;  4V2L A;  1SL1 B;  2ES7 A;  3GH9 A;  2IME A;  2VAF A;  2H71 A;  4X43 A;  3GKM A;  4NWY A;  3F6F A;  2FWF A;  1GSU A;  3VPT A;  1SJ6 A;  5IOX A;  5F07 A;  2J9H A;  3VWU A;  4KB3 A;  1K0M A;  2OKA A;  4KGI A;  4MZB A;  3KTL A;  2OAC A;  3ME8 A;  4L8E A;  2RM6 A;  1EGO A;  1GNW A;  1JFU A;  1AUC A;  3Q18 A;  4MDC A;  2LTK A;  1LBK A;  3WT2 A;  4OD7 A;  4K1F A;  4ICY A;  1GSQ A;  5DVB A;  5A5K A;  2RLI A;  3UVT A;  5DAK B;  3DD3 A;  3K8N A;  3LJR A;  3WD6 A;  1SD8 A;  3VWV A;  2LS5 A;  2YWI A;  4O92 A;  3ED3 A;  3EC3 A;  1W89 A;  2HRA A;  3GN3 A;  4GXZ A;  3S9F A;  2DJ2 A;  2WDU A;  1SKW B;  3HVX A;  4ID0 A;  2R3X A;  4NV2 A;  3EMX A;  1SYX A;  3BCK A;  2PER A;  2F8A A;  3LYP A;  4BL7 A;  4L5L A;  2JZT A;  4I6X A;  2H6X A;  1AC1 A;  2WRT A;  2H0H A;  3HXS A;  5LNK e;  1SK0 A;  1FG4 A;  1SD9 A;  3VK9 A;  2M80 A;  4HUA A;  4WBJ A;  1XWB A;  2R0G A;  3IC4 A;  2B6M A;  5ECH B;  2XBI A;  1A24 A;  1VGL A;  2QA2 A;  4K8M A;  4Z2T A;  4LLR A;  1S3D A;  3C1R A;  2H1D A;  1V40 A;  3N9J A;  2H72 A;  3APS A;  5CNW A;  4POL A;  5HR2 A;  2LQO A;  5GZZ B;  1UC7 A;  1K3L A;  4EC0 A;  4G0K A;  4J2F A;  1HNB A;  2EIQ A;  3HVV A;  3TKS A;  4KW6 A;  3SBC A;  1USB A;  5KEJ A;  1SJZ A;  2DJJ A;  1GSD A;  3P90 A;  3FMW A;  1C72 A;  4IEL A;  1QMV A;  2KHP A;  2WFC A;  4I2T A;  1R4W A;  5FWG A;  2J23 A;  2DML A;  4JR4 A;  4F0C A;  5ECL B;  2KOK A;  4OO4 A;  5D9W A;  2MMA A;  4ZB6 A;  2Z9S A;  2DBC A;  4WKW A;  14GS A;  4PNF A;  1THX A;  3FZ9 A;  4EL1 A;  2YWM A;  1YF0 A;  1MD3 A;  5ECN B;  2M46 A;  2YV7 A;  3KEB A;  3DVX A;  4OO5 A;  1ML6 A;  2LJR A;  3Q74 A;  1T7P B;  4K5R A;  1F3B A;  3KD0 A;  2QA1 A;  1XOB A;  3NIV A;  4K5S A;  3DEX A;  2E2G A;  3MAK A;  5D8I A;  4ZIJ A;  2I9H A;  1TKD B;  1O7U A;  4GQC A;  5GST A;  2LEG A;  2V6O A;  2GDR A;  4KSM A;  1YKC A;  3I69 A;  5ECO B;  1A2J A;  6GSY A;  5HFI A;  4IBP A;  1EOG A;  2YNX A;  3GFK A;  4IGJ A;  3QDN A;  2AHE A;  2JZR A;  1YF1 A;  3F4T A;  3LFL A;  5IMV A;  2C0E A;  1G7O A;  4DSR A;  2H19 A;  3EVI A;  3IPZ A;  4HJ2 A;  4MAB A;  4TR3 A;  1OC3 A;  4V1A p;  2E7P A;  3H8Q A;  3KH7 A;  3TRQ A;  3VLN A;  1GUL A;  3DXB A;  4MH2 A;  1OC9 B;  3UAP A;  3IHG A;  3ERW A;  2AV4 A;  3HZ4 A;  1MDJ A;  4YQU A;  5HQP A;  4BL7 B;  5ECI B;  4AJ8 A;  2K9F A;  1X5E A;  2R6K A;  2RUF A;  5CP1 A;  2VL3 A;  3DIE A;  4GQF A;  2A2S A;  1EP7 A;  2HRF A;  3IAM 2;  3MIX A;  5IOW A;  4FYU A;  2WJU A;  2EC4 A;  2H76 A;  2VL9 A;  2QGV A;  1GWC A;  4EE0 A;  2H1G A;  5JWQ B;  3GX8 A;  3LXT A;  3G7I A;  4TVE A;  4PUF C;  1EOH A;  3E9J B;  3MDK A;  4EVM A;  1WMJ A;  4OFM A;  5KN0 A;  2HFD A;  2DIY A;  3RHC A;  3TUE A;  3EIN A;  4J57 E;  1PRX A;  1JLV A;  2O7K A;  1QGV A;  2L6D A;  4AJ7 A;  1OC8 A;  4K7O A;  1Z7P A;  3HA9 A;  1FOH A;  4JRR A;  4HJM A;  2GSS A;  2H6Z A;  4N11 A;  3E3E A;  2VUP A;  5INY A;  1GTB A;  3KH9 A;  3Q6O A;  1V58 A;  4CW9 A;  3MWH A;  3TKR A;  4TXV A;  5HFK A;  3BOA A;  3RAZ A;  4IHU A;  2D2Z A;  1XXU A;  2X49 A;  2GST A;  5KOX A;  2DKH A;  3ZIV A;  2VLV A;  2L4Q A;  3QOU A;  1OKT A;  3RPP A;  5IO0 A;  1XWG A;  3TRP A;  3HYP A;  4HOJ A;  4EUY A;  1ILO A;  3GKX A;  4MNN A;  4XRA A;  4Q5N A;  5ECQ B;  2ZUP A;  1ERW A;  1OAZ A;  3L9S A;  1BX9 A;  13GS A;  1M0U A;  5D93 A;  1XWK A;  5DCG A;  1F6M C;  4XS4 A;  1EEM A;  3F3R A;  2FA8 A;  1H4O A;  1WRY A;  5IPG A;  2LRC A;  5D9V A;  1ST9 A;  1AQW A;  3F0I A;  2FY6 A;  3GKN A;  2PVQ A;  2C3N A;  4JBB A;  4WR4 A;  3Q19 A;  5J4U A;  3D6I A;  2B5Y A;  1F2E A;  4RQR A;  2AJQ B;  3EYT A;  22GS A;  1A23 A;  2VIM A;  5AIV A;  1T3B A;  4NPB A;  3DML A;  4TR1 B;  2YN1 A;  4LL4 B;  5IIZ A;  2CQ9 A;  4OFN A;  1R7H A;  4BA7 A;  2GZP A;  3F8U A;  1TK0 B;  1BJX A;  1DSB A;  2R5G A;  3GL5 A;  4MF6 A;  2PUK C;  1GNE A;  4YAP A;  3UBL A;  2H0G A;  2YAN A;  1M2D A;  1WPI A;  5AIX A;  5AN1 A;  3PGT A;  2WS2 A;  3QD9 A;  4RUV A;  2LNT A;  3SWL A;  3TKS E;  2L59 A;  5D9X A;  4HI7 A;  3LXZ A;  2YZH A;  3IK7 A;  4BVY A;  1PA3 A;  3FHK A;  3GRX A;  1G6W A;  3IAS 2;  5JWR B;  1A0F A;  1TRW A;  3DGQ A;  1YZX A;  1YDK A;  4MPF A;  2F9S A;  1BYE A;  4ECC A;  4YH2 A;  1RK4 A;  1FOV A;  2VL2 C;  1ERV A;  4BVX B;  2A4V A;  4POB A;  1AXD A;  3TJK A;  3FKF A;  3GYK A;  1WJK A;  3ZRE A;  3IA1 A;  2TRC P;  2CAQ A;  5DAL A;  1XOA A;  4Z2U A;  4KDX A;  5LD0 A;  4MLY A;  1GLQ A;  3IDV A;  2JZS A;  2KLX A;  3E0U A;  4G0L A;  1AAZ A;  5IMC A;  2FGX A;  6GSX A;  3MYD A;  1QUW A;  4FIW A;  4TW5 A;  5B7C A;  1JZR A;  1UN2 A;  2RM5 A;  2CVD A;  1AW9 A;  4IJ3 A;  1YJ6 A;  4XS6 A;  3TCO A;  2G2Q A;  3D5J A;  2F51 A;  2H70 A;  2GQL A;  3M3M A;  3O76 A;  1SU9 A;  5JCG A;  4JED A;  5DJM A;  2A2R A;  3IRA A;  4ZL8 A;  4L0W A;  1FVJ A;  3ERF A;  5G1K A;  1VF3 A;  3GHA A;  3RHB A;  5GAP D;  3EU4 A;  4N0V A;  1DE1 A;  3A5I A;  2IIY A;  1O85 A;  6GST A;  4XS4 B;  3JCM L;  3CSJ A;  4Q5F A;  1TJD A;  1EV4 A;  1TTZ A;  2VOC A;  4IP6 A;  4J56 E;  1BAY A;  1O8W A;  3L9U A;  1O8X A;  2AUV A;  2H75 A;  2FD3 A;  2K18 A;  5G5F A;  5G2Z A;  5B8B A;  3GA4 A;  5ECP B;  3ZFL A;  2N5F A;  2CV4 A;  3M9J A;  3F9U A;  5J3R A;  3H1N A;  2HE3 A;  5C04 A;  2REM A;  5G1L A;  1K0C A;  1T00 A;  1SJI A;  5G5E A;  1V9W A;  2HRK A;  3IXR A;  3C1S A;  3EU3 A;  3CTF A;  3IOS A;  3D22 A;  6GSS A;  5L71 A;  3ME7 A;  4MZW A;  2IPA A;  4TN8 A;  5KN2 A;  1T4Z A;  1O81 A;  2L4C A;  4ZIL A;  2HI7 A;  4KND A;  12GS A;  2H74 A;  1HD2 A;  1PGT A;  2YWO A;  1K3Y A;  3F63 A;  4PTS A;  2B7J A;  4TXO A;  5IMD A;  2R0C A;  5ENU A;  3ZIT A;  1QFN A;  1JZW A;  4AF2 A;  19GS A;  1TU7 A;  18GS A;  3DRN A;  5GAN D;  3ZZX A;  1G6Y A;  2PGT A;  3R3E A;  2V41 A;  1U88 A;  3FZ5 A;  5E4W A;  3LQ7 A;  3MSZ A;  2I4A A;  3PR8 A;  8GSS A;  4KE3 A;  4RQX A;  3KJY A;  2NVL A;  3NZN A;  3PH9 A;  4WEY A;  1SEN A;  4GSS A;  1XPV A;  2B3S A;  4XTS A;  1PN0 A;  5FHI A;  5DAL B;  1KEB A;  1X9M B;  4F03 A;  1SL0 B;  2LQQ A;  3QCP A;  3D4M A;  1BED A;  4XCS A;  3J7Y k;  1XCC A;  4KDU A;  2OBI A;  4LMW A;  3C71 A;  2XPD A;  3LW9 A;  2VCZ A;  1VF4 A;  2I1U A;  1Z5Y E;  4WF5 A;  3I43 A;  4JR6 A;  5F8B A;  3QFA C;  2CVK A;  3UIW A;  1WOU A;  1SKS B;  4GST A;  5IMF A;  3RBT A;  3TOU A;  2DJ3 A;  4DSS A;  2VCW A;  4IKH A;  2AYT A;  6GSV A;  2HZE A;  4DEJ A;  2WGR A;  1NHY A;  2KUC A;  4N0Z A;  3C7M A;  3LOR A;  4KCE A;  2IWT A;  3FR9 A;  2PPT A;  1NM3 A;  2B5E A;  2VLT A;  2TIR A;  3GMF A;  1GUM A;  2L5L A;  3M9K A;  5G31 A;  3H93 A;  3LYK A;  2GSQ A;  3F3Q A;  1XFL A;  4EXJ A;  3TKQ A;  4K0G A;  1A2L A;  1EGR A;  1GRX A;  5HR0 A;  3UL3 A;  2V2G A;  3L9V A;  3G7Y A;  20GS A;  7GSS A;  3R2Q A;  2LST A;  1A2M A;  3A5W A;  1AQV A;  3A2V A;  10GS A;  1GSS A;  3M8N A;  1Z6M A;  5D96 A;  1PSQ A;  1UVZ A;  4A5P A;  3ERG A;  1W4V A;  2PN8 A;  4GCI A;  2GT6 A;  3KGK A;  3GUR A;  2O85 A;  4O5Q A;  4PUA A;  1U87 A;  4MA9 A;  3QAG A;  2B1L A;  3N5O A;  2PMT A;  4WBR D;  2FCH A;  2HLS A;  2O87 A;  4N10 A;  3UVH A;  5ECM B;  1ZYQ B;  4NHW A;  5DBQ A;  2X8G A;  2OE1 A;  4TRX A;  4X1U A;  2X64 A;  1Z9H A;  2JAD A;  3ZTL A;  1XVW A;  2OE0 A;  3UEM A;  4OFT A;  4RI6 A;  4YKG A;  4ECB A;  3H79 A;  3UBK A;  1XZO A;  4PUR A;  4YAV A;  3G9B A;  1JLW A;  2C3Q A;  5J9B A;  4ECJ A;  2XHF A;  5F0G A;  2WZ9 A;  3HHV A;  1X9W B;  4TXO B;  3BJ5 A;  1TXX A;  1T8E B;  2IMD A;  4YQM A;  1FHE A;  1ERU A;  3W6G A;  2YJ7 A;  2DJ1 A;  2HSY A;  1Z6N A;  4K2X A;  3IC8 A;  4PGT A;  4ZXG A;  2GZZ A;  4G9H A;  3EWL A;  4FO5 A;  3TJG A;  2LJK A;  2HXK A;  3APQ A;  5F06 A;  1KBN A;  5CRD A;  1S3A A;  4MJE A;  2VD1 A;  5EL8 A;  4D73 A;  4O5R A;  1B8X A;  4RI7 A;  4KF9 A;  2C4J A;  4QQ7 A;  2JSY A;  4CY8 A;  4EIQ A;  3L4N A;  2VL2 A;  2YWN A;  1PL1 A;  4XIH A;  1GSY A;  5KN3 A;  2H73 A;  5J5N A;  3TRX A;  3P8W A;  3H4K A;  5B6N A;  1E2Y A;  4GWR A;  4XHM A;  4X0X A;  4PQH A;  3GST A;  1ZGN A;  4HQZ A;  3FR6 A;  1K0D A;  4EKZ A;  5JCW A;  1ON4 A;  5ECS A;  2DLX A;  3W8S A;  3HCZ A;  5AIS A;  2K8V A;  2HT9 A;  1HNA A;  2GQM A;  3QR6 A;  5DQS A;  1B4Q A;  3A3T A;  4ML6 A;  3GKK A;  3TKP A;  2HZF A;  1TP9 A;  2LRT A;  4DSS B;  4K6X A;  3UAR A;  2F3M A;  3L78 A;  4K7I A;  1QXH A;  2B5X A;  4NAX A;  2HZE B;  3HKR A;  1T4Y A;  2GLR A;  4ULX A;  2CVB A;  5IMA A;  1R5P A;  4ACS A;  4PX1 A;  2H01 A;  4I97 A;  1CQG A;  1TRU A;  1E6B A;  4USS A;  2N5B A;  5HFG A;  3ZMK A;  4MMM A;  2GS3 A;  4EO3 A;  5HR3 A;  1YEP A;  1TI1 A;  2JAC A;  2VCV A;  2ZNM A;  3O6T A;  4GLT A;  4NMU A;  2YPM A;  3HZ8 A;  2PBJ A;  4HEA 2;  2H0I A;  2DIZ A;  1OE7 A;  2PVO C;  1J0F A;  4H86 A;  1X5D A;  1S3C A;  5DCH A;  2OBK A;  5JCU A;  4HZ2 A;  3RPN A;  4OWY A;  4Q5Q A;  1K3O A;  1H75 A;  1ABA A;  1V98 A;  2YV9 A;  5KN1 A;  1EV9 A;  2BTO T;  1J9B A;  4V2M A;  5CAX A;  2C0D A;  1LJR A;  5EVO A;  4TR4 A;  3FZ4 A;  3FR3 A;  4ML1 A;  1SK1 A;  2CZ2 A;  4I5Q A;  3KXO A;  3F6D A;  1U3A A;  2OE3 A;  1XW6 A;  3HVS A;  1K0N A;  3US3 A;  1FO5 A;  3GH6 A;  4CDO A;  4PQ1 A;  1WIK A;  2H6Y A;  4TOP A;  1NSW A;  3BD2 A;  2VCT A;  2FWE A;  4CHS A;  2K8S A;  4YKF A;  4G19 A;  1ZYP A;  4YQV A;  3DKS A;  4F9Z A;  2VCQ A;  3CTG A;  3RDW A;  3DYR A;  2LNS A;  4NXI A;  1JZO A;  2MMO A;  5GSS A;  3CRT A;  4KH7 A;  4O7H A;  1V2A A;  5J9C A;  1PX7 A;  1R5A A;  3TB2 A;  2AAW A;  5ID2 A;  4MF5 A;  2A2P A;  1Y25 A;  2DJ0 A;  4ZBB A;  2LUS A;  3C8E A;  4G0I A;  1WWJ A;  3A2X A;  1EZK A;  4MJB A;  4OCE A;  4TR0 A;  4JU5 A;  1F9M A;  2H66 A;  4K0N A;  1B4P A;  3QAV A;  4I2U A;  3KP8 A;  2MBS A;  4HDE A;  4KCA A;  4IS0 A;  1U3I A;  1Z7R A;  1ERT A;  3DVW A;  1DUG A;  3DWV A;  4MCU A;  4PXO A;  3ZFB A;  1K0A A;  1M2A A;  2GQK A;  1GUK A;  4OMV A;  4OCF A;  3FZA A;  2X8H A;  4O5U A;  1RQM A;  3D4T A;  3ZRD A;  1BQ7 A;  2YOI A;  4FYB A;  3V1W A;  3VPQ A;  1GUH A;  1EP8 A;  3VWW A;  1TK8 B;  2H30 A;  5F05 A;  5COH A;  5JWO B;  2X8C A;  2VM2 A;  3WGE A;  5DJL A;  2DKI A;  5E59 A;  3HJM A;  1DBY A;  1T1V A;  4BWS A;  2A4H A;  4X4J A;  4EIP A;  5DQY A;  1VRS D;  4WET A;  1EEJ A;  1JHB A;  4WF4 A;  1TDI A;  4PQI A;  4ZB8 A;  9GSS A;  4GSN A;  4AGS A;  5EY6 A;  1K0B A;  4NV5 A;  4KSO A;  16GS A;  3IE3 A;  2IL3 A;  2ON5 A;  3BCI A;  3G7J A;  1XIY A;  4POM A;  2NBS A;  4JE1 A;  4WR5 A;  1FB0 A;  3KCM A;  3VI5 A;  1ZYN A;  1MDI A;  1M99 A;  3F4S A;  2R4V A;  5IM9 A;  3KMO A;  3QPM A;  4V2N A;  3EE2 A;  2JSZ A;  2GZY A;  1R26 A;  4P3Y B;  2RII A;  3AY8 A;  1DE2 A;  3WT1 A;  2GT5 A;  3EMP A;  2O89 A;  4IW9 A;  3ZYW A;  4G2E A;  1OC9 A;  4HZ4 A;  3FW2 A;  1O6J A;  3IR4 A;  3J7Y b;  3VI7 A;  1GH2 A;  1NHO A;  1JZD A;  4BVY B;  1B9X C;  3F4R A;  3M1G A;  3QAW A;  1I5G A;  2BJX A;  2FWH A;  3D21 A;  2UZ8 A;  2PU9 C;  2GGT A;  2K6V A;  1J08 A;  2ZCT A;  1ZYE A;  2ON7 A;  2EIR A;  5ELG A;  3I6A A;  4Z7X A;  3TJF A;  2OAD A;  3HD5 A;  3U5R E;  4F2I A;  3LEF A;  5ECR B;  2KP2 A;  1O73 A;  1URM A;  4BPY A;  1MD4 A;  2QC7 A;  1FAA A;  5ID2 B;  2AB6 A;  5CYY A;  1VF2 A;  4LMV A;  5G30 A;  3ZVJ A;  3APO A;  1YEX A;  1X0R A;  1PL2 A;  4IQA A;  4EDZ A;  4KA0 A;  4MF7 A;  2HSM A;  1MTC A;  4ZBA A;  2ALB A;  3CRU A;  1PX6 A;  3KTB A;  2KP1 A;  4ILF A;  5FT3 A;  4ZB9 A;  1LU4 A;  5LCZ A;  3GSS A;  2XPE A;  3BBY A;  2MZC A;  2YP6 A;  4KUN A;  3GX0 A;  3OR5 A;  1B48 A;  2FNO A;  1WP0 A;  1TRV A;  3WYW A;  5DDL A;  5CO3 A;  3HDC A;  5CRH A;  2HSH A;  4KAE A;  4K2D A;  4POK A;  1RW1 A;  2P0G A;  1FVK A;  5BRT A;  3GTU A;  2E0Q A;  1TW9 A;  4XS1 A;  2P31 A;  2GTU A;  1AQX A;  1YQ1 A;  1A8L A;  3O3T A;  2V32 A;  3KZQ A;  2M72 A;  4GTU A;  3LG6 A;  3CYN A;  4KDY A;  2P5R A;  3KIJ A;  4HQS A;  2IFQ A;  3P7X A;  2XC2 A;  1TRS A;  1GP1 A;  2B1K A;  1IYI A;  1N2A A;  1X9S B;  2LKU A;  4PNG A;  1WE0 A;  2C0F A;  2DMM A;  3TDG A;  2X99 A;  2MBT A;  1HQO A;  1HYU A;  3CXG A;  4Z2R A;  4I8B A;  1OVN A;  4WXT A;  1M9A A;  4LA1 A;  4MPG A;  4ECI A;  1GSE A;  1Z3E A;  3EPT A;  1TOF A;  1QK8 A;  2V6K A;  1V57 A;  3IV4 A;  4ISD A;  2LJA A;  2C0G A;  5A4V A;  2RUE A;  3GL3 A;  5B6M A;  3ZIJ A;  5EPF A;  4TR1 A;  1MEK A;  5IPH A;  3GV1 A;  1OE8 A;  3LGC A;  2OA7 A;  4LL1 B;  1Q98 A;  1VF1 A;  2G0F A;  2L5O A;  1Y6E A;  4L5O A;  3TOT A;  2EIO A;  1PD2 1;  4CY6 A;  2C8U A;  2C1Y A;  3GIX A;  2CA8 A;  5AGY A;  5ABR A;  1PQN A;  3HJP A;  2P5Q A;  2R2J A;  5CRE A;  3CSI A;  3FK8 A;  3C73 A;  3M0F A;  3W8J A;  5H5S A;  1M9B A;  2IJY A;  1GTA A;  2H8L A;  2R37 A;  3LSZ A;  2GVP A;  1PMT A;  3CMI A;  3GUS A;  2V1M A;  1UA5 A;  3UJ1 A;  4FQU A;  2O8V B;  2WUL A;  1BG5 A;  4JZQ A;  4ZBD A;  3VUR A;  2NTO A;  3TKS C;  1G0T A;  2CT6 A;  5BMU A;  4BVX A;  4O32 A;  1GL8 A;  3KMN A;  3PIN A;  4GF0 A;  1SKR B;  4KX4 A;  1QQ2 A;  4K7N A;  3WGX A;  3IBH A;  4ZL9 A;  4ZL7 A;  1G7E A;  1PKW A;  4E8H A;  3FYG A;  1HNC A;  3ZLP A;  2VM1 A;  2L57 A;  4EF0 A;  2I81 A;  1AIU A;  4EDY A;  2VD0 A;  2C3T A;  1PKZ A;  3ZL5 A;  1B9Y C;  1EWX A;  1PN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...