1DE1A

Nmr structures of oxidized bacteriophage t4 glutaredoxin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
87
Chain Sequence
MFKVYGYDSNIHKCVYCDNAKRLLTVKKQPFEFINIMPEKGVFDDEKIAELLTKLGRDTQIGLTMPQVFAPDGSHIGGFDQLREYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAREDOXIN
publication title Solution structures of reduced and oxidized bacteriophage T4 glutaredoxin.
pubmed doi rcsb
molecule tags Electron transport
total genus 15
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1999-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1de1A00
1JLWA 3MDKA 4MH3A 5ECKB 3KP9A 2PMTA 2NPBA 4AJ8A 2B6MA 4IJIA 2RIIA 5G31A 3GHAA 1X5EA 3F3RA 3TKSE 1GLQA 5ID2A 5CRHA 4DSQA 3C8EA 3QAGA 3UVTA 1EGOA 1F2EA 2LJAA 2HNLA 4NAXA 3RHCA 3VWXA 2PGTA 1K0CA 4NXIA 4O7HA 1KBNA 1S3AA 2H75A 3ZVJD 4RQXA 3LFLA 2TRXA 2HE3A 4IQ1A 3GKNA 1ERWA 5AN1A 1TTZA 3IK7A 5INYA 2VCQA 1MTCA 4IGJA 5D93A 2DSAA 1B8XA 5IPHA 3FRCA 2FD3A 2LNSA 1G7EA 5DDLA 4L0UA 3IE3A 5DQYA 4NHWA 3IR4A 4ECJA 1WJKA 5KN1A 1ZCPA 1Z9HA 1Z5YE 4N0VA 1GSFA 3WT2A 3EU4A 3GA4A 5KN3A 2LTKA 3BJ5A 2DJ0A 1K0BA 2GT6A 5HFIA 1TU8A 1XW5A 1O73A 3PH9A 3FR6A 3HZ8A 2FWFA 1T3BA 2LQOA 1UN2A 3UMAA 2CA8A 5ECRB 3A5WA 3BOAA 3HVVA 4I8BA 1XBSA 2R3XA 1OKTA 2CZ2A 1J0FA 3G9BA 2GZPA 5DJLA 2B5YA 3SBCA 1N2AA 5JCUA 1TK0B 2MZCA 4XCSA 2OADA 2ZUPA 2IMFA 3EC3A 3ISOA 3DVXA 3QFAC 2WRTA 2VCXA 4OCFA 2CVBA 4FYCA 4FIWA 3M9JA 1IYHA 1V98A 3D21A 1NSWA 4JZQA 1TU7A 4POMA 2FCHA 1Y25A 4K9ZA 1M9BA 1R4WA 2E2GA 4YAPA 4JRRA 4MMMA 3ZMLA 3VWWA 1TDIA 3CTGA 5DVBA 3ZRDA 4RI6A 2IMDA 1A23A 2DJKA 3TKSC 2C80A 2K6VA 3VI5A 2JZTA 4HJ2A 4L5LA 1O8XA 2HLSA 6GSXA 4PNFA 3FZ9A 3WGEA 2HYXA 5B8BA 1XFLA 4ML6A 3TJBA 1UA5A 2IL3A 2QC7A 3LXZA 4LL1B 4CHSA 2F51A 3EU3A 4AJ7A 11GSA 3UIWA 5DQSA 1A24A 1EGRA 3CMIA 4IW9A 1SL0B 4ZL7A 5F0GA 2WDUA 3LEFA 3C1SA 3KZQA 2AUVA 4PNGA 2OBKA 5J3RA 3C1RA 4QL7A 4OCEA 2K9FA 3UBKA 4TRXA 1XCCA 4MZWA 5CP1A 5HFGA 1YJ6A 3GURA 1GLPA 2A2SA 4O32A 1HNCA 4TW5A 1O85A 1BX9A 1YKCA 3S9FA 2JL4A 4DSRA 2PWJA 2Z9SA 1G0TA 3TKSA 2YANA 2B5EA 1A8LA 1EP7A 3HD5A 4KGIA 5IMCA 2HT9A 1ACVA 4PQIA 6GSSA 3CTFA 4ZXGA 3F9UA 2GSSA 2L6CA 2L57A 1PD21 1FAAA 2PVQA 1K0OA 4J2FA 4L8EA 1M2BA 1I5GA 3M9KA 1R26A 2V6OA 5FHIA 4V1Ap 1GSUA 4TKYA 5D9VA 2XPDA 2B1KA 3UBLA 1B9XC 5J9BA 4BWQA 5ECSA 3WD6A 1PKWA 2IMIA 1J9BA 1KNGA 4POLA 2FLSA 5HFKA 1NHOA 4KH7A 1EV4A 3BCKA 2FHEA 4GF0A 4KAEA 3JCML 5J4UA 3N9JA 2H6YA 5F8BA 3DKSA 1X9WB 1FHEA 1OVNA 6GSYA 3HVSA 2P5RA 4K2DA 1HYUA 2P0GA 2CQ9A 6GSTA 5IO2A 4IKHA 3W6GA 1TW9A 1V58A 1VF3A 3U6VA 2IIYA 2CZ3A 2K18A 3H1NA 3GMFA 2JZSA 1ZYEA 4RUVA 1OC9B 2VLUA 1WPIA 1FVJA 5G30A 2L59A 1WMJA 1FVKA 2PUKC 3H8QA 3EINA 2MYGA 2ZCTA 1CQGA 3GUSA 2XHFA 3TJJA 3A2XA 3VPTA 1K0AA 5EY6A 1MD4A 1F9MA 3I6AA 4EDZA 3A2WA 2FNOA 2C0GA 1NHYA 1QXHA 2H1AA 4ILFA 2LUSA 2H6XA 3LWAA 5EPFA 1GP1A 2RUEA 5DJMA 1TP9A 3EURA 3O3TA 3IXRA 2VL2A 1TK5B 4FYBA 3TKQA 1SJIA 5GSSA 3G7YA 5A4WA 5J5NA 2R2JA 4ECIA 2FUG2 3HYPA 4X1UA 3FW2A 3FKFA 1TI3A 4NV2A 2DJ3A 3GTUA 3L9UA 4JEDA 4F9ZA 3VURA 5DALA 1EV9A 1O7UA 3I69A 5ELAA 1ILOA 2K8VA 4MA9A 4WEYA 1URMA 1MDJA 4V2NA 4IELA 5F05A 2YWNA 4J57E 1AQWA 5JWQB 1GTIA 3CSIA 4YQUA 4BWSA 3CSHA 3AY8A 2YZUA 1R7HA 2V1MA 5D9WA 2L5LA 5ELGA 1LU4A 1QK8A 2I4AA 3KTBA 4KSOA 5B7CA 1PL1A 4Q5FA 4YQVA 4CDOA 1ML6A 3KM6A 3GSTA 3ZLPA 1Z6MA 1QGVA 4KDUA 4YQMA 2WGRA 1B4PA 1DUGA 1M2AA 5CREA 2R6KA 4GSSA 3WGDA 3F63A 1GTAA 2H6ZA 2A2RA 4Q5RA 4TR1B 4POBA 3PR8A 3HKRA 2VOCA 4V2LA 2VL9A 1S3DA 1FB6A 3HY2A 3DXBA 2EIQA 3QD9A 2OBIA 1H75A 3MSZA 1AQXA 2L5OA 1XW6A 5B8AA 1PSQA 3F4TA 4HU7A 3PGTA 3W8JA 4K0NA 5A4UA 5GAND 2HZEB 3P2AA 1AAZA 5ENUA 2C1YA 3DMLA 4F03A 5COHA 2REMA 2B7KA 4MABA 2GQMA 3LQ7A 1YKAA 1GULA 2DC5A 5D96A 1MD3A 2VUPA 2I81A 3QFBC 3TCOA 3US3A 2X8GA 4I2UA 2B3SA 3H93A 2HRNA 5ECLB 1VRSD 2VLVA 3LORA 4WR5A 1U88A 2MMOA 4Z7XA 2F8AA 3MAKA 2TIRA 1SK2A 2GS3A 2IMEA 2C8UA 4BPYA 2HFDA 1K3YA 2C3NA 5HR3A 3I43A 1JZRA 4MK3A 2HI7A 4LA1A 2B7JA 4MJBA 3APOA 4X43A 4EDYA 5D8IA 3TJGA 4H86A 2BJXA 2GSQA 1WWJA 1AC1A 1TRWA 2GDRA 1V40A 1GH2A 4PX1A 3F0IA 1Z6NA 2F9SA 3IRAA 4TVEA 1Q4JA 5E4WA 2WFCA 1PN9A 3Q18A 1SD9A 3APSA 3K8NA 1TI1A 3KH9A 4MF6A 3HHVA 5HR2A 4GCIA 4GXZA 3GSSA 3LGCA 3P8WA 3VLNA 2X8CA 4DVCA 2GTUA 1TKDB 1YF0A 3QPMA 1H4OA 3D6IA 5EL8A 1YEXA 2LEGA 3TOTA 3RHBA 4WKWA 5G2ZA 4ECCA 4EL1A 4ZL9A 1JFUA 2XBQA 3DIEA 4K0GA 1YEPA 5CNWA 1HD2A 2EC4A 1XW9A 5AGYA 2GSTA 4N10A 2HSYA 1DSBA 1J08A 4MJCA 2OE1A 3ZTLA 7GSSA 4WXTA 2LJKA 1XWGA 3ERFA 2F3MA 3FR9A 4JBBA 2HRFA 4K7OA 2YNXA 2G0FA 1BEDA 4ZB8A 2MMZA 4DEJA 5CYYA 3D22A 1T4ZA 2O85A 3HJPA 3UJ1A 3KH7A 4ECBA 1U6TA 1YQ1A 3DEXA 3HJOA 4WF5A 1Z7PA 5GAPD 3OR5A 4EF0A 4LMWA 3Q19A 4PQ1A 2JZRA 4GRFA 3P7XA 3W8SA 4O92A 1USBA 2YWOA 4Q5QA 4MZBA 4FH8A 3TB2A 4G2EA 3DGQA 1PL2A 5F06A 1G6WA 1ZMAA 2NTOA 1XIYA 2V6KA 5D9TA 4HU9A 5B6MA 5DAKA 3UOMA 4ID0A 2DMLA 2H19A 4LLRA 3L78A 3Q74A 1O8WA 1ERTA 4WETA 5IOXA 2CX3A 1E6BA 4F0CA 4I6XA 3O76A 2JACA 1EEJA 2VM1A 3QDNA 1A0FA 2OE3A 2P5QA 4ZBBA 3IPZA 2YWIA 2YJHA 3TKRA 3IK9A 2E0QA 3D4MA 1EEMA 3FZAA 3RPNA 16GSA 1PA3A 1XPVA 5CAXA 2I9HA 2DIYA 3GL5A 1OAZA 2GT5A 3QAVA 1XWBA 2VL3A 3CYNA 5FWGA 2MMAA 3KD0A 4OO5A 3DD3A 3ME7A 3TRPA 2PVOC 2VM2A 2N5BA 2V32A 3IA1A 4MJAA 4KNDA 1A8YA 1OC9A 3C71A 4OFTA 4HOJA 4GWRA 4N11A 3WGXA 1TRUA 4F2IA 2JSZA 3EYTA 1Q98A 2RM5A 4AJ6A 4ACSA 2NBSA 1GTBA 2QSIA 3CRUA 1R5PA 4V1Ag 2R5GA 2B5XA 2LS5A 2WULA 3R2QA 3VK9A 2I1UA 1ZOFA 2M72A 3N5OA 4E8EA 5DAKB 1KEBA 1T7PB 4I2TA 2RUFA 17GSA 4HZ2A 3QR6A 1X5DA 3TOUA 1BYEA 1GRXA 5A4VA 2DJ2A 2L4CA 2A4VA 22GSA 5DBQA 5JCWA 1DBYA 3A2VA 2YOIA 2C0FA 1EZKA 1TJDA 1FG4A 2GGTA 2LJRA 1JZDA 3U5RE 3KIJA 2GSRA 3FZ4A 4ISDA 3PINA 4CW9A 2FWGA 1C72A 1PMTA 5ECMB 3GX0A 4ZB9A 4NWYA 4N30A 2H0IA 4EE0A 4IQAA 3MWHA 3IBHA 3RPPA 3ZVJA 1MEKA 2H8LA 5B6NA 3EE2A 1GSQA 1BJXA 2KHPA 3WT1A 1V2AA 3HVXA 4GLTA 1FB0A 3ZL5A 4IJ3A 2IJYA 1M9AA 2CX4A 2PBJA 3WYWA 4PXOA 3RDWA 2DIZA 2N5FA 4WBJA 3KGKA 5JWRB 3FEUA 3F4SA 3F3QA 4XS1A 2CV4A 3ERWA 1FOVA 2YJ7A 5D9XA 4TR1A 4XRDA 4TOPA 2FWEA 6GSVA 1M99A 1JHBA 2AJQB 2R37A 1THXA 4Q5NA 1VF1A 1X9MB 4HQSA 2LQQA 4RI7A 3H4KA 2FA8A 3HCZA 3LYPA 1ST9A 4DSSA 2LV3A 4JR4A 3G7IA 1GUHA 1PRXA 1W4VA 5G1KA 2HZEA 1I9DA 3HZ4A 4ZB6A 1CQHA 2B1LA 2DMMA 1XZOA 4OFNA 1GUKA 2C3TA 2GQLA 3ZITA 3IV4A 2VCVA 1K3LA 3C7MA 1THOA 2H74A 2DJ1A 4IS0A 5DCGA 4HI7A 1WP0A 3GFKA 1MDKA 3M1GA 6GSUA 2DLXA 5EVOA 2ES7A 3E9JB 3GH6A 2XPEA 2JADA 1FW1A 1BQ7A 1OYJA 4KB3A 4MPGA 1A2JA 1XVWA 3SWLA 3GV1A 5CRWA 1M0UA 1T00A 1Y6EA 2BTOT 2H1GA 4TXVA 12GSA 4WR4A 1FO5A 1U87A 3RBTA 4MH2A 1XWCA 2VLTA 4NPBA 5AIXA 2VCWA 3QOUA 14GSA 3TJFA 2R4VA 2JU5A 3IDVA 1AW9A 4MP4A 5GZZB 2IFQA 3APQA 3H79A 4V2MA 4TR3A 1F3AA 1R5AA 2K8SA 2VAFA 2HSHA 4DSSB 4HQZA 2C3QA 4MZCA 3UEMA 1MDIA 5H5RA 4WBRD 4JE1A 3A3TA 9GSSA 2WCIA 3ZFLA 3TUEA 3FYGA 3HA9A 2YCDA 1A0RP 1X9SB 1GSDA 2X64A 1EOGA 2LSTA 2HZFA 2ON7A 3L9VA 1GNEA 1QQ2A 2LRTA 3DVWA 5L71A 1ZL9A 2MBSA 3KEBA 4YAVA 3GRXA 1WOUA 1K0DA 4O5RA 1GUMA 2LRCA 2WZ9A 1RK4A 4KCEA 4BL7A 5IQYA 4I5QA 5LNKe 2H70A 3TJKA 1LBKA 1O81A 3E3EA 1NM3A 2VCTA 3D4TA 4OO4A 3QAWA 4OFMA 4XRAA 3HDCA 2DJJA 3BCIA 1RW1A 1NW2A 4I97A 3I9V2 5HQPA 1YY7A 5IPGA 3LJRA 1LJRA 1XWKA 4HS1A 3VPQA 1QMVA 4TXOB 3MNGA 4MF7A 1IYIA 1SD8A 3ZREA 5CRGA 1TRSA 4FYUA 4TR0A 1SU9A 3FK8A 3IOSA 3DWVA 2IFQB 4L5OA 4LL4B 2HXKA 4XS4A 5AISA 3LG6A 1ZZYA 2LNTA 1SKWB 4MDCA 1X0RA 2VO4A 2M46A 2RLIA 2J23A 1XOAA 2NDOA 4OWYA 3L0HA 2GQKA 2O89A 5IMFA 3CBUA 2CAIA 3DYRA 3NIVA 4G9HA 4KDXA 1F6MC 3GKXA 5G5EA 1XVQA 5C04A 2L4QA 2OJLA 3VWUA 1PX6A 2AV4A 2H1BA 1SENA 5JWOB 1TK8B 1F37A 2ON5A 5CO3A 3RAZA 4PUAA 5ECIB 3C73A 3FZ5A 3EMPA 5CRDA 2GLRA 4ZL8A 3M3MA 4TR4A 3DRNA 2KP1A 4EKZA 1EWXA 4KDYA 4EXJA 2H0GA 5AIVA 1SKSB 3ZIVA 2BMXA 5KEJA 5H5SA 4BVYA 2CT6A 1JZOA 3FR3A 3F6FA 1KTEA 5KN2A 1XOBA 2J9HA 1DE1A 5HR1A 4BA7A 5G1LA 2XC2A 1G6YA 1YF1A 1B48A 4MJEA 4XS4B 4OMVA 3J7Yk 2I3YA 5IMVA 1SYXA 3D5JA 4PURA 4GSNA 5IMAA 3EVIA 3GNJA 3IHQA 4ZILA 2VD0A 3NZNA 3KMNA 5ID2B 5GSTA 2JSYA 2IPAA 4ZBAA 2AB6A 1BG5A 3VI7A 3Q6OA 1TOFA 1K0NA 5ECQB 4KE3A 3EWLA 3UVHA 2KLXA 5IIZA 4QL9A 4NV5A 1X5CA 2AYTA 2PERA 2X99A 2GZZA 3ZMKA 4IP6A 3F6DA 4PUFC 1OC8A 2GZYA 2H72A 4G19A 2TRCP 2YN1A 3CRTA 4MF5A 1PX7A 2PU9C 5IM9A 1HNAA 2LRNA 3UARA 1ON4A 3ED3A 5ECOB 3KMOA 1U3IA 1K3OA 1ABAA 3M0FA 2O87A 3FY7A 1G7OA 2H01A 3ME8A 2OKAA 3ZIJA 2KP2A 3IC4A 4NMUA 3E0UA 3ZZXA 2G2QA 1QUWA 4K6XA 5HR0A 2OE0A 4KW6A 4J56E 1YDKA 4POKA 4MPFA 2EIRA 1S3CA 4IP1A 1T1VA 2MMNA 2F8FA 1SL2B 2YP6A 4KA0A 3P90A 2M80A 2YV9A 4MCUA 1RQMA 3KP8A 1AIUA 4AF2A 2EIOA 3BD2A 4OD7A 3KTLA 4PQHA 1ERVA 3L9SA 2C0DA 1SJZA 1W89A 2P31A 1K0MA 4F82A 3NOFA 4KX4A 1XXUA 1UC7A 2IMKA 3UL3A 3F4RA 3TRQA 1Z3EA 2QKEA 2O7KA 1A2LA 4LMVA 1OE7A 4TN8A 1JLVA 1SKRB 4ML1A 2DBCA 5C00A 1EOHA 1JZWA 1VF2A 4P3YB 3GIXA 1PGTA 2VIMA 5KN0A 1SL1B 4X0XA 4L0WA 5ECHB 1WIKA 1V9WA 2KUCA 3GX8A 2FWHA 4WF4A 4JR6A 3GKKA 2C0EA 5IO0A 1GSEA 3KCMA 5F07A 1OE8A 4AGSA 3TGZA 4FO5A 18GSA 3FHKA 3GH9A 1ERUA 4IHUA 5ABRA 3BBYA 4GQCA 2D2ZA 4K7NA 2YZHA 2VL2C 3IAS2 1PKZA 2MBTA 3G7JA 1ZGNA 4EO3A 1N8JA 1HNBA 4MLYA 4YH2A 4HUAA 3TRXA 1B9YC 2XBIA 4K1FA 3UAPA 3L4NA 3F8UA 3GKMA 2O8VB 1SK1A 3LYKA 4HJMA 1QFNA 2H30A 4HZ4A 4EVMA 1YZXA 3HJMA 2LKUA 1VGLA 13GSA 3TDGA 4GQFA 1O6JA 5G5FA 2WJUA 1T4YA 3V1WA 4KSMA 2VCZA 1M2DA 2YV7A 2CAQA 4IVFA 1M7TA 3TKPA 4EUYA 4XIHA 4QQ7A 4IN0A 5ECPB 1U3AA 2H1DA 4GTUA 4HEA2 2CVDA 1F3BA 5JCGA 3GYKA 1OC3A 2ZNMA 5LCZA 5IMZA 1Z7RA 2OA7A 5H5QA 1TXXA 4PGTA 1OKDA 5LD0A 2FGXA 4G10A 4XHMA 2PPTA 1E2YA 2H76A 1SYRA 2N5AA 8GSSA 3GL3A 2CVKA 3J7Yb 4D73A 4K7IA 6GSWA 1DE2A 2YWMA 2L6DA 2AHEA 4BVXA 5FT3A 4RQRA 1UVZA 1GNWA 2NVLA 5J9CA 3CXGA 3D0ZA 2V41A 4E8HA 1GL8A 1AUCA 1PQNA 3QCPA 4JU5A 1GWCA 4TXOA 4N0ZA 1V57A 5J41A 4ULXA 2KOKA 2H0HA 3CSJA 3LSZA 2QGVA 1SK0A 3VWVA 4ZIJA 2H66A 3QMXA 4HDEA 4ZBDA 1TRVA 3ERGA 2WB9A 1WE0A 2X8HA 1B4QA 1HQOA 3GN3A 10GSA 1T8EB 3HXSA 3ZFBA 1GSYA 3ZYWA 4XTSA 5IMDA 1ZYQB 3EMXA 4NHZA 5E59A 2FA4A 4IBPA 4XS6A 19GSA 4K8MA 2H71A 4KUNA 1VF4A 2C4JA 4F0BA 1GSSA 2RM6A 3GTUB 2E7PA 5DALB 4KCAA 1SJ6A 5ECNB 1BAYA 2OACA 2IN3A 2V2GA 1AQVA 1A2MA 3M8NA 2YPMA 20GSA 5IOWA 2IWTA 3KJYA 5DCHA 1WRYA 1EP8A 4GSTA 1GTUA 4D73B 3KXOA 2GVPA 2ALBA 5D73A 2H73A 3O6TA 1XWAA 2E2MA 4EC0A 2VD1A 5A5KA 3LXTA 2FY6A 2WS2A 1AXDA 3IAM2 2PN8A 2AAWA 3VFIA
chains in the Genus database with same CATH superfamily
1JLWA 3MDKA 4MH3A 5ECKB 3KP9A 2HSMA 2PMTA 2NPBA 4AJ8A 2B6MA 4IJIA 2RIIA 5G31A 3GHAA 1X5EA 3F3RA 3TKSE 1GLQA 5ID2A 5CRHA 4DSQA 3C8EA 3QAGA 3UVTA 1EGOA 1F2EA 2LJAA 2HNLA 4NAXA 3RHCA 3VWXA 2PGTA 1K0CA 4NXIA 4O7HA 1KBNA 1S3AA 2H75A 3ZVJD 4RQXA 3LFLA 2TRXA 2HE3A 4IQ1A 3GKNA 1ERWA 5AN1A 1TTZA 3IK7A 5INYA 2VCQA 1MTCA 4IGJA 5D93A 2DSAA 1B8XA 5IPHA 3FRCA 2FD3A 2LNSA 1G7EA 5DDLA 4L0UA 3IE3A 5DQYA 4NHWA 3IR4A 4ECJA 1WJKA 5KN1A 1ZCPA 1Z9HA 1Z5YE 4N0VA 1GSFA 3WT2A 3EU4A 3GA4A 5KN3A 2LTKA 3BJ5A 2DJ0A 1K0BA 2GT6A 5HFIA 1TU8A 1XW5A 1O73A 3PH9A 3FR6A 3HZ8A 2FWFA 3FMWA 1T3BA 2LQOA 1UN2A 3UMAA 2CA8A 5ECRB 3A5WA 3BOAA 3HVVA 4I8BA 4USSA 1XBSA 2R3XA 1OKTA 2CZ2A 1J0FA 3G9BA 2GZPA 5DJLA 2B5YA 3SBCA 1N2AA 5JCUA 1TK0B 2MZCA 4XCSA 2OADA 2ZUPA 2IMFA 3EC3A 3ISOA 3DVXA 3QFAC 2WRTA 2VCXA 4OCFA 2CVBA 4FYCA 4FIWA 3M9JA 1IYHA 1V98A 3D21A 1NSWA 4JZQA 1TU7A 4POMA 2FCHA 1Y25A 4K9ZA 1M9BA 1R4WA 2E2GA 4YAPA 4JRRA 4MMMA 3ZMLA 3VWWA 1TDIA 3CTGA 5DVBA 3ZRDA 4RI6A 2IMDA 4Z2TA 1A23A 2DJKA 3TKSC 2C80A 2K6VA 3VI5A 2JZTA 4HJ2A 4L5LA 1O8XA 2HLSA 6GSXA 4PNFA 1M3JA 3FZ9A 3WGEA 2HYXA 5B8BA 1XFLA 4ML6A 3TJBA 1UA5A 2IL3A 2QC7A 3LXZA 4LL1B 4CHSA 2F51A 3EU3A 4AJ7A 11GSA 3UIWA 5DQSA 1A24A 1EGRA 3CMIA 4IW9A 1SL0B 3PPUA 4ZL7A 5F0GA 2WDUA 3LEFA 3C1SA 3KZQA 2AUVA 4PNGA 2OBKA 5J3RA 2QA2A 3C1RA 4OCEA 2K9FA 4QL7A 3UBKA 4TRXA 1XCCA 4MZWA 5CP1A 5HFGA 1YJ6A 3GURA 1GLPA 2A2SA 4O32A 1HNCA 4TW5A 1O85A 1BX9A 1YKCA 3S9FA 2JL4A 4DSRA 2PWJA 2Z9SA 1G0TA 3TKSA 2YANA 2B5EA 1A8LA 1EP7A 3IHGA 3HD5A 4KGIA 5IMCA 2HT9A 1ACVA 4PQIA 6GSSA 3CTFA 4ZXGA 3F9UA 2HRAA 4X4JA 2GSSA 2L6CA 2L57A 1PD21 1FAAA 2PVQA 1K0OA 4J2FA 4L8EA 1M2BA 1I5GA 2A4HA 5BRTA 3M9KA 1R26A 2V6OA 5FHIA 4V1Ap 1GSUA 4TKYA 5D9VA 2XPDA 2B1KA 3UBLA 1B9XC 5J9BA 4BWQA 5ECSA 3WD6A 1PKWA 2IMIA 1J9BA 1KNGA 4POLA 2FLSA 5HFKA 1NHOA 4KH7A 1M3IA 1EV4A 3BCKA 2FHEA 4GF0A 4A5PA 4KAEA 3JCML 5J4UA 3N9JA 2H6YA 5F8BA 3DKSA 1X9WB 1FHEA 1OVNA 6GSYA 3HVSA 2P5RA 4K2DA 4MNNA 1HYUA 2P0GA 2CQ9A 6GSTA 5IO2A 4IKHA 3W6GA 1TW9A 1V58A 1VF3A 3U6VA 2IIYA 2CZ3A 2K18A 2HRKA 3H1NA 3GMFA 2JZSA 1ZYEA 4RUVA 1OC9B 2VLUA 1WPIA 1FVJA 5G30A 2L59A 1WMJA 2R0PA 1FVKA 2PUKC 3H8QA 3EINA 2MYGA 2ZCTA 1CQGA 3GUSA 2XHFA 3TJJA 3A2XA 3VPTA 1K0AA 5EY6A 1MD4A 1F9MA 3I6AA 4EDZA 3A2WA 2FNOA 2C0GA 1NHYA 1QXHA 2H1AA 4ILFA 2LUSA 2H6XA 3LWAA 5EPFA 1GP1A 2RUEA 5DJMA 1TP9A 3EURA 3O3TA 3IXRA 2VL2A 1TK5B 4FYBA 3TKQA 1SJIA 5GSSA 3G7YA 5A4WA 5J5NA 2R2JA 4ECIA 2FUG2 3HYPA 4X1UA 3FW2A 3FKFA 1TI3A 4NV2A 2DJ3A 1ZYPA 3GTUA 3L9UA 4JEDA 4F9ZA 3VURA 5DALA 1EV9A 1O7UA 3I69A 5ELAA 1ILOA 2K8VA 4MA9A 4WEYA 1URMA 1MDJA 4V2NA 4IELA 5F05A 2YWNA 4J57E 1AQWA 5JWQB 1GTIA 1PN0A 3CSIA 4YQUA 4BWSA 3CSHA 3AY8A 2YZUA 1R7HA 2V1MA 5D9WA 2L5LA 5ELGA 1LU4A 1QK8A 2I4AA 3KTBA 4KSOA 5B7CA 1PL1A 4Q5FA 4YQVA 4CDOA 1ML6A 3KM6A 3GSTA 3ZLPA 1Z6MA 1QGVA 4KDUA 4YQMA 2WGRA 1B4PA 1DUGA 1M2AA 5CREA 2R6KA 4GSSA 3WGDA 3F63A 5KOWA 1GTAA 2H6ZA 2A2RA 4Q5RA 4TR1B 4POBA 3PR8A 3HKRA 2VOCA 4V2LA 2VL9A 1S3DA 1FB6A 3HY2A 3DXBA 2EIQA 3QD9A 2OBIA 4K5SA 1H75A 3MSZA 1AQXA 2L5OA 1XW6A 5B8AA 1PSQA 3F4TA 4HU7A 3PGTA 3W8JA 4K0NA 5A4UA 5GAND 2HZEB 3P2AA 1AAZA 5ENUA 2C1YA 3DMLA 4F03A 5COHA 2REMA 2B7KA 4MABA 2GQMA 3LQ7A 1YKAA 1GULA 2DC5A 5D96A 1MD3A 2VUPA 2I81A 3QFBC 1S3RA 3TCOA 3US3A 2X8GA 4I2UA 2B3SA 3H93A 2HRNA 5ECLB 1VRSD 2VLVA 3LORA 4WR5A 1U88A 2MMOA 4Z7XA 3A5IA 2F8AA 3MAKA 2TIRA 1SK2A 2GS3A 2IMEA 2C8UA 4BPYA 2HFDA 1K3YA 2C3NA 5HR3A 3I43A 1JZRA 4MK3A 2HI7A 4LA1A 2B7JA 4MJBA 3APOA 4X43A 4EDYA 5D8IA 3TJGA 4H86A 2BJXA 2GSQA 1WWJA 1AC1A 1TRWA 2GDRA 1V40A 1GH2A 4PX1A 3F0IA 1Z6NA 2F9SA 3IRAA 4TVEA 1Q4JA 5E4WA 2WFCA 1PN9A 3Q18A 1SD9A 3APSA 3K8NA 1TI1A 3KH9A 4MF6A 3HHVA 5HR2A 4GCIA 4GXZA 3GSSA 3LGCA 3P8WA 3VLNA 2X8CA 4DVCA 2GTUA 1TKDB 1YF0A 3QPMA 1H4OA 3D6IA 5EL8A 1YEXA 4FQUA 2LEGA 3TOTA 3RHBA 4WKWA 5G2ZA 4ECCA 4EL1A 4ZL9A 1JFUA 2XBQA 3DIEA 4BL7B 4K0GA 1YEPA 5CNWA 1HD2A 2EC4A 1XW9A 4G0KA 5AGYA 2GSTA 4N10A 2HSYA 1DSBA 1J08A 4MJCA 2OE1A 3ZTLA 7GSSA 4WXTA 2LJKA 1XWGA 3ERFA 2F3MA 3FR9A 4JBBA 2HRFA 4K7OA 2YNXA 2G0FA 1BEDA 4ZB8A 2MMZA 4DEJA 5CYYA 3D22A 1T4ZA 2O85A 3HJPA 3UJ1A 3KH7A 4ECBA 1U6TA 1YQ1A 3DEXA 3HJOA 4WF5A 4KF9A 1Z7PA 4PTSA 5GAPD 3OR5A 4EF0A 3MYDA 4LMWA 3Q19A 4PQ1A 2JZRA 4GRFA 3P7XA 3W8SA 4O92A 1USBA 2YWOA 4Q5QA 4MZBA 4FH8A 3TB2A 4G2EA 3DGQA 1XG8A 1PL2A 5F06A 1G6WA 1ZMAA 2NTOA 1XIYA 2V6KA 5D9TA 4HU9A 5B6MA 5DAKA 3UOMA 4ID0A 2DMLA 2H19A 4LLRA 3L78A 3Q74A 1O8WA 1ERTA 4WETA 5IOXA 4O5QA 2CX3A 1E6BA 4F0CA 4I6XA 3O76A 2JACA 1EEJA 2VM1A 3QDNA 1A0FA 4HSCX 2OE3A 4EIQA 2P5QA 4ZBBA 3IPZA 2YWIA 2YJHA 3TKRA 3IK9A 2E0QA 3D4MA 1EEMA 3FZAA 3RPNA 16GSA 1PA3A 1XPVA 5CAXA 2I9HA 2DIYA 3GL5A 1OAZA 2GT5A 3QAVA 1XWBA 2VL3A 3CYNA 5FWGA 2MMAA 3KD0A 4OO5A 3DD3A 3ME7A 3TRPA 2PVOC 2VM2A 2N5BA 2V32A 3IA1A 4MJAA 4KNDA 1A8YA 1OC9A 3C71A 4OFTA 4HOJA 4GWRA 4N11A 3WGXA 1TRUA 4F2IA 2JSZA 1PFOA 3EYTA 1Q98A 2RM5A 4AJ6A 4ACSA 2NBSA 1GTBA 2QSIA 3CRUA 1R5PA 4V1Ag 2R5GA 2X4AA 2B5XA 2LS5A 2WULA 3R2QA 3VK9A 2I1UA 1ZOFA 3HVNA 2M72A 3N5OA 4E8EA 5DAKB 1KEBA 1T7PB 4I2TA 2RUFA 17GSA 4HZ2A 3QR6A 1X5DA 3TOUA 1BYEA 1GRXA 5A4VA 2DJ2A 2L4CA 2A4VA 22GSA 5DBQA 5JCWA 1DBYA 3A2VA 2YOIA 2C0FA 1EZKA 1TJDA 1FG4A 2GGTA 2LJRA 1JZDA 3U5RE 3KIJA 4CY8A 2GSRA 4BIKA 3FZ4A 4ISDA 3PINA 4CW9A 2FWGA 1C72A 1PMTA 5ECMB 4Z2UA 3GX0A 4ZB9A 4NWYA 4N30A 2H0IA 4EE0A 4IQAA 4O5UA 3MWHA 3IBHA 3RPPA 3ZVJA 1MEKA 2H8LA 5B6NA 3EE2A 1GSQA 1BJXA 2KHPA 3WT1A 1V2AA 3HVXA 4GLTA 1FB0A 3ZL5A 4IJ3A 2R0GA 2IJYA 1M9AA 2CX4A 2PBJA 3WYWA 4PXOA 3RDWA 2DIZA 2N5FA 4WBJA 3KGKA 5JWRB 3FEUA 3F4SA 3F3QA 4XS1A 2CV4A 3ERWA 1FOVA 2YJ7A 5D9XA 4TR1A 4XRDA 4TOPA 2FWEA 6GSVA 1M99A 1ZYNA 1JHBA 2AJQB 2R37A 1THXA 4Q5NA 1VF1A 1X9MB 4HQSA 2LQQA 4RI7A 3H4KA 2FA8A 3HCZA 3LYPA 1ST9A 4DSSA 2LV3A 4JR4A 3G7IA 3MIXA 1GUHA 1PRXA 1W4VA 5G1KA 2HZEA 1I9DA 3HZ4A 4ZB6A 1CQHA 2B1LA 2DMMA 1XZOA 4OFNA 1GUKA 2C3TA 2GQLA 3ZITA 3IV4A 2VCVA 1K3LA 3C7MA 1THOA 2H74A 2DJ1A 4IS0A 5DCGA 4HI7A 1WP0A 3GFKA 1MDKA 3M1GA 6GSUA 2DLXA 5EVOA 2ES7A 3E9JB 3GH6A 2XPEA 2JADA 1FW1A 1BQ7A 1OYJA 4YKGA 4KB3A 4MPGA 1A2JA 1XVWA 3SWLA 3GV1A 5CRWA 1M0UA 1T00A 1Y6EA 2BTOT 2H1GA 4TXVA 12GSA 4WR4A 4CY6A 1FO5A 1U87A 2UZ8A 3RBTA 2A2PA 4MH2A 1XWCA 2VLTA 4NPBA 5AIXA 2VCWA 3QOUA 14GSA 3TJFA 2R4VA 2JU5A 3IDVA 1AW9A 4MP4A 5GZZB 4ICYA 2IFQA 3APQA 3H79A 4V2MA 4TR3A 1F3AA 1R5AA 2K8SA 2VAFA 2HSHA 4DSSB 4HQZA 2C3QA 4MZCA 3UEMA 1MDIA 5H5RA 4WBRD 4JE1A 3A3TA 9GSSA 2WCIA 3ZFLA 3TUEA 3FYGA 3HA9A 2YCDA 1A0RP 1X9SB 1GSDA 2X64A 1EOGA 2LSTA 2HZFA 2ON7A 2QA1A 2X49A 3L9VA 1GNEA 1QQ2A 2LRTA 3DVWA 5L71A 1ZL9A 2MBSA 3KEBA 4YAVA 3GRXA 5BMUA 1WOUA 1K0DA 4O5RA 1GUMA 2LRCA 2WZ9A 1RK4A 4KCEA 4BL7A 5IQYA 4I5QA 5LNKe 2H70A 3TJKA 1LBKA 1O81A 3E3EA 1NM3A 2VCTA 3D4TA 4OO4A 3QAWA 4OFMA 4XRAA 3HDCA 2DJJA 3BCIA 1RW1A 1NW2A 4I97A 3I9V2 5HQPA 1YY7A 5IPGA 3LJRA 4Z2RA 1LJRA 1XWKA 4HS1A 3VPQA 1QMVA 4TXOB 3MNGA 4MF7A 1IYIA 1SD8A 3ZREA 5CRGA 1TRSA 2R0CA 4FYUA 4TR0A 1SU9A 3FK8A 3IOSA 3DWVA 2IFQB 4L5OA 4LL4B 2HXKA 4XS4A 5AISA 3LG6A 1ZZYA 2LNTA 1SKWB 4MDCA 1X0RA 2VO4A 2M46A 2RLIA 2J23A 1XOAA 3CQFA 2NDOA 4OWYA 3L0HA 2GQKA 2O89A 5IMFA 3CBUA 2CAIA 3DYRA 3NIVA 4G9HA 4KDXA 1F6MC 3EPTA 3GKXA 5G5EA 1XVQA 5C04A 2L4QA 2OJLA 3VWUA 1PX6A 2AV4A 2H1BA 1SENA 5JWOB 1TK8B 1F37A 2ON5A 5CO3A 3RAZA 4PUAA 5ECIB 3C73A 3FZ5A 3EMPA 5CRDA 2GLRA 4ZL8A 3M3MA 4TR4A 3DRNA 2KP1A 4EKZA 1EWXA 4KDYA 4EXJA 2H0GA 5AIVA 1SKSB 3ZIVA 2BMXA 5KEJA 5H5SA 4BVYA 2CT6A 1JZOA 3FR3A 3F6FA 1KTEA 5KN2A 1XOBA 2J9HA 1DE1A 5HR1A 4BA7A 5G1LA 2XC2A 1G6YA 1YF1A 1B48A 4MJEA 4XS4B 4OMVA 3J7Yk 2I3YA 5IMVA 1SYXA 3D5JA 4G0IA 4PURA 4GSNA 5IMAA 3EVIA 3GNJA 3IHQA 4ZILA 2VD0A 3NZNA 3KMNA 5ID2B 5GSTA 2JSYA 2IPAA 4ZBAA 2AB6A 1BG5A 3VI7A 3Q6OA 1TOFA 1K0NA 5ECQB 4KE3A 4K2XA 3EWLA 3UVHA 2KLXA 5IIZA 4QL9A 4NV5A 1X5CA 2AYTA 2PERA 2X99A 2GZZA 3ZMKA 4IP6A 3F6DA 5KOXA 4PUFC 1OC8A 2GZYA 2H72A 4G19A 2TRCP 2YN1A 3CRTA 4MF5A 1PX7A 2PU9C 5IM9A 1HNAA 2LRNA 3R3EA 3UARA 1ON4A 3ED3A 5ECOB 3KMOA 1U3IA 4G0LA 1K3OA 1ABAA 3M0FA 2O87A 3FY7A 1G7OA 2H01A 3ME8A 2OKAA 3ZIJA 4K5RA 2KP2A 3IC4A 4NMUA 3E0UA 4BVYB 3ZZXA 2G2QA 1QUWA 4K6XA 5HR0A 2OE0A 4KW6A 4J56E 1YDKA 4POKA 4MPFA 2EIRA 1S3CA 4IP1A 1T1VA 2MMNA 2F8FA 1SL2B 2YP6A 4KA0A 3LW9A 3P90A 2M80A 2YV9A 4MCUA 1RQMA 3KP8A 1AIUA 4AF2A 2EIOA 3BD2A 4OD7A 3KTLA 4PQHA 1ERVA 3L9SA 2C0DA 1SJZA 1W89A 2P31A 1K0MA 4F82A 3NOFA 4KX4A 1XXUA 1UC7A 2IMKA 3UL3A 3F4RA 3TRQA 1Z3EA 2QKEA 2O7KA 1A2LA 4LMVA 1OE7A 4TN8A 1JLVA 1SKRB 4ML1A 2DBCA 5C00A 1EOHA 1FOHA 1JZWA 1VF2A 4P3YB 3GIXA 4EIPA 1PGTA 2VIMA 5KN0A 1SL1B 4X0XA 4L0WA 5ECHB 1WIKA 1V9WA 2KUCA 3GX8A 2FWHA 4WF4A 4JR6A 3GKKA 2C0EA 5IO0A 1GSEA 3KCMA 5F07A 1OE8A 4AGSA 3TGZA 4FO5A 18GSA 3FHKA 3GH9A 1ERUA 4IHUA 5ABRA 3BBYA 4GQCA 2D2ZA 4K7NA 2YZHA 2VL2C 3IAS2 1PKZA 2MBTA 3G7JA 1ZGNA 4EO3A 1N8JA 1HNBA 4MLYA 4YH2A 4HUAA 3TRXA 2DKHA 1B9YC 2XBIA 4K1FA 3UAPA 2DKIA 3L4NA 3F8UA 3GKMA 2O8VB 1SK1A 3LYKA 4HJMA 1QFNA 2H30A 4HZ4A 4EVMA 1YZXA 3HJMA 2LKUA 1VGLA 13GSA 3TDGA 4GQFA 1O6JA 5G5FA 2WJUA 1T4YA 3V1WA 4KSMA 2VCZA 1M2DA 2YV7A 2CAQA 4IVFA 1M7TA 3TKPA 4EUYA 4XIHA 4QQ7A 4IN0A 5ECPB 1U3AA 2H1DA 4GTUA 4HEA2 2CVDA 1F3BA 5JCGA 3GYKA 1OC3A 2ZNMA 5LCZA 5IMZA 1Z7RA 2OA7A 5H5QA 1TXXA 4PGTA 1OKDA 5LD0A 2FGXA 4G10A 4XHMA 2PPTA 1E2YA 2H76A 1SYRA 2N5AA 8GSSA 3GL3A 2CVKA 3J7Yb 4D73A 4K7IA 6GSWA 1DE2A 2YWMA 2L6DA 2AHEA 4BVXA 5FT3A 4RQRA 1UVZA 1GNWA 2NVLA 5J9CA 3CXGA 3D0ZA 2V41A 4E8HA 1GL8A 1AUCA 1PQNA 3QCPA 4JU5A 1GWCA 4TXOA 4N0ZA 1V57A 5J41A 4ULXA 2KOKA 2H0HA 3CSJA 3LSZA 2QGVA 1SK0A 3VWVA 4ZIJA 2H66A 3QMXA 4HDEA 4ZBDA 1TRVA 3ERGA 2WB9A 1WE0A 2X8HA 1B4QA 1HQOA 3GN3A 10GSA 1T8EB 3HXSA 3ZFBA 1GSYA 3ZYWA 4XTSA 5IMDA 1ZYQB 3EMXA 4NHZA 5E59A 2FA4A 4IBPA 4YKFA 4XS6A 19GSA 4K8MA 2H71A 4KUNA 1VF4A 2C4JA 4F0BA 1GSSA 3IC8A 2RM6A 3GTUB 2E7PA 5DALB 4KCAA 1SJ6A 5ECNB 1BAYA 2OACA 2IN3A 2V2GA 1AQVA 1A2MA 3M8NA 2YPMA 20GSA 5IOWA 2IWTA 3KJYA 5DCHA 1WRYA 1EP8A 4GSTA 1GTUA 4D73B 3KXOA 2GVPA 4BVXB 2ALBA 5D73A 2H73A 3O6TA 1XWAA 2E2MA 4EC0A 2VD1A 5A5KA 3LXTA 2FY6A 2WS2A 1AXDA 3IAM2 2PN8A 2AAWA 3VFIA
chains in the Genus database with same CATH topology
1JLWA 3MDKA 4MH3A 5ECKB 3KP9A 2HSMA 2PMTA 2NPBA 4AJ8A 2B6MA 4IJIA 2RIIA 5G31A 3GHAA 1X5EA 3F3RA 3TKSE 1GLQA 5ID2A 5CRHA 4DSQA 3C8EA 3QAGA 3UVTA 1EGOA 1F2EA 2LJAA 2HNLA 4NAXA 3RHCA 3VWXA 2PGTA 1K0CA 4NXIA 4O7HA 1KBNA 1S3AA 2H75A 3ZVJD 4RQXA 3LFLA 2TRXA 2HE3A 4IQ1A 3GKNA 1ERWA 5AN1A 1TTZA 3IK7A 5INYA 2VCQA 1MTCA 4IGJA 5D93A 2DSAA 1B8XA 5IPHA 3FRCA 2FD3A 2LNSA 1G7EA 5DDLA 4L0UA 3IE3A 5DQYA 4NHWA 3IR4A 4ECJA 1WJKA 5KN1A 1ZCPA 1Z9HA 1Z5YE 4N0VA 1GSFA 3WT2A 3EU4A 3GA4A 5KN3A 2LTKA 3BJ5A 2DJ0A 1K0BA 2GT6A 5HFIA 1TU8A 1XW5A 1O73A 3PH9A 3FR6A 3HZ8A 2FWFA 3FMWA 1T3BA 2LQOA 1UN2A 3UMAA 2CA8A 5ECRB 3A5WA 3BOAA 3HVVA 4I8BA 4USSA 1XBSA 2R3XA 1OKTA 2CZ2A 1J0FA 3G9BA 2GZPA 5DJLA 2B5YA 3SBCA 1N2AA 5JCUA 1TK0B 2MZCA 4XCSA 2OADA 2ZUPA 2IMFA 3EC3A 3ISOA 3DVXA 3QFAC 2WRTA 2VCXA 4OCFA 2CVBA 4FYCA 4FIWA 3M9JA 1IYHA 1V98A 3D21A 1NSWA 4JZQA 1TU7A 4POMA 2FCHA 1Y25A 4K9ZA 1M9BA 1R4WA 2E2GA 4YAPA 4JRRA 4MMMA 3ZMLA 3VWWA 1TDIA 3CTGA 5DVBA 3ZRDA 4RI6A 2IMDA 4Z2TA 1A23A 2DJKA 3TKSC 2C80A 2K6VA 3VI5A 2JZTA 4HJ2A 4L5LA 1O8XA 2HLSA 6GSXA 4PNFA 3FZ9A 3WGEA 2HYXA 5B8BA 1XFLA 4ML6A 3TJBA 1UA5A 2IL3A 2QC7A 3LXZA 4LL1B 4CHSA 2F51A 3EU3A 4AJ7A 11GSA 3UIWA 5DQSA 1A24A 1EGRA 3CMIA 4IW9A 1SL0B 3PPUA 4ZL7A 5F0GA 2WDUA 3LEFA 3C1SA 3KZQA 2AUVA 4PNGA 2OBKA 5J3RA 2QA2A 3C1RA 4OCEA 2K9FA 4QL7A 3UBKA 4TRXA 1XCCA 4MZWA 5CP1A 5HFGA 1YJ6A 3GURA 1GLPA 2A2SA 4O32A 1HNCA 4TW5A 1O85A 1BX9A 1YKCA 3S9FA 2JL4A 4DSRA 2PWJA 2Z9SA 1G0TA 3TKSA 2YANA 2B5EA 1A8LA 1EP7A 3IHGA 3HD5A 4KGIA 5IMCA 2HT9A 1ACVA 4PQIA 6GSSA 3CTFA 4ZXGA 3F9UA 2HRAA 4X4JA 2GSSA 2L6CA 2L57A 1PD21 1FAAA 2PVQA 1K0OA 4J2FA 4L8EA 1M2BA 1I5GA 2A4HA 5BRTA 3M9KA 1R26A 2V6OA 5FHIA 4V1Ap 1GSUA 4TKYA 5D9VA 2XPDA 2B1KA 3UBLA 1B9XC 5J9BA 4BWQA 5ECSA 3WD6A 1PKWA 2IMIA 1J9BA 1KNGA 4POLA 2FLSA 5HFKA 1NHOA 4KH7A 1EV4A 3BCKA 2FHEA 4GF0A 4A5PA 4KAEA 3JCML 5J4UA 3N9JA 2H6YA 5F8BA 3DKSA 1X9WB 1FHEA 1OVNA 6GSYA 3HVSA 2P5RA 4K2DA 4MNNA 1HYUA 2P0GA 2CQ9A 6GSTA 5IO2A 4IKHA 3W6GA 1TW9A 1V58A 1VF3A 3U6VA 2IIYA 2CZ3A 2K18A 2HRKA 3H1NA 3GMFA 2JZSA 1ZYEA 4RUVA 1OC9B 2VLUA 1WPIA 1FVJA 5G30A 2L59A 1WMJA 2R0PA 1FVKA 2PUKC 3H8QA 3EINA 2MYGA 2ZCTA 1CQGA 3GUSA 2XHFA 3TJJA 3A2XA 3VPTA 1K0AA 5EY6A 1MD4A 1F9MA 3I6AA 4EDZA 3A2WA 2FNOA 2C0GA 1NHYA 1QXHA 2H1AA 4ILFA 2LUSA 2H6XA 3LWAA 5EPFA 1GP1A 2RUEA 5DJMA 1TP9A 3EURA 3O3TA 3IXRA 2VL2A 1TK5B 4FYBA 3TKQA 1SJIA 5GSSA 3G7YA 5A4WA 5J5NA 2R2JA 4ECIA 2FUG2 3HYPA 4X1UA 3FW2A 3FKFA 1TI3A 4NV2A 2DJ3A 1ZYPA 3GTUA 3L9UA 4JEDA 4F9ZA 3VURA 5DALA 1EV9A 1O7UA 3I69A 5ELAA 1ILOA 2K8VA 4MA9A 4WEYA 1URMA 1MDJA 4V2NA 4IELA 5F05A 2YWNA 4J57E 1AQWA 5JWQB 1GTIA 1PN0A 3CSIA 4YQUA 4BWSA 3CSHA 3AY8A 2YZUA 1R7HA 2V1MA 5D9WA 2L5LA 5ELGA 1LU4A 1QK8A 2I4AA 3KTBA 4KSOA 5B7CA 1PL1A 4Q5FA 4YQVA 4CDOA 1ML6A 3KM6A 3GSTA 3ZLPA 1Z6MA 1QGVA 4KDUA 4YQMA 2WGRA 1B4PA 1DUGA 1M2AA 5CREA 2R6KA 4GSSA 3WGDA 3F63A 5KOWA 1GTAA 2H6ZA 2A2RA 4Q5RA 4TR1B 4POBA 3PR8A 3HKRA 2VOCA 4V2LA 2VL9A 1S3DA 1FB6A 3HY2A 3DXBA 2EIQA 3QD9A 2OBIA 4K5SA 1H75A 3MSZA 1AQXA 2L5OA 1XW6A 5B8AA 1PSQA 3F4TA 4HU7A 3PGTA 3W8JA 4K0NA 5A4UA 5GAND 2HZEB 3P2AA 1AAZA 5ENUA 2C1YA 3DMLA 4F03A 5COHA 2REMA 2B7KA 4MABA 2GQMA 3LQ7A 1YKAA 1GULA 2DC5A 5D96A 1MD3A 2VUPA 2I81A 3QFBC 3TCOA 3US3A 2X8GA 4I2UA 2B3SA 3H93A 2HRNA 5ECLB 1VRSD 2VLVA 3LORA 4WR5A 1U88A 2MMOA 4Z7XA 3A5IA 2F8AA 3MAKA 2TIRA 1SK2A 2GS3A 2IMEA 2C8UA 4BPYA 2HFDA 1K3YA 2C3NA 5HR3A 3I43A 1JZRA 4MK3A 2HI7A 4LA1A 2B7JA 4MJBA 3APOA 4X43A 4EDYA 5D8IA 3TJGA 4H86A 2BJXA 2GSQA 1WWJA 1AC1A 1TRWA 2GDRA 1V40A 1GH2A 4PX1A 3F0IA 1Z6NA 2F9SA 3IRAA 4TVEA 1Q4JA 5E4WA 2WFCA 1PN9A 3Q18A 1SD9A 3APSA 3K8NA 1TI1A 3KH9A 4MF6A 3HHVA 5HR2A 4GCIA 4GXZA 3GSSA 3LGCA 3P8WA 3VLNA 2X8CA 4DVCA 2GTUA 1TKDB 1YF0A 3QPMA 1H4OA 3D6IA 5EL8A 1YEXA 4FQUA 2LEGA 3TOTA 3RHBA 4WKWA 5G2ZA 4ECCA 4EL1A 4ZL9A 1JFUA 2XBQA 3DIEA 4BL7B 4K0GA 1YEPA 5CNWA 1HD2A 2EC4A 1XW9A 4G0KA 5AGYA 2GSTA 4N10A 2HSYA 1DSBA 1J08A 4MJCA 2OE1A 3ZTLA 7GSSA 4WXTA 2LJKA 1XWGA 3ERFA 2F3MA 3FR9A 4JBBA 2HRFA 4K7OA 2YNXA 2G0FA 1BEDA 4ZB8A 2MMZA 4DEJA 5CYYA 3D22A 1T4ZA 2O85A 3HJPA 3UJ1A 3KH7A 4ECBA 1U6TA 1YQ1A 3DEXA 3HJOA 4WF5A 4KF9A 1Z7PA 4PTSA 5GAPD 3OR5A 4EF0A 3MYDA 4LMWA 3Q19A 4PQ1A 2JZRA 4GRFA 3P7XA 3W8SA 4O92A 1USBA 2YWOA 4Q5QA 4MZBA 4FH8A 3TB2A 4G2EA 3DGQA 1PL2A 5F06A 1G6WA 1ZMAA 2NTOA 1XIYA 2V6KA 5D9TA 4HU9A 5B6MA 5DAKA 3UOMA 4ID0A 2DMLA 2H19A 4LLRA 3L78A 3Q74A 1O8WA 1ERTA 4WETA 5IOXA 4O5QA 2CX3A 1E6BA 4F0CA 4I6XA 3O76A 2JACA 1EEJA 2VM1A 3QDNA 1A0FA 2OE3A 4EIQA 2P5QA 4ZBBA 3IPZA 2YWIA 2YJHA 3TKRA 3IK9A 2E0QA 3D4MA 1EEMA 3FZAA 3RPNA 16GSA 1PA3A 1XPVA 5CAXA 2I9HA 2DIYA 3GL5A 1OAZA 2GT5A 3QAVA 1XWBA 2VL3A 3CYNA 5FWGA 2MMAA 3KD0A 4OO5A 3DD3A 3ME7A 3TRPA 2PVOC 2VM2A 2N5BA 2V32A 3IA1A 4MJAA 4KNDA 1A8YA 1OC9A 3C71A 4OFTA 4HOJA 4GWRA 4N11A 3WGXA 1TRUA 4F2IA 2JSZA 3EYTA 1Q98A 2RM5A 4AJ6A 4ACSA 2NBSA 1GTBA 2QSIA 3CRUA 1R5PA 4V1Ag 2R5GA 2X4AA 2B5XA 2LS5A 2WULA 3R2QA 3VK9A 2I1UA 1ZOFA 2M72A 3N5OA 4E8EA 5DAKB 1KEBA 1T7PB 4I2TA 2RUFA 17GSA 4HZ2A 3QR6A 1X5DA 3TOUA 1BYEA 1GRXA 5A4VA 2DJ2A 2L4CA 2A4VA 22GSA 5DBQA 5JCWA 1DBYA 3A2VA 2YOIA 2C0FA 1EZKA 1TJDA 1FG4A 2GGTA 2LJRA 1JZDA 3U5RE 3KIJA 4CY8A 2GSRA 3FZ4A 4ISDA 3PINA 4CW9A 2FWGA 1C72A 1PMTA 5ECMB 4Z2UA 3GX0A 4ZB9A 4NWYA 4N30A 2H0IA 4EE0A 4IQAA 4O5UA 3MWHA 3IBHA 3RPPA 3ZVJA 1MEKA 2H8LA 5B6NA 3EE2A 1GSQA 1BJXA 2KHPA 3WT1A 1V2AA 3HVXA 4GLTA 1FB0A 3ZL5A 4IJ3A 2R0GA 2IJYA 1M9AA 2CX4A 2PBJA 3WYWA 4PXOA 3RDWA 2DIZA 2N5FA 4WBJA 3KGKA 5JWRB 3FEUA 3F4SA 3F3QA 4XS1A 2CV4A 3ERWA 1FOVA 2YJ7A 5D9XA 4TR1A 4XRDA 4TOPA 2FWEA 6GSVA 1M99A 1ZYNA 1JHBA 2AJQB 2R37A 1THXA 4Q5NA 1VF1A 1X9MB 4HQSA 2LQQA 4RI7A 3H4KA 2FA8A 3HCZA 3LYPA 1ST9A 4DSSA 2LV3A 4JR4A 3G7IA 3MIXA 1GUHA 1PRXA 1W4VA 5G1KA 2HZEA 1I9DA 3HZ4A 4ZB6A 1CQHA 2B1LA 2DMMA 1XZOA 4OFNA 1GUKA 2C3TA 2GQLA 3ZITA 3IV4A 2VCVA 1K3LA 3C7MA 1THOA 2H74A 2DJ1A 4IS0A 5DCGA 4HI7A 1WP0A 3GFKA 1MDKA 3M1GA 6GSUA 2DLXA 5EVOA 2ES7A 3E9JB 3GH6A 2XPEA 2JADA 1FW1A 1BQ7A 1OYJA 4YKGA 4KB3A 4MPGA 1A2JA 1XVWA 3SWLA 3GV1A 5CRWA 1M0UA 1T00A 1Y6EA 2BTOT 2H1GA 4TXVA 12GSA 4WR4A 4CY6A 1FO5A 1U87A 2UZ8A 3RBTA 2A2PA 4MH2A 1XWCA 2VLTA 4NPBA 5AIXA 2VCWA 3QOUA 14GSA 3TJFA 2R4VA 2JU5A 3IDVA 1AW9A 4MP4A 5GZZB 4ICYA 2IFQA 3APQA 3H79A 4V2MA 4TR3A 1F3AA 1R5AA 2K8SA 2VAFA 2HSHA 4DSSB 4HQZA 2C3QA 4MZCA 3UEMA 1MDIA 5H5RA 4WBRD 4JE1A 3A3TA 9GSSA 2WCIA 3ZFLA 3TUEA 3FYGA 3HA9A 2YCDA 1A0RP 1X9SB 1GSDA 2X64A 1EOGA 2LSTA 2HZFA 2ON7A 2QA1A 2X49A 3L9VA 1GNEA 1QQ2A 2LRTA 3DVWA 5L71A 1ZL9A 2MBSA 3KEBA 4YAVA 3GRXA 5BMUA 1WOUA 1K0DA 4O5RA 1GUMA 2LRCA 2WZ9A 1RK4A 4KCEA 4BL7A 5IQYA 4I5QA 5LNKe 2H70A 3TJKA 1LBKA 1O81A 3E3EA 1NM3A 2VCTA 3D4TA 4OO4A 3QAWA 4OFMA 4XRAA 3HDCA 2DJJA 3BCIA 1RW1A 1NW2A 4I97A 3I9V2 5HQPA 1YY7A 5IPGA 3LJRA 4Z2RA 1LJRA 1XWKA 4HS1A 3VPQA 1QMVA 4TXOB 3MNGA 4MF7A 1IYIA 1SD8A 3ZREA 5CRGA 1TRSA 2R0CA 4FYUA 4TR0A 1SU9A 3FK8A 3IOSA 3DWVA 2IFQB 4L5OA 4LL4B 2HXKA 4XS4A 5AISA 3LG6A 1ZZYA 2LNTA 1SKWB 4MDCA 1X0RA 2VO4A 2M46A 2RLIA 2J23A 1XOAA 2NDOA 4OWYA 3L0HA 2GQKA 2O89A 5IMFA 3CBUA 2CAIA 3DYRA 3NIVA 4G9HA 4KDXA 1F6MC 3EPTA 3GKXA 5G5EA 1XVQA 5C04A 2L4QA 2OJLA 3VWUA 1PX6A 2AV4A 2H1BA 1SENA 5JWOB 1TK8B 1F37A 2ON5A 5CO3A 3RAZA 4PUAA 5ECIB 3C73A 3FZ5A 3EMPA 5CRDA 2GLRA 4ZL8A 3M3MA 4TR4A 3DRNA 2KP1A 4EKZA 1EWXA 4KDYA 4EXJA 2H0GA 5AIVA 1SKSB 3ZIVA 2BMXA 5KEJA 5H5SA 4BVYA 2CT6A 1JZOA 3FR3A 3F6FA 1KTEA 5KN2A 1XOBA 2J9HA 1DE1A 5HR1A 4BA7A 5G1LA 2XC2A 1G6YA 1YF1A 1B48A 4MJEA 4XS4B 4OMVA 3J7Yk 2I3YA 5IMVA 1SYXA 3D5JA 4G0IA 4PURA 4GSNA 5IMAA 3EVIA 3GNJA 3IHQA 4ZILA 2VD0A 3NZNA 3KMNA 5ID2B 5GSTA 2JSYA 2IPAA 4ZBAA 2AB6A 1BG5A 3VI7A 3Q6OA 1TOFA 1K0NA 5ECQB 4KE3A 4K2XA 3EWLA 3UVHA 2KLXA 5IIZA 4QL9A 4NV5A 1X5CA 2AYTA 2PERA 2X99A 2GZZA 3ZMKA 4IP6A 3F6DA 5KOXA 4PUFC 1OC8A 2GZYA 2H72A 4G19A 2TRCP 2YN1A 3CRTA 4MF5A 1PX7A 2PU9C 5IM9A 1HNAA 2LRNA 3R3EA 3UARA 1ON4A 3ED3A 5ECOB 3KMOA 1U3IA 4G0LA 1K3OA 1ABAA 3M0FA 2O87A 3FY7A 1G7OA 2H01A 3ME8A 2OKAA 3ZIJA 4K5RA 2KP2A 3IC4A 4NMUA 3E0UA 4BVYB 3ZZXA 2G2QA 1QUWA 4K6XA 5HR0A 2OE0A 4KW6A 4J56E 1YDKA 4POKA 4MPFA 2EIRA 1S3CA 4IP1A 1T1VA 2MMNA 2F8FA 1SL2B 2YP6A 4KA0A 3LW9A 3P90A 2M80A 2YV9A 4MCUA 1RQMA 3KP8A 1AIUA 4AF2A 2EIOA 3BD2A 4OD7A 3KTLA 4PQHA 1ERVA 3L9SA 2C0DA 1SJZA 1W89A 2P31A 1K0MA 4F82A 3NOFA 4KX4A 1XXUA 1UC7A 2IMKA 3UL3A 3F4RA 3TRQA 1Z3EA 2QKEA 2O7KA 1A2LA 4LMVA 1OE7A 4TN8A 1JLVA 1SKRB 4ML1A 2DBCA 5C00A 1EOHA 1FOHA 1JZWA 1VF2A 4P3YB 3GIXA 4EIPA 1PGTA 2VIMA 5KN0A 1SL1B 4X0XA 4L0WA 5ECHB 1WIKA 1V9WA 2KUCA 3GX8A 2FWHA 4WF4A 4JR6A 3GKKA 2C0EA 5IO0A 1GSEA 3KCMA 5F07A 1OE8A 4AGSA 3TGZA 4FO5A 18GSA 3FHKA 3GH9A 1ERUA 4IHUA 5ABRA 3BBYA 4GQCA 2D2ZA 4K7NA 2YZHA 2VL2C 3IAS2 1PKZA 2MBTA 3G7JA 1ZGNA 4EO3A 1N8JA 1HNBA 4MLYA 4YH2A 4HUAA 3TRXA 2DKHA 1B9YC 2XBIA 4K1FA 3UAPA 2DKIA 3L4NA 3F8UA 3GKMA 2O8VB 1SK1A 3LYKA 4HJMA 1QFNA 2H30A 4HZ4A 4EVMA 1YZXA 3HJMA 2LKUA 1VGLA 13GSA 3TDGA 4GQFA 1O6JA 5G5FA 2WJUA 1T4YA 3V1WA 4KSMA 2VCZA 1M2DA 2YV7A 2CAQA 4IVFA 1M7TA 3TKPA 4EUYA 4XIHA 4QQ7A 4IN0A 5ECPB 1U3AA 2H1DA 4GTUA 4HEA2 2CVDA 1F3BA 5JCGA 3GYKA 1OC3A 2ZNMA 5LCZA 5IMZA 1Z7RA 2OA7A 5H5QA 1TXXA 4PGTA 1OKDA 5LD0A 2FGXA 4G10A 4XHMA 2PPTA 1E2YA 2H76A 1SYRA 2N5AA 8GSSA 3GL3A 2CVKA 3J7Yb 4D73A 4K7IA 6GSWA 1DE2A 2YWMA 2L6DA 2AHEA 4BVXA 5FT3A 4RQRA 1UVZA 1GNWA 2NVLA 5J9CA 3CXGA 3D0ZA 2V41A 4E8HA 1GL8A 1AUCA 1PQNA 3QCPA 4JU5A 1GWCA 4TXOA 4N0ZA 1V57A 5J41A 4ULXA 2KOKA 2H0HA 3CSJA 3LSZA 2QGVA 1SK0A 3VWVA 4ZIJA 2H66A 3QMXA 4HDEA 4ZBDA 1TRVA 3ERGA 2WB9A 1WE0A 2X8HA 1B4QA 1HQOA 3GN3A 10GSA 1T8EB 3HXSA 3ZFBA 1GSYA 3ZYWA 4XTSA 5IMDA 1ZYQB 3EMXA 4NHZA 5E59A 2FA4A 4IBPA 4YKFA 4XS6A 19GSA 4K8MA 2H71A 4KUNA 1VF4A 2C4JA 4F0BA 1GSSA 3IC8A 2RM6A 3GTUB 2E7PA 5DALB 4KCAA 1SJ6A 5ECNB 1BAYA 2OACA 2IN3A 2V2GA 1AQVA 1A2MA 3M8NA 2YPMA 20GSA 5IOWA 2IWTA 3KJYA 5DCHA 1WRYA 1EP8A 4GSTA 1GTUA 4D73B 3KXOA 2GVPA 4BVXB 2ALBA 5D73A 2H73A 3O6TA 1XWAA 2E2MA 4EC0A 2VD1A 5A5KA 3LXTA 2FY6A 2WS2A 1AXDA 3IAM2 2PN8A 2AAWA 3VFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JLW A;  3MDK A;  4MH3 A;  5ECK B;  3KP9 A;  2PMT A;  2NPB A;  4AJ8 A;  2B6M A;  4IJI A;  2RII A;  5G31 A;  3GHA A;  1X5E A;  3F3R A;  3TKS E;  1GLQ A;  5ID2 A;  5CRH A;  4DSQ A;  3C8E A;  3QAG A;  3UVT A;  1EGO A;  1F2E A;  2LJA A;  2HNL A;  4NAX A;  3RHC A;  3VWX A;  2PGT A;  1K0C A;  4NXI A;  4O7H A;  1KBN A;  1S3A A;  2H75 A;  3ZVJ D;  4RQX A;  3LFL A;  2TRX A;  2HE3 A;  4IQ1 A;  3GKN A;  1ERW A;  5AN1 A;  1TTZ A;  3IK7 A;  5INY A;  2VCQ A;  1MTC A;  4IGJ A;  5D93 A;  2DSA A;  1B8X A;  5IPH A;  3FRC A;  2FD3 A;  2LNS A;  1G7E A;  5DDL A;  4L0U A;  3IE3 A;  5DQY A;  4NHW A;  3IR4 A;  4ECJ A;  1WJK A;  5KN1 A;  1ZCP A;  1Z9H A;  1Z5Y E;  4N0V A;  1GSF A;  3WT2 A;  3EU4 A;  3GA4 A;  5KN3 A;  2LTK A;  3BJ5 A;  2DJ0 A;  1K0B A;  2GT6 A;  5HFI A;  1TU8 A;  1XW5 A;  1O73 A;  3PH9 A;  3FR6 A;  3HZ8 A;  2FWF A;  1T3B A;  2LQO A;  1UN2 A;  3UMA A;  2CA8 A;  5ECR B;  3A5W A;  3BOA A;  3HVV A;  4I8B A;  1XBS A;  2R3X A;  1OKT A;  2CZ2 A;  1J0F A;  3G9B A;  2GZP A;  5DJL A;  2B5Y A;  3SBC A;  1N2A A;  5JCU A;  1TK0 B;  2MZC A;  4XCS A;  2OAD A;  2ZUP A;  2IMF A;  3EC3 A;  3ISO A;  3DVX A;  3QFA C;  2WRT A;  2VCX A;  4OCF A;  2CVB A;  4FYC A;  4FIW A;  3M9J A;  1IYH A;  1V98 A;  3D21 A;  1NSW A;  4JZQ A;  1TU7 A;  4POM A;  2FCH A;  1Y25 A;  4K9Z A;  1M9B A;  1R4W A;  2E2G A;  4YAP A;  4JRR A;  4MMM A;  3ZML A;  3VWW A;  1TDI A;  3CTG A;  5DVB A;  3ZRD A;  4RI6 A;  2IMD A;  1A23 A;  2DJK A;  3TKS C;  2C80 A;  2K6V A;  3VI5 A;  2JZT A;  4HJ2 A;  4L5L A;  1O8X A;  2HLS A;  6GSX A;  4PNF A;  3FZ9 A;  3WGE A;  2HYX A;  5B8B A;  1XFL A;  4ML6 A;  3TJB A;  1UA5 A;  2IL3 A;  2QC7 A;  3LXZ A;  4LL1 B;  4CHS A;  2F51 A;  3EU3 A;  4AJ7 A;  11GS A;  3UIW A;  5DQS A;  1A24 A;  1EGR A;  3CMI A;  4IW9 A;  1SL0 B;  4ZL7 A;  5F0G A;  2WDU A;  3LEF A;  3C1S A;  3KZQ A;  2AUV A;  4PNG A;  2OBK A;  5J3R A;  3C1R A;  4QL7 A;  4OCE A;  2K9F A;  3UBK A;  4TRX A;  1XCC A;  4MZW A;  5CP1 A;  5HFG A;  1YJ6 A;  3GUR A;  1GLP A;  2A2S A;  4O32 A;  1HNC A;  4TW5 A;  1O85 A;  1BX9 A;  1YKC A;  3S9F A;  2JL4 A;  4DSR A;  2PWJ A;  2Z9S A;  1G0T A;  3TKS A;  2YAN A;  2B5E A;  1A8L A;  1EP7 A;  3HD5 A;  4KGI A;  5IMC A;  2HT9 A;  1ACV A;  4PQI A;  6GSS A;  3CTF A;  4ZXG A;  3F9U A;  2GSS A;  2L6C A;  2L57 A;  1PD2 1;  1FAA A;  2PVQ A;  1K0O A;  4J2F A;  4L8E A;  1M2B A;  1I5G A;  3M9K A;  1R26 A;  2V6O A;  5FHI A;  4V1A p;  1GSU A;  4TKY A;  5D9V A;  2XPD A;  2B1K A;  3UBL A;  1B9X C;  5J9B A;  4BWQ A;  5ECS A;  3WD6 A;  1PKW A;  2IMI A;  1J9B A;  1KNG A;  4POL A;  2FLS A;  5HFK A;  1NHO A;  4KH7 A;  1EV4 A;  3BCK A;  2FHE A;  4GF0 A;  4KAE A;  3JCM L;  5J4U A;  3N9J A;  2H6Y A;  5F8B A;  3DKS A;  1X9W B;  1FHE A;  1OVN A;  6GSY A;  3HVS A;  2P5R A;  4K2D A;  1HYU A;  2P0G A;  2CQ9 A;  6GST A;  5IO2 A;  4IKH A;  3W6G A;  1TW9 A;  1V58 A;  1VF3 A;  3U6V A;  2IIY A;  2CZ3 A;  2K18 A;  3H1N A;  3GMF A;  2JZS A;  1ZYE A;  4RUV A;  1OC9 B;  2VLU A;  1WPI A;  1FVJ A;  5G30 A;  2L59 A;  1WMJ A;  1FVK A;  2PUK C;  3H8Q A;  3EIN A;  2MYG A;  2ZCT A;  1CQG A;  3GUS A;  2XHF A;  3TJJ A;  3A2X A;  3VPT A;  1K0A A;  5EY6 A;  1MD4 A;  1F9M A;  3I6A A;  4EDZ A;  3A2W A;  2FNO A;  2C0G A;  1NHY A;  1QXH A;  2H1A A;  4ILF A;  2LUS A;  2H6X A;  3LWA A;  5EPF A;  1GP1 A;  2RUE A;  5DJM A;  1TP9 A;  3EUR A;  3O3T A;  3IXR A;  2VL2 A;  1TK5 B;  4FYB A;  3TKQ A;  1SJI A;  5GSS A;  3G7Y A;  5A4W A;  5J5N A;  2R2J A;  4ECI A;  2FUG 2;  3HYP A;  4X1U A;  3FW2 A;  3FKF A;  1TI3 A;  4NV2 A;  2DJ3 A;  3GTU A;  3L9U A;  4JED A;  4F9Z A;  3VUR A;  5DAL A;  1EV9 A;  1O7U A;  3I69 A;  5ELA A;  1ILO A;  2K8V A;  4MA9 A;  4WEY A;  1URM A;  1MDJ A;  4V2N A;  4IEL A;  5F05 A;  2YWN A;  4J57 E;  1AQW A;  5JWQ B;  1GTI A;  3CSI A;  4YQU A;  4BWS A;  3CSH A;  3AY8 A;  2YZU A;  1R7H A;  2V1M A;  5D9W A;  2L5L A;  5ELG A;  1LU4 A;  1QK8 A;  2I4A A;  3KTB A;  4KSO A;  5B7C A;  1PL1 A;  4Q5F A;  4YQV A;  4CDO A;  1ML6 A;  3KM6 A;  3GST A;  3ZLP A;  1Z6M A;  1QGV A;  4KDU A;  4YQM A;  2WGR A;  1B4P A;  1DUG A;  1M2A A;  5CRE A;  2R6K A;  4GSS A;  3WGD A;  3F63 A;  1GTA A;  2H6Z A;  2A2R A;  4Q5R A;  4TR1 B;  4POB A;  3PR8 A;  3HKR A;  2VOC A;  4V2L A;  2VL9 A;  1S3D A;  1FB6 A;  3HY2 A;  3DXB A;  2EIQ A;  3QD9 A;  2OBI A;  1H75 A;  3MSZ A;  1AQX A;  2L5O A;  1XW6 A;  5B8A A;  1PSQ A;  3F4T A;  4HU7 A;  3PGT A;  3W8J A;  4K0N A;  5A4U A;  5GAN D;  2HZE B;  3P2A A;  1AAZ A;  5ENU A;  2C1Y A;  3DML A;  4F03 A;  5COH A;  2REM A;  2B7K A;  4MAB A;  2GQM A;  3LQ7 A;  1YKA A;  1GUL A;  2DC5 A;  5D96 A;  1MD3 A;  2VUP A;  2I81 A;  3QFB C;  3TCO A;  3US3 A;  2X8G A;  4I2U A;  2B3S A;  3H93 A;  2HRN A;  5ECL B;  1VRS D;  2VLV A;  3LOR A;  4WR5 A;  1U88 A;  2MMO A;  4Z7X A;  2F8A A;  3MAK A;  2TIR A;  1SK2 A;  2GS3 A;  2IME A;  2C8U A;  4BPY A;  2HFD A;  1K3Y A;  2C3N A;  5HR3 A;  3I43 A;  1JZR A;  4MK3 A;  2HI7 A;  4LA1 A;  2B7J A;  4MJB A;  3APO A;  4X43 A;  4EDY A;  5D8I A;  3TJG A;  4H86 A;  2BJX A;  2GSQ A;  1WWJ A;  1AC1 A;  1TRW A;  2GDR A;  1V40 A;  1GH2 A;  4PX1 A;  3F0I A;  1Z6N A;  2F9S A;  3IRA A;  4TVE A;  1Q4J A;  5E4W A;  2WFC A;  1PN9 A;  3Q18 A;  1SD9 A;  3APS A;  3K8N A;  1TI1 A;  3KH9 A;  4MF6 A;  3HHV A;  5HR2 A;  4GCI A;  4GXZ A;  3GSS A;  3LGC A;  3P8W A;  3VLN A;  2X8C A;  4DVC A;  2GTU A;  1TKD B;  1YF0 A;  3QPM A;  1H4O A;  3D6I A;  5EL8 A;  1YEX A;  2LEG A;  3TOT A;  3RHB A;  4WKW A;  5G2Z A;  4ECC A;  4EL1 A;  4ZL9 A;  1JFU A;  2XBQ A;  3DIE A;  4K0G A;  1YEP A;  5CNW A;  1HD2 A;  2EC4 A;  1XW9 A;  5AGY A;  2GST A;  4N10 A;  2HSY A;  1DSB A;  1J08 A;  4MJC A;  2OE1 A;  3ZTL A;  7GSS A;  4WXT A;  2LJK A;  1XWG A;  3ERF A;  2F3M A;  3FR9 A;  4JBB A;  2HRF A;  4K7O A;  2YNX A;  2G0F A;  1BED A;  4ZB8 A;  2MMZ A;  4DEJ A;  5CYY A;  3D22 A;  1T4Z A;  2O85 A;  3HJP A;  3UJ1 A;  3KH7 A;  4ECB A;  1U6T A;  1YQ1 A;  3DEX A;  3HJO A;  4WF5 A;  1Z7P A;  5GAP D;  3OR5 A;  4EF0 A;  4LMW A;  3Q19 A;  4PQ1 A;  2JZR A;  4GRF A;  3P7X A;  3W8S A;  4O92 A;  1USB A;  2YWO A;  4Q5Q A;  4MZB A;  4FH8 A;  3TB2 A;  4G2E A;  3DGQ A;  1PL2 A;  5F06 A;  1G6W A;  1ZMA A;  2NTO A;  1XIY A;  2V6K A;  5D9T A;  4HU9 A;  5B6M A;  5DAK A;  3UOM A;  4ID0 A;  2DML A;  2H19 A;  4LLR A;  3L78 A;  3Q74 A;  1O8W A;  1ERT A;  4WET A;  5IOX A;  2CX3 A;  1E6B A;  4F0C A;  4I6X A;  3O76 A;  2JAC A;  1EEJ A;  2VM1 A;  3QDN A;  1A0F A;  2OE3 A;  2P5Q A;  4ZBB A;  3IPZ A;  2YWI A;  2YJH A;  3TKR A;  3IK9 A;  2E0Q A;  3D4M A;  1EEM A;  3FZA A;  3RPN A;  16GS A;  1PA3 A;  1XPV A;  5CAX A;  2I9H A;  2DIY A;  3GL5 A;  1OAZ A;  2GT5 A;  3QAV A;  1XWB A;  2VL3 A;  3CYN A;  5FWG A;  2MMA A;  3KD0 A;  4OO5 A;  3DD3 A;  3ME7 A;  3TRP A;  2PVO C;  2VM2 A;  2N5B A;  2V32 A;  3IA1 A;  4MJA A;  4KND A;  1A8Y A;  1OC9 A;  3C71 A;  4OFT A;  4HOJ A;  4GWR A;  4N11 A;  3WGX A;  1TRU A;  4F2I A;  2JSZ A;  3EYT A;  1Q98 A;  2RM5 A;  4AJ6 A;  4ACS A;  2NBS A;  1GTB A;  2QSI A;  3CRU A;  1R5P A;  4V1A g;  2R5G A;  2B5X A;  2LS5 A;  2WUL A;  3R2Q A;  3VK9 A;  2I1U A;  1ZOF A;  2M72 A;  3N5O A;  4E8E A;  5DAK B;  1KEB A;  1T7P B;  4I2T A;  2RUF A;  17GS A;  4HZ2 A;  3QR6 A;  1X5D A;  3TOU A;  1BYE A;  1GRX A;  5A4V A;  2DJ2 A;  2L4C A;  2A4V A;  22GS A;  5DBQ A;  5JCW A;  1DBY A;  3A2V A;  2YOI A;  2C0F A;  1EZK A;  1TJD A;  1FG4 A;  2GGT A;  2LJR A;  1JZD A;  3U5R E;  3KIJ A;  2GSR A;  3FZ4 A;  4ISD A;  3PIN A;  4CW9 A;  2FWG A;  1C72 A;  1PMT A;  5ECM B;  3GX0 A;  4ZB9 A;  4NWY A;  4N30 A;  2H0I A;  4EE0 A;  4IQA A;  3MWH A;  3IBH A;  3RPP A;  3ZVJ A;  1MEK A;  2H8L A;  5B6N A;  3EE2 A;  1GSQ A;  1BJX A;  2KHP A;  3WT1 A;  1V2A A;  3HVX A;  4GLT A;  1FB0 A;  3ZL5 A;  4IJ3 A;  2IJY A;  1M9A A;  2CX4 A;  2PBJ A;  3WYW A;  4PXO A;  3RDW A;  2DIZ A;  2N5F A;  4WBJ A;  3KGK A;  5JWR B;  3FEU A;  3F4S A;  3F3Q A;  4XS1 A;  2CV4 A;  3ERW A;  1FOV A;  2YJ7 A;  5D9X A;  4TR1 A;  4XRD A;  4TOP A;  2FWE A;  6GSV A;  1M99 A;  1JHB A;  2AJQ B;  2R37 A;  1THX A;  4Q5N A;  1VF1 A;  1X9M B;  4HQS A;  2LQQ A;  4RI7 A;  3H4K A;  2FA8 A;  3HCZ A;  3LYP A;  1ST9 A;  4DSS A;  2LV3 A;  4JR4 A;  3G7I A;  1GUH A;  1PRX A;  1W4V A;  5G1K A;  2HZE A;  1I9D A;  3HZ4 A;  4ZB6 A;  1CQH A;  2B1L A;  2DMM A;  1XZO A;  4OFN A;  1GUK A;  2C3T A;  2GQL A;  3ZIT A;  3IV4 A;  2VCV A;  1K3L A;  3C7M A;  1THO A;  2H74 A;  2DJ1 A;  4IS0 A;  5DCG A;  4HI7 A;  1WP0 A;  3GFK A;  1MDK A;  3M1G A;  6GSU A;  2DLX A;  5EVO A;  2ES7 A;  3E9J B;  3GH6 A;  2XPE A;  2JAD A;  1FW1 A;  1BQ7 A;  1OYJ A;  4KB3 A;  4MPG A;  1A2J A;  1XVW A;  3SWL A;  3GV1 A;  5CRW A;  1M0U A;  1T00 A;  1Y6E A;  2BTO T;  2H1G A;  4TXV A;  12GS A;  4WR4 A;  1FO5 A;  1U87 A;  3RBT A;  4MH2 A;  1XWC A;  2VLT A;  4NPB A;  5AIX A;  2VCW A;  3QOU A;  14GS A;  3TJF A;  2R4V A;  2JU5 A;  3IDV A;  1AW9 A;  4MP4 A;  5GZZ B;  2IFQ A;  3APQ A;  3H79 A;  4V2M A;  4TR3 A;  1F3A A;  1R5A A;  2K8S A;  2VAF A;  2HSH A;  4DSS B;  4HQZ A;  2C3Q A;  4MZC A;  3UEM A;  1MDI A;  5H5R A;  4WBR D;  4JE1 A;  3A3T A;  9GSS A;  2WCI A;  3ZFL A;  3TUE A;  3FYG A;  3HA9 A;  2YCD A;  1A0R P;  1X9S B;  1GSD A;  2X64 A;  1EOG A;  2LST A;  2HZF A;  2ON7 A;  3L9V A;  1GNE A;  1QQ2 A;  2LRT A;  3DVW A;  5L71 A;  1ZL9 A;  2MBS A;  3KEB A;  4YAV A;  3GRX A;  1WOU A;  1K0D A;  4O5R A;  1GUM A;  2LRC A;  2WZ9 A;  1RK4 A;  4KCE A;  4BL7 A;  5IQY A;  4I5Q A;  5LNK e;  2H70 A;  3TJK A;  1LBK A;  1O81 A;  3E3E A;  1NM3 A;  2VCT A;  3D4T A;  4OO4 A;  3QAW A;  4OFM A;  4XRA A;  3HDC A;  2DJJ A;  3BCI A;  1RW1 A;  1NW2 A;  4I97 A;  3I9V 2;  5HQP A;  1YY7 A;  5IPG A;  3LJR A;  1LJR A;  1XWK A;  4HS1 A;  3VPQ A;  1QMV A;  4TXO B;  3MNG A;  4MF7 A;  1IYI A;  1SD8 A;  3ZRE A;  5CRG A;  1TRS A;  4FYU A;  4TR0 A;  1SU9 A;  3FK8 A;  3IOS A;  3DWV A;  2IFQ B;  4L5O A;  4LL4 B;  2HXK A;  4XS4 A;  5AIS A;  3LG6 A;  1ZZY A;  2LNT A;  1SKW B;  4MDC A;  1X0R A;  2VO4 A;  2M46 A;  2RLI A;  2J23 A;  1XOA A;  2NDO A;  4OWY A;  3L0H A;  2GQK A;  2O89 A;  5IMF A;  3CBU A;  2CAI A;  3DYR A;  3NIV A;  4G9H A;  4KDX A;  1F6M C;  3GKX A;  5G5E A;  1XVQ A;  5C04 A;  2L4Q A;  2OJL A;  3VWU A;  1PX6 A;  2AV4 A;  2H1B A;  1SEN A;  5JWO B;  1TK8 B;  1F37 A;  2ON5 A;  5CO3 A;  3RAZ A;  4PUA A;  5ECI B;  3C73 A;  3FZ5 A;  3EMP A;  5CRD A;  2GLR A;  4ZL8 A;  3M3M A;  4TR4 A;  3DRN A;  2KP1 A;  4EKZ A;  1EWX A;  4KDY A;  4EXJ A;  2H0G A;  5AIV A;  1SKS B;  3ZIV A;  2BMX A;  5KEJ A;  5H5S A;  4BVY A;  2CT6 A;  1JZO A;  3FR3 A;  3F6F A;  1KTE A;  5KN2 A;  1XOB A;  2J9H A;  1DE1 A;  5HR1 A;  4BA7 A;  5G1L A;  2XC2 A;  1G6Y A;  1YF1 A;  1B48 A;  4MJE A;  4XS4 B;  4OMV A;  3J7Y k;  2I3Y A;  5IMV A;  1SYX A;  3D5J A;  4PUR A;  4GSN A;  5IMA A;  3EVI A;  3GNJ A;  3IHQ A;  4ZIL A;  2VD0 A;  3NZN A;  3KMN A;  5ID2 B;  5GST A;  2JSY A;  2IPA A;  4ZBA A;  2AB6 A;  1BG5 A;  3VI7 A;  3Q6O A;  1TOF A;  1K0N A;  5ECQ B;  4KE3 A;  3EWL A;  3UVH A;  2KLX A;  5IIZ A;  4QL9 A;  4NV5 A;  1X5C A;  2AYT A;  2PER A;  2X99 A;  2GZZ A;  3ZMK A;  4IP6 A;  3F6D A;  4PUF C;  1OC8 A;  2GZY A;  2H72 A;  4G19 A;  2TRC P;  2YN1 A;  3CRT A;  4MF5 A;  1PX7 A;  2PU9 C;  5IM9 A;  1HNA A;  2LRN A;  3UAR A;  1ON4 A;  3ED3 A;  5ECO B;  3KMO A;  1U3I A;  1K3O A;  1ABA A;  3M0F A;  2O87 A;  3FY7 A;  1G7O A;  2H01 A;  3ME8 A;  2OKA A;  3ZIJ A;  2KP2 A;  3IC4 A;  4NMU A;  3E0U A;  3ZZX A;  2G2Q A;  1QUW A;  4K6X A;  5HR0 A;  2OE0 A;  4KW6 A;  4J56 E;  1YDK A;  4POK A;  4MPF A;  2EIR A;  1S3C A;  4IP1 A;  1T1V A;  2MMN A;  2F8F A;  1SL2 B;  2YP6 A;  4KA0 A;  3P90 A;  2M80 A;  2YV9 A;  4MCU A;  1RQM A;  3KP8 A;  1AIU A;  4AF2 A;  2EIO A;  3BD2 A;  4OD7 A;  3KTL A;  4PQH A;  1ERV A;  3L9S A;  2C0D A;  1SJZ A;  1W89 A;  2P31 A;  1K0M A;  4F82 A;  3NOF A;  4KX4 A;  1XXU A;  1UC7 A;  2IMK A;  3UL3 A;  3F4R A;  3TRQ A;  1Z3E A;  2QKE A;  2O7K A;  1A2L A;  4LMV A;  1OE7 A;  4TN8 A;  1JLV A;  1SKR B;  4ML1 A;  2DBC A;  5C00 A;  1EOH A;  1JZW A;  1VF2 A;  4P3Y B;  3GIX A;  1PGT A;  2VIM A;  5KN0 A;  1SL1 B;  4X0X A;  4L0W A;  5ECH B;  1WIK A;  1V9W A;  2KUC A;  3GX8 A;  2FWH A;  4WF4 A;  4JR6 A;  3GKK A;  2C0E A;  5IO0 A;  1GSE A;  3KCM A;  5F07 A;  1OE8 A;  4AGS A;  3TGZ A;  4FO5 A;  18GS A;  3FHK A;  3GH9 A;  1ERU A;  4IHU A;  5ABR A;  3BBY A;  4GQC A;  2D2Z A;  4K7N A;  2YZH A;  2VL2 C;  3IAS 2;  1PKZ A;  2MBT A;  3G7J A;  1ZGN A;  4EO3 A;  1N8J A;  1HNB A;  4MLY A;  4YH2 A;  4HUA A;  3TRX A;  1B9Y C;  2XBI A;  4K1F A;  3UAP A;  3L4N A;  3F8U A;  3GKM A;  2O8V B;  1SK1 A;  3LYK A;  4HJM A;  1QFN A;  2H30 A;  4HZ4 A;  4EVM A;  1YZX A;  3HJM A;  2LKU A;  1VGL A;  13GS A;  3TDG A;  4GQF A;  1O6J A;  5G5F A;  2WJU A;  1T4Y A;  3V1W A;  4KSM A;  2VCZ A;  1M2D A;  2YV7 A;  2CAQ A;  4IVF A;  1M7T A;  3TKP A;  4EUY A;  4XIH A;  4QQ7 A;  4IN0 A;  5ECP B;  1U3A A;  2H1D A;  4GTU A;  4HEA 2;  2CVD A;  1F3B A;  5JCG A;  3GYK A;  1OC3 A;  2ZNM A;  5LCZ A;  5IMZ A;  1Z7R A;  2OA7 A;  5H5Q A;  1TXX A;  4PGT A;  1OKD A;  5LD0 A;  2FGX A;  4G10 A;  4XHM A;  2PPT A;  1E2Y A;  2H76 A;  1SYR A;  2N5A A;  8GSS A;  3GL3 A;  2CVK A;  3J7Y b;  4D73 A;  4K7I A;  6GSW A;  1DE2 A;  2YWM A;  2L6D A;  2AHE A;  4BVX A;  5FT3 A;  4RQR A;  1UVZ A;  1GNW A;  2NVL A;  5J9C A;  3CXG A;  3D0Z A;  2V41 A;  4E8H A;  1GL8 A;  1AUC A;  1PQN A;  3QCP A;  4JU5 A;  1GWC A;  4TXO A;  4N0Z A;  1V57 A;  5J41 A;  4ULX A;  2KOK A;  2H0H A;  3CSJ A;  3LSZ A;  2QGV A;  1SK0 A;  3VWV A;  4ZIJ A;  2H66 A;  3QMX A;  4HDE A;  4ZBD A;  1TRV A;  3ERG A;  2WB9 A;  1WE0 A;  2X8H A;  1B4Q A;  1HQO A;  3GN3 A;  10GS A;  1T8E B;  3HXS A;  3ZFB A;  1GSY A;  3ZYW A;  4XTS A;  5IMD A;  1ZYQ B;  3EMX A;  4NHZ A;  5E59 A;  2FA4 A;  4IBP A;  4XS6 A;  19GS A;  4K8M A;  2H71 A;  4KUN A;  1VF4 A;  2C4J A;  4F0B A;  1GSS A;  2RM6 A;  3GTU B;  2E7P A;  5DAL B;  4KCA A;  1SJ6 A;  5ECN B;  1BAY A;  2OAC A;  2IN3 A;  2V2G A;  1AQV A;  1A2M A;  3M8N A;  2YPM A;  20GS A;  5IOW A;  2IWT A;  3KJY A;  5DCH A;  1WRY A;  1EP8 A;  4GST A;  1GTU A;  4D73 B;  3KXO A;  2GVP A;  2ALB A;  5D73 A;  2H73 A;  3O6T A;  1XWA A;  2E2M A;  4EC0 A;  2VD1 A;  5A5K A;  3LXT A;  2FY6 A;  2WS2 A;  1AXD A;  3IAM 2;  2PN8 A;  2AAW A;  3VFI A; 
#chains in the Genus database with same CATH topology
 1JLW A;  3MDK A;  4MH3 A;  5ECK B;  3KP9 A;  2HSM A;  2PMT A;  2NPB A;  4AJ8 A;  2B6M A;  4IJI A;  2RII A;  5G31 A;  3GHA A;  1X5E A;  3F3R A;  3TKS E;  1GLQ A;  5ID2 A;  5CRH A;  4DSQ A;  3C8E A;  3QAG A;  3UVT A;  1EGO A;  1F2E A;  2LJA A;  2HNL A;  4NAX A;  3RHC A;  3VWX A;  2PGT A;  1K0C A;  4NXI A;  4O7H A;  1KBN A;  1S3A A;  2H75 A;  3ZVJ D;  4RQX A;  3LFL A;  2TRX A;  2HE3 A;  4IQ1 A;  3GKN A;  1ERW A;  5AN1 A;  1TTZ A;  3IK7 A;  5INY A;  2VCQ A;  1MTC A;  4IGJ A;  5D93 A;  2DSA A;  1B8X A;  5IPH A;  3FRC A;  2FD3 A;  2LNS A;  1G7E A;  5DDL A;  4L0U A;  3IE3 A;  5DQY A;  4NHW A;  3IR4 A;  4ECJ A;  1WJK A;  5KN1 A;  1ZCP A;  1Z9H A;  1Z5Y E;  4N0V A;  1GSF A;  3WT2 A;  3EU4 A;  3GA4 A;  5KN3 A;  2LTK A;  3BJ5 A;  2DJ0 A;  1K0B A;  2GT6 A;  5HFI A;  1TU8 A;  1XW5 A;  1O73 A;  3PH9 A;  3FR6 A;  3HZ8 A;  2FWF A;  3FMW A;  1T3B A;  2LQO A;  1UN2 A;  3UMA A;  2CA8 A;  5ECR B;  3A5W A;  3BOA A;  3HVV A;  4I8B A;  4USS A;  1XBS A;  2R3X A;  1OKT A;  2CZ2 A;  1J0F A;  3G9B A;  2GZP A;  5DJL A;  2B5Y A;  3SBC A;  1N2A A;  5JCU A;  1TK0 B;  2MZC A;  4XCS A;  2OAD A;  2ZUP A;  2IMF A;  3EC3 A;  3ISO A;  3DVX A;  3QFA C;  2WRT A;  2VCX A;  4OCF A;  2CVB A;  4FYC A;  4FIW A;  3M9J A;  1IYH A;  1V98 A;  3D21 A;  1NSW A;  4JZQ A;  1TU7 A;  4POM A;  2FCH A;  1Y25 A;  4K9Z A;  1M9B A;  1R4W A;  2E2G A;  4YAP A;  4JRR A;  4MMM A;  3ZML A;  3VWW A;  1TDI A;  3CTG A;  5DVB A;  3ZRD A;  4RI6 A;  2IMD A;  4Z2T A;  1A23 A;  2DJK A;  3TKS C;  2C80 A;  2K6V A;  3VI5 A;  2JZT A;  4HJ2 A;  4L5L A;  1O8X A;  2HLS A;  6GSX A;  4PNF A;  1M3J A;  3FZ9 A;  3WGE A;  2HYX A;  5B8B A;  1XFL A;  4ML6 A;  3TJB A;  1UA5 A;  2IL3 A;  2QC7 A;  3LXZ A;  4LL1 B;  4CHS A;  2F51 A;  3EU3 A;  4AJ7 A;  11GS A;  3UIW A;  5DQS A;  1A24 A;  1EGR A;  3CMI A;  4IW9 A;  1SL0 B;  3PPU A;  4ZL7 A;  5F0G A;  2WDU A;  3LEF A;  3C1S A;  3KZQ A;  2AUV A;  4PNG A;  2OBK A;  5J3R A;  2QA2 A;  3C1R A;  4OCE A;  2K9F A;  4QL7 A;  3UBK A;  4TRX A;  1XCC A;  4MZW A;  5CP1 A;  5HFG A;  1YJ6 A;  3GUR A;  1GLP A;  2A2S A;  4O32 A;  1HNC A;  4TW5 A;  1O85 A;  1BX9 A;  1YKC A;  3S9F A;  2JL4 A;  4DSR A;  2PWJ A;  2Z9S A;  1G0T A;  3TKS A;  2YAN A;  2B5E A;  1A8L A;  1EP7 A;  3IHG A;  3HD5 A;  4KGI A;  5IMC A;  2HT9 A;  1ACV A;  4PQI A;  6GSS A;  3CTF A;  4ZXG A;  3F9U A;  2HRA A;  4X4J A;  2GSS A;  2L6C A;  2L57 A;  1PD2 1;  1FAA A;  2PVQ A;  1K0O A;  4J2F A;  4L8E A;  1M2B A;  1I5G A;  2A4H A;  5BRT A;  3M9K A;  1R26 A;  2V6O A;  5FHI A;  4V1A p;  1GSU A;  4TKY A;  5D9V A;  2XPD A;  2B1K A;  3UBL A;  1B9X C;  5J9B A;  4BWQ A;  5ECS A;  3WD6 A;  1PKW A;  2IMI A;  1J9B A;  1KNG A;  4POL A;  2FLS A;  5HFK A;  1NHO A;  4KH7 A;  1M3I A;  1EV4 A;  3BCK A;  2FHE A;  4GF0 A;  4A5P A;  4KAE A;  3JCM L;  5J4U A;  3N9J A;  2H6Y A;  5F8B A;  3DKS A;  1X9W B;  1FHE A;  1OVN A;  6GSY A;  3HVS A;  2P5R A;  4K2D A;  4MNN A;  1HYU A;  2P0G A;  2CQ9 A;  6GST A;  5IO2 A;  4IKH A;  3W6G A;  1TW9 A;  1V58 A;  1VF3 A;  3U6V A;  2IIY A;  2CZ3 A;  2K18 A;  2HRK A;  3H1N A;  3GMF A;  2JZS A;  1ZYE A;  4RUV A;  1OC9 B;  2VLU A;  1WPI A;  1FVJ A;  5G30 A;  2L59 A;  1WMJ A;  2R0P A;  1FVK A;  2PUK C;  3H8Q A;  3EIN A;  2MYG A;  2ZCT A;  1CQG A;  3GUS A;  2XHF A;  3TJJ A;  3A2X A;  3VPT A;  1K0A A;  5EY6 A;  1MD4 A;  1F9M A;  3I6A A;  4EDZ A;  3A2W A;  2FNO A;  2C0G A;  1NHY A;  1QXH A;  2H1A A;  4ILF A;  2LUS A;  2H6X A;  3LWA A;  5EPF A;  1GP1 A;  2RUE A;  5DJM A;  1TP9 A;  3EUR A;  3O3T A;  3IXR A;  2VL2 A;  1TK5 B;  4FYB A;  3TKQ A;  1SJI A;  5GSS A;  3G7Y A;  5A4W A;  5J5N A;  2R2J A;  4ECI A;  2FUG 2;  3HYP A;  4X1U A;  3FW2 A;  3FKF A;  1TI3 A;  4NV2 A;  2DJ3 A;  1ZYP A;  3GTU A;  3L9U A;  4JED A;  4F9Z A;  3VUR A;  5DAL A;  1EV9 A;  1O7U A;  3I69 A;  5ELA A;  1ILO A;  2K8V A;  4MA9 A;  4WEY A;  1URM A;  1MDJ A;  4V2N A;  4IEL A;  5F05 A;  2YWN A;  4J57 E;  1AQW A;  5JWQ B;  1GTI A;  1PN0 A;  3CSI A;  4YQU A;  4BWS A;  3CSH A;  3AY8 A;  2YZU A;  1R7H A;  2V1M A;  5D9W A;  2L5L A;  5ELG A;  1LU4 A;  1QK8 A;  2I4A A;  3KTB A;  4KSO A;  5B7C A;  1PL1 A;  4Q5F A;  4YQV A;  4CDO A;  1ML6 A;  3KM6 A;  3GST A;  3ZLP A;  1Z6M A;  1QGV A;  4KDU A;  4YQM A;  2WGR A;  1B4P A;  1DUG A;  1M2A A;  5CRE A;  2R6K A;  4GSS A;  3WGD A;  3F63 A;  5KOW A;  1GTA A;  2H6Z A;  2A2R A;  4Q5R A;  4TR1 B;  4POB A;  3PR8 A;  3HKR A;  2VOC A;  4V2L A;  2VL9 A;  1S3D A;  1FB6 A;  3HY2 A;  3DXB A;  2EIQ A;  3QD9 A;  2OBI A;  4K5S A;  1H75 A;  3MSZ A;  1AQX A;  2L5O A;  1XW6 A;  5B8A A;  1PSQ A;  3F4T A;  4HU7 A;  3PGT A;  3W8J A;  4K0N A;  5A4U A;  5GAN D;  2HZE B;  3P2A A;  1AAZ A;  5ENU A;  2C1Y A;  3DML A;  4F03 A;  5COH A;  2REM A;  2B7K A;  4MAB A;  2GQM A;  3LQ7 A;  1YKA A;  1GUL A;  2DC5 A;  5D96 A;  1MD3 A;  2VUP A;  2I81 A;  3QFB C;  1S3R A;  3TCO A;  3US3 A;  2X8G A;  4I2U A;  2B3S A;  3H93 A;  2HRN A;  5ECL B;  1VRS D;  2VLV A;  3LOR A;  4WR5 A;  1U88 A;  2MMO A;  4Z7X A;  3A5I A;  2F8A A;  3MAK A;  2TIR A;  1SK2 A;  2GS3 A;  2IME A;  2C8U A;  4BPY A;  2HFD A;  1K3Y A;  2C3N A;  5HR3 A;  3I43 A;  1JZR A;  4MK3 A;  2HI7 A;  4LA1 A;  2B7J A;  4MJB A;  3APO A;  4X43 A;  4EDY A;  5D8I A;  3TJG A;  4H86 A;  2BJX A;  2GSQ A;  1WWJ A;  1AC1 A;  1TRW A;  2GDR A;  1V40 A;  1GH2 A;  4PX1 A;  3F0I A;  1Z6N A;  2F9S A;  3IRA A;  4TVE A;  1Q4J A;  5E4W A;  2WFC A;  1PN9 A;  3Q18 A;  1SD9 A;  3APS A;  3K8N A;  1TI1 A;  3KH9 A;  4MF6 A;  3HHV A;  5HR2 A;  4GCI A;  4GXZ A;  3GSS A;  3LGC A;  3P8W A;  3VLN A;  2X8C A;  4DVC A;  2GTU A;  1TKD B;  1YF0 A;  3QPM A;  1H4O A;  3D6I A;  5EL8 A;  1YEX A;  4FQU A;  2LEG A;  3TOT A;  3RHB A;  4WKW A;  5G2Z A;  4ECC A;  4EL1 A;  4ZL9 A;  1JFU A;  2XBQ A;  3DIE A;  4BL7 B;  4K0G A;  1YEP A;  5CNW A;  1HD2 A;  2EC4 A;  1XW9 A;  4G0K A;  5AGY A;  2GST A;  4N10 A;  2HSY A;  1DSB A;  1J08 A;  4MJC A;  2OE1 A;  3ZTL A;  7GSS A;  4WXT A;  2LJK A;  1XWG A;  3ERF A;  2F3M A;  3FR9 A;  4JBB A;  2HRF A;  4K7O A;  2YNX A;  2G0F A;  1BED A;  4ZB8 A;  2MMZ A;  4DEJ A;  5CYY A;  3D22 A;  1T4Z A;  2O85 A;  3HJP A;  3UJ1 A;  3KH7 A;  4ECB A;  1U6T A;  1YQ1 A;  3DEX A;  3HJO A;  4WF5 A;  4KF9 A;  1Z7P A;  4PTS A;  5GAP D;  3OR5 A;  4EF0 A;  3MYD A;  4LMW A;  3Q19 A;  4PQ1 A;  2JZR A;  4GRF A;  3P7X A;  3W8S A;  4O92 A;  1USB A;  2YWO A;  4Q5Q A;  4MZB A;  4FH8 A;  3TB2 A;  4G2E A;  3DGQ A;  1XG8 A;  1PL2 A;  5F06 A;  1G6W A;  1ZMA A;  2NTO A;  1XIY A;  2V6K A;  5D9T A;  4HU9 A;  5B6M A;  5DAK A;  3UOM A;  4ID0 A;  2DML A;  2H19 A;  4LLR A;  3L78 A;  3Q74 A;  1O8W A;  1ERT A;  4WET A;  5IOX A;  4O5Q A;  2CX3 A;  1E6B A;  4F0C A;  4I6X A;  3O76 A;  2JAC A;  1EEJ A;  2VM1 A;  3QDN A;  1A0F A;  4HSC X;  2OE3 A;  4EIQ A;  2P5Q A;  4ZBB A;  3IPZ A;  2YWI A;  2YJH A;  3TKR A;  3IK9 A;  2E0Q A;  3D4M A;  1EEM A;  3FZA A;  3RPN A;  16GS A;  1PA3 A;  1XPV A;  5CAX A;  2I9H A;  2DIY A;  3GL5 A;  1OAZ A;  2GT5 A;  3QAV A;  1XWB A;  2VL3 A;  3CYN A;  5FWG A;  2MMA A;  3KD0 A;  4OO5 A;  3DD3 A;  3ME7 A;  3TRP A;  2PVO C;  2VM2 A;  2N5B A;  2V32 A;  3IA1 A;  4MJA A;  4KND A;  1A8Y A;  1OC9 A;  3C71 A;  4OFT A;  4HOJ A;  4GWR A;  4N11 A;  3WGX A;  1TRU A;  4F2I A;  2JSZ A;  1PFO A;  3EYT A;  1Q98 A;  2RM5 A;  4AJ6 A;  4ACS A;  2NBS A;  1GTB A;  2QSI A;  3CRU A;  1R5P A;  4V1A g;  2R5G A;  2X4A A;  2B5X A;  2LS5 A;  2WUL A;  3R2Q A;  3VK9 A;  2I1U A;  1ZOF A;  3HVN A;  2M72 A;  3N5O A;  4E8E A;  5DAK B;  1KEB A;  1T7P B;  4I2T A;  2RUF A;  17GS A;  4HZ2 A;  3QR6 A;  1X5D A;  3TOU A;  1BYE A;  1GRX A;  5A4V A;  2DJ2 A;  2L4C A;  2A4V A;  22GS A;  5DBQ A;  5JCW A;  1DBY A;  3A2V A;  2YOI A;  2C0F A;  1EZK A;  1TJD A;  1FG4 A;  2GGT A;  2LJR A;  1JZD A;  3U5R E;  3KIJ A;  4CY8 A;  2GSR A;  4BIK A;  3FZ4 A;  4ISD A;  3PIN A;  4CW9 A;  2FWG A;  1C72 A;  1PMT A;  5ECM B;  4Z2U A;  3GX0 A;  4ZB9 A;  4NWY A;  4N30 A;  2H0I A;  4EE0 A;  4IQA A;  4O5U A;  3MWH A;  3IBH A;  3RPP A;  3ZVJ A;  1MEK A;  2H8L A;  5B6N A;  3EE2 A;  1GSQ A;  1BJX A;  2KHP A;  3WT1 A;  1V2A A;  3HVX A;  4GLT A;  1FB0 A;  3ZL5 A;  4IJ3 A;  2R0G A;  2IJY A;  1M9A A;  2CX4 A;  2PBJ A;  3WYW A;  4PXO A;  3RDW A;  2DIZ A;  2N5F A;  4WBJ A;  3KGK A;  5JWR B;  3FEU A;  3F4S A;  3F3Q A;  4XS1 A;  2CV4 A;  3ERW A;  1FOV A;  2YJ7 A;  5D9X A;  4TR1 A;  4XRD A;  4TOP A;  2FWE A;  6GSV A;  1M99 A;  1ZYN A;  1JHB A;  2AJQ B;  2R37 A;  1THX A;  4Q5N A;  1VF1 A;  1X9M B;  4HQS A;  2LQQ A;  4RI7 A;  3H4K A;  2FA8 A;  3HCZ A;  3LYP A;  1ST9 A;  4DSS A;  2LV3 A;  4JR4 A;  3G7I A;  3MIX A;  1GUH A;  1PRX A;  1W4V A;  5G1K A;  2HZE A;  1I9D A;  3HZ4 A;  4ZB6 A;  1CQH A;  2B1L A;  2DMM A;  1XZO A;  4OFN A;  1GUK A;  2C3T A;  2GQL A;  3ZIT A;  3IV4 A;  2VCV A;  1K3L A;  3C7M A;  1THO A;  2H74 A;  2DJ1 A;  4IS0 A;  5DCG A;  4HI7 A;  1WP0 A;  3GFK A;  1MDK A;  3M1G A;  6GSU A;  2DLX A;  5EVO A;  2ES7 A;  3E9J B;  3GH6 A;  2XPE A;  2JAD A;  1FW1 A;  1BQ7 A;  1OYJ A;  4YKG A;  4KB3 A;  4MPG A;  1A2J A;  1XVW A;  3SWL A;  3GV1 A;  5CRW A;  1M0U A;  1T00 A;  1Y6E A;  2BTO T;  2H1G A;  4TXV A;  12GS A;  4WR4 A;  4CY6 A;  1FO5 A;  1U87 A;  2UZ8 A;  3RBT A;  2A2P A;  4MH2 A;  1XWC A;  2VLT A;  4NPB A;  5AIX A;  2VCW A;  3QOU A;  14GS A;  3TJF A;  2R4V A;  2JU5 A;  3IDV A;  1AW9 A;  4MP4 A;  5GZZ B;  4ICY A;  2IFQ A;  3APQ A;  3H79 A;  4V2M A;  4TR3 A;  1F3A A;  1R5A A;  2K8S A;  2VAF A;  2HSH A;  4DSS B;  4HQZ A;  2C3Q A;  4MZC A;  3UEM A;  1MDI A;  5H5R A;  4WBR D;  4JE1 A;  3A3T A;  9GSS A;  2WCI A;  3ZFL A;  3TUE A;  3FYG A;  3HA9 A;  2YCD A;  1A0R P;  1X9S B;  1GSD A;  2X64 A;  1EOG A;  2LST A;  2HZF A;  2ON7 A;  2QA1 A;  2X49 A;  3L9V A;  1GNE A;  1QQ2 A;  2LRT A;  3DVW A;  5L71 A;  1ZL9 A;  2MBS A;  3KEB A;  4YAV A;  3GRX A;  5BMU A;  1WOU A;  1K0D A;  4O5R A;  1GUM A;  2LRC A;  2WZ9 A;  1RK4 A;  4KCE A;  4BL7 A;  5IQY A;  4I5Q A;  5LNK e;  2H70 A;  3TJK A;  1LBK A;  1O81 A;  3E3E A;  1NM3 A;  2VCT A;  3D4T A;  4OO4 A;  3QAW A;  4OFM A;  4XRA A;  3HDC A;  2DJJ A;  3BCI A;  1RW1 A;  1NW2 A;  4I97 A;  3I9V 2;  5HQP A;  1YY7 A;  5IPG A;  3LJR A;  4Z2R A;  1LJR A;  1XWK A;  4HS1 A;  3VPQ A;  1QMV A;  4TXO B;  3MNG A;  4MF7 A;  1IYI A;  1SD8 A;  3ZRE A;  5CRG A;  1TRS A;  2R0C A;  4FYU A;  4TR0 A;  1SU9 A;  3FK8 A;  3IOS A;  3DWV A;  2IFQ B;  4L5O A;  4LL4 B;  2HXK A;  4XS4 A;  5AIS A;  3LG6 A;  1ZZY A;  2LNT A;  1SKW B;  4MDC A;  1X0R A;  2VO4 A;  2M46 A;  2RLI A;  2J23 A;  1XOA A;  3CQF A;  2NDO A;  4OWY A;  3L0H A;  2GQK A;  2O89 A;  5IMF A;  3CBU A;  2CAI A;  3DYR A;  3NIV A;  4G9H A;  4KDX A;  1F6M C;  3EPT A;  3GKX A;  5G5E A;  1XVQ A;  5C04 A;  2L4Q A;  2OJL A;  3VWU A;  1PX6 A;  2AV4 A;  2H1B A;  1SEN A;  5JWO B;  1TK8 B;  1F37 A;  2ON5 A;  5CO3 A;  3RAZ A;  4PUA A;  5ECI B;  3C73 A;  3FZ5 A;  3EMP A;  5CRD A;  2GLR A;  4ZL8 A;  3M3M A;  4TR4 A;  3DRN A;  2KP1 A;  4EKZ A;  1EWX A;  4KDY A;  4EXJ A;  2H0G A;  5AIV A;  1SKS B;  3ZIV A;  2BMX A;  5KEJ A;  5H5S A;  4BVY A;  2CT6 A;  1JZO A;  3FR3 A;  3F6F A;  1KTE A;  5KN2 A;  1XOB A;  2J9H A;  1DE1 A;  5HR1 A;  4BA7 A;  5G1L A;  2XC2 A;  1G6Y A;  1YF1 A;  1B48 A;  4MJE A;  4XS4 B;  4OMV A;  3J7Y k;  2I3Y A;  5IMV A;  1SYX A;  3D5J A;  4G0I A;  4PUR A;  4GSN A;  5IMA A;  3EVI A;  3GNJ A;  3IHQ A;  4ZIL A;  2VD0 A;  3NZN A;  3KMN A;  5ID2 B;  5GST A;  2JSY A;  2IPA A;  4ZBA A;  2AB6 A;  1BG5 A;  3VI7 A;  3Q6O A;  1TOF A;  1K0N A;  5ECQ B;  4KE3 A;  4K2X A;  3EWL A;  3UVH A;  2KLX A;  5IIZ A;  4QL9 A;  4NV5 A;  1X5C A;  2AYT A;  2PER A;  2X99 A;  2GZZ A;  3ZMK A;  4IP6 A;  3F6D A;  5KOX A;  4PUF C;  1OC8 A;  2GZY A;  2H72 A;  4G19 A;  2TRC P;  2YN1 A;  3CRT A;  4MF5 A;  1PX7 A;  2PU9 C;  5IM9 A;  1HNA A;  2LRN A;  3R3E A;  3UAR A;  1ON4 A;  3ED3 A;  5ECO B;  3KMO A;  1U3I A;  4G0L A;  1K3O A;  1ABA A;  3M0F A;  2O87 A;  3FY7 A;  1G7O A;  2H01 A;  3ME8 A;  2OKA A;  3ZIJ A;  4K5R A;  2KP2 A;  3IC4 A;  4NMU A;  3E0U A;  4BVY B;  3ZZX A;  2G2Q A;  1QUW A;  4K6X A;  5HR0 A;  2OE0 A;  4KW6 A;  4J56 E;  1YDK A;  4POK A;  4MPF A;  2EIR A;  1S3C A;  4IP1 A;  1T1V A;  2MMN A;  2F8F A;  1SL2 B;  2YP6 A;  4KA0 A;  3LW9 A;  3P90 A;  2M80 A;  2YV9 A;  4MCU A;  1RQM A;  3KP8 A;  1AIU A;  4AF2 A;  2EIO A;  3BD2 A;  4OD7 A;  3KTL A;  4PQH A;  1ERV A;  3L9S A;  2C0D A;  1SJZ A;  1W89 A;  2P31 A;  1K0M A;  4F82 A;  3NOF A;  4KX4 A;  1XXU A;  1UC7 A;  2IMK A;  3UL3 A;  3F4R A;  3TRQ A;  1Z3E A;  2QKE A;  2O7K A;  1A2L A;  4LMV A;  1OE7 A;  4TN8 A;  1JLV A;  1SKR B;  4ML1 A;  2DBC A;  5C00 A;  1EOH A;  1FOH A;  1JZW A;  1VF2 A;  4P3Y B;  3GIX A;  4EIP A;  1PGT A;  2VIM A;  5KN0 A;  1SL1 B;  4X0X A;  4L0W A;  5ECH B;  1WIK A;  1V9W A;  2KUC A;  3GX8 A;  2FWH A;  4WF4 A;  4JR6 A;  3GKK A;  2C0E A;  5IO0 A;  1GSE A;  3KCM A;  5F07 A;  1OE8 A;  4AGS A;  3TGZ A;  4FO5 A;  18GS A;  3FHK A;  3GH9 A;  1ERU A;  4IHU A;  5ABR A;  3BBY A;  4GQC A;  2D2Z A;  4K7N A;  2YZH A;  2VL2 C;  3IAS 2;  1PKZ A;  2MBT A;  3G7J A;  1ZGN A;  4EO3 A;  1N8J A;  1HNB A;  4MLY A;  4YH2 A;  4HUA A;  3TRX A;  2DKH A;  1B9Y C;  2XBI A;  4K1F A;  3UAP A;  2DKI A;  3L4N A;  3F8U A;  3GKM A;  2O8V B;  1SK1 A;  3LYK A;  4HJM A;  1QFN A;  2H30 A;  4HZ4 A;  4EVM A;  1YZX A;  3HJM A;  2LKU A;  1VGL A;  13GS A;  3TDG A;  4GQF A;  1O6J A;  5G5F A;  2WJU A;  1T4Y A;  3V1W A;  4KSM A;  2VCZ A;  1M2D A;  2YV7 A;  2CAQ A;  4IVF A;  1M7T A;  3TKP A;  4EUY A;  4XIH A;  4QQ7 A;  4IN0 A;  5ECP B;  1U3A A;  2H1D A;  4GTU A;  4HEA 2;  2CVD A;  1F3B A;  5JCG A;  3GYK A;  1OC3 A;  2ZNM A;  5LCZ A;  5IMZ A;  1Z7R A;  2OA7 A;  5H5Q A;  1TXX A;  4PGT A;  1OKD A;  5LD0 A;  2FGX A;  4G10 A;  4XHM A;  2PPT A;  1E2Y A;  2H76 A;  1SYR A;  2N5A A;  8GSS A;  3GL3 A;  2CVK A;  3J7Y b;  4D73 A;  4K7I A;  6GSW A;  1DE2 A;  2YWM A;  2L6D A;  2AHE A;  4BVX A;  5FT3 A;  4RQR A;  1UVZ A;  1GNW A;  2NVL A;  5J9C A;  3CXG A;  3D0Z A;  2V41 A;  4E8H A;  1GL8 A;  1AUC A;  1PQN A;  3QCP A;  4JU5 A;  1GWC A;  4TXO A;  4N0Z A;  1V57 A;  5J41 A;  4ULX A;  2KOK A;  2H0H A;  3CSJ A;  3LSZ A;  2QGV A;  1SK0 A;  3VWV A;  4ZIJ A;  2H66 A;  3QMX A;  4HDE A;  4ZBD A;  1TRV A;  3ERG A;  2WB9 A;  1WE0 A;  2X8H A;  1B4Q A;  1HQO A;  3GN3 A;  10GS A;  1T8E B;  3HXS A;  3ZFB A;  1GSY A;  3ZYW A;  4XTS A;  5IMD A;  1ZYQ B;  3EMX A;  4NHZ A;  5E59 A;  2FA4 A;  4IBP A;  4YKF A;  4XS6 A;  19GS A;  4K8M A;  2H71 A;  4KUN A;  1VF4 A;  2C4J A;  4F0B A;  1GSS A;  3IC8 A;  2RM6 A;  3GTU B;  2E7P A;  5DAL B;  4KCA A;  1SJ6 A;  5ECN B;  1BAY A;  2OAC A;  2IN3 A;  2V2G A;  1AQV A;  1A2M A;  3M8N A;  2YPM A;  20GS A;  5IOW A;  2IWT A;  3KJY A;  5DCH A;  1WRY A;  1EP8 A;  4GST A;  1GTU A;  4D73 B;  3KXO A;  2GVP A;  4BVX B;  2ALB A;  5D73 A;  2H73 A;  3O6T A;  1XWA A;  2E2M A;  4EC0 A;  2VD1 A;  5A5K A;  3LXT A;  2FY6 A;  2WS2 A;  1AXD A;  3IAM 2;  2PN8 A;  2AAW A;  3VFI A; 
#chains in the Genus database with same CATH homology
 1JLW A;  3MDK A;  4MH3 A;  5ECK B;  3KP9 A;  2HSM A;  2PMT A;  2NPB A;  4AJ8 A;  2B6M A;  4IJI A;  2RII A;  5G31 A;  3GHA A;  1X5E A;  3F3R A;  3TKS E;  1GLQ A;  5ID2 A;  5CRH A;  4DSQ A;  3C8E A;  3QAG A;  3UVT A;  1EGO A;  1F2E A;  2LJA A;  2HNL A;  4NAX A;  3RHC A;  3VWX A;  2PGT A;  1K0C A;  4NXI A;  4O7H A;  1KBN A;  1S3A A;  2H75 A;  3ZVJ D;  4RQX A;  3LFL A;  2TRX A;  2HE3 A;  4IQ1 A;  3GKN A;  1ERW A;  5AN1 A;  1TTZ A;  3IK7 A;  5INY A;  2VCQ A;  1MTC A;  4IGJ A;  5D93 A;  2DSA A;  1B8X A;  5IPH A;  3FRC A;  2FD3 A;  2LNS A;  1G7E A;  5DDL A;  4L0U A;  3IE3 A;  5DQY A;  4NHW A;  3IR4 A;  4ECJ A;  1WJK A;  5KN1 A;  1ZCP A;  1Z9H A;  1Z5Y E;  4N0V A;  1GSF A;  3WT2 A;  3EU4 A;  3GA4 A;  5KN3 A;  2LTK A;  3BJ5 A;  2DJ0 A;  1K0B A;  2GT6 A;  5HFI A;  1TU8 A;  1XW5 A;  1O73 A;  3PH9 A;  3FR6 A;  3HZ8 A;  2FWF A;  3FMW A;  1T3B A;  2LQO A;  1UN2 A;  3UMA A;  2CA8 A;  5ECR B;  3A5W A;  3BOA A;  3HVV A;  4I8B A;  4USS A;  1XBS A;  2R3X A;  1OKT A;  2CZ2 A;  1J0F A;  3G9B A;  2GZP A;  5DJL A;  2B5Y A;  3SBC A;  1N2A A;  5JCU A;  1TK0 B;  2MZC A;  4XCS A;  2OAD A;  2ZUP A;  2IMF A;  3EC3 A;  3ISO A;  3DVX A;  3QFA C;  2WRT A;  2VCX A;  4OCF A;  2CVB A;  4FYC A;  4FIW A;  3M9J A;  1IYH A;  1V98 A;  3D21 A;  1NSW A;  4JZQ A;  1TU7 A;  4POM A;  2FCH A;  1Y25 A;  4K9Z A;  1M9B A;  1R4W A;  2E2G A;  4YAP A;  4JRR A;  4MMM A;  3ZML A;  3VWW A;  1TDI A;  3CTG A;  5DVB A;  3ZRD A;  4RI6 A;  2IMD A;  4Z2T A;  1A23 A;  2DJK A;  3TKS C;  2C80 A;  2K6V A;  3VI5 A;  2JZT A;  4HJ2 A;  4L5L A;  1O8X A;  2HLS A;  6GSX A;  4PNF A;  3FZ9 A;  3WGE A;  2HYX A;  5B8B A;  1XFL A;  4ML6 A;  3TJB A;  1UA5 A;  2IL3 A;  2QC7 A;  3LXZ A;  4LL1 B;  4CHS A;  2F51 A;  3EU3 A;  4AJ7 A;  11GS A;  3UIW A;  5DQS A;  1A24 A;  1EGR A;  3CMI A;  4IW9 A;  1SL0 B;  3PPU A;  4ZL7 A;  5F0G A;  2WDU A;  3LEF A;  3C1S A;  3KZQ A;  2AUV A;  4PNG A;  2OBK A;  5J3R A;  2QA2 A;  3C1R A;  4OCE A;  2K9F A;  4QL7 A;  3UBK A;  4TRX A;  1XCC A;  4MZW A;  5CP1 A;  5HFG A;  1YJ6 A;  3GUR A;  1GLP A;  2A2S A;  4O32 A;  1HNC A;  4TW5 A;  1O85 A;  1BX9 A;  1YKC A;  3S9F A;  2JL4 A;  4DSR A;  2PWJ A;  2Z9S A;  1G0T A;  3TKS A;  2YAN A;  2B5E A;  1A8L A;  1EP7 A;  3IHG A;  3HD5 A;  4KGI A;  5IMC A;  2HT9 A;  1ACV A;  4PQI A;  6GSS A;  3CTF A;  4ZXG A;  3F9U A;  2HRA A;  4X4J A;  2GSS A;  2L6C A;  2L57 A;  1PD2 1;  1FAA A;  2PVQ A;  1K0O A;  4J2F A;  4L8E A;  1M2B A;  1I5G A;  2A4H A;  5BRT A;  3M9K A;  1R26 A;  2V6O A;  5FHI A;  4V1A p;  1GSU A;  4TKY A;  5D9V A;  2XPD A;  2B1K A;  3UBL A;  1B9X C;  5J9B A;  4BWQ A;  5ECS A;  3WD6 A;  1PKW A;  2IMI A;  1J9B A;  1KNG A;  4POL A;  2FLS A;  5HFK A;  1NHO A;  4KH7 A;  1EV4 A;  3BCK A;  2FHE A;  4GF0 A;  4A5P A;  4KAE A;  3JCM L;  5J4U A;  3N9J A;  2H6Y A;  5F8B A;  3DKS A;  1X9W B;  1FHE A;  1OVN A;  6GSY A;  3HVS A;  2P5R A;  4K2D A;  4MNN A;  1HYU A;  2P0G A;  2CQ9 A;  6GST A;  5IO2 A;  4IKH A;  3W6G A;  1TW9 A;  1V58 A;  1VF3 A;  3U6V A;  2IIY A;  2CZ3 A;  2K18 A;  2HRK A;  3H1N A;  3GMF A;  2JZS A;  1ZYE A;  4RUV A;  1OC9 B;  2VLU A;  1WPI A;  1FVJ A;  5G30 A;  2L59 A;  1WMJ A;  2R0P A;  1FVK A;  2PUK C;  3H8Q A;  3EIN A;  2MYG A;  2ZCT A;  1CQG A;  3GUS A;  2XHF A;  3TJJ A;  3A2X A;  3VPT A;  1K0A A;  5EY6 A;  1MD4 A;  1F9M A;  3I6A A;  4EDZ A;  3A2W A;  2FNO A;  2C0G A;  1NHY A;  1QXH A;  2H1A A;  4ILF A;  2LUS A;  2H6X A;  3LWA A;  5EPF A;  1GP1 A;  2RUE A;  5DJM A;  1TP9 A;  3EUR A;  3O3T A;  3IXR A;  2VL2 A;  1TK5 B;  4FYB A;  3TKQ A;  1SJI A;  5GSS A;  3G7Y A;  5A4W A;  5J5N A;  2R2J A;  4ECI A;  2FUG 2;  3HYP A;  4X1U A;  3FW2 A;  3FKF A;  1TI3 A;  4NV2 A;  2DJ3 A;  1ZYP A;  3GTU A;  3L9U A;  4JED A;  4F9Z A;  3VUR A;  5DAL A;  1EV9 A;  1O7U A;  3I69 A;  5ELA A;  1ILO A;  2K8V A;  4MA9 A;  4WEY A;  1URM A;  1MDJ A;  4V2N A;  4IEL A;  5F05 A;  2YWN A;  4J57 E;  1AQW A;  5JWQ B;  1GTI A;  1PN0 A;  3CSI A;  4YQU A;  4BWS A;  3CSH A;  3AY8 A;  2YZU A;  1R7H A;  2V1M A;  5D9W A;  2L5L A;  5ELG A;  1LU4 A;  1QK8 A;  2I4A A;  3KTB A;  4KSO A;  5B7C A;  1PL1 A;  4Q5F A;  4YQV A;  4CDO A;  1ML6 A;  3KM6 A;  3GST A;  3ZLP A;  1Z6M A;  1QGV A;  4KDU A;  4YQM A;  2WGR A;  1B4P A;  1DUG A;  1M2A A;  5CRE A;  2R6K A;  4GSS A;  3WGD A;  3F63 A;  5KOW A;  1GTA A;  2H6Z A;  2A2R A;  4Q5R A;  4TR1 B;  4POB A;  3PR8 A;  3HKR A;  2VOC A;  4V2L A;  2VL9 A;  1S3D A;  1FB6 A;  3HY2 A;  3DXB A;  2EIQ A;  3QD9 A;  2OBI A;  4K5S A;  1H75 A;  3MSZ A;  1AQX A;  2L5O A;  1XW6 A;  5B8A A;  1PSQ A;  3F4T A;  4HU7 A;  3PGT A;  3W8J A;  4K0N A;  5A4U A;  5GAN D;  2HZE B;  3P2A A;  1AAZ A;  5ENU A;  2C1Y A;  3DML A;  4F03 A;  5COH A;  2REM A;  2B7K A;  4MAB A;  2GQM A;  3LQ7 A;  1YKA A;  1GUL A;  2DC5 A;  5D96 A;  1MD3 A;  2VUP A;  2I81 A;  3QFB C;  3TCO A;  3US3 A;  2X8G A;  4I2U A;  2B3S A;  3H93 A;  2HRN A;  5ECL B;  1VRS D;  2VLV A;  3LOR A;  4WR5 A;  1U88 A;  2MMO A;  4Z7X A;  3A5I A;  2F8A A;  3MAK A;  2TIR A;  1SK2 A;  2GS3 A;  2IME A;  2C8U A;  4BPY A;  2HFD A;  1K3Y A;  2C3N A;  5HR3 A;  3I43 A;  1JZR A;  4MK3 A;  2HI7 A;  4LA1 A;  2B7J A;  4MJB A;  3APO A;  4X43 A;  4EDY A;  5D8I A;  3TJG A;  4H86 A;  2BJX A;  2GSQ A;  1WWJ A;  1AC1 A;  1TRW A;  2GDR A;  1V40 A;  1GH2 A;  4PX1 A;  3F0I A;  1Z6N A;  2F9S A;  3IRA A;  4TVE A;  1Q4J A;  5E4W A;  2WFC A;  1PN9 A;  3Q18 A;  1SD9 A;  3APS A;  3K8N A;  1TI1 A;  3KH9 A;  4MF6 A;  3HHV A;  5HR2 A;  4GCI A;  4GXZ A;  3GSS A;  3LGC A;  3P8W A;  3VLN A;  2X8C A;  4DVC A;  2GTU A;  1TKD B;  1YF0 A;  3QPM A;  1H4O A;  3D6I A;  5EL8 A;  1YEX A;  4FQU A;  2LEG A;  3TOT A;  3RHB A;  4WKW A;  5G2Z A;  4ECC A;  4EL1 A;  4ZL9 A;  1JFU A;  2XBQ A;  3DIE A;  4BL7 B;  4K0G A;  1YEP A;  5CNW A;  1HD2 A;  2EC4 A;  1XW9 A;  4G0K A;  5AGY A;  2GST A;  4N10 A;  2HSY A;  1DSB A;  1J08 A;  4MJC A;  2OE1 A;  3ZTL A;  7GSS A;  4WXT A;  2LJK A;  1XWG A;  3ERF A;  2F3M A;  3FR9 A;  4JBB A;  2HRF A;  4K7O A;  2YNX A;  2G0F A;  1BED A;  4ZB8 A;  2MMZ A;  4DEJ A;  5CYY A;  3D22 A;  1T4Z A;  2O85 A;  3HJP A;  3UJ1 A;  3KH7 A;  4ECB A;  1U6T A;  1YQ1 A;  3DEX A;  3HJO A;  4WF5 A;  4KF9 A;  1Z7P A;  4PTS A;  5GAP D;  3OR5 A;  4EF0 A;  3MYD A;  4LMW A;  3Q19 A;  4PQ1 A;  2JZR A;  4GRF A;  3P7X A;  3W8S A;  4O92 A;  1USB A;  2YWO A;  4Q5Q A;  4MZB A;  4FH8 A;  3TB2 A;  4G2E A;  3DGQ A;  1PL2 A;  5F06 A;  1G6W A;  1ZMA A;  2NTO A;  1XIY A;  2V6K A;  5D9T A;  4HU9 A;  5B6M A;  5DAK A;  3UOM A;  4ID0 A;  2DML A;  2H19 A;  4LLR A;  3L78 A;  3Q74 A;  1O8W A;  1ERT A;  4WET A;  5IOX A;  4O5Q A;  2CX3 A;  1E6B A;  4F0C A;  4I6X A;  3O76 A;  2JAC A;  1EEJ A;  2VM1 A;  3QDN A;  1A0F A;  2OE3 A;  4EIQ A;  2P5Q A;  4ZBB A;  3IPZ A;  2YWI A;  2YJH A;  3TKR A;  3IK9 A;  2E0Q A;  3D4M A;  1EEM A;  3FZA A;  3RPN A;  16GS A;  1PA3 A;  1XPV A;  5CAX A;  2I9H A;  2DIY A;  3GL5 A;  1OAZ A;  2GT5 A;  3QAV A;  1XWB A;  2VL3 A;  3CYN A;  5FWG A;  2MMA A;  3KD0 A;  4OO5 A;  3DD3 A;  3ME7 A;  3TRP A;  2PVO C;  2VM2 A;  2N5B A;  2V32 A;  3IA1 A;  4MJA A;  4KND A;  1A8Y A;  1OC9 A;  3C71 A;  4OFT A;  4HOJ A;  4GWR A;  4N11 A;  3WGX A;  1TRU A;  4F2I A;  2JSZ A;  3EYT A;  1Q98 A;  2RM5 A;  4AJ6 A;  4ACS A;  2NBS A;  1GTB A;  2QSI A;  3CRU A;  1R5P A;  4V1A g;  2R5G A;  2X4A A;  2B5X A;  2LS5 A;  2WUL A;  3R2Q A;  3VK9 A;  2I1U A;  1ZOF A;  2M72 A;  3N5O A;  4E8E A;  5DAK B;  1KEB A;  1T7P B;  4I2T A;  2RUF A;  17GS A;  4HZ2 A;  3QR6 A;  1X5D A;  3TOU A;  1BYE A;  1GRX A;  5A4V A;  2DJ2 A;  2L4C A;  2A4V A;  22GS A;  5DBQ A;  5JCW A;  1DBY A;  3A2V A;  2YOI A;  2C0F A;  1EZK A;  1TJD A;  1FG4 A;  2GGT A;  2LJR A;  1JZD A;  3U5R E;  3KIJ A;  4CY8 A;  2GSR A;  3FZ4 A;  4ISD A;  3PIN A;  4CW9 A;  2FWG A;  1C72 A;  1PMT A;  5ECM B;  4Z2U A;  3GX0 A;  4ZB9 A;  4NWY A;  4N30 A;  2H0I A;  4EE0 A;  4IQA A;  4O5U A;  3MWH A;  3IBH A;  3RPP A;  3ZVJ A;  1MEK A;  2H8L A;  5B6N A;  3EE2 A;  1GSQ A;  1BJX A;  2KHP A;  3WT1 A;  1V2A A;  3HVX A;  4GLT A;  1FB0 A;  3ZL5 A;  4IJ3 A;  2R0G A;  2IJY A;  1M9A A;  2CX4 A;  2PBJ A;  3WYW A;  4PXO A;  3RDW A;  2DIZ A;  2N5F A;  4WBJ A;  3KGK A;  5JWR B;  3FEU A;  3F4S A;  3F3Q A;  4XS1 A;  2CV4 A;  3ERW A;  1FOV A;  2YJ7 A;  5D9X A;  4TR1 A;  4XRD A;  4TOP A;  2FWE A;  6GSV A;  1M99 A;  1ZYN A;  1JHB A;  2AJQ B;  2R37 A;  1THX A;  4Q5N A;  1VF1 A;  1X9M B;  4HQS A;  2LQQ A;  4RI7 A;  3H4K A;  2FA8 A;  3HCZ A;  3LYP A;  1ST9 A;  4DSS A;  2LV3 A;  4JR4 A;  3G7I A;  3MIX A;  1GUH A;  1PRX A;  1W4V A;  5G1K A;  2HZE A;  1I9D A;  3HZ4 A;  4ZB6 A;  1CQH A;  2B1L A;  2DMM A;  1XZO A;  4OFN A;  1GUK A;  2C3T A;  2GQL A;  3ZIT A;  3IV4 A;  2VCV A;  1K3L A;  3C7M A;  1THO A;  2H74 A;  2DJ1 A;  4IS0 A;  5DCG A;  4HI7 A;  1WP0 A;  3GFK A;  1MDK A;  3M1G A;  6GSU A;  2DLX A;  5EVO A;  2ES7 A;  3E9J B;  3GH6 A;  2XPE A;  2JAD A;  1FW1 A;  1BQ7 A;  1OYJ A;  4YKG A;  4KB3 A;  4MPG A;  1A2J A;  1XVW A;  3SWL A;  3GV1 A;  5CRW A;  1M0U A;  1T00 A;  1Y6E A;  2BTO T;  2H1G A;  4TXV A;  12GS A;  4WR4 A;  4CY6 A;  1FO5 A;  1U87 A;  2UZ8 A;  3RBT A;  2A2P A;  4MH2 A;  1XWC A;  2VLT A;  4NPB A;  5AIX A;  2VCW A;  3QOU A;  14GS A;  3TJF A;  2R4V A;  2JU5 A;  3IDV A;  1AW9 A;  4MP4 A;  5GZZ B;  4ICY A;  2IFQ A;  3APQ A;  3H79 A;  4V2M A;  4TR3 A;  1F3A A;  1R5A A;  2K8S A;  2VAF A;  2HSH A;  4DSS B;  4HQZ A;  2C3Q A;  4MZC A;  3UEM A;  1MDI A;  5H5R A;  4WBR D;  4JE1 A;  3A3T A;  9GSS A;  2WCI A;  3ZFL A;  3TUE A;  3FYG A;  3HA9 A;  2YCD A;  1A0R P;  1X9S B;  1GSD A;  2X64 A;  1EOG A;  2LST A;  2HZF A;  2ON7 A;  2QA1 A;  2X49 A;  3L9V A;  1GNE A;  1QQ2 A;  2LRT A;  3DVW A;  5L71 A;  1ZL9 A;  2MBS A;  3KEB A;  4YAV A;  3GRX A;  5BMU A;  1WOU A;  1K0D A;  4O5R A;  1GUM A;  2LRC A;  2WZ9 A;  1RK4 A;  4KCE A;  4BL7 A;  5IQY A;  4I5Q A;  5LNK e;  2H70 A;  3TJK A;  1LBK A;  1O81 A;  3E3E A;  1NM3 A;  2VCT A;  3D4T A;  4OO4 A;  3QAW A;  4OFM A;  4XRA A;  3HDC A;  2DJJ A;  3BCI A;  1RW1 A;  1NW2 A;  4I97 A;  3I9V 2;  5HQP A;  1YY7 A;  5IPG A;  3LJR A;  4Z2R A;  1LJR A;  1XWK A;  4HS1 A;  3VPQ A;  1QMV A;  4TXO B;  3MNG A;  4MF7 A;  1IYI A;  1SD8 A;  3ZRE A;  5CRG A;  1TRS A;  2R0C A;  4FYU A;  4TR0 A;  1SU9 A;  3FK8 A;  3IOS A;  3DWV A;  2IFQ B;  4L5O A;  4LL4 B;  2HXK A;  4XS4 A;  5AIS A;  3LG6 A;  1ZZY A;  2LNT A;  1SKW B;  4MDC A;  1X0R A;  2VO4 A;  2M46 A;  2RLI A;  2J23 A;  1XOA A;  2NDO A;  4OWY A;  3L0H A;  2GQK A;  2O89 A;  5IMF A;  3CBU A;  2CAI A;  3DYR A;  3NIV A;  4G9H A;  4KDX A;  1F6M C;  3EPT A;  3GKX A;  5G5E A;  1XVQ A;  5C04 A;  2L4Q A;  2OJL A;  3VWU A;  1PX6 A;  2AV4 A;  2H1B A;  1SEN A;  5JWO B;  1TK8 B;  1F37 A;  2ON5 A;  5CO3 A;  3RAZ A;  4PUA A;  5ECI B;  3C73 A;  3FZ5 A;  3EMP A;  5CRD A;  2GLR A;  4ZL8 A;  3M3M A;  4TR4 A;  3DRN A;  2KP1 A;  4EKZ A;  1EWX A;  4KDY A;  4EXJ A;  2H0G A;  5AIV A;  1SKS B;  3ZIV A;  2BMX A;  5KEJ A;  5H5S A;  4BVY A;  2CT6 A;  1JZO A;  3FR3 A;  3F6F A;  1KTE A;  5KN2 A;  1XOB A;  2J9H A;  1DE1 A;  5HR1 A;  4BA7 A;  5G1L A;  2XC2 A;  1G6Y A;  1YF1 A;  1B48 A;  4MJE A;  4XS4 B;  4OMV A;  3J7Y k;  2I3Y A;  5IMV A;  1SYX A;  3D5J A;  4G0I A;  4PUR A;  4GSN A;  5IMA A;  3EVI A;  3GNJ A;  3IHQ A;  4ZIL A;  2VD0 A;  3NZN A;  3KMN A;  5ID2 B;  5GST A;  2JSY A;  2IPA A;  4ZBA A;  2AB6 A;  1BG5 A;  3VI7 A;  3Q6O A;  1TOF A;  1K0N A;  5ECQ B;  4KE3 A;  4K2X A;  3EWL A;  3UVH A;  2KLX A;  5IIZ A;  4QL9 A;  4NV5 A;  1X5C A;  2AYT A;  2PER A;  2X99 A;  2GZZ A;  3ZMK A;  4IP6 A;  3F6D A;  5KOX A;  4PUF C;  1OC8 A;  2GZY A;  2H72 A;  4G19 A;  2TRC P;  2YN1 A;  3CRT A;  4MF5 A;  1PX7 A;  2PU9 C;  5IM9 A;  1HNA A;  2LRN A;  3R3E A;  3UAR A;  1ON4 A;  3ED3 A;  5ECO B;  3KMO A;  1U3I A;  4G0L A;  1K3O A;  1ABA A;  3M0F A;  2O87 A;  3FY7 A;  1G7O A;  2H01 A;  3ME8 A;  2OKA A;  3ZIJ A;  4K5R A;  2KP2 A;  3IC4 A;  4NMU A;  3E0U A;  4BVY B;  3ZZX A;  2G2Q A;  1QUW A;  4K6X A;  5HR0 A;  2OE0 A;  4KW6 A;  4J56 E;  1YDK A;  4POK A;  4MPF A;  2EIR A;  1S3C A;  4IP1 A;  1T1V A;  2MMN A;  2F8F A;  1SL2 B;  2YP6 A;  4KA0 A;  3LW9 A;  3P90 A;  2M80 A;  2YV9 A;  4MCU A;  1RQM A;  3KP8 A;  1AIU A;  4AF2 A;  2EIO A;  3BD2 A;  4OD7 A;  3KTL A;  4PQH A;  1ERV A;  3L9S A;  2C0D A;  1SJZ A;  1W89 A;  2P31 A;  1K0M A;  4F82 A;  3NOF A;  4KX4 A;  1XXU A;  1UC7 A;  2IMK A;  3UL3 A;  3F4R A;  3TRQ A;  1Z3E A;  2QKE A;  2O7K A;  1A2L A;  4LMV A;  1OE7 A;  4TN8 A;  1JLV A;  1SKR B;  4ML1 A;  2DBC A;  5C00 A;  1EOH A;  1FOH A;  1JZW A;  1VF2 A;  4P3Y B;  3GIX A;  4EIP A;  1PGT A;  2VIM A;  5KN0 A;  1SL1 B;  4X0X A;  4L0W A;  5ECH B;  1WIK A;  1V9W A;  2KUC A;  3GX8 A;  2FWH A;  4WF4 A;  4JR6 A;  3GKK A;  2C0E A;  5IO0 A;  1GSE A;  3KCM A;  5F07 A;  1OE8 A;  4AGS A;  3TGZ A;  4FO5 A;  18GS A;  3FHK A;  3GH9 A;  1ERU A;  4IHU A;  5ABR A;  3BBY A;  4GQC A;  2D2Z A;  4K7N A;  2YZH A;  2VL2 C;  3IAS 2;  1PKZ A;  2MBT A;  3G7J A;  1ZGN A;  4EO3 A;  1N8J A;  1HNB A;  4MLY A;  4YH2 A;  4HUA A;  3TRX A;  2DKH A;  1B9Y C;  2XBI A;  4K1F A;  3UAP A;  2DKI A;  3L4N A;  3F8U A;  3GKM A;  2O8V B;  1SK1 A;  3LYK A;  4HJM A;  1QFN A;  2H30 A;  4HZ4 A;  4EVM A;  1YZX A;  3HJM A;  2LKU A;  1VGL A;  13GS A;  3TDG A;  4GQF A;  1O6J A;  5G5F A;  2WJU A;  1T4Y A;  3V1W A;  4KSM A;  2VCZ A;  1M2D A;  2YV7 A;  2CAQ A;  4IVF A;  1M7T A;  3TKP A;  4EUY A;  4XIH A;  4QQ7 A;  4IN0 A;  5ECP B;  1U3A A;  2H1D A;  4GTU A;  4HEA 2;  2CVD A;  1F3B A;  5JCG A;  3GYK A;  1OC3 A;  2ZNM A;  5LCZ A;  5IMZ A;  1Z7R A;  2OA7 A;  5H5Q A;  1TXX A;  4PGT A;  1OKD A;  5LD0 A;  2FGX A;  4G10 A;  4XHM A;  2PPT A;  1E2Y A;  2H76 A;  1SYR A;  2N5A A;  8GSS A;  3GL3 A;  2CVK A;  3J7Y b;  4D73 A;  4K7I A;  6GSW A;  1DE2 A;  2YWM A;  2L6D A;  2AHE A;  4BVX A;  5FT3 A;  4RQR A;  1UVZ A;  1GNW A;  2NVL A;  5J9C A;  3CXG A;  3D0Z A;  2V41 A;  4E8H A;  1GL8 A;  1AUC A;  1PQN A;  3QCP A;  4JU5 A;  1GWC A;  4TXO A;  4N0Z A;  1V57 A;  5J41 A;  4ULX A;  2KOK A;  2H0H A;  3CSJ A;  3LSZ A;  2QGV A;  1SK0 A;  3VWV A;  4ZIJ A;  2H66 A;  3QMX A;  4HDE A;  4ZBD A;  1TRV A;  3ERG A;  2WB9 A;  1WE0 A;  2X8H A;  1B4Q A;  1HQO A;  3GN3 A;  10GS A;  1T8E B;  3HXS A;  3ZFB A;  1GSY A;  3ZYW A;  4XTS A;  5IMD A;  1ZYQ B;  3EMX A;  4NHZ A;  5E59 A;  2FA4 A;  4IBP A;  4YKF A;  4XS6 A;  19GS A;  4K8M A;  2H71 A;  4KUN A;  1VF4 A;  2C4J A;  4F0B A;  1GSS A;  3IC8 A;  2RM6 A;  3GTU B;  2E7P A;  5DAL B;  4KCA A;  1SJ6 A;  5ECN B;  1BAY A;  2OAC A;  2IN3 A;  2V2G A;  1AQV A;  1A2M A;  3M8N A;  2YPM A;  20GS A;  5IOW A;  2IWT A;  3KJY A;  5DCH A;  1WRY A;  1EP8 A;  4GST A;  1GTU A;  4D73 B;  3KXO A;  2GVP A;  4BVX B;  2ALB A;  5D73 A;  2H73 A;  3O6T A;  1XWA A;  2E2M A;  4EC0 A;  2VD1 A;  5A5K A;  3LXT A;  2FY6 A;  2WS2 A;  1AXD A;  3IAM 2;  2PN8 A;  2AAW A;  3VFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...