1DE1A

Nmr structures of oxidized bacteriophage t4 glutaredoxin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
87
Chain Sequence
MFKVYGYDSNIHKCVYCDNAKRLLTVKKQPFEFINIMPEKGVFDDEKIAELLTKLGRDTQIGLTMPQVFAPDGSHIGGFDQLREYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAREDOXIN
publication title Solution structures of reduced and oxidized bacteriophage T4 glutaredoxin.
pubmed doi rcsb
molecule tags Electron transport
total genus 15
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1999-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1de1A00
2HRFA 4GWRA 2VL2C 5D8IA 3KH9A 1ILOA 3WGEA 5H5SA 2R2JA 3N9JA 4OFMA 5A4WA 1R26A 2FGXA 1YF0A 2V2GA 4FYUA 4GQCA 1BQ7A 3WGXA 1G6YA 3D21A 2QKEA 4WKWA 1WMJA 2WGRA 3GA4A 2OACA 3LYPA 3HVVA 4IKHA 4YAVA 4GSTA 5ID2A 1YY7A 1FG4A 4KSMA 4GTUA 2RUEA 3DRNA 1K3LA 1OVNA 5F8BA 4WBRD 1O81A 4MZCA 2GQKA 3IXRA 3LFLA 1TK8B 1K3YA 1YKCA 3NIVA 1F2EA 2PWJA 3QDNA 2N5FA 4ZXGA 2GSQA 4Q5NA 4HS1A 1SL0B 2F3MA 4IW9A 4AF2A 2P5RA 4KSOA 4KCEA 5CRWA 4KE3A 4J56E 2VL2A 6GSYA 2A2RA 3CSHA 2DIZA 5COHA 3IDVA 1O6JA 4CW9A 3KGKA 3KIJA 3EE2A 5AGYA 1H4OA 4ZB8A 1OKDA 3HHVA 3L9VA 4TR0A 1OC3A 1MDKA 2PUKC 3LXTA 2XBIA 3ZVJA 4IS0A 1ABAA 1XBSA 1QUWA 3QAWA 3QPMA 9GSSA 4TR4A 5IPGA 2P31A 5DAKB 5D96A 2KP1A 3GSTA 4MH3A 4O7HA 1Q4JA 3CBUA 3IE3A 2C0FA 2LSTA 4MJEA 4MF6A 5DALB 3TKPA 5ECOB 4NHZA 3M9KA 3GTUB 3DMLA 5AN1A 5L71A 1TU7A 2WB9A 4X0XA 1V9WA 1A2JA 4RI7A 2AJQB 5GAND 4P3YB 5DAKA 2C4JA 2YWNA 3H8QA 1ZOFA 3VPTA 3P90A 4ZBBA 3KTLA 4PUFC 1X9WB 3TRXA 5DALA 1A2MA 4ILFA 3GTUA 1ML6A 2EIOA 5KN0A 3DEXA 1B9YC 6GSTA 3D5JA 3W8JA 2XC2A 2F9SA 4BA7A 4NMUA 1DUGA 5CP1A 4OCEA 1Z5YE 4ECBA 4GQFA 3UJ1A 2VD1A 3F9UA 4KDXA 3IHQA 3GIXA 4HU7A 1GSDA 4OMVA 1X9SB 1T1VA 4JR4A 1SENA 1VF2A 4YAPA 2CX4A 2H76A 1TRWA 3D0ZA 1VF3A 3FZ9A 1EEJA 2HYXA 3UVHA 2DC5A 2ALBA 1XFLA 4GF0A 1XWCA 5J3RA 3KZQA 1FW1A 1B9XC 2YP6A 2IMIA 4KA0A 1M2AA 5EL8A 3I69A 2YZUA 1FO5A 2R37A 4HI7A 5IMDA 4LLRA 1FB6A 4MP4A 3VPQA 3TKSE 4PX1A 5B8AA 1PSQA 4J2FA 2O8VB 4WF5A 3O6TA 1RQMA 2JU5A 4D73B 2WZ9A 4K9ZA 2VCQA 2BMXA 4HEA2 4ID0A 2GT6A 3CRUA 4V2NA 3WYWA 1M99A 1ERTA 3O3TA 1Y6EA 4K7NA 5ECQB 1NM3A 4MH2A 3IBHA 1RW1A 4IBPA 2H74A 1WE0A 1LBKA 4D73A 4IJIA 5IMZA 2DJ2A 4ECIA 6GSWA 3GMFA 3L0HA 2N5BA 2VM2A 1BX9A 5JWOB 3KM6A 1UA5A 3ZFLA 3QOUA 1IYIA 3LGCA 4Q5QA 1J0FA 3KP9A 2PPTA 3A3TA 1Z6NA 2FHEA 3SBCA 4TKYA 3UIWA 4BWQA 1PX6A 5ECIB 1DE1A 3KH7A 1M0UA 1CQHA 1TRSA 2CQ9A 2TRCP 3UVTA 3GYKA 3GH6A 1J08A 1EOHA 3F6DA 2GZYA 3QAGA 1QMVA 3CXGA 3GRXA 2Z9SA 2GZPA 1TU8A 1TK5B 4MF5A 2RIIA 4V1Ap 3LSZA 2GVPA 1T00A 2YCDA 4F2IA 2RM5A 3DYRA 3I9V2 5G30A 1EGOA 2A2SA 1DE2A 3D4MA 2HI7A 4N10A 2R6KA 3RPPA 1ZYQB 5CRGA 2CT6A 1X9MB 5KN2A 5KN1A 1ON4A 3G7IA 3C8EA 1XWBA 5LD0A 5KN3A 1Z7PA 2JSZA 2X8HA 2RM6A 2L4QA 1GUMA 4V1Ag 5INYA 1GLQA 1F3BA 1XPVA 3PH9A 2DJ1A 1USBA 5G1KA 4NWYA 3HZ8A 3HD5A 4I8BA 2OE1A 1A0RP 19GSA 3HA9A 2HZFA 3TKSC 1KNGA 3FKFA 2GQLA 2L5OA 3GL3A 2IMKA 1UVZA 2ZNMA 3D22A 5IMFA 2F8FA 4AJ6A 3CSIA 4L5OA 2VO4A 1K0NA 2VLTA 1V98A 2JACA 3IAM2 4JZQA 1AQXA 2VCTA 1ERVA 4EE0A 2WS2A 3A5WA 3FZAA 3UAPA 2MMZA 2H6XA 2K8VA 4ZB6A 4QQ7A 3EU3A 1S3AA 2V6KA 1B8XA 5IIZA 3H93A 3GHAA 3C1RA 4AJ7A 5DCHA 3QAVA 4MLYA 4N11A 5HR0A 1PQNA 2EIQA 2KHPA 2IWTA 2J23A 2H0GA 3GN3A 2IFQB 1K0DA 4EVMA 1Z3EA 5AIVA 4I2UA 5CRDA 4NV2A 4XIHA 2DMLA 2LQOA 1U88A 2DJ3A 5CO3A 5G5FA 2IFQA 3KMOA 3DWVA 3VWUA 2WCIA 1N8JA 1SJ6A 3TUEA 1SK1A 1V58A 1XW6A 2DBCA 2BJXA 4N30A 5IMCA 2B5EA 3VURA 3ME7A 5HR3A 1SD8A 1E2YA 2KUCA 2CAQA 3HJOA 5JWQB 1Q98A 3HXSA 4K6XA 1VF1A 1FVJA 2CVKA 1AAZA 4POBA 3HY2A 2LV3A 4LL4B 4ZILA 4BVYA 2I1UA 4E8HA 3Q18A 4I2TA 1TTZA 2V32A 2L6DA 5DBQA 5ENUA 4PUAA 1XZOA 3EINA 1T4YA 2YV9A 4HJMA 5G1LA 2X8GA 3NZNA 3KJYA 3F6FA 2WFCA 3CSJA 3OR5A 4XHMA 1GULA 3IPZA 1AXDA 3D4TA 1XWAA 5F06A 2P5QA 2YJHA 2FWFA 1JZOA 3CYNA 3TJGA 10GSA 2J9HA 2L57A 5ID2B 1TI1A 5ECMB 2AAWA 3ZRDA 20GSA 2DJ0A 3HCZA 4E8EA 1TXXA 3IC4A 4PQIA 4F0CA 1XXUA 2OE3A 3F8UA 1SKRB 2IL3A 3EC3A 1XW5A 1UN2A 1ERWA 1WPIA 5C00A 2B1KA 1TDIA 1MD4A 4FYBA 2MBSA 3MSZA 5ELGA 1T8EB 3CTFA 1GSYA 1EP8A 2WDUA 1V57A 1X5DA 1ZYEA 1JFUA 5IO2A 1WIKA 2NVLA 3ZFBA 3PGTA 2L59A 2JZRA 2IIYA 4TR3A 2LNSA 1TP9A 2YANA 2B7KA 4EC0A 2QGVA 1Z6MA 3UOMA 1ERUA 4FIWA 1XWGA 5B7CA 1U6TA 3LJRA 3RDWA 1GWCA 4FO5A 1SKSB 2HZEA 1R7HA 5KEJA 2K18A 5JCUA 1V40A 22GSA 2G2QA 4IQAA 2L6CA 2OJLA 2I3YA 4ZB9A 2MMOA 5JWRB 2O85A 3U5RE 2LJAA 2N5AA 1PKWA 3WT2A 3AY8A 3ZYWA 1EOGA 1A8LA 5F05A 1M9AA 1SYRA 4JR6A 3JCML 1BAYA 4MPFA 1WP0A 4F9ZA 4CDOA 1THXA 3FY7A 1GL8A 2VCZA 4TW5A 1EGRA 1GNWA 1U3IA 2GZZA 3UEMA 3Q6OA 3DVXA 4IJ3A 4K0NA 13GSA 2YWOA 1MEKA 2ZUPA 3ISOA 3F4TA 2XPEA 1JZWA 4HQZA 1HNCA 4NXIA 1S3DA 4GXZA 2CA8A 1AW9A 1TOFA 4RQXA 17GSA 1LJRA 3MWHA 1JLVA 3IK9A 4L8EA 4G9HA 2C1YA 2OA7A 3DIEA 2XHFA 4HQSA 4GSNA 3CRTA 2IN3A 2A4VA 3M1GA 3TKRA 1B4QA 4PURA 1YZXA 1OE7A 2M46A 1SK0A 3ZTLA 4IELA 4ML1A 2OBKA 2YV7A 4HZ2A 3EVIA 1Z7RA 2HRNA 3GH9A 1SJIA 5D9WA 2LRNA 1XVQA 3DXBA 2YWIA 2NPBA 5J5NA 2PERA 4OWYA 4HOJA 5CREA 5A4UA 3DVWA 3VWVA 4GRFA 1IYHA 2PBJA 1TK0B 2KP2A 1QGVA 3MAKA 4WBJA 2LEGA 1A23A 3GX0A 3KEBA 4MZWA 3ZMLA 2DJJA 3L9SA 1FAAA 2M80A 4WEYA 3NOFA 2VLUA 4LL1B 1F37A 2FWHA 1GSUA 1GNEA 2H66A 1PGTA 2YWMA 1FHEA 5LCZA 2JADA 2MYGA 4OFTA 1M2BA 1A2LA 3A2WA 4KW6A 1M7TA 3G9BA 1ZZYA 4TR1B 2VCWA 3TOTA 3IK7A 5ECLB 3RHBA 3L9UA 4IN0A 4RQRA 5IOWA 4MA9A 2TRXA 1JZDA 4ML6A 1H75A 3W6GA 3HVSA 3IOSA 4HUAA 1FVKA 4OO4A 1X5EA 1YF1A 4TR1A 4KAEA 2GGTA 1KBNA 4YQMA 2IMDA 1XW9A 3QR6A 4PXOA 3BJ5A 1BJXA 1GTUA 1M9BA 1F3AA 1XOAA 2C0GA 4PQHA 4RUVA 1QK8A 3LYKA 1PA3A 2JSYA 1SK2A 4KCAA 3LEFA 1EV4A 4I5QA 4V2MA 3M8NA 2NBSA 5DCGA 2K9FA 4DVCA 1I5GA 5J9CA 1NHOA 4JEDA 2R4VA 2C80A 2VL3A 3TRQA 1UC7A 2WULA 2ES7A 1TKDB 3BOAA 1O8XA 1HYUA 2I4AA 2AUVA 4ZL9A 2HNLA 4FYCA 2QSIA 3K8NA 4O5RA 1M2DA 4K7IA 4HDEA 3HJPA 2HLSA 3GX8A 3IR4A 3F4SA 1NSWA 4OO5A 3TJJA 3TJFA 5A4VA 2H1DA 3M9JA 1F9MA 4LA1A 3VI5A 3V1WA 5DDLA 4F82A 4JE1A 3F4RA 1THOA 3H4KA 1X0RA 4POLA 2OADA 2F51A 4G2EA 2AB6A 2CAIA 4AGSA 2GTUA 1W89A 1AQWA 3RHCA 4QL9A 3P7XA 2B1LA 4XRAA 1GUKA 1SYXA 1LU4A 2DLXA 2AHEA 2VLVA 4L0UA 2VIMA 2YN1A 3CTGA 3ZLPA 2RLIA 3QCPA 4LMWA 3QFBC 4K7OA 1ZL9A 4K8MA 4DSRA 2C3TA 1U3AA 2H1GA 4PNFA 1OE8A 1BYEA 4ISDA 1AIUA 2H6YA 2PVOC 2I9HA 2C3NA 4CHSA 1SU9A 2L5LA 2CX3A 5B6MA 3FZ4A 2QC7A 3DKSA 4ULXA 1E6BA 2M72A 1G7OA 2LJRA 1GTAA 1OC9A 1PD21 5HFKA 1GRXA 1R5PA 4TXOB 3Q74A 11GSA 2K6VA 1EEMA 4DSQA 2H1AA 2MBTA 2H75A 3FR3A 2MZCA 1O85A 4XCSA 3I6AA 1GP1A 1VRSD 2E7PA 3GV1A 3UMAA 4TN8A 5G31A 4TXOA 1JHBA 1K0OA 2ON7A 1RK4A 2I81A 6GSUA 2ON5A 1K0BA 4YQVA 1ZMAA 3TGZA 5D9VA 2GSRA 3WT1A 3IV4A 2LKUA 1TRVA 3Q19A 1GTIA 2GT5A 1K0MA 2L4CA 2VCXA 2E0QA 1U87A 4POMA 4EDYA 4MMMA 3F3RA 3LXZA 2LS5A 3ZZXA 4ZL7A 3HJMA 16GSA 4EUYA 4AJ8A 12GSA 3GNJA 4I97A 4PNGA 3RBTA 4KH7A 3RAZA 4EDZA 3LORA 3I43A 4IGJA 3P8WA 1O7UA 1XCCA 2FA4A 2RUFA 4EF0A 3ERFA 1JLWA 2G0FA 1SL1B 1R5AA 4TOPA 3A2XA 1W4VA 2NDOA 1XIYA 5ECNB 1B48A 1GLPA 5D9TA 5CNWA 2FWGA 14GSA 3C1SA 5F0GA 5E4WA 2H1BA 3BBYA 2GDRA 3VLNA 3UBKA 4IQ1A 5CRHA 5H5RA 3F3QA 3ZITA 2GSSA 1ST9A 4EL1A 4BWSA 3WD6A 4X43A 3HYPA 5GSTA 4EKZA 1J9BA 3US3A 5B8BA 4QL7A 2O87A 1CQGA 1GH2A 1XOBA 2VUPA 5IPHA 2JZTA 1I9DA 4GSSA 2PMTA 3S9FA 3TJBA 2ZCTA 4ACSA 4IVFA 4K0GA 4ECCA 2H72A 5C04A 2DSAA 4KNDA 3UBLA 2VD0A 4DSSB 3L78A 5AIXA 2AYTA 5J9BA 4GLTA 1AQVA 2GSTA 4HU9A 4L5LA 2B3SA 5ECRB 2HZEB 1AUCA 3VWWA 4J57E 5IMVA 4WR5A 4G19A 5FT3A 4DSSA 3HZ4A 4PQ1A 1NHYA 4XS1A 4WETA 4POKA 1EZKA 2YZHA 2MMNA 1PL2A 4XS4B 3TJKA 1K0AA 1A24A 2GS3A 3A2VA 1HD2A 2FUG2 5D73A 1GSQA 1GTBA 2YOIA 3GFKA 5HFIA 2FY6A 2IMEA 2VL9A 2C0DA 1URMA 1C72A 1PRXA 3P2AA 3TDGA 3M3MA 2YNXA 3GSSA 4XS4A 3APQA 4Q5FA 3J7Yk 3E0UA 5DQYA 1T3BA 2O89A 4OCFA 4H86A 5DJMA 8GSSA 4KDUA 5E59A 5ABRA 3EMPA 1Z9HA 2PU9C 7GSSA 5IMAA 1G6WA 4NV5A 3GKKA 4OFNA 1B4PA 4TRXA 1SJZA 2OE0A 5J41A 2CVDA 1K3OA 3EURA 1GSSA 1SKWB 2AV4A 4MJAA 4ECJA 2XBQA 4O32A 3C7MA 2C8UA 1OC8A 4ZIJA 3HDCA 2HFDA 4MJBA 3QD9A 2H8LA 5IO0A 2YPMA 3FHKA 5ELAA 4LMVA 2DJKA 3MNGA 6GSVA 3DD3A 2PGTA 3ZL5A 3TB2A 1DBYA 2YJ7A 1KEBA 1TRUA 1WWJA 4O92A 2IMFA 3EYTA 2D2ZA 3TOUA 2LRTA 5EY6A 2PVQA 2LQQA 4NPBA 4NAXA 5GSSA 2WJUA 3FZ5A 4WR4A 2H71A 3FEUA 2LNTA 3RPNA 5EPFA 3F0IA 2LTKA 2BTOT 5IQYA 1R4WA 1EP7A 3GKMA 4ZBDA 3M0FA 2H0IA 3FK8A 2FLSA 3KTBA 3G7YA 4KX4A 4BVXA 3KD0A 5GZZB 4ZBAA 3L4NA 1EV9A 5D9XA 3D6IA 1HQOA 3FRCA 4XS6A 5D93A 1WRYA 3TCOA 3UL3A 1PKZA 5DVBA 3GKNA 4BPYA 2HSYA 3U6VA 1O73A 1AC1A 2FNOA 4BL7A 3EU4A 4N0ZA 2R3XA 4EXJA 2VCVA 6GSXA 3IRAA 2VM1A 1HNBA 4JRRA 1WJKA 3TRPA 3EMXA 3GUSA 1A8YA 2V1MA 4F0BA 2H01A 3H1NA 2H0HA 4N0VA 5JCGA 3N5OA 1TJDA 4F03A 3G7JA 5HQPA 4XRDA 3BCKA 2E2MA 1JZRA 1ZCPA 2H73A 3C73A 3KCMA 2P0GA 4I6XA 3VK9A 4WXTA 2K8SA 4GCIA 2FD3A 2LUSA 5G5EA 3KMNA 2EC4A 2V41A 5IOXA 3ZREA 1HNAA 2CZ3A 3PINA 3E9JB 4PGTA 4ZL8A 1GSEA 1OYJA 4TXVA 3F63A 2B5YA 3GL5A 3ZMKA 3J7Yb 5FWGA 1TI3A 2B7JA 2H30A 4YQUA 3APOA 2MMAA 2C0EA 5A5KA 5HFGA 5DJLA 1BEDA 4MPGA 3E3EA 3GKXA 1DSBA 3ED3A 2IJYA 3MDKA 3UARA 4IHUA 6GSSA 2H19A 1V2AA 4G10A 3O76A 4RI6A 2KOKA 2VAFA 1SD9A 1VGLA 2H6ZA 5F07A 2FWEA 4KUNA 4YH2A 2DIYA 3DGQA 4NHWA 4IP6A 4HZ4A 1OAZA 3ZIJA 2OBIA 1BG5A 3H79A 4TVEA 4KGIA 1T7PB 4V2LA 5J4UA 2JZSA 1VF4A 2X64A 4OD7A 2FA8A 5G2ZA 5LNKe 5CAXA 5AISA 2VOCA 4EO3A 1ZGNA 2DMMA 3PR8A 3LWAA 3WGDA 4KDYA 1OC9B 3ZIVA 2EIRA 3FR9A 2F8AA 3C71A 3W8SA 3VI7A 3BCIA 1XWKA 1WOUA 4K2DA 1KTEA 3FR6A 5HR1A 1MD3A 3ZVJD 1YEXA 2X8CA 1FB0A 3KP8A 3QFAC 2FCHA 2KLXA 3SWLA 2HXKA 3BD2A 2V6OA 1GUHA 2TIRA 5DQSA 5FHIA 5GAPD 4Q5RA 2O7KA 2C3QA 2GLRA 4FH8A 2R5GA 4WF4A 2B5XA 1YJ6A 1A0FA 5JCWA 1QFNA 1X5CA 4IP1A 4XTSA 1PX7A 4MJCA 1QQ2A 1Y25A 3FYGA 3IAS2 2HT9A 3QMXA 2REMA 1NW2A 1G7EA 5HR2A 3CMIA 1S3CA 3IA1A 4MCUA 18GSA 3ERGA 2LRCA 2LJKA 2CZ2A 4K1FA 2HSHA 1XVWA 2H70A 3TKQA 2XPDA 2IPAA 3TKSA 4KB3A 1O8WA 2CV4A 2HE3A 4MABA 3VFIA 2OKAA 4L0WA 1YDKA 1YKAA 1MTCA 1F6MC 3GURA 4X1UA 1PL1A 5CYYA 3ERWA 4MDCA 5EVOA 3LG6A 2E2GA 1GSFA 4DEJA 4JBBA 3FW2A 1K0CA 1SL2B 5ECHB 1N2AA 3KXOA 2CVBA 2NTOA 1TW9A 3HKRA 4MZBA 3VWXA 2X99A 1OKTA 3HVXA 5H5QA 4MF7A 5IM9A 2B6MA 1QXHA 1PN9A 3LQ7A 3ME8A 3APSA 3R2QA 1PMTA 5ECKB 2JL4A 2PN8A 2GQMA 1FOVA 5ECSA 5B6NA 2WRTA 1G0TA 1YQ1A 1T4ZA 1EWXA 5ECPB 4JU5A 1ACVA 4HJ2A 1MDIA 3EWLA 4MK3A 1MDJA 4Z7XA 1YEPA
chains in the Genus database with same CATH superfamily
2HRFA 4GWRA 2VL2C 5D8IA 3KH9A 1ILOA 3WGEA 5H5SA 2R2JA 3N9JA 4OFMA 5A4WA 1R26A 2FGXA 1YF0A 2V2GA 4FYUA 4GQCA 1BQ7A 3WGXA 1G6YA 3D21A 2QKEA 4WKWA 1WMJA 2WGRA 3GA4A 2OACA 3LYPA 3HVVA 4IKHA 4YAVA 4GSTA 5ID2A 1YY7A 1FG4A 4KSMA 4GTUA 2RUEA 3DRNA 1K3LA 1OVNA 5F8BA 4WBRD 1O81A 4MZCA 2GQKA 3IXRA 3LFLA 1TK8B 1K3YA 1YKCA 3NIVA 1F2EA 2PWJA 3QDNA 2N5FA 4ZXGA 2GSQA 4Q5NA 4HS1A 1SL0B 2F3MA 4IW9A 4AF2A 2P5RA 4KSOA 4KCEA 5CRWA 4KE3A 4J56E 4O5UA 2VL2A 6GSYA 2A2RA 3CSHA 2DIZA 5COHA 3IDVA 1O6JA 4CW9A 3KGKA 3KIJA 3EE2A 5AGYA 1H4OA 4ZB8A 1OKDA 3HHVA 3L9VA 4TR0A 1OC3A 1MDKA 2PUKC 3LXTA 2XBIA 3ZVJA 4IS0A 1ABAA 1XBSA 1QUWA 3QAWA 3QPMA 9GSSA 4TR4A 5IPGA 2P31A 5DAKB 5D96A 2KP1A 3GSTA 4MH3A 4O7HA 1Q4JA 3CBUA 3IE3A 2C0FA 2LSTA 4MJEA 4MF6A 5DALB 3TKPA 5ECOB 4NHZA 3M9KA 3GTUB 3DMLA 4Z2TA 5AN1A 5L71A 1TU7A 2WB9A 4X0XA 1V9WA 1A2JA 4RI7A 2AJQB 5GAND 4P3YB 5DAKA 2C4JA 2YWNA 3H8QA 1ZOFA 3VPTA 3P90A 4ZBBA 3KTLA 4PUFC 1X9WB 3TRXA 5DALA 1A2MA 4ILFA 3GTUA 1ML6A 2EIOA 5KN0A 3DEXA 1B9YC 6GSTA 3D5JA 3W8JA 2R0PA 2XC2A 2F9SA 4BA7A 4NMUA 1DUGA 5CP1A 4OCEA 1Z5YE 4YKGA 4ECBA 4GQFA 3UJ1A 2VD1A 3F9UA 4KDXA 4BVXB 3IHQA 3GIXA 4HU7A 1GSDA 4OMVA 1X9SB 1T1VA 4JR4A 1SENA 1VF2A 4YAPA 2CX4A 2H76A 1TRWA 3D0ZA 1VF3A 3FZ9A 1EEJA 2HYXA 4PTSA 3UVHA 2DC5A 2ALBA 1XFLA 4GF0A 1XWCA 5J3RA 3KZQA 1FW1A 1B9XC 2YP6A 2IMIA 4KA0A 1M2AA 5EL8A 3I69A 2YZUA 1FO5A 2R37A 4HI7A 5IMDA 4LLRA 1FB6A 4MP4A 3VPQA 3TKSE 4PX1A 5B8AA 1PSQA 4J2FA 2O8VB 4WF5A 3O6TA 1RQMA 1PN0A 2JU5A 4D73B 2WZ9A 4K9ZA 2VCQA 2BMXA 4HEA2 4ID0A 2GT6A 3CRUA 4V2NA 3WYWA 1M99A 1ERTA 3O3TA 1Y6EA 4K7NA 5ECQB 1NM3A 4MH2A 3IBHA 1RW1A 4IBPA 2H74A 1WE0A 1LBKA 4D73A 2HRAA 4IJIA 4EIQA 5IMZA 2DJ2A 4ECIA 6GSWA 3GMFA 3L0HA 2N5BA 2VM2A 1BX9A 5JWOB 3KM6A 1UA5A 3ZFLA 3QOUA 1IYIA 3LGCA 4Q5QA 1J0FA 3KP9A 2PPTA 3A3TA 1Z6NA 2FHEA 3SBCA 4TKYA 3UIWA 4BWQA 1PX6A 5ECIB 1DE1A 3KH7A 1M0UA 1CQHA 1TRSA 2CQ9A 2TRCP 3UVTA 3GYKA 3GH6A 1J08A 1EOHA 3F6DA 2GZYA 3QAGA 1QMVA 3CXGA 3GRXA 2Z9SA 2UZ8A 2GZPA 1TU8A 1TK5B 4MF5A 2RIIA 3MYDA 4V1Ap 3LSZA 2GVPA 1T00A 2YCDA 4F2IA 2RM5A 3DYRA 3I9V2 5G30A 1EGOA 2A2SA 1DE2A 3D4MA 2HI7A 4N10A 2R6KA 3RPPA 1ZYQB 5CRGA 2CT6A 1X9MB 5KN2A 5KN1A 1ON4A 3G7IA 3C8EA 1XWBA 5LD0A 5KN3A 1Z7PA 2JSZA 2X8HA 2RM6A 2L4QA 1GUMA 4V1Ag 5INYA 1GLQA 1F3BA 1XPVA 3PH9A 2DJ1A 1USBA 5G1KA 4NWYA 3HZ8A 3HD5A 4I8BA 2OE1A 1A0RP 19GSA 3HA9A 2HZFA 3TKSC 1KNGA 3FKFA 2GQLA 2L5OA 3GL3A 2IMKA 1UVZA 2ZNMA 3D22A 5IMFA 2F8FA 4AJ6A 3CSIA 4L5OA 2VO4A 1K0NA 2VLTA 1V98A 2JACA 3IAM2 4JZQA 1AQXA 2VCTA 1ERVA 4EE0A 2WS2A 3A5WA 3FZAA 3UAPA 2MMZA 2H6XA 4BIKA 2K8VA 4ZB6A 1ZYNA 4QQ7A 4EIPA 3EU3A 1S3AA 2V6KA 4USSA 1B8XA 5IIZA 3H93A 3GHAA 3C1RA 4AJ7A 5DCHA 3QAVA 4MLYA 4N11A 5HR0A 1PQNA 2EIQA 2KHPA 2IWTA 2J23A 2H0GA 3GN3A 2IFQB 1K0DA 4EVMA 1Z3EA 5AIVA 4I2UA 5CRDA 4NV2A 4XIHA 2DMLA 2LQOA 1U88A 2DJ3A 5CO3A 5G5FA 2IFQA 3KMOA 3DWVA 3VWUA 2WCIA 1N8JA 1SJ6A 3TUEA 5BRTA 1SK1A 1V58A 1XW6A 2DBCA 2BJXA 4N30A 5IMCA 4BVYB 2B5EA 3VURA 3ME7A 5HR3A 1SD8A 1E2YA 2KUCA 2CAQA 3HJOA 5JWQB 1Q98A 3HXSA 4K6XA 1VF1A 1FVJA 2CVKA 1AAZA 4POBA 3HY2A 2LV3A 4LL4B 4ZILA 4BVYA 2I1UA 4G0IA 4E8HA 3Q18A 4I2TA 1TTZA 2V32A 2L6DA 5DBQA 5ENUA 4PUAA 1XZOA 3EINA 1T4YA 2YV9A 4HJMA 1M3JA 5G1LA 2X8GA 3NZNA 3KJYA 3F6FA 2WFCA 4CY8A 3CSJA 3OR5A 4XHMA 1GULA 3IPZA 1AXDA 3D4TA 1XWAA 5F06A 2P5QA 2YJHA 2FWFA 1JZOA 3CYNA 3TJGA 10GSA 2J9HA 2L57A 5ID2B 1TI1A 5ECMB 2AAWA 3ZRDA 20GSA 2DJ0A 3HCZA 4G0LA 4E8EA 1TXXA 3IC4A 4PQIA 4F0CA 1XXUA 2OE3A 3F8UA 1SKRB 2IL3A 3EC3A 2HRKA 1XW5A 1UN2A 1ERWA 1WPIA 5C00A 2B1KA 1TDIA 1MD4A 4FYBA 2MBSA 4A5PA 3MSZA 5ELGA 1T8EB 3CTFA 1GSYA 1EP8A 2WDUA 1V57A 1X5DA 1ZYEA 1JFUA 5IO2A 1WIKA 2NVLA 3ZFBA 3PGTA 4Z2RA 2L59A 2JZRA 2IIYA 4TR3A 2LNSA 1TP9A 2YANA 2B7KA 4EC0A 2QGVA 1Z6MA 2A4HA 3UOMA 1ERUA 4FIWA 4G0KA 1XWGA 5B7CA 1U6TA 3LJRA 3RDWA 1GWCA 4FO5A 1SKSB 2HZEA 1R7HA 5KEJA 2K18A 5JCUA 1V40A 22GSA 2G2QA 4IQAA 2L6CA 2OJLA 2I3YA 4ZB9A 2MMOA 5JWRB 2O85A 3U5RE 2LJAA 2N5AA 1PKWA 3WT2A 3AY8A 3ZYWA 2DKIA 1EOGA 1A8LA 5F05A 1M9AA 1SYRA 4JR6A 3JCML 1BAYA 4MPFA 1WP0A 4F9ZA 4CDOA 1THXA 3FY7A 1GL8A 2VCZA 4TW5A 1EGRA 1GNWA 1U3IA 2DKHA 2GZZA 3UEMA 3Q6OA 3DVXA 4IJ3A 4K0NA 13GSA 2YWOA 1MEKA 2ZUPA 3ISOA 3F4TA 2XPEA 1JZWA 4HQZA 1HNCA 4NXIA 1S3DA 4GXZA 2CA8A 1AW9A 1TOFA 4RQXA 17GSA 1LJRA 3MWHA 1JLVA 3IK9A 4L8EA 4G9HA 2C1YA 2OA7A 3DIEA 2XHFA 4HQSA 4GSNA 3CRTA 2IN3A 2A4VA 3M1GA 3TKRA 1B4QA 4PURA 1YZXA 1OE7A 2M46A 1SK0A 3ZTLA 4IELA 4ML1A 2OBKA 2YV7A 4HZ2A 3EVIA 1Z7RA 2HRNA 3GH9A 1SJIA 5D9WA 2LRNA 1XVQA 3DXBA 1FOHA 2YWIA 2NPBA 5J5NA 2PERA 4OWYA 4HOJA 5CREA 5A4UA 3DVWA 3VWVA 4GRFA 1IYHA 2PBJA 1TK0B 2KP2A 1QGVA 3MAKA 4WBJA 2LEGA 1A23A 3GX0A 3KEBA 4MZWA 3ZMLA 2DJJA 3L9SA 1FAAA 2A2PA 2M80A 4WEYA 3NOFA 2VLUA 4LL1B 1F37A 2FWHA 1GSUA 1GNEA 2H66A 1PGTA 2YWMA 1FHEA 5LCZA 2JADA 2MYGA 4OFTA 1M2BA 1A2LA 3A2WA 4KW6A 1M7TA 3G9BA 1ZZYA 4TR1B 4K5RA 2VCWA 3TOTA 3IK7A 5ECLB 3RHBA 3L9UA 4IN0A 4RQRA 5IOWA 4MA9A 2TRXA 1JZDA 4ML6A 1H75A 3W6GA 3HVSA 3IOSA 4HUAA 1FVKA 4OO4A 4Z2UA 1X5EA 1YF1A 4TR1A 4KAEA 2GGTA 1KBNA 4YQMA 2IMDA 1XW9A 3QR6A 4PXOA 3BJ5A 1BJXA 1GTUA 1M9BA 1F3AA 1XOAA 2C0GA 4PQHA 4RUVA 1QK8A 3LYKA 1PA3A 2JSYA 1SK2A 4KCAA 3LEFA 1EV4A 4I5QA 4V2MA 3M8NA 2NBSA 5DCGA 2K9FA 4DVCA 1I5GA 5J9CA 1NHOA 4JEDA 2R4VA 2C80A 2VL3A 3TRQA 1UC7A 2WULA 2ES7A 1TKDB 3BOAA 3IHGA 1PFOA 1O8XA 1HYUA 2I4AA 2AUVA 4ZL9A 2HNLA 4FYCA 2QSIA 3K8NA 4O5RA 1M2DA 4K7IA 4HDEA 3HJPA 3EPTA 2HLSA 3GX8A 3IR4A 3F4SA 3IC8A 1NSWA 4OO5A 1XG8A 3TJJA 3TJFA 5A4VA 2H1DA 3M9JA 1F9MA 4LA1A 3VI5A 3V1WA 5DDLA 4F82A 4JE1A 3F4RA 1THOA 3H4KA 1X0RA 4POLA 2OADA 2F51A 4G2EA 2AB6A 2CAIA 4AGSA 2GTUA 1W89A 1AQWA 3RHCA 4QL9A 3P7XA 2B1LA 4XRAA 1GUKA 1SYXA 1LU4A 2DLXA 2AHEA 2VLVA 4L0UA 2VIMA 2YN1A 3CTGA 3ZLPA 2RLIA 3QCPA 4LMWA 3QFBC 4K7OA 1ZL9A 4K8MA 1M3IA 4DSRA 4K5SA 2C3TA 1U3AA 2H1GA 4PNFA 1OE8A 1BYEA 4ISDA 1AIUA 2H6YA 2PVOC 2I9HA 2C3NA 4CHSA 1SU9A 2L5LA 5BMUA 2CX3A 5B6MA 3FZ4A 2QC7A 4YKFA 3DKSA 4ULXA 1E6BA 2M72A 1G7OA 2LJRA 1GTAA 1OC9A 1PD21 5HFKA 1GRXA 1R5PA 4TXOB 3Q74A 11GSA 2K6VA 2R0GA 1EEMA 4DSQA 1ZYPA 2H1AA 2MBTA 2H75A 3FR3A 2MZCA 1O85A 4XCSA 3I6AA 1GP1A 1VRSD 2E7PA 3GV1A 3UMAA 4TN8A 5G31A 4TXOA 1JHBA 1K0OA 2ON7A 1RK4A 2I81A 6GSUA 2ON5A 1K0BA 4YQVA 1ZMAA 3TGZA 5D9VA 2GSRA 3WT1A 3IV4A 2LKUA 1TRVA 3Q19A 1GTIA 2GT5A 1K0MA 2L4CA 2VCXA 2E0QA 1U87A 4POMA 4EDYA 4MMMA 3F3RA 3LXZA 2LS5A 3ZZXA 4ZL7A 3HJMA 16GSA 4EUYA 4AJ8A 12GSA 3GNJA 4I97A 3A5IA 4PNGA 3RBTA 4KH7A 3RAZA 4EDZA 3LORA 3I43A 4IGJA 3P8WA 1O7UA 1XCCA 2FA4A 2RUFA 4FQUA 4EF0A 3ERFA 1JLWA 2G0FA 1SL1B 1R5AA 4TOPA 3A2XA 1W4VA 2NDOA 1XIYA 5ECNB 1B48A 1GLPA 5D9TA 5CNWA 2FWGA 14GSA 3C1SA 5F0GA 5E4WA 2H1BA 3BBYA 2GDRA 3VLNA 3UBKA 4IQ1A 5CRHA 5H5RA 3F3QA 3ZITA 2GSSA 1ST9A 4EL1A 4BWSA 3WD6A 4X43A 3HYPA 5GSTA 4EKZA 1J9BA 3US3A 5B8BA 3R3EA 4QL7A 2O87A 1CQGA 1GH2A 3MIXA 1XOBA 2VUPA 5IPHA 2JZTA 1I9DA 4GSSA 2PMTA 3S9FA 4CY6A 3TJBA 2ZCTA 4ACSA 4IVFA 4K0GA 4ECCA 2H72A 5C04A 2DSAA 4KNDA 3UBLA 2VD0A 4DSSB 3L78A 5AIXA 2AYTA 2QA1A 5J9BA 4GLTA 1AQVA 2GSTA 4HU9A 4L5LA 2B3SA 5ECRB 2HZEB 1AUCA 3VWWA 4J57E 5IMVA 4WR5A 4G19A 5FT3A 4DSSA 3HZ4A 4PQ1A 1NHYA 4XS1A 4WETA 4POKA 1EZKA 2YZHA 2MMNA 1PL2A 4XS4B 3TJKA 1K0AA 1A24A 2GS3A 3A2VA 1HD2A 2FUG2 3HVNA 5D73A 1GSQA 1GTBA 2YOIA 3GFKA 5HFIA 2FY6A 2IMEA 2VL9A 2C0DA 1URMA 1C72A 1PRXA 3P2AA 3TDGA 3M3MA 2YNXA 3GSSA 4XS4A 3APQA 4Q5FA 3J7Yk 3E0UA 5DQYA 1T3BA 2O89A 4OCFA 4H86A 5DJMA 8GSSA 4KDUA 5E59A 5ABRA 3EMPA 1Z9HA 2PU9C 7GSSA 5IMAA 1G6WA 4NV5A 3GKKA 4OFNA 1B4PA 4TRXA 1SJZA 2OE0A 5J41A 2CVDA 1K3OA 3EURA 1GSSA 1SKWB 2AV4A 4MJAA 4ECJA 4MNNA 2XBQA 4O32A 3C7MA 2C8UA 1OC8A 4ZIJA 3HDCA 2HFDA 4MJBA 3QD9A 2H8LA 5IO0A 2YPMA 3FHKA 5ELAA 4LMVA 2DJKA 3MNGA 6GSVA 3DD3A 2PGTA 3ZL5A 3TB2A 1DBYA 2YJ7A 1KEBA 1TRUA 1WWJA 4O92A 2IMFA 3EYTA 2D2ZA 3TOUA 2LRTA 5EY6A 2PVQA 2LQQA 4NPBA 4NAXA 5GSSA 2WJUA 3FZ5A 4WR4A 2H71A 3FEUA 2LNTA 3RPNA 5EPFA 3F0IA 2LTKA 2BTOT 5IQYA 1R4WA 1EP7A 3GKMA 4ZBDA 3M0FA 2H0IA 3FK8A 2FLSA 3KTBA 3G7YA 4KX4A 4BVXA 3KD0A 5GZZB 4ZBAA 3L4NA 4BL7B 1EV9A 5D9XA 3D6IA 1HQOA 3FRCA 4XS6A 5D93A 1WRYA 3TCOA 3UL3A 1PKZA 2X4AA 5DVBA 3GKNA 4BPYA 2HSYA 3U6VA 1O73A 1AC1A 2FNOA 4BL7A 3EU4A 4N0ZA 2R3XA 4EXJA 2VCVA 6GSXA 3IRAA 2VM1A 1HNBA 4JRRA 1WJKA 3TRPA 3EMXA 3GUSA 1A8YA 3CQFA 2V1MA 4F0BA 2H01A 3H1NA 2H0HA 4N0VA 5JCGA 3N5OA 1TJDA 4F03A 3G7JA 5HQPA 4XRDA 3BCKA 2E2MA 1JZRA 1ZCPA 3PPUA 2H73A 3C73A 3KCMA 4KF9A 2P0GA 3FMWA 4I6XA 3VK9A 4WXTA 2K8SA 4GCIA 2FD3A 2LUSA 5G5EA 3KMNA 2EC4A 2QA2A 2V41A 5IOXA 3ZREA 1HNAA 2CZ3A 3PINA 3E9JB 4PGTA 4ZL8A 3LW9A 1GSEA 1OYJA 4TXVA 3F63A 2B5YA 3GL5A 3ZMKA 3J7Yb 5FWGA 1TI3A 2B7JA 2H30A 4YQUA 3APOA 2MMAA 2C0EA 5A5KA 5HFGA 5DJLA 1BEDA 4MPGA 3E3EA 3GKXA 1DSBA 3ED3A 2IJYA 3MDKA 3UARA 4IHUA 6GSSA 2H19A 1V2AA 4G10A 3O76A 4RI6A 2KOKA 2VAFA 1SD9A 1VGLA 2H6ZA 5F07A 2FWEA 4KUNA 4YH2A 2DIYA 3DGQA 4NHWA 4IP6A 4HZ4A 4O5QA 1OAZA 3ZIJA 2OBIA 1BG5A 3H79A 5KOXA 4TVEA 4KGIA 1T7PB 4V2LA 5J4UA 2JZSA 1VF4A 4ICYA 2X64A 4OD7A 2FA8A 5G2ZA 5LNKe 5CAXA 5AISA 2HSMA 2VOCA 4EO3A 1ZGNA 2DMMA 3PR8A 3LWAA 3WGDA 4KDYA 1OC9B 3ZIVA 2EIRA 3FR9A 2F8AA 3C71A 3W8SA 3VI7A 3BCIA 1XWKA 1WOUA 4K2DA 1KTEA 3FR6A 5HR1A 1MD3A 3ZVJD 1YEXA 2X8CA 1FB0A 3KP8A 3QFAC 2FCHA 2KLXA 2R0CA 3SWLA 4X4JA 2HXKA 3BD2A 2V6OA 1GUHA 2TIRA 5DQSA 5FHIA 5GAPD 4Q5RA 2O7KA 2C3QA 2GLRA 4FH8A 2R5GA 4WF4A 2B5XA 1YJ6A 1A0FA 2X49A 5JCWA 1QFNA 1X5CA 4IP1A 4XTSA 1PX7A 4MJCA 1QQ2A 1Y25A 3FYGA 3IAS2 2HT9A 3QMXA 4K2XA 2REMA 1NW2A 1G7EA 5HR2A 3CMIA 1S3CA 3IA1A 4MCUA 18GSA 3ERGA 2LRCA 2LJKA 2CZ2A 4K1FA 2HSHA 1XVWA 2H70A 3TKQA 2XPDA 2IPAA 3TKSA 4KB3A 1O8WA 2CV4A 2HE3A 4MABA 3VFIA 2OKAA 4L0WA 1YDKA 1YKAA 1MTCA 1F6MC 3GURA 4X1UA 1PL1A 5CYYA 3ERWA 4MDCA 5EVOA 3LG6A 2E2GA 1GSFA 4DEJA 4JBBA 3FW2A 1K0CA 1SL2B 5ECHB 1N2AA 3KXOA 2CVBA 2NTOA 1TW9A 3HKRA 4MZBA 1S3RA 3VWXA 2X99A 1OKTA 3HVXA 5KOWA 5H5QA 4MF7A 5IM9A 2B6MA 1QXHA 1PN9A 3LQ7A 3ME8A 3APSA 3R2QA 1PMTA 5ECKB 2JL4A 2PN8A 2GQMA 1FOVA 5ECSA 5B6NA 2WRTA 4HSCX 1G0TA 1YQ1A 1T4ZA 1EWXA 5ECPB 4JU5A 1ACVA 4HJ2A 1MDIA 3EWLA 4MK3A 1MDJA 4Z7XA 1YEPA
chains in the Genus database with same CATH topology
2HRFA 4GWRA 2VL2C 5D8IA 3KH9A 1ILOA 3WGEA 5H5SA 2R2JA 3N9JA 4OFMA 5A4WA 1R26A 2FGXA 1YF0A 2V2GA 4FYUA 4GQCA 1BQ7A 3WGXA 1G6YA 3D21A 2QKEA 4WKWA 1WMJA 2WGRA 3GA4A 2OACA 3LYPA 3HVVA 4IKHA 4YAVA 4GSTA 5ID2A 1YY7A 1FG4A 4KSMA 4GTUA 2RUEA 3DRNA 1K3LA 1OVNA 5F8BA 4WBRD 1O81A 4MZCA 2GQKA 3IXRA 3LFLA 1TK8B 1K3YA 1YKCA 3NIVA 1F2EA 2PWJA 3QDNA 2N5FA 4ZXGA 2GSQA 4Q5NA 4HS1A 1SL0B 2F3MA 4IW9A 4AF2A 2P5RA 4KSOA 4KCEA 5CRWA 4KE3A 4J56E 4O5UA 2VL2A 6GSYA 2A2RA 3CSHA 2DIZA 5COHA 3IDVA 1O6JA 4CW9A 3KGKA 3KIJA 3EE2A 5AGYA 1H4OA 4ZB8A 1OKDA 3HHVA 3L9VA 4TR0A 1OC3A 1MDKA 2PUKC 3LXTA 2XBIA 3ZVJA 4IS0A 1ABAA 1XBSA 1QUWA 3QAWA 3QPMA 9GSSA 4TR4A 5IPGA 2P31A 5DAKB 5D96A 2KP1A 3GSTA 4MH3A 4O7HA 1Q4JA 3CBUA 3IE3A 2C0FA 2LSTA 4MJEA 4MF6A 5DALB 3TKPA 5ECOB 4NHZA 3M9KA 3GTUB 3DMLA 4Z2TA 5AN1A 5L71A 1TU7A 2WB9A 4X0XA 1V9WA 1A2JA 4RI7A 2AJQB 5GAND 4P3YB 5DAKA 2C4JA 2YWNA 3H8QA 1ZOFA 3VPTA 3P90A 4ZBBA 3KTLA 4PUFC 1X9WB 3TRXA 5DALA 1A2MA 4ILFA 3GTUA 1ML6A 2EIOA 5KN0A 3DEXA 1B9YC 6GSTA 3D5JA 3W8JA 2R0PA 2XC2A 2F9SA 4BA7A 4NMUA 1DUGA 5CP1A 4OCEA 1Z5YE 4YKGA 4ECBA 4GQFA 3UJ1A 2VD1A 3F9UA 4KDXA 4BVXB 3IHQA 3GIXA 4HU7A 1GSDA 4OMVA 1X9SB 1T1VA 4JR4A 1SENA 1VF2A 4YAPA 2CX4A 2H76A 1TRWA 3D0ZA 1VF3A 3FZ9A 1EEJA 2HYXA 4PTSA 3UVHA 2DC5A 2ALBA 1XFLA 4GF0A 1XWCA 5J3RA 3KZQA 1FW1A 1B9XC 2YP6A 2IMIA 4KA0A 1M2AA 5EL8A 3I69A 2YZUA 1FO5A 2R37A 4HI7A 5IMDA 4LLRA 1FB6A 4MP4A 3VPQA 3TKSE 4PX1A 5B8AA 1PSQA 4J2FA 2O8VB 4WF5A 3O6TA 1RQMA 1PN0A 2JU5A 4D73B 2WZ9A 4K9ZA 2VCQA 2BMXA 4HEA2 4ID0A 2GT6A 3CRUA 4V2NA 3WYWA 1M99A 1ERTA 3O3TA 1Y6EA 4K7NA 5ECQB 1NM3A 4MH2A 3IBHA 1RW1A 4IBPA 2H74A 1WE0A 1LBKA 4D73A 2HRAA 4IJIA 4EIQA 5IMZA 2DJ2A 4ECIA 6GSWA 3GMFA 3L0HA 2N5BA 2VM2A 1BX9A 5JWOB 3KM6A 1UA5A 3ZFLA 3QOUA 1IYIA 3LGCA 4Q5QA 1J0FA 3KP9A 2PPTA 3A3TA 1Z6NA 2FHEA 3SBCA 4TKYA 3UIWA 4BWQA 1PX6A 5ECIB 1DE1A 3KH7A 1M0UA 1CQHA 1TRSA 2CQ9A 2TRCP 3UVTA 3GYKA 3GH6A 1J08A 1EOHA 3F6DA 2GZYA 3QAGA 1QMVA 3CXGA 3GRXA 2Z9SA 2UZ8A 2GZPA 1TU8A 1TK5B 4MF5A 2RIIA 3MYDA 4V1Ap 3LSZA 2GVPA 1T00A 2YCDA 4F2IA 2RM5A 3DYRA 3I9V2 5G30A 1EGOA 2A2SA 1DE2A 3D4MA 2HI7A 4N10A 2R6KA 3RPPA 1ZYQB 5CRGA 2CT6A 1X9MB 5KN2A 5KN1A 1ON4A 3G7IA 3C8EA 1XWBA 5LD0A 5KN3A 1Z7PA 2JSZA 2X8HA 2RM6A 2L4QA 1GUMA 4V1Ag 5INYA 1GLQA 1F3BA 1XPVA 3PH9A 2DJ1A 1USBA 5G1KA 4NWYA 3HZ8A 3HD5A 4I8BA 2OE1A 1A0RP 19GSA 3HA9A 2HZFA 3TKSC 1KNGA 3FKFA 2GQLA 2L5OA 3GL3A 2IMKA 1UVZA 2ZNMA 3D22A 5IMFA 2F8FA 4AJ6A 3CSIA 4L5OA 2VO4A 1K0NA 2VLTA 1V98A 2JACA 3IAM2 4JZQA 1AQXA 2VCTA 1ERVA 4EE0A 2WS2A 3A5WA 3FZAA 3UAPA 2MMZA 2H6XA 2K8VA 4ZB6A 1ZYNA 4QQ7A 4EIPA 3EU3A 1S3AA 2V6KA 4USSA 1B8XA 5IIZA 3H93A 3GHAA 3C1RA 4AJ7A 5DCHA 3QAVA 4MLYA 4N11A 5HR0A 1PQNA 2EIQA 2KHPA 2IWTA 2J23A 2H0GA 3GN3A 2IFQB 1K0DA 4EVMA 1Z3EA 5AIVA 4I2UA 5CRDA 4NV2A 4XIHA 2DMLA 2LQOA 1U88A 2DJ3A 5CO3A 5G5FA 2IFQA 3KMOA 3DWVA 3VWUA 2WCIA 1N8JA 1SJ6A 3TUEA 5BRTA 1SK1A 1V58A 1XW6A 2DBCA 2BJXA 4N30A 5IMCA 4BVYB 2B5EA 3VURA 3ME7A 5HR3A 1SD8A 1E2YA 2KUCA 2CAQA 3HJOA 5JWQB 1Q98A 3HXSA 4K6XA 1VF1A 1FVJA 2CVKA 1AAZA 4POBA 3HY2A 2LV3A 4LL4B 4ZILA 4BVYA 2I1UA 4G0IA 4E8HA 3Q18A 4I2TA 1TTZA 2V32A 2L6DA 5DBQA 5ENUA 4PUAA 1XZOA 3EINA 1T4YA 2YV9A 4HJMA 5G1LA 2X8GA 3NZNA 3KJYA 3F6FA 2WFCA 4CY8A 3CSJA 3OR5A 4XHMA 1GULA 3IPZA 1AXDA 3D4TA 1XWAA 5F06A 2P5QA 2YJHA 2FWFA 1JZOA 3CYNA 3TJGA 10GSA 2J9HA 2L57A 5ID2B 1TI1A 5ECMB 2AAWA 3ZRDA 20GSA 2DJ0A 3HCZA 4G0LA 4E8EA 1TXXA 3IC4A 4PQIA 4F0CA 1XXUA 2OE3A 3F8UA 1SKRB 2IL3A 3EC3A 2HRKA 1XW5A 1UN2A 1ERWA 1WPIA 5C00A 2B1KA 1TDIA 1MD4A 4FYBA 2MBSA 4A5PA 3MSZA 5ELGA 1T8EB 3CTFA 1GSYA 1EP8A 2WDUA 1V57A 1X5DA 1ZYEA 1JFUA 5IO2A 1WIKA 2NVLA 3ZFBA 3PGTA 4Z2RA 2L59A 2JZRA 2IIYA 4TR3A 2LNSA 1TP9A 2YANA 2B7KA 4EC0A 2QGVA 1Z6MA 2A4HA 3UOMA 1ERUA 4FIWA 4G0KA 1XWGA 5B7CA 1U6TA 3LJRA 3RDWA 1GWCA 4FO5A 1SKSB 2HZEA 1R7HA 5KEJA 2K18A 5JCUA 1V40A 22GSA 2G2QA 4IQAA 2L6CA 2OJLA 2I3YA 4ZB9A 2MMOA 5JWRB 2O85A 3U5RE 2LJAA 2N5AA 1PKWA 3WT2A 3AY8A 3ZYWA 2DKIA 1EOGA 1A8LA 5F05A 1M9AA 1SYRA 4JR6A 3JCML 1BAYA 4MPFA 1WP0A 4F9ZA 4CDOA 1THXA 3FY7A 1GL8A 2VCZA 4TW5A 1EGRA 1GNWA 1U3IA 2DKHA 2GZZA 3UEMA 3Q6OA 3DVXA 4IJ3A 4K0NA 13GSA 2YWOA 1MEKA 2ZUPA 3ISOA 3F4TA 2XPEA 1JZWA 4HQZA 1HNCA 4NXIA 1S3DA 4GXZA 2CA8A 1AW9A 1TOFA 4RQXA 17GSA 1LJRA 3MWHA 1JLVA 3IK9A 4L8EA 4G9HA 2C1YA 2OA7A 3DIEA 2XHFA 4HQSA 4GSNA 3CRTA 2IN3A 2A4VA 3M1GA 3TKRA 1B4QA 4PURA 1YZXA 1OE7A 2M46A 1SK0A 3ZTLA 4IELA 4ML1A 2OBKA 2YV7A 4HZ2A 3EVIA 1Z7RA 2HRNA 3GH9A 1SJIA 5D9WA 2LRNA 1XVQA 3DXBA 1FOHA 2YWIA 2NPBA 5J5NA 2PERA 4OWYA 4HOJA 5CREA 5A4UA 3DVWA 3VWVA 4GRFA 1IYHA 2PBJA 1TK0B 2KP2A 1QGVA 3MAKA 4WBJA 2LEGA 1A23A 3GX0A 3KEBA 4MZWA 3ZMLA 2DJJA 3L9SA 1FAAA 2A2PA 2M80A 4WEYA 3NOFA 2VLUA 4LL1B 1F37A 2FWHA 1GSUA 1GNEA 2H66A 1PGTA 2YWMA 1FHEA 5LCZA 2JADA 2MYGA 4OFTA 1M2BA 1A2LA 3A2WA 4KW6A 1M7TA 3G9BA 1ZZYA 4TR1B 4K5RA 2VCWA 3TOTA 3IK7A 5ECLB 3RHBA 3L9UA 4IN0A 4RQRA 5IOWA 4MA9A 2TRXA 1JZDA 4ML6A 1H75A 3W6GA 3HVSA 3IOSA 4HUAA 1FVKA 4OO4A 4Z2UA 1X5EA 1YF1A 4TR1A 4KAEA 2GGTA 1KBNA 4YQMA 2IMDA 1XW9A 3QR6A 4PXOA 3BJ5A 1BJXA 1GTUA 1M9BA 1F3AA 1XOAA 2C0GA 4PQHA 4RUVA 1QK8A 3LYKA 1PA3A 2JSYA 1SK2A 4KCAA 3LEFA 1EV4A 4I5QA 4V2MA 3M8NA 2NBSA 5DCGA 2K9FA 4DVCA 1I5GA 5J9CA 1NHOA 4JEDA 2R4VA 2C80A 2VL3A 3TRQA 1UC7A 2WULA 2ES7A 1TKDB 3BOAA 3IHGA 1O8XA 1HYUA 2I4AA 2AUVA 4ZL9A 2HNLA 4FYCA 2QSIA 3K8NA 4O5RA 1M2DA 4K7IA 4HDEA 3HJPA 3EPTA 2HLSA 3GX8A 3IR4A 3F4SA 3IC8A 1NSWA 4OO5A 3TJJA 3TJFA 5A4VA 2H1DA 3M9JA 1F9MA 4LA1A 3VI5A 3V1WA 5DDLA 4F82A 4JE1A 3F4RA 1THOA 3H4KA 1X0RA 4POLA 2OADA 2F51A 4G2EA 2AB6A 2CAIA 4AGSA 2GTUA 1W89A 1AQWA 3RHCA 4QL9A 3P7XA 2B1LA 4XRAA 1GUKA 1SYXA 1LU4A 2DLXA 2AHEA 2VLVA 4L0UA 2VIMA 2YN1A 3CTGA 3ZLPA 2RLIA 3QCPA 4LMWA 3QFBC 4K7OA 1ZL9A 4K8MA 4DSRA 4K5SA 2C3TA 1U3AA 2H1GA 4PNFA 1OE8A 1BYEA 4ISDA 1AIUA 2H6YA 2PVOC 2I9HA 2C3NA 4CHSA 1SU9A 2L5LA 5BMUA 2CX3A 5B6MA 3FZ4A 2QC7A 4YKFA 3DKSA 4ULXA 1E6BA 2M72A 1G7OA 2LJRA 1GTAA 1OC9A 1PD21 5HFKA 1GRXA 1R5PA 4TXOB 3Q74A 11GSA 2K6VA 2R0GA 1EEMA 4DSQA 1ZYPA 2H1AA 2MBTA 2H75A 3FR3A 2MZCA 1O85A 4XCSA 3I6AA 1GP1A 1VRSD 2E7PA 3GV1A 3UMAA 4TN8A 5G31A 4TXOA 1JHBA 1K0OA 2ON7A 1RK4A 2I81A 6GSUA 2ON5A 1K0BA 4YQVA 1ZMAA 3TGZA 5D9VA 2GSRA 3WT1A 3IV4A 2LKUA 1TRVA 3Q19A 1GTIA 2GT5A 1K0MA 2L4CA 2VCXA 2E0QA 1U87A 4POMA 4EDYA 4MMMA 3F3RA 3LXZA 2LS5A 3ZZXA 4ZL7A 3HJMA 16GSA 4EUYA 4AJ8A 12GSA 3GNJA 4I97A 3A5IA 4PNGA 3RBTA 4KH7A 3RAZA 4EDZA 3LORA 3I43A 4IGJA 3P8WA 1O7UA 1XCCA 2FA4A 2RUFA 4FQUA 4EF0A 3ERFA 1JLWA 2G0FA 1SL1B 1R5AA 4TOPA 3A2XA 1W4VA 2NDOA 1XIYA 5ECNB 1B48A 1GLPA 5D9TA 5CNWA 2FWGA 14GSA 3C1SA 5F0GA 5E4WA 2H1BA 3BBYA 2GDRA 3VLNA 3UBKA 4IQ1A 5CRHA 5H5RA 3F3QA 3ZITA 2GSSA 1ST9A 4EL1A 4BWSA 3WD6A 4X43A 3HYPA 5GSTA 4EKZA 1J9BA 3US3A 5B8BA 3R3EA 4QL7A 2O87A 1CQGA 1GH2A 3MIXA 1XOBA 2VUPA 5IPHA 2JZTA 1I9DA 4GSSA 2PMTA 3S9FA 4CY6A 3TJBA 2ZCTA 4ACSA 4IVFA 4K0GA 4ECCA 2H72A 5C04A 2DSAA 4KNDA 3UBLA 2VD0A 4DSSB 3L78A 5AIXA 2AYTA 2QA1A 5J9BA 4GLTA 1AQVA 2GSTA 4HU9A 4L5LA 2B3SA 5ECRB 2HZEB 1AUCA 3VWWA 4J57E 5IMVA 4WR5A 4G19A 5FT3A 4DSSA 3HZ4A 4PQ1A 1NHYA 4XS1A 4WETA 4POKA 1EZKA 2YZHA 2MMNA 1PL2A 4XS4B 3TJKA 1K0AA 1A24A 2GS3A 3A2VA 1HD2A 2FUG2 5D73A 1GSQA 1GTBA 2YOIA 3GFKA 5HFIA 2FY6A 2IMEA 2VL9A 2C0DA 1URMA 1C72A 1PRXA 3P2AA 3TDGA 3M3MA 2YNXA 3GSSA 4XS4A 3APQA 4Q5FA 3J7Yk 3E0UA 5DQYA 1T3BA 2O89A 4OCFA 4H86A 5DJMA 8GSSA 4KDUA 5E59A 5ABRA 3EMPA 1Z9HA 2PU9C 7GSSA 5IMAA 1G6WA 4NV5A 3GKKA 4OFNA 1B4PA 4TRXA 1SJZA 2OE0A 5J41A 2CVDA 1K3OA 3EURA 1GSSA 1SKWB 2AV4A 4MJAA 4ECJA 4MNNA 2XBQA 4O32A 3C7MA 2C8UA 1OC8A 4ZIJA 3HDCA 2HFDA 4MJBA 3QD9A 2H8LA 5IO0A 2YPMA 3FHKA 5ELAA 4LMVA 2DJKA 3MNGA 6GSVA 3DD3A 2PGTA 3ZL5A 3TB2A 1DBYA 2YJ7A 1KEBA 1TRUA 1WWJA 4O92A 2IMFA 3EYTA 2D2ZA 3TOUA 2LRTA 5EY6A 2PVQA 2LQQA 4NPBA 4NAXA 5GSSA 2WJUA 3FZ5A 4WR4A 2H71A 3FEUA 2LNTA 3RPNA 5EPFA 3F0IA 2LTKA 2BTOT 5IQYA 1R4WA 1EP7A 3GKMA 4ZBDA 3M0FA 2H0IA 3FK8A 2FLSA 3KTBA 3G7YA 4KX4A 4BVXA 3KD0A 5GZZB 4ZBAA 3L4NA 4BL7B 1EV9A 5D9XA 3D6IA 1HQOA 3FRCA 4XS6A 5D93A 1WRYA 3TCOA 3UL3A 1PKZA 2X4AA 5DVBA 3GKNA 4BPYA 2HSYA 3U6VA 1O73A 1AC1A 2FNOA 4BL7A 3EU4A 4N0ZA 2R3XA 4EXJA 2VCVA 6GSXA 3IRAA 2VM1A 1HNBA 4JRRA 1WJKA 3TRPA 3EMXA 3GUSA 1A8YA 2V1MA 4F0BA 2H01A 3H1NA 2H0HA 4N0VA 5JCGA 3N5OA 1TJDA 4F03A 3G7JA 5HQPA 4XRDA 3BCKA 2E2MA 1JZRA 1ZCPA 3PPUA 2H73A 3C73A 3KCMA 4KF9A 2P0GA 3FMWA 4I6XA 3VK9A 4WXTA 2K8SA 4GCIA 2FD3A 2LUSA 5G5EA 3KMNA 2EC4A 2QA2A 2V41A 5IOXA 3ZREA 1HNAA 2CZ3A 3PINA 3E9JB 4PGTA 4ZL8A 3LW9A 1GSEA 1OYJA 4TXVA 3F63A 2B5YA 3GL5A 3ZMKA 3J7Yb 5FWGA 1TI3A 2B7JA 2H30A 4YQUA 3APOA 2MMAA 2C0EA 5A5KA 5HFGA 5DJLA 1BEDA 4MPGA 3E3EA 3GKXA 1DSBA 3ED3A 2IJYA 3MDKA 3UARA 4IHUA 6GSSA 2H19A 1V2AA 4G10A 3O76A 4RI6A 2KOKA 2VAFA 1SD9A 1VGLA 2H6ZA 5F07A 2FWEA 4KUNA 4YH2A 2DIYA 3DGQA 4NHWA 4IP6A 4HZ4A 4O5QA 1OAZA 3ZIJA 2OBIA 1BG5A 3H79A 5KOXA 4TVEA 4KGIA 1T7PB 4V2LA 5J4UA 2JZSA 1VF4A 4ICYA 2X64A 4OD7A 2FA8A 5G2ZA 5LNKe 5CAXA 5AISA 2HSMA 2VOCA 4EO3A 1ZGNA 2DMMA 3PR8A 3LWAA 3WGDA 4KDYA 1OC9B 3ZIVA 2EIRA 3FR9A 2F8AA 3C71A 3W8SA 3VI7A 3BCIA 1XWKA 1WOUA 4K2DA 1KTEA 3FR6A 5HR1A 1MD3A 3ZVJD 1YEXA 2X8CA 1FB0A 3KP8A 3QFAC 2FCHA 2KLXA 2R0CA 3SWLA 4X4JA 2HXKA 3BD2A 2V6OA 1GUHA 2TIRA 5DQSA 5FHIA 5GAPD 4Q5RA 2O7KA 2C3QA 2GLRA 4FH8A 2R5GA 4WF4A 2B5XA 1YJ6A 1A0FA 2X49A 5JCWA 1QFNA 1X5CA 4IP1A 4XTSA 1PX7A 4MJCA 1QQ2A 1Y25A 3FYGA 3IAS2 2HT9A 3QMXA 4K2XA 2REMA 1NW2A 1G7EA 5HR2A 3CMIA 1S3CA 3IA1A 4MCUA 18GSA 3ERGA 2LRCA 2LJKA 2CZ2A 4K1FA 2HSHA 1XVWA 2H70A 3TKQA 2XPDA 2IPAA 3TKSA 4KB3A 1O8WA 2CV4A 2HE3A 4MABA 3VFIA 2OKAA 4L0WA 1YDKA 1YKAA 1MTCA 1F6MC 3GURA 4X1UA 1PL1A 5CYYA 3ERWA 4MDCA 5EVOA 3LG6A 2E2GA 1GSFA 4DEJA 4JBBA 3FW2A 1K0CA 1SL2B 5ECHB 1N2AA 3KXOA 2CVBA 2NTOA 1TW9A 3HKRA 4MZBA 3VWXA 2X99A 1OKTA 3HVXA 5KOWA 5H5QA 4MF7A 5IM9A 2B6MA 1QXHA 1PN9A 3LQ7A 3ME8A 3APSA 3R2QA 1PMTA 5ECKB 2JL4A 2PN8A 2GQMA 1FOVA 5ECSA 5B6NA 2WRTA 1G0TA 1YQ1A 1T4ZA 1EWXA 5ECPB 4JU5A 1ACVA 4HJ2A 1MDIA 3EWLA 4MK3A 1MDJA 4Z7XA 1YEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HRF A;  4GWR A;  2VL2 C;  5D8I A;  3KH9 A;  1ILO A;  3WGE A;  5H5S A;  2R2J A;  3N9J A;  4OFM A;  5A4W A;  1R26 A;  2FGX A;  1YF0 A;  2V2G A;  4FYU A;  4GQC A;  1BQ7 A;  3WGX A;  1G6Y A;  3D21 A;  2QKE A;  4WKW A;  1WMJ A;  2WGR A;  3GA4 A;  2OAC A;  3LYP A;  3HVV A;  4IKH A;  4YAV A;  4GST A;  5ID2 A;  1YY7 A;  1FG4 A;  4KSM A;  4GTU A;  2RUE A;  3DRN A;  1K3L A;  1OVN A;  5F8B A;  4WBR D;  1O81 A;  4MZC A;  2GQK A;  3IXR A;  3LFL A;  1TK8 B;  1K3Y A;  1YKC A;  3NIV A;  1F2E A;  2PWJ A;  3QDN A;  2N5F A;  4ZXG A;  2GSQ A;  4Q5N A;  4HS1 A;  1SL0 B;  2F3M A;  4IW9 A;  4AF2 A;  2P5R A;  4KSO A;  4KCE A;  5CRW A;  4KE3 A;  4J56 E;  2VL2 A;  6GSY A;  2A2R A;  3CSH A;  2DIZ A;  5COH A;  3IDV A;  1O6J A;  4CW9 A;  3KGK A;  3KIJ A;  3EE2 A;  5AGY A;  1H4O A;  4ZB8 A;  1OKD A;  3HHV A;  3L9V A;  4TR0 A;  1OC3 A;  1MDK A;  2PUK C;  3LXT A;  2XBI A;  3ZVJ A;  4IS0 A;  1ABA A;  1XBS A;  1QUW A;  3QAW A;  3QPM A;  9GSS A;  4TR4 A;  5IPG A;  2P31 A;  5DAK B;  5D96 A;  2KP1 A;  3GST A;  4MH3 A;  4O7H A;  1Q4J A;  3CBU A;  3IE3 A;  2C0F A;  2LST A;  4MJE A;  4MF6 A;  5DAL B;  3TKP A;  5ECO B;  4NHZ A;  3M9K A;  3GTU B;  3DML A;  5AN1 A;  5L71 A;  1TU7 A;  2WB9 A;  4X0X A;  1V9W A;  1A2J A;  4RI7 A;  2AJQ B;  5GAN D;  4P3Y B;  5DAK A;  2C4J A;  2YWN A;  3H8Q A;  1ZOF A;  3VPT A;  3P90 A;  4ZBB A;  3KTL A;  4PUF C;  1X9W B;  3TRX A;  5DAL A;  1A2M A;  4ILF A;  3GTU A;  1ML6 A;  2EIO A;  5KN0 A;  3DEX A;  1B9Y C;  6GST A;  3D5J A;  3W8J A;  2XC2 A;  2F9S A;  4BA7 A;  4NMU A;  1DUG A;  5CP1 A;  4OCE A;  1Z5Y E;  4ECB A;  4GQF A;  3UJ1 A;  2VD1 A;  3F9U A;  4KDX A;  3IHQ A;  3GIX A;  4HU7 A;  1GSD A;  4OMV A;  1X9S B;  1T1V A;  4JR4 A;  1SEN A;  1VF2 A;  4YAP A;  2CX4 A;  2H76 A;  1TRW A;  3D0Z A;  1VF3 A;  3FZ9 A;  1EEJ A;  2HYX A;  3UVH A;  2DC5 A;  2ALB A;  1XFL A;  4GF0 A;  1XWC A;  5J3R A;  3KZQ A;  1FW1 A;  1B9X C;  2YP6 A;  2IMI A;  4KA0 A;  1M2A A;  5EL8 A;  3I69 A;  2YZU A;  1FO5 A;  2R37 A;  4HI7 A;  5IMD A;  4LLR A;  1FB6 A;  4MP4 A;  3VPQ A;  3TKS E;  4PX1 A;  5B8A A;  1PSQ A;  4J2F A;  2O8V B;  4WF5 A;  3O6T A;  1RQM A;  2JU5 A;  4D73 B;  2WZ9 A;  4K9Z A;  2VCQ A;  2BMX A;  4HEA 2;  4ID0 A;  2GT6 A;  3CRU A;  4V2N A;  3WYW A;  1M99 A;  1ERT A;  3O3T A;  1Y6E A;  4K7N A;  5ECQ B;  1NM3 A;  4MH2 A;  3IBH A;  1RW1 A;  4IBP A;  2H74 A;  1WE0 A;  1LBK A;  4D73 A;  4IJI A;  5IMZ A;  2DJ2 A;  4ECI A;  6GSW A;  3GMF A;  3L0H A;  2N5B A;  2VM2 A;  1BX9 A;  5JWO B;  3KM6 A;  1UA5 A;  3ZFL A;  3QOU A;  1IYI A;  3LGC A;  4Q5Q A;  1J0F A;  3KP9 A;  2PPT A;  3A3T A;  1Z6N A;  2FHE A;  3SBC A;  4TKY A;  3UIW A;  4BWQ A;  1PX6 A;  5ECI B;  1DE1 A;  3KH7 A;  1M0U A;  1CQH A;  1TRS A;  2CQ9 A;  2TRC P;  3UVT A;  3GYK A;  3GH6 A;  1J08 A;  1EOH A;  3F6D A;  2GZY A;  3QAG A;  1QMV A;  3CXG A;  3GRX A;  2Z9S A;  2GZP A;  1TU8 A;  1TK5 B;  4MF5 A;  2RII A;  4V1A p;  3LSZ A;  2GVP A;  1T00 A;  2YCD A;  4F2I A;  2RM5 A;  3DYR A;  3I9V 2;  5G30 A;  1EGO A;  2A2S A;  1DE2 A;  3D4M A;  2HI7 A;  4N10 A;  2R6K A;  3RPP A;  1ZYQ B;  5CRG A;  2CT6 A;  1X9M B;  5KN2 A;  5KN1 A;  1ON4 A;  3G7I A;  3C8E A;  1XWB A;  5LD0 A;  5KN3 A;  1Z7P A;  2JSZ A;  2X8H A;  2RM6 A;  2L4Q A;  1GUM A;  4V1A g;  5INY A;  1GLQ A;  1F3B A;  1XPV A;  3PH9 A;  2DJ1 A;  1USB A;  5G1K A;  4NWY A;  3HZ8 A;  3HD5 A;  4I8B A;  2OE1 A;  1A0R P;  19GS A;  3HA9 A;  2HZF A;  3TKS C;  1KNG A;  3FKF A;  2GQL A;  2L5O A;  3GL3 A;  2IMK A;  1UVZ A;  2ZNM A;  3D22 A;  5IMF A;  2F8F A;  4AJ6 A;  3CSI A;  4L5O A;  2VO4 A;  1K0N A;  2VLT A;  1V98 A;  2JAC A;  3IAM 2;  4JZQ A;  1AQX A;  2VCT A;  1ERV A;  4EE0 A;  2WS2 A;  3A5W A;  3FZA A;  3UAP A;  2MMZ A;  2H6X A;  2K8V A;  4ZB6 A;  4QQ7 A;  3EU3 A;  1S3A A;  2V6K A;  1B8X A;  5IIZ A;  3H93 A;  3GHA A;  3C1R A;  4AJ7 A;  5DCH A;  3QAV A;  4MLY A;  4N11 A;  5HR0 A;  1PQN A;  2EIQ A;  2KHP A;  2IWT A;  2J23 A;  2H0G A;  3GN3 A;  2IFQ B;  1K0D A;  4EVM A;  1Z3E A;  5AIV A;  4I2U A;  5CRD A;  4NV2 A;  4XIH A;  2DML A;  2LQO A;  1U88 A;  2DJ3 A;  5CO3 A;  5G5F A;  2IFQ A;  3KMO A;  3DWV A;  3VWU A;  2WCI A;  1N8J A;  1SJ6 A;  3TUE A;  1SK1 A;  1V58 A;  1XW6 A;  2DBC A;  2BJX A;  4N30 A;  5IMC A;  2B5E A;  3VUR A;  3ME7 A;  5HR3 A;  1SD8 A;  1E2Y A;  2KUC A;  2CAQ A;  3HJO A;  5JWQ B;  1Q98 A;  3HXS A;  4K6X A;  1VF1 A;  1FVJ A;  2CVK A;  1AAZ A;  4POB A;  3HY2 A;  2LV3 A;  4LL4 B;  4ZIL A;  4BVY A;  2I1U A;  4E8H A;  3Q18 A;  4I2T A;  1TTZ A;  2V32 A;  2L6D A;  5DBQ A;  5ENU A;  4PUA A;  1XZO A;  3EIN A;  1T4Y A;  2YV9 A;  4HJM A;  5G1L A;  2X8G A;  3NZN A;  3KJY A;  3F6F A;  2WFC A;  3CSJ A;  3OR5 A;  4XHM A;  1GUL A;  3IPZ A;  1AXD A;  3D4T A;  1XWA A;  5F06 A;  2P5Q A;  2YJH A;  2FWF A;  1JZO A;  3CYN A;  3TJG A;  10GS A;  2J9H A;  2L57 A;  5ID2 B;  1TI1 A;  5ECM B;  2AAW A;  3ZRD A;  20GS A;  2DJ0 A;  3HCZ A;  4E8E A;  1TXX A;  3IC4 A;  4PQI A;  4F0C A;  1XXU A;  2OE3 A;  3F8U A;  1SKR B;  2IL3 A;  3EC3 A;  1XW5 A;  1UN2 A;  1ERW A;  1WPI A;  5C00 A;  2B1K A;  1TDI A;  1MD4 A;  4FYB A;  2MBS A;  3MSZ A;  5ELG A;  1T8E B;  3CTF A;  1GSY A;  1EP8 A;  2WDU A;  1V57 A;  1X5D A;  1ZYE A;  1JFU A;  5IO2 A;  1WIK A;  2NVL A;  3ZFB A;  3PGT A;  2L59 A;  2JZR A;  2IIY A;  4TR3 A;  2LNS A;  1TP9 A;  2YAN A;  2B7K A;  4EC0 A;  2QGV A;  1Z6M A;  3UOM A;  1ERU A;  4FIW A;  1XWG A;  5B7C A;  1U6T A;  3LJR A;  3RDW A;  1GWC A;  4FO5 A;  1SKS B;  2HZE A;  1R7H A;  5KEJ A;  2K18 A;  5JCU A;  1V40 A;  22GS A;  2G2Q A;  4IQA A;  2L6C A;  2OJL A;  2I3Y A;  4ZB9 A;  2MMO A;  5JWR B;  2O85 A;  3U5R E;  2LJA A;  2N5A A;  1PKW A;  3WT2 A;  3AY8 A;  3ZYW A;  1EOG A;  1A8L A;  5F05 A;  1M9A A;  1SYR A;  4JR6 A;  3JCM L;  1BAY A;  4MPF A;  1WP0 A;  4F9Z A;  4CDO A;  1THX A;  3FY7 A;  1GL8 A;  2VCZ A;  4TW5 A;  1EGR A;  1GNW A;  1U3I A;  2GZZ A;  3UEM A;  3Q6O A;  3DVX A;  4IJ3 A;  4K0N A;  13GS A;  2YWO A;  1MEK A;  2ZUP A;  3ISO A;  3F4T A;  2XPE A;  1JZW A;  4HQZ A;  1HNC A;  4NXI A;  1S3D A;  4GXZ A;  2CA8 A;  1AW9 A;  1TOF A;  4RQX A;  17GS A;  1LJR A;  3MWH A;  1JLV A;  3IK9 A;  4L8E A;  4G9H A;  2C1Y A;  2OA7 A;  3DIE A;  2XHF A;  4HQS A;  4GSN A;  3CRT A;  2IN3 A;  2A4V A;  3M1G A;  3TKR A;  1B4Q A;  4PUR A;  1YZX A;  1OE7 A;  2M46 A;  1SK0 A;  3ZTL A;  4IEL A;  4ML1 A;  2OBK A;  2YV7 A;  4HZ2 A;  3EVI A;  1Z7R A;  2HRN A;  3GH9 A;  1SJI A;  5D9W A;  2LRN A;  1XVQ A;  3DXB A;  2YWI A;  2NPB A;  5J5N A;  2PER A;  4OWY A;  4HOJ A;  5CRE A;  5A4U A;  3DVW A;  3VWV A;  4GRF A;  1IYH A;  2PBJ A;  1TK0 B;  2KP2 A;  1QGV A;  3MAK A;  4WBJ A;  2LEG A;  1A23 A;  3GX0 A;  3KEB A;  4MZW A;  3ZML A;  2DJJ A;  3L9S A;  1FAA A;  2M80 A;  4WEY A;  3NOF A;  2VLU A;  4LL1 B;  1F37 A;  2FWH A;  1GSU A;  1GNE A;  2H66 A;  1PGT A;  2YWM A;  1FHE A;  5LCZ A;  2JAD A;  2MYG A;  4OFT A;  1M2B A;  1A2L A;  3A2W A;  4KW6 A;  1M7T A;  3G9B A;  1ZZY A;  4TR1 B;  2VCW A;  3TOT A;  3IK7 A;  5ECL B;  3RHB A;  3L9U A;  4IN0 A;  4RQR A;  5IOW A;  4MA9 A;  2TRX A;  1JZD A;  4ML6 A;  1H75 A;  3W6G A;  3HVS A;  3IOS A;  4HUA A;  1FVK A;  4OO4 A;  1X5E A;  1YF1 A;  4TR1 A;  4KAE A;  2GGT A;  1KBN A;  4YQM A;  2IMD A;  1XW9 A;  3QR6 A;  4PXO A;  3BJ5 A;  1BJX A;  1GTU A;  1M9B A;  1F3A A;  1XOA A;  2C0G A;  4PQH A;  4RUV A;  1QK8 A;  3LYK A;  1PA3 A;  2JSY A;  1SK2 A;  4KCA A;  3LEF A;  1EV4 A;  4I5Q A;  4V2M A;  3M8N A;  2NBS A;  5DCG A;  2K9F A;  4DVC A;  1I5G A;  5J9C A;  1NHO A;  4JED A;  2R4V A;  2C80 A;  2VL3 A;  3TRQ A;  1UC7 A;  2WUL A;  2ES7 A;  1TKD B;  3BOA A;  1O8X A;  1HYU A;  2I4A A;  2AUV A;  4ZL9 A;  2HNL A;  4FYC A;  2QSI A;  3K8N A;  4O5R A;  1M2D A;  4K7I A;  4HDE A;  3HJP A;  2HLS A;  3GX8 A;  3IR4 A;  3F4S A;  1NSW A;  4OO5 A;  3TJJ A;  3TJF A;  5A4V A;  2H1D A;  3M9J A;  1F9M A;  4LA1 A;  3VI5 A;  3V1W A;  5DDL A;  4F82 A;  4JE1 A;  3F4R A;  1THO A;  3H4K A;  1X0R A;  4POL A;  2OAD A;  2F51 A;  4G2E A;  2AB6 A;  2CAI A;  4AGS A;  2GTU A;  1W89 A;  1AQW A;  3RHC A;  4QL9 A;  3P7X A;  2B1L A;  4XRA A;  1GUK A;  1SYX A;  1LU4 A;  2DLX A;  2AHE A;  2VLV A;  4L0U A;  2VIM A;  2YN1 A;  3CTG A;  3ZLP A;  2RLI A;  3QCP A;  4LMW A;  3QFB C;  4K7O A;  1ZL9 A;  4K8M A;  4DSR A;  2C3T A;  1U3A A;  2H1G A;  4PNF A;  1OE8 A;  1BYE A;  4ISD A;  1AIU A;  2H6Y A;  2PVO C;  2I9H A;  2C3N A;  4CHS A;  1SU9 A;  2L5L A;  2CX3 A;  5B6M A;  3FZ4 A;  2QC7 A;  3DKS A;  4ULX A;  1E6B A;  2M72 A;  1G7O A;  2LJR A;  1GTA A;  1OC9 A;  1PD2 1;  5HFK A;  1GRX A;  1R5P A;  4TXO B;  3Q74 A;  11GS A;  2K6V A;  1EEM A;  4DSQ A;  2H1A A;  2MBT A;  2H75 A;  3FR3 A;  2MZC A;  1O85 A;  4XCS A;  3I6A A;  1GP1 A;  1VRS D;  2E7P A;  3GV1 A;  3UMA A;  4TN8 A;  5G31 A;  4TXO A;  1JHB A;  1K0O A;  2ON7 A;  1RK4 A;  2I81 A;  6GSU A;  2ON5 A;  1K0B A;  4YQV A;  1ZMA A;  3TGZ A;  5D9V A;  2GSR A;  3WT1 A;  3IV4 A;  2LKU A;  1TRV A;  3Q19 A;  1GTI A;  2GT5 A;  1K0M A;  2L4C A;  2VCX A;  2E0Q A;  1U87 A;  4POM A;  4EDY A;  4MMM A;  3F3R A;  3LXZ A;  2LS5 A;  3ZZX A;  4ZL7 A;  3HJM A;  16GS A;  4EUY A;  4AJ8 A;  12GS A;  3GNJ A;  4I97 A;  4PNG A;  3RBT A;  4KH7 A;  3RAZ A;  4EDZ A;  3LOR A;  3I43 A;  4IGJ A;  3P8W A;  1O7U A;  1XCC A;  2FA4 A;  2RUF A;  4EF0 A;  3ERF A;  1JLW A;  2G0F A;  1SL1 B;  1R5A A;  4TOP A;  3A2X A;  1W4V A;  2NDO A;  1XIY A;  5ECN B;  1B48 A;  1GLP A;  5D9T A;  5CNW A;  2FWG A;  14GS A;  3C1S A;  5F0G A;  5E4W A;  2H1B A;  3BBY A;  2GDR A;  3VLN A;  3UBK A;  4IQ1 A;  5CRH A;  5H5R A;  3F3Q A;  3ZIT A;  2GSS A;  1ST9 A;  4EL1 A;  4BWS A;  3WD6 A;  4X43 A;  3HYP A;  5GST A;  4EKZ A;  1J9B A;  3US3 A;  5B8B A;  4QL7 A;  2O87 A;  1CQG A;  1GH2 A;  1XOB A;  2VUP A;  5IPH A;  2JZT A;  1I9D A;  4GSS A;  2PMT A;  3S9F A;  3TJB A;  2ZCT A;  4ACS A;  4IVF A;  4K0G A;  4ECC A;  2H72 A;  5C04 A;  2DSA A;  4KND A;  3UBL A;  2VD0 A;  4DSS B;  3L78 A;  5AIX A;  2AYT A;  5J9B A;  4GLT A;  1AQV A;  2GST A;  4HU9 A;  4L5L A;  2B3S A;  5ECR B;  2HZE B;  1AUC A;  3VWW A;  4J57 E;  5IMV A;  4WR5 A;  4G19 A;  5FT3 A;  4DSS A;  3HZ4 A;  4PQ1 A;  1NHY A;  4XS1 A;  4WET A;  4POK A;  1EZK A;  2YZH A;  2MMN A;  1PL2 A;  4XS4 B;  3TJK A;  1K0A A;  1A24 A;  2GS3 A;  3A2V A;  1HD2 A;  2FUG 2;  5D73 A;  1GSQ A;  1GTB A;  2YOI A;  3GFK A;  5HFI A;  2FY6 A;  2IME A;  2VL9 A;  2C0D A;  1URM A;  1C72 A;  1PRX A;  3P2A A;  3TDG A;  3M3M A;  2YNX A;  3GSS A;  4XS4 A;  3APQ A;  4Q5F A;  3J7Y k;  3E0U A;  5DQY A;  1T3B A;  2O89 A;  4OCF A;  4H86 A;  5DJM A;  8GSS A;  4KDU A;  5E59 A;  5ABR A;  3EMP A;  1Z9H A;  2PU9 C;  7GSS A;  5IMA A;  1G6W A;  4NV5 A;  3GKK A;  4OFN A;  1B4P A;  4TRX A;  1SJZ A;  2OE0 A;  5J41 A;  2CVD A;  1K3O A;  3EUR A;  1GSS A;  1SKW B;  2AV4 A;  4MJA A;  4ECJ A;  2XBQ A;  4O32 A;  3C7M A;  2C8U A;  1OC8 A;  4ZIJ A;  3HDC A;  2HFD A;  4MJB A;  3QD9 A;  2H8L A;  5IO0 A;  2YPM A;  3FHK A;  5ELA A;  4LMV A;  2DJK A;  3MNG A;  6GSV A;  3DD3 A;  2PGT A;  3ZL5 A;  3TB2 A;  1DBY A;  2YJ7 A;  1KEB A;  1TRU A;  1WWJ A;  4O92 A;  2IMF A;  3EYT A;  2D2Z A;  3TOU A;  2LRT A;  5EY6 A;  2PVQ A;  2LQQ A;  4NPB A;  4NAX A;  5GSS A;  2WJU A;  3FZ5 A;  4WR4 A;  2H71 A;  3FEU A;  2LNT A;  3RPN A;  5EPF A;  3F0I A;  2LTK A;  2BTO T;  5IQY A;  1R4W A;  1EP7 A;  3GKM A;  4ZBD A;  3M0F A;  2H0I A;  3FK8 A;  2FLS A;  3KTB A;  3G7Y A;  4KX4 A;  4BVX A;  3KD0 A;  5GZZ B;  4ZBA A;  3L4N A;  1EV9 A;  5D9X A;  3D6I A;  1HQO A;  3FRC A;  4XS6 A;  5D93 A;  1WRY A;  3TCO A;  3UL3 A;  1PKZ A;  5DVB A;  3GKN A;  4BPY A;  2HSY A;  3U6V A;  1O73 A;  1AC1 A;  2FNO A;  4BL7 A;  3EU4 A;  4N0Z A;  2R3X A;  4EXJ A;  2VCV A;  6GSX A;  3IRA A;  2VM1 A;  1HNB A;  4JRR A;  1WJK A;  3TRP A;  3EMX A;  3GUS A;  1A8Y A;  2V1M A;  4F0B A;  2H01 A;  3H1N A;  2H0H A;  4N0V A;  5JCG A;  3N5O A;  1TJD A;  4F03 A;  3G7J A;  5HQP A;  4XRD A;  3BCK A;  2E2M A;  1JZR A;  1ZCP A;  2H73 A;  3C73 A;  3KCM A;  2P0G A;  4I6X A;  3VK9 A;  4WXT A;  2K8S A;  4GCI A;  2FD3 A;  2LUS A;  5G5E A;  3KMN A;  2EC4 A;  2V41 A;  5IOX A;  3ZRE A;  1HNA A;  2CZ3 A;  3PIN A;  3E9J B;  4PGT A;  4ZL8 A;  1GSE A;  1OYJ A;  4TXV A;  3F63 A;  2B5Y A;  3GL5 A;  3ZMK A;  3J7Y b;  5FWG A;  1TI3 A;  2B7J A;  2H30 A;  4YQU A;  3APO A;  2MMA A;  2C0E A;  5A5K A;  5HFG A;  5DJL A;  1BED A;  4MPG A;  3E3E A;  3GKX A;  1DSB A;  3ED3 A;  2IJY A;  3MDK A;  3UAR A;  4IHU A;  6GSS A;  2H19 A;  1V2A A;  4G10 A;  3O76 A;  4RI6 A;  2KOK A;  2VAF A;  1SD9 A;  1VGL A;  2H6Z A;  5F07 A;  2FWE A;  4KUN A;  4YH2 A;  2DIY A;  3DGQ A;  4NHW A;  4IP6 A;  4HZ4 A;  1OAZ A;  3ZIJ A;  2OBI A;  1BG5 A;  3H79 A;  4TVE A;  4KGI A;  1T7P B;  4V2L A;  5J4U A;  2JZS A;  1VF4 A;  2X64 A;  4OD7 A;  2FA8 A;  5G2Z A;  5LNK e;  5CAX A;  5AIS A;  2VOC A;  4EO3 A;  1ZGN A;  2DMM A;  3PR8 A;  3LWA A;  3WGD A;  4KDY A;  1OC9 B;  3ZIV A;  2EIR A;  3FR9 A;  2F8A A;  3C71 A;  3W8S A;  3VI7 A;  3BCI A;  1XWK A;  1WOU A;  4K2D A;  1KTE A;  3FR6 A;  5HR1 A;  1MD3 A;  3ZVJ D;  1YEX A;  2X8C A;  1FB0 A;  3KP8 A;  3QFA C;  2FCH A;  2KLX A;  3SWL A;  2HXK A;  3BD2 A;  2V6O A;  1GUH A;  2TIR A;  5DQS A;  5FHI A;  5GAP D;  4Q5R A;  2O7K A;  2C3Q A;  2GLR A;  4FH8 A;  2R5G A;  4WF4 A;  2B5X A;  1YJ6 A;  1A0F A;  5JCW A;  1QFN A;  1X5C A;  4IP1 A;  4XTS A;  1PX7 A;  4MJC A;  1QQ2 A;  1Y25 A;  3FYG A;  3IAS 2;  2HT9 A;  3QMX A;  2REM A;  1NW2 A;  1G7E A;  5HR2 A;  3CMI A;  1S3C A;  3IA1 A;  4MCU A;  18GS A;  3ERG A;  2LRC A;  2LJK A;  2CZ2 A;  4K1F A;  2HSH A;  1XVW A;  2H70 A;  3TKQ A;  2XPD A;  2IPA A;  3TKS A;  4KB3 A;  1O8W A;  2CV4 A;  2HE3 A;  4MAB A;  3VFI A;  2OKA A;  4L0W A;  1YDK A;  1YKA A;  1MTC A;  1F6M C;  3GUR A;  4X1U A;  1PL1 A;  5CYY A;  3ERW A;  4MDC A;  5EVO A;  3LG6 A;  2E2G A;  1GSF A;  4DEJ A;  4JBB A;  3FW2 A;  1K0C A;  1SL2 B;  5ECH B;  1N2A A;  3KXO A;  2CVB A;  2NTO A;  1TW9 A;  3HKR A;  4MZB A;  3VWX A;  2X99 A;  1OKT A;  3HVX A;  5H5Q A;  4MF7 A;  5IM9 A;  2B6M A;  1QXH A;  1PN9 A;  3LQ7 A;  3ME8 A;  3APS A;  3R2Q A;  1PMT A;  5ECK B;  2JL4 A;  2PN8 A;  2GQM A;  1FOV A;  5ECS A;  5B6N A;  2WRT A;  1G0T A;  1YQ1 A;  1T4Z A;  1EWX A;  5ECP B;  4JU5 A;  1ACV A;  4HJ2 A;  1MDI A;  3EWL A;  4MK3 A;  1MDJ A;  4Z7X A;  1YEP A; 
#chains in the Genus database with same CATH topology
 2HRF A;  4GWR A;  2VL2 C;  5D8I A;  3KH9 A;  1ILO A;  3WGE A;  5H5S A;  2R2J A;  3N9J A;  4OFM A;  5A4W A;  1R26 A;  2FGX A;  1YF0 A;  2V2G A;  4FYU A;  4GQC A;  1BQ7 A;  3WGX A;  1G6Y A;  3D21 A;  2QKE A;  4WKW A;  1WMJ A;  2WGR A;  3GA4 A;  2OAC A;  3LYP A;  3HVV A;  4IKH A;  4YAV A;  4GST A;  5ID2 A;  1YY7 A;  1FG4 A;  4KSM A;  4GTU A;  2RUE A;  3DRN A;  1K3L A;  1OVN A;  5F8B A;  4WBR D;  1O81 A;  4MZC A;  2GQK A;  3IXR A;  3LFL A;  1TK8 B;  1K3Y A;  1YKC A;  3NIV A;  1F2E A;  2PWJ A;  3QDN A;  2N5F A;  4ZXG A;  2GSQ A;  4Q5N A;  4HS1 A;  1SL0 B;  2F3M A;  4IW9 A;  4AF2 A;  2P5R A;  4KSO A;  4KCE A;  5CRW A;  4KE3 A;  4J56 E;  4O5U A;  2VL2 A;  6GSY A;  2A2R A;  3CSH A;  2DIZ A;  5COH A;  3IDV A;  1O6J A;  4CW9 A;  3KGK A;  3KIJ A;  3EE2 A;  5AGY A;  1H4O A;  4ZB8 A;  1OKD A;  3HHV A;  3L9V A;  4TR0 A;  1OC3 A;  1MDK A;  2PUK C;  3LXT A;  2XBI A;  3ZVJ A;  4IS0 A;  1ABA A;  1XBS A;  1QUW A;  3QAW A;  3QPM A;  9GSS A;  4TR4 A;  5IPG A;  2P31 A;  5DAK B;  5D96 A;  2KP1 A;  3GST A;  4MH3 A;  4O7H A;  1Q4J A;  3CBU A;  3IE3 A;  2C0F A;  2LST A;  4MJE A;  4MF6 A;  5DAL B;  3TKP A;  5ECO B;  4NHZ A;  3M9K A;  3GTU B;  3DML A;  4Z2T A;  5AN1 A;  5L71 A;  1TU7 A;  2WB9 A;  4X0X A;  1V9W A;  1A2J A;  4RI7 A;  2AJQ B;  5GAN D;  4P3Y B;  5DAK A;  2C4J A;  2YWN A;  3H8Q A;  1ZOF A;  3VPT A;  3P90 A;  4ZBB A;  3KTL A;  4PUF C;  1X9W B;  3TRX A;  5DAL A;  1A2M A;  4ILF A;  3GTU A;  1ML6 A;  2EIO A;  5KN0 A;  3DEX A;  1B9Y C;  6GST A;  3D5J A;  3W8J A;  2R0P A;  2XC2 A;  2F9S A;  4BA7 A;  4NMU A;  1DUG A;  5CP1 A;  4OCE A;  1Z5Y E;  4YKG A;  4ECB A;  4GQF A;  3UJ1 A;  2VD1 A;  3F9U A;  4KDX A;  4BVX B;  3IHQ A;  3GIX A;  4HU7 A;  1GSD A;  4OMV A;  1X9S B;  1T1V A;  4JR4 A;  1SEN A;  1VF2 A;  4YAP A;  2CX4 A;  2H76 A;  1TRW A;  3D0Z A;  1VF3 A;  3FZ9 A;  1EEJ A;  2HYX A;  4PTS A;  3UVH A;  2DC5 A;  2ALB A;  1XFL A;  4GF0 A;  1XWC A;  5J3R A;  3KZQ A;  1FW1 A;  1B9X C;  2YP6 A;  2IMI A;  4KA0 A;  1M2A A;  5EL8 A;  3I69 A;  2YZU A;  1FO5 A;  2R37 A;  4HI7 A;  5IMD A;  4LLR A;  1FB6 A;  4MP4 A;  3VPQ A;  3TKS E;  4PX1 A;  5B8A A;  1PSQ A;  4J2F A;  2O8V B;  4WF5 A;  3O6T A;  1RQM A;  1PN0 A;  2JU5 A;  4D73 B;  2WZ9 A;  4K9Z A;  2VCQ A;  2BMX A;  4HEA 2;  4ID0 A;  2GT6 A;  3CRU A;  4V2N A;  3WYW A;  1M99 A;  1ERT A;  3O3T A;  1Y6E A;  4K7N A;  5ECQ B;  1NM3 A;  4MH2 A;  3IBH A;  1RW1 A;  4IBP A;  2H74 A;  1WE0 A;  1LBK A;  4D73 A;  2HRA A;  4IJI A;  4EIQ A;  5IMZ A;  2DJ2 A;  4ECI A;  6GSW A;  3GMF A;  3L0H A;  2N5B A;  2VM2 A;  1BX9 A;  5JWO B;  3KM6 A;  1UA5 A;  3ZFL A;  3QOU A;  1IYI A;  3LGC A;  4Q5Q A;  1J0F A;  3KP9 A;  2PPT A;  3A3T A;  1Z6N A;  2FHE A;  3SBC A;  4TKY A;  3UIW A;  4BWQ A;  1PX6 A;  5ECI B;  1DE1 A;  3KH7 A;  1M0U A;  1CQH A;  1TRS A;  2CQ9 A;  2TRC P;  3UVT A;  3GYK A;  3GH6 A;  1J08 A;  1EOH A;  3F6D A;  2GZY A;  3QAG A;  1QMV A;  3CXG A;  3GRX A;  2Z9S A;  2UZ8 A;  2GZP A;  1TU8 A;  1TK5 B;  4MF5 A;  2RII A;  3MYD A;  4V1A p;  3LSZ A;  2GVP A;  1T00 A;  2YCD A;  4F2I A;  2RM5 A;  3DYR A;  3I9V 2;  5G30 A;  1EGO A;  2A2S A;  1DE2 A;  3D4M A;  2HI7 A;  4N10 A;  2R6K A;  3RPP A;  1ZYQ B;  5CRG A;  2CT6 A;  1X9M B;  5KN2 A;  5KN1 A;  1ON4 A;  3G7I A;  3C8E A;  1XWB A;  5LD0 A;  5KN3 A;  1Z7P A;  2JSZ A;  2X8H A;  2RM6 A;  2L4Q A;  1GUM A;  4V1A g;  5INY A;  1GLQ A;  1F3B A;  1XPV A;  3PH9 A;  2DJ1 A;  1USB A;  5G1K A;  4NWY A;  3HZ8 A;  3HD5 A;  4I8B A;  2OE1 A;  1A0R P;  19GS A;  3HA9 A;  2HZF A;  3TKS C;  1KNG A;  3FKF A;  2GQL A;  2L5O A;  3GL3 A;  2IMK A;  1UVZ A;  2ZNM A;  3D22 A;  5IMF A;  2F8F A;  4AJ6 A;  3CSI A;  4L5O A;  2VO4 A;  1K0N A;  2VLT A;  1V98 A;  2JAC A;  3IAM 2;  4JZQ A;  1AQX A;  2VCT A;  1ERV A;  4EE0 A;  2WS2 A;  3A5W A;  3FZA A;  3UAP A;  2MMZ A;  2H6X A;  4BIK A;  2K8V A;  4ZB6 A;  1ZYN A;  4QQ7 A;  4EIP A;  3EU3 A;  1S3A A;  2V6K A;  4USS A;  1B8X A;  5IIZ A;  3H93 A;  3GHA A;  3C1R A;  4AJ7 A;  5DCH A;  3QAV A;  4MLY A;  4N11 A;  5HR0 A;  1PQN A;  2EIQ A;  2KHP A;  2IWT A;  2J23 A;  2H0G A;  3GN3 A;  2IFQ B;  1K0D A;  4EVM A;  1Z3E A;  5AIV A;  4I2U A;  5CRD A;  4NV2 A;  4XIH A;  2DML A;  2LQO A;  1U88 A;  2DJ3 A;  5CO3 A;  5G5F A;  2IFQ A;  3KMO A;  3DWV A;  3VWU A;  2WCI A;  1N8J A;  1SJ6 A;  3TUE A;  5BRT A;  1SK1 A;  1V58 A;  1XW6 A;  2DBC A;  2BJX A;  4N30 A;  5IMC A;  4BVY B;  2B5E A;  3VUR A;  3ME7 A;  5HR3 A;  1SD8 A;  1E2Y A;  2KUC A;  2CAQ A;  3HJO A;  5JWQ B;  1Q98 A;  3HXS A;  4K6X A;  1VF1 A;  1FVJ A;  2CVK A;  1AAZ A;  4POB A;  3HY2 A;  2LV3 A;  4LL4 B;  4ZIL A;  4BVY A;  2I1U A;  4G0I A;  4E8H A;  3Q18 A;  4I2T A;  1TTZ A;  2V32 A;  2L6D A;  5DBQ A;  5ENU A;  4PUA A;  1XZO A;  3EIN A;  1T4Y A;  2YV9 A;  4HJM A;  1M3J A;  5G1L A;  2X8G A;  3NZN A;  3KJY A;  3F6F A;  2WFC A;  4CY8 A;  3CSJ A;  3OR5 A;  4XHM A;  1GUL A;  3IPZ A;  1AXD A;  3D4T A;  1XWA A;  5F06 A;  2P5Q A;  2YJH A;  2FWF A;  1JZO A;  3CYN A;  3TJG A;  10GS A;  2J9H A;  2L57 A;  5ID2 B;  1TI1 A;  5ECM B;  2AAW A;  3ZRD A;  20GS A;  2DJ0 A;  3HCZ A;  4G0L A;  4E8E A;  1TXX A;  3IC4 A;  4PQI A;  4F0C A;  1XXU A;  2OE3 A;  3F8U A;  1SKR B;  2IL3 A;  3EC3 A;  2HRK A;  1XW5 A;  1UN2 A;  1ERW A;  1WPI A;  5C00 A;  2B1K A;  1TDI A;  1MD4 A;  4FYB A;  2MBS A;  4A5P A;  3MSZ A;  5ELG A;  1T8E B;  3CTF A;  1GSY A;  1EP8 A;  2WDU A;  1V57 A;  1X5D A;  1ZYE A;  1JFU A;  5IO2 A;  1WIK A;  2NVL A;  3ZFB A;  3PGT A;  4Z2R A;  2L59 A;  2JZR A;  2IIY A;  4TR3 A;  2LNS A;  1TP9 A;  2YAN A;  2B7K A;  4EC0 A;  2QGV A;  1Z6M A;  2A4H A;  3UOM A;  1ERU A;  4FIW A;  4G0K A;  1XWG A;  5B7C A;  1U6T A;  3LJR A;  3RDW A;  1GWC A;  4FO5 A;  1SKS B;  2HZE A;  1R7H A;  5KEJ A;  2K18 A;  5JCU A;  1V40 A;  22GS A;  2G2Q A;  4IQA A;  2L6C A;  2OJL A;  2I3Y A;  4ZB9 A;  2MMO A;  5JWR B;  2O85 A;  3U5R E;  2LJA A;  2N5A A;  1PKW A;  3WT2 A;  3AY8 A;  3ZYW A;  2DKI A;  1EOG A;  1A8L A;  5F05 A;  1M9A A;  1SYR A;  4JR6 A;  3JCM L;  1BAY A;  4MPF A;  1WP0 A;  4F9Z A;  4CDO A;  1THX A;  3FY7 A;  1GL8 A;  2VCZ A;  4TW5 A;  1EGR A;  1GNW A;  1U3I A;  2DKH A;  2GZZ A;  3UEM A;  3Q6O A;  3DVX A;  4IJ3 A;  4K0N A;  13GS A;  2YWO A;  1MEK A;  2ZUP A;  3ISO A;  3F4T A;  2XPE A;  1JZW A;  4HQZ A;  1HNC A;  4NXI A;  1S3D A;  4GXZ A;  2CA8 A;  1AW9 A;  1TOF A;  4RQX A;  17GS A;  1LJR A;  3MWH A;  1JLV A;  3IK9 A;  4L8E A;  4G9H A;  2C1Y A;  2OA7 A;  3DIE A;  2XHF A;  4HQS A;  4GSN A;  3CRT A;  2IN3 A;  2A4V A;  3M1G A;  3TKR A;  1B4Q A;  4PUR A;  1YZX A;  1OE7 A;  2M46 A;  1SK0 A;  3ZTL A;  4IEL A;  4ML1 A;  2OBK A;  2YV7 A;  4HZ2 A;  3EVI A;  1Z7R A;  2HRN A;  3GH9 A;  1SJI A;  5D9W A;  2LRN A;  1XVQ A;  3DXB A;  1FOH A;  2YWI A;  2NPB A;  5J5N A;  2PER A;  4OWY A;  4HOJ A;  5CRE A;  5A4U A;  3DVW A;  3VWV A;  4GRF A;  1IYH A;  2PBJ A;  1TK0 B;  2KP2 A;  1QGV A;  3MAK A;  4WBJ A;  2LEG A;  1A23 A;  3GX0 A;  3KEB A;  4MZW A;  3ZML A;  2DJJ A;  3L9S A;  1FAA A;  2A2P A;  2M80 A;  4WEY A;  3NOF A;  2VLU A;  4LL1 B;  1F37 A;  2FWH A;  1GSU A;  1GNE A;  2H66 A;  1PGT A;  2YWM A;  1FHE A;  5LCZ A;  2JAD A;  2MYG A;  4OFT A;  1M2B A;  1A2L A;  3A2W A;  4KW6 A;  1M7T A;  3G9B A;  1ZZY A;  4TR1 B;  4K5R A;  2VCW A;  3TOT A;  3IK7 A;  5ECL B;  3RHB A;  3L9U A;  4IN0 A;  4RQR A;  5IOW A;  4MA9 A;  2TRX A;  1JZD A;  4ML6 A;  1H75 A;  3W6G A;  3HVS A;  3IOS A;  4HUA A;  1FVK A;  4OO4 A;  4Z2U A;  1X5E A;  1YF1 A;  4TR1 A;  4KAE A;  2GGT A;  1KBN A;  4YQM A;  2IMD A;  1XW9 A;  3QR6 A;  4PXO A;  3BJ5 A;  1BJX A;  1GTU A;  1M9B A;  1F3A A;  1XOA A;  2C0G A;  4PQH A;  4RUV A;  1QK8 A;  3LYK A;  1PA3 A;  2JSY A;  1SK2 A;  4KCA A;  3LEF A;  1EV4 A;  4I5Q A;  4V2M A;  3M8N A;  2NBS A;  5DCG A;  2K9F A;  4DVC A;  1I5G A;  5J9C A;  1NHO A;  4JED A;  2R4V A;  2C80 A;  2VL3 A;  3TRQ A;  1UC7 A;  2WUL A;  2ES7 A;  1TKD B;  3BOA A;  3IHG A;  1PFO A;  1O8X A;  1HYU A;  2I4A A;  2AUV A;  4ZL9 A;  2HNL A;  4FYC A;  2QSI A;  3K8N A;  4O5R A;  1M2D A;  4K7I A;  4HDE A;  3HJP A;  3EPT A;  2HLS A;  3GX8 A;  3IR4 A;  3F4S A;  3IC8 A;  1NSW A;  4OO5 A;  1XG8 A;  3TJJ A;  3TJF A;  5A4V A;  2H1D A;  3M9J A;  1F9M A;  4LA1 A;  3VI5 A;  3V1W A;  5DDL A;  4F82 A;  4JE1 A;  3F4R A;  1THO A;  3H4K A;  1X0R A;  4POL A;  2OAD A;  2F51 A;  4G2E A;  2AB6 A;  2CAI A;  4AGS A;  2GTU A;  1W89 A;  1AQW A;  3RHC A;  4QL9 A;  3P7X A;  2B1L A;  4XRA A;  1GUK A;  1SYX A;  1LU4 A;  2DLX A;  2AHE A;  2VLV A;  4L0U A;  2VIM A;  2YN1 A;  3CTG A;  3ZLP A;  2RLI A;  3QCP A;  4LMW A;  3QFB C;  4K7O A;  1ZL9 A;  4K8M A;  1M3I A;  4DSR A;  4K5S A;  2C3T A;  1U3A A;  2H1G A;  4PNF A;  1OE8 A;  1BYE A;  4ISD A;  1AIU A;  2H6Y A;  2PVO C;  2I9H A;  2C3N A;  4CHS A;  1SU9 A;  2L5L A;  5BMU A;  2CX3 A;  5B6M A;  3FZ4 A;  2QC7 A;  4YKF A;  3DKS A;  4ULX A;  1E6B A;  2M72 A;  1G7O A;  2LJR A;  1GTA A;  1OC9 A;  1PD2 1;  5HFK A;  1GRX A;  1R5P A;  4TXO B;  3Q74 A;  11GS A;  2K6V A;  2R0G A;  1EEM A;  4DSQ A;  1ZYP A;  2H1A A;  2MBT A;  2H75 A;  3FR3 A;  2MZC A;  1O85 A;  4XCS A;  3I6A A;  1GP1 A;  1VRS D;  2E7P A;  3GV1 A;  3UMA A;  4TN8 A;  5G31 A;  4TXO A;  1JHB A;  1K0O A;  2ON7 A;  1RK4 A;  2I81 A;  6GSU A;  2ON5 A;  1K0B A;  4YQV A;  1ZMA A;  3TGZ A;  5D9V A;  2GSR A;  3WT1 A;  3IV4 A;  2LKU A;  1TRV A;  3Q19 A;  1GTI A;  2GT5 A;  1K0M A;  2L4C A;  2VCX A;  2E0Q A;  1U87 A;  4POM A;  4EDY A;  4MMM A;  3F3R A;  3LXZ A;  2LS5 A;  3ZZX A;  4ZL7 A;  3HJM A;  16GS A;  4EUY A;  4AJ8 A;  12GS A;  3GNJ A;  4I97 A;  3A5I A;  4PNG A;  3RBT A;  4KH7 A;  3RAZ A;  4EDZ A;  3LOR A;  3I43 A;  4IGJ A;  3P8W A;  1O7U A;  1XCC A;  2FA4 A;  2RUF A;  4FQU A;  4EF0 A;  3ERF A;  1JLW A;  2G0F A;  1SL1 B;  1R5A A;  4TOP A;  3A2X A;  1W4V A;  2NDO A;  1XIY A;  5ECN B;  1B48 A;  1GLP A;  5D9T A;  5CNW A;  2FWG A;  14GS A;  3C1S A;  5F0G A;  5E4W A;  2H1B A;  3BBY A;  2GDR A;  3VLN A;  3UBK A;  4IQ1 A;  5CRH A;  5H5R A;  3F3Q A;  3ZIT A;  2GSS A;  1ST9 A;  4EL1 A;  4BWS A;  3WD6 A;  4X43 A;  3HYP A;  5GST A;  4EKZ A;  1J9B A;  3US3 A;  5B8B A;  3R3E A;  4QL7 A;  2O87 A;  1CQG A;  1GH2 A;  3MIX A;  1XOB A;  2VUP A;  5IPH A;  2JZT A;  1I9D A;  4GSS A;  2PMT A;  3S9F A;  4CY6 A;  3TJB A;  2ZCT A;  4ACS A;  4IVF A;  4K0G A;  4ECC A;  2H72 A;  5C04 A;  2DSA A;  4KND A;  3UBL A;  2VD0 A;  4DSS B;  3L78 A;  5AIX A;  2AYT A;  2QA1 A;  5J9B A;  4GLT A;  1AQV A;  2GST A;  4HU9 A;  4L5L A;  2B3S A;  5ECR B;  2HZE B;  1AUC A;  3VWW A;  4J57 E;  5IMV A;  4WR5 A;  4G19 A;  5FT3 A;  4DSS A;  3HZ4 A;  4PQ1 A;  1NHY A;  4XS1 A;  4WET A;  4POK A;  1EZK A;  2YZH A;  2MMN A;  1PL2 A;  4XS4 B;  3TJK A;  1K0A A;  1A24 A;  2GS3 A;  3A2V A;  1HD2 A;  2FUG 2;  3HVN A;  5D73 A;  1GSQ A;  1GTB A;  2YOI A;  3GFK A;  5HFI A;  2FY6 A;  2IME A;  2VL9 A;  2C0D A;  1URM A;  1C72 A;  1PRX A;  3P2A A;  3TDG A;  3M3M A;  2YNX A;  3GSS A;  4XS4 A;  3APQ A;  4Q5F A;  3J7Y k;  3E0U A;  5DQY A;  1T3B A;  2O89 A;  4OCF A;  4H86 A;  5DJM A;  8GSS A;  4KDU A;  5E59 A;  5ABR A;  3EMP A;  1Z9H A;  2PU9 C;  7GSS A;  5IMA A;  1G6W A;  4NV5 A;  3GKK A;  4OFN A;  1B4P A;  4TRX A;  1SJZ A;  2OE0 A;  5J41 A;  2CVD A;  1K3O A;  3EUR A;  1GSS A;  1SKW B;  2AV4 A;  4MJA A;  4ECJ A;  4MNN A;  2XBQ A;  4O32 A;  3C7M A;  2C8U A;  1OC8 A;  4ZIJ A;  3HDC A;  2HFD A;  4MJB A;  3QD9 A;  2H8L A;  5IO0 A;  2YPM A;  3FHK A;  5ELA A;  4LMV A;  2DJK A;  3MNG A;  6GSV A;  3DD3 A;  2PGT A;  3ZL5 A;  3TB2 A;  1DBY A;  2YJ7 A;  1KEB A;  1TRU A;  1WWJ A;  4O92 A;  2IMF A;  3EYT A;  2D2Z A;  3TOU A;  2LRT A;  5EY6 A;  2PVQ A;  2LQQ A;  4NPB A;  4NAX A;  5GSS A;  2WJU A;  3FZ5 A;  4WR4 A;  2H71 A;  3FEU A;  2LNT A;  3RPN A;  5EPF A;  3F0I A;  2LTK A;  2BTO T;  5IQY A;  1R4W A;  1EP7 A;  3GKM A;  4ZBD A;  3M0F A;  2H0I A;  3FK8 A;  2FLS A;  3KTB A;  3G7Y A;  4KX4 A;  4BVX A;  3KD0 A;  5GZZ B;  4ZBA A;  3L4N A;  4BL7 B;  1EV9 A;  5D9X A;  3D6I A;  1HQO A;  3FRC A;  4XS6 A;  5D93 A;  1WRY A;  3TCO A;  3UL3 A;  1PKZ A;  2X4A A;  5DVB A;  3GKN A;  4BPY A;  2HSY A;  3U6V A;  1O73 A;  1AC1 A;  2FNO A;  4BL7 A;  3EU4 A;  4N0Z A;  2R3X A;  4EXJ A;  2VCV A;  6GSX A;  3IRA A;  2VM1 A;  1HNB A;  4JRR A;  1WJK A;  3TRP A;  3EMX A;  3GUS A;  1A8Y A;  3CQF A;  2V1M A;  4F0B A;  2H01 A;  3H1N A;  2H0H A;  4N0V A;  5JCG A;  3N5O A;  1TJD A;  4F03 A;  3G7J A;  5HQP A;  4XRD A;  3BCK A;  2E2M A;  1JZR A;  1ZCP A;  3PPU A;  2H73 A;  3C73 A;  3KCM A;  4KF9 A;  2P0G A;  3FMW A;  4I6X A;  3VK9 A;  4WXT A;  2K8S A;  4GCI A;  2FD3 A;  2LUS A;  5G5E A;  3KMN A;  2EC4 A;  2QA2 A;  2V41 A;  5IOX A;  3ZRE A;  1HNA A;  2CZ3 A;  3PIN A;  3E9J B;  4PGT A;  4ZL8 A;  3LW9 A;  1GSE A;  1OYJ A;  4TXV A;  3F63 A;  2B5Y A;  3GL5 A;  3ZMK A;  3J7Y b;  5FWG A;  1TI3 A;  2B7J A;  2H30 A;  4YQU A;  3APO A;  2MMA A;  2C0E A;  5A5K A;  5HFG A;  5DJL A;  1BED A;  4MPG A;  3E3E A;  3GKX A;  1DSB A;  3ED3 A;  2IJY A;  3MDK A;  3UAR A;  4IHU A;  6GSS A;  2H19 A;  1V2A A;  4G10 A;  3O76 A;  4RI6 A;  2KOK A;  2VAF A;  1SD9 A;  1VGL A;  2H6Z A;  5F07 A;  2FWE A;  4KUN A;  4YH2 A;  2DIY A;  3DGQ A;  4NHW A;  4IP6 A;  4HZ4 A;  4O5Q A;  1OAZ A;  3ZIJ A;  2OBI A;  1BG5 A;  3H79 A;  5KOX A;  4TVE A;  4KGI A;  1T7P B;  4V2L A;  5J4U A;  2JZS A;  1VF4 A;  4ICY A;  2X64 A;  4OD7 A;  2FA8 A;  5G2Z A;  5LNK e;  5CAX A;  5AIS A;  2HSM A;  2VOC A;  4EO3 A;  1ZGN A;  2DMM A;  3PR8 A;  3LWA A;  3WGD A;  4KDY A;  1OC9 B;  3ZIV A;  2EIR A;  3FR9 A;  2F8A A;  3C71 A;  3W8S A;  3VI7 A;  3BCI A;  1XWK A;  1WOU A;  4K2D A;  1KTE A;  3FR6 A;  5HR1 A;  1MD3 A;  3ZVJ D;  1YEX A;  2X8C A;  1FB0 A;  3KP8 A;  3QFA C;  2FCH A;  2KLX A;  2R0C A;  3SWL A;  4X4J A;  2HXK A;  3BD2 A;  2V6O A;  1GUH A;  2TIR A;  5DQS A;  5FHI A;  5GAP D;  4Q5R A;  2O7K A;  2C3Q A;  2GLR A;  4FH8 A;  2R5G A;  4WF4 A;  2B5X A;  1YJ6 A;  1A0F A;  2X49 A;  5JCW A;  1QFN A;  1X5C A;  4IP1 A;  4XTS A;  1PX7 A;  4MJC A;  1QQ2 A;  1Y25 A;  3FYG A;  3IAS 2;  2HT9 A;  3QMX A;  4K2X A;  2REM A;  1NW2 A;  1G7E A;  5HR2 A;  3CMI A;  1S3C A;  3IA1 A;  4MCU A;  18GS A;  3ERG A;  2LRC A;  2LJK A;  2CZ2 A;  4K1F A;  2HSH A;  1XVW A;  2H70 A;  3TKQ A;  2XPD A;  2IPA A;  3TKS A;  4KB3 A;  1O8W A;  2CV4 A;  2HE3 A;  4MAB A;  3VFI A;  2OKA A;  4L0W A;  1YDK A;  1YKA A;  1MTC A;  1F6M C;  3GUR A;  4X1U A;  1PL1 A;  5CYY A;  3ERW A;  4MDC A;  5EVO A;  3LG6 A;  2E2G A;  1GSF A;  4DEJ A;  4JBB A;  3FW2 A;  1K0C A;  1SL2 B;  5ECH B;  1N2A A;  3KXO A;  2CVB A;  2NTO A;  1TW9 A;  3HKR A;  4MZB A;  1S3R A;  3VWX A;  2X99 A;  1OKT A;  3HVX A;  5KOW A;  5H5Q A;  4MF7 A;  5IM9 A;  2B6M A;  1QXH A;  1PN9 A;  3LQ7 A;  3ME8 A;  3APS A;  3R2Q A;  1PMT A;  5ECK B;  2JL4 A;  2PN8 A;  2GQM A;  1FOV A;  5ECS A;  5B6N A;  2WRT A;  4HSC X;  1G0T A;  1YQ1 A;  1T4Z A;  1EWX A;  5ECP B;  4JU5 A;  1ACV A;  4HJ2 A;  1MDI A;  3EWL A;  4MK3 A;  1MDJ A;  4Z7X A;  1YEP A; 
#chains in the Genus database with same CATH homology
 2HRF A;  4GWR A;  2VL2 C;  5D8I A;  3KH9 A;  1ILO A;  3WGE A;  5H5S A;  2R2J A;  3N9J A;  4OFM A;  5A4W A;  1R26 A;  2FGX A;  1YF0 A;  2V2G A;  4FYU A;  4GQC A;  1BQ7 A;  3WGX A;  1G6Y A;  3D21 A;  2QKE A;  4WKW A;  1WMJ A;  2WGR A;  3GA4 A;  2OAC A;  3LYP A;  3HVV A;  4IKH A;  4YAV A;  4GST A;  5ID2 A;  1YY7 A;  1FG4 A;  4KSM A;  4GTU A;  2RUE A;  3DRN A;  1K3L A;  1OVN A;  5F8B A;  4WBR D;  1O81 A;  4MZC A;  2GQK A;  3IXR A;  3LFL A;  1TK8 B;  1K3Y A;  1YKC A;  3NIV A;  1F2E A;  2PWJ A;  3QDN A;  2N5F A;  4ZXG A;  2GSQ A;  4Q5N A;  4HS1 A;  1SL0 B;  2F3M A;  4IW9 A;  4AF2 A;  2P5R A;  4KSO A;  4KCE A;  5CRW A;  4KE3 A;  4J56 E;  4O5U A;  2VL2 A;  6GSY A;  2A2R A;  3CSH A;  2DIZ A;  5COH A;  3IDV A;  1O6J A;  4CW9 A;  3KGK A;  3KIJ A;  3EE2 A;  5AGY A;  1H4O A;  4ZB8 A;  1OKD A;  3HHV A;  3L9V A;  4TR0 A;  1OC3 A;  1MDK A;  2PUK C;  3LXT A;  2XBI A;  3ZVJ A;  4IS0 A;  1ABA A;  1XBS A;  1QUW A;  3QAW A;  3QPM A;  9GSS A;  4TR4 A;  5IPG A;  2P31 A;  5DAK B;  5D96 A;  2KP1 A;  3GST A;  4MH3 A;  4O7H A;  1Q4J A;  3CBU A;  3IE3 A;  2C0F A;  2LST A;  4MJE A;  4MF6 A;  5DAL B;  3TKP A;  5ECO B;  4NHZ A;  3M9K A;  3GTU B;  3DML A;  4Z2T A;  5AN1 A;  5L71 A;  1TU7 A;  2WB9 A;  4X0X A;  1V9W A;  1A2J A;  4RI7 A;  2AJQ B;  5GAN D;  4P3Y B;  5DAK A;  2C4J A;  2YWN A;  3H8Q A;  1ZOF A;  3VPT A;  3P90 A;  4ZBB A;  3KTL A;  4PUF C;  1X9W B;  3TRX A;  5DAL A;  1A2M A;  4ILF A;  3GTU A;  1ML6 A;  2EIO A;  5KN0 A;  3DEX A;  1B9Y C;  6GST A;  3D5J A;  3W8J A;  2R0P A;  2XC2 A;  2F9S A;  4BA7 A;  4NMU A;  1DUG A;  5CP1 A;  4OCE A;  1Z5Y E;  4YKG A;  4ECB A;  4GQF A;  3UJ1 A;  2VD1 A;  3F9U A;  4KDX A;  4BVX B;  3IHQ A;  3GIX A;  4HU7 A;  1GSD A;  4OMV A;  1X9S B;  1T1V A;  4JR4 A;  1SEN A;  1VF2 A;  4YAP A;  2CX4 A;  2H76 A;  1TRW A;  3D0Z A;  1VF3 A;  3FZ9 A;  1EEJ A;  2HYX A;  4PTS A;  3UVH A;  2DC5 A;  2ALB A;  1XFL A;  4GF0 A;  1XWC A;  5J3R A;  3KZQ A;  1FW1 A;  1B9X C;  2YP6 A;  2IMI A;  4KA0 A;  1M2A A;  5EL8 A;  3I69 A;  2YZU A;  1FO5 A;  2R37 A;  4HI7 A;  5IMD A;  4LLR A;  1FB6 A;  4MP4 A;  3VPQ A;  3TKS E;  4PX1 A;  5B8A A;  1PSQ A;  4J2F A;  2O8V B;  4WF5 A;  3O6T A;  1RQM A;  1PN0 A;  2JU5 A;  4D73 B;  2WZ9 A;  4K9Z A;  2VCQ A;  2BMX A;  4HEA 2;  4ID0 A;  2GT6 A;  3CRU A;  4V2N A;  3WYW A;  1M99 A;  1ERT A;  3O3T A;  1Y6E A;  4K7N A;  5ECQ B;  1NM3 A;  4MH2 A;  3IBH A;  1RW1 A;  4IBP A;  2H74 A;  1WE0 A;  1LBK A;  4D73 A;  2HRA A;  4IJI A;  4EIQ A;  5IMZ A;  2DJ2 A;  4ECI A;  6GSW A;  3GMF A;  3L0H A;  2N5B A;  2VM2 A;  1BX9 A;  5JWO B;  3KM6 A;  1UA5 A;  3ZFL A;  3QOU A;  1IYI A;  3LGC A;  4Q5Q A;  1J0F A;  3KP9 A;  2PPT A;  3A3T A;  1Z6N A;  2FHE A;  3SBC A;  4TKY A;  3UIW A;  4BWQ A;  1PX6 A;  5ECI B;  1DE1 A;  3KH7 A;  1M0U A;  1CQH A;  1TRS A;  2CQ9 A;  2TRC P;  3UVT A;  3GYK A;  3GH6 A;  1J08 A;  1EOH A;  3F6D A;  2GZY A;  3QAG A;  1QMV A;  3CXG A;  3GRX A;  2Z9S A;  2UZ8 A;  2GZP A;  1TU8 A;  1TK5 B;  4MF5 A;  2RII A;  3MYD A;  4V1A p;  3LSZ A;  2GVP A;  1T00 A;  2YCD A;  4F2I A;  2RM5 A;  3DYR A;  3I9V 2;  5G30 A;  1EGO A;  2A2S A;  1DE2 A;  3D4M A;  2HI7 A;  4N10 A;  2R6K A;  3RPP A;  1ZYQ B;  5CRG A;  2CT6 A;  1X9M B;  5KN2 A;  5KN1 A;  1ON4 A;  3G7I A;  3C8E A;  1XWB A;  5LD0 A;  5KN3 A;  1Z7P A;  2JSZ A;  2X8H A;  2RM6 A;  2L4Q A;  1GUM A;  4V1A g;  5INY A;  1GLQ A;  1F3B A;  1XPV A;  3PH9 A;  2DJ1 A;  1USB A;  5G1K A;  4NWY A;  3HZ8 A;  3HD5 A;  4I8B A;  2OE1 A;  1A0R P;  19GS A;  3HA9 A;  2HZF A;  3TKS C;  1KNG A;  3FKF A;  2GQL A;  2L5O A;  3GL3 A;  2IMK A;  1UVZ A;  2ZNM A;  3D22 A;  5IMF A;  2F8F A;  4AJ6 A;  3CSI A;  4L5O A;  2VO4 A;  1K0N A;  2VLT A;  1V98 A;  2JAC A;  3IAM 2;  4JZQ A;  1AQX A;  2VCT A;  1ERV A;  4EE0 A;  2WS2 A;  3A5W A;  3FZA A;  3UAP A;  2MMZ A;  2H6X A;  2K8V A;  4ZB6 A;  1ZYN A;  4QQ7 A;  4EIP A;  3EU3 A;  1S3A A;  2V6K A;  4USS A;  1B8X A;  5IIZ A;  3H93 A;  3GHA A;  3C1R A;  4AJ7 A;  5DCH A;  3QAV A;  4MLY A;  4N11 A;  5HR0 A;  1PQN A;  2EIQ A;  2KHP A;  2IWT A;  2J23 A;  2H0G A;  3GN3 A;  2IFQ B;  1K0D A;  4EVM A;  1Z3E A;  5AIV A;  4I2U A;  5CRD A;  4NV2 A;  4XIH A;  2DML A;  2LQO A;  1U88 A;  2DJ3 A;  5CO3 A;  5G5F A;  2IFQ A;  3KMO A;  3DWV A;  3VWU A;  2WCI A;  1N8J A;  1SJ6 A;  3TUE A;  5BRT A;  1SK1 A;  1V58 A;  1XW6 A;  2DBC A;  2BJX A;  4N30 A;  5IMC A;  4BVY B;  2B5E A;  3VUR A;  3ME7 A;  5HR3 A;  1SD8 A;  1E2Y A;  2KUC A;  2CAQ A;  3HJO A;  5JWQ B;  1Q98 A;  3HXS A;  4K6X A;  1VF1 A;  1FVJ A;  2CVK A;  1AAZ A;  4POB A;  3HY2 A;  2LV3 A;  4LL4 B;  4ZIL A;  4BVY A;  2I1U A;  4G0I A;  4E8H A;  3Q18 A;  4I2T A;  1TTZ A;  2V32 A;  2L6D A;  5DBQ A;  5ENU A;  4PUA A;  1XZO A;  3EIN A;  1T4Y A;  2YV9 A;  4HJM A;  5G1L A;  2X8G A;  3NZN A;  3KJY A;  3F6F A;  2WFC A;  4CY8 A;  3CSJ A;  3OR5 A;  4XHM A;  1GUL A;  3IPZ A;  1AXD A;  3D4T A;  1XWA A;  5F06 A;  2P5Q A;  2YJH A;  2FWF A;  1JZO A;  3CYN A;  3TJG A;  10GS A;  2J9H A;  2L57 A;  5ID2 B;  1TI1 A;  5ECM B;  2AAW A;  3ZRD A;  20GS A;  2DJ0 A;  3HCZ A;  4G0L A;  4E8E A;  1TXX A;  3IC4 A;  4PQI A;  4F0C A;  1XXU A;  2OE3 A;  3F8U A;  1SKR B;  2IL3 A;  3EC3 A;  2HRK A;  1XW5 A;  1UN2 A;  1ERW A;  1WPI A;  5C00 A;  2B1K A;  1TDI A;  1MD4 A;  4FYB A;  2MBS A;  4A5P A;  3MSZ A;  5ELG A;  1T8E B;  3CTF A;  1GSY A;  1EP8 A;  2WDU A;  1V57 A;  1X5D A;  1ZYE A;  1JFU A;  5IO2 A;  1WIK A;  2NVL A;  3ZFB A;  3PGT A;  4Z2R A;  2L59 A;  2JZR A;  2IIY A;  4TR3 A;  2LNS A;  1TP9 A;  2YAN A;  2B7K A;  4EC0 A;  2QGV A;  1Z6M A;  2A4H A;  3UOM A;  1ERU A;  4FIW A;  4G0K A;  1XWG A;  5B7C A;  1U6T A;  3LJR A;  3RDW A;  1GWC A;  4FO5 A;  1SKS B;  2HZE A;  1R7H A;  5KEJ A;  2K18 A;  5JCU A;  1V40 A;  22GS A;  2G2Q A;  4IQA A;  2L6C A;  2OJL A;  2I3Y A;  4ZB9 A;  2MMO A;  5JWR B;  2O85 A;  3U5R E;  2LJA A;  2N5A A;  1PKW A;  3WT2 A;  3AY8 A;  3ZYW A;  2DKI A;  1EOG A;  1A8L A;  5F05 A;  1M9A A;  1SYR A;  4JR6 A;  3JCM L;  1BAY A;  4MPF A;  1WP0 A;  4F9Z A;  4CDO A;  1THX A;  3FY7 A;  1GL8 A;  2VCZ A;  4TW5 A;  1EGR A;  1GNW A;  1U3I A;  2DKH A;  2GZZ A;  3UEM A;  3Q6O A;  3DVX A;  4IJ3 A;  4K0N A;  13GS A;  2YWO A;  1MEK A;  2ZUP A;  3ISO A;  3F4T A;  2XPE A;  1JZW A;  4HQZ A;  1HNC A;  4NXI A;  1S3D A;  4GXZ A;  2CA8 A;  1AW9 A;  1TOF A;  4RQX A;  17GS A;  1LJR A;  3MWH A;  1JLV A;  3IK9 A;  4L8E A;  4G9H A;  2C1Y A;  2OA7 A;  3DIE A;  2XHF A;  4HQS A;  4GSN A;  3CRT A;  2IN3 A;  2A4V A;  3M1G A;  3TKR A;  1B4Q A;  4PUR A;  1YZX A;  1OE7 A;  2M46 A;  1SK0 A;  3ZTL A;  4IEL A;  4ML1 A;  2OBK A;  2YV7 A;  4HZ2 A;  3EVI A;  1Z7R A;  2HRN A;  3GH9 A;  1SJI A;  5D9W A;  2LRN A;  1XVQ A;  3DXB A;  1FOH A;  2YWI A;  2NPB A;  5J5N A;  2PER A;  4OWY A;  4HOJ A;  5CRE A;  5A4U A;  3DVW A;  3VWV A;  4GRF A;  1IYH A;  2PBJ A;  1TK0 B;  2KP2 A;  1QGV A;  3MAK A;  4WBJ A;  2LEG A;  1A23 A;  3GX0 A;  3KEB A;  4MZW A;  3ZML A;  2DJJ A;  3L9S A;  1FAA A;  2A2P A;  2M80 A;  4WEY A;  3NOF A;  2VLU A;  4LL1 B;  1F37 A;  2FWH A;  1GSU A;  1GNE A;  2H66 A;  1PGT A;  2YWM A;  1FHE A;  5LCZ A;  2JAD A;  2MYG A;  4OFT A;  1M2B A;  1A2L A;  3A2W A;  4KW6 A;  1M7T A;  3G9B A;  1ZZY A;  4TR1 B;  4K5R A;  2VCW A;  3TOT A;  3IK7 A;  5ECL B;  3RHB A;  3L9U A;  4IN0 A;  4RQR A;  5IOW A;  4MA9 A;  2TRX A;  1JZD A;  4ML6 A;  1H75 A;  3W6G A;  3HVS A;  3IOS A;  4HUA A;  1FVK A;  4OO4 A;  4Z2U A;  1X5E A;  1YF1 A;  4TR1 A;  4KAE A;  2GGT A;  1KBN A;  4YQM A;  2IMD A;  1XW9 A;  3QR6 A;  4PXO A;  3BJ5 A;  1BJX A;  1GTU A;  1M9B A;  1F3A A;  1XOA A;  2C0G A;  4PQH A;  4RUV A;  1QK8 A;  3LYK A;  1PA3 A;  2JSY A;  1SK2 A;  4KCA A;  3LEF A;  1EV4 A;  4I5Q A;  4V2M A;  3M8N A;  2NBS A;  5DCG A;  2K9F A;  4DVC A;  1I5G A;  5J9C A;  1NHO A;  4JED A;  2R4V A;  2C80 A;  2VL3 A;  3TRQ A;  1UC7 A;  2WUL A;  2ES7 A;  1TKD B;  3BOA A;  3IHG A;  1O8X A;  1HYU A;  2I4A A;  2AUV A;  4ZL9 A;  2HNL A;  4FYC A;  2QSI A;  3K8N A;  4O5R A;  1M2D A;  4K7I A;  4HDE A;  3HJP A;  3EPT A;  2HLS A;  3GX8 A;  3IR4 A;  3F4S A;  3IC8 A;  1NSW A;  4OO5 A;  3TJJ A;  3TJF A;  5A4V A;  2H1D A;  3M9J A;  1F9M A;  4LA1 A;  3VI5 A;  3V1W A;  5DDL A;  4F82 A;  4JE1 A;  3F4R A;  1THO A;  3H4K A;  1X0R A;  4POL A;  2OAD A;  2F51 A;  4G2E A;  2AB6 A;  2CAI A;  4AGS A;  2GTU A;  1W89 A;  1AQW A;  3RHC A;  4QL9 A;  3P7X A;  2B1L A;  4XRA A;  1GUK A;  1SYX A;  1LU4 A;  2DLX A;  2AHE A;  2VLV A;  4L0U A;  2VIM A;  2YN1 A;  3CTG A;  3ZLP A;  2RLI A;  3QCP A;  4LMW A;  3QFB C;  4K7O A;  1ZL9 A;  4K8M A;  4DSR A;  4K5S A;  2C3T A;  1U3A A;  2H1G A;  4PNF A;  1OE8 A;  1BYE A;  4ISD A;  1AIU A;  2H6Y A;  2PVO C;  2I9H A;  2C3N A;  4CHS A;  1SU9 A;  2L5L A;  5BMU A;  2CX3 A;  5B6M A;  3FZ4 A;  2QC7 A;  4YKF A;  3DKS A;  4ULX A;  1E6B A;  2M72 A;  1G7O A;  2LJR A;  1GTA A;  1OC9 A;  1PD2 1;  5HFK A;  1GRX A;  1R5P A;  4TXO B;  3Q74 A;  11GS A;  2K6V A;  2R0G A;  1EEM A;  4DSQ A;  1ZYP A;  2H1A A;  2MBT A;  2H75 A;  3FR3 A;  2MZC A;  1O85 A;  4XCS A;  3I6A A;  1GP1 A;  1VRS D;  2E7P A;  3GV1 A;  3UMA A;  4TN8 A;  5G31 A;  4TXO A;  1JHB A;  1K0O A;  2ON7 A;  1RK4 A;  2I81 A;  6GSU A;  2ON5 A;  1K0B A;  4YQV A;  1ZMA A;  3TGZ A;  5D9V A;  2GSR A;  3WT1 A;  3IV4 A;  2LKU A;  1TRV A;  3Q19 A;  1GTI A;  2GT5 A;  1K0M A;  2L4C A;  2VCX A;  2E0Q A;  1U87 A;  4POM A;  4EDY A;  4MMM A;  3F3R A;  3LXZ A;  2LS5 A;  3ZZX A;  4ZL7 A;  3HJM A;  16GS A;  4EUY A;  4AJ8 A;  12GS A;  3GNJ A;  4I97 A;  3A5I A;  4PNG A;  3RBT A;  4KH7 A;  3RAZ A;  4EDZ A;  3LOR A;  3I43 A;  4IGJ A;  3P8W A;  1O7U A;  1XCC A;  2FA4 A;  2RUF A;  4FQU A;  4EF0 A;  3ERF A;  1JLW A;  2G0F A;  1SL1 B;  1R5A A;  4TOP A;  3A2X A;  1W4V A;  2NDO A;  1XIY A;  5ECN B;  1B48 A;  1GLP A;  5D9T A;  5CNW A;  2FWG A;  14GS A;  3C1S A;  5F0G A;  5E4W A;  2H1B A;  3BBY A;  2GDR A;  3VLN A;  3UBK A;  4IQ1 A;  5CRH A;  5H5R A;  3F3Q A;  3ZIT A;  2GSS A;  1ST9 A;  4EL1 A;  4BWS A;  3WD6 A;  4X43 A;  3HYP A;  5GST A;  4EKZ A;  1J9B A;  3US3 A;  5B8B A;  3R3E A;  4QL7 A;  2O87 A;  1CQG A;  1GH2 A;  3MIX A;  1XOB A;  2VUP A;  5IPH A;  2JZT A;  1I9D A;  4GSS A;  2PMT A;  3S9F A;  4CY6 A;  3TJB A;  2ZCT A;  4ACS A;  4IVF A;  4K0G A;  4ECC A;  2H72 A;  5C04 A;  2DSA A;  4KND A;  3UBL A;  2VD0 A;  4DSS B;  3L78 A;  5AIX A;  2AYT A;  2QA1 A;  5J9B A;  4GLT A;  1AQV A;  2GST A;  4HU9 A;  4L5L A;  2B3S A;  5ECR B;  2HZE B;  1AUC A;  3VWW A;  4J57 E;  5IMV A;  4WR5 A;  4G19 A;  5FT3 A;  4DSS A;  3HZ4 A;  4PQ1 A;  1NHY A;  4XS1 A;  4WET A;  4POK A;  1EZK A;  2YZH A;  2MMN A;  1PL2 A;  4XS4 B;  3TJK A;  1K0A A;  1A24 A;  2GS3 A;  3A2V A;  1HD2 A;  2FUG 2;  5D73 A;  1GSQ A;  1GTB A;  2YOI A;  3GFK A;  5HFI A;  2FY6 A;  2IME A;  2VL9 A;  2C0D A;  1URM A;  1C72 A;  1PRX A;  3P2A A;  3TDG A;  3M3M A;  2YNX A;  3GSS A;  4XS4 A;  3APQ A;  4Q5F A;  3J7Y k;  3E0U A;  5DQY A;  1T3B A;  2O89 A;  4OCF A;  4H86 A;  5DJM A;  8GSS A;  4KDU A;  5E59 A;  5ABR A;  3EMP A;  1Z9H A;  2PU9 C;  7GSS A;  5IMA A;  1G6W A;  4NV5 A;  3GKK A;  4OFN A;  1B4P A;  4TRX A;  1SJZ A;  2OE0 A;  5J41 A;  2CVD A;  1K3O A;  3EUR A;  1GSS A;  1SKW B;  2AV4 A;  4MJA A;  4ECJ A;  4MNN A;  2XBQ A;  4O32 A;  3C7M A;  2C8U A;  1OC8 A;  4ZIJ A;  3HDC A;  2HFD A;  4MJB A;  3QD9 A;  2H8L A;  5IO0 A;  2YPM A;  3FHK A;  5ELA A;  4LMV A;  2DJK A;  3MNG A;  6GSV A;  3DD3 A;  2PGT A;  3ZL5 A;  3TB2 A;  1DBY A;  2YJ7 A;  1KEB A;  1TRU A;  1WWJ A;  4O92 A;  2IMF A;  3EYT A;  2D2Z A;  3TOU A;  2LRT A;  5EY6 A;  2PVQ A;  2LQQ A;  4NPB A;  4NAX A;  5GSS A;  2WJU A;  3FZ5 A;  4WR4 A;  2H71 A;  3FEU A;  2LNT A;  3RPN A;  5EPF A;  3F0I A;  2LTK A;  2BTO T;  5IQY A;  1R4W A;  1EP7 A;  3GKM A;  4ZBD A;  3M0F A;  2H0I A;  3FK8 A;  2FLS A;  3KTB A;  3G7Y A;  4KX4 A;  4BVX A;  3KD0 A;  5GZZ B;  4ZBA A;  3L4N A;  4BL7 B;  1EV9 A;  5D9X A;  3D6I A;  1HQO A;  3FRC A;  4XS6 A;  5D93 A;  1WRY A;  3TCO A;  3UL3 A;  1PKZ A;  2X4A A;  5DVB A;  3GKN A;  4BPY A;  2HSY A;  3U6V A;  1O73 A;  1AC1 A;  2FNO A;  4BL7 A;  3EU4 A;  4N0Z A;  2R3X A;  4EXJ A;  2VCV A;  6GSX A;  3IRA A;  2VM1 A;  1HNB A;  4JRR A;  1WJK A;  3TRP A;  3EMX A;  3GUS A;  1A8Y A;  2V1M A;  4F0B A;  2H01 A;  3H1N A;  2H0H A;  4N0V A;  5JCG A;  3N5O A;  1TJD A;  4F03 A;  3G7J A;  5HQP A;  4XRD A;  3BCK A;  2E2M A;  1JZR A;  1ZCP A;  3PPU A;  2H73 A;  3C73 A;  3KCM A;  4KF9 A;  2P0G A;  3FMW A;  4I6X A;  3VK9 A;  4WXT A;  2K8S A;  4GCI A;  2FD3 A;  2LUS A;  5G5E A;  3KMN A;  2EC4 A;  2QA2 A;  2V41 A;  5IOX A;  3ZRE A;  1HNA A;  2CZ3 A;  3PIN A;  3E9J B;  4PGT A;  4ZL8 A;  3LW9 A;  1GSE A;  1OYJ A;  4TXV A;  3F63 A;  2B5Y A;  3GL5 A;  3ZMK A;  3J7Y b;  5FWG A;  1TI3 A;  2B7J A;  2H30 A;  4YQU A;  3APO A;  2MMA A;  2C0E A;  5A5K A;  5HFG A;  5DJL A;  1BED A;  4MPG A;  3E3E A;  3GKX A;  1DSB A;  3ED3 A;  2IJY A;  3MDK A;  3UAR A;  4IHU A;  6GSS A;  2H19 A;  1V2A A;  4G10 A;  3O76 A;  4RI6 A;  2KOK A;  2VAF A;  1SD9 A;  1VGL A;  2H6Z A;  5F07 A;  2FWE A;  4KUN A;  4YH2 A;  2DIY A;  3DGQ A;  4NHW A;  4IP6 A;  4HZ4 A;  4O5Q A;  1OAZ A;  3ZIJ A;  2OBI A;  1BG5 A;  3H79 A;  5KOX A;  4TVE A;  4KGI A;  1T7P B;  4V2L A;  5J4U A;  2JZS A;  1VF4 A;  4ICY A;  2X64 A;  4OD7 A;  2FA8 A;  5G2Z A;  5LNK e;  5CAX A;  5AIS A;  2HSM A;  2VOC A;  4EO3 A;  1ZGN A;  2DMM A;  3PR8 A;  3LWA A;  3WGD A;  4KDY A;  1OC9 B;  3ZIV A;  2EIR A;  3FR9 A;  2F8A A;  3C71 A;  3W8S A;  3VI7 A;  3BCI A;  1XWK A;  1WOU A;  4K2D A;  1KTE A;  3FR6 A;  5HR1 A;  1MD3 A;  3ZVJ D;  1YEX A;  2X8C A;  1FB0 A;  3KP8 A;  3QFA C;  2FCH A;  2KLX A;  2R0C A;  3SWL A;  4X4J A;  2HXK A;  3BD2 A;  2V6O A;  1GUH A;  2TIR A;  5DQS A;  5FHI A;  5GAP D;  4Q5R A;  2O7K A;  2C3Q A;  2GLR A;  4FH8 A;  2R5G A;  4WF4 A;  2B5X A;  1YJ6 A;  1A0F A;  2X49 A;  5JCW A;  1QFN A;  1X5C A;  4IP1 A;  4XTS A;  1PX7 A;  4MJC A;  1QQ2 A;  1Y25 A;  3FYG A;  3IAS 2;  2HT9 A;  3QMX A;  4K2X A;  2REM A;  1NW2 A;  1G7E A;  5HR2 A;  3CMI A;  1S3C A;  3IA1 A;  4MCU A;  18GS A;  3ERG A;  2LRC A;  2LJK A;  2CZ2 A;  4K1F A;  2HSH A;  1XVW A;  2H70 A;  3TKQ A;  2XPD A;  2IPA A;  3TKS A;  4KB3 A;  1O8W A;  2CV4 A;  2HE3 A;  4MAB A;  3VFI A;  2OKA A;  4L0W A;  1YDK A;  1YKA A;  1MTC A;  1F6M C;  3GUR A;  4X1U A;  1PL1 A;  5CYY A;  3ERW A;  4MDC A;  5EVO A;  3LG6 A;  2E2G A;  1GSF A;  4DEJ A;  4JBB A;  3FW2 A;  1K0C A;  1SL2 B;  5ECH B;  1N2A A;  3KXO A;  2CVB A;  2NTO A;  1TW9 A;  3HKR A;  4MZB A;  3VWX A;  2X99 A;  1OKT A;  3HVX A;  5KOW A;  5H5Q A;  4MF7 A;  5IM9 A;  2B6M A;  1QXH A;  1PN9 A;  3LQ7 A;  3ME8 A;  3APS A;  3R2Q A;  1PMT A;  5ECK B;  2JL4 A;  2PN8 A;  2GQM A;  1FOV A;  5ECS A;  5B6N A;  2WRT A;  1G0T A;  1YQ1 A;  1T4Z A;  1EWX A;  5ECP B;  4JU5 A;  1ACV A;  4HJ2 A;  1MDI A;  3EWL A;  4MK3 A;  1MDJ A;  4Z7X A;  1YEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...