1DE1A

Nmr structures of oxidized bacteriophage t4 glutaredoxin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
87
structure length
87
Chain Sequence
MFKVYGYDSNIHKCVYCDNAKRLLTVKKQPFEFINIMPEKGVFDDEKIAELLTKLGRDTQIGLTMPQVFAPDGSHIGGFDQLREYFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords GLUTAREDOXIN
publication title Solution structures of reduced and oxidized bacteriophage T4 glutaredoxin.
pubmed doi rcsb
total genus 15
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 1999-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1de1A00
4HJ2A 3UARA 1T4ZA 3ZVJD 1K0BA 5A5KA 3VFIA 4FYUA 3PINA 5ENUA 3QFAC 3DVXA 2YCDA 3ZZXA 5D9WA 1A0FA 1XVQA 1A23A 2HLSA 2O87A 3GURA 4RI6A 1NHYA 5GAPD 1QGVA 3WT1A 1M2AA 3KZQA 5KEJA 1SK0A 2CQ9A 5IOXA 5ECQB 2L4QA 4LL4B 4J57E 3ERWA 3Q18A 2HFDA 3DWVA 3TJBA 5G2ZA 1ST9A 2OE0A 2JZRA 4N30A 1LBKA 5ECSA 2M80A 2CA8A 1FO5A 3QR6A 1SKWB 4MA9A 2GSSA 5IPHA 3GV1A 1NW2A 4PXOA 4KX4A 2GZZA 1ABAA 2VM1A 3Q19A 4WR4A 2GSRA 2H19A 4TR1A 2D2ZA 2JACA 4XIHA 3CXGA 4ECJA 1XOAA 2FCHA 3CSJA 3UIWA 3ZL5A 1LU4A 5D96A 2LQOA 2DJ0A 3GA4A 5EVOA 5ECKB 3TKRA 1TRWA 3QFBC 3FKFA 3TB2A 1YEXA 4TR1B 5IMDA 3GX0A 3HVSA 5ECPB 1DE2A 3Q74A 1SD8A 2E0QA 4DSRA 4ZB6A 1B4QA 14GSA 4NXIA 4MZCA 2IMFA 2DC5A 2KUCA 2RLIA 2MMAA 2ON7A 4J2FA 3QDNA 4K7NA 1TK0B 2O89A 2IL3A 1GLQA 1A8YA 3KMOA 1A2MA 4GTUA 4I2UA 1GSEA 2GSTA 2H1AA 5D9TA 3C1RA 4IP1A 2CAIA 1EEMA 5D73A 1UN2A 1JFUA 2O8VB 3C71A 3F4RA 1DUGA 3FR3A 3EU3A 1AQXA 2I9HA 1K0DA 1F9MA 2B5EA 1VF4A 5IMFA 1JZDA 4OFNA 1B4PA 5HR2A 3FR9A 1GWCA 5D93A 2H0GA 1QFNA 2N5AA 2OBKA 2QKEA 2M46A 4EF0A 3VI7A 4KA0A 3FRCA 1YDKA 5L71A 5COHA 4HU9A 3ED3A 3LJRA 1GTBA 3RBTA 1GNEA 3EMXA 3QAWA 2R5GA 3UJ1A 1VF2A 5KN2A 5DCGA 3ZMKA 3IK9A 5AIXA 2M72A 1U6TA 4ECCA 5D9VA 19GSA 2P31A 3TRPA 4XRAA 3ZFBA 2GQLA 4Q5NA 6GSTA 4ZL9A 2FUG2 2A4VA 1X9MB 4MP4A 3HVVA 3GH6A 2YWOA 1JZOA 4KUNA 4TOPA 5GSSA 3KH9A 1U3IA 2H1GA 3P7XA 2MMNA 4IW9A 2H74A 2PN8A 1RQMA 5CRGA 5JWOB 3H4KA 3HJPA 1NSWA 2RUFA 2WZ9A 4MJAA 2VUPA 3BD2A 3US3A 1JHBA 2L6CA 1PX7A 5KN3A 4E8HA 1PL1A 4O92A 2REMA 1WWJA 1F3AA 3IAS2 4KE3A 1IYIA 2VCWA 4N0ZA 2JSYA 6GSSA 3IC4A 1QK8A 1B8XA 4EUYA 1VF1A 2L6DA 5J5NA 4JU5A 3FW2A 1ZZYA 5JWQB 2H6XA 2PVQA 5HR1A 1S3AA 1EOGA 1N2AA 3NIVA 2FHEA 3FZAA 1G7EA 2O7KA 3D21A 3GSSA 3LGCA 3HHVA 2DJ1A 2B5XA 1XZOA 5FHIA 5G30A 4PQIA 1QXHA 3ME7A 3G7IA 1PMTA 4V1Ag 1Z9HA 4K1FA 4WBRD 2VL3A 4P3YB 3GKNA 5FWGA 4O32A 3DIEA 2H66A 2DJJA 2L5LA 5B6NA 1A8LA 2XPDA 2HT9A 2FA4A 1SK2A 2FD3A 2C0FA 1GNWA 1ACVA 1MEKA 2JU5A 3IOSA 1TP9A 5LCZA 3LORA 3SBCA 1K0NA 4TR4A 4X1UA 1GULA 1ZYEA 3ISOA 2GGTA 2WRTA 4Q5QA 2FWHA 3UVHA 5ECOB 1MDKA 3QAVA 3F4TA 1YKCA 2I1UA 1TRVA 2LTKA 1FW1A 1XWGA 3G9BA 5IMCA 4POLA 3D5JA 4PNFA 3BBYA 4HEA2 4DVCA 3F3RA 3F0IA 3IDVA 3WGEA 5HFKA 1HNCA 1XBSA 3GKKA 4KH7A 3GFKA 1GSDA 5IPGA 1YY7A 2FLSA 1GUHA 3HCZA 2JSZA 3LWAA 2H1DA 1TOFA 1T7PB 1XPVA 1YF0A 3V1WA 3CTFA 4X43A 3EVIA 5JCWA 2QSIA 3ZREA 1PRXA 4JZQA 5LNKe 4NV2A 5ECLB 2VLTA 2FY6A 1B48A 3TKSE 1YEPA 3BCIA 2PUKC 2CV4A 2I4AA 3G7JA 2FA8A 4OO5A 1FB0A 4DSQA 2E2MA 3TUEA 1THOA 5HFIA 2C0GA 1DBYA 1NM3A 4F82A 3DKSA 3VPQA 2H1BA 1KTEA 3OR5A 4RQXA 3LG6A 5GZZB 2HI7A 3VWUA 2DMMA 22GSA 2L57A 1EP7A 1F6MC 4PX1A 1SK1A 3BOAA 2H70A 4BL7A 3ME8A 4TR3A 1O85A 3IE3A 4OCEA 3KMNA 2ZUPA 3TJKA 3N9JA 1V9WA 5ELGA 4IVFA 4I2TA 4PURA 2IJYA 5A4UA 2MYGA 1PL2A 3MAKA 3TJGA 7GSSA 2R3XA 4MLYA 2GVPA 3QPMA 4XS6A 5DCHA 2LJAA 4TVEA 1OAZA 3SWLA 4OO4A 2VCQA 5E59A 3QOUA 1T3BA 4H86A 4O5RA 4PQ1A 2RIIA 4KSMA 4ML6A 2LJKA 3EINA 4G19A 2VLVA 2ES7A 3F6FA 1I9DA 5IM9A 4F2IA 18GSA 1HQOA 2NBSA 3O76A 1YJ6A 3L0HA 4G2EA 5AN1A 4MH3A 3L9SA 3Q6OA 1BYEA 2IMIA 4GQCA 4XCSA 5ELAA 2YV7A 2B6MA 4XTSA 5ECRB 5ECMB 1MDJA 1Z6MA 3QMXA 4MF5A 2LRTA 4WF5A 1TRUA 1Z3EA 2DJKA 2PERA 2C1YA 3D0ZA 1GRXA 1WRYA 1FOVA 1XCCA 2I81A 2PPTA 2IMEA 1EGOA 2N5BA 1X5CA 4EDYA 2C4JA 3FHKA 3LXZA 2IWTA 2F51A 4K6XA 3WYWA 1K3YA 2HE3A 2J23A 2YWMA 3H93A 2B7JA 1MDIA 1WPIA 1XIYA 2GSQA 1FG4A 1AXDA 2V6OA 2LSTA 5GAND 2LEGA 5DVBA 4BVXA 3ZITA 2DJ2A 1MTCA 1X5EA 4V2MA 1RK4A 1R26A 2MZCA 4NHWA 2QC7A 1RW1A 3AY8A 1WIKA 4XS4A 1CQGA 4NAXA 3VPTA 2EIRA 2LQQA 1JZRA 4GSSA 3RHCA 2H75A 4GWRA 5DJMA 2C0EA 2OADA 1OC3A 2YN1A 3L4NA 2YANA 1ML6A 4QL7A 9GSSA 4XS4B 2YP6A 3F4SA 1SJ6A 1O8XA 1XWCA 2WS2A 4F9ZA 3FZ9A 1M2DA 4ILFA 1XVWA 3C73A 3TGZA 12GSA 3C7MA 1TTZA 5IMAA 2X8HA 2LV3A 4MF7A 2TRCP 5G1LA 4NWYA 1GH2A 4PUAA 1SJIA 3M0FA 5CNWA 4LLRA 1ZGNA 3O6TA 1XW6A 5C00A 2OA7A 4IQAA 2H73A 3KP9A 5CRHA 3W8SA 1OC9A 3IR4A 4QQ7A 2YZUA 3H79A 2OE1A 2NTOA 2JZSA 1JLWA 4HJMA 4KNDA 1FHEA 1K0OA 4GCIA 3DRNA 5H5QA 2VIMA 2OBIA 2DIZA 5IO0A 3DD3A 3APOA 3GHAA 3GL5A 3TRXA 1OC9B 3VLNA 8GSSA 4RI7A 5IIZA 3A2XA 3CBUA 2IPAA 2GQMA 5DAKA 2GT6A 2VCTA 1KEBA 1QMVA 4L0WA 3NOFA 1EWXA 3IAM2 4BWSA 4HS1A 5CRDA 3MWHA 2VAFA 4I8BA 4PQHA 2HSYA 5HR3A 4I6XA 5DAKB 5J41A 4EC0A 5G5FA 2HNLA 2B1KA 3FEUA 3IA1A 3HZ4A 4HI7A 1VGLA 1GTAA 2YV9A 1AC1A 2MBTA 1GSQA 5CRWA 2V6KA 2FGXA 1XOBA 1SL0B 4GF0A 5F06A 2ZCTA 4JR6A 2WGRA 4IJ3A 3EURA 2I3YA 2GT5A 1SU9A 1GLPA 4LMVA 4RUVA 3PR8A 4EO3A 2C3QA 3LYPA 4TN8A 3CTGA 1M0UA 1FB6A 1VF3A 2WCIA 4OCFA 2KLXA 1PN9A 4ZL7A 4OWYA 3RDWA 4Q5FA 1Z6NA 3EE2A 1TRSA 1OYJA 2O85A 4RQRA 1B9XC 4GRFA 4JEDA 3L9VA 1H4OA 2H30A 2ZNMA 1GSUA 2IIYA 3GTUA 4V2NA 3A5WA 2IMDA 4KAEA 4BA7A 1BQ7A 3LFLA 3KJYA 4ZIJA 2LJRA 3O3TA 4GXZA 1DE1A 1XWKA 3LSZA 4MPGA 3M1GA 3TKPA 5AISA 2KP2A 4ZB8A 3ZRDA 3GTUB 2FWEA 3M9JA 4IP6A 2H72A 2CT6A 4AGSA 3CRUA 2Z9SA 3GKMA 2G2QA 4TW5A 2VCVA 3DMLA 3TRQA 3U5RE 1JLVA 3VWWA 1UVZA 3CSIA 2PMTA 2XBIA 1M9AA 1SKSB 1V2AA 3UBLA 5E4WA 1C72A 2LRCA 4CDOA 3S9FA 1U87A 2AV4A 3G7YA 1SL1B 5B8AA 2X64A 2KHPA 4TKYA 4EVMA 5JCGA 20GSA 3IPZA 4WETA 1OE8A 3TDGA 5J9CA 3UMAA 2VD1A 5G5EA 5KN1A 2H0HA 1X0RA 1Y25A 3JCML 3F8UA 2VM2A 2FWFA 4ZB9A 3APQA 5LD0A 4L0UA 3ZTLA 3WGDA 3MSZA 2EC4A 3TKSC 2F8AA 1G7OA 1V40A 5G1KA 5ECNB 4HOJA 1TXXA 1W4VA 1M2BA 1WOUA 5ECIB 1V58A 5F05A 2CZ3A 3KD0A 3ZMLA 4EXJA 2LNTA 2OACA 4MF6A 3E0UA 3TKQA 1Z5YE 2H8LA 4YQMA 2AAWA 1I5GA 1TU7A 2H71A 5DALA 4BPYA 4KW6A 3FZ5A 2VL2C 3KGKA 2R4VA 1F2EA 5G31A 2YNXA 2BMXA 1Z7PA 2GZPA 13GSA 1AAZA 3IHQA 3PGTA 4L5OA 2GS3A 2CVBA 3EWLA 4MPFA 5DALB 3F3QA 5HR0A 4HDEA 2AYTA 1XFLA 1YKAA 3KH7A 5IOWA 1USBA 2R6KA 2VD0A 6GSYA 2ALBA 3KIJA 4IHUA 1PQNA 1ERVA 1A0RP 1XW9A 1SYRA 4WBJA 4ECBA 1GTIA 4YAVA 1EV9A 1N8JA 4KDYA 3TKSA 1GP1A 1BG5A 1E2YA 3VI5A 1J0FA 1O8WA 4N0VA 2V1MA 4POKA 5ABRA 3A2WA 5CAXA 2RM5A 2GLRA 4D73A 2LKUA 3GMFA 4K0NA 2F9SA 1A2JA 2WDUA 3KM6A 3TJFA 4KCAA 4Z7XA 4KDUA 3RPPA 3UEMA 2K18A 2VL2A 3DEXA 4FYCA 1F37A 3J7Yk 4G10A 3ZIVA 4D73B 3TOUA 3KTLA 4KCEA 1O6JA 3F9UA 5JWRB 3GH9A 4NMUA 2A2RA 5CP1A 5J4UA 4GQFA 3ERGA 4PGTA 1T1VA 4WR5A 3L78A 2V41A 2CX4A 4EDZA 1URMA 3H8QA 1TI3A 5DBQA 3DVWA 3L9UA 2PBJA 5F8BA 3KP8A 1HNAA 1PGTA 4MABA 5H5RA 4LMWA 3KCMA 1OC8A 1ILOA 2L59A 2WULA 1AQVA 1EV4A 2QGVA 3EU4A 5ECHB 2EIQA 4OFTA 1K0MA 3GRXA 2A2SA 4MCUA 3HY2A 1T4YA 1HYUA 1G6YA 1XXUA 1OKTA 4IN0A 3VK9A 4ML1A 2V32A 4NV5A 2H6ZA 2X8GA 2FNOA 3HA9A 3TJJA 3MNGA 2P0GA 3QCPA 2AB6A 5F07A 4BWQA 1M99A 2XBQA 4FH8A 3ZFLA 1TK8B 3P90A 2WFCA 2LS5A 4MK3A 2E7PA 2F3MA 2YWIA 1WJKA 1DSBA 1BEDA 1SYXA 1WP0A 4CHSA 1AW9A 2XHFA 1XWBA 3KTBA 3APSA 4WF4A 1YQ1A 4TR0A 1FVKA 2EIOA 3EYTA 4TXOA 4E8EA 2XC2A 5D8IA 4PNGA 3GNJA 11GSA 16GSA 3E3EA 1R5PA 3ERFA 1ERTA 4K9ZA 4TRXA 2TIRA 1AQWA 2P5QA 1K3LA 2DSAA 5F0GA 6GSWA 5A4VA 4F0BA 3LXTA 4XRDA 2DBCA 2YJHA 3I43A 4TXOB 3GKXA 2K6VA 2IFQA 4GSTA 4JBBA 4HZ4A 3F63A 3QD9A 4K0GA 17GSA 2WJUA 4EL1A 3R2QA 2MMZA 1BJXA 1G6WA 2X8CA 2V2GA 1HNBA 1T8EB 1ZCPA 2YPMA 4FYBA 4L8EA 4OMVA 5D9XA 2K8VA 2IFQB 3FR6A 6GSVA 1NHOA 3RPNA 1O73A 1ZL9A 3F6DA 4MJCA 1GSSA 3GSTA 5GSTA 2R2JA 3GL3A 1K0AA 4YQUA 3D4MA 4HUAA 2HYXA 3W8JA 2B1LA 2N5FA 3WGXA 2DMLA 1R7HA 1KNGA 1SJZA 4K8MA 1H75A 3UAPA 3QAGA 1T00A 1SENA 5IMZA 4KSOA 2H0IA 2ON5A 1YF1A 4ZBBA 2TRXA 3CRTA 3KEBA 3GX8A 4GSNA 4KDXA 1ZMAA 2B3SA 1JZWA 3K8NA 4NPBA 1MD3A 4JR4A 2IMKA 4YAPA 4K2DA 2NVLA 3A2VA 1UC7A 2F8FA 5DJLA 5FT3A 2HSHA 5B8BA 1X9SB 2HZEA 4JRRA 3IXRA 3BCKA 4ECIA 1M9BA 2K8SA 5AIVA 4DEJA 4LA1A 4KB3A 2RUEA 2VLUA 4Q5RA 1GUKA 4AF2A 2PGTA 3HDCA 4G9HA 4POBA 5INYA 2E2GA 1ZOFA 4N11A 2MBSA 4ZBDA 1K0CA 2HZEB 1R4WA 5A4WA 5IMVA 1OKDA 1QUWA 2MMOA 2NDOA 1ZYQB 1V57A 4L5LA 1F3BA 6GSUA 3P8WA 2B5YA 3UOMA 4IQ1A 2VOCA 3C8EA 1MD4A 3IRAA 3N5OA 4AJ7A 4MZWA 1GSYA 1PX6A 3TOTA 5B6MA 4ZILA 3WD6A 1J9BA 2H6YA 4IJIA 4MZBA 2P5RA 3HKRA 3VWXA 2NPBA 3EMPA 4FO5A 2JADA 3TCOA 3DGQA 3HJOA 5IO2A 4CW9A 1V98A 2VCZA 4NHZA 4ULXA 2G0FA 3IV4A 4GLTA 2C3TA 3D4TA 2C8UA 1EGRA 1EEJA 2HRNA 5CREA 1FAAA 1W89A 1SD9A 2AHEA 4PUFC 3UBKA 2J9HA 1Q98A 1ERWA 3ZIJA 3CYNA 4ZL8A 4ID0A 3W6GA 2GZYA 5DDLA 5ID2A 1XW5A 2AUVA 4HZ2A 2HZFA 2CVDA 3FYGA 2LUSA 4IELA 1S3DA 2PVOC 3HVXA 3HXSA 2CZ2A 1G0TA 5AGYA 1QQ2A 4OFMA 5B7CA 4F03A 5ID2B 4XS1A 4MH2A 4IKHA 1UA5A 5J3RA 3DYRA 1BX9A 1PD21 3FK8A 1AIUA 5J9BA 4LL1B 4HQZA 4EE0A 3FZ4A 4EKZA 4ZBAA 1U88A 2PWJA 2C0DA 1U3AA 3VURA 4MDCA 1GL8A 4BVYA 2JZTA 3C1SA 1EZKA 2AJQB 3HJMA 1B9YC 3NZNA 4V1Ap 1TJDA 3HD5A 4ACSA 1PSQA 1TU8A 3BJ5A 4POMA 4I5QA 5HQPA 5EY6A 3HZ8A 1O81A 3P2AA 4AJ6A 3I69A 2KOKA 1WE0A 2H76A 3A3TA 1PA3A 4IGJA 4MMMA 1Y6EA 2CVKA 1Q4JA 3CSHA 1A2LA 1PKZA 2WB9A 3GYKA 5DQYA 2BTOT 1HD2A 4HU7A 4MJBA 5KN0A 2GDRA 2PU9C 5EL8A 1TI1A 3KXOA 2BJXA 4J56E 4K7IA 4HQSA 1THXA 2H01A 2YWNA 3HYPA 3M9KA 1FVJA 3ZVJA 1ERUA 3J7Yb 2YJ7A 2X99A 3IBHA 2FWGA 1PKWA 1GUMA 2K9FA 3LQ7A 4MJEA 3ZLPA 2B7KA 1J08A 1SKRB 5CO3A 3MDKA 5JCUA 3LEFA 3GN3A 4K7OA 3GUSA 3LYKA 5IQYA 4QL9A 1X9WB 3D22A 3IK7A 4XHMA 6GSXA 1TKDB 5C04A 1EP8A 1IYHA 2DJ3A 2OE3A 3ZYWA 4X0XA 5EPFA 1XWAA 2OKAA 4ISDA 3PH9A 4OD7A 2DLXA 5H5SA 1GSFA 4N10A 1YZXA 1OE7A 3CMIA 2GTUA 4FIWA 4WEYA 4JE1A 1K3OA 1VRSD 1X5DA 2C80A 4ZXGA 2XPEA 3I9V2 1EOHA 3FY7A 3M3MA 4F0CA 4WXTA 2RM6A 1ON4A 2OJLA 4I97A 4DSSA 2R37A 3VWVA 1E6BA 4WKWA 2HXKA 3UVTA 3EC3A 1AUCA 3D6IA 3U6VA 2YZHA 2GQKA 2CAQA 2IN3A 2HRFA 5CYYA 2CX3A 2DIYA 3M8NA 1TK5B 3GIXA 2LRNA 3DXBA 1LJRA 4KGIA 3WT2A 4DSSB 2LNSA 3RAZA 1S3CA 1Z7RA 1R5AA 1TDIA 1SL2B 2C3NA 1A24A 4AJ8A 2L4CA 5HFGA 4YQVA 2L5OA 1O7UA 4IS0A 2KP1A 2JL4A 10GSA 2VO4A 3RHBA 4O7HA 1WMJA 5DQSA 4IBPA 1KBNA 1OVNA 3UL3A 1TW9A 3H1NA 3E9JB 4YH2A 2VL9A 4V2LA 3I6AA 2VCXA 1BAYA 2YOIA 1CQHA 1GTUA 4TXVA 1M7TA
chains in the Genus database with same CATH superfamily
4HJ2A 3UARA 1T4ZA 3ZVJD 1K0BA 5A5KA 3VFIA 4FYUA 3PINA 5ENUA 3QFAC 3DVXA 2YCDA 3ZZXA 5D9WA 1A0FA 1XVQA 1A23A 2HLSA 2O87A 3GURA 4RI6A 1NHYA 5GAPD 1QGVA 3WT1A 1M2AA 3KZQA 5KEJA 1SK0A 2CQ9A 5IOXA 5ECQB 2L4QA 4LL4B 4J57E 3ERWA 3Q18A 2HFDA 3DWVA 3TJBA 5G2ZA 1ST9A 2OE0A 2JZRA 4N30A 1LBKA 5ECSA 2M80A 2CA8A 1FO5A 3QR6A 1SKWB 4MA9A 2GSSA 5IPHA 4Z2UA 3GV1A 1NW2A 4PXOA 4KX4A 2GZZA 1ABAA 2VM1A 3Q19A 4WR4A 2GSRA 2H19A 4TR1A 2D2ZA 2JACA 4XIHA 3CXGA 4ECJA 1XOAA 2FCHA 3CSJA 3UIWA 3ZL5A 1LU4A 5D96A 2LQOA 2DJ0A 3GA4A 5EVOA 5ECKB 3TKRA 1TRWA 3QFBC 3FKFA 3TB2A 1YEXA 4HSCX 4TR1B 5IMDA 3GX0A 3HVSA 5ECPB 1DE2A 3Q74A 1SD8A 2E0QA 4DSRA 4ZB6A 1B4QA 14GSA 4NXIA 4MZCA 2IMFA 2DC5A 2KUCA 2RLIA 2MMAA 2ON7A 4J2FA 3QDNA 4K7NA 1TK0B 2O89A 2IL3A 1GLQA 1A8YA 3KMOA 1A2MA 4GTUA 4I2UA 1GSEA 2GSTA 2H1AA 5D9TA 3C1RA 4IP1A 2CAIA 1EEMA 5D73A 1UN2A 1JFUA 2O8VB 3C71A 3F4RA 1DUGA 3FR3A 3EU3A 1AQXA 2I9HA 1K0DA 3MIXA 1F9MA 2B5EA 1VF4A 5IMFA 1JZDA 5KOWA 4K5RA 4OFNA 1B4PA 5HR2A 3FR9A 1GWCA 5D93A 2H0GA 1QFNA 2N5AA 2OBKA 2QKEA 2M46A 4EF0A 3VI7A 4KA0A 3FRCA 1YDKA 5L71A 5COHA 4HU9A 3ED3A 3LJRA 2DKIA 1GTBA 3RBTA 1GNEA 3EMXA 3QAWA 2R5GA 3UJ1A 1VF2A 5KN2A 5DCGA 3ZMKA 3IK9A 5AIXA 2M72A 1U6TA 4ECCA 5D9VA 19GSA 2P31A 4K5SA 3TRPA 4XRAA 3ZFBA 2GQLA 4Q5NA 6GSTA 3MYDA 4ZL9A 2FUG2 2A4VA 1X9MB 4MP4A 3HVVA 3GH6A 2YWOA 1JZOA 4KUNA 4TOPA 5GSSA 3KH9A 1U3IA 2H1GA 3HVNA 3P7XA 2MMNA 4IW9A 2H74A 2PN8A 1RQMA 5CRGA 5JWOB 3H4KA 3HJPA 1NSWA 2RUFA 4MNNA 2WZ9A 4MJAA 2VUPA 3BD2A 3US3A 2A2PA 1JHBA 2L6CA 1PX7A 5KN3A 4E8HA 1PL1A 4O92A 2REMA 1WWJA 1F3AA 3IAS2 4KE3A 1IYIA 2VCWA 4N0ZA 2JSYA 3FMWA 6GSSA 3IC4A 1QK8A 1B8XA 4EUYA 1VF1A 2L6DA 5J5NA 4JU5A 3FW2A 1ZZYA 5JWQB 2H6XA 2PVQA 5HR1A 1S3AA 1ZYNA 1EOGA 1N2AA 3NIVA 4A5PA 2FHEA 3FZAA 1G7EA 2O7KA 3D21A 3GSSA 3LGCA 3HHVA 2DJ1A 2B5XA 1XZOA 5FHIA 5G30A 4PQIA 1QXHA 3ME7A 2QA1A 3G7IA 1PMTA 4V1Ag 1Z9HA 4K1FA 4WBRD 2VL3A 4P3YB 3GKNA 5FWGA 4O32A 3DIEA 2H66A 2DJJA 2L5LA 5B6NA 1A8LA 2XPDA 2HT9A 2FA4A 1SK2A 2FD3A 2C0FA 1GNWA 1ACVA 1MEKA 2JU5A 3IOSA 1TP9A 5LCZA 3LORA 3SBCA 1K0NA 4TR4A 4X1UA 1GULA 1ZYEA 3ISOA 4YKGA 2GGTA 2WRTA 4Q5QA 2FWHA 3UVHA 5ECOB 1MDKA 3QAVA 3F4TA 3LW9A 1YKCA 2I1UA 1TRVA 2LTKA 1FW1A 1XWGA 3G9BA 5IMCA 4POLA 3D5JA 4PNFA 3BBYA 4HEA2 4DVCA 3F3RA 3F0IA 3IDVA 3WGEA 5HFKA 1HNCA 1XBSA 3GKKA 4KH7A 3GFKA 1GSDA 5IPGA 1YY7A 2FLSA 1GUHA 3HCZA 2JSZA 3LWAA 2H1DA 1TOFA 1T7PB 1XPVA 1YF0A 3V1WA 3CTFA 4X43A 3EVIA 5JCWA 2QSIA 3ZREA 1PRXA 4JZQA 5LNKe 4NV2A 5ECLB 2VLTA 2FY6A 1B48A 3TKSE 1YEPA 3BCIA 2PUKC 2CV4A 2I4AA 3G7JA 2FA8A 4OO5A 1FB0A 4DSQA 2E2MA 3TUEA 1THOA 5HFIA 2C0GA 1DBYA 1NM3A 4F82A 3DKSA 3VPQA 2H1BA 3PPUA 1KTEA 3OR5A 4RQXA 3LG6A 5GZZB 2HI7A 3VWUA 2DMMA 22GSA 2L57A 1EP7A 1F6MC 4PX1A 1SK1A 3BOAA 2H70A 4BL7A 3ME8A 4TR3A 1O85A 3IE3A 4OCEA 3KMNA 2ZUPA 3TJKA 3N9JA 1V9WA 5ELGA 4IVFA 4I2TA 4PURA 2IJYA 5A4UA 2MYGA 1PL2A 3MAKA 3TJGA 7GSSA 2R3XA 4MLYA 2GVPA 3QPMA 4XS6A 5DCHA 2LJAA 4TVEA 4BL7B 1OAZA 3SWLA 4OO4A 2VCQA 5E59A 3QOUA 1T3BA 4H86A 4O5RA 4PQ1A 2RIIA 4KSMA 2R0CA 4ML6A 2LJKA 3EINA 4G19A 2VLVA 2ES7A 3F6FA 1I9DA 5IM9A 4F2IA 18GSA 1HQOA 2NBSA 3O76A 1YJ6A 3L0HA 4G2EA 5AN1A 4MH3A 3L9SA 3Q6OA 1BYEA 2IMIA 4GQCA 4XCSA 5ELAA 2YV7A 2B6MA 4XTSA 5ECRB 5ECMB 1MDJA 1Z6MA 3QMXA 4MF5A 2LRTA 4WF5A 1TRUA 1Z3EA 2DJKA 2PERA 2C1YA 3D0ZA 4EIQA 1GRXA 1WRYA 1FOVA 2DKHA 1XCCA 2I81A 2PPTA 2IMEA 1EGOA 2N5BA 1X5CA 4EDYA 2C4JA 3FHKA 3A5IA 3LXZA 2IWTA 2F51A 4K6XA 3WYWA 1K3YA 2HE3A 2J23A 2YWMA 3H93A 2B7JA 1MDIA 1WPIA 1XIYA 2GSQA 1FG4A 1AXDA 2V6OA 2LSTA 5GAND 2LEGA 5DVBA 4BVXA 3ZITA 2DJ2A 1MTCA 1X5EA 4V2MA 1RK4A 1R26A 2MZCA 4NHWA 2QC7A 4BVXB 1RW1A 3AY8A 1WIKA 4XS4A 1CQGA 4NAXA 3VPTA 2EIRA 2LQQA 1JZRA 3IC8A 4GSSA 3RHCA 2H75A 4GWRA 5DJMA 2C0EA 2OADA 1OC3A 2YN1A 3L4NA 4FQUA 5BRTA 2YANA 1ML6A 4QL7A 9GSSA 4XS4B 2YP6A 3F4SA 1SJ6A 1O8XA 1XWCA 2WS2A 4F9ZA 3FZ9A 1M2DA 4ILFA 1XVWA 3C73A 3TGZA 1XG8A 12GSA 3C7MA 1TTZA 5IMAA 2X8HA 2LV3A 4MF7A 2TRCP 5G1LA 4NWYA 1GH2A 4PUAA 1SJIA 3M0FA 5CNWA 3IHGA 4LLRA 1ZGNA 3O6TA 1XW6A 5C00A 2OA7A 4IQAA 2H73A 3KP9A 5CRHA 3W8SA 1OC9A 3IR4A 5KOXA 4QQ7A 2YZUA 3H79A 2OE1A 2NTOA 2JZSA 1JLWA 4HJMA 4KNDA 4G0IA 1FHEA 1K0OA 4GCIA 3DRNA 5H5QA 2VIMA 2OBIA 2DIZA 5IO0A 3DD3A 3APOA 3GHAA 3GL5A 3TRXA 1OC9B 3VLNA 8GSSA 4RI7A 5IIZA 3A2XA 3CBUA 2IPAA 2GQMA 5DAKA 2GT6A 2VCTA 1KEBA 1QMVA 4L0WA 3NOFA 1EWXA 3IAM2 4BWSA 4HS1A 5CRDA 3MWHA 2VAFA 4I8BA 4PQHA 2HSYA 5HR3A 4I6XA 5DAKB 5J41A 4EC0A 1PN0A 5G5FA 2HNLA 4K2XA 2B1KA 3FEUA 3IA1A 3HZ4A 4HI7A 1VGLA 1GTAA 2YV9A 1AC1A 2MBTA 1GSQA 4Z2RA 5CRWA 2V6KA 2FGXA 1XOBA 1SL0B 4GF0A 5F06A 2ZCTA 4JR6A 2WGRA 4IJ3A 3EURA 2I3YA 2GT5A 1SU9A 1GLPA 4LMVA 4RUVA 3PR8A 4EO3A 2C3QA 3LYPA 4TN8A 3CTGA 1M0UA 1FB6A 1VF3A 2WCIA 4OCFA 2KLXA 1PN9A 4ZL7A 4OWYA 3RDWA 4Q5FA 1Z6NA 3EE2A 1TRSA 1OYJA 4KF9A 2O85A 4RQRA 1B9XC 4GRFA 4JEDA 3L9VA 1H4OA 2H30A 2ZNMA 1GSUA 2IIYA 3GTUA 4V2NA 3A5WA 2IMDA 4KAEA 4BA7A 1BQ7A 3LFLA 3KJYA 4ZIJA 2LJRA 3O3TA 4GXZA 1DE1A 1XWKA 4CY8A 3LSZA 4MPGA 3M1GA 3TKPA 5AISA 2KP2A 4ZB8A 3ZRDA 3GTUB 2FWEA 3M9JA 4IP6A 2H72A 2CT6A 4AGSA 3CRUA 2Z9SA 3GKMA 2G2QA 4TW5A 2VCVA 3DMLA 3TRQA 3U5RE 1JLVA 3VWWA 1UVZA 3CSIA 2PMTA 2XBIA 4ICYA 1M9AA 1SKSB 1V2AA 3UBLA 5E4WA 1ZYPA 1C72A 2LRCA 4CDOA 1FOHA 3S9FA 1U87A 2AV4A 3G7YA 1SL1B 5B8AA 2X64A 2KHPA 4TKYA 4EVMA 5JCGA 20GSA 3IPZA 4WETA 1OE8A 3TDGA 5J9CA 3UMAA 2VD1A 5G5EA 4YKFA 5KN1A 2H0HA 1X0RA 1Y25A 3JCML 3F8UA 2VM2A 2FWFA 4ZB9A 3APQA 5LD0A 4L0UA 3ZTLA 3WGDA 3MSZA 2EC4A 3TKSC 2F8AA 1G7OA 1V40A 5G1KA 5ECNB 4HOJA 1TXXA 1W4VA 1M2BA 1WOUA 5ECIB 1V58A 5F05A 2CZ3A 3KD0A 3ZMLA 1S3RA 4EXJA 2LNTA 2OACA 4MF6A 3E0UA 3TKQA 1Z5YE 2H8LA 4YQMA 2AAWA 1I5GA 1TU7A 2H71A 5DALA 4BPYA 4KW6A 3FZ5A 2VL2C 3KGKA 2R4VA 1F2EA 5G31A 2YNXA 2BMXA 1Z7PA 4G0KA 2GZPA 13GSA 1AAZA 3IHQA 3PGTA 4L5OA 2GS3A 2CVBA 3EWLA 4MPFA 5DALB 3F3QA 5HR0A 4HDEA 2AYTA 1XFLA 1YKAA 3KH7A 5IOWA 1USBA 2R6KA 2VD0A 6GSYA 2ALBA 3KIJA 4IHUA 1PQNA 1ERVA 1A0RP 1XW9A 1SYRA 4WBJA 4ECBA 1GTIA 4YAVA 1EV9A 1N8JA 4KDYA 3TKSA 1GP1A 1BG5A 1E2YA 3VI5A 1J0FA 1O8WA 4N0VA 2V1MA 4POKA 5ABRA 3A2WA 5CAXA 2RM5A 2GLRA 4D73A 2LKUA 3GMFA 4K0NA 2F9SA 1A2JA 2WDUA 3KM6A 3TJFA 4KCAA 4Z7XA 4KDUA 3RPPA 3UEMA 2K18A 2VL2A 3DEXA 4FYCA 1F37A 3J7Yk 4G10A 3ZIVA 4D73B 3TOUA 3KTLA 4KCEA 1O6JA 3F9UA 5JWRB 3GH9A 4NMUA 2A2RA 5CP1A 2UZ8A 5J4UA 4GQFA 4G0LA 3ERGA 4PGTA 1T1VA 4WR5A 3L78A 3EPTA 2V41A 2CX4A 4EDZA 1URMA 3H8QA 1TI3A 5DBQA 3DVWA 3L9UA 2PBJA 5F8BA 3KP8A 1HNAA 1PGTA 4MABA 5H5RA 4LMWA 3KCMA 1OC8A 1ILOA 2L59A 2WULA 1AQVA 1EV4A 2QGVA 3EU4A 5ECHB 2EIQA 4OFTA 1K0MA 4BIKA 3GRXA 2A2SA 4MCUA 3HY2A 1T4YA 1HYUA 1G6YA 1XXUA 1OKTA 4IN0A 3VK9A 4ML1A 2V32A 4NV5A 2H6ZA 2X8GA 2FNOA 3HA9A 3TJJA 3MNGA 2P0GA 3QCPA 2AB6A 5F07A 4BWQA 1M99A 2XBQA 4FH8A 3ZFLA 1TK8B 3P90A 2WFCA 2LS5A 4MK3A 2E7PA 2F3MA 2YWIA 1WJKA 1DSBA 1BEDA 1SYXA 1WP0A 4CHSA 1AW9A 2XHFA 1XWBA 3KTBA 3APSA 4WF4A 1YQ1A 4TR0A 1FVKA 2EIOA 3EYTA 4TXOA 4E8EA 2XC2A 5D8IA 4PNGA 2R0GA 3GNJA 11GSA 16GSA 3E3EA 1R5PA 3ERFA 1ERTA 4K9ZA 4TRXA 2TIRA 1AQWA 2P5QA 1K3LA 2DSAA 5F0GA 6GSWA 5A4VA 1M3JA 4F0BA 3LXTA 5BMUA 4XRDA 2DBCA 2YJHA 3I43A 4TXOB 3GKXA 2K6VA 2IFQA 4GSTA 4JBBA 4HZ4A 3F63A 3QD9A 4K0GA 17GSA 2WJUA 2X49A 4EL1A 3R2QA 2MMZA 1BJXA 1G6WA 2X8CA 2V2GA 1HNBA 1T8EB 1ZCPA 2YPMA 4FYBA 4L8EA 4OMVA 5D9XA 2K8VA 2IFQB 3FR6A 6GSVA 1NHOA 3RPNA 1O73A 1ZL9A 3F6DA 4MJCA 1GSSA 3GSTA 5GSTA 2R2JA 3GL3A 1K0AA 4YQUA 3D4MA 4HUAA 2HYXA 4PTSA 3W8JA 2B1LA 2N5FA 3WGXA 2DMLA 1R7HA 1KNGA 1SJZA 4K8MA 1H75A 3UAPA 3QAGA 1T00A 1SENA 5IMZA 4KSOA 2H0IA 2ON5A 1YF1A 4ZBBA 2TRXA 3CRTA 3KEBA 3GX8A 4GSNA 4KDXA 1ZMAA 2B3SA 1JZWA 3K8NA 4NPBA 1MD3A 4JR4A 2IMKA 4YAPA 4K2DA 2NVLA 3A2VA 1UC7A 2F8FA 5DJLA 5FT3A 2HSHA 5B8BA 1X9SB 2HZEA 4JRRA 3IXRA 3BCKA 2A4HA 4Z2TA 4ECIA 1M9BA 2K8SA 5AIVA 4DEJA 4LA1A 4KB3A 2RUEA 2VLUA 4Q5RA 1GUKA 4AF2A 2PGTA 3HDCA 4G9HA 4POBA 5INYA 2E2GA 1ZOFA 4N11A 2MBSA 4ZBDA 1K0CA 2HZEB 1R4WA 5A4WA 5IMVA 1OKDA 1QUWA 2QA2A 2MMOA 2NDOA 1ZYQB 1V57A 2X4AA 4L5LA 1F3BA 6GSUA 3P8WA 2B5YA 3UOMA 4IQ1A 2VOCA 3C8EA 1M3IA 1MD4A 3IRAA 3N5OA 4AJ7A 4MZWA 1GSYA 1PX6A 3TOTA 5B6MA 2HSMA 4ZILA 3WD6A 1J9BA 2H6YA 4IJIA 4MZBA 2P5RA 3HKRA 3VWXA 2NPBA 3EMPA 4X4JA 4FO5A 2JADA 3TCOA 3DGQA 3HJOA 5IO2A 4CW9A 1V98A 2VCZA 4NHZA 4ULXA 2G0FA 3IV4A 4GLTA 2C3TA 3D4TA 4O5UA 2C8UA 1EGRA 1EEJA 2HRNA 5CREA 1FAAA 2HRAA 1W89A 1SD9A 2AHEA 4PUFC 3UBKA 2J9HA 1Q98A 1ERWA 3ZIJA 3CYNA 4ZL8A 4ID0A 3W6GA 2GZYA 5DDLA 5ID2A 1XW5A 2AUVA 4HZ2A 2HZFA 2CVDA 3FYGA 2LUSA 4IELA 1S3DA 2PVOC 3HVXA 3HXSA 2CZ2A 1G0TA 5AGYA 1QQ2A 4OFMA 5B7CA 4F03A 5ID2B 4XS1A 4MH2A 4IKHA 1UA5A 5J3RA 3DYRA 1BX9A 1PD21 3FK8A 1AIUA 5J9BA 4LL1B 4HQZA 4EE0A 3FZ4A 4EKZA 4ZBAA 1U88A 2PWJA 1PFOA 2C0DA 1U3AA 3VURA 4MDCA 1GL8A 4BVYA 2JZTA 3C1SA 3R3EA 1EZKA 2AJQB 3HJMA 1B9YC 3NZNA 4V1Ap 1TJDA 3HD5A 4ACSA 1PSQA 1TU8A 3BJ5A 4POMA 4I5QA 4BVYB 5HQPA 5EY6A 3HZ8A 1O81A 3P2AA 4AJ6A 3I69A 2KOKA 1WE0A 2H76A 3A3TA 1PA3A 4IGJA 4MMMA 1Y6EA 2CVKA 1Q4JA 3CSHA 1A2LA 1PKZA 2WB9A 3GYKA 5DQYA 2BTOT 3CQFA 1HD2A 4HU7A 4MJBA 5KN0A 2GDRA 2PU9C 5EL8A 1TI1A 3KXOA 2BJXA 4J56E 4K7IA 4HQSA 1THXA 2H01A 2YWNA 4USSA 3HYPA 3M9KA 1FVJA 3ZVJA 1ERUA 3J7Yb 2YJ7A 2X99A 3IBHA 2FWGA 1PKWA 1GUMA 2K9FA 3LQ7A 4MJEA 3ZLPA 2B7KA 1J08A 1SKRB 4CY6A 5CO3A 3MDKA 2R0PA 5JCUA 3LEFA 3GN3A 4K7OA 3GUSA 3LYKA 5IQYA 4QL9A 1X9WB 3D22A 3IK7A 4XHMA 2HRKA 6GSXA 1TKDB 5C04A 1EP8A 1IYHA 2DJ3A 2OE3A 3ZYWA 4X0XA 5EPFA 1XWAA 2OKAA 4ISDA 3PH9A 4OD7A 2DLXA 5H5SA 1GSFA 4EIPA 4N10A 1YZXA 1OE7A 3CMIA 2GTUA 4FIWA 4WEYA 4JE1A 1K3OA 1VRSD 1X5DA 2C80A 4ZXGA 2XPEA 3I9V2 1EOHA 3FY7A 3M3MA 4F0CA 4WXTA 2RM6A 1ON4A 2OJLA 4I97A 4DSSA 2R37A 3VWVA 1E6BA 4WKWA 2HXKA 3UVTA 3EC3A 1AUCA 3D6IA 3U6VA 2YZHA 2GQKA 4O5QA 2CAQA 2IN3A 2HRFA 5CYYA 2CX3A 2DIYA 3M8NA 1TK5B 3GIXA 2LRNA 3DXBA 1LJRA 4KGIA 3WT2A 4DSSB 2LNSA 3RAZA 1S3CA 1Z7RA 1R5AA 1TDIA 1SL2B 2C3NA 1A24A 4AJ8A 2L4CA 5HFGA 4YQVA 2L5OA 1O7UA 4IS0A 2KP1A 2JL4A 10GSA 2VO4A 3RHBA 4O7HA 1WMJA 5DQSA 4IBPA 1KBNA 1OVNA 3UL3A 1TW9A 3H1NA 3E9JB 4YH2A 2VL9A 4V2LA 3I6AA 2VCXA 1BAYA 2YOIA 1CQHA 1GTUA 4TXVA 1M7TA
chains in the Genus database with same CATH topology
4HJ2A 3UARA 1T4ZA 3ZVJD 1K0BA 5A5KA 3VFIA 4FYUA 3PINA 5ENUA 3QFAC 3DVXA 2YCDA 3ZZXA 5D9WA 1A0FA 1XVQA 1A23A 2HLSA 2O87A 3GURA 4RI6A 1NHYA 5GAPD 1QGVA 3WT1A 1M2AA 3KZQA 5KEJA 1SK0A 2CQ9A 5IOXA 5ECQB 2L4QA 4LL4B 4J57E 3ERWA 3Q18A 2HFDA 3DWVA 3TJBA 5G2ZA 1ST9A 2OE0A 2JZRA 4N30A 1LBKA 5ECSA 2M80A 2CA8A 1FO5A 3QR6A 1SKWB 4MA9A 2GSSA 5IPHA 4Z2UA 3GV1A 1NW2A 4PXOA 4KX4A 2GZZA 1ABAA 2VM1A 3Q19A 4WR4A 2GSRA 2H19A 4TR1A 2D2ZA 2JACA 4XIHA 3CXGA 4ECJA 1XOAA 2FCHA 3CSJA 3UIWA 3ZL5A 1LU4A 5D96A 2LQOA 2DJ0A 3GA4A 5EVOA 5ECKB 3TKRA 1TRWA 3QFBC 3FKFA 3TB2A 1YEXA 4TR1B 5IMDA 3GX0A 3HVSA 5ECPB 1DE2A 3Q74A 1SD8A 2E0QA 4DSRA 4ZB6A 1B4QA 14GSA 4NXIA 4MZCA 2IMFA 2DC5A 2KUCA 2RLIA 2MMAA 2ON7A 4J2FA 3QDNA 4K7NA 1TK0B 2O89A 2IL3A 1GLQA 1A8YA 3KMOA 1A2MA 4GTUA 4I2UA 1GSEA 2GSTA 2H1AA 5D9TA 3C1RA 4IP1A 2CAIA 1EEMA 5D73A 1UN2A 1JFUA 2O8VB 3C71A 3F4RA 1DUGA 3FR3A 3EU3A 1AQXA 2I9HA 1K0DA 3MIXA 1F9MA 2B5EA 1VF4A 5IMFA 1JZDA 5KOWA 4K5RA 4OFNA 1B4PA 5HR2A 3FR9A 1GWCA 5D93A 2H0GA 1QFNA 2N5AA 2OBKA 2QKEA 2M46A 4EF0A 3VI7A 4KA0A 3FRCA 1YDKA 5L71A 5COHA 4HU9A 3ED3A 3LJRA 2DKIA 1GTBA 3RBTA 1GNEA 3EMXA 3QAWA 2R5GA 3UJ1A 1VF2A 5KN2A 5DCGA 3ZMKA 3IK9A 5AIXA 2M72A 1U6TA 4ECCA 5D9VA 19GSA 2P31A 4K5SA 3TRPA 4XRAA 3ZFBA 2GQLA 4Q5NA 6GSTA 3MYDA 4ZL9A 2FUG2 2A4VA 1X9MB 4MP4A 3HVVA 3GH6A 2YWOA 1JZOA 4KUNA 4TOPA 5GSSA 3KH9A 1U3IA 2H1GA 3P7XA 2MMNA 4IW9A 2H74A 2PN8A 1RQMA 5CRGA 5JWOB 3H4KA 3HJPA 1NSWA 2RUFA 4MNNA 2WZ9A 4MJAA 2VUPA 3BD2A 3US3A 2A2PA 1JHBA 2L6CA 1PX7A 5KN3A 4E8HA 1PL1A 4O92A 2REMA 1WWJA 1F3AA 3IAS2 4KE3A 1IYIA 2VCWA 4N0ZA 2JSYA 3FMWA 6GSSA 3IC4A 1QK8A 1B8XA 4EUYA 1VF1A 2L6DA 5J5NA 4JU5A 3FW2A 1ZZYA 5JWQB 2H6XA 2PVQA 5HR1A 1S3AA 1ZYNA 1EOGA 1N2AA 3NIVA 4A5PA 2FHEA 3FZAA 1G7EA 2O7KA 3D21A 3GSSA 3LGCA 3HHVA 2DJ1A 2B5XA 1XZOA 5FHIA 5G30A 4PQIA 1QXHA 3ME7A 2QA1A 3G7IA 1PMTA 4V1Ag 1Z9HA 4K1FA 4WBRD 2VL3A 4P3YB 3GKNA 5FWGA 4O32A 3DIEA 2H66A 2DJJA 2L5LA 5B6NA 1A8LA 2XPDA 2HT9A 2FA4A 1SK2A 2FD3A 2C0FA 1GNWA 1ACVA 1MEKA 2JU5A 3IOSA 1TP9A 5LCZA 3LORA 3SBCA 1K0NA 4TR4A 4X1UA 1GULA 1ZYEA 3ISOA 4YKGA 2GGTA 2WRTA 4Q5QA 2FWHA 3UVHA 5ECOB 1MDKA 3QAVA 3F4TA 3LW9A 1YKCA 2I1UA 1TRVA 2LTKA 1FW1A 1XWGA 3G9BA 5IMCA 4POLA 3D5JA 4PNFA 3BBYA 4HEA2 4DVCA 3F3RA 3F0IA 3IDVA 3WGEA 5HFKA 1HNCA 1XBSA 3GKKA 4KH7A 3GFKA 1GSDA 5IPGA 1YY7A 2FLSA 1GUHA 3HCZA 2JSZA 3LWAA 2H1DA 1TOFA 1T7PB 1XPVA 1YF0A 3V1WA 3CTFA 4X43A 3EVIA 5JCWA 2QSIA 3ZREA 1PRXA 4JZQA 5LNKe 4NV2A 5ECLB 2VLTA 2FY6A 1B48A 3TKSE 1YEPA 3BCIA 2PUKC 2CV4A 2I4AA 3G7JA 2FA8A 4OO5A 1FB0A 4DSQA 2E2MA 3TUEA 1THOA 5HFIA 2C0GA 1DBYA 1NM3A 4F82A 3DKSA 3VPQA 2H1BA 3PPUA 1KTEA 3OR5A 4RQXA 3LG6A 5GZZB 2HI7A 3VWUA 2DMMA 22GSA 2L57A 1EP7A 1F6MC 4PX1A 1SK1A 3BOAA 2H70A 4BL7A 3ME8A 4TR3A 1O85A 3IE3A 4OCEA 3KMNA 2ZUPA 3TJKA 3N9JA 1V9WA 5ELGA 4IVFA 4I2TA 4PURA 2IJYA 5A4UA 2MYGA 1PL2A 3MAKA 3TJGA 7GSSA 2R3XA 4MLYA 2GVPA 3QPMA 4XS6A 5DCHA 2LJAA 4TVEA 4BL7B 1OAZA 3SWLA 4OO4A 2VCQA 5E59A 3QOUA 1T3BA 4H86A 4O5RA 4PQ1A 2RIIA 4KSMA 2R0CA 4ML6A 2LJKA 3EINA 4G19A 2VLVA 2ES7A 3F6FA 1I9DA 5IM9A 4F2IA 18GSA 1HQOA 2NBSA 3O76A 1YJ6A 3L0HA 4G2EA 5AN1A 4MH3A 3L9SA 3Q6OA 1BYEA 2IMIA 4GQCA 4XCSA 5ELAA 2YV7A 2B6MA 4XTSA 5ECRB 5ECMB 1MDJA 1Z6MA 3QMXA 4MF5A 2LRTA 4WF5A 1TRUA 1Z3EA 2DJKA 2PERA 2C1YA 3D0ZA 4EIQA 1GRXA 1WRYA 1FOVA 2DKHA 1XCCA 2I81A 2PPTA 2IMEA 1EGOA 2N5BA 1X5CA 4EDYA 2C4JA 3FHKA 3A5IA 3LXZA 2IWTA 2F51A 4K6XA 3WYWA 1K3YA 2HE3A 2J23A 2YWMA 3H93A 2B7JA 1MDIA 1WPIA 1XIYA 2GSQA 1FG4A 1AXDA 2V6OA 2LSTA 5GAND 2LEGA 5DVBA 4BVXA 3ZITA 2DJ2A 1MTCA 1X5EA 4V2MA 1RK4A 1R26A 2MZCA 4NHWA 2QC7A 4BVXB 1RW1A 3AY8A 1WIKA 4XS4A 1CQGA 4NAXA 3VPTA 2EIRA 2LQQA 1JZRA 3IC8A 4GSSA 3RHCA 2H75A 4GWRA 5DJMA 2C0EA 2OADA 1OC3A 2YN1A 3L4NA 4FQUA 5BRTA 2YANA 1ML6A 4QL7A 9GSSA 4XS4B 2YP6A 3F4SA 1SJ6A 1O8XA 1XWCA 2WS2A 4F9ZA 3FZ9A 1M2DA 4ILFA 1XVWA 3C73A 3TGZA 12GSA 3C7MA 1TTZA 5IMAA 2X8HA 2LV3A 4MF7A 2TRCP 5G1LA 4NWYA 1GH2A 4PUAA 1SJIA 3M0FA 5CNWA 3IHGA 4LLRA 1ZGNA 3O6TA 1XW6A 5C00A 2OA7A 4IQAA 2H73A 3KP9A 5CRHA 3W8SA 1OC9A 3IR4A 5KOXA 4QQ7A 2YZUA 3H79A 2OE1A 2NTOA 2JZSA 1JLWA 4HJMA 4KNDA 4G0IA 1FHEA 1K0OA 4GCIA 3DRNA 5H5QA 2VIMA 2OBIA 2DIZA 5IO0A 3DD3A 3APOA 3GHAA 3GL5A 3TRXA 1OC9B 3VLNA 8GSSA 4RI7A 5IIZA 3A2XA 3CBUA 2IPAA 2GQMA 5DAKA 2GT6A 2VCTA 1KEBA 1QMVA 4L0WA 3NOFA 1EWXA 3IAM2 4BWSA 4HS1A 5CRDA 3MWHA 2VAFA 4I8BA 4PQHA 2HSYA 5HR3A 4I6XA 5DAKB 5J41A 4EC0A 1PN0A 5G5FA 2HNLA 4K2XA 2B1KA 3FEUA 3IA1A 3HZ4A 4HI7A 1VGLA 1GTAA 2YV9A 1AC1A 2MBTA 1GSQA 4Z2RA 5CRWA 2V6KA 2FGXA 1XOBA 1SL0B 4GF0A 5F06A 2ZCTA 4JR6A 2WGRA 4IJ3A 3EURA 2I3YA 2GT5A 1SU9A 1GLPA 4LMVA 4RUVA 3PR8A 4EO3A 2C3QA 3LYPA 4TN8A 3CTGA 1M0UA 1FB6A 1VF3A 2WCIA 4OCFA 2KLXA 1PN9A 4ZL7A 4OWYA 3RDWA 4Q5FA 1Z6NA 3EE2A 1TRSA 1OYJA 4KF9A 2O85A 4RQRA 1B9XC 4GRFA 4JEDA 3L9VA 1H4OA 2H30A 2ZNMA 1GSUA 2IIYA 3GTUA 4V2NA 3A5WA 2IMDA 4KAEA 4BA7A 1BQ7A 3LFLA 3KJYA 4ZIJA 2LJRA 3O3TA 4GXZA 1DE1A 1XWKA 4CY8A 3LSZA 4MPGA 3M1GA 3TKPA 5AISA 2KP2A 4ZB8A 3ZRDA 3GTUB 2FWEA 3M9JA 4IP6A 2H72A 2CT6A 4AGSA 3CRUA 2Z9SA 3GKMA 2G2QA 4TW5A 2VCVA 3DMLA 3TRQA 3U5RE 1JLVA 3VWWA 1UVZA 3CSIA 2PMTA 2XBIA 4ICYA 1M9AA 1SKSB 1V2AA 3UBLA 5E4WA 1ZYPA 1C72A 2LRCA 4CDOA 1FOHA 3S9FA 1U87A 2AV4A 3G7YA 1SL1B 5B8AA 2X64A 2KHPA 4TKYA 4EVMA 5JCGA 20GSA 3IPZA 4WETA 1OE8A 3TDGA 5J9CA 3UMAA 2VD1A 5G5EA 4YKFA 5KN1A 2H0HA 1X0RA 1Y25A 3JCML 3F8UA 2VM2A 2FWFA 4ZB9A 3APQA 5LD0A 4L0UA 3ZTLA 3WGDA 3MSZA 2EC4A 3TKSC 2F8AA 1G7OA 1V40A 5G1KA 5ECNB 4HOJA 1TXXA 1W4VA 1M2BA 1WOUA 5ECIB 1V58A 5F05A 2CZ3A 3KD0A 3ZMLA 4EXJA 2LNTA 2OACA 4MF6A 3E0UA 3TKQA 1Z5YE 2H8LA 4YQMA 2AAWA 1I5GA 1TU7A 2H71A 5DALA 4BPYA 4KW6A 3FZ5A 2VL2C 3KGKA 2R4VA 1F2EA 5G31A 2YNXA 2BMXA 1Z7PA 4G0KA 2GZPA 13GSA 1AAZA 3IHQA 3PGTA 4L5OA 2GS3A 2CVBA 3EWLA 4MPFA 5DALB 3F3QA 5HR0A 4HDEA 2AYTA 1XFLA 1YKAA 3KH7A 5IOWA 1USBA 2R6KA 2VD0A 6GSYA 2ALBA 3KIJA 4IHUA 1PQNA 1ERVA 1A0RP 1XW9A 1SYRA 4WBJA 4ECBA 1GTIA 4YAVA 1EV9A 1N8JA 4KDYA 3TKSA 1GP1A 1BG5A 1E2YA 3VI5A 1J0FA 1O8WA 4N0VA 2V1MA 4POKA 5ABRA 3A2WA 5CAXA 2RM5A 2GLRA 4D73A 2LKUA 3GMFA 4K0NA 2F9SA 1A2JA 2WDUA 3KM6A 3TJFA 4KCAA 4Z7XA 4KDUA 3RPPA 3UEMA 2K18A 2VL2A 3DEXA 4FYCA 1F37A 3J7Yk 4G10A 3ZIVA 4D73B 3TOUA 3KTLA 4KCEA 1O6JA 3F9UA 5JWRB 3GH9A 4NMUA 2A2RA 5CP1A 2UZ8A 5J4UA 4GQFA 4G0LA 3ERGA 4PGTA 1T1VA 4WR5A 3L78A 3EPTA 2V41A 2CX4A 4EDZA 1URMA 3H8QA 1TI3A 5DBQA 3DVWA 3L9UA 2PBJA 5F8BA 3KP8A 1HNAA 1PGTA 4MABA 5H5RA 4LMWA 3KCMA 1OC8A 1ILOA 2L59A 2WULA 1AQVA 1EV4A 2QGVA 3EU4A 5ECHB 2EIQA 4OFTA 1K0MA 3GRXA 2A2SA 4MCUA 3HY2A 1T4YA 1HYUA 1G6YA 1XXUA 1OKTA 4IN0A 3VK9A 4ML1A 2V32A 4NV5A 2H6ZA 2X8GA 2FNOA 3HA9A 3TJJA 3MNGA 2P0GA 3QCPA 2AB6A 5F07A 4BWQA 1M99A 2XBQA 4FH8A 3ZFLA 1TK8B 3P90A 2WFCA 2LS5A 4MK3A 2E7PA 2F3MA 2YWIA 1WJKA 1DSBA 1BEDA 1SYXA 1WP0A 4CHSA 1AW9A 2XHFA 1XWBA 3KTBA 3APSA 4WF4A 1YQ1A 4TR0A 1FVKA 2EIOA 3EYTA 4TXOA 4E8EA 2XC2A 5D8IA 4PNGA 2R0GA 3GNJA 11GSA 16GSA 3E3EA 1R5PA 3ERFA 1ERTA 4K9ZA 4TRXA 2TIRA 1AQWA 2P5QA 1K3LA 2DSAA 5F0GA 6GSWA 5A4VA 4F0BA 3LXTA 5BMUA 4XRDA 2DBCA 2YJHA 3I43A 4TXOB 3GKXA 2K6VA 2IFQA 4GSTA 4JBBA 4HZ4A 3F63A 3QD9A 4K0GA 17GSA 2WJUA 2X49A 4EL1A 3R2QA 2MMZA 1BJXA 1G6WA 2X8CA 2V2GA 1HNBA 1T8EB 1ZCPA 2YPMA 4FYBA 4L8EA 4OMVA 5D9XA 2K8VA 2IFQB 3FR6A 6GSVA 1NHOA 3RPNA 1O73A 1ZL9A 3F6DA 4MJCA 1GSSA 3GSTA 5GSTA 2R2JA 3GL3A 1K0AA 4YQUA 3D4MA 4HUAA 2HYXA 4PTSA 3W8JA 2B1LA 2N5FA 3WGXA 2DMLA 1R7HA 1KNGA 1SJZA 4K8MA 1H75A 3UAPA 3QAGA 1T00A 1SENA 5IMZA 4KSOA 2H0IA 2ON5A 1YF1A 4ZBBA 2TRXA 3CRTA 3KEBA 3GX8A 4GSNA 4KDXA 1ZMAA 2B3SA 1JZWA 3K8NA 4NPBA 1MD3A 4JR4A 2IMKA 4YAPA 4K2DA 2NVLA 3A2VA 1UC7A 2F8FA 5DJLA 5FT3A 2HSHA 5B8BA 1X9SB 2HZEA 4JRRA 3IXRA 3BCKA 2A4HA 4Z2TA 4ECIA 1M9BA 2K8SA 5AIVA 4DEJA 4LA1A 4KB3A 2RUEA 2VLUA 4Q5RA 1GUKA 4AF2A 2PGTA 3HDCA 4G9HA 4POBA 5INYA 2E2GA 1ZOFA 4N11A 2MBSA 4ZBDA 1K0CA 2HZEB 1R4WA 5A4WA 5IMVA 1OKDA 1QUWA 2QA2A 2MMOA 2NDOA 1ZYQB 1V57A 2X4AA 4L5LA 1F3BA 6GSUA 3P8WA 2B5YA 3UOMA 4IQ1A 2VOCA 3C8EA 1MD4A 3IRAA 3N5OA 4AJ7A 4MZWA 1GSYA 1PX6A 3TOTA 5B6MA 2HSMA 4ZILA 3WD6A 1J9BA 2H6YA 4IJIA 4MZBA 2P5RA 3HKRA 3VWXA 2NPBA 3EMPA 4X4JA 4FO5A 2JADA 3TCOA 3DGQA 3HJOA 5IO2A 4CW9A 1V98A 2VCZA 4NHZA 4ULXA 2G0FA 3IV4A 4GLTA 2C3TA 3D4TA 4O5UA 2C8UA 1EGRA 1EEJA 2HRNA 5CREA 1FAAA 2HRAA 1W89A 1SD9A 2AHEA 4PUFC 3UBKA 2J9HA 1Q98A 1ERWA 3ZIJA 3CYNA 4ZL8A 4ID0A 3W6GA 2GZYA 5DDLA 5ID2A 1XW5A 2AUVA 4HZ2A 2HZFA 2CVDA 3FYGA 2LUSA 4IELA 1S3DA 2PVOC 3HVXA 3HXSA 2CZ2A 1G0TA 5AGYA 1QQ2A 4OFMA 5B7CA 4F03A 5ID2B 4XS1A 4MH2A 4IKHA 1UA5A 5J3RA 3DYRA 1BX9A 1PD21 3FK8A 1AIUA 5J9BA 4LL1B 4HQZA 4EE0A 3FZ4A 4EKZA 4ZBAA 1U88A 2PWJA 2C0DA 1U3AA 3VURA 4MDCA 1GL8A 4BVYA 2JZTA 3C1SA 3R3EA 1EZKA 2AJQB 3HJMA 1B9YC 3NZNA 4V1Ap 1TJDA 3HD5A 4ACSA 1PSQA 1TU8A 3BJ5A 4POMA 4I5QA 4BVYB 5HQPA 5EY6A 3HZ8A 1O81A 3P2AA 4AJ6A 3I69A 2KOKA 1WE0A 2H76A 3A3TA 1PA3A 4IGJA 4MMMA 1Y6EA 2CVKA 1Q4JA 3CSHA 1A2LA 1PKZA 2WB9A 3GYKA 5DQYA 2BTOT 1HD2A 4HU7A 4MJBA 5KN0A 2GDRA 2PU9C 5EL8A 1TI1A 3KXOA 2BJXA 4J56E 4K7IA 4HQSA 1THXA 2H01A 2YWNA 4USSA 3HYPA 3M9KA 1FVJA 3ZVJA 1ERUA 3J7Yb 2YJ7A 2X99A 3IBHA 2FWGA 1PKWA 1GUMA 2K9FA 3LQ7A 4MJEA 3ZLPA 2B7KA 1J08A 1SKRB 4CY6A 5CO3A 3MDKA 2R0PA 5JCUA 3LEFA 3GN3A 4K7OA 3GUSA 3LYKA 5IQYA 4QL9A 1X9WB 3D22A 3IK7A 4XHMA 2HRKA 6GSXA 1TKDB 5C04A 1EP8A 1IYHA 2DJ3A 2OE3A 3ZYWA 4X0XA 5EPFA 1XWAA 2OKAA 4ISDA 3PH9A 4OD7A 2DLXA 5H5SA 1GSFA 4EIPA 4N10A 1YZXA 1OE7A 3CMIA 2GTUA 4FIWA 4WEYA 4JE1A 1K3OA 1VRSD 1X5DA 2C80A 4ZXGA 2XPEA 3I9V2 1EOHA 3FY7A 3M3MA 4F0CA 4WXTA 2RM6A 1ON4A 2OJLA 4I97A 4DSSA 2R37A 3VWVA 1E6BA 4WKWA 2HXKA 3UVTA 3EC3A 1AUCA 3D6IA 3U6VA 2YZHA 2GQKA 4O5QA 2CAQA 2IN3A 2HRFA 5CYYA 2CX3A 2DIYA 3M8NA 1TK5B 3GIXA 2LRNA 3DXBA 1LJRA 4KGIA 3WT2A 4DSSB 2LNSA 3RAZA 1S3CA 1Z7RA 1R5AA 1TDIA 1SL2B 2C3NA 1A24A 4AJ8A 2L4CA 5HFGA 4YQVA 2L5OA 1O7UA 4IS0A 2KP1A 2JL4A 10GSA 2VO4A 3RHBA 4O7HA 1WMJA 5DQSA 4IBPA 1KBNA 1OVNA 3UL3A 1TW9A 3H1NA 3E9JB 4YH2A 2VL9A 4V2LA 3I6AA 2VCXA 1BAYA 2YOIA 1CQHA 1GTUA 4TXVA 1M7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJ2 A;  3UAR A;  1T4Z A;  3ZVJ D;  1K0B A;  5A5K A;  3VFI A;  4FYU A;  3PIN A;  5ENU A;  3QFA C;  3DVX A;  2YCD A;  3ZZX A;  5D9W A;  1A0F A;  1XVQ A;  1A23 A;  2HLS A;  2O87 A;  3GUR A;  4RI6 A;  1NHY A;  5GAP D;  1QGV A;  3WT1 A;  1M2A A;  3KZQ A;  5KEJ A;  1SK0 A;  2CQ9 A;  5IOX A;  5ECQ B;  2L4Q A;  4LL4 B;  4J57 E;  3ERW A;  3Q18 A;  2HFD A;  3DWV A;  3TJB A;  5G2Z A;  1ST9 A;  2OE0 A;  2JZR A;  4N30 A;  1LBK A;  5ECS A;  2M80 A;  2CA8 A;  1FO5 A;  3QR6 A;  1SKW B;  4MA9 A;  2GSS A;  5IPH A;  3GV1 A;  1NW2 A;  4PXO A;  4KX4 A;  2GZZ A;  1ABA A;  2VM1 A;  3Q19 A;  4WR4 A;  2GSR A;  2H19 A;  4TR1 A;  2D2Z A;  2JAC A;  4XIH A;  3CXG A;  4ECJ A;  1XOA A;  2FCH A;  3CSJ A;  3UIW A;  3ZL5 A;  1LU4 A;  5D96 A;  2LQO A;  2DJ0 A;  3GA4 A;  5EVO A;  5ECK B;  3TKR A;  1TRW A;  3QFB C;  3FKF A;  3TB2 A;  1YEX A;  4TR1 B;  5IMD A;  3GX0 A;  3HVS A;  5ECP B;  1DE2 A;  3Q74 A;  1SD8 A;  2E0Q A;  4DSR A;  4ZB6 A;  1B4Q A;  14GS A;  4NXI A;  4MZC A;  2IMF A;  2DC5 A;  2KUC A;  2RLI A;  2MMA A;  2ON7 A;  4J2F A;  3QDN A;  4K7N A;  1TK0 B;  2O89 A;  2IL3 A;  1GLQ A;  1A8Y A;  3KMO A;  1A2M A;  4GTU A;  4I2U A;  1GSE A;  2GST A;  2H1A A;  5D9T A;  3C1R A;  4IP1 A;  2CAI A;  1EEM A;  5D73 A;  1UN2 A;  1JFU A;  2O8V B;  3C71 A;  3F4R A;  1DUG A;  3FR3 A;  3EU3 A;  1AQX A;  2I9H A;  1K0D A;  1F9M A;  2B5E A;  1VF4 A;  5IMF A;  1JZD A;  4OFN A;  1B4P A;  5HR2 A;  3FR9 A;  1GWC A;  5D93 A;  2H0G A;  1QFN A;  2N5A A;  2OBK A;  2QKE A;  2M46 A;  4EF0 A;  3VI7 A;  4KA0 A;  3FRC A;  1YDK A;  5L71 A;  5COH A;  4HU9 A;  3ED3 A;  3LJR A;  1GTB A;  3RBT A;  1GNE A;  3EMX A;  3QAW A;  2R5G A;  3UJ1 A;  1VF2 A;  5KN2 A;  5DCG A;  3ZMK A;  3IK9 A;  5AIX A;  2M72 A;  1U6T A;  4ECC A;  5D9V A;  19GS A;  2P31 A;  3TRP A;  4XRA A;  3ZFB A;  2GQL A;  4Q5N A;  6GST A;  4ZL9 A;  2FUG 2;  2A4V A;  1X9M B;  4MP4 A;  3HVV A;  3GH6 A;  2YWO A;  1JZO A;  4KUN A;  4TOP A;  5GSS A;  3KH9 A;  1U3I A;  2H1G A;  3P7X A;  2MMN A;  4IW9 A;  2H74 A;  2PN8 A;  1RQM A;  5CRG A;  5JWO B;  3H4K A;  3HJP A;  1NSW A;  2RUF A;  2WZ9 A;  4MJA A;  2VUP A;  3BD2 A;  3US3 A;  1JHB A;  2L6C A;  1PX7 A;  5KN3 A;  4E8H A;  1PL1 A;  4O92 A;  2REM A;  1WWJ A;  1F3A A;  3IAS 2;  4KE3 A;  1IYI A;  2VCW A;  4N0Z A;  2JSY A;  6GSS A;  3IC4 A;  1QK8 A;  1B8X A;  4EUY A;  1VF1 A;  2L6D A;  5J5N A;  4JU5 A;  3FW2 A;  1ZZY A;  5JWQ B;  2H6X A;  2PVQ A;  5HR1 A;  1S3A A;  1EOG A;  1N2A A;  3NIV A;  2FHE A;  3FZA A;  1G7E A;  2O7K A;  3D21 A;  3GSS A;  3LGC A;  3HHV A;  2DJ1 A;  2B5X A;  1XZO A;  5FHI A;  5G30 A;  4PQI A;  1QXH A;  3ME7 A;  3G7I A;  1PMT A;  4V1A g;  1Z9H A;  4K1F A;  4WBR D;  2VL3 A;  4P3Y B;  3GKN A;  5FWG A;  4O32 A;  3DIE A;  2H66 A;  2DJJ A;  2L5L A;  5B6N A;  1A8L A;  2XPD A;  2HT9 A;  2FA4 A;  1SK2 A;  2FD3 A;  2C0F A;  1GNW A;  1ACV A;  1MEK A;  2JU5 A;  3IOS A;  1TP9 A;  5LCZ A;  3LOR A;  3SBC A;  1K0N A;  4TR4 A;  4X1U A;  1GUL A;  1ZYE A;  3ISO A;  2GGT A;  2WRT A;  4Q5Q A;  2FWH A;  3UVH A;  5ECO B;  1MDK A;  3QAV A;  3F4T A;  1YKC A;  2I1U A;  1TRV A;  2LTK A;  1FW1 A;  1XWG A;  3G9B A;  5IMC A;  4POL A;  3D5J A;  4PNF A;  3BBY A;  4HEA 2;  4DVC A;  3F3R A;  3F0I A;  3IDV A;  3WGE A;  5HFK A;  1HNC A;  1XBS A;  3GKK A;  4KH7 A;  3GFK A;  1GSD A;  5IPG A;  1YY7 A;  2FLS A;  1GUH A;  3HCZ A;  2JSZ A;  3LWA A;  2H1D A;  1TOF A;  1T7P B;  1XPV A;  1YF0 A;  3V1W A;  3CTF A;  4X43 A;  3EVI A;  5JCW A;  2QSI A;  3ZRE A;  1PRX A;  4JZQ A;  5LNK e;  4NV2 A;  5ECL B;  2VLT A;  2FY6 A;  1B48 A;  3TKS E;  1YEP A;  3BCI A;  2PUK C;  2CV4 A;  2I4A A;  3G7J A;  2FA8 A;  4OO5 A;  1FB0 A;  4DSQ A;  2E2M A;  3TUE A;  1THO A;  5HFI A;  2C0G A;  1DBY A;  1NM3 A;  4F82 A;  3DKS A;  3VPQ A;  2H1B A;  1KTE A;  3OR5 A;  4RQX A;  3LG6 A;  5GZZ B;  2HI7 A;  3VWU A;  2DMM A;  22GS A;  2L57 A;  1EP7 A;  1F6M C;  4PX1 A;  1SK1 A;  3BOA A;  2H70 A;  4BL7 A;  3ME8 A;  4TR3 A;  1O85 A;  3IE3 A;  4OCE A;  3KMN A;  2ZUP A;  3TJK A;  3N9J A;  1V9W A;  5ELG A;  4IVF A;  4I2T A;  4PUR A;  2IJY A;  5A4U A;  2MYG A;  1PL2 A;  3MAK A;  3TJG A;  7GSS A;  2R3X A;  4MLY A;  2GVP A;  3QPM A;  4XS6 A;  5DCH A;  2LJA A;  4TVE A;  1OAZ A;  3SWL A;  4OO4 A;  2VCQ A;  5E59 A;  3QOU A;  1T3B A;  4H86 A;  4O5R A;  4PQ1 A;  2RII A;  4KSM A;  4ML6 A;  2LJK A;  3EIN A;  4G19 A;  2VLV A;  2ES7 A;  3F6F A;  1I9D A;  5IM9 A;  4F2I A;  18GS A;  1HQO A;  2NBS A;  3O76 A;  1YJ6 A;  3L0H A;  4G2E A;  5AN1 A;  4MH3 A;  3L9S A;  3Q6O A;  1BYE A;  2IMI A;  4GQC A;  4XCS A;  5ELA A;  2YV7 A;  2B6M A;  4XTS A;  5ECR B;  5ECM B;  1MDJ A;  1Z6M A;  3QMX A;  4MF5 A;  2LRT A;  4WF5 A;  1TRU A;  1Z3E A;  2DJK A;  2PER A;  2C1Y A;  3D0Z A;  1GRX A;  1WRY A;  1FOV A;  1XCC A;  2I81 A;  2PPT A;  2IME A;  1EGO A;  2N5B A;  1X5C A;  4EDY A;  2C4J A;  3FHK A;  3LXZ A;  2IWT A;  2F51 A;  4K6X A;  3WYW A;  1K3Y A;  2HE3 A;  2J23 A;  2YWM A;  3H93 A;  2B7J A;  1MDI A;  1WPI A;  1XIY A;  2GSQ A;  1FG4 A;  1AXD A;  2V6O A;  2LST A;  5GAN D;  2LEG A;  5DVB A;  4BVX A;  3ZIT A;  2DJ2 A;  1MTC A;  1X5E A;  4V2M A;  1RK4 A;  1R26 A;  2MZC A;  4NHW A;  2QC7 A;  1RW1 A;  3AY8 A;  1WIK A;  4XS4 A;  1CQG A;  4NAX A;  3VPT A;  2EIR A;  2LQQ A;  1JZR A;  4GSS A;  3RHC A;  2H75 A;  4GWR A;  5DJM A;  2C0E A;  2OAD A;  1OC3 A;  2YN1 A;  3L4N A;  2YAN A;  1ML6 A;  4QL7 A;  9GSS A;  4XS4 B;  2YP6 A;  3F4S A;  1SJ6 A;  1O8X A;  1XWC A;  2WS2 A;  4F9Z A;  3FZ9 A;  1M2D A;  4ILF A;  1XVW A;  3C73 A;  3TGZ A;  12GS A;  3C7M A;  1TTZ A;  5IMA A;  2X8H A;  2LV3 A;  4MF7 A;  2TRC P;  5G1L A;  4NWY A;  1GH2 A;  4PUA A;  1SJI A;  3M0F A;  5CNW A;  4LLR A;  1ZGN A;  3O6T A;  1XW6 A;  5C00 A;  2OA7 A;  4IQA A;  2H73 A;  3KP9 A;  5CRH A;  3W8S A;  1OC9 A;  3IR4 A;  4QQ7 A;  2YZU A;  3H79 A;  2OE1 A;  2NTO A;  2JZS A;  1JLW A;  4HJM A;  4KND A;  1FHE A;  1K0O A;  4GCI A;  3DRN A;  5H5Q A;  2VIM A;  2OBI A;  2DIZ A;  5IO0 A;  3DD3 A;  3APO A;  3GHA A;  3GL5 A;  3TRX A;  1OC9 B;  3VLN A;  8GSS A;  4RI7 A;  5IIZ A;  3A2X A;  3CBU A;  2IPA A;  2GQM A;  5DAK A;  2GT6 A;  2VCT A;  1KEB A;  1QMV A;  4L0W A;  3NOF A;  1EWX A;  3IAM 2;  4BWS A;  4HS1 A;  5CRD A;  3MWH A;  2VAF A;  4I8B A;  4PQH A;  2HSY A;  5HR3 A;  4I6X A;  5DAK B;  5J41 A;  4EC0 A;  5G5F A;  2HNL A;  2B1K A;  3FEU A;  3IA1 A;  3HZ4 A;  4HI7 A;  1VGL A;  1GTA A;  2YV9 A;  1AC1 A;  2MBT A;  1GSQ A;  5CRW A;  2V6K A;  2FGX A;  1XOB A;  1SL0 B;  4GF0 A;  5F06 A;  2ZCT A;  4JR6 A;  2WGR A;  4IJ3 A;  3EUR A;  2I3Y A;  2GT5 A;  1SU9 A;  1GLP A;  4LMV A;  4RUV A;  3PR8 A;  4EO3 A;  2C3Q A;  3LYP A;  4TN8 A;  3CTG A;  1M0U A;  1FB6 A;  1VF3 A;  2WCI A;  4OCF A;  2KLX A;  1PN9 A;  4ZL7 A;  4OWY A;  3RDW A;  4Q5F A;  1Z6N A;  3EE2 A;  1TRS A;  1OYJ A;  2O85 A;  4RQR A;  1B9X C;  4GRF A;  4JED A;  3L9V A;  1H4O A;  2H30 A;  2ZNM A;  1GSU A;  2IIY A;  3GTU A;  4V2N A;  3A5W A;  2IMD A;  4KAE A;  4BA7 A;  1BQ7 A;  3LFL A;  3KJY A;  4ZIJ A;  2LJR A;  3O3T A;  4GXZ A;  1DE1 A;  1XWK A;  3LSZ A;  4MPG A;  3M1G A;  3TKP A;  5AIS A;  2KP2 A;  4ZB8 A;  3ZRD A;  3GTU B;  2FWE A;  3M9J A;  4IP6 A;  2H72 A;  2CT6 A;  4AGS A;  3CRU A;  2Z9S A;  3GKM A;  2G2Q A;  4TW5 A;  2VCV A;  3DML A;  3TRQ A;  3U5R E;  1JLV A;  3VWW A;  1UVZ A;  3CSI A;  2PMT A;  2XBI A;  1M9A A;  1SKS B;  1V2A A;  3UBL A;  5E4W A;  1C72 A;  2LRC A;  4CDO A;  3S9F A;  1U87 A;  2AV4 A;  3G7Y A;  1SL1 B;  5B8A A;  2X64 A;  2KHP A;  4TKY A;  4EVM A;  5JCG A;  20GS A;  3IPZ A;  4WET A;  1OE8 A;  3TDG A;  5J9C A;  3UMA A;  2VD1 A;  5G5E A;  5KN1 A;  2H0H A;  1X0R A;  1Y25 A;  3JCM L;  3F8U A;  2VM2 A;  2FWF A;  4ZB9 A;  3APQ A;  5LD0 A;  4L0U A;  3ZTL A;  3WGD A;  3MSZ A;  2EC4 A;  3TKS C;  2F8A A;  1G7O A;  1V40 A;  5G1K A;  5ECN B;  4HOJ A;  1TXX A;  1W4V A;  1M2B A;  1WOU A;  5ECI B;  1V58 A;  5F05 A;  2CZ3 A;  3KD0 A;  3ZML A;  4EXJ A;  2LNT A;  2OAC A;  4MF6 A;  3E0U A;  3TKQ A;  1Z5Y E;  2H8L A;  4YQM A;  2AAW A;  1I5G A;  1TU7 A;  2H71 A;  5DAL A;  4BPY A;  4KW6 A;  3FZ5 A;  2VL2 C;  3KGK A;  2R4V A;  1F2E A;  5G31 A;  2YNX A;  2BMX A;  1Z7P A;  2GZP A;  13GS A;  1AAZ A;  3IHQ A;  3PGT A;  4L5O A;  2GS3 A;  2CVB A;  3EWL A;  4MPF A;  5DAL B;  3F3Q A;  5HR0 A;  4HDE A;  2AYT A;  1XFL A;  1YKA A;  3KH7 A;  5IOW A;  1USB A;  2R6K A;  2VD0 A;  6GSY A;  2ALB A;  3KIJ A;  4IHU A;  1PQN A;  1ERV A;  1A0R P;  1XW9 A;  1SYR A;  4WBJ A;  4ECB A;  1GTI A;  4YAV A;  1EV9 A;  1N8J A;  4KDY A;  3TKS A;  1GP1 A;  1BG5 A;  1E2Y A;  3VI5 A;  1J0F A;  1O8W A;  4N0V A;  2V1M A;  4POK A;  5ABR A;  3A2W A;  5CAX A;  2RM5 A;  2GLR A;  4D73 A;  2LKU A;  3GMF A;  4K0N A;  2F9S A;  1A2J A;  2WDU A;  3KM6 A;  3TJF A;  4KCA A;  4Z7X A;  4KDU A;  3RPP A;  3UEM A;  2K18 A;  2VL2 A;  3DEX A;  4FYC A;  1F37 A;  3J7Y k;  4G10 A;  3ZIV A;  4D73 B;  3TOU A;  3KTL A;  4KCE A;  1O6J A;  3F9U A;  5JWR B;  3GH9 A;  4NMU A;  2A2R A;  5CP1 A;  5J4U A;  4GQF A;  3ERG A;  4PGT A;  1T1V A;  4WR5 A;  3L78 A;  2V41 A;  2CX4 A;  4EDZ A;  1URM A;  3H8Q A;  1TI3 A;  5DBQ A;  3DVW A;  3L9U A;  2PBJ A;  5F8B A;  3KP8 A;  1HNA A;  1PGT A;  4MAB A;  5H5R A;  4LMW A;  3KCM A;  1OC8 A;  1ILO A;  2L59 A;  2WUL A;  1AQV A;  1EV4 A;  2QGV A;  3EU4 A;  5ECH B;  2EIQ A;  4OFT A;  1K0M A;  3GRX A;  2A2S A;  4MCU A;  3HY2 A;  1T4Y A;  1HYU A;  1G6Y A;  1XXU A;  1OKT A;  4IN0 A;  3VK9 A;  4ML1 A;  2V32 A;  4NV5 A;  2H6Z A;  2X8G A;  2FNO A;  3HA9 A;  3TJJ A;  3MNG A;  2P0G A;  3QCP A;  2AB6 A;  5F07 A;  4BWQ A;  1M99 A;  2XBQ A;  4FH8 A;  3ZFL A;  1TK8 B;  3P90 A;  2WFC A;  2LS5 A;  4MK3 A;  2E7P A;  2F3M A;  2YWI A;  1WJK A;  1DSB A;  1BED A;  1SYX A;  1WP0 A;  4CHS A;  1AW9 A;  2XHF A;  1XWB A;  3KTB A;  3APS A;  4WF4 A;  1YQ1 A;  4TR0 A;  1FVK A;  2EIO A;  3EYT A;  4TXO A;  4E8E A;  2XC2 A;  5D8I A;  4PNG A;  3GNJ A;  11GS A;  16GS A;  3E3E A;  1R5P A;  3ERF A;  1ERT A;  4K9Z A;  4TRX A;  2TIR A;  1AQW A;  2P5Q A;  1K3L A;  2DSA A;  5F0G A;  6GSW A;  5A4V A;  4F0B A;  3LXT A;  4XRD A;  2DBC A;  2YJH A;  3I43 A;  4TXO B;  3GKX A;  2K6V A;  2IFQ A;  4GST A;  4JBB A;  4HZ4 A;  3F63 A;  3QD9 A;  4K0G A;  17GS A;  2WJU A;  4EL1 A;  3R2Q A;  2MMZ A;  1BJX A;  1G6W A;  2X8C A;  2V2G A;  1HNB A;  1T8E B;  1ZCP A;  2YPM A;  4FYB A;  4L8E A;  4OMV A;  5D9X A;  2K8V A;  2IFQ B;  3FR6 A;  6GSV A;  1NHO A;  3RPN A;  1O73 A;  1ZL9 A;  3F6D A;  4MJC A;  1GSS A;  3GST A;  5GST A;  2R2J A;  3GL3 A;  1K0A A;  4YQU A;  3D4M A;  4HUA A;  2HYX A;  3W8J A;  2B1L A;  2N5F A;  3WGX A;  2DML A;  1R7H A;  1KNG A;  1SJZ A;  4K8M A;  1H75 A;  3UAP A;  3QAG A;  1T00 A;  1SEN A;  5IMZ A;  4KSO A;  2H0I A;  2ON5 A;  1YF1 A;  4ZBB A;  2TRX A;  3CRT A;  3KEB A;  3GX8 A;  4GSN A;  4KDX A;  1ZMA A;  2B3S A;  1JZW A;  3K8N A;  4NPB A;  1MD3 A;  4JR4 A;  2IMK A;  4YAP A;  4K2D A;  2NVL A;  3A2V A;  1UC7 A;  2F8F A;  5DJL A;  5FT3 A;  2HSH A;  5B8B A;  1X9S B;  2HZE A;  4JRR A;  3IXR A;  3BCK A;  4ECI A;  1M9B A;  2K8S A;  5AIV A;  4DEJ A;  4LA1 A;  4KB3 A;  2RUE A;  2VLU A;  4Q5R A;  1GUK A;  4AF2 A;  2PGT A;  3HDC A;  4G9H A;  4POB A;  5INY A;  2E2G A;  1ZOF A;  4N11 A;  2MBS A;  4ZBD A;  1K0C A;  2HZE B;  1R4W A;  5A4W A;  5IMV A;  1OKD A;  1QUW A;  2MMO A;  2NDO A;  1ZYQ B;  1V57 A;  4L5L A;  1F3B A;  6GSU A;  3P8W A;  2B5Y A;  3UOM A;  4IQ1 A;  2VOC A;  3C8E A;  1MD4 A;  3IRA A;  3N5O A;  4AJ7 A;  4MZW A;  1GSY A;  1PX6 A;  3TOT A;  5B6M A;  4ZIL A;  3WD6 A;  1J9B A;  2H6Y A;  4IJI A;  4MZB A;  2P5R A;  3HKR A;  3VWX A;  2NPB A;  3EMP A;  4FO5 A;  2JAD A;  3TCO A;  3DGQ A;  3HJO A;  5IO2 A;  4CW9 A;  1V98 A;  2VCZ A;  4NHZ A;  4ULX A;  2G0F A;  3IV4 A;  4GLT A;  2C3T A;  3D4T A;  2C8U A;  1EGR A;  1EEJ A;  2HRN A;  5CRE A;  1FAA A;  1W89 A;  1SD9 A;  2AHE A;  4PUF C;  3UBK A;  2J9H A;  1Q98 A;  1ERW A;  3ZIJ A;  3CYN A;  4ZL8 A;  4ID0 A;  3W6G A;  2GZY A;  5DDL A;  5ID2 A;  1XW5 A;  2AUV A;  4HZ2 A;  2HZF A;  2CVD A;  3FYG A;  2LUS A;  4IEL A;  1S3D A;  2PVO C;  3HVX A;  3HXS A;  2CZ2 A;  1G0T A;  5AGY A;  1QQ2 A;  4OFM A;  5B7C A;  4F03 A;  5ID2 B;  4XS1 A;  4MH2 A;  4IKH A;  1UA5 A;  5J3R A;  3DYR A;  1BX9 A;  1PD2 1;  3FK8 A;  1AIU A;  5J9B A;  4LL1 B;  4HQZ A;  4EE0 A;  3FZ4 A;  4EKZ A;  4ZBA A;  1U88 A;  2PWJ A;  2C0D A;  1U3A A;  3VUR A;  4MDC A;  1GL8 A;  4BVY A;  2JZT A;  3C1S A;  1EZK A;  2AJQ B;  3HJM A;  1B9Y C;  3NZN A;  4V1A p;  1TJD A;  3HD5 A;  4ACS A;  1PSQ A;  1TU8 A;  3BJ5 A;  4POM A;  4I5Q A;  5HQP A;  5EY6 A;  3HZ8 A;  1O81 A;  3P2A A;  4AJ6 A;  3I69 A;  2KOK A;  1WE0 A;  2H76 A;  3A3T A;  1PA3 A;  4IGJ A;  4MMM A;  1Y6E A;  2CVK A;  1Q4J A;  3CSH A;  1A2L A;  1PKZ A;  2WB9 A;  3GYK A;  5DQY A;  2BTO T;  1HD2 A;  4HU7 A;  4MJB A;  5KN0 A;  2GDR A;  2PU9 C;  5EL8 A;  1TI1 A;  3KXO A;  2BJX A;  4J56 E;  4K7I A;  4HQS A;  1THX A;  2H01 A;  2YWN A;  3HYP A;  3M9K A;  1FVJ A;  3ZVJ A;  1ERU A;  3J7Y b;  2YJ7 A;  2X99 A;  3IBH A;  2FWG A;  1PKW A;  1GUM A;  2K9F A;  3LQ7 A;  4MJE A;  3ZLP A;  2B7K A;  1J08 A;  1SKR B;  5CO3 A;  3MDK A;  5JCU A;  3LEF A;  3GN3 A;  4K7O A;  3GUS A;  3LYK A;  5IQY A;  4QL9 A;  1X9W B;  3D22 A;  3IK7 A;  4XHM A;  6GSX A;  1TKD B;  5C04 A;  1EP8 A;  1IYH A;  2DJ3 A;  2OE3 A;  3ZYW A;  4X0X A;  5EPF A;  1XWA A;  2OKA A;  4ISD A;  3PH9 A;  4OD7 A;  2DLX A;  5H5S A;  1GSF A;  4N10 A;  1YZX A;  1OE7 A;  3CMI A;  2GTU A;  4FIW A;  4WEY A;  4JE1 A;  1K3O A;  1VRS D;  1X5D A;  2C80 A;  4ZXG A;  2XPE A;  3I9V 2;  1EOH A;  3FY7 A;  3M3M A;  4F0C A;  4WXT A;  2RM6 A;  1ON4 A;  2OJL A;  4I97 A;  4DSS A;  2R37 A;  3VWV A;  1E6B A;  4WKW A;  2HXK A;  3UVT A;  3EC3 A;  1AUC A;  3D6I A;  3U6V A;  2YZH A;  2GQK A;  2CAQ A;  2IN3 A;  2HRF A;  5CYY A;  2CX3 A;  2DIY A;  3M8N A;  1TK5 B;  3GIX A;  2LRN A;  3DXB A;  1LJR A;  4KGI A;  3WT2 A;  4DSS B;  2LNS A;  3RAZ A;  1S3C A;  1Z7R A;  1R5A A;  1TDI A;  1SL2 B;  2C3N A;  1A24 A;  4AJ8 A;  2L4C A;  5HFG A;  4YQV A;  2L5O A;  1O7U A;  4IS0 A;  2KP1 A;  2JL4 A;  10GS A;  2VO4 A;  3RHB A;  4O7H A;  1WMJ A;  5DQS A;  4IBP A;  1KBN A;  1OVN A;  3UL3 A;  1TW9 A;  3H1N A;  3E9J B;  4YH2 A;  2VL9 A;  4V2L A;  3I6A A;  2VCX A;  1BAY A;  2YOI A;  1CQH A;  1GTU A;  4TXV A;  1M7T A; 
#chains in the Genus database with same CATH topology
 4HJ2 A;  3UAR A;  1T4Z A;  3ZVJ D;  1K0B A;  5A5K A;  3VFI A;  4FYU A;  3PIN A;  5ENU A;  3QFA C;  3DVX A;  2YCD A;  3ZZX A;  5D9W A;  1A0F A;  1XVQ A;  1A23 A;  2HLS A;  2O87 A;  3GUR A;  4RI6 A;  1NHY A;  5GAP D;  1QGV A;  3WT1 A;  1M2A A;  3KZQ A;  5KEJ A;  1SK0 A;  2CQ9 A;  5IOX A;  5ECQ B;  2L4Q A;  4LL4 B;  4J57 E;  3ERW A;  3Q18 A;  2HFD A;  3DWV A;  3TJB A;  5G2Z A;  1ST9 A;  2OE0 A;  2JZR A;  4N30 A;  1LBK A;  5ECS A;  2M80 A;  2CA8 A;  1FO5 A;  3QR6 A;  1SKW B;  4MA9 A;  2GSS A;  5IPH A;  4Z2U A;  3GV1 A;  1NW2 A;  4PXO A;  4KX4 A;  2GZZ A;  1ABA A;  2VM1 A;  3Q19 A;  4WR4 A;  2GSR A;  2H19 A;  4TR1 A;  2D2Z A;  2JAC A;  4XIH A;  3CXG A;  4ECJ A;  1XOA A;  2FCH A;  3CSJ A;  3UIW A;  3ZL5 A;  1LU4 A;  5D96 A;  2LQO A;  2DJ0 A;  3GA4 A;  5EVO A;  5ECK B;  3TKR A;  1TRW A;  3QFB C;  3FKF A;  3TB2 A;  1YEX A;  4HSC X;  4TR1 B;  5IMD A;  3GX0 A;  3HVS A;  5ECP B;  1DE2 A;  3Q74 A;  1SD8 A;  2E0Q A;  4DSR A;  4ZB6 A;  1B4Q A;  14GS A;  4NXI A;  4MZC A;  2IMF A;  2DC5 A;  2KUC A;  2RLI A;  2MMA A;  2ON7 A;  4J2F A;  3QDN A;  4K7N A;  1TK0 B;  2O89 A;  2IL3 A;  1GLQ A;  1A8Y A;  3KMO A;  1A2M A;  4GTU A;  4I2U A;  1GSE A;  2GST A;  2H1A A;  5D9T A;  3C1R A;  4IP1 A;  2CAI A;  1EEM A;  5D73 A;  1UN2 A;  1JFU A;  2O8V B;  3C71 A;  3F4R A;  1DUG A;  3FR3 A;  3EU3 A;  1AQX A;  2I9H A;  1K0D A;  3MIX A;  1F9M A;  2B5E A;  1VF4 A;  5IMF A;  1JZD A;  5KOW A;  4K5R A;  4OFN A;  1B4P A;  5HR2 A;  3FR9 A;  1GWC A;  5D93 A;  2H0G A;  1QFN A;  2N5A A;  2OBK A;  2QKE A;  2M46 A;  4EF0 A;  3VI7 A;  4KA0 A;  3FRC A;  1YDK A;  5L71 A;  5COH A;  4HU9 A;  3ED3 A;  3LJR A;  2DKI A;  1GTB A;  3RBT A;  1GNE A;  3EMX A;  3QAW A;  2R5G A;  3UJ1 A;  1VF2 A;  5KN2 A;  5DCG A;  3ZMK A;  3IK9 A;  5AIX A;  2M72 A;  1U6T A;  4ECC A;  5D9V A;  19GS A;  2P31 A;  4K5S A;  3TRP A;  4XRA A;  3ZFB A;  2GQL A;  4Q5N A;  6GST A;  3MYD A;  4ZL9 A;  2FUG 2;  2A4V A;  1X9M B;  4MP4 A;  3HVV A;  3GH6 A;  2YWO A;  1JZO A;  4KUN A;  4TOP A;  5GSS A;  3KH9 A;  1U3I A;  2H1G A;  3HVN A;  3P7X A;  2MMN A;  4IW9 A;  2H74 A;  2PN8 A;  1RQM A;  5CRG A;  5JWO B;  3H4K A;  3HJP A;  1NSW A;  2RUF A;  4MNN A;  2WZ9 A;  4MJA A;  2VUP A;  3BD2 A;  3US3 A;  2A2P A;  1JHB A;  2L6C A;  1PX7 A;  5KN3 A;  4E8H A;  1PL1 A;  4O92 A;  2REM A;  1WWJ A;  1F3A A;  3IAS 2;  4KE3 A;  1IYI A;  2VCW A;  4N0Z A;  2JSY A;  3FMW A;  6GSS A;  3IC4 A;  1QK8 A;  1B8X A;  4EUY A;  1VF1 A;  2L6D A;  5J5N A;  4JU5 A;  3FW2 A;  1ZZY A;  5JWQ B;  2H6X A;  2PVQ A;  5HR1 A;  1S3A A;  1ZYN A;  1EOG A;  1N2A A;  3NIV A;  4A5P A;  2FHE A;  3FZA A;  1G7E A;  2O7K A;  3D21 A;  3GSS A;  3LGC A;  3HHV A;  2DJ1 A;  2B5X A;  1XZO A;  5FHI A;  5G30 A;  4PQI A;  1QXH A;  3ME7 A;  2QA1 A;  3G7I A;  1PMT A;  4V1A g;  1Z9H A;  4K1F A;  4WBR D;  2VL3 A;  4P3Y B;  3GKN A;  5FWG A;  4O32 A;  3DIE A;  2H66 A;  2DJJ A;  2L5L A;  5B6N A;  1A8L A;  2XPD A;  2HT9 A;  2FA4 A;  1SK2 A;  2FD3 A;  2C0F A;  1GNW A;  1ACV A;  1MEK A;  2JU5 A;  3IOS A;  1TP9 A;  5LCZ A;  3LOR A;  3SBC A;  1K0N A;  4TR4 A;  4X1U A;  1GUL A;  1ZYE A;  3ISO A;  4YKG A;  2GGT A;  2WRT A;  4Q5Q A;  2FWH A;  3UVH A;  5ECO B;  1MDK A;  3QAV A;  3F4T A;  3LW9 A;  1YKC A;  2I1U A;  1TRV A;  2LTK A;  1FW1 A;  1XWG A;  3G9B A;  5IMC A;  4POL A;  3D5J A;  4PNF A;  3BBY A;  4HEA 2;  4DVC A;  3F3R A;  3F0I A;  3IDV A;  3WGE A;  5HFK A;  1HNC A;  1XBS A;  3GKK A;  4KH7 A;  3GFK A;  1GSD A;  5IPG A;  1YY7 A;  2FLS A;  1GUH A;  3HCZ A;  2JSZ A;  3LWA A;  2H1D A;  1TOF A;  1T7P B;  1XPV A;  1YF0 A;  3V1W A;  3CTF A;  4X43 A;  3EVI A;  5JCW A;  2QSI A;  3ZRE A;  1PRX A;  4JZQ A;  5LNK e;  4NV2 A;  5ECL B;  2VLT A;  2FY6 A;  1B48 A;  3TKS E;  1YEP A;  3BCI A;  2PUK C;  2CV4 A;  2I4A A;  3G7J A;  2FA8 A;  4OO5 A;  1FB0 A;  4DSQ A;  2E2M A;  3TUE A;  1THO A;  5HFI A;  2C0G A;  1DBY A;  1NM3 A;  4F82 A;  3DKS A;  3VPQ A;  2H1B A;  3PPU A;  1KTE A;  3OR5 A;  4RQX A;  3LG6 A;  5GZZ B;  2HI7 A;  3VWU A;  2DMM A;  22GS A;  2L57 A;  1EP7 A;  1F6M C;  4PX1 A;  1SK1 A;  3BOA A;  2H70 A;  4BL7 A;  3ME8 A;  4TR3 A;  1O85 A;  3IE3 A;  4OCE A;  3KMN A;  2ZUP A;  3TJK A;  3N9J A;  1V9W A;  5ELG A;  4IVF A;  4I2T A;  4PUR A;  2IJY A;  5A4U A;  2MYG A;  1PL2 A;  3MAK A;  3TJG A;  7GSS A;  2R3X A;  4MLY A;  2GVP A;  3QPM A;  4XS6 A;  5DCH A;  2LJA A;  4TVE A;  4BL7 B;  1OAZ A;  3SWL A;  4OO4 A;  2VCQ A;  5E59 A;  3QOU A;  1T3B A;  4H86 A;  4O5R A;  4PQ1 A;  2RII A;  4KSM A;  2R0C A;  4ML6 A;  2LJK A;  3EIN A;  4G19 A;  2VLV A;  2ES7 A;  3F6F A;  1I9D A;  5IM9 A;  4F2I A;  18GS A;  1HQO A;  2NBS A;  3O76 A;  1YJ6 A;  3L0H A;  4G2E A;  5AN1 A;  4MH3 A;  3L9S A;  3Q6O A;  1BYE A;  2IMI A;  4GQC A;  4XCS A;  5ELA A;  2YV7 A;  2B6M A;  4XTS A;  5ECR B;  5ECM B;  1MDJ A;  1Z6M A;  3QMX A;  4MF5 A;  2LRT A;  4WF5 A;  1TRU A;  1Z3E A;  2DJK A;  2PER A;  2C1Y A;  3D0Z A;  4EIQ A;  1GRX A;  1WRY A;  1FOV A;  2DKH A;  1XCC A;  2I81 A;  2PPT A;  2IME A;  1EGO A;  2N5B A;  1X5C A;  4EDY A;  2C4J A;  3FHK A;  3A5I A;  3LXZ A;  2IWT A;  2F51 A;  4K6X A;  3WYW A;  1K3Y A;  2HE3 A;  2J23 A;  2YWM A;  3H93 A;  2B7J A;  1MDI A;  1WPI A;  1XIY A;  2GSQ A;  1FG4 A;  1AXD A;  2V6O A;  2LST A;  5GAN D;  2LEG A;  5DVB A;  4BVX A;  3ZIT A;  2DJ2 A;  1MTC A;  1X5E A;  4V2M A;  1RK4 A;  1R26 A;  2MZC A;  4NHW A;  2QC7 A;  4BVX B;  1RW1 A;  3AY8 A;  1WIK A;  4XS4 A;  1CQG A;  4NAX A;  3VPT A;  2EIR A;  2LQQ A;  1JZR A;  3IC8 A;  4GSS A;  3RHC A;  2H75 A;  4GWR A;  5DJM A;  2C0E A;  2OAD A;  1OC3 A;  2YN1 A;  3L4N A;  4FQU A;  5BRT A;  2YAN A;  1ML6 A;  4QL7 A;  9GSS A;  4XS4 B;  2YP6 A;  3F4S A;  1SJ6 A;  1O8X A;  1XWC A;  2WS2 A;  4F9Z A;  3FZ9 A;  1M2D A;  4ILF A;  1XVW A;  3C73 A;  3TGZ A;  1XG8 A;  12GS A;  3C7M A;  1TTZ A;  5IMA A;  2X8H A;  2LV3 A;  4MF7 A;  2TRC P;  5G1L A;  4NWY A;  1GH2 A;  4PUA A;  1SJI A;  3M0F A;  5CNW A;  3IHG A;  4LLR A;  1ZGN A;  3O6T A;  1XW6 A;  5C00 A;  2OA7 A;  4IQA A;  2H73 A;  3KP9 A;  5CRH A;  3W8S A;  1OC9 A;  3IR4 A;  5KOX A;  4QQ7 A;  2YZU A;  3H79 A;  2OE1 A;  2NTO A;  2JZS A;  1JLW A;  4HJM A;  4KND A;  4G0I A;  1FHE A;  1K0O A;  4GCI A;  3DRN A;  5H5Q A;  2VIM A;  2OBI A;  2DIZ A;  5IO0 A;  3DD3 A;  3APO A;  3GHA A;  3GL5 A;  3TRX A;  1OC9 B;  3VLN A;  8GSS A;  4RI7 A;  5IIZ A;  3A2X A;  3CBU A;  2IPA A;  2GQM A;  5DAK A;  2GT6 A;  2VCT A;  1KEB A;  1QMV A;  4L0W A;  3NOF A;  1EWX A;  3IAM 2;  4BWS A;  4HS1 A;  5CRD A;  3MWH A;  2VAF A;  4I8B A;  4PQH A;  2HSY A;  5HR3 A;  4I6X A;  5DAK B;  5J41 A;  4EC0 A;  1PN0 A;  5G5F A;  2HNL A;  4K2X A;  2B1K A;  3FEU A;  3IA1 A;  3HZ4 A;  4HI7 A;  1VGL A;  1GTA A;  2YV9 A;  1AC1 A;  2MBT A;  1GSQ A;  4Z2R A;  5CRW A;  2V6K A;  2FGX A;  1XOB A;  1SL0 B;  4GF0 A;  5F06 A;  2ZCT A;  4JR6 A;  2WGR A;  4IJ3 A;  3EUR A;  2I3Y A;  2GT5 A;  1SU9 A;  1GLP A;  4LMV A;  4RUV A;  3PR8 A;  4EO3 A;  2C3Q A;  3LYP A;  4TN8 A;  3CTG A;  1M0U A;  1FB6 A;  1VF3 A;  2WCI A;  4OCF A;  2KLX A;  1PN9 A;  4ZL7 A;  4OWY A;  3RDW A;  4Q5F A;  1Z6N A;  3EE2 A;  1TRS A;  1OYJ A;  4KF9 A;  2O85 A;  4RQR A;  1B9X C;  4GRF A;  4JED A;  3L9V A;  1H4O A;  2H30 A;  2ZNM A;  1GSU A;  2IIY A;  3GTU A;  4V2N A;  3A5W A;  2IMD A;  4KAE A;  4BA7 A;  1BQ7 A;  3LFL A;  3KJY A;  4ZIJ A;  2LJR A;  3O3T A;  4GXZ A;  1DE1 A;  1XWK A;  4CY8 A;  3LSZ A;  4MPG A;  3M1G A;  3TKP A;  5AIS A;  2KP2 A;  4ZB8 A;  3ZRD A;  3GTU B;  2FWE A;  3M9J A;  4IP6 A;  2H72 A;  2CT6 A;  4AGS A;  3CRU A;  2Z9S A;  3GKM A;  2G2Q A;  4TW5 A;  2VCV A;  3DML A;  3TRQ A;  3U5R E;  1JLV A;  3VWW A;  1UVZ A;  3CSI A;  2PMT A;  2XBI A;  4ICY A;  1M9A A;  1SKS B;  1V2A A;  3UBL A;  5E4W A;  1ZYP A;  1C72 A;  2LRC A;  4CDO A;  1FOH A;  3S9F A;  1U87 A;  2AV4 A;  3G7Y A;  1SL1 B;  5B8A A;  2X64 A;  2KHP A;  4TKY A;  4EVM A;  5JCG A;  20GS A;  3IPZ A;  4WET A;  1OE8 A;  3TDG A;  5J9C A;  3UMA A;  2VD1 A;  5G5E A;  4YKF A;  5KN1 A;  2H0H A;  1X0R A;  1Y25 A;  3JCM L;  3F8U A;  2VM2 A;  2FWF A;  4ZB9 A;  3APQ A;  5LD0 A;  4L0U A;  3ZTL A;  3WGD A;  3MSZ A;  2EC4 A;  3TKS C;  2F8A A;  1G7O A;  1V40 A;  5G1K A;  5ECN B;  4HOJ A;  1TXX A;  1W4V A;  1M2B A;  1WOU A;  5ECI B;  1V58 A;  5F05 A;  2CZ3 A;  3KD0 A;  3ZML A;  1S3R A;  4EXJ A;  2LNT A;  2OAC A;  4MF6 A;  3E0U A;  3TKQ A;  1Z5Y E;  2H8L A;  4YQM A;  2AAW A;  1I5G A;  1TU7 A;  2H71 A;  5DAL A;  4BPY A;  4KW6 A;  3FZ5 A;  2VL2 C;  3KGK A;  2R4V A;  1F2E A;  5G31 A;  2YNX A;  2BMX A;  1Z7P A;  4G0K A;  2GZP A;  13GS A;  1AAZ A;  3IHQ A;  3PGT A;  4L5O A;  2GS3 A;  2CVB A;  3EWL A;  4MPF A;  5DAL B;  3F3Q A;  5HR0 A;  4HDE A;  2AYT A;  1XFL A;  1YKA A;  3KH7 A;  5IOW A;  1USB A;  2R6K A;  2VD0 A;  6GSY A;  2ALB A;  3KIJ A;  4IHU A;  1PQN A;  1ERV A;  1A0R P;  1XW9 A;  1SYR A;  4WBJ A;  4ECB A;  1GTI A;  4YAV A;  1EV9 A;  1N8J A;  4KDY A;  3TKS A;  1GP1 A;  1BG5 A;  1E2Y A;  3VI5 A;  1J0F A;  1O8W A;  4N0V A;  2V1M A;  4POK A;  5ABR A;  3A2W A;  5CAX A;  2RM5 A;  2GLR A;  4D73 A;  2LKU A;  3GMF A;  4K0N A;  2F9S A;  1A2J A;  2WDU A;  3KM6 A;  3TJF A;  4KCA A;  4Z7X A;  4KDU A;  3RPP A;  3UEM A;  2K18 A;  2VL2 A;  3DEX A;  4FYC A;  1F37 A;  3J7Y k;  4G10 A;  3ZIV A;  4D73 B;  3TOU A;  3KTL A;  4KCE A;  1O6J A;  3F9U A;  5JWR B;  3GH9 A;  4NMU A;  2A2R A;  5CP1 A;  2UZ8 A;  5J4U A;  4GQF A;  4G0L A;  3ERG A;  4PGT A;  1T1V A;  4WR5 A;  3L78 A;  3EPT A;  2V41 A;  2CX4 A;  4EDZ A;  1URM A;  3H8Q A;  1TI3 A;  5DBQ A;  3DVW A;  3L9U A;  2PBJ A;  5F8B A;  3KP8 A;  1HNA A;  1PGT A;  4MAB A;  5H5R A;  4LMW A;  3KCM A;  1OC8 A;  1ILO A;  2L59 A;  2WUL A;  1AQV A;  1EV4 A;  2QGV A;  3EU4 A;  5ECH B;  2EIQ A;  4OFT A;  1K0M A;  4BIK A;  3GRX A;  2A2S A;  4MCU A;  3HY2 A;  1T4Y A;  1HYU A;  1G6Y A;  1XXU A;  1OKT A;  4IN0 A;  3VK9 A;  4ML1 A;  2V32 A;  4NV5 A;  2H6Z A;  2X8G A;  2FNO A;  3HA9 A;  3TJJ A;  3MNG A;  2P0G A;  3QCP A;  2AB6 A;  5F07 A;  4BWQ A;  1M99 A;  2XBQ A;  4FH8 A;  3ZFL A;  1TK8 B;  3P90 A;  2WFC A;  2LS5 A;  4MK3 A;  2E7P A;  2F3M A;  2YWI A;  1WJK A;  1DSB A;  1BED A;  1SYX A;  1WP0 A;  4CHS A;  1AW9 A;  2XHF A;  1XWB A;  3KTB A;  3APS A;  4WF4 A;  1YQ1 A;  4TR0 A;  1FVK A;  2EIO A;  3EYT A;  4TXO A;  4E8E A;  2XC2 A;  5D8I A;  4PNG A;  2R0G A;  3GNJ A;  11GS A;  16GS A;  3E3E A;  1R5P A;  3ERF A;  1ERT A;  4K9Z A;  4TRX A;  2TIR A;  1AQW A;  2P5Q A;  1K3L A;  2DSA A;  5F0G A;  6GSW A;  5A4V A;  1M3J A;  4F0B A;  3LXT A;  5BMU A;  4XRD A;  2DBC A;  2YJH A;  3I43 A;  4TXO B;  3GKX A;  2K6V A;  2IFQ A;  4GST A;  4JBB A;  4HZ4 A;  3F63 A;  3QD9 A;  4K0G A;  17GS A;  2WJU A;  2X49 A;  4EL1 A;  3R2Q A;  2MMZ A;  1BJX A;  1G6W A;  2X8C A;  2V2G A;  1HNB A;  1T8E B;  1ZCP A;  2YPM A;  4FYB A;  4L8E A;  4OMV A;  5D9X A;  2K8V A;  2IFQ B;  3FR6 A;  6GSV A;  1NHO A;  3RPN A;  1O73 A;  1ZL9 A;  3F6D A;  4MJC A;  1GSS A;  3GST A;  5GST A;  2R2J A;  3GL3 A;  1K0A A;  4YQU A;  3D4M A;  4HUA A;  2HYX A;  4PTS A;  3W8J A;  2B1L A;  2N5F A;  3WGX A;  2DML A;  1R7H A;  1KNG A;  1SJZ A;  4K8M A;  1H75 A;  3UAP A;  3QAG A;  1T00 A;  1SEN A;  5IMZ A;  4KSO A;  2H0I A;  2ON5 A;  1YF1 A;  4ZBB A;  2TRX A;  3CRT A;  3KEB A;  3GX8 A;  4GSN A;  4KDX A;  1ZMA A;  2B3S A;  1JZW A;  3K8N A;  4NPB A;  1MD3 A;  4JR4 A;  2IMK A;  4YAP A;  4K2D A;  2NVL A;  3A2V A;  1UC7 A;  2F8F A;  5DJL A;  5FT3 A;  2HSH A;  5B8B A;  1X9S B;  2HZE A;  4JRR A;  3IXR A;  3BCK A;  2A4H A;  4Z2T A;  4ECI A;  1M9B A;  2K8S A;  5AIV A;  4DEJ A;  4LA1 A;  4KB3 A;  2RUE A;  2VLU A;  4Q5R A;  1GUK A;  4AF2 A;  2PGT A;  3HDC A;  4G9H A;  4POB A;  5INY A;  2E2G A;  1ZOF A;  4N11 A;  2MBS A;  4ZBD A;  1K0C A;  2HZE B;  1R4W A;  5A4W A;  5IMV A;  1OKD A;  1QUW A;  2QA2 A;  2MMO A;  2NDO A;  1ZYQ B;  1V57 A;  2X4A A;  4L5L A;  1F3B A;  6GSU A;  3P8W A;  2B5Y A;  3UOM A;  4IQ1 A;  2VOC A;  3C8E A;  1M3I A;  1MD4 A;  3IRA A;  3N5O A;  4AJ7 A;  4MZW A;  1GSY A;  1PX6 A;  3TOT A;  5B6M A;  2HSM A;  4ZIL A;  3WD6 A;  1J9B A;  2H6Y A;  4IJI A;  4MZB A;  2P5R A;  3HKR A;  3VWX A;  2NPB A;  3EMP A;  4X4J A;  4FO5 A;  2JAD A;  3TCO A;  3DGQ A;  3HJO A;  5IO2 A;  4CW9 A;  1V98 A;  2VCZ A;  4NHZ A;  4ULX A;  2G0F A;  3IV4 A;  4GLT A;  2C3T A;  3D4T A;  4O5U A;  2C8U A;  1EGR A;  1EEJ A;  2HRN A;  5CRE A;  1FAA A;  2HRA A;  1W89 A;  1SD9 A;  2AHE A;  4PUF C;  3UBK A;  2J9H A;  1Q98 A;  1ERW A;  3ZIJ A;  3CYN A;  4ZL8 A;  4ID0 A;  3W6G A;  2GZY A;  5DDL A;  5ID2 A;  1XW5 A;  2AUV A;  4HZ2 A;  2HZF A;  2CVD A;  3FYG A;  2LUS A;  4IEL A;  1S3D A;  2PVO C;  3HVX A;  3HXS A;  2CZ2 A;  1G0T A;  5AGY A;  1QQ2 A;  4OFM A;  5B7C A;  4F03 A;  5ID2 B;  4XS1 A;  4MH2 A;  4IKH A;  1UA5 A;  5J3R A;  3DYR A;  1BX9 A;  1PD2 1;  3FK8 A;  1AIU A;  5J9B A;  4LL1 B;  4HQZ A;  4EE0 A;  3FZ4 A;  4EKZ A;  4ZBA A;  1U88 A;  2PWJ A;  1PFO A;  2C0D A;  1U3A A;  3VUR A;  4MDC A;  1GL8 A;  4BVY A;  2JZT A;  3C1S A;  3R3E A;  1EZK A;  2AJQ B;  3HJM A;  1B9Y C;  3NZN A;  4V1A p;  1TJD A;  3HD5 A;  4ACS A;  1PSQ A;  1TU8 A;  3BJ5 A;  4POM A;  4I5Q A;  4BVY B;  5HQP A;  5EY6 A;  3HZ8 A;  1O81 A;  3P2A A;  4AJ6 A;  3I69 A;  2KOK A;  1WE0 A;  2H76 A;  3A3T A;  1PA3 A;  4IGJ A;  4MMM A;  1Y6E A;  2CVK A;  1Q4J A;  3CSH A;  1A2L A;  1PKZ A;  2WB9 A;  3GYK A;  5DQY A;  2BTO T;  3CQF A;  1HD2 A;  4HU7 A;  4MJB A;  5KN0 A;  2GDR A;  2PU9 C;  5EL8 A;  1TI1 A;  3KXO A;  2BJX A;  4J56 E;  4K7I A;  4HQS A;  1THX A;  2H01 A;  2YWN A;  4USS A;  3HYP A;  3M9K A;  1FVJ A;  3ZVJ A;  1ERU A;  3J7Y b;  2YJ7 A;  2X99 A;  3IBH A;  2FWG A;  1PKW A;  1GUM A;  2K9F A;  3LQ7 A;  4MJE A;  3ZLP A;  2B7K A;  1J08 A;  1SKR B;  4CY6 A;  5CO3 A;  3MDK A;  2R0P A;  5JCU A;  3LEF A;  3GN3 A;  4K7O A;  3GUS A;  3LYK A;  5IQY A;  4QL9 A;  1X9W B;  3D22 A;  3IK7 A;  4XHM A;  2HRK A;  6GSX A;  1TKD B;  5C04 A;  1EP8 A;  1IYH A;  2DJ3 A;  2OE3 A;  3ZYW A;  4X0X A;  5EPF A;  1XWA A;  2OKA A;  4ISD A;  3PH9 A;  4OD7 A;  2DLX A;  5H5S A;  1GSF A;  4EIP A;  4N10 A;  1YZX A;  1OE7 A;  3CMI A;  2GTU A;  4FIW A;  4WEY A;  4JE1 A;  1K3O A;  1VRS D;  1X5D A;  2C80 A;  4ZXG A;  2XPE A;  3I9V 2;  1EOH A;  3FY7 A;  3M3M A;  4F0C A;  4WXT A;  2RM6 A;  1ON4 A;  2OJL A;  4I97 A;  4DSS A;  2R37 A;  3VWV A;  1E6B A;  4WKW A;  2HXK A;  3UVT A;  3EC3 A;  1AUC A;  3D6I A;  3U6V A;  2YZH A;  2GQK A;  4O5Q A;  2CAQ A;  2IN3 A;  2HRF A;  5CYY A;  2CX3 A;  2DIY A;  3M8N A;  1TK5 B;  3GIX A;  2LRN A;  3DXB A;  1LJR A;  4KGI A;  3WT2 A;  4DSS B;  2LNS A;  3RAZ A;  1S3C A;  1Z7R A;  1R5A A;  1TDI A;  1SL2 B;  2C3N A;  1A24 A;  4AJ8 A;  2L4C A;  5HFG A;  4YQV A;  2L5O A;  1O7U A;  4IS0 A;  2KP1 A;  2JL4 A;  10GS A;  2VO4 A;  3RHB A;  4O7H A;  1WMJ A;  5DQS A;  4IBP A;  1KBN A;  1OVN A;  3UL3 A;  1TW9 A;  3H1N A;  3E9J B;  4YH2 A;  2VL9 A;  4V2L A;  3I6A A;  2VCX A;  1BAY A;  2YOI A;  1CQH A;  1GTU A;  4TXV A;  1M7T A; 
#chains in the Genus database with same CATH homology
 4HJ2 A;  3UAR A;  1T4Z A;  3ZVJ D;  1K0B A;  5A5K A;  3VFI A;  4FYU A;  3PIN A;  5ENU A;  3QFA C;  3DVX A;  2YCD A;  3ZZX A;  5D9W A;  1A0F A;  1XVQ A;  1A23 A;  2HLS A;  2O87 A;  3GUR A;  4RI6 A;  1NHY A;  5GAP D;  1QGV A;  3WT1 A;  1M2A A;  3KZQ A;  5KEJ A;  1SK0 A;  2CQ9 A;  5IOX A;  5ECQ B;  2L4Q A;  4LL4 B;  4J57 E;  3ERW A;  3Q18 A;  2HFD A;  3DWV A;  3TJB A;  5G2Z A;  1ST9 A;  2OE0 A;  2JZR A;  4N30 A;  1LBK A;  5ECS A;  2M80 A;  2CA8 A;  1FO5 A;  3QR6 A;  1SKW B;  4MA9 A;  2GSS A;  5IPH A;  4Z2U A;  3GV1 A;  1NW2 A;  4PXO A;  4KX4 A;  2GZZ A;  1ABA A;  2VM1 A;  3Q19 A;  4WR4 A;  2GSR A;  2H19 A;  4TR1 A;  2D2Z A;  2JAC A;  4XIH A;  3CXG A;  4ECJ A;  1XOA A;  2FCH A;  3CSJ A;  3UIW A;  3ZL5 A;  1LU4 A;  5D96 A;  2LQO A;  2DJ0 A;  3GA4 A;  5EVO A;  5ECK B;  3TKR A;  1TRW A;  3QFB C;  3FKF A;  3TB2 A;  1YEX A;  4TR1 B;  5IMD A;  3GX0 A;  3HVS A;  5ECP B;  1DE2 A;  3Q74 A;  1SD8 A;  2E0Q A;  4DSR A;  4ZB6 A;  1B4Q A;  14GS A;  4NXI A;  4MZC A;  2IMF A;  2DC5 A;  2KUC A;  2RLI A;  2MMA A;  2ON7 A;  4J2F A;  3QDN A;  4K7N A;  1TK0 B;  2O89 A;  2IL3 A;  1GLQ A;  1A8Y A;  3KMO A;  1A2M A;  4GTU A;  4I2U A;  1GSE A;  2GST A;  2H1A A;  5D9T A;  3C1R A;  4IP1 A;  2CAI A;  1EEM A;  5D73 A;  1UN2 A;  1JFU A;  2O8V B;  3C71 A;  3F4R A;  1DUG A;  3FR3 A;  3EU3 A;  1AQX A;  2I9H A;  1K0D A;  3MIX A;  1F9M A;  2B5E A;  1VF4 A;  5IMF A;  1JZD A;  5KOW A;  4K5R A;  4OFN A;  1B4P A;  5HR2 A;  3FR9 A;  1GWC A;  5D93 A;  2H0G A;  1QFN A;  2N5A A;  2OBK A;  2QKE A;  2M46 A;  4EF0 A;  3VI7 A;  4KA0 A;  3FRC A;  1YDK A;  5L71 A;  5COH A;  4HU9 A;  3ED3 A;  3LJR A;  2DKI A;  1GTB A;  3RBT A;  1GNE A;  3EMX A;  3QAW A;  2R5G A;  3UJ1 A;  1VF2 A;  5KN2 A;  5DCG A;  3ZMK A;  3IK9 A;  5AIX A;  2M72 A;  1U6T A;  4ECC A;  5D9V A;  19GS A;  2P31 A;  4K5S A;  3TRP A;  4XRA A;  3ZFB A;  2GQL A;  4Q5N A;  6GST A;  3MYD A;  4ZL9 A;  2FUG 2;  2A4V A;  1X9M B;  4MP4 A;  3HVV A;  3GH6 A;  2YWO A;  1JZO A;  4KUN A;  4TOP A;  5GSS A;  3KH9 A;  1U3I A;  2H1G A;  3P7X A;  2MMN A;  4IW9 A;  2H74 A;  2PN8 A;  1RQM A;  5CRG A;  5JWO B;  3H4K A;  3HJP A;  1NSW A;  2RUF A;  4MNN A;  2WZ9 A;  4MJA A;  2VUP A;  3BD2 A;  3US3 A;  2A2P A;  1JHB A;  2L6C A;  1PX7 A;  5KN3 A;  4E8H A;  1PL1 A;  4O92 A;  2REM A;  1WWJ A;  1F3A A;  3IAS 2;  4KE3 A;  1IYI A;  2VCW A;  4N0Z A;  2JSY A;  3FMW A;  6GSS A;  3IC4 A;  1QK8 A;  1B8X A;  4EUY A;  1VF1 A;  2L6D A;  5J5N A;  4JU5 A;  3FW2 A;  1ZZY A;  5JWQ B;  2H6X A;  2PVQ A;  5HR1 A;  1S3A A;  1ZYN A;  1EOG A;  1N2A A;  3NIV A;  4A5P A;  2FHE A;  3FZA A;  1G7E A;  2O7K A;  3D21 A;  3GSS A;  3LGC A;  3HHV A;  2DJ1 A;  2B5X A;  1XZO A;  5FHI A;  5G30 A;  4PQI A;  1QXH A;  3ME7 A;  2QA1 A;  3G7I A;  1PMT A;  4V1A g;  1Z9H A;  4K1F A;  4WBR D;  2VL3 A;  4P3Y B;  3GKN A;  5FWG A;  4O32 A;  3DIE A;  2H66 A;  2DJJ A;  2L5L A;  5B6N A;  1A8L A;  2XPD A;  2HT9 A;  2FA4 A;  1SK2 A;  2FD3 A;  2C0F A;  1GNW A;  1ACV A;  1MEK A;  2JU5 A;  3IOS A;  1TP9 A;  5LCZ A;  3LOR A;  3SBC A;  1K0N A;  4TR4 A;  4X1U A;  1GUL A;  1ZYE A;  3ISO A;  4YKG A;  2GGT A;  2WRT A;  4Q5Q A;  2FWH A;  3UVH A;  5ECO B;  1MDK A;  3QAV A;  3F4T A;  3LW9 A;  1YKC A;  2I1U A;  1TRV A;  2LTK A;  1FW1 A;  1XWG A;  3G9B A;  5IMC A;  4POL A;  3D5J A;  4PNF A;  3BBY A;  4HEA 2;  4DVC A;  3F3R A;  3F0I A;  3IDV A;  3WGE A;  5HFK A;  1HNC A;  1XBS A;  3GKK A;  4KH7 A;  3GFK A;  1GSD A;  5IPG A;  1YY7 A;  2FLS A;  1GUH A;  3HCZ A;  2JSZ A;  3LWA A;  2H1D A;  1TOF A;  1T7P B;  1XPV A;  1YF0 A;  3V1W A;  3CTF A;  4X43 A;  3EVI A;  5JCW A;  2QSI A;  3ZRE A;  1PRX A;  4JZQ A;  5LNK e;  4NV2 A;  5ECL B;  2VLT A;  2FY6 A;  1B48 A;  3TKS E;  1YEP A;  3BCI A;  2PUK C;  2CV4 A;  2I4A A;  3G7J A;  2FA8 A;  4OO5 A;  1FB0 A;  4DSQ A;  2E2M A;  3TUE A;  1THO A;  5HFI A;  2C0G A;  1DBY A;  1NM3 A;  4F82 A;  3DKS A;  3VPQ A;  2H1B A;  3PPU A;  1KTE A;  3OR5 A;  4RQX A;  3LG6 A;  5GZZ B;  2HI7 A;  3VWU A;  2DMM A;  22GS A;  2L57 A;  1EP7 A;  1F6M C;  4PX1 A;  1SK1 A;  3BOA A;  2H70 A;  4BL7 A;  3ME8 A;  4TR3 A;  1O85 A;  3IE3 A;  4OCE A;  3KMN A;  2ZUP A;  3TJK A;  3N9J A;  1V9W A;  5ELG A;  4IVF A;  4I2T A;  4PUR A;  2IJY A;  5A4U A;  2MYG A;  1PL2 A;  3MAK A;  3TJG A;  7GSS A;  2R3X A;  4MLY A;  2GVP A;  3QPM A;  4XS6 A;  5DCH A;  2LJA A;  4TVE A;  4BL7 B;  1OAZ A;  3SWL A;  4OO4 A;  2VCQ A;  5E59 A;  3QOU A;  1T3B A;  4H86 A;  4O5R A;  4PQ1 A;  2RII A;  4KSM A;  2R0C A;  4ML6 A;  2LJK A;  3EIN A;  4G19 A;  2VLV A;  2ES7 A;  3F6F A;  1I9D A;  5IM9 A;  4F2I A;  18GS A;  1HQO A;  2NBS A;  3O76 A;  1YJ6 A;  3L0H A;  4G2E A;  5AN1 A;  4MH3 A;  3L9S A;  3Q6O A;  1BYE A;  2IMI A;  4GQC A;  4XCS A;  5ELA A;  2YV7 A;  2B6M A;  4XTS A;  5ECR B;  5ECM B;  1MDJ A;  1Z6M A;  3QMX A;  4MF5 A;  2LRT A;  4WF5 A;  1TRU A;  1Z3E A;  2DJK A;  2PER A;  2C1Y A;  3D0Z A;  4EIQ A;  1GRX A;  1WRY A;  1FOV A;  2DKH A;  1XCC A;  2I81 A;  2PPT A;  2IME A;  1EGO A;  2N5B A;  1X5C A;  4EDY A;  2C4J A;  3FHK A;  3A5I A;  3LXZ A;  2IWT A;  2F51 A;  4K6X A;  3WYW A;  1K3Y A;  2HE3 A;  2J23 A;  2YWM A;  3H93 A;  2B7J A;  1MDI A;  1WPI A;  1XIY A;  2GSQ A;  1FG4 A;  1AXD A;  2V6O A;  2LST A;  5GAN D;  2LEG A;  5DVB A;  4BVX A;  3ZIT A;  2DJ2 A;  1MTC A;  1X5E A;  4V2M A;  1RK4 A;  1R26 A;  2MZC A;  4NHW A;  2QC7 A;  4BVX B;  1RW1 A;  3AY8 A;  1WIK A;  4XS4 A;  1CQG A;  4NAX A;  3VPT A;  2EIR A;  2LQQ A;  1JZR A;  3IC8 A;  4GSS A;  3RHC A;  2H75 A;  4GWR A;  5DJM A;  2C0E A;  2OAD A;  1OC3 A;  2YN1 A;  3L4N A;  4FQU A;  5BRT A;  2YAN A;  1ML6 A;  4QL7 A;  9GSS A;  4XS4 B;  2YP6 A;  3F4S A;  1SJ6 A;  1O8X A;  1XWC A;  2WS2 A;  4F9Z A;  3FZ9 A;  1M2D A;  4ILF A;  1XVW A;  3C73 A;  3TGZ A;  12GS A;  3C7M A;  1TTZ A;  5IMA A;  2X8H A;  2LV3 A;  4MF7 A;  2TRC P;  5G1L A;  4NWY A;  1GH2 A;  4PUA A;  1SJI A;  3M0F A;  5CNW A;  3IHG A;  4LLR A;  1ZGN A;  3O6T A;  1XW6 A;  5C00 A;  2OA7 A;  4IQA A;  2H73 A;  3KP9 A;  5CRH A;  3W8S A;  1OC9 A;  3IR4 A;  5KOX A;  4QQ7 A;  2YZU A;  3H79 A;  2OE1 A;  2NTO A;  2JZS A;  1JLW A;  4HJM A;  4KND A;  4G0I A;  1FHE A;  1K0O A;  4GCI A;  3DRN A;  5H5Q A;  2VIM A;  2OBI A;  2DIZ A;  5IO0 A;  3DD3 A;  3APO A;  3GHA A;  3GL5 A;  3TRX A;  1OC9 B;  3VLN A;  8GSS A;  4RI7 A;  5IIZ A;  3A2X A;  3CBU A;  2IPA A;  2GQM A;  5DAK A;  2GT6 A;  2VCT A;  1KEB A;  1QMV A;  4L0W A;  3NOF A;  1EWX A;  3IAM 2;  4BWS A;  4HS1 A;  5CRD A;  3MWH A;  2VAF A;  4I8B A;  4PQH A;  2HSY A;  5HR3 A;  4I6X A;  5DAK B;  5J41 A;  4EC0 A;  1PN0 A;  5G5F A;  2HNL A;  4K2X A;  2B1K A;  3FEU A;  3IA1 A;  3HZ4 A;  4HI7 A;  1VGL A;  1GTA A;  2YV9 A;  1AC1 A;  2MBT A;  1GSQ A;  4Z2R A;  5CRW A;  2V6K A;  2FGX A;  1XOB A;  1SL0 B;  4GF0 A;  5F06 A;  2ZCT A;  4JR6 A;  2WGR A;  4IJ3 A;  3EUR A;  2I3Y A;  2GT5 A;  1SU9 A;  1GLP A;  4LMV A;  4RUV A;  3PR8 A;  4EO3 A;  2C3Q A;  3LYP A;  4TN8 A;  3CTG A;  1M0U A;  1FB6 A;  1VF3 A;  2WCI A;  4OCF A;  2KLX A;  1PN9 A;  4ZL7 A;  4OWY A;  3RDW A;  4Q5F A;  1Z6N A;  3EE2 A;  1TRS A;  1OYJ A;  4KF9 A;  2O85 A;  4RQR A;  1B9X C;  4GRF A;  4JED A;  3L9V A;  1H4O A;  2H30 A;  2ZNM A;  1GSU A;  2IIY A;  3GTU A;  4V2N A;  3A5W A;  2IMD A;  4KAE A;  4BA7 A;  1BQ7 A;  3LFL A;  3KJY A;  4ZIJ A;  2LJR A;  3O3T A;  4GXZ A;  1DE1 A;  1XWK A;  4CY8 A;  3LSZ A;  4MPG A;  3M1G A;  3TKP A;  5AIS A;  2KP2 A;  4ZB8 A;  3ZRD A;  3GTU B;  2FWE A;  3M9J A;  4IP6 A;  2H72 A;  2CT6 A;  4AGS A;  3CRU A;  2Z9S A;  3GKM A;  2G2Q A;  4TW5 A;  2VCV A;  3DML A;  3TRQ A;  3U5R E;  1JLV A;  3VWW A;  1UVZ A;  3CSI A;  2PMT A;  2XBI A;  4ICY A;  1M9A A;  1SKS B;  1V2A A;  3UBL A;  5E4W A;  1ZYP A;  1C72 A;  2LRC A;  4CDO A;  1FOH A;  3S9F A;  1U87 A;  2AV4 A;  3G7Y A;  1SL1 B;  5B8A A;  2X64 A;  2KHP A;  4TKY A;  4EVM A;  5JCG A;  20GS A;  3IPZ A;  4WET A;  1OE8 A;  3TDG A;  5J9C A;  3UMA A;  2VD1 A;  5G5E A;  4YKF A;  5KN1 A;  2H0H A;  1X0R A;  1Y25 A;  3JCM L;  3F8U A;  2VM2 A;  2FWF A;  4ZB9 A;  3APQ A;  5LD0 A;  4L0U A;  3ZTL A;  3WGD A;  3MSZ A;  2EC4 A;  3TKS C;  2F8A A;  1G7O A;  1V40 A;  5G1K A;  5ECN B;  4HOJ A;  1TXX A;  1W4V A;  1M2B A;  1WOU A;  5ECI B;  1V58 A;  5F05 A;  2CZ3 A;  3KD0 A;  3ZML A;  4EXJ A;  2LNT A;  2OAC A;  4MF6 A;  3E0U A;  3TKQ A;  1Z5Y E;  2H8L A;  4YQM A;  2AAW A;  1I5G A;  1TU7 A;  2H71 A;  5DAL A;  4BPY A;  4KW6 A;  3FZ5 A;  2VL2 C;  3KGK A;  2R4V A;  1F2E A;  5G31 A;  2YNX A;  2BMX A;  1Z7P A;  4G0K A;  2GZP A;  13GS A;  1AAZ A;  3IHQ A;  3PGT A;  4L5O A;  2GS3 A;  2CVB A;  3EWL A;  4MPF A;  5DAL B;  3F3Q A;  5HR0 A;  4HDE A;  2AYT A;  1XFL A;  1YKA A;  3KH7 A;  5IOW A;  1USB A;  2R6K A;  2VD0 A;  6GSY A;  2ALB A;  3KIJ A;  4IHU A;  1PQN A;  1ERV A;  1A0R P;  1XW9 A;  1SYR A;  4WBJ A;  4ECB A;  1GTI A;  4YAV A;  1EV9 A;  1N8J A;  4KDY A;  3TKS A;  1GP1 A;  1BG5 A;  1E2Y A;  3VI5 A;  1J0F A;  1O8W A;  4N0V A;  2V1M A;  4POK A;  5ABR A;  3A2W A;  5CAX A;  2RM5 A;  2GLR A;  4D73 A;  2LKU A;  3GMF A;  4K0N A;  2F9S A;  1A2J A;  2WDU A;  3KM6 A;  3TJF A;  4KCA A;  4Z7X A;  4KDU A;  3RPP A;  3UEM A;  2K18 A;  2VL2 A;  3DEX A;  4FYC A;  1F37 A;  3J7Y k;  4G10 A;  3ZIV A;  4D73 B;  3TOU A;  3KTL A;  4KCE A;  1O6J A;  3F9U A;  5JWR B;  3GH9 A;  4NMU A;  2A2R A;  5CP1 A;  2UZ8 A;  5J4U A;  4GQF A;  4G0L A;  3ERG A;  4PGT A;  1T1V A;  4WR5 A;  3L78 A;  3EPT A;  2V41 A;  2CX4 A;  4EDZ A;  1URM A;  3H8Q A;  1TI3 A;  5DBQ A;  3DVW A;  3L9U A;  2PBJ A;  5F8B A;  3KP8 A;  1HNA A;  1PGT A;  4MAB A;  5H5R A;  4LMW A;  3KCM A;  1OC8 A;  1ILO A;  2L59 A;  2WUL A;  1AQV A;  1EV4 A;  2QGV A;  3EU4 A;  5ECH B;  2EIQ A;  4OFT A;  1K0M A;  3GRX A;  2A2S A;  4MCU A;  3HY2 A;  1T4Y A;  1HYU A;  1G6Y A;  1XXU A;  1OKT A;  4IN0 A;  3VK9 A;  4ML1 A;  2V32 A;  4NV5 A;  2H6Z A;  2X8G A;  2FNO A;  3HA9 A;  3TJJ A;  3MNG A;  2P0G A;  3QCP A;  2AB6 A;  5F07 A;  4BWQ A;  1M99 A;  2XBQ A;  4FH8 A;  3ZFL A;  1TK8 B;  3P90 A;  2WFC A;  2LS5 A;  4MK3 A;  2E7P A;  2F3M A;  2YWI A;  1WJK A;  1DSB A;  1BED A;  1SYX A;  1WP0 A;  4CHS A;  1AW9 A;  2XHF A;  1XWB A;  3KTB A;  3APS A;  4WF4 A;  1YQ1 A;  4TR0 A;  1FVK A;  2EIO A;  3EYT A;  4TXO A;  4E8E A;  2XC2 A;  5D8I A;  4PNG A;  2R0G A;  3GNJ A;  11GS A;  16GS A;  3E3E A;  1R5P A;  3ERF A;  1ERT A;  4K9Z A;  4TRX A;  2TIR A;  1AQW A;  2P5Q A;  1K3L A;  2DSA A;  5F0G A;  6GSW A;  5A4V A;  4F0B A;  3LXT A;  5BMU A;  4XRD A;  2DBC A;  2YJH A;  3I43 A;  4TXO B;  3GKX A;  2K6V A;  2IFQ A;  4GST A;  4JBB A;  4HZ4 A;  3F63 A;  3QD9 A;  4K0G A;  17GS A;  2WJU A;  2X49 A;  4EL1 A;  3R2Q A;  2MMZ A;  1BJX A;  1G6W A;  2X8C A;  2V2G A;  1HNB A;  1T8E B;  1ZCP A;  2YPM A;  4FYB A;  4L8E A;  4OMV A;  5D9X A;  2K8V A;  2IFQ B;  3FR6 A;  6GSV A;  1NHO A;  3RPN A;  1O73 A;  1ZL9 A;  3F6D A;  4MJC A;  1GSS A;  3GST A;  5GST A;  2R2J A;  3GL3 A;  1K0A A;  4YQU A;  3D4M A;  4HUA A;  2HYX A;  4PTS A;  3W8J A;  2B1L A;  2N5F A;  3WGX A;  2DML A;  1R7H A;  1KNG A;  1SJZ A;  4K8M A;  1H75 A;  3UAP A;  3QAG A;  1T00 A;  1SEN A;  5IMZ A;  4KSO A;  2H0I A;  2ON5 A;  1YF1 A;  4ZBB A;  2TRX A;  3CRT A;  3KEB A;  3GX8 A;  4GSN A;  4KDX A;  1ZMA A;  2B3S A;  1JZW A;  3K8N A;  4NPB A;  1MD3 A;  4JR4 A;  2IMK A;  4YAP A;  4K2D A;  2NVL A;  3A2V A;  1UC7 A;  2F8F A;  5DJL A;  5FT3 A;  2HSH A;  5B8B A;  1X9S B;  2HZE A;  4JRR A;  3IXR A;  3BCK A;  2A4H A;  4Z2T A;  4ECI A;  1M9B A;  2K8S A;  5AIV A;  4DEJ A;  4LA1 A;  4KB3 A;  2RUE A;  2VLU A;  4Q5R A;  1GUK A;  4AF2 A;  2PGT A;  3HDC A;  4G9H A;  4POB A;  5INY A;  2E2G A;  1ZOF A;  4N11 A;  2MBS A;  4ZBD A;  1K0C A;  2HZE B;  1R4W A;  5A4W A;  5IMV A;  1OKD A;  1QUW A;  2QA2 A;  2MMO A;  2NDO A;  1ZYQ B;  1V57 A;  2X4A A;  4L5L A;  1F3B A;  6GSU A;  3P8W A;  2B5Y A;  3UOM A;  4IQ1 A;  2VOC A;  3C8E A;  1MD4 A;  3IRA A;  3N5O A;  4AJ7 A;  4MZW A;  1GSY A;  1PX6 A;  3TOT A;  5B6M A;  2HSM A;  4ZIL A;  3WD6 A;  1J9B A;  2H6Y A;  4IJI A;  4MZB A;  2P5R A;  3HKR A;  3VWX A;  2NPB A;  3EMP A;  4X4J A;  4FO5 A;  2JAD A;  3TCO A;  3DGQ A;  3HJO A;  5IO2 A;  4CW9 A;  1V98 A;  2VCZ A;  4NHZ A;  4ULX A;  2G0F A;  3IV4 A;  4GLT A;  2C3T A;  3D4T A;  4O5U A;  2C8U A;  1EGR A;  1EEJ A;  2HRN A;  5CRE A;  1FAA A;  2HRA A;  1W89 A;  1SD9 A;  2AHE A;  4PUF C;  3UBK A;  2J9H A;  1Q98 A;  1ERW A;  3ZIJ A;  3CYN A;  4ZL8 A;  4ID0 A;  3W6G A;  2GZY A;  5DDL A;  5ID2 A;  1XW5 A;  2AUV A;  4HZ2 A;  2HZF A;  2CVD A;  3FYG A;  2LUS A;  4IEL A;  1S3D A;  2PVO C;  3HVX A;  3HXS A;  2CZ2 A;  1G0T A;  5AGY A;  1QQ2 A;  4OFM A;  5B7C A;  4F03 A;  5ID2 B;  4XS1 A;  4MH2 A;  4IKH A;  1UA5 A;  5J3R A;  3DYR A;  1BX9 A;  1PD2 1;  3FK8 A;  1AIU A;  5J9B A;  4LL1 B;  4HQZ A;  4EE0 A;  3FZ4 A;  4EKZ A;  4ZBA A;  1U88 A;  2PWJ A;  2C0D A;  1U3A A;  3VUR A;  4MDC A;  1GL8 A;  4BVY A;  2JZT A;  3C1S A;  3R3E A;  1EZK A;  2AJQ B;  3HJM A;  1B9Y C;  3NZN A;  4V1A p;  1TJD A;  3HD5 A;  4ACS A;  1PSQ A;  1TU8 A;  3BJ5 A;  4POM A;  4I5Q A;  4BVY B;  5HQP A;  5EY6 A;  3HZ8 A;  1O81 A;  3P2A A;  4AJ6 A;  3I69 A;  2KOK A;  1WE0 A;  2H76 A;  3A3T A;  1PA3 A;  4IGJ A;  4MMM A;  1Y6E A;  2CVK A;  1Q4J A;  3CSH A;  1A2L A;  1PKZ A;  2WB9 A;  3GYK A;  5DQY A;  2BTO T;  1HD2 A;  4HU7 A;  4MJB A;  5KN0 A;  2GDR A;  2PU9 C;  5EL8 A;  1TI1 A;  3KXO A;  2BJX A;  4J56 E;  4K7I A;  4HQS A;  1THX A;  2H01 A;  2YWN A;  4USS A;  3HYP A;  3M9K A;  1FVJ A;  3ZVJ A;  1ERU A;  3J7Y b;  2YJ7 A;  2X99 A;  3IBH A;  2FWG A;  1PKW A;  1GUM A;  2K9F A;  3LQ7 A;  4MJE A;  3ZLP A;  2B7K A;  1J08 A;  1SKR B;  4CY6 A;  5CO3 A;  3MDK A;  2R0P A;  5JCU A;  3LEF A;  3GN3 A;  4K7O A;  3GUS A;  3LYK A;  5IQY A;  4QL9 A;  1X9W B;  3D22 A;  3IK7 A;  4XHM A;  2HRK A;  6GSX A;  1TKD B;  5C04 A;  1EP8 A;  1IYH A;  2DJ3 A;  2OE3 A;  3ZYW A;  4X0X A;  5EPF A;  1XWA A;  2OKA A;  4ISD A;  3PH9 A;  4OD7 A;  2DLX A;  5H5S A;  1GSF A;  4EIP A;  4N10 A;  1YZX A;  1OE7 A;  3CMI A;  2GTU A;  4FIW A;  4WEY A;  4JE1 A;  1K3O A;  1VRS D;  1X5D A;  2C80 A;  4ZXG A;  2XPE A;  3I9V 2;  1EOH A;  3FY7 A;  3M3M A;  4F0C A;  4WXT A;  2RM6 A;  1ON4 A;  2OJL A;  4I97 A;  4DSS A;  2R37 A;  3VWV A;  1E6B A;  4WKW A;  2HXK A;  3UVT A;  3EC3 A;  1AUC A;  3D6I A;  3U6V A;  2YZH A;  2GQK A;  4O5Q A;  2CAQ A;  2IN3 A;  2HRF A;  5CYY A;  2CX3 A;  2DIY A;  3M8N A;  1TK5 B;  3GIX A;  2LRN A;  3DXB A;  1LJR A;  4KGI A;  3WT2 A;  4DSS B;  2LNS A;  3RAZ A;  1S3C A;  1Z7R A;  1R5A A;  1TDI A;  1SL2 B;  2C3N A;  1A24 A;  4AJ8 A;  2L4C A;  5HFG A;  4YQV A;  2L5O A;  1O7U A;  4IS0 A;  2KP1 A;  2JL4 A;  10GS A;  2VO4 A;  3RHB A;  4O7H A;  1WMJ A;  5DQS A;  4IBP A;  1KBN A;  1OVN A;  3UL3 A;  1TW9 A;  3H1N A;  3E9J B;  4YH2 A;  2VL9 A;  4V2L A;  3I6A A;  2VCX A;  1BAY A;  2YOI A;  1CQH A;  1GTU A;  4TXV A;  1M7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...