1Z7PA

Solution structure of reduced glutaredoxin c1 from populus tremula x tremuloides
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
117
structure length
117
Chain Sequence
MASKQELDAALKKAKELASSAPVVVFSKTYCGYCNRVKQLLTQVGASYKVVELDELSDGSQLQSALAHWTGRGTVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQDAAATAKNPAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutaredoxin
publication title Structural Insight into Poplar Glutaredoxin C1 with a Bridging Iron-Sulfur Cluster at the Active Site
pubmed doi rcsb
source organism Populus tremula x populus tremuloides
molecule tags Electron transport
total genus 41
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2005-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1z7pA00
2K18A 4WR4A 1S3CA 3UL3A 3F3RA 4F0BA 2C0DA 1TP9A 2RIIA 4L0WA 3Q74A 2DJ0A 4ZBBA 2V1MA 3DGQA 2MMZA 1KNGA 1YQ1A 2H1BA 3GH6A 1ZYQB 5ECIB 3GKNA 5AGYA 1SYXA 2EIQA 4IP1A 2C0EA 2OE1A 1GL8A 4OD7A 2FGXA 3L0HA 1T3BA 4YH2A 3F6DA 4H86A 2DC5A 2I9HA 2NBSA 3Q6OA 1W89A 2CAIA 2HZEB 3LYPA 1R26A 3ERFA 1OC9A 2CX4A 5ECRB 3IAM2 1PD21 1B8XA 1E2YA 3KEBA 3A3TA 3ZIJA 4JEDA 3N5OA 4ZBDA 2IWTA 4TN8A 2NDOA 3A5WA 3D22A 4PUAA 4HOJA 1W4VA 3IAS2 2GZPA 2H72A 1F3BA 5D9XA 4YQMA 2MYGA 3EWLA 2WJUA 1FB6A 3A2VA 2VCWA 3GHAA 2B1KA 2IMFA 3FZ9A 4XCSA 2PBJA 1XWCA 1DE2A 1TTZA 4D73B 2IJYA 2GTUA 2ALBA 4PNFA 1YEPA 3LGCA 3VPTA 2I1UA 1NW2A 3L78A 2MZCA 4KDYA 1TOFA 3K8NA 4TR1B 4MK3A 1SU9A 1FO5A 2C80A 5IMFA 3VWVA 3EMXA 4OFNA 4POMA 2B6MA 2JADA 1YDKA 4K1FA 4AF2A 4DEJA 2YWNA 1A8YA 1TXXA 5F8BA 1EZKA 4HJ2A 4NV5A 5IQYA 3HD5A 4ZL9A 3FZAA 1VF4A 3IRAA 3G9BA 3P8WA 2KP2A 2YV7A 5G1LA 4QL9A 3F4RA 3GSTA 5B8AA 18GSA 1U3IA 2WCIA 1EV9A 2C3TA 2GQKA 4Q5NA 1EEJA 5IPGA 1GNWA 2PUKC 4V2LA 5EL8A 3WT2A 2C3QA 3D4TA 2Z9SA 1MDJA 3TJBA 4RQXA 1U87A 5ECQB 3L4NA 1V58A 2C4JA 4PXOA 1H75A 1GTBA 3GKXA 1AQWA 2L57A 4ML6A 3FR3A 3ZZXA 2H6YA 2IMKA 2X64A 17GSA 3HJPA 5DCHA 3IR4A 4ZBAA 2CAQA 5JWQB 2WFCA 1KEBA 3HDCA 4ECBA 2MMNA 1QXHA 5LD0A 2GSSA 2VCXA 1ERTA 4O7HA 1TRWA 1RK4A 2JU5A 3O3TA 3P2AA 4YQUA 2WZ9A 4G2EA 4LA1A 11GSA 2JZTA 5DVBA 4IQ1A 4F0CA 5KN1A 4PNGA 3VWWA 5IOXA 5D93A 2L6CA 4K0GA 4EKZA 4RQRA 2CA8A 5ECSA 4J56E 1XXUA 3E9JB 3ME8A 3MSZA 4KA0A 2WGRA 5JCWA 4GSNA 2H74A 3LXZA 5C04A 2K8SA 1OKDA 1F6MC 1KTEA 2FHEA 2JSZA 2ON5A 3DWVA 2CVBA 1Z6MA 4DSRA 5FWGA 4EC0A 1YF1A 4EO3A 2L5LA 1T8EB 1FG4A 1FHEA 3HKRA 2YCDA 5F07A 5B6MA 1DE1A 3GTUB 1F2EA 2FY6A 4GWRA 1UC7A 2O89A 6GSTA 1T00A 1NHOA 1BYEA 2LEGA 3ERGA 2H71A 4WXTA 4XS4B 2E7PA 2IL3A 3M3MA 3F4SA 4WETA 5CREA 1URMA 3IDVA 3HXSA 5CNWA 4JE1A 2XC2A 2HE3A 5HR2A 20GSA 1M2BA 3ZVJA 3QPMA 2P31A 3GUSA 2PWJA 3HA9A 2KOKA 1T7PB 5G31A 1HNBA 2O7KA 3I43A 3DKSA 3ZMKA 1TRVA 4X1UA 2FWEA 1OE8A 3FHKA 3RHBA 4XS1A 13GSA 1B9XC 3IK9A 1TKDB 4WF4A 2CZ3A 3UAPA 1NM3A 3TJFA 2GT6A 2HI7A 4FYUA 2GT5A 1TDIA 4HEA2 1QQ2A 2DMLA 1VF3A 4XRDA 4NHWA 3TKPA 3QR6A 3CXGA 5GZZB 4QL7A 2F8AA 1YEXA 4GTUA 2LQOA 2PPTA 1IYIA 4HJMA 1N2AA 5HFKA 2LJAA 1V9WA 2GSQA 1XOBA 14GSA 3O6TA 2XBQA 4I97A 4MDCA 3APOA 1X9SB 5AIXA 1GSUA 1GSEA 5FHIA 5J4UA 2FWFA 2HYXA 1O6JA 1UVZA 3APQA 3LORA 1U6TA 3MWHA 2HRNA 3KD0A 5JCGA 1GSQA 3EMPA 4MZBA 2B1LA 2GVPA 1ABAA 2XBIA 1MDKA 3FR9A 3G7YA 2IN3A 2PMTA 1MDIA 4KAEA 4TXVA 1GSDA 2H70A 3LG6A 3KGKA 1Z5YE 2C0GA 3KTBA 4K8MA 3W8SA 3UARA 1GWCA 6GSSA 3EVIA 2VAFA 3GMFA 3DMLA 1LU4A 5G1KA 2B5EA 2PVQA 3UBLA 1Z6NA 1R5PA 4K7NA 1A0RP 2KHPA 5AN1A 3RAZA 1PMTA 2GDRA 3J7Yk 4JZQA 1PKWA 1OE7A 2VCTA 4DSSB 3UEMA 1U88A 3EYTA 1SENA 5G5EA 4N10A 4EE0A 1YF0A 2WULA 4ZB9A 1PX6A 3VPQA 6GSWA 3VI5A 1GLQA 4MJAA 4ZILA 2I3YA 4GRFA 1GUKA 2DJ1A 2GZYA 1HNCA 4BPYA 2N5BA 4WBRD 1Q4JA 3H8QA 1BQ7A 3TRQA 2V6KA 5CRDA 4WR5A 4K9ZA 4LL4B 2IMEA 1BJXA 4IQAA 3KXOA 1ERUA 2VOCA 4PX1A 3UMAA 1FVKA 4HU7A 2WRTA 2FNOA 3D21A 3IV4A 1YY7A 3KM6A 1DUGA 1M9AA 2DJ3A 2XPEA 3H93A 3DXBA 5D73A 4Q5RA 1Z3EA 2JZRA 5DALB 4JU5A 2OA7A 4IJIA 2HFDA 3VURA 2OADA 3UBKA 2FWGA 5ECKB 2LKUA 4HS1A 1VF2A 1PGTA 5AISA 1OC8A 1AUCA 1PQNA 4KNDA 2HZFA 3EURA 3VI7A 2LTKA 2YJHA 2B3SA 2F51A 3FKFA 2O85A 5ID2B 4GXZA 1GSFA 5JCUA 2R2JA 1M0UA 2FWHA 4N0ZA 1GLPA 4IS0A 3F9UA 3GYKA 2DMMA 1X5DA 1WPIA 2V6OA 4EL1A 1X9MB 6GSXA 2J23A 1R4WA 1G7EA 3TOTA 3P7XA 3N9JA 2FLSA 2PERA 2YZUA 3O76A 1ML6A 5A4WA 1USBA 3KMOA 1MTCA 1THOA 1XPVA 2FA4A 4KCAA 2VO4A 2HZEA 3TJJA 3QCPA 5D9WA 2A4VA 2CZ2A 2YWIA 3CBUA 1I9DA 4G9HA 4N30A 1O81A 3PH9A 2QKEA 2NVLA 5E59A 3C7MA 1HNAA 4I2UA 4TXOB 4OFTA 1T4YA 4ECIA 3CSJA 3I6AA 3V1WA 2H73A 3ISOA 4IGJA 4YAVA 1JZOA 3F8UA 5EVOA 4D73A 1GULA 1XVQA 1GH2A 1YKAA 4EF0A 1Q98A 3F63A 4XTSA 1TU7A 3LJRA 5F0GA 1ZL9A 2IFQB 2DJKA 4ZB6A 4FH8A 4Q5QA 1BX9A 4TR1A 1DSBA 4WBJA 2VLUA 5GAPD 7GSSA 2LRNA 1SJ6A 4F82A 4MZWA 2DBCA 1YKCA 3MDKA 1F37A 1PRXA 1K3LA 3AY8A 4BVYA 1SKSB 1ON4A 3TDGA 2GSTA 4ILFA 4LL1B 1WWJA 1XWGA 1EOGA 10GSA 2B5YA 4MF6A 4HZ4A 1K0NA 3WYWA 3ZITA 2RM5A 5J41A 2LRCA 2ZNMA 2PVOC 1Y25A 3CRUA 4Z7XA 2N5FA 3QFAC 1HD2A 5LNKe 3IE3A 4XIHA 2H0HA 2KUCA 4AJ6A 5F05A 1AXDA 1PN9A 1ZOFA 2HSHA 1X5CA 2C8UA 1EGRA 1V57A 4E8EA 2OACA 2YP6A 4FIWA 1EP7A 3L9SA 5LCZA 2MBSA 3P90A 1AIUA 4MJBA 2CT6A 3ERWA 3GKMA 3WT1A 1EWXA 3R2QA 3F6FA 4IHUA 5DBQA 1GP1A 2MMOA 3APSA 3HCZA 2A2RA 4TKYA 4F2IA 4IP6A 3CSIA 4OO4A 3I9V2 4POKA 3QMXA 4ML1A 3TRXA 3PR8A 3HYPA 5ECHB 2TIRA 3DIEA 1B4QA 2H1DA 2AYTA 3TKSE 1V98A 2VLTA 2XPDA 4NHZA 5G2ZA 4GLTA 4FYCA 2R3XA 1X5EA 2EIOA 4MP4A 1K0BA 3TKQA 3GN3A 3HJOA 2IMDA 1WIKA 3GX0A 2YJ7A 3GTUA 3IBHA 2OE0A 1ST9A 2M46A 5IM9A 1RW1A 4MJCA 2AUVA 3RPPA 4N0VA 3ZRDA 1JHBA 2QSIA 5ECOB 2FCHA 2OJLA 3KIJA 3ZFLA 3ZVJD 5JWRB 2TRXA 1FOVA 1M2DA 5IIZA 4XS4A 3GSSA 1XFLA 1SJZA 5KEJA 1XW6A 1HYUA 5ELAA 3GFKA 4WKWA 1H4OA 4XRAA 3UOMA 3ZFBA 4F9ZA 2HT9A 4Q5FA 2LRTA 4ZL7A 2QC7A 1EP8A 1BG5A 2H76A 22GSA 2K8VA 5IO0A 2R6KA 2HXKA 4J2FA 3CRTA 4GSSA 2GQLA 3KH7A 2LUSA 4ISDA 1XCCA 2C1YA 1B48A 1WMJA 5A5KA 5CRGA 3QD9A 4HU9A 2VCVA 4X0XA 1CQGA 2O87A 3JCML 1GSSA 4N11A 4V2NA 1FAAA 1B4PA 2LNTA 2RUEA 1AC1A 3MNGA 4TVEA 2CV4A 3CMIA 4PQIA 5DQSA 5HQPA 4O92A 2AAWA 16GSA 3HY2A 4EVMA 1S3DA 4L5OA 2DJ2A 4NXIA 2CVKA 1EOHA 4TOPA 2WB9A 1AQXA 2DJJA 4ULXA 1SKWB 4MJEA 4ZB8A 2EIRA 2YPMA 1SL1B 1Z7RA 2KP1A 2C0FA 2HRFA 5D9VA 3U6VA 3KJYA 5IMVA 3BBYA 3ZTLA 3HJMA 4YQVA 2H30A 1Z9HA 1PX7A 2B7KA 3FK8A 3NIVA 3UIWA 4ID0A 4OFMA 1V40A 1MEKA 4FYBA 2AV4A 2LS5A 3KMNA 4P3YB 3ED3A 2O8VB 3GA4A 2P5RA 4DVCA 3TCOA 2MBTA 1K3YA 1T4ZA 1BEDA 4DSSA 2AHEA 3GURA 1PA3A 3RPNA 1O85A 2NTOA 1THXA 3W8JA 2H01A 1VF1A 1SKRB 1A2JA 2JL4A 4LMWA 4TRXA 2GQMA 3KZQA 5DJLA 4OWYA 2BJXA 3F0IA 5J3RA 1GTIA 1XW9A 3EE2A 5H5QA 4POBA 1UA5A 5DAKB 1A23A 4I6XA 5AIVA 3IOSA 3ZYWA 5H5RA 2L4CA 2FA8A 1JZDA 4EDYA 2IPAA 1M2AA 1PL2A 1ERWA 2EC4A 2X8CA 5CRHA 4I8BA 2VCQA 5CO3A 3FW2A 2BTOT 3CTGA 4GQFA 4KW6A 2TRCP 1SD8A 4V2MA 4ZIJA 1GNEA 4RUVA 4PGTA 5DALA 5ECLB 3SBCA 2H6ZA 2LSTA 3QAWA 2VD1A 2H6XA 4IELA 3C73A 2VL9A 1TRUA 4JRRA 4L8EA 1YZXA 2ZUPA 4EDZA 2ON7A 3LSZA 1G0TA 1OVNA 2QGVA 3TRPA 5ELGA 1TK0B 4HUAA 4TR3A 3SWLA 4WF5A 3TJKA 2P5QA 2PN8A 4EUYA 5E4WA 2OE3A 1QK8A 5ID2A 5GSTA 1Z7PA 3L9VA 2D2ZA 1K0DA 3TKSC 3DD3A 4K6XA 1MD3A 1TK5B 1G6WA 2R4VA 5HR1A 19GSA 5IOWA 1TRSA 1FW1A 1K0MA 3ZLPA 1TU8A 3A2XA 1UN2A 5H5SA 5IMZA 3GV1A 1SL2B 3KP8A 1FVJA 1LBKA 4XHMA 3RBTA 1G6YA 2M80A 3TOUA 5ECMB 3WGXA 2V2GA 1S3AA 2LV3A 4V1Ap 4MCUA 2LNSA 9GSSA 3LXTA 3VK9A 1U3AA 4AJ8A 2G2QA 2CVDA 5KN3A 1XBSA 5A4UA 4IW9A 4KSMA 5F06A 5JWOB 3DYRA 1GUHA 1MD4A 4ZXGA 3ZL5A 4TXOA 3BCKA 2F9SA 4NV2A 4NWYA 4I5QA 4PURA 3TJGA 4LMVA 2I4AA 5CRWA 5FT3A 1M9BA 1B9YC 1M99A 2VM2A 1SK2A 4MH2A 2H0IA 1I5GA 3GL5A 2FD3A 4XS6A 1EV4A 4KCEA 1DBYA 1A2MA 1OC9B 4RI7A 2IFQA 4AJ7A 1K0CA 4DSQA 1K3OA 4K7OA 3D6IA 2H75A 2V41A 4MZCA 4F03A 1PSQA 2J9HA 3S9FA 3HZ4A 3NOFA 1O8WA 4L0UA 4NMUA 2H19A 6GSVA 3LFLA 5J5NA 3FZ5A 5G5FA 3H79A 3TGZA 3VLNA 2E2GA 1XZOA 2M72A 3LEFA 4GF0A 3Q18A 2YZHA 3QFBC 2MMAA 1ZZYA 3IA1A 3IXRA 4BA7A 3EU3A 1IYHA 2N5AA 1RQMA 1JZRA 4EXJA 2G0FA 2PU9C 5IO2A 2F3MA 3MAKA 3DVWA 4TW5A 5IMDA 4KB3A 2LJKA 4NPBA 2CX3A 4KDUA 5EY6A 1SL0B 4IN0A 2LQQA 5IMAA 2YOIA 3HVXA 3M1GA 5B7CA 2A2SA 3GNJA 2K9FA 1A0FA 4MPGA 2VL2C 5D8IA 3EC3A 1JLWA 1SYRA 4MH3A 3D5JA 1QMVA 3WGDA 5DDLA 2PGTA 1VGLA 2GSRA 4GQCA 4YAPA 1YJ6A 2F8FA 2NPBA 3PINA 1SJIA 3EINA 2I81A 1ZGNA 1G7OA 2XHFA 3ZREA 2IMIA 1A24A 2ES7A 2VCZA 1WE0A 2H8LA 3FY7A 5ECPB 1JZWA 3H4KA 2KLXA 2WS2A 4JR4A 2OKAA 4E8HA 4OCFA 2YV9A 3KH9A 3HHVA 5KN2A 2P0GA 2R37A 1N8JA 4I2TA 1XW5A 6GSYA 5J9CA 2K6VA 5IMCA 1JLVA 3U5RE 1SK1A 4ZL8A 1X9WB 4QQ7A 2YNXA 4O32A 2H0GA 3E3EA 8GSSA 3IHQA 3C8EA 4TR0A 5ECNB 4KSOA 4BWSA 4KDXA 4ECJA 3DEXA 1J0FA 1TK8B 4HZ2A 5L71A 2RLIA 5ENUA 3FEUA 4NAXA 1R7HA 1C72A 1T1VA 2L59A 3KCMA 4IVFA 4MPFA 4MABA 4MLYA 3US3A 3GX8A 4KGIA 3M8NA 6GSUA 4POLA 5D9TA 5HR3A 3NZNA 3TUEA 3C71A 3QAVA 3CSHA 1TJDA 1OAZA 1WRYA 1WOUA 1XWAA 3DVXA 5GAND 1GSYA 3CYNA 3M9KA 3UVTA 2H1AA 5CYYA 2VUPA 3RDWA 1ILOA 3ME7A 3F4TA 1XVWA 4RI6A 2AJQB 3QDNA 2HSYA 4IKHA 1R5AA 3C1SA 3VWXA 2YANA 3FRCA 2H1GA 3KTLA 3QAGA 5HFGA 5COHA 3C1RA 2YWMA 4PUFC 4HQSA 4L5LA 3FZ4A 4FO5A 3TB2A 1QFNA 3ZMLA 2DLXA 1O7UA 3M0FA 4K0NA 3A2WA 4CW9A 5HFIA 4BL7A 1SD9A 2GZZA 2BMXA 1WJKA 4MMMA 3GIXA 1WP0A 4O5RA 4ACSA 4KX4A 2JSYA 2VIMA 1CQHA 2VM1A 1PKZA 3D0ZA 3Q19A 4OCEA 1TI1A 3TKSA 4GSTA 3DRNA 3ZIVA 4OMVA 3IK7A 4V1Ag 2C3NA 2YN1A 3EU4A 2R5GA 2X8HA 1ZMAA 3PGTA 3BJ5A 1JFUA 4BVXA 1J08A 5IPHA 1AAZA 3VFIA 5HR0A 2RM6A 3IPZA 1V2AA 1F9MA 4G10A 3IC4A 2JACA 1KBNA 3GH9A 4KUNA 4OO5A 3OR5A 2DSAA 5C00A 1VRSD 5EPFA 1GRXA 2VD0A 2B5XA 2HLSA 5D96A 2DIYA 1K0OA 2X8GA 4G19A 5B6NA 2HNLA 3FYGA 3L9UA 5G30A 4MA9A 1EGOA 2VLVA 2L6DA 2GGTA 4KH7A 2L5OA 1HQOA 3BD2A 5CAXA 1GTAA 3M9JA 3BOAA 1X0RA 3CTFA 3LYKA 1PL1A 1ACVA 3HVVA 1ZYEA 3G7JA 1FB0A 3I69A 4JR6A 1OYJA 3W6GA 3UJ1A 3HVSA 4HDEA 1SK0A 2RUFA 5DCGA 4LLRA 4IBPA 5DAKA 4CDOA 2OBIA 1GTUA 3GL3A 1AW9A 2FUG2 1ERVA 12GSA 2VL3A 4AGSA 3WGEA 2L4QA 2X99A 3H1NA 3HZ8A 3G7IA 5ABRA 3KP9A 4HI7A 1ZCPA 1TW9A 3F3QA 4PQ1A 3LQ7A 4K2DA 4MF5A 4TR4A 3GRXA 2IIYA 1F3AA 4MF7A 1TI3A 4GCIA 3D4MA 5DJMA 1QGVA 5CP1A 3BCIA 3TKRA 4CHSA 2E0QA 2JZSA 3E0UA 3J7Yb 5A4VA 5DQYA 4HQZA 1QUWA 3VWUA 4IJ3A 2H66A 3UVHA 1OKTA 2OBKA 2ZCTA 1BAYA 1XIYA 4X43A 2WDUA 4KE3A 5GSSA 1A2LA 5INYA 1E6BA 3WD6A 2GS3A 2CQ9A 3RHCA 4JBBA 1XWKA 1M7TA 4ECCA 1O73A 2DIZA 1A8LA 5J9BA 4J57E 1K0AA 3LWAA 1LJRA 1OC3A 4K7IA 2AB6A 1Y6EA 1AQVA 1GUMA 4WEYA 2VL2A 2REMA 2E2MA 1EEMA 5KN0A 1NSWA 5B8BA 1O8XA 4PQHA 4BWQA 2V32A 2B7JA 1J9BA 2GLRA 3GKKA 2YWOA 3QOUA 2LJRA 1XWBA 3FR6A 1XOAA 1NHYA
chains in the Genus database with same CATH superfamily
2K18A 4WR4A 1S3CA 3UL3A 3F3RA 4F0BA 2C0DA 1TP9A 2RIIA 4L0WA 3Q74A 2DJ0A 4ZBBA 2V1MA 3DGQA 2MMZA 1KNGA 1YQ1A 2H1BA 3GH6A 1ZYQB 5ECIB 3GKNA 5AGYA 1SYXA 2EIQA 4IP1A 2C0EA 2OE1A 1GL8A 4OD7A 2FGXA 3L0HA 1T3BA 4YH2A 3F6DA 4H86A 2DC5A 2I9HA 2NBSA 3Q6OA 1W89A 2CAIA 2HZEB 3LYPA 1R26A 3ERFA 1OC9A 2CX4A 4BIKA 5ECRB 3IAM2 1PD21 1B8XA 1E2YA 3KEBA 3A3TA 3ZIJA 4JEDA 3N5OA 4ZBDA 2IWTA 4TN8A 2NDOA 3A5WA 3MIXA 3D22A 4PUAA 4HOJA 1W4VA 3IAS2 2GZPA 3A5IA 2H72A 1F3BA 5D9XA 4YQMA 2MYGA 3EWLA 2WJUA 1FB6A 3A2VA 2VCWA 3GHAA 2B1KA 2IMFA 3FZ9A 4XCSA 2PBJA 1XWCA 1DE2A 1TTZA 4D73B 4YKGA 2IJYA 2GTUA 2ALBA 4PNFA 1YEPA 3LGCA 3VPTA 2I1UA 1NW2A 3L78A 2MZCA 4KDYA 1TOFA 3K8NA 4TR1B 4MK3A 1SU9A 1FO5A 2C80A 5IMFA 3VWVA 3EMXA 4OFNA 4POMA 2B6MA 2JADA 1YDKA 1M3JA 4K1FA 4AF2A 4DEJA 2YWNA 1A8YA 1TXXA 5F8BA 1EZKA 4HJ2A 4BVYB 4NV5A 5IQYA 3HD5A 4ZL9A 3FZAA 1VF4A 3IRAA 3G9BA 3P8WA 4G0LA 2KP2A 2YV7A 5G1LA 4QL9A 3F4RA 3GSTA 5B8AA 18GSA 1U3IA 2WCIA 1EV9A 2C3TA 2GQKA 4Q5NA 1EEJA 5IPGA 1GNWA 4G0IA 2PUKC 4V2LA 5EL8A 3WT2A 2C3QA 3D4TA 2Z9SA 1MDJA 3TJBA 4RQXA 1U87A 5ECQB 3L4NA 1V58A 2C4JA 4PXOA 1H75A 1GTBA 3GKXA 1AQWA 2L57A 4ML6A 3FR3A 3ZZXA 2H6YA 2IMKA 2X64A 17GSA 3HJPA 5DCHA 3IR4A 4ZBAA 2CAQA 5JWQB 2WFCA 1KEBA 3HDCA 4ECBA 2MMNA 1QXHA 5LD0A 2GSSA 2VCXA 1ERTA 4O7HA 1TRWA 1RK4A 1ZYNA 2JU5A 3O3TA 3P2AA 4YQUA 2WZ9A 4G2EA 4LA1A 11GSA 2JZTA 5DVBA 4IQ1A 4F0CA 5KN1A 4PNGA 3VWWA 5IOXA 5D93A 2L6CA 4K0GA 4EKZA 4RQRA 2CA8A 5ECSA 4J56E 1XXUA 3E9JB 3ME8A 3MSZA 4KA0A 2WGRA 5JCWA 4GSNA 2H74A 3LXZA 5C04A 2K8SA 1OKDA 2QA2A 1F6MC 1KTEA 2FHEA 2JSZA 2ON5A 3DWVA 2CVBA 1Z6MA 4DSRA 5FWGA 4EC0A 1YF1A 4Z2TA 4EO3A 2L5LA 1T8EB 1FG4A 1FHEA 3HKRA 2YCDA 5F07A 5B6MA 1DE1A 3GTUB 1F2EA 2FY6A 4GWRA 1UC7A 2O89A 6GSTA 1T00A 1NHOA 1BYEA 2LEGA 3ERGA 2H71A 4WXTA 4XS4B 2E7PA 2IL3A 3M3MA 3F4SA 4WETA 5CREA 1URMA 3IDVA 3HXSA 5CNWA 4JE1A 2XC2A 2R0PA 2HE3A 5HR2A 20GSA 1M2BA 3ZVJA 3QPMA 2P31A 3GUSA 2PWJA 3HA9A 2KOKA 1T7PB 5G31A 1HNBA 2O7KA 3I43A 3DKSA 3ZMKA 1TRVA 4X1UA 2FWEA 1OE8A 3FHKA 3RHBA 4XS1A 13GSA 1B9XC 3IK9A 1TKDB 4WF4A 2CZ3A 3UAPA 1NM3A 3TJFA 2GT6A 2HI7A 4FYUA 2GT5A 1TDIA 4HEA2 1QQ2A 2DMLA 1VF3A 4XRDA 4NHWA 3TKPA 3QR6A 3CXGA 2DKHA 5GZZB 4QL7A 2F8AA 1YEXA 4GTUA 2LQOA 2PPTA 1IYIA 4HJMA 1N2AA 5HFKA 2LJAA 1V9WA 2GSQA 1XOBA 14GSA 3O6TA 2XBQA 4I97A 4MDCA 3APOA 1X9SB 5AIXA 1GSUA 1GSEA 5FHIA 5J4UA 2FWFA 2HYXA 1O6JA 1UVZA 3APQA 4O5UA 3LORA 1U6TA 3MWHA 2HRNA 3KD0A 5JCGA 1GSQA 3EMPA 1PFOA 4MZBA 2B1LA 2GVPA 1ABAA 2XBIA 1MDKA 3FR9A 3G7YA 2IN3A 4CY8A 2PMTA 1MDIA 4KAEA 4TXVA 1GSDA 2H70A 3LG6A 3KGKA 1Z5YE 2C0GA 3KTBA 4K8MA 3W8SA 3UARA 1GWCA 6GSSA 3EVIA 2VAFA 3GMFA 3DMLA 1LU4A 5G1KA 2B5EA 2PVQA 3UBLA 1Z6NA 1R5PA 4K7NA 1A0RP 2KHPA 5AN1A 3RAZA 1PMTA 2GDRA 3J7Yk 4JZQA 1PKWA 1OE7A 2VCTA 4DSSB 3UEMA 1U88A 3EYTA 1SENA 5G5EA 4N10A 4EE0A 1YF0A 2WULA 4ZB9A 1PX6A 3VPQA 6GSWA 3VI5A 2QA1A 1GLQA 4MJAA 4ZILA 2I3YA 4GRFA 1GUKA 2DJ1A 2GZYA 1HNCA 4BPYA 2N5BA 4WBRD 1Q4JA 3H8QA 1BQ7A 3TRQA 2V6KA 5CRDA 4WR5A 4K9ZA 4LL4B 2IMEA 1BJXA 4IQAA 3KXOA 1ERUA 2VOCA 4PX1A 3UMAA 1FVKA 4HU7A 2WRTA 2FNOA 3D21A 3IV4A 1YY7A 3KM6A 1DUGA 1M9AA 2DJ3A 2XPEA 3H93A 3DXBA 5D73A 4Q5RA 1Z3EA 2JZRA 5DALB 4JU5A 4X4JA 2OA7A 4ICYA 4IJIA 2HFDA 3VURA 2OADA 3UBKA 2FWGA 5ECKB 2LKUA 4HS1A 3HVNA 1VF2A 1PGTA 5AISA 1OC8A 1AUCA 1PQNA 4KNDA 2HZFA 3EURA 3VI7A 2LTKA 2YJHA 2B3SA 2F51A 3FKFA 2O85A 5ID2B 4GXZA 1GSFA 5JCUA 2R2JA 1M0UA 2FWHA 4N0ZA 1GLPA 4IS0A 3F9UA 3GYKA 2DMMA 1X5DA 1WPIA 2V6OA 4EL1A 1X9MB 6GSXA 2J23A 1R4WA 1G7EA 3TOTA 3P7XA 3N9JA 2FLSA 2PERA 2YZUA 3O76A 1ML6A 5A4WA 1USBA 3KMOA 1MTCA 4K5SA 1THOA 1XPVA 2FA4A 4KCAA 2VO4A 2HZEA 3TJJA 3QCPA 5D9WA 2A4VA 2CZ2A 2YWIA 3CBUA 1I9DA 4G9HA 4N30A 1O81A 3PH9A 2QKEA 2NVLA 5E59A 3C7MA 1HNAA 4I2UA 4TXOB 4OFTA 1T4YA 4ECIA 3CSJA 3I6AA 3V1WA 2H73A 3ISOA 4IGJA 4YAVA 1JZOA 3F8UA 1ZYPA 5EVOA 4D73A 1GULA 1XVQA 1GH2A 4K2XA 1YKAA 4EF0A 1Q98A 3F63A 4XTSA 1TU7A 3LJRA 5F0GA 1ZL9A 2IFQB 2DJKA 4ZB6A 4FH8A 4Q5QA 1BX9A 4TR1A 1DSBA 4WBJA 2VLUA 5GAPD 7GSSA 2LRNA 3CQFA 1SJ6A 4F82A 4MZWA 2DBCA 1YKCA 3MDKA 1F37A 4USSA 1PRXA 1K3LA 3AY8A 4BVYA 1SKSB 1ON4A 3TDGA 2GSTA 4ILFA 4LL1B 1WWJA 1XWGA 1EOGA 10GSA 2HRKA 2B5YA 4MF6A 4HZ4A 1K0NA 3WYWA 3IHGA 2RM5A 3ZITA 4HSCX 5J41A 2LRCA 2ZNMA 2PVOC 1Y25A 3CRUA 4Z7XA 2N5FA 3QFAC 1HD2A 5LNKe 3IE3A 4XIHA 2H0HA 2KUCA 4AJ6A 5F05A 1AXDA 1PN9A 1ZOFA 2HSHA 1X5CA 2C8UA 1EGRA 1V57A 4E8EA 2OACA 2YP6A 4FIWA 1EP7A 3L9SA 5LCZA 2MBSA 3P90A 1AIUA 4MJBA 2CT6A 3ERWA 3GKMA 3WT1A 1EWXA 3R2QA 3F6FA 4IHUA 5DBQA 1GP1A 2MMOA 3APSA 3HCZA 2UZ8A 2A2RA 4TKYA 4F2IA 4IP6A 3CSIA 4OO4A 3I9V2 4POKA 3QMXA 4ML1A 3TRXA 3PR8A 3HYPA 5ECHB 2TIRA 3FMWA 3DIEA 1B4QA 2H1DA 2AYTA 4O5QA 3TKSE 1V98A 2VLTA 2XPDA 4NHZA 5G2ZA 4GLTA 4FYCA 2R3XA 1X5EA 2EIOA 4MP4A 1K0BA 3TKQA 3GN3A 3HJOA 2IMDA 1WIKA 3GX0A 2YJ7A 3GTUA 3IBHA 2OE0A 1ST9A 2M46A 5IM9A 1RW1A 4MJCA 2AUVA 5KOXA 3RPPA 4N0VA 3ZRDA 1JHBA 2QSIA 5ECOB 2FCHA 2OJLA 3KIJA 3ZFLA 3ZVJD 5JWRB 2TRXA 1FOVA 1M2DA 5IIZA 4XS4A 3GSSA 1XFLA 3MYDA 1SJZA 5KEJA 1XW6A 1HYUA 5ELAA 3GFKA 4WKWA 1H4OA 4XRAA 3UOMA 3ZFBA 4F9ZA 2HT9A 4Q5FA 2LRTA 4ZL7A 2QC7A 1EP8A 1BG5A 2H76A 3R3EA 22GSA 2K8VA 5IO0A 2R6KA 2HXKA 4J2FA 3CRTA 4GSSA 2GQLA 3KH7A 2LUSA 4ISDA 1XCCA 2C1YA 1B48A 1WMJA 5A5KA 5CRGA 3QD9A 4HU9A 2VCVA 4X0XA 1CQGA 2O87A 4Z2UA 3JCML 1GSSA 4N11A 4V2NA 1XG8A 1FAAA 1B4PA 2LNTA 2RUEA 1AC1A 3MNGA 4TVEA 2CV4A 3CMIA 4PTSA 4PQIA 5DQSA 5HQPA 4O92A 2AAWA 4BL7B 16GSA 3HY2A 4EVMA 4G0KA 1S3DA 4L5OA 2DJ2A 4NXIA 2CVKA 1EOHA 4TOPA 2WB9A 1AQXA 2DJJA 4ULXA 1SKWB 4MJEA 4ZB8A 2EIRA 2YPMA 1SL1B 1Z7RA 2KP1A 2C0FA 2HRFA 5D9VA 3U6VA 3KJYA 5IMVA 2X4AA 3BBYA 3ZTLA 3HJMA 4YQVA 2H30A 1Z9HA 1PX7A 2B7KA 3FK8A 4BVXB 3NIVA 3UIWA 4ID0A 4OFMA 1V40A 1MEKA 4FYBA 2AV4A 2LS5A 3KMNA 4P3YB 3ED3A 2O8VB 3GA4A 2P5RA 4DVCA 3TCOA 2MBTA 1K3YA 4K5RA 4KF9A 1T4ZA 1BEDA 2R0GA 3EPTA 4DSSA 5KOWA 2AHEA 3GURA 1PA3A 3RPNA 1O85A 2NTOA 1THXA 3W8JA 2H01A 1VF1A 1SKRB 1A2JA 2JL4A 4LMWA 4TRXA 2GQMA 3KZQA 5DJLA 4OWYA 2BJXA 3F0IA 5J3RA 1GTIA 1XW9A 3EE2A 5H5QA 4POBA 1UA5A 5DAKB 1A23A 4I6XA 5AIVA 3IOSA 3ZYWA 5H5RA 2L4CA 2FA8A 1JZDA 4EDYA 2IPAA 1M2AA 1PL2A 1ERWA 2EC4A 2X8CA 5CRHA 4I8BA 2VCQA 5CO3A 3FW2A 5BMUA 2BTOT 3CTGA 4GQFA 4KW6A 2TRCP 1SD8A 4V2MA 4ZIJA 1GNEA 4RUVA 4PGTA 5DALA 5ECLB 4EIPA 3SBCA 2H6ZA 2LSTA 3QAWA 4A5PA 2VD1A 2H6XA 4IELA 3C73A 2VL9A 1TRUA 4JRRA 4L8EA 1YZXA 2ZUPA 4EDZA 2ON7A 3LSZA 1G0TA 1OVNA 2QGVA 3TRPA 5ELGA 1TK0B 4HUAA 4TR3A 3SWLA 4WF5A 3TJKA 2P5QA 2PN8A 4EUYA 5E4WA 2OE3A 1QK8A 5ID2A 5GSTA 1Z7PA 3L9VA 2D2ZA 1K0DA 3TKSC 3DD3A 4K6XA 1MD3A 1TK5B 1G6WA 2R4VA 5HR1A 19GSA 5IOWA 1TRSA 1FW1A 1K0MA 3ZLPA 1TU8A 3A2XA 1UN2A 5H5SA 5IMZA 3GV1A 1SL2B 3KP8A 1FVJA 1LBKA 4XHMA 3RBTA 1G6YA 2M80A 3TOUA 5ECMB 3WGXA 2V2GA 1S3AA 2LV3A 4V1Ap 4MCUA 2LNSA 9GSSA 3LXTA 3VK9A 1U3AA 4AJ8A 2G2QA 2CVDA 5KN3A 1XBSA 5A4UA 2A4HA 4IW9A 4KSMA 5F06A 5JWOB 3DYRA 1GUHA 1MD4A 4ZXGA 3ZL5A 4TXOA 3BCKA 2F9SA 4NV2A 4NWYA 4I5QA 4PURA 3TJGA 4LMVA 2I4AA 5CRWA 5FT3A 1M9BA 1B9YC 1M99A 2VM2A 1SK2A 4MH2A 2H0IA 1I5GA 3GL5A 2FD3A 4XS6A 1EV4A 4KCEA 1DBYA 1A2MA 1OC9B 4RI7A 2IFQA 4AJ7A 1K0CA 4DSQA 1K3OA 4K7OA 3D6IA 2H75A 2V41A 4MZCA 4F03A 1PSQA 2J9HA 3S9FA 3HZ4A 3NOFA 1O8WA 4L0UA 4NMUA 1M3IA 2H19A 6GSVA 3LFLA 5J5NA 3FZ5A 5G5FA 3H79A 3TGZA 3VLNA 2E2GA 1XZOA 2M72A 3LEFA 4GF0A 3Q18A 2YZHA 3QFBC 2MMAA 1ZZYA 3IA1A 3IXRA 4BA7A 3EU3A 1IYHA 2N5AA 1RQMA 1JZRA 4EXJA 2G0FA 2PU9C 5IO2A 2F3MA 3MAKA 3DVWA 4TW5A 5IMDA 4KB3A 2LJKA 4NPBA 2CX3A 4KDUA 5EY6A 1SL0B 4IN0A 2LQQA 5IMAA 2YOIA 3HVXA 3M1GA 5B7CA 4YKFA 2A2SA 3GNJA 2K9FA 1A0FA 4MPGA 2VL2C 5D8IA 3EC3A 1JLWA 1SYRA 4MH3A 3D5JA 4Z2RA 1QMVA 3WGDA 5DDLA 2PGTA 1VGLA 2GSRA 4GQCA 4YAPA 1YJ6A 2F8FA 2NPBA 3PINA 2HSMA 1SJIA 3EINA 2I81A 1ZGNA 1G7OA 2XHFA 3ZREA 2IMIA 1A24A 2ES7A 2VCZA 1WE0A 2H8LA 3FY7A 5ECPB 1JZWA 3H4KA 2KLXA 2WS2A 4JR4A 2OKAA 4E8HA 4OCFA 2YV9A 3KH9A 3HHVA 5KN2A 2P0GA 2R37A 1N8JA 4I2TA 1XW5A 6GSYA 5J9CA 2K6VA 5IMCA 1JLVA 3U5RE 1SK1A 4ZL8A 1X9WB 4QQ7A 2YNXA 4O32A 2H0GA 3E3EA 8GSSA 3IHQA 3C8EA 4TR0A 5ECNB 4KSOA 4BWSA 4KDXA 4ECJA 3DEXA 1J0FA 1TK8B 4HZ2A 5L71A 2RLIA 5ENUA 3FEUA 4NAXA 1R7HA 1C72A 1T1VA 2L59A 3KCMA 4IVFA 4MPFA 4MABA 4MLYA 3US3A 3GX8A 4KGIA 3M8NA 6GSUA 4POLA 5D9TA 5HR3A 3NZNA 3TUEA 3C71A 3QAVA 3CSHA 1TJDA 1OAZA 1WRYA 1WOUA 1XWAA 3DVXA 5GAND 1GSYA 3CYNA 3M9KA 3UVTA 2H1AA 5CYYA 2VUPA 3RDWA 1ILOA 3ME7A 1PN0A 3F4TA 1XVWA 4RI6A 2AJQB 3QDNA 2HSYA 4IKHA 1R5AA 3C1SA 3VWXA 2YANA 3FRCA 2H1GA 3KTLA 3QAGA 5HFGA 5COHA 3C1RA 2YWMA 4EIQA 4PUFC 4HQSA 4L5LA 3FZ4A 4FO5A 3TB2A 1QFNA 3ZMLA 2DLXA 1O7UA 3M0FA 3LW9A 4K0NA 3A2WA 4CW9A 5HFIA 4CY6A 4BL7A 1SD9A 2GZZA 2BMXA 1WJKA 4MMMA 2DKIA 3GIXA 1WP0A 4O5RA 4ACSA 4KX4A 2JSYA 2VIMA 1CQHA 2VM1A 1PKZA 3D0ZA 3Q19A 4OCEA 3IC8A 1TI1A 3TKSA 4GSTA 3DRNA 3ZIVA 4OMVA 3IK7A 4V1Ag 2C3NA 2YN1A 3EU4A 2R5GA 2X8HA 1ZMAA 3PGTA 3BJ5A 1JFUA 4BVXA 1J08A 5IPHA 1AAZA 3VFIA 5HR0A 2RM6A 3IPZA 1V2AA 1F9MA 4G10A 3IC4A 2JACA 1KBNA 3GH9A 4KUNA 4OO5A 3OR5A 2DSAA 5C00A 1VRSD 5EPFA 1GRXA 2VD0A 2B5XA 2HLSA 2DIYA 2X8GA 1K0OA 5D96A 4G19A 5B6NA 2HNLA 3FYGA 3L9UA 5G30A 4MA9A 1EGOA 2VLVA 2L6DA 2GGTA 4KH7A 2L5OA 1HQOA 3BD2A 5CAXA 1GTAA 3M9JA 3BOAA 1X0RA 3CTFA 3LYKA 1PL1A 1ACVA 3HVVA 1ZYEA 3G7JA 1FB0A 3I69A 4JR6A 1OYJA 3W6GA 3UJ1A 3HVSA 4HDEA 1SK0A 2RUFA 5DCGA 4LLRA 4IBPA 5DAKA 4MNNA 4CDOA 2OBIA 1GTUA 3GL3A 1AW9A 2FUG2 1ERVA 12GSA 2VL3A 4AGSA 3WGEA 2L4QA 2X99A 3H1NA 2HRAA 3HZ8A 3G7IA 5ABRA 3KP9A 2R0CA 4HI7A 4FQUA 1ZCPA 1TW9A 3F3QA 4PQ1A 3LQ7A 4K2DA 4MF5A 4TR4A 3GRXA 2IIYA 1F3AA 4MF7A 1FOHA 1TI3A 4GCIA 3D4MA 5DJMA 1QGVA 5CP1A 3BCIA 3TKRA 4CHSA 2E0QA 2JZSA 3E0UA 3J7Yb 5A4VA 5DQYA 5BRTA 4HQZA 1QUWA 3VWUA 4IJ3A 2H66A 3UVHA 1OKTA 1S3RA 2OBKA 1BAYA 2ZCTA 1XIYA 4X43A 2WDUA 4KE3A 5GSSA 2X49A 1A2LA 2A2PA 5INYA 1E6BA 3WD6A 2GS3A 2CQ9A 3RHCA 4JBBA 1XWKA 1M7TA 4ECCA 1O73A 2DIZA 1A8LA 5J9BA 4J57E 1K0AA 3LWAA 1LJRA 3PPUA 1OC3A 4K7IA 2AB6A 1Y6EA 1AQVA 1GUMA 4WEYA 2VL2A 2REMA 2E2MA 1EEMA 5KN0A 1NSWA 5B8BA 1O8XA 4PQHA 4BWQA 2V32A 2B7JA 1J9BA 2GLRA 3GKKA 2YWOA 3QOUA 2LJRA 1XWBA 3FR6A 1XOAA 1NHYA
chains in the Genus database with same CATH topology
2K18A 4WR4A 1S3CA 3UL3A 3F3RA 4F0BA 2C0DA 1TP9A 2RIIA 4L0WA 3Q74A 2DJ0A 4ZBBA 2V1MA 3DGQA 2MMZA 1KNGA 1YQ1A 2H1BA 3GH6A 1ZYQB 5ECIB 3GKNA 5AGYA 1SYXA 2EIQA 4IP1A 2C0EA 2OE1A 1GL8A 4OD7A 2FGXA 3L0HA 1T3BA 4YH2A 3F6DA 4H86A 2DC5A 2I9HA 2NBSA 3Q6OA 1W89A 2CAIA 2HZEB 3LYPA 1R26A 3ERFA 1OC9A 2CX4A 5ECRB 3IAM2 1PD21 1B8XA 1E2YA 3KEBA 3A3TA 3ZIJA 4JEDA 3N5OA 4ZBDA 2IWTA 4TN8A 2NDOA 3A5WA 3MIXA 3D22A 4PUAA 4HOJA 1W4VA 3IAS2 2GZPA 3A5IA 2H72A 1F3BA 5D9XA 4YQMA 2MYGA 3EWLA 2WJUA 1FB6A 3A2VA 2VCWA 3GHAA 2B1KA 2IMFA 3FZ9A 4XCSA 2PBJA 1XWCA 1DE2A 1TTZA 4D73B 4YKGA 2IJYA 2GTUA 2ALBA 4PNFA 1YEPA 3LGCA 3VPTA 2I1UA 1NW2A 3L78A 2MZCA 4KDYA 1TOFA 3K8NA 4TR1B 4MK3A 1SU9A 1FO5A 2C80A 5IMFA 3VWVA 3EMXA 4OFNA 4POMA 2B6MA 2JADA 1YDKA 4K1FA 4AF2A 4DEJA 2YWNA 1A8YA 1TXXA 5F8BA 1EZKA 4HJ2A 4BVYB 4NV5A 5IQYA 3HD5A 4ZL9A 3FZAA 1VF4A 3IRAA 3G9BA 3P8WA 4G0LA 2KP2A 2YV7A 5G1LA 4QL9A 3F4RA 3GSTA 5B8AA 18GSA 1U3IA 2WCIA 1EV9A 2C3TA 2GQKA 4Q5NA 1EEJA 5IPGA 1GNWA 4G0IA 2PUKC 4V2LA 5EL8A 3WT2A 2C3QA 3D4TA 2Z9SA 1MDJA 3TJBA 4RQXA 1U87A 5ECQB 3L4NA 1V58A 2C4JA 4PXOA 1H75A 1GTBA 3GKXA 1AQWA 2L57A 4ML6A 3FR3A 3ZZXA 2H6YA 2IMKA 2X64A 17GSA 3HJPA 5DCHA 3IR4A 4ZBAA 2CAQA 5JWQB 2WFCA 1KEBA 3HDCA 4ECBA 2MMNA 1QXHA 5LD0A 2GSSA 2VCXA 1ERTA 4O7HA 1TRWA 1RK4A 1ZYNA 2JU5A 3O3TA 3P2AA 4YQUA 2WZ9A 4G2EA 4LA1A 11GSA 2JZTA 5DVBA 4IQ1A 4F0CA 5KN1A 4PNGA 3VWWA 5IOXA 5D93A 2L6CA 4K0GA 4EKZA 4RQRA 2CA8A 5ECSA 4J56E 1XXUA 3E9JB 3ME8A 3MSZA 4KA0A 2WGRA 5JCWA 4GSNA 2H74A 3LXZA 5C04A 2K8SA 1OKDA 2QA2A 1F6MC 1KTEA 2FHEA 2JSZA 2ON5A 3DWVA 2CVBA 1Z6MA 4DSRA 5FWGA 4EC0A 1YF1A 4Z2TA 4EO3A 2L5LA 1T8EB 1FG4A 1FHEA 3HKRA 2YCDA 5F07A 5B6MA 1DE1A 3GTUB 1F2EA 2FY6A 4GWRA 1UC7A 2O89A 6GSTA 1T00A 1NHOA 1BYEA 2LEGA 3ERGA 2H71A 4WXTA 4XS4B 2E7PA 2IL3A 3M3MA 3F4SA 4WETA 5CREA 1URMA 3IDVA 3HXSA 5CNWA 4JE1A 2XC2A 2R0PA 2HE3A 5HR2A 20GSA 1M2BA 3ZVJA 3QPMA 2P31A 3GUSA 2PWJA 3HA9A 2KOKA 1T7PB 5G31A 1HNBA 2O7KA 3I43A 3DKSA 3ZMKA 1TRVA 4X1UA 2FWEA 1OE8A 3FHKA 3RHBA 4XS1A 13GSA 1B9XC 3IK9A 1TKDB 4WF4A 2CZ3A 3UAPA 1NM3A 3TJFA 2GT6A 2HI7A 4FYUA 2GT5A 1TDIA 4HEA2 1QQ2A 2DMLA 1VF3A 4XRDA 4NHWA 3TKPA 3QR6A 3CXGA 2DKHA 5GZZB 4QL7A 2F8AA 1YEXA 4GTUA 2LQOA 2PPTA 1IYIA 4HJMA 1N2AA 5HFKA 2LJAA 1V9WA 2GSQA 1XOBA 14GSA 3O6TA 2XBQA 4I97A 4MDCA 3APOA 1X9SB 5AIXA 1GSUA 1GSEA 5FHIA 5J4UA 2FWFA 2HYXA 1O6JA 1UVZA 3APQA 4O5UA 3LORA 1U6TA 3MWHA 2HRNA 3KD0A 5JCGA 1GSQA 3EMPA 4MZBA 2B1LA 2GVPA 1ABAA 2XBIA 1MDKA 3FR9A 3G7YA 2IN3A 4CY8A 2PMTA 1MDIA 4KAEA 4TXVA 1GSDA 2H70A 3LG6A 3KGKA 1Z5YE 2C0GA 3KTBA 4K8MA 3W8SA 3UARA 1GWCA 6GSSA 3EVIA 2VAFA 3GMFA 3DMLA 1LU4A 5G1KA 2B5EA 2PVQA 3UBLA 1Z6NA 1R5PA 4K7NA 1A0RP 2KHPA 5AN1A 3RAZA 1PMTA 2GDRA 3J7Yk 4JZQA 1PKWA 1OE7A 2VCTA 4DSSB 3UEMA 1U88A 3EYTA 1SENA 5G5EA 4N10A 4EE0A 1YF0A 2WULA 4ZB9A 1PX6A 3VPQA 6GSWA 3VI5A 2QA1A 1GLQA 4MJAA 4ZILA 2I3YA 4GRFA 1GUKA 2DJ1A 2GZYA 1HNCA 4BPYA 2N5BA 4WBRD 1Q4JA 3H8QA 1BQ7A 3TRQA 2V6KA 5CRDA 4WR5A 4K9ZA 4LL4B 2IMEA 1BJXA 4IQAA 3KXOA 1ERUA 2VOCA 4PX1A 3UMAA 1FVKA 4HU7A 2WRTA 2FNOA 3D21A 3IV4A 1YY7A 3KM6A 1DUGA 1M9AA 2DJ3A 2XPEA 3H93A 3DXBA 5D73A 4Q5RA 1Z3EA 2JZRA 5DALB 4JU5A 4X4JA 2OA7A 4ICYA 4IJIA 2HFDA 3VURA 2OADA 3UBKA 2FWGA 5ECKB 2LKUA 4HS1A 1VF2A 1PGTA 5AISA 1OC8A 1AUCA 1PQNA 4KNDA 2HZFA 3EURA 3VI7A 2LTKA 2YJHA 2B3SA 2F51A 3FKFA 2O85A 5ID2B 4GXZA 1GSFA 5JCUA 2R2JA 1M0UA 2FWHA 4N0ZA 1GLPA 4IS0A 3F9UA 3GYKA 2DMMA 1X5DA 1WPIA 2V6OA 4EL1A 1X9MB 6GSXA 2J23A 1R4WA 1G7EA 3TOTA 3P7XA 3N9JA 2FLSA 2PERA 2YZUA 3O76A 1ML6A 5A4WA 1USBA 3KMOA 1MTCA 4K5SA 1THOA 1XPVA 2FA4A 4KCAA 2VO4A 2HZEA 3TJJA 3QCPA 5D9WA 2A4VA 2CZ2A 2YWIA 3CBUA 1I9DA 4G9HA 4N30A 1O81A 3PH9A 2QKEA 2NVLA 5E59A 3C7MA 1HNAA 4I2UA 4TXOB 4OFTA 1T4YA 4ECIA 3CSJA 3I6AA 3V1WA 2H73A 3ISOA 4IGJA 4YAVA 1JZOA 3F8UA 1ZYPA 5EVOA 4D73A 1GULA 1XVQA 1GH2A 4K2XA 1YKAA 4EF0A 1Q98A 3F63A 4XTSA 1TU7A 3LJRA 5F0GA 1ZL9A 2IFQB 2DJKA 4ZB6A 4FH8A 4Q5QA 1BX9A 4TR1A 1DSBA 4WBJA 2VLUA 5GAPD 7GSSA 2LRNA 1SJ6A 4F82A 4MZWA 2DBCA 1YKCA 3MDKA 1F37A 4USSA 1PRXA 1K3LA 3AY8A 4BVYA 1SKSB 1ON4A 3TDGA 2GSTA 4ILFA 4LL1B 1WWJA 1XWGA 1EOGA 10GSA 2HRKA 2B5YA 4MF6A 4HZ4A 1K0NA 3WYWA 3IHGA 2RM5A 3ZITA 5J41A 2LRCA 2ZNMA 2PVOC 1Y25A 3CRUA 4Z7XA 2N5FA 3QFAC 1HD2A 5LNKe 3IE3A 4XIHA 2H0HA 2KUCA 4AJ6A 5F05A 1AXDA 1PN9A 1ZOFA 2HSHA 1X5CA 2C8UA 1EGRA 1V57A 4E8EA 2OACA 2YP6A 4FIWA 1EP7A 3L9SA 5LCZA 2MBSA 3P90A 1AIUA 4MJBA 2CT6A 3ERWA 3GKMA 3WT1A 1EWXA 3R2QA 3F6FA 4IHUA 5DBQA 1GP1A 2MMOA 3APSA 3HCZA 2UZ8A 2A2RA 4TKYA 4F2IA 4IP6A 3CSIA 4OO4A 3I9V2 4POKA 3QMXA 4ML1A 3TRXA 3PR8A 3HYPA 5ECHB 2TIRA 3FMWA 3DIEA 1B4QA 2H1DA 2AYTA 4O5QA 3TKSE 1V98A 2VLTA 2XPDA 4NHZA 5G2ZA 4GLTA 4FYCA 2R3XA 1X5EA 2EIOA 4MP4A 1K0BA 3TKQA 3GN3A 3HJOA 2IMDA 1WIKA 3GX0A 2YJ7A 3GTUA 3IBHA 2OE0A 1ST9A 2M46A 5IM9A 1RW1A 4MJCA 2AUVA 5KOXA 3RPPA 4N0VA 3ZRDA 1JHBA 2QSIA 5ECOB 2FCHA 2OJLA 3KIJA 3ZFLA 3ZVJD 5JWRB 2TRXA 1FOVA 1M2DA 5IIZA 4XS4A 3GSSA 1XFLA 3MYDA 1SJZA 5KEJA 1XW6A 1HYUA 5ELAA 3GFKA 4WKWA 1H4OA 4XRAA 3UOMA 3ZFBA 4F9ZA 2HT9A 4Q5FA 2LRTA 4ZL7A 2QC7A 1EP8A 1BG5A 2H76A 3R3EA 22GSA 2K8VA 5IO0A 2R6KA 2HXKA 4J2FA 3CRTA 4GSSA 2GQLA 3KH7A 2LUSA 4ISDA 1XCCA 2C1YA 1B48A 1WMJA 5A5KA 5CRGA 3QD9A 4HU9A 2VCVA 4X0XA 1CQGA 2O87A 4Z2UA 3JCML 1GSSA 4N11A 4V2NA 1FAAA 1B4PA 2LNTA 2RUEA 1AC1A 3MNGA 4TVEA 2CV4A 3CMIA 4PTSA 4PQIA 5DQSA 5HQPA 4O92A 2AAWA 4BL7B 16GSA 3HY2A 4EVMA 4G0KA 1S3DA 4L5OA 2DJ2A 4NXIA 2CVKA 1EOHA 4TOPA 2WB9A 1AQXA 2DJJA 4ULXA 1SKWB 4MJEA 4ZB8A 2EIRA 2YPMA 1SL1B 1Z7RA 2KP1A 2C0FA 2HRFA 5D9VA 3U6VA 3KJYA 5IMVA 2X4AA 3BBYA 3ZTLA 3HJMA 4YQVA 2H30A 1Z9HA 1PX7A 2B7KA 3FK8A 4BVXB 3NIVA 3UIWA 4ID0A 4OFMA 1V40A 1MEKA 4FYBA 2AV4A 2LS5A 3KMNA 4P3YB 3ED3A 2O8VB 3GA4A 2P5RA 4DVCA 3TCOA 2MBTA 1K3YA 4K5RA 4KF9A 1T4ZA 1BEDA 2R0GA 3EPTA 4DSSA 5KOWA 2AHEA 3GURA 1PA3A 3RPNA 1O85A 2NTOA 1THXA 3W8JA 2H01A 1VF1A 1SKRB 1A2JA 2JL4A 4LMWA 4TRXA 2GQMA 3KZQA 5DJLA 4OWYA 2BJXA 3F0IA 5J3RA 1GTIA 1XW9A 3EE2A 5H5QA 4POBA 1UA5A 5DAKB 1A23A 4I6XA 5AIVA 3IOSA 3ZYWA 5H5RA 2L4CA 2FA8A 1JZDA 4EDYA 2IPAA 1M2AA 1PL2A 1ERWA 2EC4A 2X8CA 5CRHA 4I8BA 2VCQA 5CO3A 3FW2A 5BMUA 2BTOT 3CTGA 4GQFA 4KW6A 2TRCP 1SD8A 4V2MA 4ZIJA 1GNEA 4RUVA 4PGTA 5DALA 5ECLB 4EIPA 3SBCA 2H6ZA 2LSTA 3QAWA 4A5PA 2VD1A 2H6XA 4IELA 3C73A 2VL9A 1TRUA 4JRRA 4L8EA 1YZXA 2ZUPA 4EDZA 2ON7A 3LSZA 1G0TA 1OVNA 2QGVA 3TRPA 5ELGA 1TK0B 4HUAA 4TR3A 3SWLA 4WF5A 3TJKA 2P5QA 2PN8A 4EUYA 5E4WA 2OE3A 1QK8A 5ID2A 5GSTA 1Z7PA 3L9VA 2D2ZA 1K0DA 3TKSC 3DD3A 4K6XA 1MD3A 1TK5B 1G6WA 2R4VA 5HR1A 19GSA 5IOWA 1TRSA 1FW1A 1K0MA 3ZLPA 1TU8A 3A2XA 1UN2A 5H5SA 5IMZA 3GV1A 1SL2B 3KP8A 1FVJA 1LBKA 4XHMA 3RBTA 1G6YA 2M80A 3TOUA 5ECMB 3WGXA 2V2GA 1S3AA 2LV3A 4V1Ap 4MCUA 2LNSA 9GSSA 3LXTA 3VK9A 1U3AA 4AJ8A 2G2QA 2CVDA 5KN3A 1XBSA 5A4UA 2A4HA 4IW9A 4KSMA 5F06A 5JWOB 3DYRA 1GUHA 1MD4A 4ZXGA 3ZL5A 4TXOA 3BCKA 2F9SA 4NV2A 4NWYA 4I5QA 4PURA 3TJGA 4LMVA 2I4AA 5CRWA 5FT3A 1M9BA 1B9YC 1M99A 2VM2A 1SK2A 4MH2A 2H0IA 1I5GA 3GL5A 2FD3A 4XS6A 1EV4A 4KCEA 1DBYA 1A2MA 1OC9B 4RI7A 2IFQA 4AJ7A 1K0CA 4DSQA 1K3OA 4K7OA 3D6IA 2H75A 2V41A 4MZCA 4F03A 1PSQA 2J9HA 3S9FA 3HZ4A 3NOFA 1O8WA 4L0UA 4NMUA 2H19A 6GSVA 3LFLA 5J5NA 3FZ5A 5G5FA 3H79A 3TGZA 3VLNA 2E2GA 1XZOA 2M72A 3LEFA 4GF0A 3Q18A 2YZHA 3QFBC 2MMAA 1ZZYA 3IA1A 3IXRA 4BA7A 3EU3A 1IYHA 2N5AA 1RQMA 1JZRA 4EXJA 2G0FA 2PU9C 5IO2A 2F3MA 3MAKA 3DVWA 4TW5A 5IMDA 4KB3A 2LJKA 4NPBA 2CX3A 4KDUA 5EY6A 1SL0B 4IN0A 2LQQA 5IMAA 2YOIA 3HVXA 3M1GA 5B7CA 4YKFA 2A2SA 3GNJA 2K9FA 1A0FA 4MPGA 2VL2C 5D8IA 3EC3A 1JLWA 1SYRA 4MH3A 3D5JA 4Z2RA 1QMVA 3WGDA 5DDLA 2PGTA 1VGLA 2GSRA 4GQCA 4YAPA 1YJ6A 2F8FA 2NPBA 3PINA 2HSMA 1SJIA 3EINA 2I81A 1ZGNA 1G7OA 2XHFA 3ZREA 2IMIA 1A24A 2ES7A 2VCZA 1WE0A 2H8LA 3FY7A 5ECPB 1JZWA 3H4KA 2KLXA 2WS2A 4JR4A 2OKAA 4E8HA 4OCFA 2YV9A 3KH9A 3HHVA 5KN2A 2P0GA 2R37A 1N8JA 4I2TA 1XW5A 6GSYA 5J9CA 2K6VA 5IMCA 1JLVA 3U5RE 1SK1A 4ZL8A 1X9WB 4QQ7A 2YNXA 4O32A 2H0GA 3E3EA 8GSSA 3IHQA 3C8EA 4TR0A 5ECNB 4KSOA 4BWSA 4KDXA 4ECJA 3DEXA 1J0FA 1TK8B 4HZ2A 5L71A 2RLIA 5ENUA 3FEUA 4NAXA 1R7HA 1C72A 1T1VA 2L59A 3KCMA 4IVFA 4MPFA 4MABA 4MLYA 3US3A 3GX8A 4KGIA 3M8NA 6GSUA 4POLA 5D9TA 5HR3A 3NZNA 3TUEA 3C71A 3QAVA 3CSHA 1TJDA 1OAZA 1WRYA 1WOUA 1XWAA 3DVXA 5GAND 1GSYA 3CYNA 3M9KA 3UVTA 2H1AA 5CYYA 2VUPA 3RDWA 1ILOA 3ME7A 1PN0A 3F4TA 1XVWA 4RI6A 2AJQB 3QDNA 2HSYA 4IKHA 1R5AA 3C1SA 3VWXA 2YANA 3FRCA 2H1GA 3KTLA 3QAGA 5HFGA 5COHA 3C1RA 2YWMA 4EIQA 4PUFC 4HQSA 4L5LA 3FZ4A 4FO5A 3TB2A 1QFNA 3ZMLA 2DLXA 1O7UA 3M0FA 3LW9A 4K0NA 3A2WA 4CW9A 5HFIA 4CY6A 4BL7A 1SD9A 2GZZA 2BMXA 1WJKA 4MMMA 2DKIA 3GIXA 1WP0A 4O5RA 4ACSA 4KX4A 2JSYA 2VIMA 1CQHA 2VM1A 1PKZA 3D0ZA 3Q19A 4OCEA 3IC8A 1TI1A 3TKSA 4GSTA 3DRNA 3ZIVA 4OMVA 3IK7A 4V1Ag 2C3NA 2YN1A 3EU4A 2R5GA 2X8HA 1ZMAA 3PGTA 3BJ5A 1JFUA 4BVXA 1J08A 5IPHA 1AAZA 3VFIA 5HR0A 2RM6A 3IPZA 1V2AA 1F9MA 4G10A 3IC4A 2JACA 1KBNA 3GH9A 4KUNA 4OO5A 3OR5A 2DSAA 5C00A 1VRSD 5EPFA 1GRXA 2VD0A 2B5XA 2HLSA 5D96A 2DIYA 1K0OA 2X8GA 4G19A 5B6NA 2HNLA 3FYGA 3L9UA 5G30A 4MA9A 1EGOA 2VLVA 2L6DA 2GGTA 4KH7A 2L5OA 1HQOA 3BD2A 5CAXA 1GTAA 3M9JA 3BOAA 1X0RA 3CTFA 3LYKA 1PL1A 1ACVA 3HVVA 1ZYEA 3G7JA 1FB0A 3I69A 4JR6A 1OYJA 3W6GA 3UJ1A 3HVSA 4HDEA 1SK0A 2RUFA 5DCGA 4LLRA 4IBPA 5DAKA 4MNNA 4CDOA 2OBIA 1GTUA 3GL3A 1AW9A 2FUG2 1ERVA 12GSA 2VL3A 4AGSA 3WGEA 2L4QA 2X99A 3H1NA 2HRAA 3HZ8A 3G7IA 5ABRA 3KP9A 2R0CA 4HI7A 4FQUA 1ZCPA 1TW9A 3F3QA 4PQ1A 3LQ7A 4K2DA 4MF5A 4TR4A 3GRXA 2IIYA 1F3AA 4MF7A 1FOHA 1TI3A 4GCIA 3D4MA 5DJMA 1QGVA 5CP1A 3BCIA 3TKRA 4CHSA 2E0QA 2JZSA 3E0UA 3J7Yb 5A4VA 5DQYA 5BRTA 4HQZA 1QUWA 3VWUA 4IJ3A 2H66A 3UVHA 1OKTA 2OBKA 2ZCTA 1BAYA 1XIYA 4X43A 2WDUA 4KE3A 5GSSA 2X49A 1A2LA 2A2PA 5INYA 1E6BA 3WD6A 2GS3A 2CQ9A 3RHCA 4JBBA 1XWKA 1M7TA 4ECCA 1O73A 2DIZA 1A8LA 5J9BA 4J57E 1K0AA 3LWAA 1LJRA 3PPUA 1OC3A 4K7IA 2AB6A 1Y6EA 1AQVA 1GUMA 4WEYA 2VL2A 2REMA 2E2MA 1EEMA 5KN0A 1NSWA 5B8BA 1O8XA 4PQHA 4BWQA 2V32A 2B7JA 1J9BA 2GLRA 3GKKA 2YWOA 3QOUA 2LJRA 1XWBA 3FR6A 1XOAA 1NHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K18 A;  4WR4 A;  1S3C A;  3UL3 A;  3F3R A;  4F0B A;  2C0D A;  1TP9 A;  2RII A;  4L0W A;  3Q74 A;  2DJ0 A;  4ZBB A;  2V1M A;  3DGQ A;  2MMZ A;  1KNG A;  1YQ1 A;  2H1B A;  3GH6 A;  1ZYQ B;  5ECI B;  3GKN A;  5AGY A;  1SYX A;  2EIQ A;  4IP1 A;  2C0E A;  2OE1 A;  1GL8 A;  4OD7 A;  2FGX A;  3L0H A;  1T3B A;  4YH2 A;  3F6D A;  4H86 A;  2DC5 A;  2I9H A;  2NBS A;  3Q6O A;  1W89 A;  2CAI A;  2HZE B;  3LYP A;  1R26 A;  3ERF A;  1OC9 A;  2CX4 A;  5ECR B;  3IAM 2;  1PD2 1;  1B8X A;  1E2Y A;  3KEB A;  3A3T A;  3ZIJ A;  4JED A;  3N5O A;  4ZBD A;  2IWT A;  4TN8 A;  2NDO A;  3A5W A;  3D22 A;  4PUA A;  4HOJ A;  1W4V A;  3IAS 2;  2GZP A;  2H72 A;  1F3B A;  5D9X A;  4YQM A;  2MYG A;  3EWL A;  2WJU A;  1FB6 A;  3A2V A;  2VCW A;  3GHA A;  2B1K A;  2IMF A;  3FZ9 A;  4XCS A;  2PBJ A;  1XWC A;  1DE2 A;  1TTZ A;  4D73 B;  2IJY A;  2GTU A;  2ALB A;  4PNF A;  1YEP A;  3LGC A;  3VPT A;  2I1U A;  1NW2 A;  3L78 A;  2MZC A;  4KDY A;  1TOF A;  3K8N A;  4TR1 B;  4MK3 A;  1SU9 A;  1FO5 A;  2C80 A;  5IMF A;  3VWV A;  3EMX A;  4OFN A;  4POM A;  2B6M A;  2JAD A;  1YDK A;  4K1F A;  4AF2 A;  4DEJ A;  2YWN A;  1A8Y A;  1TXX A;  5F8B A;  1EZK A;  4HJ2 A;  4NV5 A;  5IQY A;  3HD5 A;  4ZL9 A;  3FZA A;  1VF4 A;  3IRA A;  3G9B A;  3P8W A;  2KP2 A;  2YV7 A;  5G1L A;  4QL9 A;  3F4R A;  3GST A;  5B8A A;  18GS A;  1U3I A;  2WCI A;  1EV9 A;  2C3T A;  2GQK A;  4Q5N A;  1EEJ A;  5IPG A;  1GNW A;  2PUK C;  4V2L A;  5EL8 A;  3WT2 A;  2C3Q A;  3D4T A;  2Z9S A;  1MDJ A;  3TJB A;  4RQX A;  1U87 A;  5ECQ B;  3L4N A;  1V58 A;  2C4J A;  4PXO A;  1H75 A;  1GTB A;  3GKX A;  1AQW A;  2L57 A;  4ML6 A;  3FR3 A;  3ZZX A;  2H6Y A;  2IMK A;  2X64 A;  17GS A;  3HJP A;  5DCH A;  3IR4 A;  4ZBA A;  2CAQ A;  5JWQ B;  2WFC A;  1KEB A;  3HDC A;  4ECB A;  2MMN A;  1QXH A;  5LD0 A;  2GSS A;  2VCX A;  1ERT A;  4O7H A;  1TRW A;  1RK4 A;  2JU5 A;  3O3T A;  3P2A A;  4YQU A;  2WZ9 A;  4G2E A;  4LA1 A;  11GS A;  2JZT A;  5DVB A;  4IQ1 A;  4F0C A;  5KN1 A;  4PNG A;  3VWW A;  5IOX A;  5D93 A;  2L6C A;  4K0G A;  4EKZ A;  4RQR A;  2CA8 A;  5ECS A;  4J56 E;  1XXU A;  3E9J B;  3ME8 A;  3MSZ A;  4KA0 A;  2WGR A;  5JCW A;  4GSN A;  2H74 A;  3LXZ A;  5C04 A;  2K8S A;  1OKD A;  1F6M C;  1KTE A;  2FHE A;  2JSZ A;  2ON5 A;  3DWV A;  2CVB A;  1Z6M A;  4DSR A;  5FWG A;  4EC0 A;  1YF1 A;  4EO3 A;  2L5L A;  1T8E B;  1FG4 A;  1FHE A;  3HKR A;  2YCD A;  5F07 A;  5B6M A;  1DE1 A;  3GTU B;  1F2E A;  2FY6 A;  4GWR A;  1UC7 A;  2O89 A;  6GST A;  1T00 A;  1NHO A;  1BYE A;  2LEG A;  3ERG A;  2H71 A;  4WXT A;  4XS4 B;  2E7P A;  2IL3 A;  3M3M A;  3F4S A;  4WET A;  5CRE A;  1URM A;  3IDV A;  3HXS A;  5CNW A;  4JE1 A;  2XC2 A;  2HE3 A;  5HR2 A;  20GS A;  1M2B A;  3ZVJ A;  3QPM A;  2P31 A;  3GUS A;  2PWJ A;  3HA9 A;  2KOK A;  1T7P B;  5G31 A;  1HNB A;  2O7K A;  3I43 A;  3DKS A;  3ZMK A;  1TRV A;  4X1U A;  2FWE A;  1OE8 A;  3FHK A;  3RHB A;  4XS1 A;  13GS A;  1B9X C;  3IK9 A;  1TKD B;  4WF4 A;  2CZ3 A;  3UAP A;  1NM3 A;  3TJF A;  2GT6 A;  2HI7 A;  4FYU A;  2GT5 A;  1TDI A;  4HEA 2;  1QQ2 A;  2DML A;  1VF3 A;  4XRD A;  4NHW A;  3TKP A;  3QR6 A;  3CXG A;  5GZZ B;  4QL7 A;  2F8A A;  1YEX A;  4GTU A;  2LQO A;  2PPT A;  1IYI A;  4HJM A;  1N2A A;  5HFK A;  2LJA A;  1V9W A;  2GSQ A;  1XOB A;  14GS A;  3O6T A;  2XBQ A;  4I97 A;  4MDC A;  3APO A;  1X9S B;  5AIX A;  1GSU A;  1GSE A;  5FHI A;  5J4U A;  2FWF A;  2HYX A;  1O6J A;  1UVZ A;  3APQ A;  3LOR A;  1U6T A;  3MWH A;  2HRN A;  3KD0 A;  5JCG A;  1GSQ A;  3EMP A;  4MZB A;  2B1L A;  2GVP A;  1ABA A;  2XBI A;  1MDK A;  3FR9 A;  3G7Y A;  2IN3 A;  2PMT A;  1MDI A;  4KAE A;  4TXV A;  1GSD A;  2H70 A;  3LG6 A;  3KGK A;  1Z5Y E;  2C0G A;  3KTB A;  4K8M A;  3W8S A;  3UAR A;  1GWC A;  6GSS A;  3EVI A;  2VAF A;  3GMF A;  3DML A;  1LU4 A;  5G1K A;  2B5E A;  2PVQ A;  3UBL A;  1Z6N A;  1R5P A;  4K7N A;  1A0R P;  2KHP A;  5AN1 A;  3RAZ A;  1PMT A;  2GDR A;  3J7Y k;  4JZQ A;  1PKW A;  1OE7 A;  2VCT A;  4DSS B;  3UEM A;  1U88 A;  3EYT A;  1SEN A;  5G5E A;  4N10 A;  4EE0 A;  1YF0 A;  2WUL A;  4ZB9 A;  1PX6 A;  3VPQ A;  6GSW A;  3VI5 A;  1GLQ A;  4MJA A;  4ZIL A;  2I3Y A;  4GRF A;  1GUK A;  2DJ1 A;  2GZY A;  1HNC A;  4BPY A;  2N5B A;  4WBR D;  1Q4J A;  3H8Q A;  1BQ7 A;  3TRQ A;  2V6K A;  5CRD A;  4WR5 A;  4K9Z A;  4LL4 B;  2IME A;  1BJX A;  4IQA A;  3KXO A;  1ERU A;  2VOC A;  4PX1 A;  3UMA A;  1FVK A;  4HU7 A;  2WRT A;  2FNO A;  3D21 A;  3IV4 A;  1YY7 A;  3KM6 A;  1DUG A;  1M9A A;  2DJ3 A;  2XPE A;  3H93 A;  3DXB A;  5D73 A;  4Q5R A;  1Z3E A;  2JZR A;  5DAL B;  4JU5 A;  2OA7 A;  4IJI A;  2HFD A;  3VUR A;  2OAD A;  3UBK A;  2FWG A;  5ECK B;  2LKU A;  4HS1 A;  1VF2 A;  1PGT A;  5AIS A;  1OC8 A;  1AUC A;  1PQN A;  4KND A;  2HZF A;  3EUR A;  3VI7 A;  2LTK A;  2YJH A;  2B3S A;  2F51 A;  3FKF A;  2O85 A;  5ID2 B;  4GXZ A;  1GSF A;  5JCU A;  2R2J A;  1M0U A;  2FWH A;  4N0Z A;  1GLP A;  4IS0 A;  3F9U A;  3GYK A;  2DMM A;  1X5D A;  1WPI A;  2V6O A;  4EL1 A;  1X9M B;  6GSX A;  2J23 A;  1R4W A;  1G7E A;  3TOT A;  3P7X A;  3N9J A;  2FLS A;  2PER A;  2YZU A;  3O76 A;  1ML6 A;  5A4W A;  1USB A;  3KMO A;  1MTC A;  1THO A;  1XPV A;  2FA4 A;  4KCA A;  2VO4 A;  2HZE A;  3TJJ A;  3QCP A;  5D9W A;  2A4V A;  2CZ2 A;  2YWI A;  3CBU A;  1I9D A;  4G9H A;  4N30 A;  1O81 A;  3PH9 A;  2QKE A;  2NVL A;  5E59 A;  3C7M A;  1HNA A;  4I2U A;  4TXO B;  4OFT A;  1T4Y A;  4ECI A;  3CSJ A;  3I6A A;  3V1W A;  2H73 A;  3ISO A;  4IGJ A;  4YAV A;  1JZO A;  3F8U A;  5EVO A;  4D73 A;  1GUL A;  1XVQ A;  1GH2 A;  1YKA A;  4EF0 A;  1Q98 A;  3F63 A;  4XTS A;  1TU7 A;  3LJR A;  5F0G A;  1ZL9 A;  2IFQ B;  2DJK A;  4ZB6 A;  4FH8 A;  4Q5Q A;  1BX9 A;  4TR1 A;  1DSB A;  4WBJ A;  2VLU A;  5GAP D;  7GSS A;  2LRN A;  1SJ6 A;  4F82 A;  4MZW A;  2DBC A;  1YKC A;  3MDK A;  1F37 A;  1PRX A;  1K3L A;  3AY8 A;  4BVY A;  1SKS B;  1ON4 A;  3TDG A;  2GST A;  4ILF A;  4LL1 B;  1WWJ A;  1XWG A;  1EOG A;  10GS A;  2B5Y A;  4MF6 A;  4HZ4 A;  1K0N A;  3WYW A;  3ZIT A;  2RM5 A;  5J41 A;  2LRC A;  2ZNM A;  2PVO C;  1Y25 A;  3CRU A;  4Z7X A;  2N5F A;  3QFA C;  1HD2 A;  5LNK e;  3IE3 A;  4XIH A;  2H0H A;  2KUC A;  4AJ6 A;  5F05 A;  1AXD A;  1PN9 A;  1ZOF A;  2HSH A;  1X5C A;  2C8U A;  1EGR A;  1V57 A;  4E8E A;  2OAC A;  2YP6 A;  4FIW A;  1EP7 A;  3L9S A;  5LCZ A;  2MBS A;  3P90 A;  1AIU A;  4MJB A;  2CT6 A;  3ERW A;  3GKM A;  3WT1 A;  1EWX A;  3R2Q A;  3F6F A;  4IHU A;  5DBQ A;  1GP1 A;  2MMO A;  3APS A;  3HCZ A;  2A2R A;  4TKY A;  4F2I A;  4IP6 A;  3CSI A;  4OO4 A;  3I9V 2;  4POK A;  3QMX A;  4ML1 A;  3TRX A;  3PR8 A;  3HYP A;  5ECH B;  2TIR A;  3DIE A;  1B4Q A;  2H1D A;  2AYT A;  3TKS E;  1V98 A;  2VLT A;  2XPD A;  4NHZ A;  5G2Z A;  4GLT A;  4FYC A;  2R3X A;  1X5E A;  2EIO A;  4MP4 A;  1K0B A;  3TKQ A;  3GN3 A;  3HJO A;  2IMD A;  1WIK A;  3GX0 A;  2YJ7 A;  3GTU A;  3IBH A;  2OE0 A;  1ST9 A;  2M46 A;  5IM9 A;  1RW1 A;  4MJC A;  2AUV A;  3RPP A;  4N0V A;  3ZRD A;  1JHB A;  2QSI A;  5ECO B;  2FCH A;  2OJL A;  3KIJ A;  3ZFL A;  3ZVJ D;  5JWR B;  2TRX A;  1FOV A;  1M2D A;  5IIZ A;  4XS4 A;  3GSS A;  1XFL A;  1SJZ A;  5KEJ A;  1XW6 A;  1HYU A;  5ELA A;  3GFK A;  4WKW A;  1H4O A;  4XRA A;  3UOM A;  3ZFB A;  4F9Z A;  2HT9 A;  4Q5F A;  2LRT A;  4ZL7 A;  2QC7 A;  1EP8 A;  1BG5 A;  2H76 A;  22GS A;  2K8V A;  5IO0 A;  2R6K A;  2HXK A;  4J2F A;  3CRT A;  4GSS A;  2GQL A;  3KH7 A;  2LUS A;  4ISD A;  1XCC A;  2C1Y A;  1B48 A;  1WMJ A;  5A5K A;  5CRG A;  3QD9 A;  4HU9 A;  2VCV A;  4X0X A;  1CQG A;  2O87 A;  3JCM L;  1GSS A;  4N11 A;  4V2N A;  1FAA A;  1B4P A;  2LNT A;  2RUE A;  1AC1 A;  3MNG A;  4TVE A;  2CV4 A;  3CMI A;  4PQI A;  5DQS A;  5HQP A;  4O92 A;  2AAW A;  16GS A;  3HY2 A;  4EVM A;  1S3D A;  4L5O A;  2DJ2 A;  4NXI A;  2CVK A;  1EOH A;  4TOP A;  2WB9 A;  1AQX A;  2DJJ A;  4ULX A;  1SKW B;  4MJE A;  4ZB8 A;  2EIR A;  2YPM A;  1SL1 B;  1Z7R A;  2KP1 A;  2C0F A;  2HRF A;  5D9V A;  3U6V A;  3KJY A;  5IMV A;  3BBY A;  3ZTL A;  3HJM A;  4YQV A;  2H30 A;  1Z9H A;  1PX7 A;  2B7K A;  3FK8 A;  3NIV A;  3UIW A;  4ID0 A;  4OFM A;  1V40 A;  1MEK A;  4FYB A;  2AV4 A;  2LS5 A;  3KMN A;  4P3Y B;  3ED3 A;  2O8V B;  3GA4 A;  2P5R A;  4DVC A;  3TCO A;  2MBT A;  1K3Y A;  1T4Z A;  1BED A;  4DSS A;  2AHE A;  3GUR A;  1PA3 A;  3RPN A;  1O85 A;  2NTO A;  1THX A;  3W8J A;  2H01 A;  1VF1 A;  1SKR B;  1A2J A;  2JL4 A;  4LMW A;  4TRX A;  2GQM A;  3KZQ A;  5DJL A;  4OWY A;  2BJX A;  3F0I A;  5J3R A;  1GTI A;  1XW9 A;  3EE2 A;  5H5Q A;  4POB A;  1UA5 A;  5DAK B;  1A23 A;  4I6X A;  5AIV A;  3IOS A;  3ZYW A;  5H5R A;  2L4C A;  2FA8 A;  1JZD A;  4EDY A;  2IPA A;  1M2A A;  1PL2 A;  1ERW A;  2EC4 A;  2X8C A;  5CRH A;  4I8B A;  2VCQ A;  5CO3 A;  3FW2 A;  2BTO T;  3CTG A;  4GQF A;  4KW6 A;  2TRC P;  1SD8 A;  4V2M A;  4ZIJ A;  1GNE A;  4RUV A;  4PGT A;  5DAL A;  5ECL B;  3SBC A;  2H6Z A;  2LST A;  3QAW A;  2VD1 A;  2H6X A;  4IEL A;  3C73 A;  2VL9 A;  1TRU A;  4JRR A;  4L8E A;  1YZX A;  2ZUP A;  4EDZ A;  2ON7 A;  3LSZ A;  1G0T A;  1OVN A;  2QGV A;  3TRP A;  5ELG A;  1TK0 B;  4HUA A;  4TR3 A;  3SWL A;  4WF5 A;  3TJK A;  2P5Q A;  2PN8 A;  4EUY A;  5E4W A;  2OE3 A;  1QK8 A;  5ID2 A;  5GST A;  1Z7P A;  3L9V A;  2D2Z A;  1K0D A;  3TKS C;  3DD3 A;  4K6X A;  1MD3 A;  1TK5 B;  1G6W A;  2R4V A;  5HR1 A;  19GS A;  5IOW A;  1TRS A;  1FW1 A;  1K0M A;  3ZLP A;  1TU8 A;  3A2X A;  1UN2 A;  5H5S A;  5IMZ A;  3GV1 A;  1SL2 B;  3KP8 A;  1FVJ A;  1LBK A;  4XHM A;  3RBT A;  1G6Y A;  2M80 A;  3TOU A;  5ECM B;  3WGX A;  2V2G A;  1S3A A;  2LV3 A;  4V1A p;  4MCU A;  2LNS A;  9GSS A;  3LXT A;  3VK9 A;  1U3A A;  4AJ8 A;  2G2Q A;  2CVD A;  5KN3 A;  1XBS A;  5A4U A;  4IW9 A;  4KSM A;  5F06 A;  5JWO B;  3DYR A;  1GUH A;  1MD4 A;  4ZXG A;  3ZL5 A;  4TXO A;  3BCK A;  2F9S A;  4NV2 A;  4NWY A;  4I5Q A;  4PUR A;  3TJG A;  4LMV A;  2I4A A;  5CRW A;  5FT3 A;  1M9B A;  1B9Y C;  1M99 A;  2VM2 A;  1SK2 A;  4MH2 A;  2H0I A;  1I5G A;  3GL5 A;  2FD3 A;  4XS6 A;  1EV4 A;  4KCE A;  1DBY A;  1A2M A;  1OC9 B;  4RI7 A;  2IFQ A;  4AJ7 A;  1K0C A;  4DSQ A;  1K3O A;  4K7O A;  3D6I A;  2H75 A;  2V41 A;  4MZC A;  4F03 A;  1PSQ A;  2J9H A;  3S9F A;  3HZ4 A;  3NOF A;  1O8W A;  4L0U A;  4NMU A;  2H19 A;  6GSV A;  3LFL A;  5J5N A;  3FZ5 A;  5G5F A;  3H79 A;  3TGZ A;  3VLN A;  2E2G A;  1XZO A;  2M72 A;  3LEF A;  4GF0 A;  3Q18 A;  2YZH A;  3QFB C;  2MMA A;  1ZZY A;  3IA1 A;  3IXR A;  4BA7 A;  3EU3 A;  1IYH A;  2N5A A;  1RQM A;  1JZR A;  4EXJ A;  2G0F A;  2PU9 C;  5IO2 A;  2F3M A;  3MAK A;  3DVW A;  4TW5 A;  5IMD A;  4KB3 A;  2LJK A;  4NPB A;  2CX3 A;  4KDU A;  5EY6 A;  1SL0 B;  4IN0 A;  2LQQ A;  5IMA A;  2YOI A;  3HVX A;  3M1G A;  5B7C A;  2A2S A;  3GNJ A;  2K9F A;  1A0F A;  4MPG A;  2VL2 C;  5D8I A;  3EC3 A;  1JLW A;  1SYR A;  4MH3 A;  3D5J A;  1QMV A;  3WGD A;  5DDL A;  2PGT A;  1VGL A;  2GSR A;  4GQC A;  4YAP A;  1YJ6 A;  2F8F A;  2NPB A;  3PIN A;  1SJI A;  3EIN A;  2I81 A;  1ZGN A;  1G7O A;  2XHF A;  3ZRE A;  2IMI A;  1A24 A;  2ES7 A;  2VCZ A;  1WE0 A;  2H8L A;  3FY7 A;  5ECP B;  1JZW A;  3H4K A;  2KLX A;  2WS2 A;  4JR4 A;  2OKA A;  4E8H A;  4OCF A;  2YV9 A;  3KH9 A;  3HHV A;  5KN2 A;  2P0G A;  2R37 A;  1N8J A;  4I2T A;  1XW5 A;  6GSY A;  5J9C A;  2K6V A;  5IMC A;  1JLV A;  3U5R E;  1SK1 A;  4ZL8 A;  1X9W B;  4QQ7 A;  2YNX A;  4O32 A;  2H0G A;  3E3E A;  8GSS A;  3IHQ A;  3C8E A;  4TR0 A;  5ECN B;  4KSO A;  4BWS A;  4KDX A;  4ECJ A;  3DEX A;  1J0F A;  1TK8 B;  4HZ2 A;  5L71 A;  2RLI A;  5ENU A;  3FEU A;  4NAX A;  1R7H A;  1C72 A;  1T1V A;  2L59 A;  3KCM A;  4IVF A;  4MPF A;  4MAB A;  4MLY A;  3US3 A;  3GX8 A;  4KGI A;  3M8N A;  6GSU A;  4POL A;  5D9T A;  5HR3 A;  3NZN A;  3TUE A;  3C71 A;  3QAV A;  3CSH A;  1TJD A;  1OAZ A;  1WRY A;  1WOU A;  1XWA A;  3DVX A;  5GAN D;  1GSY A;  3CYN A;  3M9K A;  3UVT A;  2H1A A;  5CYY A;  2VUP A;  3RDW A;  1ILO A;  3ME7 A;  3F4T A;  1XVW A;  4RI6 A;  2AJQ B;  3QDN A;  2HSY A;  4IKH A;  1R5A A;  3C1S A;  3VWX A;  2YAN A;  3FRC A;  2H1G A;  3KTL A;  3QAG A;  5HFG A;  5COH A;  3C1R A;  2YWM A;  4PUF C;  4HQS A;  4L5L A;  3FZ4 A;  4FO5 A;  3TB2 A;  1QFN A;  3ZML A;  2DLX A;  1O7U A;  3M0F A;  4K0N A;  3A2W A;  4CW9 A;  5HFI A;  4BL7 A;  1SD9 A;  2GZZ A;  2BMX A;  1WJK A;  4MMM A;  3GIX A;  1WP0 A;  4O5R A;  4ACS A;  4KX4 A;  2JSY A;  2VIM A;  1CQH A;  2VM1 A;  1PKZ A;  3D0Z A;  3Q19 A;  4OCE A;  1TI1 A;  3TKS A;  4GST A;  3DRN A;  3ZIV A;  4OMV A;  3IK7 A;  4V1A g;  2C3N A;  2YN1 A;  3EU4 A;  2R5G A;  2X8H A;  1ZMA A;  3PGT A;  3BJ5 A;  1JFU A;  4BVX A;  1J08 A;  5IPH A;  1AAZ A;  3VFI A;  5HR0 A;  2RM6 A;  3IPZ A;  1V2A A;  1F9M A;  4G10 A;  3IC4 A;  2JAC A;  1KBN A;  3GH9 A;  4KUN A;  4OO5 A;  3OR5 A;  2DSA A;  5C00 A;  1VRS D;  5EPF A;  1GRX A;  2VD0 A;  2B5X A;  2HLS A;  5D96 A;  2DIY A;  1K0O A;  2X8G A;  4G19 A;  5B6N A;  2HNL A;  3FYG A;  3L9U A;  5G30 A;  4MA9 A;  1EGO A;  2VLV A;  2L6D A;  2GGT A;  4KH7 A;  2L5O A;  1HQO A;  3BD2 A;  5CAX A;  1GTA A;  3M9J A;  3BOA A;  1X0R A;  3CTF A;  3LYK A;  1PL1 A;  1ACV A;  3HVV A;  1ZYE A;  3G7J A;  1FB0 A;  3I69 A;  4JR6 A;  1OYJ A;  3W6G A;  3UJ1 A;  3HVS A;  4HDE A;  1SK0 A;  2RUF A;  5DCG A;  4LLR A;  4IBP A;  5DAK A;  4CDO A;  2OBI A;  1GTU A;  3GL3 A;  1AW9 A;  2FUG 2;  1ERV A;  12GS A;  2VL3 A;  4AGS A;  3WGE A;  2L4Q A;  2X99 A;  3H1N A;  3HZ8 A;  3G7I A;  5ABR A;  3KP9 A;  4HI7 A;  1ZCP A;  1TW9 A;  3F3Q A;  4PQ1 A;  3LQ7 A;  4K2D A;  4MF5 A;  4TR4 A;  3GRX A;  2IIY A;  1F3A A;  4MF7 A;  1TI3 A;  4GCI A;  3D4M A;  5DJM A;  1QGV A;  5CP1 A;  3BCI A;  3TKR A;  4CHS A;  2E0Q A;  2JZS A;  3E0U A;  3J7Y b;  5A4V A;  5DQY A;  4HQZ A;  1QUW A;  3VWU A;  4IJ3 A;  2H66 A;  3UVH A;  1OKT A;  2OBK A;  2ZCT A;  1BAY A;  1XIY A;  4X43 A;  2WDU A;  4KE3 A;  5GSS A;  1A2L A;  5INY A;  1E6B A;  3WD6 A;  2GS3 A;  2CQ9 A;  3RHC A;  4JBB A;  1XWK A;  1M7T A;  4ECC A;  1O73 A;  2DIZ A;  1A8L A;  5J9B A;  4J57 E;  1K0A A;  3LWA A;  1LJR A;  1OC3 A;  4K7I A;  2AB6 A;  1Y6E A;  1AQV A;  1GUM A;  4WEY A;  2VL2 A;  2REM A;  2E2M A;  1EEM A;  5KN0 A;  1NSW A;  5B8B A;  1O8X A;  4PQH A;  4BWQ A;  2V32 A;  2B7J A;  1J9B A;  2GLR A;  3GKK A;  2YWO A;  3QOU A;  2LJR A;  1XWB A;  3FR6 A;  1XOA A;  1NHY A; 
#chains in the Genus database with same CATH topology
 2K18 A;  4WR4 A;  1S3C A;  3UL3 A;  3F3R A;  4F0B A;  2C0D A;  1TP9 A;  2RII A;  4L0W A;  3Q74 A;  2DJ0 A;  4ZBB A;  2V1M A;  3DGQ A;  2MMZ A;  1KNG A;  1YQ1 A;  2H1B A;  3GH6 A;  1ZYQ B;  5ECI B;  3GKN A;  5AGY A;  1SYX A;  2EIQ A;  4IP1 A;  2C0E A;  2OE1 A;  1GL8 A;  4OD7 A;  2FGX A;  3L0H A;  1T3B A;  4YH2 A;  3F6D A;  4H86 A;  2DC5 A;  2I9H A;  2NBS A;  3Q6O A;  1W89 A;  2CAI A;  2HZE B;  3LYP A;  1R26 A;  3ERF A;  1OC9 A;  2CX4 A;  4BIK A;  5ECR B;  3IAM 2;  1PD2 1;  1B8X A;  1E2Y A;  3KEB A;  3A3T A;  3ZIJ A;  4JED A;  3N5O A;  4ZBD A;  2IWT A;  4TN8 A;  2NDO A;  3A5W A;  3MIX A;  3D22 A;  4PUA A;  4HOJ A;  1W4V A;  3IAS 2;  2GZP A;  3A5I A;  2H72 A;  1F3B A;  5D9X A;  4YQM A;  2MYG A;  3EWL A;  2WJU A;  1FB6 A;  3A2V A;  2VCW A;  3GHA A;  2B1K A;  2IMF A;  3FZ9 A;  4XCS A;  2PBJ A;  1XWC A;  1DE2 A;  1TTZ A;  4D73 B;  4YKG A;  2IJY A;  2GTU A;  2ALB A;  4PNF A;  1YEP A;  3LGC A;  3VPT A;  2I1U A;  1NW2 A;  3L78 A;  2MZC A;  4KDY A;  1TOF A;  3K8N A;  4TR1 B;  4MK3 A;  1SU9 A;  1FO5 A;  2C80 A;  5IMF A;  3VWV A;  3EMX A;  4OFN A;  4POM A;  2B6M A;  2JAD A;  1YDK A;  1M3J A;  4K1F A;  4AF2 A;  4DEJ A;  2YWN A;  1A8Y A;  1TXX A;  5F8B A;  1EZK A;  4HJ2 A;  4BVY B;  4NV5 A;  5IQY A;  3HD5 A;  4ZL9 A;  3FZA A;  1VF4 A;  3IRA A;  3G9B A;  3P8W A;  4G0L A;  2KP2 A;  2YV7 A;  5G1L A;  4QL9 A;  3F4R A;  3GST A;  5B8A A;  18GS A;  1U3I A;  2WCI A;  1EV9 A;  2C3T A;  2GQK A;  4Q5N A;  1EEJ A;  5IPG A;  1GNW A;  4G0I A;  2PUK C;  4V2L A;  5EL8 A;  3WT2 A;  2C3Q A;  3D4T A;  2Z9S A;  1MDJ A;  3TJB A;  4RQX A;  1U87 A;  5ECQ B;  3L4N A;  1V58 A;  2C4J A;  4PXO A;  1H75 A;  1GTB A;  3GKX A;  1AQW A;  2L57 A;  4ML6 A;  3FR3 A;  3ZZX A;  2H6Y A;  2IMK A;  2X64 A;  17GS A;  3HJP A;  5DCH A;  3IR4 A;  4ZBA A;  2CAQ A;  5JWQ B;  2WFC A;  1KEB A;  3HDC A;  4ECB A;  2MMN A;  1QXH A;  5LD0 A;  2GSS A;  2VCX A;  1ERT A;  4O7H A;  1TRW A;  1RK4 A;  1ZYN A;  2JU5 A;  3O3T A;  3P2A A;  4YQU A;  2WZ9 A;  4G2E A;  4LA1 A;  11GS A;  2JZT A;  5DVB A;  4IQ1 A;  4F0C A;  5KN1 A;  4PNG A;  3VWW A;  5IOX A;  5D93 A;  2L6C A;  4K0G A;  4EKZ A;  4RQR A;  2CA8 A;  5ECS A;  4J56 E;  1XXU A;  3E9J B;  3ME8 A;  3MSZ A;  4KA0 A;  2WGR A;  5JCW A;  4GSN A;  2H74 A;  3LXZ A;  5C04 A;  2K8S A;  1OKD A;  2QA2 A;  1F6M C;  1KTE A;  2FHE A;  2JSZ A;  2ON5 A;  3DWV A;  2CVB A;  1Z6M A;  4DSR A;  5FWG A;  4EC0 A;  1YF1 A;  4Z2T A;  4EO3 A;  2L5L A;  1T8E B;  1FG4 A;  1FHE A;  3HKR A;  2YCD A;  5F07 A;  5B6M A;  1DE1 A;  3GTU B;  1F2E A;  2FY6 A;  4GWR A;  1UC7 A;  2O89 A;  6GST A;  1T00 A;  1NHO A;  1BYE A;  2LEG A;  3ERG A;  2H71 A;  4WXT A;  4XS4 B;  2E7P A;  2IL3 A;  3M3M A;  3F4S A;  4WET A;  5CRE A;  1URM A;  3IDV A;  3HXS A;  5CNW A;  4JE1 A;  2XC2 A;  2R0P A;  2HE3 A;  5HR2 A;  20GS A;  1M2B A;  3ZVJ A;  3QPM A;  2P31 A;  3GUS A;  2PWJ A;  3HA9 A;  2KOK A;  1T7P B;  5G31 A;  1HNB A;  2O7K A;  3I43 A;  3DKS A;  3ZMK A;  1TRV A;  4X1U A;  2FWE A;  1OE8 A;  3FHK A;  3RHB A;  4XS1 A;  13GS A;  1B9X C;  3IK9 A;  1TKD B;  4WF4 A;  2CZ3 A;  3UAP A;  1NM3 A;  3TJF A;  2GT6 A;  2HI7 A;  4FYU A;  2GT5 A;  1TDI A;  4HEA 2;  1QQ2 A;  2DML A;  1VF3 A;  4XRD A;  4NHW A;  3TKP A;  3QR6 A;  3CXG A;  2DKH A;  5GZZ B;  4QL7 A;  2F8A A;  1YEX A;  4GTU A;  2LQO A;  2PPT A;  1IYI A;  4HJM A;  1N2A A;  5HFK A;  2LJA A;  1V9W A;  2GSQ A;  1XOB A;  14GS A;  3O6T A;  2XBQ A;  4I97 A;  4MDC A;  3APO A;  1X9S B;  5AIX A;  1GSU A;  1GSE A;  5FHI A;  5J4U A;  2FWF A;  2HYX A;  1O6J A;  1UVZ A;  3APQ A;  4O5U A;  3LOR A;  1U6T A;  3MWH A;  2HRN A;  3KD0 A;  5JCG A;  1GSQ A;  3EMP A;  1PFO A;  4MZB A;  2B1L A;  2GVP A;  1ABA A;  2XBI A;  1MDK A;  3FR9 A;  3G7Y A;  2IN3 A;  4CY8 A;  2PMT A;  1MDI A;  4KAE A;  4TXV A;  1GSD A;  2H70 A;  3LG6 A;  3KGK A;  1Z5Y E;  2C0G A;  3KTB A;  4K8M A;  3W8S A;  3UAR A;  1GWC A;  6GSS A;  3EVI A;  2VAF A;  3GMF A;  3DML A;  1LU4 A;  5G1K A;  2B5E A;  2PVQ A;  3UBL A;  1Z6N A;  1R5P A;  4K7N A;  1A0R P;  2KHP A;  5AN1 A;  3RAZ A;  1PMT A;  2GDR A;  3J7Y k;  4JZQ A;  1PKW A;  1OE7 A;  2VCT A;  4DSS B;  3UEM A;  1U88 A;  3EYT A;  1SEN A;  5G5E A;  4N10 A;  4EE0 A;  1YF0 A;  2WUL A;  4ZB9 A;  1PX6 A;  3VPQ A;  6GSW A;  3VI5 A;  2QA1 A;  1GLQ A;  4MJA A;  4ZIL A;  2I3Y A;  4GRF A;  1GUK A;  2DJ1 A;  2GZY A;  1HNC A;  4BPY A;  2N5B A;  4WBR D;  1Q4J A;  3H8Q A;  1BQ7 A;  3TRQ A;  2V6K A;  5CRD A;  4WR5 A;  4K9Z A;  4LL4 B;  2IME A;  1BJX A;  4IQA A;  3KXO A;  1ERU A;  2VOC A;  4PX1 A;  3UMA A;  1FVK A;  4HU7 A;  2WRT A;  2FNO A;  3D21 A;  3IV4 A;  1YY7 A;  3KM6 A;  1DUG A;  1M9A A;  2DJ3 A;  2XPE A;  3H93 A;  3DXB A;  5D73 A;  4Q5R A;  1Z3E A;  2JZR A;  5DAL B;  4JU5 A;  4X4J A;  2OA7 A;  4ICY A;  4IJI A;  2HFD A;  3VUR A;  2OAD A;  3UBK A;  2FWG A;  5ECK B;  2LKU A;  4HS1 A;  3HVN A;  1VF2 A;  1PGT A;  5AIS A;  1OC8 A;  1AUC A;  1PQN A;  4KND A;  2HZF A;  3EUR A;  3VI7 A;  2LTK A;  2YJH A;  2B3S A;  2F51 A;  3FKF A;  2O85 A;  5ID2 B;  4GXZ A;  1GSF A;  5JCU A;  2R2J A;  1M0U A;  2FWH A;  4N0Z A;  1GLP A;  4IS0 A;  3F9U A;  3GYK A;  2DMM A;  1X5D A;  1WPI A;  2V6O A;  4EL1 A;  1X9M B;  6GSX A;  2J23 A;  1R4W A;  1G7E A;  3TOT A;  3P7X A;  3N9J A;  2FLS A;  2PER A;  2YZU A;  3O76 A;  1ML6 A;  5A4W A;  1USB A;  3KMO A;  1MTC A;  4K5S A;  1THO A;  1XPV A;  2FA4 A;  4KCA A;  2VO4 A;  2HZE A;  3TJJ A;  3QCP A;  5D9W A;  2A4V A;  2CZ2 A;  2YWI A;  3CBU A;  1I9D A;  4G9H A;  4N30 A;  1O81 A;  3PH9 A;  2QKE A;  2NVL A;  5E59 A;  3C7M A;  1HNA A;  4I2U A;  4TXO B;  4OFT A;  1T4Y A;  4ECI A;  3CSJ A;  3I6A A;  3V1W A;  2H73 A;  3ISO A;  4IGJ A;  4YAV A;  1JZO A;  3F8U A;  1ZYP A;  5EVO A;  4D73 A;  1GUL A;  1XVQ A;  1GH2 A;  4K2X A;  1YKA A;  4EF0 A;  1Q98 A;  3F63 A;  4XTS A;  1TU7 A;  3LJR A;  5F0G A;  1ZL9 A;  2IFQ B;  2DJK A;  4ZB6 A;  4FH8 A;  4Q5Q A;  1BX9 A;  4TR1 A;  1DSB A;  4WBJ A;  2VLU A;  5GAP D;  7GSS A;  2LRN A;  3CQF A;  1SJ6 A;  4F82 A;  4MZW A;  2DBC A;  1YKC A;  3MDK A;  1F37 A;  4USS A;  1PRX A;  1K3L A;  3AY8 A;  4BVY A;  1SKS B;  1ON4 A;  3TDG A;  2GST A;  4ILF A;  4LL1 B;  1WWJ A;  1XWG A;  1EOG A;  10GS A;  2HRK A;  2B5Y A;  4MF6 A;  4HZ4 A;  1K0N A;  3WYW A;  3IHG A;  2RM5 A;  3ZIT A;  4HSC X;  5J41 A;  2LRC A;  2ZNM A;  2PVO C;  1Y25 A;  3CRU A;  4Z7X A;  2N5F A;  3QFA C;  1HD2 A;  5LNK e;  3IE3 A;  4XIH A;  2H0H A;  2KUC A;  4AJ6 A;  5F05 A;  1AXD A;  1PN9 A;  1ZOF A;  2HSH A;  1X5C A;  2C8U A;  1EGR A;  1V57 A;  4E8E A;  2OAC A;  2YP6 A;  4FIW A;  1EP7 A;  3L9S A;  5LCZ A;  2MBS A;  3P90 A;  1AIU A;  4MJB A;  2CT6 A;  3ERW A;  3GKM A;  3WT1 A;  1EWX A;  3R2Q A;  3F6F A;  4IHU A;  5DBQ A;  1GP1 A;  2MMO A;  3APS A;  3HCZ A;  2UZ8 A;  2A2R A;  4TKY A;  4F2I A;  4IP6 A;  3CSI A;  4OO4 A;  3I9V 2;  4POK A;  3QMX A;  4ML1 A;  3TRX A;  3PR8 A;  3HYP A;  5ECH B;  2TIR A;  3FMW A;  3DIE A;  1B4Q A;  2H1D A;  2AYT A;  4O5Q A;  3TKS E;  1V98 A;  2VLT A;  2XPD A;  4NHZ A;  5G2Z A;  4GLT A;  4FYC A;  2R3X A;  1X5E A;  2EIO A;  4MP4 A;  1K0B A;  3TKQ A;  3GN3 A;  3HJO A;  2IMD A;  1WIK A;  3GX0 A;  2YJ7 A;  3GTU A;  3IBH A;  2OE0 A;  1ST9 A;  2M46 A;  5IM9 A;  1RW1 A;  4MJC A;  2AUV A;  5KOX A;  3RPP A;  4N0V A;  3ZRD A;  1JHB A;  2QSI A;  5ECO B;  2FCH A;  2OJL A;  3KIJ A;  3ZFL A;  3ZVJ D;  5JWR B;  2TRX A;  1FOV A;  1M2D A;  5IIZ A;  4XS4 A;  3GSS A;  1XFL A;  3MYD A;  1SJZ A;  5KEJ A;  1XW6 A;  1HYU A;  5ELA A;  3GFK A;  4WKW A;  1H4O A;  4XRA A;  3UOM A;  3ZFB A;  4F9Z A;  2HT9 A;  4Q5F A;  2LRT A;  4ZL7 A;  2QC7 A;  1EP8 A;  1BG5 A;  2H76 A;  3R3E A;  22GS A;  2K8V A;  5IO0 A;  2R6K A;  2HXK A;  4J2F A;  3CRT A;  4GSS A;  2GQL A;  3KH7 A;  2LUS A;  4ISD A;  1XCC A;  2C1Y A;  1B48 A;  1WMJ A;  5A5K A;  5CRG A;  3QD9 A;  4HU9 A;  2VCV A;  4X0X A;  1CQG A;  2O87 A;  4Z2U A;  3JCM L;  1GSS A;  4N11 A;  4V2N A;  1XG8 A;  1FAA A;  1B4P A;  2LNT A;  2RUE A;  1AC1 A;  3MNG A;  4TVE A;  2CV4 A;  3CMI A;  4PTS A;  4PQI A;  5DQS A;  5HQP A;  4O92 A;  2AAW A;  4BL7 B;  16GS A;  3HY2 A;  4EVM A;  4G0K A;  1S3D A;  4L5O A;  2DJ2 A;  4NXI A;  2CVK A;  1EOH A;  4TOP A;  2WB9 A;  1AQX A;  2DJJ A;  4ULX A;  1SKW B;  4MJE A;  4ZB8 A;  2EIR A;  2YPM A;  1SL1 B;  1Z7R A;  2KP1 A;  2C0F A;  2HRF A;  5D9V A;  3U6V A;  3KJY A;  5IMV A;  2X4A A;  3BBY A;  3ZTL A;  3HJM A;  4YQV A;  2H30 A;  1Z9H A;  1PX7 A;  2B7K A;  3FK8 A;  4BVX B;  3NIV A;  3UIW A;  4ID0 A;  4OFM A;  1V40 A;  1MEK A;  4FYB A;  2AV4 A;  2LS5 A;  3KMN A;  4P3Y B;  3ED3 A;  2O8V B;  3GA4 A;  2P5R A;  4DVC A;  3TCO A;  2MBT A;  1K3Y A;  4K5R A;  4KF9 A;  1T4Z A;  1BED A;  2R0G A;  3EPT A;  4DSS A;  5KOW A;  2AHE A;  3GUR A;  1PA3 A;  3RPN A;  1O85 A;  2NTO A;  1THX A;  3W8J A;  2H01 A;  1VF1 A;  1SKR B;  1A2J A;  2JL4 A;  4LMW A;  4TRX A;  2GQM A;  3KZQ A;  5DJL A;  4OWY A;  2BJX A;  3F0I A;  5J3R A;  1GTI A;  1XW9 A;  3EE2 A;  5H5Q A;  4POB A;  1UA5 A;  5DAK B;  1A23 A;  4I6X A;  5AIV A;  3IOS A;  3ZYW A;  5H5R A;  2L4C A;  2FA8 A;  1JZD A;  4EDY A;  2IPA A;  1M2A A;  1PL2 A;  1ERW A;  2EC4 A;  2X8C A;  5CRH A;  4I8B A;  2VCQ A;  5CO3 A;  3FW2 A;  5BMU A;  2BTO T;  3CTG A;  4GQF A;  4KW6 A;  2TRC P;  1SD8 A;  4V2M A;  4ZIJ A;  1GNE A;  4RUV A;  4PGT A;  5DAL A;  5ECL B;  4EIP A;  3SBC A;  2H6Z A;  2LST A;  3QAW A;  4A5P A;  2VD1 A;  2H6X A;  4IEL A;  3C73 A;  2VL9 A;  1TRU A;  4JRR A;  4L8E A;  1YZX A;  2ZUP A;  4EDZ A;  2ON7 A;  3LSZ A;  1G0T A;  1OVN A;  2QGV A;  3TRP A;  5ELG A;  1TK0 B;  4HUA A;  4TR3 A;  3SWL A;  4WF5 A;  3TJK A;  2P5Q A;  2PN8 A;  4EUY A;  5E4W A;  2OE3 A;  1QK8 A;  5ID2 A;  5GST A;  1Z7P A;  3L9V A;  2D2Z A;  1K0D A;  3TKS C;  3DD3 A;  4K6X A;  1MD3 A;  1TK5 B;  1G6W A;  2R4V A;  5HR1 A;  19GS A;  5IOW A;  1TRS A;  1FW1 A;  1K0M A;  3ZLP A;  1TU8 A;  3A2X A;  1UN2 A;  5H5S A;  5IMZ A;  3GV1 A;  1SL2 B;  3KP8 A;  1FVJ A;  1LBK A;  4XHM A;  3RBT A;  1G6Y A;  2M80 A;  3TOU A;  5ECM B;  3WGX A;  2V2G A;  1S3A A;  2LV3 A;  4V1A p;  4MCU A;  2LNS A;  9GSS A;  3LXT A;  3VK9 A;  1U3A A;  4AJ8 A;  2G2Q A;  2CVD A;  5KN3 A;  1XBS A;  5A4U A;  2A4H A;  4IW9 A;  4KSM A;  5F06 A;  5JWO B;  3DYR A;  1GUH A;  1MD4 A;  4ZXG A;  3ZL5 A;  4TXO A;  3BCK A;  2F9S A;  4NV2 A;  4NWY A;  4I5Q A;  4PUR A;  3TJG A;  4LMV A;  2I4A A;  5CRW A;  5FT3 A;  1M9B A;  1B9Y C;  1M99 A;  2VM2 A;  1SK2 A;  4MH2 A;  2H0I A;  1I5G A;  3GL5 A;  2FD3 A;  4XS6 A;  1EV4 A;  4KCE A;  1DBY A;  1A2M A;  1OC9 B;  4RI7 A;  2IFQ A;  4AJ7 A;  1K0C A;  4DSQ A;  1K3O A;  4K7O A;  3D6I A;  2H75 A;  2V41 A;  4MZC A;  4F03 A;  1PSQ A;  2J9H A;  3S9F A;  3HZ4 A;  3NOF A;  1O8W A;  4L0U A;  4NMU A;  1M3I A;  2H19 A;  6GSV A;  3LFL A;  5J5N A;  3FZ5 A;  5G5F A;  3H79 A;  3TGZ A;  3VLN A;  2E2G A;  1XZO A;  2M72 A;  3LEF A;  4GF0 A;  3Q18 A;  2YZH A;  3QFB C;  2MMA A;  1ZZY A;  3IA1 A;  3IXR A;  4BA7 A;  3EU3 A;  1IYH A;  2N5A A;  1RQM A;  1JZR A;  4EXJ A;  2G0F A;  2PU9 C;  5IO2 A;  2F3M A;  3MAK A;  3DVW A;  4TW5 A;  5IMD A;  4KB3 A;  2LJK A;  4NPB A;  2CX3 A;  4KDU A;  5EY6 A;  1SL0 B;  4IN0 A;  2LQQ A;  5IMA A;  2YOI A;  3HVX A;  3M1G A;  5B7C A;  4YKF A;  2A2S A;  3GNJ A;  2K9F A;  1A0F A;  4MPG A;  2VL2 C;  5D8I A;  3EC3 A;  1JLW A;  1SYR A;  4MH3 A;  3D5J A;  4Z2R A;  1QMV A;  3WGD A;  5DDL A;  2PGT A;  1VGL A;  2GSR A;  4GQC A;  4YAP A;  1YJ6 A;  2F8F A;  2NPB A;  3PIN A;  2HSM A;  1SJI A;  3EIN A;  2I81 A;  1ZGN A;  1G7O A;  2XHF A;  3ZRE A;  2IMI A;  1A24 A;  2ES7 A;  2VCZ A;  1WE0 A;  2H8L A;  3FY7 A;  5ECP B;  1JZW A;  3H4K A;  2KLX A;  2WS2 A;  4JR4 A;  2OKA A;  4E8H A;  4OCF A;  2YV9 A;  3KH9 A;  3HHV A;  5KN2 A;  2P0G A;  2R37 A;  1N8J A;  4I2T A;  1XW5 A;  6GSY A;  5J9C A;  2K6V A;  5IMC A;  1JLV A;  3U5R E;  1SK1 A;  4ZL8 A;  1X9W B;  4QQ7 A;  2YNX A;  4O32 A;  2H0G A;  3E3E A;  8GSS A;  3IHQ A;  3C8E A;  4TR0 A;  5ECN B;  4KSO A;  4BWS A;  4KDX A;  4ECJ A;  3DEX A;  1J0F A;  1TK8 B;  4HZ2 A;  5L71 A;  2RLI A;  5ENU A;  3FEU A;  4NAX A;  1R7H A;  1C72 A;  1T1V A;  2L59 A;  3KCM A;  4IVF A;  4MPF A;  4MAB A;  4MLY A;  3US3 A;  3GX8 A;  4KGI A;  3M8N A;  6GSU A;  4POL A;  5D9T A;  5HR3 A;  3NZN A;  3TUE A;  3C71 A;  3QAV A;  3CSH A;  1TJD A;  1OAZ A;  1WRY A;  1WOU A;  1XWA A;  3DVX A;  5GAN D;  1GSY A;  3CYN A;  3M9K A;  3UVT A;  2H1A A;  5CYY A;  2VUP A;  3RDW A;  1ILO A;  3ME7 A;  1PN0 A;  3F4T A;  1XVW A;  4RI6 A;  2AJQ B;  3QDN A;  2HSY A;  4IKH A;  1R5A A;  3C1S A;  3VWX A;  2YAN A;  3FRC A;  2H1G A;  3KTL A;  3QAG A;  5HFG A;  5COH A;  3C1R A;  2YWM A;  4EIQ A;  4PUF C;  4HQS A;  4L5L A;  3FZ4 A;  4FO5 A;  3TB2 A;  1QFN A;  3ZML A;  2DLX A;  1O7U A;  3M0F A;  3LW9 A;  4K0N A;  3A2W A;  4CW9 A;  5HFI A;  4CY6 A;  4BL7 A;  1SD9 A;  2GZZ A;  2BMX A;  1WJK A;  4MMM A;  2DKI A;  3GIX A;  1WP0 A;  4O5R A;  4ACS A;  4KX4 A;  2JSY A;  2VIM A;  1CQH A;  2VM1 A;  1PKZ A;  3D0Z A;  3Q19 A;  4OCE A;  3IC8 A;  1TI1 A;  3TKS A;  4GST A;  3DRN A;  3ZIV A;  4OMV A;  3IK7 A;  4V1A g;  2C3N A;  2YN1 A;  3EU4 A;  2R5G A;  2X8H A;  1ZMA A;  3PGT A;  3BJ5 A;  1JFU A;  4BVX A;  1J08 A;  5IPH A;  1AAZ A;  3VFI A;  5HR0 A;  2RM6 A;  3IPZ A;  1V2A A;  1F9M A;  4G10 A;  3IC4 A;  2JAC A;  1KBN A;  3GH9 A;  4KUN A;  4OO5 A;  3OR5 A;  2DSA A;  5C00 A;  1VRS D;  5EPF A;  1GRX A;  2VD0 A;  2B5X A;  2HLS A;  2DIY A;  2X8G A;  1K0O A;  5D96 A;  4G19 A;  5B6N A;  2HNL A;  3FYG A;  3L9U A;  5G30 A;  4MA9 A;  1EGO A;  2VLV A;  2L6D A;  2GGT A;  4KH7 A;  2L5O A;  1HQO A;  3BD2 A;  5CAX A;  1GTA A;  3M9J A;  3BOA A;  1X0R A;  3CTF A;  3LYK A;  1PL1 A;  1ACV A;  3HVV A;  1ZYE A;  3G7J A;  1FB0 A;  3I69 A;  4JR6 A;  1OYJ A;  3W6G A;  3UJ1 A;  3HVS A;  4HDE A;  1SK0 A;  2RUF A;  5DCG A;  4LLR A;  4IBP A;  5DAK A;  4MNN A;  4CDO A;  2OBI A;  1GTU A;  3GL3 A;  1AW9 A;  2FUG 2;  1ERV A;  12GS A;  2VL3 A;  4AGS A;  3WGE A;  2L4Q A;  2X99 A;  3H1N A;  2HRA A;  3HZ8 A;  3G7I A;  5ABR A;  3KP9 A;  2R0C A;  4HI7 A;  4FQU A;  1ZCP A;  1TW9 A;  3F3Q A;  4PQ1 A;  3LQ7 A;  4K2D A;  4MF5 A;  4TR4 A;  3GRX A;  2IIY A;  1F3A A;  4MF7 A;  1FOH A;  1TI3 A;  4GCI A;  3D4M A;  5DJM A;  1QGV A;  5CP1 A;  3BCI A;  3TKR A;  4CHS A;  2E0Q A;  2JZS A;  3E0U A;  3J7Y b;  5A4V A;  5DQY A;  5BRT A;  4HQZ A;  1QUW A;  3VWU A;  4IJ3 A;  2H66 A;  3UVH A;  1OKT A;  1S3R A;  2OBK A;  1BAY A;  2ZCT A;  1XIY A;  4X43 A;  2WDU A;  4KE3 A;  5GSS A;  2X49 A;  1A2L A;  2A2P A;  5INY A;  1E6B A;  3WD6 A;  2GS3 A;  2CQ9 A;  3RHC A;  4JBB A;  1XWK A;  1M7T A;  4ECC A;  1O73 A;  2DIZ A;  1A8L A;  5J9B A;  4J57 E;  1K0A A;  3LWA A;  1LJR A;  3PPU A;  1OC3 A;  4K7I A;  2AB6 A;  1Y6E A;  1AQV A;  1GUM A;  4WEY A;  2VL2 A;  2REM A;  2E2M A;  1EEM A;  5KN0 A;  1NSW A;  5B8B A;  1O8X A;  4PQH A;  4BWQ A;  2V32 A;  2B7J A;  1J9B A;  2GLR A;  3GKK A;  2YWO A;  3QOU A;  2LJR A;  1XWB A;  3FR6 A;  1XOA A;  1NHY A; 
#chains in the Genus database with same CATH homology
 2K18 A;  4WR4 A;  1S3C A;  3UL3 A;  3F3R A;  4F0B A;  2C0D A;  1TP9 A;  2RII A;  4L0W A;  3Q74 A;  2DJ0 A;  4ZBB A;  2V1M A;  3DGQ A;  2MMZ A;  1KNG A;  1YQ1 A;  2H1B A;  3GH6 A;  1ZYQ B;  5ECI B;  3GKN A;  5AGY A;  1SYX A;  2EIQ A;  4IP1 A;  2C0E A;  2OE1 A;  1GL8 A;  4OD7 A;  2FGX A;  3L0H A;  1T3B A;  4YH2 A;  3F6D A;  4H86 A;  2DC5 A;  2I9H A;  2NBS A;  3Q6O A;  1W89 A;  2CAI A;  2HZE B;  3LYP A;  1R26 A;  3ERF A;  1OC9 A;  2CX4 A;  5ECR B;  3IAM 2;  1PD2 1;  1B8X A;  1E2Y A;  3KEB A;  3A3T A;  3ZIJ A;  4JED A;  3N5O A;  4ZBD A;  2IWT A;  4TN8 A;  2NDO A;  3A5W A;  3MIX A;  3D22 A;  4PUA A;  4HOJ A;  1W4V A;  3IAS 2;  2GZP A;  3A5I A;  2H72 A;  1F3B A;  5D9X A;  4YQM A;  2MYG A;  3EWL A;  2WJU A;  1FB6 A;  3A2V A;  2VCW A;  3GHA A;  2B1K A;  2IMF A;  3FZ9 A;  4XCS A;  2PBJ A;  1XWC A;  1DE2 A;  1TTZ A;  4D73 B;  4YKG A;  2IJY A;  2GTU A;  2ALB A;  4PNF A;  1YEP A;  3LGC A;  3VPT A;  2I1U A;  1NW2 A;  3L78 A;  2MZC A;  4KDY A;  1TOF A;  3K8N A;  4TR1 B;  4MK3 A;  1SU9 A;  1FO5 A;  2C80 A;  5IMF A;  3VWV A;  3EMX A;  4OFN A;  4POM A;  2B6M A;  2JAD A;  1YDK A;  4K1F A;  4AF2 A;  4DEJ A;  2YWN A;  1A8Y A;  1TXX A;  5F8B A;  1EZK A;  4HJ2 A;  4BVY B;  4NV5 A;  5IQY A;  3HD5 A;  4ZL9 A;  3FZA A;  1VF4 A;  3IRA A;  3G9B A;  3P8W A;  4G0L A;  2KP2 A;  2YV7 A;  5G1L A;  4QL9 A;  3F4R A;  3GST A;  5B8A A;  18GS A;  1U3I A;  2WCI A;  1EV9 A;  2C3T A;  2GQK A;  4Q5N A;  1EEJ A;  5IPG A;  1GNW A;  4G0I A;  2PUK C;  4V2L A;  5EL8 A;  3WT2 A;  2C3Q A;  3D4T A;  2Z9S A;  1MDJ A;  3TJB A;  4RQX A;  1U87 A;  5ECQ B;  3L4N A;  1V58 A;  2C4J A;  4PXO A;  1H75 A;  1GTB A;  3GKX A;  1AQW A;  2L57 A;  4ML6 A;  3FR3 A;  3ZZX A;  2H6Y A;  2IMK A;  2X64 A;  17GS A;  3HJP A;  5DCH A;  3IR4 A;  4ZBA A;  2CAQ A;  5JWQ B;  2WFC A;  1KEB A;  3HDC A;  4ECB A;  2MMN A;  1QXH A;  5LD0 A;  2GSS A;  2VCX A;  1ERT A;  4O7H A;  1TRW A;  1RK4 A;  1ZYN A;  2JU5 A;  3O3T A;  3P2A A;  4YQU A;  2WZ9 A;  4G2E A;  4LA1 A;  11GS A;  2JZT A;  5DVB A;  4IQ1 A;  4F0C A;  5KN1 A;  4PNG A;  3VWW A;  5IOX A;  5D93 A;  2L6C A;  4K0G A;  4EKZ A;  4RQR A;  2CA8 A;  5ECS A;  4J56 E;  1XXU A;  3E9J B;  3ME8 A;  3MSZ A;  4KA0 A;  2WGR A;  5JCW A;  4GSN A;  2H74 A;  3LXZ A;  5C04 A;  2K8S A;  1OKD A;  2QA2 A;  1F6M C;  1KTE A;  2FHE A;  2JSZ A;  2ON5 A;  3DWV A;  2CVB A;  1Z6M A;  4DSR A;  5FWG A;  4EC0 A;  1YF1 A;  4Z2T A;  4EO3 A;  2L5L A;  1T8E B;  1FG4 A;  1FHE A;  3HKR A;  2YCD A;  5F07 A;  5B6M A;  1DE1 A;  3GTU B;  1F2E A;  2FY6 A;  4GWR A;  1UC7 A;  2O89 A;  6GST A;  1T00 A;  1NHO A;  1BYE A;  2LEG A;  3ERG A;  2H71 A;  4WXT A;  4XS4 B;  2E7P A;  2IL3 A;  3M3M A;  3F4S A;  4WET A;  5CRE A;  1URM A;  3IDV A;  3HXS A;  5CNW A;  4JE1 A;  2XC2 A;  2R0P A;  2HE3 A;  5HR2 A;  20GS A;  1M2B A;  3ZVJ A;  3QPM A;  2P31 A;  3GUS A;  2PWJ A;  3HA9 A;  2KOK A;  1T7P B;  5G31 A;  1HNB A;  2O7K A;  3I43 A;  3DKS A;  3ZMK A;  1TRV A;  4X1U A;  2FWE A;  1OE8 A;  3FHK A;  3RHB A;  4XS1 A;  13GS A;  1B9X C;  3IK9 A;  1TKD B;  4WF4 A;  2CZ3 A;  3UAP A;  1NM3 A;  3TJF A;  2GT6 A;  2HI7 A;  4FYU A;  2GT5 A;  1TDI A;  4HEA 2;  1QQ2 A;  2DML A;  1VF3 A;  4XRD A;  4NHW A;  3TKP A;  3QR6 A;  3CXG A;  2DKH A;  5GZZ B;  4QL7 A;  2F8A A;  1YEX A;  4GTU A;  2LQO A;  2PPT A;  1IYI A;  4HJM A;  1N2A A;  5HFK A;  2LJA A;  1V9W A;  2GSQ A;  1XOB A;  14GS A;  3O6T A;  2XBQ A;  4I97 A;  4MDC A;  3APO A;  1X9S B;  5AIX A;  1GSU A;  1GSE A;  5FHI A;  5J4U A;  2FWF A;  2HYX A;  1O6J A;  1UVZ A;  3APQ A;  4O5U A;  3LOR A;  1U6T A;  3MWH A;  2HRN A;  3KD0 A;  5JCG A;  1GSQ A;  3EMP A;  4MZB A;  2B1L A;  2GVP A;  1ABA A;  2XBI A;  1MDK A;  3FR9 A;  3G7Y A;  2IN3 A;  4CY8 A;  2PMT A;  1MDI A;  4KAE A;  4TXV A;  1GSD A;  2H70 A;  3LG6 A;  3KGK A;  1Z5Y E;  2C0G A;  3KTB A;  4K8M A;  3W8S A;  3UAR A;  1GWC A;  6GSS A;  3EVI A;  2VAF A;  3GMF A;  3DML A;  1LU4 A;  5G1K A;  2B5E A;  2PVQ A;  3UBL A;  1Z6N A;  1R5P A;  4K7N A;  1A0R P;  2KHP A;  5AN1 A;  3RAZ A;  1PMT A;  2GDR A;  3J7Y k;  4JZQ A;  1PKW A;  1OE7 A;  2VCT A;  4DSS B;  3UEM A;  1U88 A;  3EYT A;  1SEN A;  5G5E A;  4N10 A;  4EE0 A;  1YF0 A;  2WUL A;  4ZB9 A;  1PX6 A;  3VPQ A;  6GSW A;  3VI5 A;  2QA1 A;  1GLQ A;  4MJA A;  4ZIL A;  2I3Y A;  4GRF A;  1GUK A;  2DJ1 A;  2GZY A;  1HNC A;  4BPY A;  2N5B A;  4WBR D;  1Q4J A;  3H8Q A;  1BQ7 A;  3TRQ A;  2V6K A;  5CRD A;  4WR5 A;  4K9Z A;  4LL4 B;  2IME A;  1BJX A;  4IQA A;  3KXO A;  1ERU A;  2VOC A;  4PX1 A;  3UMA A;  1FVK A;  4HU7 A;  2WRT A;  2FNO A;  3D21 A;  3IV4 A;  1YY7 A;  3KM6 A;  1DUG A;  1M9A A;  2DJ3 A;  2XPE A;  3H93 A;  3DXB A;  5D73 A;  4Q5R A;  1Z3E A;  2JZR A;  5DAL B;  4JU5 A;  4X4J A;  2OA7 A;  4ICY A;  4IJI A;  2HFD A;  3VUR A;  2OAD A;  3UBK A;  2FWG A;  5ECK B;  2LKU A;  4HS1 A;  1VF2 A;  1PGT A;  5AIS A;  1OC8 A;  1AUC A;  1PQN A;  4KND A;  2HZF A;  3EUR A;  3VI7 A;  2LTK A;  2YJH A;  2B3S A;  2F51 A;  3FKF A;  2O85 A;  5ID2 B;  4GXZ A;  1GSF A;  5JCU A;  2R2J A;  1M0U A;  2FWH A;  4N0Z A;  1GLP A;  4IS0 A;  3F9U A;  3GYK A;  2DMM A;  1X5D A;  1WPI A;  2V6O A;  4EL1 A;  1X9M B;  6GSX A;  2J23 A;  1R4W A;  1G7E A;  3TOT A;  3P7X A;  3N9J A;  2FLS A;  2PER A;  2YZU A;  3O76 A;  1ML6 A;  5A4W A;  1USB A;  3KMO A;  1MTC A;  4K5S A;  1THO A;  1XPV A;  2FA4 A;  4KCA A;  2VO4 A;  2HZE A;  3TJJ A;  3QCP A;  5D9W A;  2A4V A;  2CZ2 A;  2YWI A;  3CBU A;  1I9D A;  4G9H A;  4N30 A;  1O81 A;  3PH9 A;  2QKE A;  2NVL A;  5E59 A;  3C7M A;  1HNA A;  4I2U A;  4TXO B;  4OFT A;  1T4Y A;  4ECI A;  3CSJ A;  3I6A A;  3V1W A;  2H73 A;  3ISO A;  4IGJ A;  4YAV A;  1JZO A;  3F8U A;  1ZYP A;  5EVO A;  4D73 A;  1GUL A;  1XVQ A;  1GH2 A;  4K2X A;  1YKA A;  4EF0 A;  1Q98 A;  3F63 A;  4XTS A;  1TU7 A;  3LJR A;  5F0G A;  1ZL9 A;  2IFQ B;  2DJK A;  4ZB6 A;  4FH8 A;  4Q5Q A;  1BX9 A;  4TR1 A;  1DSB A;  4WBJ A;  2VLU A;  5GAP D;  7GSS A;  2LRN A;  1SJ6 A;  4F82 A;  4MZW A;  2DBC A;  1YKC A;  3MDK A;  1F37 A;  4USS A;  1PRX A;  1K3L A;  3AY8 A;  4BVY A;  1SKS B;  1ON4 A;  3TDG A;  2GST A;  4ILF A;  4LL1 B;  1WWJ A;  1XWG A;  1EOG A;  10GS A;  2HRK A;  2B5Y A;  4MF6 A;  4HZ4 A;  1K0N A;  3WYW A;  3IHG A;  2RM5 A;  3ZIT A;  5J41 A;  2LRC A;  2ZNM A;  2PVO C;  1Y25 A;  3CRU A;  4Z7X A;  2N5F A;  3QFA C;  1HD2 A;  5LNK e;  3IE3 A;  4XIH A;  2H0H A;  2KUC A;  4AJ6 A;  5F05 A;  1AXD A;  1PN9 A;  1ZOF A;  2HSH A;  1X5C A;  2C8U A;  1EGR A;  1V57 A;  4E8E A;  2OAC A;  2YP6 A;  4FIW A;  1EP7 A;  3L9S A;  5LCZ A;  2MBS A;  3P90 A;  1AIU A;  4MJB A;  2CT6 A;  3ERW A;  3GKM A;  3WT1 A;  1EWX A;  3R2Q A;  3F6F A;  4IHU A;  5DBQ A;  1GP1 A;  2MMO A;  3APS A;  3HCZ A;  2UZ8 A;  2A2R A;  4TKY A;  4F2I A;  4IP6 A;  3CSI A;  4OO4 A;  3I9V 2;  4POK A;  3QMX A;  4ML1 A;  3TRX A;  3PR8 A;  3HYP A;  5ECH B;  2TIR A;  3FMW A;  3DIE A;  1B4Q A;  2H1D A;  2AYT A;  4O5Q A;  3TKS E;  1V98 A;  2VLT A;  2XPD A;  4NHZ A;  5G2Z A;  4GLT A;  4FYC A;  2R3X A;  1X5E A;  2EIO A;  4MP4 A;  1K0B A;  3TKQ A;  3GN3 A;  3HJO A;  2IMD A;  1WIK A;  3GX0 A;  2YJ7 A;  3GTU A;  3IBH A;  2OE0 A;  1ST9 A;  2M46 A;  5IM9 A;  1RW1 A;  4MJC A;  2AUV A;  5KOX A;  3RPP A;  4N0V A;  3ZRD A;  1JHB A;  2QSI A;  5ECO B;  2FCH A;  2OJL A;  3KIJ A;  3ZFL A;  3ZVJ D;  5JWR B;  2TRX A;  1FOV A;  1M2D A;  5IIZ A;  4XS4 A;  3GSS A;  1XFL A;  3MYD A;  1SJZ A;  5KEJ A;  1XW6 A;  1HYU A;  5ELA A;  3GFK A;  4WKW A;  1H4O A;  4XRA A;  3UOM A;  3ZFB A;  4F9Z A;  2HT9 A;  4Q5F A;  2LRT A;  4ZL7 A;  2QC7 A;  1EP8 A;  1BG5 A;  2H76 A;  3R3E A;  22GS A;  2K8V A;  5IO0 A;  2R6K A;  2HXK A;  4J2F A;  3CRT A;  4GSS A;  2GQL A;  3KH7 A;  2LUS A;  4ISD A;  1XCC A;  2C1Y A;  1B48 A;  1WMJ A;  5A5K A;  5CRG A;  3QD9 A;  4HU9 A;  2VCV A;  4X0X A;  1CQG A;  2O87 A;  4Z2U A;  3JCM L;  1GSS A;  4N11 A;  4V2N A;  1FAA A;  1B4P A;  2LNT A;  2RUE A;  1AC1 A;  3MNG A;  4TVE A;  2CV4 A;  3CMI A;  4PTS A;  4PQI A;  5DQS A;  5HQP A;  4O92 A;  2AAW A;  4BL7 B;  16GS A;  3HY2 A;  4EVM A;  4G0K A;  1S3D A;  4L5O A;  2DJ2 A;  4NXI A;  2CVK A;  1EOH A;  4TOP A;  2WB9 A;  1AQX A;  2DJJ A;  4ULX A;  1SKW B;  4MJE A;  4ZB8 A;  2EIR A;  2YPM A;  1SL1 B;  1Z7R A;  2KP1 A;  2C0F A;  2HRF A;  5D9V A;  3U6V A;  3KJY A;  5IMV A;  2X4A A;  3BBY A;  3ZTL A;  3HJM A;  4YQV A;  2H30 A;  1Z9H A;  1PX7 A;  2B7K A;  3FK8 A;  4BVX B;  3NIV A;  3UIW A;  4ID0 A;  4OFM A;  1V40 A;  1MEK A;  4FYB A;  2AV4 A;  2LS5 A;  3KMN A;  4P3Y B;  3ED3 A;  2O8V B;  3GA4 A;  2P5R A;  4DVC A;  3TCO A;  2MBT A;  1K3Y A;  4K5R A;  4KF9 A;  1T4Z A;  1BED A;  2R0G A;  3EPT A;  4DSS A;  5KOW A;  2AHE A;  3GUR A;  1PA3 A;  3RPN A;  1O85 A;  2NTO A;  1THX A;  3W8J A;  2H01 A;  1VF1 A;  1SKR B;  1A2J A;  2JL4 A;  4LMW A;  4TRX A;  2GQM A;  3KZQ A;  5DJL A;  4OWY A;  2BJX A;  3F0I A;  5J3R A;  1GTI A;  1XW9 A;  3EE2 A;  5H5Q A;  4POB A;  1UA5 A;  5DAK B;  1A23 A;  4I6X A;  5AIV A;  3IOS A;  3ZYW A;  5H5R A;  2L4C A;  2FA8 A;  1JZD A;  4EDY A;  2IPA A;  1M2A A;  1PL2 A;  1ERW A;  2EC4 A;  2X8C A;  5CRH A;  4I8B A;  2VCQ A;  5CO3 A;  3FW2 A;  5BMU A;  2BTO T;  3CTG A;  4GQF A;  4KW6 A;  2TRC P;  1SD8 A;  4V2M A;  4ZIJ A;  1GNE A;  4RUV A;  4PGT A;  5DAL A;  5ECL B;  4EIP A;  3SBC A;  2H6Z A;  2LST A;  3QAW A;  4A5P A;  2VD1 A;  2H6X A;  4IEL A;  3C73 A;  2VL9 A;  1TRU A;  4JRR A;  4L8E A;  1YZX A;  2ZUP A;  4EDZ A;  2ON7 A;  3LSZ A;  1G0T A;  1OVN A;  2QGV A;  3TRP A;  5ELG A;  1TK0 B;  4HUA A;  4TR3 A;  3SWL A;  4WF5 A;  3TJK A;  2P5Q A;  2PN8 A;  4EUY A;  5E4W A;  2OE3 A;  1QK8 A;  5ID2 A;  5GST A;  1Z7P A;  3L9V A;  2D2Z A;  1K0D A;  3TKS C;  3DD3 A;  4K6X A;  1MD3 A;  1TK5 B;  1G6W A;  2R4V A;  5HR1 A;  19GS A;  5IOW A;  1TRS A;  1FW1 A;  1K0M A;  3ZLP A;  1TU8 A;  3A2X A;  1UN2 A;  5H5S A;  5IMZ A;  3GV1 A;  1SL2 B;  3KP8 A;  1FVJ A;  1LBK A;  4XHM A;  3RBT A;  1G6Y A;  2M80 A;  3TOU A;  5ECM B;  3WGX A;  2V2G A;  1S3A A;  2LV3 A;  4V1A p;  4MCU A;  2LNS A;  9GSS A;  3LXT A;  3VK9 A;  1U3A A;  4AJ8 A;  2G2Q A;  2CVD A;  5KN3 A;  1XBS A;  5A4U A;  2A4H A;  4IW9 A;  4KSM A;  5F06 A;  5JWO B;  3DYR A;  1GUH A;  1MD4 A;  4ZXG A;  3ZL5 A;  4TXO A;  3BCK A;  2F9S A;  4NV2 A;  4NWY A;  4I5Q A;  4PUR A;  3TJG A;  4LMV A;  2I4A A;  5CRW A;  5FT3 A;  1M9B A;  1B9Y C;  1M99 A;  2VM2 A;  1SK2 A;  4MH2 A;  2H0I A;  1I5G A;  3GL5 A;  2FD3 A;  4XS6 A;  1EV4 A;  4KCE A;  1DBY A;  1A2M A;  1OC9 B;  4RI7 A;  2IFQ A;  4AJ7 A;  1K0C A;  4DSQ A;  1K3O A;  4K7O A;  3D6I A;  2H75 A;  2V41 A;  4MZC A;  4F03 A;  1PSQ A;  2J9H A;  3S9F A;  3HZ4 A;  3NOF A;  1O8W A;  4L0U A;  4NMU A;  2H19 A;  6GSV A;  3LFL A;  5J5N A;  3FZ5 A;  5G5F A;  3H79 A;  3TGZ A;  3VLN A;  2E2G A;  1XZO A;  2M72 A;  3LEF A;  4GF0 A;  3Q18 A;  2YZH A;  3QFB C;  2MMA A;  1ZZY A;  3IA1 A;  3IXR A;  4BA7 A;  3EU3 A;  1IYH A;  2N5A A;  1RQM A;  1JZR A;  4EXJ A;  2G0F A;  2PU9 C;  5IO2 A;  2F3M A;  3MAK A;  3DVW A;  4TW5 A;  5IMD A;  4KB3 A;  2LJK A;  4NPB A;  2CX3 A;  4KDU A;  5EY6 A;  1SL0 B;  4IN0 A;  2LQQ A;  5IMA A;  2YOI A;  3HVX A;  3M1G A;  5B7C A;  4YKF A;  2A2S A;  3GNJ A;  2K9F A;  1A0F A;  4MPG A;  2VL2 C;  5D8I A;  3EC3 A;  1JLW A;  1SYR A;  4MH3 A;  3D5J A;  4Z2R A;  1QMV A;  3WGD A;  5DDL A;  2PGT A;  1VGL A;  2GSR A;  4GQC A;  4YAP A;  1YJ6 A;  2F8F A;  2NPB A;  3PIN A;  2HSM A;  1SJI A;  3EIN A;  2I81 A;  1ZGN A;  1G7O A;  2XHF A;  3ZRE A;  2IMI A;  1A24 A;  2ES7 A;  2VCZ A;  1WE0 A;  2H8L A;  3FY7 A;  5ECP B;  1JZW A;  3H4K A;  2KLX A;  2WS2 A;  4JR4 A;  2OKA A;  4E8H A;  4OCF A;  2YV9 A;  3KH9 A;  3HHV A;  5KN2 A;  2P0G A;  2R37 A;  1N8J A;  4I2T A;  1XW5 A;  6GSY A;  5J9C A;  2K6V A;  5IMC A;  1JLV A;  3U5R E;  1SK1 A;  4ZL8 A;  1X9W B;  4QQ7 A;  2YNX A;  4O32 A;  2H0G A;  3E3E A;  8GSS A;  3IHQ A;  3C8E A;  4TR0 A;  5ECN B;  4KSO A;  4BWS A;  4KDX A;  4ECJ A;  3DEX A;  1J0F A;  1TK8 B;  4HZ2 A;  5L71 A;  2RLI A;  5ENU A;  3FEU A;  4NAX A;  1R7H A;  1C72 A;  1T1V A;  2L59 A;  3KCM A;  4IVF A;  4MPF A;  4MAB A;  4MLY A;  3US3 A;  3GX8 A;  4KGI A;  3M8N A;  6GSU A;  4POL A;  5D9T A;  5HR3 A;  3NZN A;  3TUE A;  3C71 A;  3QAV A;  3CSH A;  1TJD A;  1OAZ A;  1WRY A;  1WOU A;  1XWA A;  3DVX A;  5GAN D;  1GSY A;  3CYN A;  3M9K A;  3UVT A;  2H1A A;  5CYY A;  2VUP A;  3RDW A;  1ILO A;  3ME7 A;  1PN0 A;  3F4T A;  1XVW A;  4RI6 A;  2AJQ B;  3QDN A;  2HSY A;  4IKH A;  1R5A A;  3C1S A;  3VWX A;  2YAN A;  3FRC A;  2H1G A;  3KTL A;  3QAG A;  5HFG A;  5COH A;  3C1R A;  2YWM A;  4EIQ A;  4PUF C;  4HQS A;  4L5L A;  3FZ4 A;  4FO5 A;  3TB2 A;  1QFN A;  3ZML A;  2DLX A;  1O7U A;  3M0F A;  3LW9 A;  4K0N A;  3A2W A;  4CW9 A;  5HFI A;  4CY6 A;  4BL7 A;  1SD9 A;  2GZZ A;  2BMX A;  1WJK A;  4MMM A;  2DKI A;  3GIX A;  1WP0 A;  4O5R A;  4ACS A;  4KX4 A;  2JSY A;  2VIM A;  1CQH A;  2VM1 A;  1PKZ A;  3D0Z A;  3Q19 A;  4OCE A;  3IC8 A;  1TI1 A;  3TKS A;  4GST A;  3DRN A;  3ZIV A;  4OMV A;  3IK7 A;  4V1A g;  2C3N A;  2YN1 A;  3EU4 A;  2R5G A;  2X8H A;  1ZMA A;  3PGT A;  3BJ5 A;  1JFU A;  4BVX A;  1J08 A;  5IPH A;  1AAZ A;  3VFI A;  5HR0 A;  2RM6 A;  3IPZ A;  1V2A A;  1F9M A;  4G10 A;  3IC4 A;  2JAC A;  1KBN A;  3GH9 A;  4KUN A;  4OO5 A;  3OR5 A;  2DSA A;  5C00 A;  1VRS D;  5EPF A;  1GRX A;  2VD0 A;  2B5X A;  2HLS A;  5D96 A;  2DIY A;  1K0O A;  2X8G A;  4G19 A;  5B6N A;  2HNL A;  3FYG A;  3L9U A;  5G30 A;  4MA9 A;  1EGO A;  2VLV A;  2L6D A;  2GGT A;  4KH7 A;  2L5O A;  1HQO A;  3BD2 A;  5CAX A;  1GTA A;  3M9J A;  3BOA A;  1X0R A;  3CTF A;  3LYK A;  1PL1 A;  1ACV A;  3HVV A;  1ZYE A;  3G7J A;  1FB0 A;  3I69 A;  4JR6 A;  1OYJ A;  3W6G A;  3UJ1 A;  3HVS A;  4HDE A;  1SK0 A;  2RUF A;  5DCG A;  4LLR A;  4IBP A;  5DAK A;  4MNN A;  4CDO A;  2OBI A;  1GTU A;  3GL3 A;  1AW9 A;  2FUG 2;  1ERV A;  12GS A;  2VL3 A;  4AGS A;  3WGE A;  2L4Q A;  2X99 A;  3H1N A;  2HRA A;  3HZ8 A;  3G7I A;  5ABR A;  3KP9 A;  2R0C A;  4HI7 A;  4FQU A;  1ZCP A;  1TW9 A;  3F3Q A;  4PQ1 A;  3LQ7 A;  4K2D A;  4MF5 A;  4TR4 A;  3GRX A;  2IIY A;  1F3A A;  4MF7 A;  1FOH A;  1TI3 A;  4GCI A;  3D4M A;  5DJM A;  1QGV A;  5CP1 A;  3BCI A;  3TKR A;  4CHS A;  2E0Q A;  2JZS A;  3E0U A;  3J7Y b;  5A4V A;  5DQY A;  5BRT A;  4HQZ A;  1QUW A;  3VWU A;  4IJ3 A;  2H66 A;  3UVH A;  1OKT A;  2OBK A;  2ZCT A;  1BAY A;  1XIY A;  4X43 A;  2WDU A;  4KE3 A;  5GSS A;  2X49 A;  1A2L A;  2A2P A;  5INY A;  1E6B A;  3WD6 A;  2GS3 A;  2CQ9 A;  3RHC A;  4JBB A;  1XWK A;  1M7T A;  4ECC A;  1O73 A;  2DIZ A;  1A8L A;  5J9B A;  4J57 E;  1K0A A;  3LWA A;  1LJR A;  3PPU A;  1OC3 A;  4K7I A;  2AB6 A;  1Y6E A;  1AQV A;  1GUM A;  4WEY A;  2VL2 A;  2REM A;  2E2M A;  1EEM A;  5KN0 A;  1NSW A;  5B8B A;  1O8X A;  4PQH A;  4BWQ A;  2V32 A;  2B7J A;  1J9B A;  2GLR A;  3GKK A;  2YWO A;  3QOU A;  2LJR A;  1XWB A;  3FR6 A;  1XOA A;  1NHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...