1Z7PA

Solution structure of reduced glutaredoxin c1 from populus tremula x tremuloides
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
117
structure length
117
Chain Sequence
b'MASKQELDAALKKAKELASSAPVVVFSKTYCGYCNRVKQLLTQVGASYKVVELDELSDGSQLQSALAHWTGRGTVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQDAAATAKNPAQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glutaredoxin
publication title Structural Insight into Poplar Glutaredoxin C1 with a Bridging Iron-Sulfur Cluster at the Active Site
pubmed doi rcsb
source organism Populus tremula x populus tremuloides
molecule tags Electron transport
total genus 41
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2005-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1z7pA00
2LJKA 3FEUA 1E6BA 3W8JA 2DMMA 2FA4A 1WE0A 3FR6A 3F6DA 2FUG2 1T4ZA 3TJBA 3EU3A 4KCEA 2VOCA 2XPEA 3GMFA 2VCQA 2C3TA 2YPMA 4KAEA 3L9UA 3EURA 2V6KA 3KXOA 3FZ4A 4OFTA 3D21A 3DXBA 3TJGA 3HXSA 4IBPA 3FHKA 1ZL9A 3EWLA 2WULA 4LLRA 3IA1A 2H1DA 5IMDA 5ECPB 1TRSA 1ZGNA 1R5PA 3LYKA 2F8AA 3QR6A 3FW2A 1AXDA 5D9WA 2L6CA 2IIYA 3KGKA 3DVXA 3ERFA 3RBTA 4ECIA 2LNTA 3P7XA 2YWNA 5HR1A 4PNGA 4ZB8A 4MZCA 2IPAA 1K0DA 2TRCP 4JBBA 1BX9A 4WEYA 5GSTA 4IJ3A 4K9ZA 4G2EA 4MH2A 2RM5A 4HZ4A 3F9UA 3KTLA 5G30A 5C04A 3GX8A 5JWRB 2AJQB 13GSA 2FWHA 1K0OA 4O5RA 1F6MC 4EF0A 2YP6A 2H01A 2B6MA 1KBNA 2H30A 2AV4A 5D96A 3FR3A 3UAPA 1QQ2A 2FLSA 5J9BA 3NOFA 2C3QA 2GVPA 3TOUA 2GSRA 1A2MA 3FYGA 1FOVA 2VCTA 1G0TA 2O85A 4E8EA 2F8FA 2FY6A 2WB9A 5DALB 4HJMA 4MCUA 3HHVA 3VPTA 4HEA2 1FHEA 1WOUA 1JZRA 4MABA 2HFDA 5EL8A 2RLIA 1XWAA 1GTIA 1ERWA 4I2UA 2R37A 1TRUA 4RI7A 4CW9A 3H8QA 1PSQA 3LWAA 3DD3A 4HI7A 3BD2A 1TI3A 3PR8A 4ML1A 5IPHA 3VURA 2O8VB 5KEJA 2YOIA 1R26A 2DJ3A 4IGJA 4V2LA 5LCZA 2C0DA 2H0HA 3GL5A 4KSMA 4MF6A 2VUPA 1SYRA 1GH2A 3CYNA 3ZL5A 3ME7A 3HVVA 1M0UA 5JCGA 1YKCA 1SKSB 1XPVA 4X43A 3TJJA 4FIWA 5ECNB 3ZFLA 2LRNA 2IFQB 2DSAA 4POLA 2E0QA 3QAGA 1QFNA 1ABAA 3HVSA 1M9AA 2CT6A 1ML6A 4V2NA 4TR1A 1MEKA 2WRTA 5CYYA 2GGTA 11GSA 2PPTA 3G9BA 1XW9A 3LSZA 1GTBA 1TI1A 20GSA 4GTUA 2MMOA 5D9XA 1VF1A 3VFIA 1YEXA 2LNSA 2E2MA 2IMEA 2HT9A 3FZAA 2HE3A 3TUEA 4D73A 3CTGA 2HZEA 3LXZA 5B6NA 1EWXA 4L5LA 3IRAA 2H73A 4Q5FA 3CXGA 1NW2A 3L0HA 2RIIA 1Z6NA 1TU8A 2OE3A 2GDRA 6GSTA 3QOUA 2V2GA 4IKHA 1VF3A 3FR9A 2H0IA 1XWGA 4BVYA 1WRYA 3V1WA 3GNJA 2PMTA 2GQLA 4BWSA 3VK9A 4BVXA 5D8IA 2PN8A 4G19A 3U5RE 3R2QA 2V1MA 5B8BA 1PGTA 3MNGA 2GT6A 4GCIA 5G1LA 1HNAA 1TXXA 2MBTA 2JU5A 2CV4A 3PH9A 6GSVA 2VCXA 4V1Ap 4YAVA 3D6IA 3L9SA 3GURA 4WKWA 3LXTA 3VI7A 1MD3A 5ECOB 1U3AA 5KN3A 1AQVA 3PINA 2IJYA 1PKZA 4GQFA 2H6ZA 1X9WB 4Z7XA 5IPGA 3TCOA 2K18A 2N5FA 4FYUA 4MZWA 1ZOFA 5ECKB 5G5FA 3LEFA 3GKKA 2XHFA 1SD8A 4ECBA 2GS3A 1F3BA 4XRAA 2YV7A 3CMIA 4KNDA 5A5KA 1SJ6A 2DLXA 3A5WA 5COHA 3A2VA 4PNFA 1AQWA 1FVJA 4QL7A 1X9SB 3Q6OA 1K0MA 5JCUA 3HVXA 2K9FA 6GSXA 4JR4A 1TW9A 6GSUA 3F4RA 1YDKA 4J57E 5J41A 5IO0A 2B1LA 4DSSB 4LA1A 2WGRA 1GSFA 2K6VA 4TXVA 2DBCA 5IOWA 4JRRA 6GSYA 2JSZA 17GSA 5AN1A 3GN3A 1JZWA 3BCKA 1WMJA 1TP9A 2V32A 3VPQA 1AUCA 4K6XA 3ERGA 2HRNA 2N5BA 1OC9B 3LGCA 2MMAA 2C80A 2OBIA 2H0GA 2XC2A 2E7PA 4MJEA 4K0GA 1OYJA 4PQHA 7GSSA 1GSSA 2B3SA 3O76A 1RK4A 2X99A 1GNEA 1Z7PA 4O92A 4TR3A 1NSWA 3FZ9A 4KA0A 1A23A 6GSSA 1WWJA 1T3BA 2H74A 3HD5A 5AIVA 3LJRA 2Z9SA 5E59A 3SWLA 4NXIA 4EDYA 2EIOA 3LORA 4KDYA 3UOMA 1K3OA 2F9SA 2G2QA 1H4OA 4ZILA 2L4CA 1G7EA 3G7JA 1I5GA 3HZ8A 2OKAA 2NPBA 4TVEA 2YV9A 2L5LA 5FT3A 5A4VA 4N11A 4NV2A 5G31A 3W8SA 5JWOB 1M2DA 1V58A 2H75A 1VGLA 1TTZA 3UMAA 3HKRA 3IXRA 3ME8A 5E4WA 2J23A 1UC7A 2GZYA 3MWHA 3GH9A 4HQZA 4TXOB 3N9JA 3KP9A 1XVWA 2CQ9A 2DMLA 3QAVA 5EPFA 4GSTA 2VLVA 3D0ZA 3F4TA 3TOTA 3ZMLA 2VM2A 3MDKA 4ZXGA 2IMKA 1GSEA 2XBQA 3APOA 3HJMA 2C0EA 3CRTA 2OBKA 2YZHA 1LU4A 3VWUA 1QMVA 1XWKA 3ZVJA 1TDIA 3ZVJD 3FY7A 3P2AA 1A8LA 1JLWA 4WF4A 4I6XA 4N0ZA 3APQA 4K2DA 1DE2A 4YQUA 22GSA 1XCCA 3TKSE 2AUVA 3NZNA 3DIEA 2QC7A 3MSZA 2YWOA 3GSTA 1ZCPA 3ZREA 5INYA 3M0FA 3CSJA 5DCHA 2C1YA 4TR4A 5ECRB 5ECQB 1YF0A 1FG4A 2M72A 1F2EA 1Y25A 5ID2A 2YCDA 3BJ5A 3M9KA 1TU7A 5DAKB 2AAWA 3J7Yb 2DJJA 1ERTA 5IOXA 3IDVA 3P8WA 1M99A 3U6VA 2WZ9A 1R5AA 1R7HA 2OADA 2JADA 3GL3A 3OR5A 2CX3A 4TRXA 2P5QA 3RPNA 1V98A 2IN3A 4MJAA 2F3MA 4HU7A 2DIYA 4TKYA 4KDUA 4POBA 4ID0A 4JEDA 1V57A 1R4WA 4AGSA 1EGRA 5KN0A 1MTCA 2HZFA 1ZMAA 2JL4A 3L9VA 2WCIA 5ELGA 4KUNA 5CO3A 2LEGA 4TOPA 3TKQA 3L78A 2VD0A 4FO5A 3K8NA 4NAXA 3IPZA 2PU9C 1V2AA 4XS4A 3UL3A 4GSNA 2FHEA 3CTFA 4V2MA 1GL8A 1AIUA 2DJ1A 3KP8A 2CAQA 1BEDA 1M9BA 1Z9HA 3H1NA 1MDJA 2C3NA 3GTUB 2YANA 3KTBA 3KM6A 1SL1B 3IC4A 2B1KA 2X8HA 4QL9A 2H1AA 4KB3A 2ES7A 3D22A 4XHMA 2FWFA 5ELAA 1AC1A 2VO4A 5DDLA 3ZRDA 1UA5A 1MDIA 4HDEA 4KE3A 1T8EB 1F9MA 1Q4JA 2QSIA 4HOJA 2EIRA 2QKEA 1Z7RA 5HFGA 3ZYWA 3UARA 2I1UA 2WDUA 1QUWA 3A2WA 1GRXA 4ZL7A 3VI5A 4Q5RA 1LBKA 4YAPA 1XW5A 5IMCA 2QGVA 2OE0A 5IIZA 2P5RA 3HJPA 1X0RA 1EEMA 4EC0A 2HSHA 1F37A 4AF2A 2R5GA 2O87A 4DVCA 4JE1A 4CHSA 4WXTA 2C4JA 3D5JA 2HYXA 2LJAA 3KEBA 4KDXA 1SKRB 4BL7A 3KH9A 1THXA 2V6OA 3DRNA 3DMLA 1FO5A 3DYRA 4MPFA 2VL9A 1TRWA 3APSA 1B4PA 1TOFA 1TKDB 2LUSA 1HNCA 5EVOA 2JZTA 3UBLA 1THOA 1S3DA 2B5EA 4WBJA 1SKWB 1SD9A 4ML6A 16GSA 4OFMA 4LL1B 2DJ2A 5IMVA 1M2BA 5AISA 3LQ7A 2GQMA 4ZB9A 1JLVA 5FWGA 5D73A 1JZDA 4JR6A 1X5EA 3ISOA 4EO3A 1URMA 5J3RA 3DEXA 3WGXA 1GUKA 4EDZA 2H1BA 3WGEA 3EC3A 1WIKA 2CA8A 2LQQA 3JCML 1G6YA 4EE0A 1ERUA 1FB6A 4FYBA 2KP2A 3WYWA 2A2SA 1DE1A 2KUCA 1NHYA 3N5OA 1ZYQB 3IOSA 4KX4A 5CAXA 3GSSA 5ECHB 2H70A 4F9ZA 5HFKA 1OE7A 1PL2A 1MDKA 3ZTLA 4H86A 2EIQA 5F07A 3TKSC 2H76A 3F0IA 2VL2A 4K7OA 3Q19A 3UEMA 3F4SA 3BOAA 4I5QA 5HQPA 3LYPA 4ZBAA 4J2FA 1EP8A 4GWRA 1O8WA 1Z6MA 4ZBBA 3QFBC 5L71A 2H66A 4DEJA 3ZIVA 1K0AA 4K7IA 4POMA 1CQHA 2PGTA 4IJIA 4F03A 2KLXA 5EY6A 3GFKA 1T00A 1Y6EA 3NIVA 4MJCA 4YQMA 1V40A 4EUYA 5IMFA 3EVIA 1J9BA 2MZCA 4JU5A 3HJOA 1U88A 1SK2A 1SK1A 2B7KA 2RUFA 4FH8A 1XFLA 3F3QA 9GSSA 3H4KA 2O89A 2LS5A 1ON4A 1WJKA 1ZZYA 2JZSA 4I8BA 4GQCA 1G6WA 2CZ3A 3TKSA 1XW6A 4TR1B 5A4WA 1VF4A 4WETA 1MD4A 1JZOA 4GLTA 2LJRA 1A2JA 1X9MB 3F8UA 1FW1A 4JZQA 3VWXA 1VRSD 1V9WA 4IELA 4BPYA 4WR4A 2ALBA 4IS0A 4PUFC 5GSSA 1GLQA 4D73B 14GSA 3Q18A 2HZEB 1T7PB 1OKTA 3AY8A 3EU4A 3IBHA 3KZQA 5F0GA 4NHWA 4XS6A 4HZ2A 5H5RA 5G1KA 5CRDA 2VCZA 4NPBA 1SL0B 5ENUA 5JWQB 2VM1A 4IQ1A 5IQYA 5HR0A 4X1UA 3HCZA 2DC5A 2DIZA 3C71A 5DQSA 2LKUA 4YH2A 1B8XA 1HNBA 5CP1A 1AAZA 3US3A 4EL1A 3IAS2 1OKDA 2H6YA 2M80A 8GSSA 1AQXA 1S3AA 2KP1A 1U87A 3QMXA 3ERWA 1K3LA 3CSIA 2L6DA 5IO2A 2IMFA 2NTOA 5D9TA 3M3MA 1Z5YE 1LJRA 3H79A 1QGVA 1IYHA 1GSDA 3UIWA 2X8CA 2YJ7A 2ZNMA 3VWVA 4AJ8A 3GHAA 4MLYA 2DJ0A 3KD0A 5CRGA 2C0FA 4MDCA 5DALA 4ZL8A 1GTAA 2PVQA 3ZMKA 4K7NA 2HRFA 4G9HA 4KSOA 1K3YA 2MBSA 1PRXA 2H6XA 3EINA 2L5OA 4TW5A 1TK0B 2JACA 5H5SA 5A4UA 2FD3A 2CAIA 1O81A 4HQSA 4QQ7A 3FKFA 4MH3A 3HY2A 1BYEA 2GTUA 3M1GA 2F51A 2O7KA 1GP1A 3L4NA 5ECLB 3E3EA 2WFCA 3LFLA 4HS1A 3W6GA 4GSSA 1B48A 3EE2A 3KIJA 3ZIJA 10GSA 1GWCA 2X8GA 2AB6A 4ECCA 3GYKA 5DJMA 2BTOT 3QPMA 5D93A 2G0FA 2REMA 2N5AA 2PWJA 3LG6A 1PL1A 4PUAA 1PQNA 4IW9A 5F05A 2IFQA 3TRPA 4AJ6A 5IMAA 1WP0A 4F2IA 3CBUA 2AYTA 3H93A 2A4VA 1M7TA 4KGIA 3IV4A 2GQKA 5B7CA 2OA7A 3TJKA 3ZFBA 5ABRA 1SJZA 1H75A 4ZB6A 3A2XA 2ON7A 3IK7A 4XS1A 1GSUA 4CDOA 1G7OA 1O6JA 2X64A 1N2AA 1A2LA 4Q5QA 4FYCA 1K0NA 2H71A 4BWQA 3G7IA 2IL3A 3VLNA 3TKRA 4WF5A 3FK8A 2L57A 4RQRA 3HYPA 4I2TA 1EEJA 5DBQA 4ZBDA 1AW9A 2E2GA 1E2YA 3TDGA 2PERA 1FAAA 4L5OA 2GSTA 4IP6A 2HLSA 1RW1A 4XCSA 2KHPA 4OWYA 1BJXA 2B7JA 5GZZB 1RQMA 2RUEA 3Q74A 1A8YA 1HQOA 4DSRA 2TRXA 3C73A 3BCIA 4ULXA 1WPIA 2R4VA 4KCAA 19GSA 4ZL9A 3E9JB 4LL4B 2FCHA 2LQOA 1OE8A 2R2JA 5FHIA 2YWIA 2MMNA 1PX6A 3D4MA 5KN1A 3VWWA 2YNXA 4IVFA 2I3YA 2VCWA 3DWVA 5HFIA 2VLUA 4O7HA 3RDWA 1NHOA 3KJYA 2WS2A 3MAKA 1GTUA 1K0BA 2VL3A 5J4UA 1EZKA 1TRVA 3WT2A 3DKSA 4XIHA 4PQIA 5DCGA 2CVBA 2GLRA 2I9HA 1USBA 1A0FA 2FGXA 2RM6A 3KMOA 2XPDA 4AJ7A 1XOAA 3DGQA 18GSA 4XRDA 1DSBA 3ZLPA 2CVDA 2EC4A 2HSYA 2ZCTA 4RI6A 3WD6A 4OD7A 4YQVA 1EOHA 2TIRA 1O73A 3TKPA 1KTEA 4RUVA 1CQGA 3HZ4A 2I4AA 5DVBA 1PKWA 1N8JA 3QFAC 4F0BA 1BQ7A 1PD21 3C7MA 4TN8A 1QXHA 2H8LA 5AGYA 2GZZA 1DBYA 1ERVA 1GNWA 2FWEA 1W4VA 2LSTA 4HUAA 3QD9A 1J0FA 4BA7A 3C1SA 1C72A 5DJLA 4RQXA 1PX7A 4N0VA 2OJLA 2OACA 4OO4A 1NM3A 4OFNA 1ST9A 2R6KA 3F6FA 2DJKA 4WBRD 1EV4A 3BBYA 2OE1A 4OMVA 1XIYA 2HI7A 1U3IA 2VAFA 3GX0A 4NV5A 4IHUA 2NBSA 1VF2A 5ID2B 2M46A 4X0XA 4GXZA 1EP7A 2H72A 4DSSA 5HR3A 3RPPA 3IHQA 3D4TA 5AIXA 2I81A 3I6AA 2VL2C 4MK3A 4EKZA 2P31A 2LV3A 5IMZA 2L4QA 2FWGA 1T1VA 1B4QA 1GSYA 3TRQA 3TJFA 3GKNA 5LNKe 2B5YA 3O3TA 4E8HA 2GSSA 1KEBA 2MYGA 3G7YA 1OC9A 1UN2A 4N10A 3IR4A 2MMZA 1ZYEA 2K8VA 3GUSA 1JFUA 4NWYA 1GLPA 5JCWA 1EGOA 4PX1A 2VIMA 3ED3A 4XS4B 4ZIJA 1YKAA 5CRWA 4Q5NA 3RAZA 2VLTA 1EV9A 1TK5B 2C0GA 4POKA 1TK8B 4ILFA 3EMPA 2KOKA 1F3AA 3P90A 3KMNA 1QK8A 1YJ6A 2C8UA 3FZ5A 3GKMA 3PGTA 3ZZXA 1X5CA 4L0UA 1SYXA 3KCMA 3GIXA 2BMXA 4G10A 1GUHA 1GULA 3M9JA 3UBKA 2YWMA 1BG5A 3GA4A 4HU9A 1FB0A 2AHEA 1HD2A 5ECSA 1SK0A 2FA8A 1Q98A 4N30A 3CRUA 1OC3A 1W89A 3DVWA 1XBSA 2A2RA 2B5XA 2IWTA 1ACVA 4MZBA 1O7UA 1M2AA 2H19A 4F0CA 5KN2A 4V1Ag 5ECMB 1O8XA 4TXOA 2IMIA 4PXOA 1A24A 3F63A 4PGTA 2VD1A 5CRHA 1KNGA 1B9XC 2BJXA 3GRXA 3I9V2 4K0NA 1XOBA 5H5QA 3O6TA 2PVOC 5B6MA 1SL2B 2PBJA 1I9DA 1JHBA 1BAYA 3EYTA 4IQAA 3I43A 5DQYA 2R3XA 2IMDA 1GSQA 4XTSA 3S9FA 2YJHA 1ILOA 1X5DA 4O32A 1IYIA 4MF7A 2PUKC 2J9HA 1UVZA 5J5NA 2VCVA 2L59A 1XXUA 3IK9A 4LMWA 3SBCA 4MA9A 2WJUA 4I97A 1S3CA 3HA9A 3UJ1A 5LD0A 4GRFA 3QAWA 3FRCA 1Z3EA 3C1RA 1T4YA 2CZ2A 4NMUA 2XBIA 2LTKA 3J7Yk 1DUGA 2LRTA 2CX4A 4ECJA 4PQ1A 4OCFA 2JZRA 1YY7A 4IP1A 1SJIA 3GV1A 3ZITA 1O85A 1J08A 5DAKA 4PURA 1EOGA 1PA3A 3IE3A 5CREA 4HJ2A 3HDCA 1TJDA 2FNOA 5F8BA 5G2ZA 4K8MA 3A3TA 1XZOA 12GSA 2HXKA 1U6TA 2CVKA 2YN1A 1XWBA 2V41A 4KH7A 4ACSA 1YZXA 4MF5A 5J9CA 5F06A 4EVMA 3M8NA 4F82A 3C8EA 3IAM2 4LMVA 4L0WA 2JSYA 2P0GA 3GH6A 4ISDA 4TR0A 3CSHA 1HYUA 4J56E 1XWCA 1SU9A 4L8EA 4DSQA 4MPGA 3TRXA 2HNLA 3TB2A 3GKXA 1B9YC 3KH7A 3QDNA 2H1GA 4EXJA 3I69A 2NDOA 4K1FA 6GSWA 3QCPA 4KW6A 4MP4A 2GZPA 4P3YB 1FVKA 2ZUPA 1OC8A 5HR2A 1YEPA 5B8AA 1YQ1A 1SENA 2K8SA 3EMXA 2D2ZA 2NVLA 4WR5A 4MJBA 2GSQA 3WT1A 3RHCA 1PN9A 2YZUA 4GF0A 1OAZA 5CNWA 4OO5A 3GTUA 4OCEA 2GT5A 3TGZA 1PMTA 5ECIB 3E0UA 3RHBA 2LRCA 5GAND 1A0RP 5IM9A 1YF1A 5C00A 1XVQA 5D9VA 5GAPD 1OVNA 3UVHA 4MMMA 3UVTA 1GUMA 5G5EA 1K0CA 3F3RA 3WGDA 2ON5A 4IN0A 4NHZA
chains in the Genus database with same CATH superfamily
2LJKA 3FEUA 1E6BA 3W8JA 2DMMA 2FA4A 1WE0A 3FR6A 3F6DA 2FUG2 1T4ZA 3TJBA 3EU3A 4KCEA 2VOCA 2XPEA 3GMFA 4FQUA 2VCQA 2C3TA 2YPMA 4KAEA 3L9UA 3EURA 2V6KA 3KXOA 1S3RA 3FZ4A 4OFTA 3D21A 3DXBA 3TJGA 3HXSA 4IBPA 3FHKA 1ZL9A 3EWLA 2WULA 4LLRA 3IA1A 2H1DA 5IMDA 5ECPB 1TRSA 1ZGNA 1R5PA 3LYKA 2F8AA 3QR6A 3FW2A 1AXDA 5D9WA 2L6CA 2IIYA 3KGKA 3DVXA 3ERFA 3RBTA 4ECIA 2LNTA 3P7XA 2YWNA 5HR1A 4PNGA 4ZB8A 4EIQA 3PPUA 4MZCA 2IPAA 1K0DA 2TRCP 4JBBA 1BX9A 4WEYA 1FOHA 5GSTA 4IJ3A 4K9ZA 4G2EA 4MH2A 2RM5A 4HZ4A 3F9UA 3KTLA 5G30A 1PN0A 5C04A 3GX8A 5JWRB 2AJQB 13GSA 2FWHA 1K0OA 4O5RA 1F6MC 4EF0A 2YP6A 2H01A 2B6MA 1KBNA 2H30A 2AV4A 5D96A 3FR3A 3UAPA 1QQ2A 2FLSA 5J9BA 3NOFA 2C3QA 2GVPA 3TOUA 2GSRA 1A2MA 3FYGA 1FOVA 2VCTA 1G0TA 2O85A 4E8EA 3IC8A 2F8FA 2FY6A 2WB9A 5DALB 4HJMA 4MCUA 3HHVA 3VPTA 4HEA2 2QA1A 1FHEA 1WOUA 1JZRA 4MABA 2HFDA 5EL8A 2RLIA 1XWAA 1GTIA 1ERWA 4I2UA 2R37A 1TRUA 4RI7A 4CW9A 3H8QA 1PSQA 3LWAA 3DD3A 4HI7A 3BD2A 2R0CA 1TI3A 3PR8A 4ML1A 5IPHA 3VURA 2O8VB 5KEJA 2YOIA 1R26A 2DJ3A 2DKIA 4IGJA 4V2LA 5LCZA 2C0DA 2H0HA 3GL5A 4KSMA 4MF6A 2VUPA 1SYRA 1GH2A 3CYNA 3ZL5A 3ME7A 3HVVA 2HRKA 1M0UA 5JCGA 1YKCA 1SKSB 1XPVA 4X43A 3TJJA 4FIWA 5ECNB 3ZFLA 2LRNA 2IFQB 2DSAA 4POLA 2E0QA 3QAGA 1QFNA 1ABAA 3HVSA 1M9AA 2CT6A 1ML6A 4V2NA 4TR1A 1MEKA 2WRTA 4MNNA 5CYYA 2GGTA 11GSA 2PPTA 3G9BA 1XW9A 3LSZA 1GTBA 3CQFA 1TI1A 20GSA 4GTUA 2MMOA 5D9XA 1VF1A 3VFIA 1YEXA 2LNSA 2E2MA 2IMEA 2HT9A 3FZAA 2HE3A 3TUEA 4D73A 3CTGA 4KF9A 2HZEA 3LXZA 3IHGA 5B6NA 1EWXA 4L5LA 1M3JA 3IRAA 2H73A 4Q5FA 3CXGA 1NW2A 3L0HA 2RIIA 1Z6NA 1TU8A 2OE3A 2GDRA 3MYDA 6GSTA 3QOUA 2V2GA 4IKHA 1VF3A 3FR9A 2H0IA 1XWGA 4BVYA 1WRYA 3V1WA 3GNJA 2PMTA 2GQLA 4BWSA 3VK9A 4BVXA 5D8IA 2PN8A 4G19A 3U5RE 3R2QA 2V1MA 5B8BA 1PGTA 3MNGA 2GT6A 4GCIA 5G1LA 1HNAA 1TXXA 2MBTA 2JU5A 2CV4A 3PH9A 6GSVA 2VCXA 4V1Ap 4YAVA 3D6IA 3L9SA 3GURA 4WKWA 3LXTA 3VI7A 1MD3A 5ECOB 1U3AA 5KN3A 1AQVA 3PINA 2IJYA 1PKZA 4GQFA 2H6ZA 1X9WB 4Z7XA 5IPGA 3TCOA 2K18A 2N5FA 4FYUA 4MZWA 1ZOFA 5ECKB 5G5FA 3LEFA 3GKKA 2XHFA 1SD8A 4ECBA 2GS3A 1F3BA 4XRAA 2YV7A 3CMIA 4KNDA 5A5KA 1SJ6A 2DLXA 2X49A 3A5WA 5COHA 3A2VA 4PNFA 1AQWA 1FVJA 4QL7A 4Z2RA 1X9SB 3Q6OA 1K0MA 5JCUA 3HVXA 2K9FA 6GSXA 4JR4A 1TW9A 6GSUA 3F4RA 1YDKA 4J57E 5J41A 5IO0A 2B1LA 4DSSB 4LA1A 2R0GA 2WGRA 1GSFA 2K6VA 4TXVA 2DBCA 5IOWA 4JRRA 6GSYA 2JSZA 17GSA 5AN1A 3GN3A 1JZWA 3BCKA 1WMJA 1TP9A 2V32A 3VPQA 1AUCA 4K6XA 3FMWA 4EIPA 3ERGA 2HRNA 2N5BA 1OC9B 3LGCA 2MMAA 2C80A 2OBIA 2H0GA 2XC2A 2E7PA 4MJEA 4K0GA 1OYJA 4O5UA 4PQHA 7GSSA 1GSSA 2B3SA 3O76A 1RK4A 2X99A 1GNEA 1Z7PA 4O92A 4TR3A 1NSWA 3FZ9A 3EPTA 4KA0A 1A23A 6GSSA 1WWJA 1T3BA 2H74A 3HD5A 5AIVA 3LJRA 2Z9SA 1M3IA 5E59A 3SWLA 4NXIA 4EDYA 2EIOA 3LORA 4KDYA 3UOMA 1K3OA 2F9SA 2G2QA 1H4OA 4ZILA 2L4CA 1G7EA 3G7JA 1I5GA 3HZ8A 2OKAA 2NPBA 4TVEA 2YV9A 2L5LA 5FT3A 5A4VA 4N11A 4NV2A 5G31A 3W8SA 5JWOB 1M2DA 4G0KA 1V58A 2H75A 1VGLA 1TTZA 3UMAA 3HKRA 3IXRA 3ME8A 5E4WA 2J23A 1UC7A 2GZYA 3MWHA 3GH9A 4HQZA 4TXOB 3N9JA 3KP9A 1XVWA 2CQ9A 2DMLA 3QAVA 5EPFA 4GSTA 2VLVA 3D0ZA 3F4TA 3TOTA 3ZMLA 2VM2A 3MDKA 5KOXA 4ZXGA 2IMKA 1GSEA 2XBQA 3APOA 3HJMA 2C0EA 3CRTA 2OBKA 2YZHA 1LU4A 3VWUA 1QMVA 1XWKA 3ZVJA 1TDIA 3ZVJD 3FY7A 3P2AA 1A8LA 1JLWA 4WF4A 4I6XA 4N0ZA 3APQA 4K2DA 1DE2A 4YQUA 22GSA 1XCCA 3TKSE 2AUVA 3NZNA 3DIEA 2QC7A 3MSZA 2YWOA 3GSTA 1ZCPA 3ZREA 5INYA 3M0FA 3CSJA 5DCHA 2C1YA 4TR4A 5ECRB 4X4JA 5ECQB 1YF0A 2A2PA 1FG4A 2M72A 1F2EA 1Y25A 5ID2A 2YCDA 3BJ5A 3M9KA 2HRAA 1TU7A 5DAKB 2AAWA 3J7Yb 2DJJA 1ERTA 5IOXA 3IDVA 3P8WA 1M99A 3U6VA 2WZ9A 1R5AA 1R7HA 2OADA 2JADA 3GL3A 3OR5A 2CX3A 4TRXA 2P5QA 3RPNA 1V98A 2IN3A 4MJAA 2F3MA 4HU7A 2DIYA 4TKYA 4KDUA 4POBA 4ID0A 4JEDA 1V57A 1R4WA 4AGSA 1EGRA 5KN0A 1MTCA 2HZFA 1ZYPA 4BIKA 1ZMAA 2JL4A 3L9VA 2WCIA 5ELGA 4KUNA 5CO3A 2LEGA 4TOPA 3TKQA 3L78A 2VD0A 4FO5A 3K8NA 4NAXA 3IPZA 4G0IA 2PU9C 1V2AA 4XS4A 3UL3A 4GSNA 2FHEA 3CTFA 4V2MA 1GL8A 1AIUA 2DJ1A 3KP8A 2CAQA 1BEDA 1M9BA 1Z9HA 3H1NA 1MDJA 2C3NA 3GTUB 2YANA 3KTBA 4G0LA 3KM6A 1SL1B 3IC4A 2B1KA 2X8HA 4QL9A 2H1AA 4Z2UA 4KB3A 2ES7A 3D22A 3R3EA 4XHMA 2FWFA 5ELAA 1AC1A 2VO4A 5DDLA 3ZRDA 1UA5A 1MDIA 4HDEA 4KE3A 1T8EB 1F9MA 1Q4JA 2QSIA 4HOJA 2EIRA 2QKEA 1Z7RA 5HFGA 3ZYWA 3UARA 2I1UA 2WDUA 1QUWA 3A2WA 1GRXA 4ZL7A 3VI5A 4Q5RA 1LBKA 4YAPA 1XW5A 5IMCA 2QGVA 2OE0A 5IIZA 2P5RA 3HJPA 1X0RA 1EEMA 4EC0A 2HSHA 1F37A 4AF2A 2R5GA 2O87A 4DVCA 4JE1A 4CHSA 4WXTA 2C4JA 3D5JA 2HYXA 2LJAA 3KEBA 4KDXA 1SKRB 4BL7A 3KH9A 1THXA 2V6OA 3DRNA 3DMLA 1FO5A 3DYRA 4MPFA 2VL9A 1TRWA 3APSA 1B4PA 1TOFA 1TKDB 2LUSA 1HNCA 5EVOA 2JZTA 3UBLA 1THOA 1S3DA 2B5EA 4WBJA 1SKWB 1SD9A 4ML6A 16GSA 4OFMA 4LL1B 2DKHA 2DJ2A 5IMVA 1M2BA 5AISA 3LQ7A 2GQMA 4ZB9A 1JLVA 5FWGA 5D73A 1JZDA 4JR6A 2UZ8A 1X5EA 3ISOA 4EO3A 1URMA 5J3RA 3DEXA 4HSCX 3WGXA 1GUKA 4EDZA 2H1BA 3WGEA 3EC3A 1WIKA 2CA8A 2LQQA 3JCML 1G6YA 4EE0A 1ERUA 1FB6A 4FYBA 2KP2A 3WYWA 2A2SA 1DE1A 2KUCA 1NHYA 3N5OA 1ZYQB 3IOSA 4KX4A 5CAXA 3GSSA 5ECHB 2H70A 4F9ZA 5HFKA 1OE7A 1PL2A 1MDKA 3ZTLA 4H86A 2EIQA 5F07A 3TKSC 2H76A 3F0IA 2VL2A 4K7OA 3Q19A 3UEMA 3F4SA 3BOAA 4I5QA 5HQPA 3LYPA 4ZBAA 4J2FA 1ZYNA 1EP8A 4GWRA 1O8WA 1Z6MA 4ZBBA 3QFBC 5L71A 2H66A 4DEJA 3ZIVA 1K0AA 4K7IA 4POMA 1CQHA 2PGTA 4IJIA 4F03A 2KLXA 5EY6A 3GFKA 1T00A 1Y6EA 3NIVA 4MJCA 4YQMA 1V40A 4EUYA 5IMFA 4PTSA 3EVIA 1J9BA 2MZCA 4JU5A 3HJOA 1U88A 1SK2A 1SK1A 2B7KA 2RUFA 4FH8A 1XFLA 3F3QA 9GSSA 3H4KA 2O89A 2LS5A 1ON4A 1WJKA 1ZZYA 2JZSA 4I8BA 4GQCA 1G6WA 2CZ3A 3TKSA 1XW6A 4TR1B 5A4WA 1VF4A 4WETA 1MD4A 1JZOA 4GLTA 2LJRA 1A2JA 1X9MB 3F8UA 1XG8A 1FW1A 4JZQA 3VWXA 1VRSD 1V9WA 4IELA 4BPYA 4WR4A 2ALBA 4IS0A 4PUFC 5GSSA 1GLQA 4D73B 14GSA 3Q18A 2HZEB 1T7PB 1OKTA 3AY8A 3EU4A 3IBHA 2R0PA 3KZQA 5F0GA 4NHWA 4XS6A 4HZ2A 5H5RA 5G1KA 5CRDA 2VCZA 4NPBA 1SL0B 5ENUA 5BRTA 5JWQB 2VM1A 4IQ1A 5IQYA 5HR0A 4X1UA 3HCZA 2DC5A 2DIZA 3C71A 5DQSA 2LKUA 4YH2A 1B8XA 1HNBA 5CP1A 1AAZA 3US3A 4EL1A 3IAS2 1OKDA 2H6YA 2M80A 8GSSA 1AQXA 1S3AA 2KP1A 1U87A 4BVYB 3QMXA 3ERWA 1K3LA 3CSIA 2L6DA 5IO2A 4BVXB 2IMFA 2A4HA 2NTOA 5D9TA 3M3MA 1Z5YE 1LJRA 3H79A 1QGVA 1IYHA 1GSDA 3UIWA 2X8CA 2YJ7A 2ZNMA 3VWVA 4AJ8A 3GHAA 4O5QA 4MLYA 2DJ0A 3KD0A 5CRGA 2HSMA 2C0FA 4MDCA 5DALA 4ZL8A 1GTAA 2PVQA 3ZMKA 4K7NA 2HRFA 4G9HA 4KSOA 1K3YA 2MBSA 1PRXA 2H6XA 3EINA 4CY6A 2L5OA 4TW5A 1TK0B 2JACA 5H5SA 5A4UA 2FD3A 2CAIA 1O81A 4HQSA 4QQ7A 3FKFA 4MH3A 3HY2A 1BYEA 2GTUA 3M1GA 2F51A 2O7KA 1GP1A 3L4NA 5ECLB 3E3EA 2WFCA 3LFLA 4HS1A 3W6GA 4GSSA 1B48A 3EE2A 3KIJA 3ZIJA 10GSA 1GWCA 2X8GA 2AB6A 4ECCA 3GYKA 5DJMA 2BTOT 3QPMA 5D93A 2G0FA 2REMA 2N5AA 2PWJA 3LG6A 1PL1A 4PUAA 1PQNA 4IW9A 5F05A 2IFQA 3TRPA 4AJ6A 5IMAA 1WP0A 4F2IA 3CBUA 2AYTA 3H93A 2A4VA 1M7TA 4KGIA 3IV4A 2GQKA 5B7CA 2OA7A 3TJKA 3ZFBA 5ABRA 1SJZA 1H75A 4ZB6A 3A2XA 2ON7A 3IK7A 4XS1A 1GSUA 4CDOA 1G7OA 1O6JA 2X64A 1N2AA 1A2LA 4Q5QA 4FYCA 1K0NA 2H71A 4BWQA 3G7IA 2IL3A 2QA2A 3VLNA 3TKRA 4WF5A 3FK8A 2L57A 4RQRA 3HYPA 4I2TA 1EEJA 5DBQA 4ZBDA 1AW9A 2E2GA 1E2YA 3TDGA 2PERA 1FAAA 4L5OA 2GSTA 4IP6A 2HLSA 1RW1A 4XCSA 2KHPA 4OWYA 1BJXA 2B7JA 4K5RA 5GZZB 1RQMA 2RUEA 3Q74A 1A8YA 1HQOA 4DSRA 4Z2TA 2TRXA 3C73A 3BCIA 4ULXA 1WPIA 2R4VA 4KCAA 19GSA 4ZL9A 3E9JB 4LL4B 2FCHA 2LQOA 1OE8A 2R2JA 5FHIA 2YWIA 2MMNA 1PX6A 3D4MA 5KN1A 3VWWA 2YNXA 4IVFA 2I3YA 2VCWA 3DWVA 3A5IA 5HFIA 2VLUA 4O7HA 3RDWA 1NHOA 3KJYA 2WS2A 3MAKA 1GTUA 1K0BA 2VL3A 5J4UA 1EZKA 1TRVA 3WT2A 1PFOA 3DKSA 4PQIA 4XIHA 5DCGA 2CVBA 2GLRA 2I9HA 1USBA 1A0FA 2FGXA 2RM6A 3KMOA 2XPDA 4AJ7A 1XOAA 3DGQA 18GSA 4XRDA 1DSBA 3ZLPA 2CVDA 2EC4A 2HSYA 2ZCTA 4RI6A 3WD6A 4OD7A 4YQVA 1EOHA 2TIRA 1O73A 3TKPA 1KTEA 4RUVA 1CQGA 3HZ4A 2I4AA 5DVBA 1PKWA 1N8JA 3QFAC 4F0BA 1BQ7A 4K5SA 1PD21 3C7MA 4TN8A 1QXHA 2H8LA 5AGYA 2GZZA 1DBYA 1ERVA 1GNWA 2FWEA 1W4VA 2LSTA 4HUAA 3QD9A 1J0FA 4BA7A 3C1SA 1C72A 5DJLA 4RQXA 1PX7A 4N0VA 2OJLA 2OACA 4OO4A 1NM3A 4OFNA 1ST9A 2R6KA 3F6FA 2DJKA 4WBRD 1EV4A 3BBYA 2OE1A 4OMVA 1XIYA 2HI7A 1U3IA 2VAFA 3GX0A 4NV5A 4IHUA 2NBSA 1VF2A 5ID2B 2M46A 4X0XA 4GXZA 1EP7A 2H72A 4DSSA 5HR3A 3RPPA 3IHQA 3D4TA 5AIXA 2I81A 3I6AA 4YKGA 2VL2C 4MK3A 4EKZA 5KOWA 2P31A 2LV3A 5IMZA 2L4QA 2FWGA 1T1VA 1B4QA 1GSYA 3TRQA 3TJFA 3GKNA 5LNKe 2B5YA 4ICYA 3O3TA 4E8HA 2GSSA 1KEBA 2MYGA 3G7YA 1OC9A 1UN2A 4N10A 4K2XA 3IR4A 2MMZA 1ZYEA 2K8VA 3GUSA 1JFUA 3LW9A 2X4AA 4NWYA 1GLPA 5JCWA 1EGOA 4PX1A 2VIMA 3ED3A 4XS4B 4ZIJA 1YKAA 5CRWA 4Q5NA 3RAZA 2VLTA 1EV9A 1TK5B 2C0GA 4POKA 1TK8B 4ILFA 3EMPA 2KOKA 1F3AA 3P90A 3KMNA 1QK8A 1YJ6A 2C8UA 3FZ5A 3GKMA 3PGTA 3ZZXA 1X5CA 4L0UA 1SYXA 3KCMA 3GIXA 2BMXA 4G10A 1GUHA 1GULA 3M9JA 3UBKA 2YWMA 1BG5A 3GA4A 4HU9A 1FB0A 2AHEA 1HD2A 5ECSA 1SK0A 2FA8A 1Q98A 4N30A 3CRUA 1OC3A 1W89A 3DVWA 1XBSA 2A2RA 4YKFA 2B5XA 2IWTA 1ACVA 4MZBA 1O7UA 1M2AA 2H19A 4F0CA 3MIXA 5KN2A 4V1Ag 5ECMB 1O8XA 4TXOA 2IMIA 4PXOA 1A24A 3F63A 4PGTA 2VD1A 5CRHA 1KNGA 1B9XC 2BJXA 3GRXA 3I9V2 4K0NA 1XOBA 5H5QA 3O6TA 2PVOC 5B6MA 1SL2B 2PBJA 1I9DA 1JHBA 1BAYA 3EYTA 4IQAA 3I43A 5DQYA 2R3XA 2IMDA 1GSQA 4XTSA 4CY8A 3S9FA 2YJHA 5BMUA 1ILOA 1X5DA 4O32A 1IYIA 4BL7B 4MF7A 2PUKC 2J9HA 1UVZA 5J5NA 2VCVA 2L59A 1XXUA 3IK9A 4LMWA 3SBCA 4MA9A 2WJUA 4I97A 1S3CA 3HA9A 3UJ1A 5LD0A 4GRFA 3QAWA 3FRCA 1Z3EA 3C1RA 1T4YA 2CZ2A 4NMUA 2XBIA 2LTKA 3J7Yk 1DUGA 2LRTA 2CX4A 4ECJA 4PQ1A 4OCFA 2JZRA 1YY7A 4IP1A 1SJIA 3GV1A 3ZITA 1O85A 1J08A 5DAKA 4PURA 1EOGA 1PA3A 3IE3A 5CREA 4HJ2A 3HDCA 1TJDA 2FNOA 5F8BA 5G2ZA 4K8MA 3A3TA 1XZOA 12GSA 2HXKA 1U6TA 2CVKA 2YN1A 1XWBA 2V41A 4KH7A 4ACSA 1YZXA 4MF5A 5J9CA 5F06A 4EVMA 3M8NA 4F82A 3C8EA 3IAM2 4LMVA 4L0WA 2JSYA 2P0GA 3GH6A 4ISDA 4TR0A 3CSHA 1HYUA 4J56E 1XWCA 1SU9A 4L8EA 4DSQA 4MPGA 3HVNA 3TRXA 2HNLA 3TB2A 3GKXA 1B9YC 4USSA 3KH7A 3QDNA 2H1GA 4EXJA 3I69A 2NDOA 4K1FA 6GSWA 3QCPA 4KW6A 4MP4A 2GZPA 4P3YB 1FVKA 2ZUPA 1OC8A 5HR2A 1YEPA 5B8AA 1YQ1A 1SENA 2K8SA 3EMXA 2D2ZA 2NVLA 4WR5A 4MJBA 2GSQA 3WT1A 3RHCA 1PN9A 2YZUA 4GF0A 1OAZA 5CNWA 4OO5A 3GTUA 4OCEA 2GT5A 3TGZA 1PMTA 5ECIB 3E0UA 3RHBA 2LRCA 5GAND 1A0RP 5IM9A 1YF1A 5C00A 1XVQA 5D9VA 4A5PA 5GAPD 1OVNA 3UVHA 4MMMA 3UVTA 1GUMA 5G5EA 1K0CA 3F3RA 3WGDA 2ON5A 4IN0A 4NHZA
chains in the Genus database with same CATH topology
2LJKA 3FEUA 1E6BA 3W8JA 2DMMA 2FA4A 1WE0A 3FR6A 3F6DA 2FUG2 1T4ZA 3TJBA 3EU3A 4KCEA 2VOCA 2XPEA 3GMFA 4FQUA 2VCQA 2C3TA 2YPMA 4KAEA 3L9UA 3EURA 2V6KA 3KXOA 3FZ4A 4OFTA 3D21A 3DXBA 3TJGA 3HXSA 4IBPA 3FHKA 1ZL9A 3EWLA 2WULA 4LLRA 3IA1A 2H1DA 5IMDA 5ECPB 1TRSA 1ZGNA 1R5PA 3LYKA 2F8AA 3QR6A 3FW2A 1AXDA 5D9WA 2L6CA 2IIYA 3KGKA 3DVXA 3ERFA 3RBTA 4ECIA 2LNTA 3P7XA 2YWNA 5HR1A 4PNGA 4ZB8A 4EIQA 3PPUA 4MZCA 2IPAA 1K0DA 2TRCP 4JBBA 1BX9A 4WEYA 1FOHA 5GSTA 4IJ3A 4K9ZA 4G2EA 4MH2A 2RM5A 4HZ4A 3F9UA 3KTLA 5G30A 1PN0A 5C04A 3GX8A 5JWRB 2AJQB 13GSA 2FWHA 1K0OA 4O5RA 1F6MC 4EF0A 2YP6A 2H01A 2B6MA 1KBNA 2H30A 2AV4A 5D96A 3FR3A 3UAPA 1QQ2A 2FLSA 5J9BA 3NOFA 2C3QA 2GVPA 3TOUA 2GSRA 1A2MA 3FYGA 1FOVA 2VCTA 1G0TA 2O85A 4E8EA 3IC8A 2F8FA 2FY6A 2WB9A 5DALB 4HJMA 4MCUA 3HHVA 3VPTA 4HEA2 2QA1A 1FHEA 1WOUA 1JZRA 4MABA 2HFDA 5EL8A 2RLIA 1XWAA 1GTIA 1ERWA 4I2UA 2R37A 1TRUA 4RI7A 4CW9A 3H8QA 1PSQA 3LWAA 3DD3A 4HI7A 3BD2A 2R0CA 1TI3A 3PR8A 4ML1A 5IPHA 3VURA 2O8VB 5KEJA 2YOIA 1R26A 2DJ3A 2DKIA 4IGJA 4V2LA 5LCZA 2C0DA 2H0HA 3GL5A 4KSMA 4MF6A 2VUPA 1SYRA 1GH2A 3CYNA 3ZL5A 3ME7A 3HVVA 2HRKA 1M0UA 5JCGA 1YKCA 1SKSB 1XPVA 4X43A 3TJJA 4FIWA 5ECNB 3ZFLA 2LRNA 2IFQB 2DSAA 4POLA 2E0QA 3QAGA 1QFNA 1ABAA 3HVSA 1M9AA 2CT6A 1ML6A 4V2NA 4TR1A 1MEKA 2WRTA 4MNNA 5CYYA 2GGTA 11GSA 2PPTA 3G9BA 1XW9A 3LSZA 1GTBA 1TI1A 20GSA 4GTUA 2MMOA 5D9XA 1VF1A 3VFIA 1YEXA 2LNSA 2E2MA 2IMEA 2HT9A 3FZAA 2HE3A 3TUEA 4D73A 3CTGA 4KF9A 2HZEA 3LXZA 3IHGA 5B6NA 1EWXA 4L5LA 3IRAA 2H73A 4Q5FA 3CXGA 1NW2A 3L0HA 2RIIA 1Z6NA 1TU8A 2OE3A 2GDRA 3MYDA 6GSTA 3QOUA 2V2GA 4IKHA 1VF3A 3FR9A 2H0IA 1XWGA 4BVYA 1WRYA 3V1WA 3GNJA 2PMTA 2GQLA 4BWSA 3VK9A 4BVXA 5D8IA 2PN8A 4G19A 3U5RE 3R2QA 2V1MA 5B8BA 1PGTA 3MNGA 2GT6A 4GCIA 5G1LA 1HNAA 1TXXA 2MBTA 2JU5A 2CV4A 3PH9A 6GSVA 2VCXA 4V1Ap 4YAVA 3D6IA 3L9SA 3GURA 4WKWA 3LXTA 3VI7A 1MD3A 5ECOB 1U3AA 5KN3A 1AQVA 3PINA 2IJYA 1PKZA 4GQFA 2H6ZA 1X9WB 4Z7XA 5IPGA 3TCOA 2K18A 2N5FA 4FYUA 4MZWA 1ZOFA 5ECKB 5G5FA 3LEFA 3GKKA 2XHFA 1SD8A 4ECBA 2GS3A 1F3BA 4XRAA 2YV7A 3CMIA 4KNDA 5A5KA 1SJ6A 2DLXA 2X49A 3A5WA 5COHA 3A2VA 4PNFA 1AQWA 1FVJA 4QL7A 4Z2RA 1X9SB 3Q6OA 1K0MA 5JCUA 3HVXA 2K9FA 6GSXA 4JR4A 1TW9A 6GSUA 3F4RA 1YDKA 4J57E 5J41A 5IO0A 2B1LA 4DSSB 4LA1A 2R0GA 2WGRA 1GSFA 2K6VA 4TXVA 2DBCA 5IOWA 4JRRA 6GSYA 2JSZA 17GSA 5AN1A 3GN3A 1JZWA 3BCKA 1WMJA 1TP9A 2V32A 3VPQA 1AUCA 4K6XA 3FMWA 4EIPA 3ERGA 2HRNA 2N5BA 1OC9B 3LGCA 2MMAA 2C80A 2OBIA 2H0GA 2XC2A 2E7PA 4MJEA 4K0GA 1OYJA 4O5UA 4PQHA 7GSSA 1GSSA 2B3SA 3O76A 1RK4A 2X99A 1GNEA 1Z7PA 4O92A 4TR3A 1NSWA 3FZ9A 3EPTA 4KA0A 1A23A 6GSSA 1WWJA 1T3BA 2H74A 3HD5A 5AIVA 3LJRA 2Z9SA 5E59A 3SWLA 4NXIA 4EDYA 2EIOA 3LORA 4KDYA 3UOMA 1K3OA 2F9SA 2G2QA 1H4OA 4ZILA 2L4CA 1G7EA 3G7JA 1I5GA 3HZ8A 2OKAA 2NPBA 4TVEA 2YV9A 2L5LA 5FT3A 5A4VA 4N11A 4NV2A 5G31A 3W8SA 5JWOB 1M2DA 4G0KA 1V58A 2H75A 1VGLA 1TTZA 3UMAA 3HKRA 3IXRA 3ME8A 5E4WA 2J23A 1UC7A 2GZYA 3MWHA 3GH9A 4HQZA 4TXOB 3N9JA 3KP9A 1XVWA 2CQ9A 2DMLA 3QAVA 5EPFA 4GSTA 2VLVA 3D0ZA 3F4TA 3TOTA 3ZMLA 2VM2A 3MDKA 5KOXA 4ZXGA 2IMKA 1GSEA 2XBQA 3APOA 3HJMA 2C0EA 3CRTA 2OBKA 2YZHA 1LU4A 3VWUA 1QMVA 1XWKA 3ZVJA 1TDIA 3ZVJD 3FY7A 3P2AA 1A8LA 1JLWA 4WF4A 4I6XA 4N0ZA 3APQA 4K2DA 1DE2A 4YQUA 22GSA 1XCCA 3TKSE 2AUVA 3NZNA 3DIEA 2QC7A 3MSZA 2YWOA 3GSTA 1ZCPA 3ZREA 5INYA 3M0FA 3CSJA 5DCHA 2C1YA 4TR4A 5ECRB 4X4JA 5ECQB 1YF0A 2A2PA 1FG4A 2M72A 1F2EA 1Y25A 5ID2A 2YCDA 3BJ5A 3M9KA 2HRAA 1TU7A 5DAKB 2AAWA 3J7Yb 2DJJA 1ERTA 5IOXA 3IDVA 3P8WA 1M99A 3U6VA 2WZ9A 1R5AA 1R7HA 2OADA 2JADA 3GL3A 3OR5A 2CX3A 4TRXA 2P5QA 3RPNA 1V98A 2IN3A 4MJAA 2F3MA 4HU7A 2DIYA 4TKYA 4KDUA 4POBA 4ID0A 4JEDA 1V57A 1R4WA 4AGSA 1EGRA 5KN0A 1MTCA 2HZFA 1ZYPA 1ZMAA 2JL4A 3L9VA 2WCIA 5ELGA 4KUNA 5CO3A 2LEGA 4TOPA 3TKQA 3L78A 2VD0A 4FO5A 3K8NA 4NAXA 3IPZA 4G0IA 2PU9C 1V2AA 4XS4A 3UL3A 4GSNA 2FHEA 3CTFA 4V2MA 1GL8A 1AIUA 2DJ1A 3KP8A 2CAQA 1BEDA 1M9BA 1Z9HA 3H1NA 1MDJA 2C3NA 3GTUB 2YANA 3KTBA 4G0LA 3KM6A 1SL1B 3IC4A 2B1KA 2X8HA 4QL9A 2H1AA 4Z2UA 4KB3A 2ES7A 3D22A 3R3EA 4XHMA 2FWFA 5ELAA 1AC1A 2VO4A 5DDLA 3ZRDA 1UA5A 1MDIA 4HDEA 4KE3A 1T8EB 1F9MA 1Q4JA 2QSIA 4HOJA 2EIRA 2QKEA 1Z7RA 5HFGA 3ZYWA 3UARA 2I1UA 2WDUA 1QUWA 3A2WA 1GRXA 4ZL7A 3VI5A 4Q5RA 1LBKA 4YAPA 1XW5A 5IMCA 2QGVA 2OE0A 5IIZA 2P5RA 3HJPA 1X0RA 1EEMA 4EC0A 2HSHA 1F37A 4AF2A 2R5GA 2O87A 4DVCA 4JE1A 4CHSA 4WXTA 2C4JA 3D5JA 2HYXA 2LJAA 3KEBA 4KDXA 1SKRB 4BL7A 3KH9A 1THXA 2V6OA 3DRNA 3DMLA 1FO5A 3DYRA 4MPFA 2VL9A 1TRWA 3APSA 1B4PA 1TOFA 1TKDB 2LUSA 1HNCA 5EVOA 2JZTA 3UBLA 1THOA 1S3DA 2B5EA 4WBJA 1SKWB 1SD9A 4ML6A 16GSA 4OFMA 4LL1B 2DKHA 2DJ2A 5IMVA 1M2BA 5AISA 3LQ7A 2GQMA 4ZB9A 1JLVA 5FWGA 5D73A 1JZDA 4JR6A 2UZ8A 1X5EA 3ISOA 4EO3A 1URMA 5J3RA 3DEXA 3WGXA 1GUKA 4EDZA 2H1BA 3WGEA 3EC3A 1WIKA 2CA8A 2LQQA 3JCML 1G6YA 4EE0A 1ERUA 1FB6A 4FYBA 2KP2A 3WYWA 2A2SA 1DE1A 2KUCA 1NHYA 3N5OA 1ZYQB 3IOSA 4KX4A 5CAXA 3GSSA 5ECHB 2H70A 4F9ZA 5HFKA 1OE7A 1PL2A 1MDKA 3ZTLA 4H86A 2EIQA 5F07A 3TKSC 2H76A 3F0IA 2VL2A 4K7OA 3Q19A 3UEMA 3F4SA 3BOAA 4I5QA 5HQPA 3LYPA 4ZBAA 4J2FA 1ZYNA 1EP8A 4GWRA 1O8WA 1Z6MA 4ZBBA 3QFBC 5L71A 2H66A 4DEJA 3ZIVA 1K0AA 4K7IA 4POMA 1CQHA 2PGTA 4IJIA 4F03A 2KLXA 5EY6A 3GFKA 1T00A 1Y6EA 3NIVA 4MJCA 4YQMA 1V40A 4EUYA 5IMFA 4PTSA 3EVIA 1J9BA 2MZCA 4JU5A 3HJOA 1U88A 1SK2A 1SK1A 2B7KA 2RUFA 4FH8A 1XFLA 3F3QA 9GSSA 3H4KA 2O89A 2LS5A 1ON4A 1WJKA 1ZZYA 2JZSA 4I8BA 4GQCA 1G6WA 2CZ3A 3TKSA 1XW6A 4TR1B 5A4WA 1VF4A 4WETA 1MD4A 1JZOA 4GLTA 2LJRA 1A2JA 1X9MB 3F8UA 1FW1A 4JZQA 3VWXA 1VRSD 1V9WA 4IELA 4BPYA 4WR4A 2ALBA 4IS0A 4PUFC 5GSSA 1GLQA 4D73B 14GSA 3Q18A 2HZEB 1T7PB 1OKTA 3AY8A 3EU4A 3IBHA 2R0PA 3KZQA 5F0GA 4NHWA 4XS6A 4HZ2A 5H5RA 5G1KA 5CRDA 2VCZA 4NPBA 1SL0B 5ENUA 5BRTA 5JWQB 2VM1A 4IQ1A 5IQYA 5HR0A 4X1UA 3HCZA 2DC5A 2DIZA 3C71A 5DQSA 2LKUA 4YH2A 1B8XA 1HNBA 5CP1A 1AAZA 3US3A 4EL1A 3IAS2 1OKDA 2H6YA 2M80A 8GSSA 1AQXA 1S3AA 2KP1A 1U87A 4BVYB 3QMXA 3ERWA 1K3LA 3CSIA 2L6DA 5IO2A 4BVXB 2IMFA 2A4HA 2NTOA 5D9TA 3M3MA 1Z5YE 1LJRA 3H79A 1QGVA 1IYHA 1GSDA 3UIWA 2X8CA 2YJ7A 2ZNMA 3VWVA 4AJ8A 3GHAA 4O5QA 4MLYA 2DJ0A 3KD0A 5CRGA 2HSMA 2C0FA 4MDCA 5DALA 4ZL8A 1GTAA 2PVQA 3ZMKA 4K7NA 2HRFA 4G9HA 4KSOA 1K3YA 2MBSA 1PRXA 2H6XA 3EINA 4CY6A 2L5OA 4TW5A 1TK0B 2JACA 5H5SA 5A4UA 2FD3A 2CAIA 1O81A 4HQSA 4QQ7A 3FKFA 4MH3A 3HY2A 1BYEA 2GTUA 3M1GA 2F51A 2O7KA 1GP1A 3L4NA 5ECLB 3E3EA 2WFCA 3LFLA 4HS1A 3W6GA 4GSSA 1B48A 3EE2A 3KIJA 3ZIJA 10GSA 1GWCA 2X8GA 2AB6A 4ECCA 3GYKA 5DJMA 2BTOT 3QPMA 5D93A 2G0FA 2REMA 2N5AA 2PWJA 3LG6A 1PL1A 4PUAA 1PQNA 4IW9A 5F05A 2IFQA 3TRPA 4AJ6A 5IMAA 1WP0A 4F2IA 3CBUA 2AYTA 3H93A 2A4VA 1M7TA 4KGIA 3IV4A 2GQKA 5B7CA 2OA7A 3TJKA 3ZFBA 5ABRA 1SJZA 1H75A 4ZB6A 3A2XA 2ON7A 3IK7A 4XS1A 1GSUA 4CDOA 1G7OA 1O6JA 2X64A 1N2AA 1A2LA 4Q5QA 4FYCA 1K0NA 2H71A 4BWQA 3G7IA 2IL3A 2QA2A 3VLNA 3TKRA 4WF5A 3FK8A 2L57A 4RQRA 3HYPA 4I2TA 1EEJA 5DBQA 4ZBDA 1AW9A 2E2GA 1E2YA 3TDGA 2PERA 1FAAA 4L5OA 2GSTA 4IP6A 2HLSA 1RW1A 4XCSA 2KHPA 4OWYA 1BJXA 2B7JA 4K5RA 5GZZB 1RQMA 2RUEA 3Q74A 1A8YA 1HQOA 4DSRA 4Z2TA 2TRXA 3C73A 3BCIA 4ULXA 1WPIA 2R4VA 4KCAA 19GSA 4ZL9A 3E9JB 4LL4B 2FCHA 2LQOA 1OE8A 2R2JA 5FHIA 2YWIA 2MMNA 1PX6A 3D4MA 5KN1A 3VWWA 2YNXA 4IVFA 2I3YA 2VCWA 3DWVA 3A5IA 5HFIA 2VLUA 4O7HA 3RDWA 1NHOA 3KJYA 2WS2A 3MAKA 1GTUA 1K0BA 2VL3A 5J4UA 1EZKA 1TRVA 3WT2A 3DKSA 4XIHA 4PQIA 5DCGA 2CVBA 2GLRA 2I9HA 1USBA 1A0FA 2FGXA 2RM6A 3KMOA 2XPDA 4AJ7A 1XOAA 3DGQA 18GSA 4XRDA 1DSBA 3ZLPA 2CVDA 2EC4A 2HSYA 2ZCTA 4RI6A 3WD6A 4OD7A 4YQVA 1EOHA 2TIRA 1O73A 3TKPA 1KTEA 4RUVA 1CQGA 3HZ4A 2I4AA 5DVBA 1PKWA 1N8JA 3QFAC 4F0BA 1BQ7A 4K5SA 1PD21 3C7MA 4TN8A 1QXHA 2H8LA 5AGYA 2GZZA 1DBYA 1ERVA 1GNWA 2FWEA 1W4VA 2LSTA 4HUAA 3QD9A 1J0FA 4BA7A 3C1SA 1C72A 5DJLA 4RQXA 1PX7A 4N0VA 2OJLA 2OACA 4OO4A 1NM3A 4OFNA 1ST9A 2R6KA 3F6FA 2DJKA 4WBRD 1EV4A 3BBYA 2OE1A 4OMVA 1XIYA 2HI7A 1U3IA 2VAFA 3GX0A 4NV5A 4IHUA 2NBSA 1VF2A 5ID2B 2M46A 4X0XA 4GXZA 1EP7A 2H72A 4DSSA 5HR3A 3RPPA 3IHQA 3D4TA 5AIXA 2I81A 3I6AA 4YKGA 2VL2C 4MK3A 4EKZA 5KOWA 2P31A 2LV3A 5IMZA 2L4QA 2FWGA 1T1VA 1B4QA 1GSYA 3TRQA 3TJFA 3GKNA 5LNKe 2B5YA 4ICYA 3O3TA 4E8HA 2GSSA 1KEBA 2MYGA 3G7YA 1OC9A 1UN2A 4N10A 4K2XA 3IR4A 2MMZA 1ZYEA 2K8VA 3GUSA 1JFUA 3LW9A 2X4AA 4NWYA 1GLPA 5JCWA 1EGOA 4PX1A 2VIMA 3ED3A 4XS4B 4ZIJA 1YKAA 5CRWA 4Q5NA 3RAZA 2VLTA 1EV9A 1TK5B 2C0GA 4POKA 1TK8B 4ILFA 3EMPA 2KOKA 1F3AA 3P90A 3KMNA 1QK8A 1YJ6A 2C8UA 3FZ5A 3GKMA 3PGTA 3ZZXA 1X5CA 4L0UA 1SYXA 3KCMA 3GIXA 2BMXA 4G10A 1GUHA 1GULA 3M9JA 3UBKA 2YWMA 1BG5A 3GA4A 4HU9A 1FB0A 2AHEA 1HD2A 5ECSA 1SK0A 2FA8A 1Q98A 4N30A 3CRUA 1OC3A 1W89A 3DVWA 1XBSA 2A2RA 4YKFA 2B5XA 2IWTA 1ACVA 4MZBA 1O7UA 1M2AA 2H19A 4F0CA 3MIXA 5KN2A 4V1Ag 5ECMB 1O8XA 4TXOA 2IMIA 4PXOA 1A24A 3F63A 4PGTA 2VD1A 5CRHA 1KNGA 1B9XC 2BJXA 3GRXA 3I9V2 4K0NA 1XOBA 5H5QA 3O6TA 2PVOC 5B6MA 1SL2B 2PBJA 1I9DA 1JHBA 1BAYA 3EYTA 4IQAA 3I43A 5DQYA 2R3XA 2IMDA 1GSQA 4XTSA 4CY8A 3S9FA 2YJHA 5BMUA 1ILOA 1X5DA 4O32A 1IYIA 4BL7B 4MF7A 2PUKC 2J9HA 1UVZA 5J5NA 2VCVA 2L59A 1XXUA 3IK9A 4LMWA 3SBCA 4MA9A 2WJUA 4I97A 1S3CA 3HA9A 3UJ1A 5LD0A 4GRFA 3QAWA 3FRCA 1Z3EA 3C1RA 1T4YA 2CZ2A 4NMUA 2XBIA 2LTKA 3J7Yk 1DUGA 2LRTA 2CX4A 4ECJA 4PQ1A 4OCFA 2JZRA 1YY7A 4IP1A 1SJIA 3GV1A 3ZITA 1O85A 1J08A 5DAKA 4PURA 1EOGA 1PA3A 3IE3A 5CREA 4HJ2A 3HDCA 1TJDA 2FNOA 5F8BA 5G2ZA 4K8MA 3A3TA 1XZOA 12GSA 2HXKA 1U6TA 2CVKA 2YN1A 1XWBA 2V41A 4KH7A 4ACSA 1YZXA 4MF5A 5J9CA 5F06A 4EVMA 3M8NA 4F82A 3C8EA 3IAM2 4LMVA 4L0WA 2JSYA 2P0GA 3GH6A 4ISDA 4TR0A 3CSHA 1HYUA 4J56E 1XWCA 1SU9A 4L8EA 4DSQA 4MPGA 3TRXA 2HNLA 3TB2A 3GKXA 1B9YC 4USSA 3KH7A 3QDNA 2H1GA 4EXJA 3I69A 2NDOA 4K1FA 6GSWA 3QCPA 4KW6A 4MP4A 2GZPA 4P3YB 1FVKA 2ZUPA 1OC8A 5HR2A 1YEPA 5B8AA 1YQ1A 1SENA 2K8SA 3EMXA 2D2ZA 2NVLA 4WR5A 4MJBA 2GSQA 3WT1A 3RHCA 1PN9A 2YZUA 4GF0A 1OAZA 5CNWA 4OO5A 3GTUA 4OCEA 2GT5A 3TGZA 1PMTA 5ECIB 3E0UA 3RHBA 2LRCA 5GAND 1A0RP 5IM9A 1YF1A 5C00A 1XVQA 5D9VA 4A5PA 5GAPD 1OVNA 3UVHA 4MMMA 3UVTA 1GUMA 5G5EA 1K0CA 3F3RA 3WGDA 2ON5A 4IN0A 4NHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJK A;  3FEU A;  1E6B A;  3W8J A;  2DMM A;  2FA4 A;  1WE0 A;  3FR6 A;  3F6D A;  2FUG 2;  1T4Z A;  3TJB A;  3EU3 A;  4KCE A;  2VOC A;  2XPE A;  3GMF A;  2VCQ A;  2C3T A;  2YPM A;  4KAE A;  3L9U A;  3EUR A;  2V6K A;  3KXO A;  3FZ4 A;  4OFT A;  3D21 A;  3DXB A;  3TJG A;  3HXS A;  4IBP A;  3FHK A;  1ZL9 A;  3EWL A;  2WUL A;  4LLR A;  3IA1 A;  2H1D A;  5IMD A;  5ECP B;  1TRS A;  1ZGN A;  1R5P A;  3LYK A;  2F8A A;  3QR6 A;  3FW2 A;  1AXD A;  5D9W A;  2L6C A;  2IIY A;  3KGK A;  3DVX A;  3ERF A;  3RBT A;  4ECI A;  2LNT A;  3P7X A;  2YWN A;  5HR1 A;  4PNG A;  4ZB8 A;  4MZC A;  2IPA A;  1K0D A;  2TRC P;  4JBB A;  1BX9 A;  4WEY A;  5GST A;  4IJ3 A;  4K9Z A;  4G2E A;  4MH2 A;  2RM5 A;  4HZ4 A;  3F9U A;  3KTL A;  5G30 A;  5C04 A;  3GX8 A;  5JWR B;  2AJQ B;  13GS A;  2FWH A;  1K0O A;  4O5R A;  1F6M C;  4EF0 A;  2YP6 A;  2H01 A;  2B6M A;  1KBN A;  2H30 A;  2AV4 A;  5D96 A;  3FR3 A;  3UAP A;  1QQ2 A;  2FLS A;  5J9B A;  3NOF A;  2C3Q A;  2GVP A;  3TOU A;  2GSR A;  1A2M A;  3FYG A;  1FOV A;  2VCT A;  1G0T A;  2O85 A;  4E8E A;  2F8F A;  2FY6 A;  2WB9 A;  5DAL B;  4HJM A;  4MCU A;  3HHV A;  3VPT A;  4HEA 2;  1FHE A;  1WOU A;  1JZR A;  4MAB A;  2HFD A;  5EL8 A;  2RLI A;  1XWA A;  1GTI A;  1ERW A;  4I2U A;  2R37 A;  1TRU A;  4RI7 A;  4CW9 A;  3H8Q A;  1PSQ A;  3LWA A;  3DD3 A;  4HI7 A;  3BD2 A;  1TI3 A;  3PR8 A;  4ML1 A;  5IPH A;  3VUR A;  2O8V B;  5KEJ A;  2YOI A;  1R26 A;  2DJ3 A;  4IGJ A;  4V2L A;  5LCZ A;  2C0D A;  2H0H A;  3GL5 A;  4KSM A;  4MF6 A;  2VUP A;  1SYR A;  1GH2 A;  3CYN A;  3ZL5 A;  3ME7 A;  3HVV A;  1M0U A;  5JCG A;  1YKC A;  1SKS B;  1XPV A;  4X43 A;  3TJJ A;  4FIW A;  5ECN B;  3ZFL A;  2LRN A;  2IFQ B;  2DSA A;  4POL A;  2E0Q A;  3QAG A;  1QFN A;  1ABA A;  3HVS A;  1M9A A;  2CT6 A;  1ML6 A;  4V2N A;  4TR1 A;  1MEK A;  2WRT A;  5CYY A;  2GGT A;  11GS A;  2PPT A;  3G9B A;  1XW9 A;  3LSZ A;  1GTB A;  1TI1 A;  20GS A;  4GTU A;  2MMO A;  5D9X A;  1VF1 A;  3VFI A;  1YEX A;  2LNS A;  2E2M A;  2IME A;  2HT9 A;  3FZA A;  2HE3 A;  3TUE A;  4D73 A;  3CTG A;  2HZE A;  3LXZ A;  5B6N A;  1EWX A;  4L5L A;  3IRA A;  2H73 A;  4Q5F A;  3CXG A;  1NW2 A;  3L0H A;  2RII A;  1Z6N A;  1TU8 A;  2OE3 A;  2GDR A;  6GST A;  3QOU A;  2V2G A;  4IKH A;  1VF3 A;  3FR9 A;  2H0I A;  1XWG A;  4BVY A;  1WRY A;  3V1W A;  3GNJ A;  2PMT A;  2GQL A;  4BWS A;  3VK9 A;  4BVX A;  5D8I A;  2PN8 A;  4G19 A;  3U5R E;  3R2Q A;  2V1M A;  5B8B A;  1PGT A;  3MNG A;  2GT6 A;  4GCI A;  5G1L A;  1HNA A;  1TXX A;  2MBT A;  2JU5 A;  2CV4 A;  3PH9 A;  6GSV A;  2VCX A;  4V1A p;  4YAV A;  3D6I A;  3L9S A;  3GUR A;  4WKW A;  3LXT A;  3VI7 A;  1MD3 A;  5ECO B;  1U3A A;  5KN3 A;  1AQV A;  3PIN A;  2IJY A;  1PKZ A;  4GQF A;  2H6Z A;  1X9W B;  4Z7X A;  5IPG A;  3TCO A;  2K18 A;  2N5F A;  4FYU A;  4MZW A;  1ZOF A;  5ECK B;  5G5F A;  3LEF A;  3GKK A;  2XHF A;  1SD8 A;  4ECB A;  2GS3 A;  1F3B A;  4XRA A;  2YV7 A;  3CMI A;  4KND A;  5A5K A;  1SJ6 A;  2DLX A;  3A5W A;  5COH A;  3A2V A;  4PNF A;  1AQW A;  1FVJ A;  4QL7 A;  1X9S B;  3Q6O A;  1K0M A;  5JCU A;  3HVX A;  2K9F A;  6GSX A;  4JR4 A;  1TW9 A;  6GSU A;  3F4R A;  1YDK A;  4J57 E;  5J41 A;  5IO0 A;  2B1L A;  4DSS B;  4LA1 A;  2WGR A;  1GSF A;  2K6V A;  4TXV A;  2DBC A;  5IOW A;  4JRR A;  6GSY A;  2JSZ A;  17GS A;  5AN1 A;  3GN3 A;  1JZW A;  3BCK A;  1WMJ A;  1TP9 A;  2V32 A;  3VPQ A;  1AUC A;  4K6X A;  3ERG A;  2HRN A;  2N5B A;  1OC9 B;  3LGC A;  2MMA A;  2C80 A;  2OBI A;  2H0G A;  2XC2 A;  2E7P A;  4MJE A;  4K0G A;  1OYJ A;  4PQH A;  7GSS A;  1GSS A;  2B3S A;  3O76 A;  1RK4 A;  2X99 A;  1GNE A;  1Z7P A;  4O92 A;  4TR3 A;  1NSW A;  3FZ9 A;  4KA0 A;  1A23 A;  6GSS A;  1WWJ A;  1T3B A;  2H74 A;  3HD5 A;  5AIV A;  3LJR A;  2Z9S A;  5E59 A;  3SWL A;  4NXI A;  4EDY A;  2EIO A;  3LOR A;  4KDY A;  3UOM A;  1K3O A;  2F9S A;  2G2Q A;  1H4O A;  4ZIL A;  2L4C A;  1G7E A;  3G7J A;  1I5G A;  3HZ8 A;  2OKA A;  2NPB A;  4TVE A;  2YV9 A;  2L5L A;  5FT3 A;  5A4V A;  4N11 A;  4NV2 A;  5G31 A;  3W8S A;  5JWO B;  1M2D A;  1V58 A;  2H75 A;  1VGL A;  1TTZ A;  3UMA A;  3HKR A;  3IXR A;  3ME8 A;  5E4W A;  2J23 A;  1UC7 A;  2GZY A;  3MWH A;  3GH9 A;  4HQZ A;  4TXO B;  3N9J A;  3KP9 A;  1XVW A;  2CQ9 A;  2DML A;  3QAV A;  5EPF A;  4GST A;  2VLV A;  3D0Z A;  3F4T A;  3TOT A;  3ZML A;  2VM2 A;  3MDK A;  4ZXG A;  2IMK A;  1GSE A;  2XBQ A;  3APO A;  3HJM A;  2C0E A;  3CRT A;  2OBK A;  2YZH A;  1LU4 A;  3VWU A;  1QMV A;  1XWK A;  3ZVJ A;  1TDI A;  3ZVJ D;  3FY7 A;  3P2A A;  1A8L A;  1JLW A;  4WF4 A;  4I6X A;  4N0Z A;  3APQ A;  4K2D A;  1DE2 A;  4YQU A;  22GS A;  1XCC A;  3TKS E;  2AUV A;  3NZN A;  3DIE A;  2QC7 A;  3MSZ A;  2YWO A;  3GST A;  1ZCP A;  3ZRE A;  5INY A;  3M0F A;  3CSJ A;  5DCH A;  2C1Y A;  4TR4 A;  5ECR B;  5ECQ B;  1YF0 A;  1FG4 A;  2M72 A;  1F2E A;  1Y25 A;  5ID2 A;  2YCD A;  3BJ5 A;  3M9K A;  1TU7 A;  5DAK B;  2AAW A;  3J7Y b;  2DJJ A;  1ERT A;  5IOX A;  3IDV A;  3P8W A;  1M99 A;  3U6V A;  2WZ9 A;  1R5A A;  1R7H A;  2OAD A;  2JAD A;  3GL3 A;  3OR5 A;  2CX3 A;  4TRX A;  2P5Q A;  3RPN A;  1V98 A;  2IN3 A;  4MJA A;  2F3M A;  4HU7 A;  2DIY A;  4TKY A;  4KDU A;  4POB A;  4ID0 A;  4JED A;  1V57 A;  1R4W A;  4AGS A;  1EGR A;  5KN0 A;  1MTC A;  2HZF A;  1ZMA A;  2JL4 A;  3L9V A;  2WCI A;  5ELG A;  4KUN A;  5CO3 A;  2LEG A;  4TOP A;  3TKQ A;  3L78 A;  2VD0 A;  4FO5 A;  3K8N A;  4NAX A;  3IPZ A;  2PU9 C;  1V2A A;  4XS4 A;  3UL3 A;  4GSN A;  2FHE A;  3CTF A;  4V2M A;  1GL8 A;  1AIU A;  2DJ1 A;  3KP8 A;  2CAQ A;  1BED A;  1M9B A;  1Z9H A;  3H1N A;  1MDJ A;  2C3N A;  3GTU B;  2YAN A;  3KTB A;  3KM6 A;  1SL1 B;  3IC4 A;  2B1K A;  2X8H A;  4QL9 A;  2H1A A;  4KB3 A;  2ES7 A;  3D22 A;  4XHM A;  2FWF A;  5ELA A;  1AC1 A;  2VO4 A;  5DDL A;  3ZRD A;  1UA5 A;  1MDI A;  4HDE A;  4KE3 A;  1T8E B;  1F9M A;  1Q4J A;  2QSI A;  4HOJ A;  2EIR A;  2QKE A;  1Z7R A;  5HFG A;  3ZYW A;  3UAR A;  2I1U A;  2WDU A;  1QUW A;  3A2W A;  1GRX A;  4ZL7 A;  3VI5 A;  4Q5R A;  1LBK A;  4YAP A;  1XW5 A;  5IMC A;  2QGV A;  2OE0 A;  5IIZ A;  2P5R A;  3HJP A;  1X0R A;  1EEM A;  4EC0 A;  2HSH A;  1F37 A;  4AF2 A;  2R5G A;  2O87 A;  4DVC A;  4JE1 A;  4CHS A;  4WXT A;  2C4J A;  3D5J A;  2HYX A;  2LJA A;  3KEB A;  4KDX A;  1SKR B;  4BL7 A;  3KH9 A;  1THX A;  2V6O A;  3DRN A;  3DML A;  1FO5 A;  3DYR A;  4MPF A;  2VL9 A;  1TRW A;  3APS A;  1B4P A;  1TOF A;  1TKD B;  2LUS A;  1HNC A;  5EVO A;  2JZT A;  3UBL A;  1THO A;  1S3D A;  2B5E A;  4WBJ A;  1SKW B;  1SD9 A;  4ML6 A;  16GS A;  4OFM A;  4LL1 B;  2DJ2 A;  5IMV A;  1M2B A;  5AIS A;  3LQ7 A;  2GQM A;  4ZB9 A;  1JLV A;  5FWG A;  5D73 A;  1JZD A;  4JR6 A;  1X5E A;  3ISO A;  4EO3 A;  1URM A;  5J3R A;  3DEX A;  3WGX A;  1GUK A;  4EDZ A;  2H1B A;  3WGE A;  3EC3 A;  1WIK A;  2CA8 A;  2LQQ A;  3JCM L;  1G6Y A;  4EE0 A;  1ERU A;  1FB6 A;  4FYB A;  2KP2 A;  3WYW A;  2A2S A;  1DE1 A;  2KUC A;  1NHY A;  3N5O A;  1ZYQ B;  3IOS A;  4KX4 A;  5CAX A;  3GSS A;  5ECH B;  2H70 A;  4F9Z A;  5HFK A;  1OE7 A;  1PL2 A;  1MDK A;  3ZTL A;  4H86 A;  2EIQ A;  5F07 A;  3TKS C;  2H76 A;  3F0I A;  2VL2 A;  4K7O A;  3Q19 A;  3UEM A;  3F4S A;  3BOA A;  4I5Q A;  5HQP A;  3LYP A;  4ZBA A;  4J2F A;  1EP8 A;  4GWR A;  1O8W A;  1Z6M A;  4ZBB A;  3QFB C;  5L71 A;  2H66 A;  4DEJ A;  3ZIV A;  1K0A A;  4K7I A;  4POM A;  1CQH A;  2PGT A;  4IJI A;  4F03 A;  2KLX A;  5EY6 A;  3GFK A;  1T00 A;  1Y6E A;  3NIV A;  4MJC A;  4YQM A;  1V40 A;  4EUY A;  5IMF A;  3EVI A;  1J9B A;  2MZC A;  4JU5 A;  3HJO A;  1U88 A;  1SK2 A;  1SK1 A;  2B7K A;  2RUF A;  4FH8 A;  1XFL A;  3F3Q A;  9GSS A;  3H4K A;  2O89 A;  2LS5 A;  1ON4 A;  1WJK A;  1ZZY A;  2JZS A;  4I8B A;  4GQC A;  1G6W A;  2CZ3 A;  3TKS A;  1XW6 A;  4TR1 B;  5A4W A;  1VF4 A;  4WET A;  1MD4 A;  1JZO A;  4GLT A;  2LJR A;  1A2J A;  1X9M B;  3F8U A;  1FW1 A;  4JZQ A;  3VWX A;  1VRS D;  1V9W A;  4IEL A;  4BPY A;  4WR4 A;  2ALB A;  4IS0 A;  4PUF C;  5GSS A;  1GLQ A;  4D73 B;  14GS A;  3Q18 A;  2HZE B;  1T7P B;  1OKT A;  3AY8 A;  3EU4 A;  3IBH A;  3KZQ A;  5F0G A;  4NHW A;  4XS6 A;  4HZ2 A;  5H5R A;  5G1K A;  5CRD A;  2VCZ A;  4NPB A;  1SL0 B;  5ENU A;  5JWQ B;  2VM1 A;  4IQ1 A;  5IQY A;  5HR0 A;  4X1U A;  3HCZ A;  2DC5 A;  2DIZ A;  3C71 A;  5DQS A;  2LKU A;  4YH2 A;  1B8X A;  1HNB A;  5CP1 A;  1AAZ A;  3US3 A;  4EL1 A;  3IAS 2;  1OKD A;  2H6Y A;  2M80 A;  8GSS A;  1AQX A;  1S3A A;  2KP1 A;  1U87 A;  3QMX A;  3ERW A;  1K3L A;  3CSI A;  2L6D A;  5IO2 A;  2IMF A;  2NTO A;  5D9T A;  3M3M A;  1Z5Y E;  1LJR A;  3H79 A;  1QGV A;  1IYH A;  1GSD A;  3UIW A;  2X8C A;  2YJ7 A;  2ZNM A;  3VWV A;  4AJ8 A;  3GHA A;  4MLY A;  2DJ0 A;  3KD0 A;  5CRG A;  2C0F A;  4MDC A;  5DAL A;  4ZL8 A;  1GTA A;  2PVQ A;  3ZMK A;  4K7N A;  2HRF A;  4G9H A;  4KSO A;  1K3Y A;  2MBS A;  1PRX A;  2H6X A;  3EIN A;  2L5O A;  4TW5 A;  1TK0 B;  2JAC A;  5H5S A;  5A4U A;  2FD3 A;  2CAI A;  1O81 A;  4HQS A;  4QQ7 A;  3FKF A;  4MH3 A;  3HY2 A;  1BYE A;  2GTU A;  3M1G A;  2F51 A;  2O7K A;  1GP1 A;  3L4N A;  5ECL B;  3E3E A;  2WFC A;  3LFL A;  4HS1 A;  3W6G A;  4GSS A;  1B48 A;  3EE2 A;  3KIJ A;  3ZIJ A;  10GS A;  1GWC A;  2X8G A;  2AB6 A;  4ECC A;  3GYK A;  5DJM A;  2BTO T;  3QPM A;  5D93 A;  2G0F A;  2REM A;  2N5A A;  2PWJ A;  3LG6 A;  1PL1 A;  4PUA A;  1PQN A;  4IW9 A;  5F05 A;  2IFQ A;  3TRP A;  4AJ6 A;  5IMA A;  1WP0 A;  4F2I A;  3CBU A;  2AYT A;  3H93 A;  2A4V A;  1M7T A;  4KGI A;  3IV4 A;  2GQK A;  5B7C A;  2OA7 A;  3TJK A;  3ZFB A;  5ABR A;  1SJZ A;  1H75 A;  4ZB6 A;  3A2X A;  2ON7 A;  3IK7 A;  4XS1 A;  1GSU A;  4CDO A;  1G7O A;  1O6J A;  2X64 A;  1N2A A;  1A2L A;  4Q5Q A;  4FYC A;  1K0N A;  2H71 A;  4BWQ A;  3G7I A;  2IL3 A;  3VLN A;  3TKR A;  4WF5 A;  3FK8 A;  2L57 A;  4RQR A;  3HYP A;  4I2T A;  1EEJ A;  5DBQ A;  4ZBD A;  1AW9 A;  2E2G A;  1E2Y A;  3TDG A;  2PER A;  1FAA A;  4L5O A;  2GST A;  4IP6 A;  2HLS A;  1RW1 A;  4XCS A;  2KHP A;  4OWY A;  1BJX A;  2B7J A;  5GZZ B;  1RQM A;  2RUE A;  3Q74 A;  1A8Y A;  1HQO A;  4DSR A;  2TRX A;  3C73 A;  3BCI A;  4ULX A;  1WPI A;  2R4V A;  4KCA A;  19GS A;  4ZL9 A;  3E9J B;  4LL4 B;  2FCH A;  2LQO A;  1OE8 A;  2R2J A;  5FHI A;  2YWI A;  2MMN A;  1PX6 A;  3D4M A;  5KN1 A;  3VWW A;  2YNX A;  4IVF A;  2I3Y A;  2VCW A;  3DWV A;  5HFI A;  2VLU A;  4O7H A;  3RDW A;  1NHO A;  3KJY A;  2WS2 A;  3MAK A;  1GTU A;  1K0B A;  2VL3 A;  5J4U A;  1EZK A;  1TRV A;  3WT2 A;  3DKS A;  4XIH A;  4PQI A;  5DCG A;  2CVB A;  2GLR A;  2I9H A;  1USB A;  1A0F A;  2FGX A;  2RM6 A;  3KMO A;  2XPD A;  4AJ7 A;  1XOA A;  3DGQ A;  18GS A;  4XRD A;  1DSB A;  3ZLP A;  2CVD A;  2EC4 A;  2HSY A;  2ZCT A;  4RI6 A;  3WD6 A;  4OD7 A;  4YQV A;  1EOH A;  2TIR A;  1O73 A;  3TKP A;  1KTE A;  4RUV A;  1CQG A;  3HZ4 A;  2I4A A;  5DVB A;  1PKW A;  1N8J A;  3QFA C;  4F0B A;  1BQ7 A;  1PD2 1;  3C7M A;  4TN8 A;  1QXH A;  2H8L A;  5AGY A;  2GZZ A;  1DBY A;  1ERV A;  1GNW A;  2FWE A;  1W4V A;  2LST A;  4HUA A;  3QD9 A;  1J0F A;  4BA7 A;  3C1S A;  1C72 A;  5DJL A;  4RQX A;  1PX7 A;  4N0V A;  2OJL A;  2OAC A;  4OO4 A;  1NM3 A;  4OFN A;  1ST9 A;  2R6K A;  3F6F A;  2DJK A;  4WBR D;  1EV4 A;  3BBY A;  2OE1 A;  4OMV A;  1XIY A;  2HI7 A;  1U3I A;  2VAF A;  3GX0 A;  4NV5 A;  4IHU A;  2NBS A;  1VF2 A;  5ID2 B;  2M46 A;  4X0X A;  4GXZ A;  1EP7 A;  2H72 A;  4DSS A;  5HR3 A;  3RPP A;  3IHQ A;  3D4T A;  5AIX A;  2I81 A;  3I6A A;  2VL2 C;  4MK3 A;  4EKZ A;  2P31 A;  2LV3 A;  5IMZ A;  2L4Q A;  2FWG A;  1T1V A;  1B4Q A;  1GSY A;  3TRQ A;  3TJF A;  3GKN A;  5LNK e;  2B5Y A;  3O3T A;  4E8H A;  2GSS A;  1KEB A;  2MYG A;  3G7Y A;  1OC9 A;  1UN2 A;  4N10 A;  3IR4 A;  2MMZ A;  1ZYE A;  2K8V A;  3GUS A;  1JFU A;  4NWY A;  1GLP A;  5JCW A;  1EGO A;  4PX1 A;  2VIM A;  3ED3 A;  4XS4 B;  4ZIJ A;  1YKA A;  5CRW A;  4Q5N A;  3RAZ A;  2VLT A;  1EV9 A;  1TK5 B;  2C0G A;  4POK A;  1TK8 B;  4ILF A;  3EMP A;  2KOK A;  1F3A A;  3P90 A;  3KMN A;  1QK8 A;  1YJ6 A;  2C8U A;  3FZ5 A;  3GKM A;  3PGT A;  3ZZX A;  1X5C A;  4L0U A;  1SYX A;  3KCM A;  3GIX A;  2BMX A;  4G10 A;  1GUH A;  1GUL A;  3M9J A;  3UBK A;  2YWM A;  1BG5 A;  3GA4 A;  4HU9 A;  1FB0 A;  2AHE A;  1HD2 A;  5ECS A;  1SK0 A;  2FA8 A;  1Q98 A;  4N30 A;  3CRU A;  1OC3 A;  1W89 A;  3DVW A;  1XBS A;  2A2R A;  2B5X A;  2IWT A;  1ACV A;  4MZB A;  1O7U A;  1M2A A;  2H19 A;  4F0C A;  5KN2 A;  4V1A g;  5ECM B;  1O8X A;  4TXO A;  2IMI A;  4PXO A;  1A24 A;  3F63 A;  4PGT A;  2VD1 A;  5CRH A;  1KNG A;  1B9X C;  2BJX A;  3GRX A;  3I9V 2;  4K0N A;  1XOB A;  5H5Q A;  3O6T A;  2PVO C;  5B6M A;  1SL2 B;  2PBJ A;  1I9D A;  1JHB A;  1BAY A;  3EYT A;  4IQA A;  3I43 A;  5DQY A;  2R3X A;  2IMD A;  1GSQ A;  4XTS A;  3S9F A;  2YJH A;  1ILO A;  1X5D A;  4O32 A;  1IYI A;  4MF7 A;  2PUK C;  2J9H A;  1UVZ A;  5J5N A;  2VCV A;  2L59 A;  1XXU A;  3IK9 A;  4LMW A;  3SBC A;  4MA9 A;  2WJU A;  4I97 A;  1S3C A;  3HA9 A;  3UJ1 A;  5LD0 A;  4GRF A;  3QAW A;  3FRC A;  1Z3E A;  3C1R A;  1T4Y A;  2CZ2 A;  4NMU A;  2XBI A;  2LTK A;  3J7Y k;  1DUG A;  2LRT A;  2CX4 A;  4ECJ A;  4PQ1 A;  4OCF A;  2JZR A;  1YY7 A;  4IP1 A;  1SJI A;  3GV1 A;  3ZIT A;  1O85 A;  1J08 A;  5DAK A;  4PUR A;  1EOG A;  1PA3 A;  3IE3 A;  5CRE A;  4HJ2 A;  3HDC A;  1TJD A;  2FNO A;  5F8B A;  5G2Z A;  4K8M A;  3A3T A;  1XZO A;  12GS A;  2HXK A;  1U6T A;  2CVK A;  2YN1 A;  1XWB A;  2V41 A;  4KH7 A;  4ACS A;  1YZX A;  4MF5 A;  5J9C A;  5F06 A;  4EVM A;  3M8N A;  4F82 A;  3C8E A;  3IAM 2;  4LMV A;  4L0W A;  2JSY A;  2P0G A;  3GH6 A;  4ISD A;  4TR0 A;  3CSH A;  1HYU A;  4J56 E;  1XWC A;  1SU9 A;  4L8E A;  4DSQ A;  4MPG A;  3TRX A;  2HNL A;  3TB2 A;  3GKX A;  1B9Y C;  3KH7 A;  3QDN A;  2H1G A;  4EXJ A;  3I69 A;  2NDO A;  4K1F A;  6GSW A;  3QCP A;  4KW6 A;  4MP4 A;  2GZP A;  4P3Y B;  1FVK A;  2ZUP A;  1OC8 A;  5HR2 A;  1YEP A;  5B8A A;  1YQ1 A;  1SEN A;  2K8S A;  3EMX A;  2D2Z A;  2NVL A;  4WR5 A;  4MJB A;  2GSQ A;  3WT1 A;  3RHC A;  1PN9 A;  2YZU A;  4GF0 A;  1OAZ A;  5CNW A;  4OO5 A;  3GTU A;  4OCE A;  2GT5 A;  3TGZ A;  1PMT A;  5ECI B;  3E0U A;  3RHB A;  2LRC A;  5GAN D;  1A0R P;  5IM9 A;  1YF1 A;  5C00 A;  1XVQ A;  5D9V A;  5GAP D;  1OVN A;  3UVH A;  4MMM A;  3UVT A;  1GUM A;  5G5E A;  1K0C A;  3F3R A;  3WGD A;  2ON5 A;  4IN0 A;  4NHZ A; 
#chains in the Genus database with same CATH topology
 2LJK A;  3FEU A;  1E6B A;  3W8J A;  2DMM A;  2FA4 A;  1WE0 A;  3FR6 A;  3F6D A;  2FUG 2;  1T4Z A;  3TJB A;  3EU3 A;  4KCE A;  2VOC A;  2XPE A;  3GMF A;  4FQU A;  2VCQ A;  2C3T A;  2YPM A;  4KAE A;  3L9U A;  3EUR A;  2V6K A;  3KXO A;  1S3R A;  3FZ4 A;  4OFT A;  3D21 A;  3DXB A;  3TJG A;  3HXS A;  4IBP A;  3FHK A;  1ZL9 A;  3EWL A;  2WUL A;  4LLR A;  3IA1 A;  2H1D A;  5IMD A;  5ECP B;  1TRS A;  1ZGN A;  1R5P A;  3LYK A;  2F8A A;  3QR6 A;  3FW2 A;  1AXD A;  5D9W A;  2L6C A;  2IIY A;  3KGK A;  3DVX A;  3ERF A;  3RBT A;  4ECI A;  2LNT A;  3P7X A;  2YWN A;  5HR1 A;  4PNG A;  4ZB8 A;  4EIQ A;  3PPU A;  4MZC A;  2IPA A;  1K0D A;  2TRC P;  4JBB A;  1BX9 A;  4WEY A;  1FOH A;  5GST A;  4IJ3 A;  4K9Z A;  4G2E A;  4MH2 A;  2RM5 A;  4HZ4 A;  3F9U A;  3KTL A;  5G30 A;  1PN0 A;  5C04 A;  3GX8 A;  5JWR B;  2AJQ B;  13GS A;  2FWH A;  1K0O A;  4O5R A;  1F6M C;  4EF0 A;  2YP6 A;  2H01 A;  2B6M A;  1KBN A;  2H30 A;  2AV4 A;  5D96 A;  3FR3 A;  3UAP A;  1QQ2 A;  2FLS A;  5J9B A;  3NOF A;  2C3Q A;  2GVP A;  3TOU A;  2GSR A;  1A2M A;  3FYG A;  1FOV A;  2VCT A;  1G0T A;  2O85 A;  4E8E A;  3IC8 A;  2F8F A;  2FY6 A;  2WB9 A;  5DAL B;  4HJM A;  4MCU A;  3HHV A;  3VPT A;  4HEA 2;  2QA1 A;  1FHE A;  1WOU A;  1JZR A;  4MAB A;  2HFD A;  5EL8 A;  2RLI A;  1XWA A;  1GTI A;  1ERW A;  4I2U A;  2R37 A;  1TRU A;  4RI7 A;  4CW9 A;  3H8Q A;  1PSQ A;  3LWA A;  3DD3 A;  4HI7 A;  3BD2 A;  2R0C A;  1TI3 A;  3PR8 A;  4ML1 A;  5IPH A;  3VUR A;  2O8V B;  5KEJ A;  2YOI A;  1R26 A;  2DJ3 A;  2DKI A;  4IGJ A;  4V2L A;  5LCZ A;  2C0D A;  2H0H A;  3GL5 A;  4KSM A;  4MF6 A;  2VUP A;  1SYR A;  1GH2 A;  3CYN A;  3ZL5 A;  3ME7 A;  3HVV A;  2HRK A;  1M0U A;  5JCG A;  1YKC A;  1SKS B;  1XPV A;  4X43 A;  3TJJ A;  4FIW A;  5ECN B;  3ZFL A;  2LRN A;  2IFQ B;  2DSA A;  4POL A;  2E0Q A;  3QAG A;  1QFN A;  1ABA A;  3HVS A;  1M9A A;  2CT6 A;  1ML6 A;  4V2N A;  4TR1 A;  1MEK A;  2WRT A;  4MNN A;  5CYY A;  2GGT A;  11GS A;  2PPT A;  3G9B A;  1XW9 A;  3LSZ A;  1GTB A;  3CQF A;  1TI1 A;  20GS A;  4GTU A;  2MMO A;  5D9X A;  1VF1 A;  3VFI A;  1YEX A;  2LNS A;  2E2M A;  2IME A;  2HT9 A;  3FZA A;  2HE3 A;  3TUE A;  4D73 A;  3CTG A;  4KF9 A;  2HZE A;  3LXZ A;  3IHG A;  5B6N A;  1EWX A;  4L5L A;  1M3J A;  3IRA A;  2H73 A;  4Q5F A;  3CXG A;  1NW2 A;  3L0H A;  2RII A;  1Z6N A;  1TU8 A;  2OE3 A;  2GDR A;  3MYD A;  6GST A;  3QOU A;  2V2G A;  4IKH A;  1VF3 A;  3FR9 A;  2H0I A;  1XWG A;  4BVY A;  1WRY A;  3V1W A;  3GNJ A;  2PMT A;  2GQL A;  4BWS A;  3VK9 A;  4BVX A;  5D8I A;  2PN8 A;  4G19 A;  3U5R E;  3R2Q A;  2V1M A;  5B8B A;  1PGT A;  3MNG A;  2GT6 A;  4GCI A;  5G1L A;  1HNA A;  1TXX A;  2MBT A;  2JU5 A;  2CV4 A;  3PH9 A;  6GSV A;  2VCX A;  4V1A p;  4YAV A;  3D6I A;  3L9S A;  3GUR A;  4WKW A;  3LXT A;  3VI7 A;  1MD3 A;  5ECO B;  1U3A A;  5KN3 A;  1AQV A;  3PIN A;  2IJY A;  1PKZ A;  4GQF A;  2H6Z A;  1X9W B;  4Z7X A;  5IPG A;  3TCO A;  2K18 A;  2N5F A;  4FYU A;  4MZW A;  1ZOF A;  5ECK B;  5G5F A;  3LEF A;  3GKK A;  2XHF A;  1SD8 A;  4ECB A;  2GS3 A;  1F3B A;  4XRA A;  2YV7 A;  3CMI A;  4KND A;  5A5K A;  1SJ6 A;  2DLX A;  2X49 A;  3A5W A;  5COH A;  3A2V A;  4PNF A;  1AQW A;  1FVJ A;  4QL7 A;  4Z2R A;  1X9S B;  3Q6O A;  1K0M A;  5JCU A;  3HVX A;  2K9F A;  6GSX A;  4JR4 A;  1TW9 A;  6GSU A;  3F4R A;  1YDK A;  4J57 E;  5J41 A;  5IO0 A;  2B1L A;  4DSS B;  4LA1 A;  2R0G A;  2WGR A;  1GSF A;  2K6V A;  4TXV A;  2DBC A;  5IOW A;  4JRR A;  6GSY A;  2JSZ A;  17GS A;  5AN1 A;  3GN3 A;  1JZW A;  3BCK A;  1WMJ A;  1TP9 A;  2V32 A;  3VPQ A;  1AUC A;  4K6X A;  3FMW A;  4EIP A;  3ERG A;  2HRN A;  2N5B A;  1OC9 B;  3LGC A;  2MMA A;  2C80 A;  2OBI A;  2H0G A;  2XC2 A;  2E7P A;  4MJE A;  4K0G A;  1OYJ A;  4O5U A;  4PQH A;  7GSS A;  1GSS A;  2B3S A;  3O76 A;  1RK4 A;  2X99 A;  1GNE A;  1Z7P A;  4O92 A;  4TR3 A;  1NSW A;  3FZ9 A;  3EPT A;  4KA0 A;  1A23 A;  6GSS A;  1WWJ A;  1T3B A;  2H74 A;  3HD5 A;  5AIV A;  3LJR A;  2Z9S A;  1M3I A;  5E59 A;  3SWL A;  4NXI A;  4EDY A;  2EIO A;  3LOR A;  4KDY A;  3UOM A;  1K3O A;  2F9S A;  2G2Q A;  1H4O A;  4ZIL A;  2L4C A;  1G7E A;  3G7J A;  1I5G A;  3HZ8 A;  2OKA A;  2NPB A;  4TVE A;  2YV9 A;  2L5L A;  5FT3 A;  5A4V A;  4N11 A;  4NV2 A;  5G31 A;  3W8S A;  5JWO B;  1M2D A;  4G0K A;  1V58 A;  2H75 A;  1VGL A;  1TTZ A;  3UMA A;  3HKR A;  3IXR A;  3ME8 A;  5E4W A;  2J23 A;  1UC7 A;  2GZY A;  3MWH A;  3GH9 A;  4HQZ A;  4TXO B;  3N9J A;  3KP9 A;  1XVW A;  2CQ9 A;  2DML A;  3QAV A;  5EPF A;  4GST A;  2VLV A;  3D0Z A;  3F4T A;  3TOT A;  3ZML A;  2VM2 A;  3MDK A;  5KOX A;  4ZXG A;  2IMK A;  1GSE A;  2XBQ A;  3APO A;  3HJM A;  2C0E A;  3CRT A;  2OBK A;  2YZH A;  1LU4 A;  3VWU A;  1QMV A;  1XWK A;  3ZVJ A;  1TDI A;  3ZVJ D;  3FY7 A;  3P2A A;  1A8L A;  1JLW A;  4WF4 A;  4I6X A;  4N0Z A;  3APQ A;  4K2D A;  1DE2 A;  4YQU A;  22GS A;  1XCC A;  3TKS E;  2AUV A;  3NZN A;  3DIE A;  2QC7 A;  3MSZ A;  2YWO A;  3GST A;  1ZCP A;  3ZRE A;  5INY A;  3M0F A;  3CSJ A;  5DCH A;  2C1Y A;  4TR4 A;  5ECR B;  4X4J A;  5ECQ B;  1YF0 A;  2A2P A;  1FG4 A;  2M72 A;  1F2E A;  1Y25 A;  5ID2 A;  2YCD A;  3BJ5 A;  3M9K A;  2HRA A;  1TU7 A;  5DAK B;  2AAW A;  3J7Y b;  2DJJ A;  1ERT A;  5IOX A;  3IDV A;  3P8W A;  1M99 A;  3U6V A;  2WZ9 A;  1R5A A;  1R7H A;  2OAD A;  2JAD A;  3GL3 A;  3OR5 A;  2CX3 A;  4TRX A;  2P5Q A;  3RPN A;  1V98 A;  2IN3 A;  4MJA A;  2F3M A;  4HU7 A;  2DIY A;  4TKY A;  4KDU A;  4POB A;  4ID0 A;  4JED A;  1V57 A;  1R4W A;  4AGS A;  1EGR A;  5KN0 A;  1MTC A;  2HZF A;  1ZYP A;  4BIK A;  1ZMA A;  2JL4 A;  3L9V A;  2WCI A;  5ELG A;  4KUN A;  5CO3 A;  2LEG A;  4TOP A;  3TKQ A;  3L78 A;  2VD0 A;  4FO5 A;  3K8N A;  4NAX A;  3IPZ A;  4G0I A;  2PU9 C;  1V2A A;  4XS4 A;  3UL3 A;  4GSN A;  2FHE A;  3CTF A;  4V2M A;  1GL8 A;  1AIU A;  2DJ1 A;  3KP8 A;  2CAQ A;  1BED A;  1M9B A;  1Z9H A;  3H1N A;  1MDJ A;  2C3N A;  3GTU B;  2YAN A;  3KTB A;  4G0L A;  3KM6 A;  1SL1 B;  3IC4 A;  2B1K A;  2X8H A;  4QL9 A;  2H1A A;  4Z2U A;  4KB3 A;  2ES7 A;  3D22 A;  3R3E A;  4XHM A;  2FWF A;  5ELA A;  1AC1 A;  2VO4 A;  5DDL A;  3ZRD A;  1UA5 A;  1MDI A;  4HDE A;  4KE3 A;  1T8E B;  1F9M A;  1Q4J A;  2QSI A;  4HOJ A;  2EIR A;  2QKE A;  1Z7R A;  5HFG A;  3ZYW A;  3UAR A;  2I1U A;  2WDU A;  1QUW A;  3A2W A;  1GRX A;  4ZL7 A;  3VI5 A;  4Q5R A;  1LBK A;  4YAP A;  1XW5 A;  5IMC A;  2QGV A;  2OE0 A;  5IIZ A;  2P5R A;  3HJP A;  1X0R A;  1EEM A;  4EC0 A;  2HSH A;  1F37 A;  4AF2 A;  2R5G A;  2O87 A;  4DVC A;  4JE1 A;  4CHS A;  4WXT A;  2C4J A;  3D5J A;  2HYX A;  2LJA A;  3KEB A;  4KDX A;  1SKR B;  4BL7 A;  3KH9 A;  1THX A;  2V6O A;  3DRN A;  3DML A;  1FO5 A;  3DYR A;  4MPF A;  2VL9 A;  1TRW A;  3APS A;  1B4P A;  1TOF A;  1TKD B;  2LUS A;  1HNC A;  5EVO A;  2JZT A;  3UBL A;  1THO A;  1S3D A;  2B5E A;  4WBJ A;  1SKW B;  1SD9 A;  4ML6 A;  16GS A;  4OFM A;  4LL1 B;  2DKH A;  2DJ2 A;  5IMV A;  1M2B A;  5AIS A;  3LQ7 A;  2GQM A;  4ZB9 A;  1JLV A;  5FWG A;  5D73 A;  1JZD A;  4JR6 A;  2UZ8 A;  1X5E A;  3ISO A;  4EO3 A;  1URM A;  5J3R A;  3DEX A;  4HSC X;  3WGX A;  1GUK A;  4EDZ A;  2H1B A;  3WGE A;  3EC3 A;  1WIK A;  2CA8 A;  2LQQ A;  3JCM L;  1G6Y A;  4EE0 A;  1ERU A;  1FB6 A;  4FYB A;  2KP2 A;  3WYW A;  2A2S A;  1DE1 A;  2KUC A;  1NHY A;  3N5O A;  1ZYQ B;  3IOS A;  4KX4 A;  5CAX A;  3GSS A;  5ECH B;  2H70 A;  4F9Z A;  5HFK A;  1OE7 A;  1PL2 A;  1MDK A;  3ZTL A;  4H86 A;  2EIQ A;  5F07 A;  3TKS C;  2H76 A;  3F0I A;  2VL2 A;  4K7O A;  3Q19 A;  3UEM A;  3F4S A;  3BOA A;  4I5Q A;  5HQP A;  3LYP A;  4ZBA A;  4J2F A;  1ZYN A;  1EP8 A;  4GWR A;  1O8W A;  1Z6M A;  4ZBB A;  3QFB C;  5L71 A;  2H66 A;  4DEJ A;  3ZIV A;  1K0A A;  4K7I A;  4POM A;  1CQH A;  2PGT A;  4IJI A;  4F03 A;  2KLX A;  5EY6 A;  3GFK A;  1T00 A;  1Y6E A;  3NIV A;  4MJC A;  4YQM A;  1V40 A;  4EUY A;  5IMF A;  4PTS A;  3EVI A;  1J9B A;  2MZC A;  4JU5 A;  3HJO A;  1U88 A;  1SK2 A;  1SK1 A;  2B7K A;  2RUF A;  4FH8 A;  1XFL A;  3F3Q A;  9GSS A;  3H4K A;  2O89 A;  2LS5 A;  1ON4 A;  1WJK A;  1ZZY A;  2JZS A;  4I8B A;  4GQC A;  1G6W A;  2CZ3 A;  3TKS A;  1XW6 A;  4TR1 B;  5A4W A;  1VF4 A;  4WET A;  1MD4 A;  1JZO A;  4GLT A;  2LJR A;  1A2J A;  1X9M B;  3F8U A;  1XG8 A;  1FW1 A;  4JZQ A;  3VWX A;  1VRS D;  1V9W A;  4IEL A;  4BPY A;  4WR4 A;  2ALB A;  4IS0 A;  4PUF C;  5GSS A;  1GLQ A;  4D73 B;  14GS A;  3Q18 A;  2HZE B;  1T7P B;  1OKT A;  3AY8 A;  3EU4 A;  3IBH A;  2R0P A;  3KZQ A;  5F0G A;  4NHW A;  4XS6 A;  4HZ2 A;  5H5R A;  5G1K A;  5CRD A;  2VCZ A;  4NPB A;  1SL0 B;  5ENU A;  5BRT A;  5JWQ B;  2VM1 A;  4IQ1 A;  5IQY A;  5HR0 A;  4X1U A;  3HCZ A;  2DC5 A;  2DIZ A;  3C71 A;  5DQS A;  2LKU A;  4YH2 A;  1B8X A;  1HNB A;  5CP1 A;  1AAZ A;  3US3 A;  4EL1 A;  3IAS 2;  1OKD A;  2H6Y A;  2M80 A;  8GSS A;  1AQX A;  1S3A A;  2KP1 A;  1U87 A;  4BVY B;  3QMX A;  3ERW A;  1K3L A;  3CSI A;  2L6D A;  5IO2 A;  4BVX B;  2IMF A;  2A4H A;  2NTO A;  5D9T A;  3M3M A;  1Z5Y E;  1LJR A;  3H79 A;  1QGV A;  1IYH A;  1GSD A;  3UIW A;  2X8C A;  2YJ7 A;  2ZNM A;  3VWV A;  4AJ8 A;  3GHA A;  4O5Q A;  4MLY A;  2DJ0 A;  3KD0 A;  5CRG A;  2HSM A;  2C0F A;  4MDC A;  5DAL A;  4ZL8 A;  1GTA A;  2PVQ A;  3ZMK A;  4K7N A;  2HRF A;  4G9H A;  4KSO A;  1K3Y A;  2MBS A;  1PRX A;  2H6X A;  3EIN A;  4CY6 A;  2L5O A;  4TW5 A;  1TK0 B;  2JAC A;  5H5S A;  5A4U A;  2FD3 A;  2CAI A;  1O81 A;  4HQS A;  4QQ7 A;  3FKF A;  4MH3 A;  3HY2 A;  1BYE A;  2GTU A;  3M1G A;  2F51 A;  2O7K A;  1GP1 A;  3L4N A;  5ECL B;  3E3E A;  2WFC A;  3LFL A;  4HS1 A;  3W6G A;  4GSS A;  1B48 A;  3EE2 A;  3KIJ A;  3ZIJ A;  10GS A;  1GWC A;  2X8G A;  2AB6 A;  4ECC A;  3GYK A;  5DJM A;  2BTO T;  3QPM A;  5D93 A;  2G0F A;  2REM A;  2N5A A;  2PWJ A;  3LG6 A;  1PL1 A;  4PUA A;  1PQN A;  4IW9 A;  5F05 A;  2IFQ A;  3TRP A;  4AJ6 A;  5IMA A;  1WP0 A;  4F2I A;  3CBU A;  2AYT A;  3H93 A;  2A4V A;  1M7T A;  4KGI A;  3IV4 A;  2GQK A;  5B7C A;  2OA7 A;  3TJK A;  3ZFB A;  5ABR A;  1SJZ A;  1H75 A;  4ZB6 A;  3A2X A;  2ON7 A;  3IK7 A;  4XS1 A;  1GSU A;  4CDO A;  1G7O A;  1O6J A;  2X64 A;  1N2A A;  1A2L A;  4Q5Q A;  4FYC A;  1K0N A;  2H71 A;  4BWQ A;  3G7I A;  2IL3 A;  2QA2 A;  3VLN A;  3TKR A;  4WF5 A;  3FK8 A;  2L57 A;  4RQR A;  3HYP A;  4I2T A;  1EEJ A;  5DBQ A;  4ZBD A;  1AW9 A;  2E2G A;  1E2Y A;  3TDG A;  2PER A;  1FAA A;  4L5O A;  2GST A;  4IP6 A;  2HLS A;  1RW1 A;  4XCS A;  2KHP A;  4OWY A;  1BJX A;  2B7J A;  4K5R A;  5GZZ B;  1RQM A;  2RUE A;  3Q74 A;  1A8Y A;  1HQO A;  4DSR A;  4Z2T A;  2TRX A;  3C73 A;  3BCI A;  4ULX A;  1WPI A;  2R4V A;  4KCA A;  19GS A;  4ZL9 A;  3E9J B;  4LL4 B;  2FCH A;  2LQO A;  1OE8 A;  2R2J A;  5FHI A;  2YWI A;  2MMN A;  1PX6 A;  3D4M A;  5KN1 A;  3VWW A;  2YNX A;  4IVF A;  2I3Y A;  2VCW A;  3DWV A;  3A5I A;  5HFI A;  2VLU A;  4O7H A;  3RDW A;  1NHO A;  3KJY A;  2WS2 A;  3MAK A;  1GTU A;  1K0B A;  2VL3 A;  5J4U A;  1EZK A;  1TRV A;  3WT2 A;  1PFO A;  3DKS A;  4PQI A;  4XIH A;  5DCG A;  2CVB A;  2GLR A;  2I9H A;  1USB A;  1A0F A;  2FGX A;  2RM6 A;  3KMO A;  2XPD A;  4AJ7 A;  1XOA A;  3DGQ A;  18GS A;  4XRD A;  1DSB A;  3ZLP A;  2CVD A;  2EC4 A;  2HSY A;  2ZCT A;  4RI6 A;  3WD6 A;  4OD7 A;  4YQV A;  1EOH A;  2TIR A;  1O73 A;  3TKP A;  1KTE A;  4RUV A;  1CQG A;  3HZ4 A;  2I4A A;  5DVB A;  1PKW A;  1N8J A;  3QFA C;  4F0B A;  1BQ7 A;  4K5S A;  1PD2 1;  3C7M A;  4TN8 A;  1QXH A;  2H8L A;  5AGY A;  2GZZ A;  1DBY A;  1ERV A;  1GNW A;  2FWE A;  1W4V A;  2LST A;  4HUA A;  3QD9 A;  1J0F A;  4BA7 A;  3C1S A;  1C72 A;  5DJL A;  4RQX A;  1PX7 A;  4N0V A;  2OJL A;  2OAC A;  4OO4 A;  1NM3 A;  4OFN A;  1ST9 A;  2R6K A;  3F6F A;  2DJK A;  4WBR D;  1EV4 A;  3BBY A;  2OE1 A;  4OMV A;  1XIY A;  2HI7 A;  1U3I A;  2VAF A;  3GX0 A;  4NV5 A;  4IHU A;  2NBS A;  1VF2 A;  5ID2 B;  2M46 A;  4X0X A;  4GXZ A;  1EP7 A;  2H72 A;  4DSS A;  5HR3 A;  3RPP A;  3IHQ A;  3D4T A;  5AIX A;  2I81 A;  3I6A A;  4YKG A;  2VL2 C;  4MK3 A;  4EKZ A;  5KOW A;  2P31 A;  2LV3 A;  5IMZ A;  2L4Q A;  2FWG A;  1T1V A;  1B4Q A;  1GSY A;  3TRQ A;  3TJF A;  3GKN A;  5LNK e;  2B5Y A;  4ICY A;  3O3T A;  4E8H A;  2GSS A;  1KEB A;  2MYG A;  3G7Y A;  1OC9 A;  1UN2 A;  4N10 A;  4K2X A;  3IR4 A;  2MMZ A;  1ZYE A;  2K8V A;  3GUS A;  1JFU A;  3LW9 A;  2X4A A;  4NWY A;  1GLP A;  5JCW A;  1EGO A;  4PX1 A;  2VIM A;  3ED3 A;  4XS4 B;  4ZIJ A;  1YKA A;  5CRW A;  4Q5N A;  3RAZ A;  2VLT A;  1EV9 A;  1TK5 B;  2C0G A;  4POK A;  1TK8 B;  4ILF A;  3EMP A;  2KOK A;  1F3A A;  3P90 A;  3KMN A;  1QK8 A;  1YJ6 A;  2C8U A;  3FZ5 A;  3GKM A;  3PGT A;  3ZZX A;  1X5C A;  4L0U A;  1SYX A;  3KCM A;  3GIX A;  2BMX A;  4G10 A;  1GUH A;  1GUL A;  3M9J A;  3UBK A;  2YWM A;  1BG5 A;  3GA4 A;  4HU9 A;  1FB0 A;  2AHE A;  1HD2 A;  5ECS A;  1SK0 A;  2FA8 A;  1Q98 A;  4N30 A;  3CRU A;  1OC3 A;  1W89 A;  3DVW A;  1XBS A;  2A2R A;  4YKF A;  2B5X A;  2IWT A;  1ACV A;  4MZB A;  1O7U A;  1M2A A;  2H19 A;  4F0C A;  3MIX A;  5KN2 A;  4V1A g;  5ECM B;  1O8X A;  4TXO A;  2IMI A;  4PXO A;  1A24 A;  3F63 A;  4PGT A;  2VD1 A;  5CRH A;  1KNG A;  1B9X C;  2BJX A;  3GRX A;  3I9V 2;  4K0N A;  1XOB A;  5H5Q A;  3O6T A;  2PVO C;  5B6M A;  1SL2 B;  2PBJ A;  1I9D A;  1JHB A;  1BAY A;  3EYT A;  4IQA A;  3I43 A;  5DQY A;  2R3X A;  2IMD A;  1GSQ A;  4XTS A;  4CY8 A;  3S9F A;  2YJH A;  5BMU A;  1ILO A;  1X5D A;  4O32 A;  1IYI A;  4BL7 B;  4MF7 A;  2PUK C;  2J9H A;  1UVZ A;  5J5N A;  2VCV A;  2L59 A;  1XXU A;  3IK9 A;  4LMW A;  3SBC A;  4MA9 A;  2WJU A;  4I97 A;  1S3C A;  3HA9 A;  3UJ1 A;  5LD0 A;  4GRF A;  3QAW A;  3FRC A;  1Z3E A;  3C1R A;  1T4Y A;  2CZ2 A;  4NMU A;  2XBI A;  2LTK A;  3J7Y k;  1DUG A;  2LRT A;  2CX4 A;  4ECJ A;  4PQ1 A;  4OCF A;  2JZR A;  1YY7 A;  4IP1 A;  1SJI A;  3GV1 A;  3ZIT A;  1O85 A;  1J08 A;  5DAK A;  4PUR A;  1EOG A;  1PA3 A;  3IE3 A;  5CRE A;  4HJ2 A;  3HDC A;  1TJD A;  2FNO A;  5F8B A;  5G2Z A;  4K8M A;  3A3T A;  1XZO A;  12GS A;  2HXK A;  1U6T A;  2CVK A;  2YN1 A;  1XWB A;  2V41 A;  4KH7 A;  4ACS A;  1YZX A;  4MF5 A;  5J9C A;  5F06 A;  4EVM A;  3M8N A;  4F82 A;  3C8E A;  3IAM 2;  4LMV A;  4L0W A;  2JSY A;  2P0G A;  3GH6 A;  4ISD A;  4TR0 A;  3CSH A;  1HYU A;  4J56 E;  1XWC A;  1SU9 A;  4L8E A;  4DSQ A;  4MPG A;  3HVN A;  3TRX A;  2HNL A;  3TB2 A;  3GKX A;  1B9Y C;  4USS A;  3KH7 A;  3QDN A;  2H1G A;  4EXJ A;  3I69 A;  2NDO A;  4K1F A;  6GSW A;  3QCP A;  4KW6 A;  4MP4 A;  2GZP A;  4P3Y B;  1FVK A;  2ZUP A;  1OC8 A;  5HR2 A;  1YEP A;  5B8A A;  1YQ1 A;  1SEN A;  2K8S A;  3EMX A;  2D2Z A;  2NVL A;  4WR5 A;  4MJB A;  2GSQ A;  3WT1 A;  3RHC A;  1PN9 A;  2YZU A;  4GF0 A;  1OAZ A;  5CNW A;  4OO5 A;  3GTU A;  4OCE A;  2GT5 A;  3TGZ A;  1PMT A;  5ECI B;  3E0U A;  3RHB A;  2LRC A;  5GAN D;  1A0R P;  5IM9 A;  1YF1 A;  5C00 A;  1XVQ A;  5D9V A;  4A5P A;  5GAP D;  1OVN A;  3UVH A;  4MMM A;  3UVT A;  1GUM A;  5G5E A;  1K0C A;  3F3R A;  3WGD A;  2ON5 A;  4IN0 A;  4NHZ A; 
#chains in the Genus database with same CATH homology
 2LJK A;  3FEU A;  1E6B A;  3W8J A;  2DMM A;  2FA4 A;  1WE0 A;  3FR6 A;  3F6D A;  2FUG 2;  1T4Z A;  3TJB A;  3EU3 A;  4KCE A;  2VOC A;  2XPE A;  3GMF A;  4FQU A;  2VCQ A;  2C3T A;  2YPM A;  4KAE A;  3L9U A;  3EUR A;  2V6K A;  3KXO A;  3FZ4 A;  4OFT A;  3D21 A;  3DXB A;  3TJG A;  3HXS A;  4IBP A;  3FHK A;  1ZL9 A;  3EWL A;  2WUL A;  4LLR A;  3IA1 A;  2H1D A;  5IMD A;  5ECP B;  1TRS A;  1ZGN A;  1R5P A;  3LYK A;  2F8A A;  3QR6 A;  3FW2 A;  1AXD A;  5D9W A;  2L6C A;  2IIY A;  3KGK A;  3DVX A;  3ERF A;  3RBT A;  4ECI A;  2LNT A;  3P7X A;  2YWN A;  5HR1 A;  4PNG A;  4ZB8 A;  4EIQ A;  3PPU A;  4MZC A;  2IPA A;  1K0D A;  2TRC P;  4JBB A;  1BX9 A;  4WEY A;  1FOH A;  5GST A;  4IJ3 A;  4K9Z A;  4G2E A;  4MH2 A;  2RM5 A;  4HZ4 A;  3F9U A;  3KTL A;  5G30 A;  1PN0 A;  5C04 A;  3GX8 A;  5JWR B;  2AJQ B;  13GS A;  2FWH A;  1K0O A;  4O5R A;  1F6M C;  4EF0 A;  2YP6 A;  2H01 A;  2B6M A;  1KBN A;  2H30 A;  2AV4 A;  5D96 A;  3FR3 A;  3UAP A;  1QQ2 A;  2FLS A;  5J9B A;  3NOF A;  2C3Q A;  2GVP A;  3TOU A;  2GSR A;  1A2M A;  3FYG A;  1FOV A;  2VCT A;  1G0T A;  2O85 A;  4E8E A;  3IC8 A;  2F8F A;  2FY6 A;  2WB9 A;  5DAL B;  4HJM A;  4MCU A;  3HHV A;  3VPT A;  4HEA 2;  2QA1 A;  1FHE A;  1WOU A;  1JZR A;  4MAB A;  2HFD A;  5EL8 A;  2RLI A;  1XWA A;  1GTI A;  1ERW A;  4I2U A;  2R37 A;  1TRU A;  4RI7 A;  4CW9 A;  3H8Q A;  1PSQ A;  3LWA A;  3DD3 A;  4HI7 A;  3BD2 A;  2R0C A;  1TI3 A;  3PR8 A;  4ML1 A;  5IPH A;  3VUR A;  2O8V B;  5KEJ A;  2YOI A;  1R26 A;  2DJ3 A;  2DKI A;  4IGJ A;  4V2L A;  5LCZ A;  2C0D A;  2H0H A;  3GL5 A;  4KSM A;  4MF6 A;  2VUP A;  1SYR A;  1GH2 A;  3CYN A;  3ZL5 A;  3ME7 A;  3HVV A;  2HRK A;  1M0U A;  5JCG A;  1YKC A;  1SKS B;  1XPV A;  4X43 A;  3TJJ A;  4FIW A;  5ECN B;  3ZFL A;  2LRN A;  2IFQ B;  2DSA A;  4POL A;  2E0Q A;  3QAG A;  1QFN A;  1ABA A;  3HVS A;  1M9A A;  2CT6 A;  1ML6 A;  4V2N A;  4TR1 A;  1MEK A;  2WRT A;  4MNN A;  5CYY A;  2GGT A;  11GS A;  2PPT A;  3G9B A;  1XW9 A;  3LSZ A;  1GTB A;  1TI1 A;  20GS A;  4GTU A;  2MMO A;  5D9X A;  1VF1 A;  3VFI A;  1YEX A;  2LNS A;  2E2M A;  2IME A;  2HT9 A;  3FZA A;  2HE3 A;  3TUE A;  4D73 A;  3CTG A;  4KF9 A;  2HZE A;  3LXZ A;  3IHG A;  5B6N A;  1EWX A;  4L5L A;  3IRA A;  2H73 A;  4Q5F A;  3CXG A;  1NW2 A;  3L0H A;  2RII A;  1Z6N A;  1TU8 A;  2OE3 A;  2GDR A;  3MYD A;  6GST A;  3QOU A;  2V2G A;  4IKH A;  1VF3 A;  3FR9 A;  2H0I A;  1XWG A;  4BVY A;  1WRY A;  3V1W A;  3GNJ A;  2PMT A;  2GQL A;  4BWS A;  3VK9 A;  4BVX A;  5D8I A;  2PN8 A;  4G19 A;  3U5R E;  3R2Q A;  2V1M A;  5B8B A;  1PGT A;  3MNG A;  2GT6 A;  4GCI A;  5G1L A;  1HNA A;  1TXX A;  2MBT A;  2JU5 A;  2CV4 A;  3PH9 A;  6GSV A;  2VCX A;  4V1A p;  4YAV A;  3D6I A;  3L9S A;  3GUR A;  4WKW A;  3LXT A;  3VI7 A;  1MD3 A;  5ECO B;  1U3A A;  5KN3 A;  1AQV A;  3PIN A;  2IJY A;  1PKZ A;  4GQF A;  2H6Z A;  1X9W B;  4Z7X A;  5IPG A;  3TCO A;  2K18 A;  2N5F A;  4FYU A;  4MZW A;  1ZOF A;  5ECK B;  5G5F A;  3LEF A;  3GKK A;  2XHF A;  1SD8 A;  4ECB A;  2GS3 A;  1F3B A;  4XRA A;  2YV7 A;  3CMI A;  4KND A;  5A5K A;  1SJ6 A;  2DLX A;  2X49 A;  3A5W A;  5COH A;  3A2V A;  4PNF A;  1AQW A;  1FVJ A;  4QL7 A;  4Z2R A;  1X9S B;  3Q6O A;  1K0M A;  5JCU A;  3HVX A;  2K9F A;  6GSX A;  4JR4 A;  1TW9 A;  6GSU A;  3F4R A;  1YDK A;  4J57 E;  5J41 A;  5IO0 A;  2B1L A;  4DSS B;  4LA1 A;  2R0G A;  2WGR A;  1GSF A;  2K6V A;  4TXV A;  2DBC A;  5IOW A;  4JRR A;  6GSY A;  2JSZ A;  17GS A;  5AN1 A;  3GN3 A;  1JZW A;  3BCK A;  1WMJ A;  1TP9 A;  2V32 A;  3VPQ A;  1AUC A;  4K6X A;  3FMW A;  4EIP A;  3ERG A;  2HRN A;  2N5B A;  1OC9 B;  3LGC A;  2MMA A;  2C80 A;  2OBI A;  2H0G A;  2XC2 A;  2E7P A;  4MJE A;  4K0G A;  1OYJ A;  4O5U A;  4PQH A;  7GSS A;  1GSS A;  2B3S A;  3O76 A;  1RK4 A;  2X99 A;  1GNE A;  1Z7P A;  4O92 A;  4TR3 A;  1NSW A;  3FZ9 A;  3EPT A;  4KA0 A;  1A23 A;  6GSS A;  1WWJ A;  1T3B A;  2H74 A;  3HD5 A;  5AIV A;  3LJR A;  2Z9S A;  5E59 A;  3SWL A;  4NXI A;  4EDY A;  2EIO A;  3LOR A;  4KDY A;  3UOM A;  1K3O A;  2F9S A;  2G2Q A;  1H4O A;  4ZIL A;  2L4C A;  1G7E A;  3G7J A;  1I5G A;  3HZ8 A;  2OKA A;  2NPB A;  4TVE A;  2YV9 A;  2L5L A;  5FT3 A;  5A4V A;  4N11 A;  4NV2 A;  5G31 A;  3W8S A;  5JWO B;  1M2D A;  4G0K A;  1V58 A;  2H75 A;  1VGL A;  1TTZ A;  3UMA A;  3HKR A;  3IXR A;  3ME8 A;  5E4W A;  2J23 A;  1UC7 A;  2GZY A;  3MWH A;  3GH9 A;  4HQZ A;  4TXO B;  3N9J A;  3KP9 A;  1XVW A;  2CQ9 A;  2DML A;  3QAV A;  5EPF A;  4GST A;  2VLV A;  3D0Z A;  3F4T A;  3TOT A;  3ZML A;  2VM2 A;  3MDK A;  5KOX A;  4ZXG A;  2IMK A;  1GSE A;  2XBQ A;  3APO A;  3HJM A;  2C0E A;  3CRT A;  2OBK A;  2YZH A;  1LU4 A;  3VWU A;  1QMV A;  1XWK A;  3ZVJ A;  1TDI A;  3ZVJ D;  3FY7 A;  3P2A A;  1A8L A;  1JLW A;  4WF4 A;  4I6X A;  4N0Z A;  3APQ A;  4K2D A;  1DE2 A;  4YQU A;  22GS A;  1XCC A;  3TKS E;  2AUV A;  3NZN A;  3DIE A;  2QC7 A;  3MSZ A;  2YWO A;  3GST A;  1ZCP A;  3ZRE A;  5INY A;  3M0F A;  3CSJ A;  5DCH A;  2C1Y A;  4TR4 A;  5ECR B;  4X4J A;  5ECQ B;  1YF0 A;  2A2P A;  1FG4 A;  2M72 A;  1F2E A;  1Y25 A;  5ID2 A;  2YCD A;  3BJ5 A;  3M9K A;  2HRA A;  1TU7 A;  5DAK B;  2AAW A;  3J7Y b;  2DJJ A;  1ERT A;  5IOX A;  3IDV A;  3P8W A;  1M99 A;  3U6V A;  2WZ9 A;  1R5A A;  1R7H A;  2OAD A;  2JAD A;  3GL3 A;  3OR5 A;  2CX3 A;  4TRX A;  2P5Q A;  3RPN A;  1V98 A;  2IN3 A;  4MJA A;  2F3M A;  4HU7 A;  2DIY A;  4TKY A;  4KDU A;  4POB A;  4ID0 A;  4JED A;  1V57 A;  1R4W A;  4AGS A;  1EGR A;  5KN0 A;  1MTC A;  2HZF A;  1ZYP A;  1ZMA A;  2JL4 A;  3L9V A;  2WCI A;  5ELG A;  4KUN A;  5CO3 A;  2LEG A;  4TOP A;  3TKQ A;  3L78 A;  2VD0 A;  4FO5 A;  3K8N A;  4NAX A;  3IPZ A;  4G0I A;  2PU9 C;  1V2A A;  4XS4 A;  3UL3 A;  4GSN A;  2FHE A;  3CTF A;  4V2M A;  1GL8 A;  1AIU A;  2DJ1 A;  3KP8 A;  2CAQ A;  1BED A;  1M9B A;  1Z9H A;  3H1N A;  1MDJ A;  2C3N A;  3GTU B;  2YAN A;  3KTB A;  4G0L A;  3KM6 A;  1SL1 B;  3IC4 A;  2B1K A;  2X8H A;  4QL9 A;  2H1A A;  4Z2U A;  4KB3 A;  2ES7 A;  3D22 A;  3R3E A;  4XHM A;  2FWF A;  5ELA A;  1AC1 A;  2VO4 A;  5DDL A;  3ZRD A;  1UA5 A;  1MDI A;  4HDE A;  4KE3 A;  1T8E B;  1F9M A;  1Q4J A;  2QSI A;  4HOJ A;  2EIR A;  2QKE A;  1Z7R A;  5HFG A;  3ZYW A;  3UAR A;  2I1U A;  2WDU A;  1QUW A;  3A2W A;  1GRX A;  4ZL7 A;  3VI5 A;  4Q5R A;  1LBK A;  4YAP A;  1XW5 A;  5IMC A;  2QGV A;  2OE0 A;  5IIZ A;  2P5R A;  3HJP A;  1X0R A;  1EEM A;  4EC0 A;  2HSH A;  1F37 A;  4AF2 A;  2R5G A;  2O87 A;  4DVC A;  4JE1 A;  4CHS A;  4WXT A;  2C4J A;  3D5J A;  2HYX A;  2LJA A;  3KEB A;  4KDX A;  1SKR B;  4BL7 A;  3KH9 A;  1THX A;  2V6O A;  3DRN A;  3DML A;  1FO5 A;  3DYR A;  4MPF A;  2VL9 A;  1TRW A;  3APS A;  1B4P A;  1TOF A;  1TKD B;  2LUS A;  1HNC A;  5EVO A;  2JZT A;  3UBL A;  1THO A;  1S3D A;  2B5E A;  4WBJ A;  1SKW B;  1SD9 A;  4ML6 A;  16GS A;  4OFM A;  4LL1 B;  2DKH A;  2DJ2 A;  5IMV A;  1M2B A;  5AIS A;  3LQ7 A;  2GQM A;  4ZB9 A;  1JLV A;  5FWG A;  5D73 A;  1JZD A;  4JR6 A;  2UZ8 A;  1X5E A;  3ISO A;  4EO3 A;  1URM A;  5J3R A;  3DEX A;  3WGX A;  1GUK A;  4EDZ A;  2H1B A;  3WGE A;  3EC3 A;  1WIK A;  2CA8 A;  2LQQ A;  3JCM L;  1G6Y A;  4EE0 A;  1ERU A;  1FB6 A;  4FYB A;  2KP2 A;  3WYW A;  2A2S A;  1DE1 A;  2KUC A;  1NHY A;  3N5O A;  1ZYQ B;  3IOS A;  4KX4 A;  5CAX A;  3GSS A;  5ECH B;  2H70 A;  4F9Z A;  5HFK A;  1OE7 A;  1PL2 A;  1MDK A;  3ZTL A;  4H86 A;  2EIQ A;  5F07 A;  3TKS C;  2H76 A;  3F0I A;  2VL2 A;  4K7O A;  3Q19 A;  3UEM A;  3F4S A;  3BOA A;  4I5Q A;  5HQP A;  3LYP A;  4ZBA A;  4J2F A;  1ZYN A;  1EP8 A;  4GWR A;  1O8W A;  1Z6M A;  4ZBB A;  3QFB C;  5L71 A;  2H66 A;  4DEJ A;  3ZIV A;  1K0A A;  4K7I A;  4POM A;  1CQH A;  2PGT A;  4IJI A;  4F03 A;  2KLX A;  5EY6 A;  3GFK A;  1T00 A;  1Y6E A;  3NIV A;  4MJC A;  4YQM A;  1V40 A;  4EUY A;  5IMF A;  4PTS A;  3EVI A;  1J9B A;  2MZC A;  4JU5 A;  3HJO A;  1U88 A;  1SK2 A;  1SK1 A;  2B7K A;  2RUF A;  4FH8 A;  1XFL A;  3F3Q A;  9GSS A;  3H4K A;  2O89 A;  2LS5 A;  1ON4 A;  1WJK A;  1ZZY A;  2JZS A;  4I8B A;  4GQC A;  1G6W A;  2CZ3 A;  3TKS A;  1XW6 A;  4TR1 B;  5A4W A;  1VF4 A;  4WET A;  1MD4 A;  1JZO A;  4GLT A;  2LJR A;  1A2J A;  1X9M B;  3F8U A;  1FW1 A;  4JZQ A;  3VWX A;  1VRS D;  1V9W A;  4IEL A;  4BPY A;  4WR4 A;  2ALB A;  4IS0 A;  4PUF C;  5GSS A;  1GLQ A;  4D73 B;  14GS A;  3Q18 A;  2HZE B;  1T7P B;  1OKT A;  3AY8 A;  3EU4 A;  3IBH A;  2R0P A;  3KZQ A;  5F0G A;  4NHW A;  4XS6 A;  4HZ2 A;  5H5R A;  5G1K A;  5CRD A;  2VCZ A;  4NPB A;  1SL0 B;  5ENU A;  5BRT A;  5JWQ B;  2VM1 A;  4IQ1 A;  5IQY A;  5HR0 A;  4X1U A;  3HCZ A;  2DC5 A;  2DIZ A;  3C71 A;  5DQS A;  2LKU A;  4YH2 A;  1B8X A;  1HNB A;  5CP1 A;  1AAZ A;  3US3 A;  4EL1 A;  3IAS 2;  1OKD A;  2H6Y A;  2M80 A;  8GSS A;  1AQX A;  1S3A A;  2KP1 A;  1U87 A;  4BVY B;  3QMX A;  3ERW A;  1K3L A;  3CSI A;  2L6D A;  5IO2 A;  4BVX B;  2IMF A;  2A4H A;  2NTO A;  5D9T A;  3M3M A;  1Z5Y E;  1LJR A;  3H79 A;  1QGV A;  1IYH A;  1GSD A;  3UIW A;  2X8C A;  2YJ7 A;  2ZNM A;  3VWV A;  4AJ8 A;  3GHA A;  4O5Q A;  4MLY A;  2DJ0 A;  3KD0 A;  5CRG A;  2HSM A;  2C0F A;  4MDC A;  5DAL A;  4ZL8 A;  1GTA A;  2PVQ A;  3ZMK A;  4K7N A;  2HRF A;  4G9H A;  4KSO A;  1K3Y A;  2MBS A;  1PRX A;  2H6X A;  3EIN A;  4CY6 A;  2L5O A;  4TW5 A;  1TK0 B;  2JAC A;  5H5S A;  5A4U A;  2FD3 A;  2CAI A;  1O81 A;  4HQS A;  4QQ7 A;  3FKF A;  4MH3 A;  3HY2 A;  1BYE A;  2GTU A;  3M1G A;  2F51 A;  2O7K A;  1GP1 A;  3L4N A;  5ECL B;  3E3E A;  2WFC A;  3LFL A;  4HS1 A;  3W6G A;  4GSS A;  1B48 A;  3EE2 A;  3KIJ A;  3ZIJ A;  10GS A;  1GWC A;  2X8G A;  2AB6 A;  4ECC A;  3GYK A;  5DJM A;  2BTO T;  3QPM A;  5D93 A;  2G0F A;  2REM A;  2N5A A;  2PWJ A;  3LG6 A;  1PL1 A;  4PUA A;  1PQN A;  4IW9 A;  5F05 A;  2IFQ A;  3TRP A;  4AJ6 A;  5IMA A;  1WP0 A;  4F2I A;  3CBU A;  2AYT A;  3H93 A;  2A4V A;  1M7T A;  4KGI A;  3IV4 A;  2GQK A;  5B7C A;  2OA7 A;  3TJK A;  3ZFB A;  5ABR A;  1SJZ A;  1H75 A;  4ZB6 A;  3A2X A;  2ON7 A;  3IK7 A;  4XS1 A;  1GSU A;  4CDO A;  1G7O A;  1O6J A;  2X64 A;  1N2A A;  1A2L A;  4Q5Q A;  4FYC A;  1K0N A;  2H71 A;  4BWQ A;  3G7I A;  2IL3 A;  2QA2 A;  3VLN A;  3TKR A;  4WF5 A;  3FK8 A;  2L57 A;  4RQR A;  3HYP A;  4I2T A;  1EEJ A;  5DBQ A;  4ZBD A;  1AW9 A;  2E2G A;  1E2Y A;  3TDG A;  2PER A;  1FAA A;  4L5O A;  2GST A;  4IP6 A;  2HLS A;  1RW1 A;  4XCS A;  2KHP A;  4OWY A;  1BJX A;  2B7J A;  4K5R A;  5GZZ B;  1RQM A;  2RUE A;  3Q74 A;  1A8Y A;  1HQO A;  4DSR A;  4Z2T A;  2TRX A;  3C73 A;  3BCI A;  4ULX A;  1WPI A;  2R4V A;  4KCA A;  19GS A;  4ZL9 A;  3E9J B;  4LL4 B;  2FCH A;  2LQO A;  1OE8 A;  2R2J A;  5FHI A;  2YWI A;  2MMN A;  1PX6 A;  3D4M A;  5KN1 A;  3VWW A;  2YNX A;  4IVF A;  2I3Y A;  2VCW A;  3DWV A;  3A5I A;  5HFI A;  2VLU A;  4O7H A;  3RDW A;  1NHO A;  3KJY A;  2WS2 A;  3MAK A;  1GTU A;  1K0B A;  2VL3 A;  5J4U A;  1EZK A;  1TRV A;  3WT2 A;  3DKS A;  4XIH A;  4PQI A;  5DCG A;  2CVB A;  2GLR A;  2I9H A;  1USB A;  1A0F A;  2FGX A;  2RM6 A;  3KMO A;  2XPD A;  4AJ7 A;  1XOA A;  3DGQ A;  18GS A;  4XRD A;  1DSB A;  3ZLP A;  2CVD A;  2EC4 A;  2HSY A;  2ZCT A;  4RI6 A;  3WD6 A;  4OD7 A;  4YQV A;  1EOH A;  2TIR A;  1O73 A;  3TKP A;  1KTE A;  4RUV A;  1CQG A;  3HZ4 A;  2I4A A;  5DVB A;  1PKW A;  1N8J A;  3QFA C;  4F0B A;  1BQ7 A;  4K5S A;  1PD2 1;  3C7M A;  4TN8 A;  1QXH A;  2H8L A;  5AGY A;  2GZZ A;  1DBY A;  1ERV A;  1GNW A;  2FWE A;  1W4V A;  2LST A;  4HUA A;  3QD9 A;  1J0F A;  4BA7 A;  3C1S A;  1C72 A;  5DJL A;  4RQX A;  1PX7 A;  4N0V A;  2OJL A;  2OAC A;  4OO4 A;  1NM3 A;  4OFN A;  1ST9 A;  2R6K A;  3F6F A;  2DJK A;  4WBR D;  1EV4 A;  3BBY A;  2OE1 A;  4OMV A;  1XIY A;  2HI7 A;  1U3I A;  2VAF A;  3GX0 A;  4NV5 A;  4IHU A;  2NBS A;  1VF2 A;  5ID2 B;  2M46 A;  4X0X A;  4GXZ A;  1EP7 A;  2H72 A;  4DSS A;  5HR3 A;  3RPP A;  3IHQ A;  3D4T A;  5AIX A;  2I81 A;  3I6A A;  4YKG A;  2VL2 C;  4MK3 A;  4EKZ A;  5KOW A;  2P31 A;  2LV3 A;  5IMZ A;  2L4Q A;  2FWG A;  1T1V A;  1B4Q A;  1GSY A;  3TRQ A;  3TJF A;  3GKN A;  5LNK e;  2B5Y A;  4ICY A;  3O3T A;  4E8H A;  2GSS A;  1KEB A;  2MYG A;  3G7Y A;  1OC9 A;  1UN2 A;  4N10 A;  4K2X A;  3IR4 A;  2MMZ A;  1ZYE A;  2K8V A;  3GUS A;  1JFU A;  3LW9 A;  2X4A A;  4NWY A;  1GLP A;  5JCW A;  1EGO A;  4PX1 A;  2VIM A;  3ED3 A;  4XS4 B;  4ZIJ A;  1YKA A;  5CRW A;  4Q5N A;  3RAZ A;  2VLT A;  1EV9 A;  1TK5 B;  2C0G A;  4POK A;  1TK8 B;  4ILF A;  3EMP A;  2KOK A;  1F3A A;  3P90 A;  3KMN A;  1QK8 A;  1YJ6 A;  2C8U A;  3FZ5 A;  3GKM A;  3PGT A;  3ZZX A;  1X5C A;  4L0U A;  1SYX A;  3KCM A;  3GIX A;  2BMX A;  4G10 A;  1GUH A;  1GUL A;  3M9J A;  3UBK A;  2YWM A;  1BG5 A;  3GA4 A;  4HU9 A;  1FB0 A;  2AHE A;  1HD2 A;  5ECS A;  1SK0 A;  2FA8 A;  1Q98 A;  4N30 A;  3CRU A;  1OC3 A;  1W89 A;  3DVW A;  1XBS A;  2A2R A;  4YKF A;  2B5X A;  2IWT A;  1ACV A;  4MZB A;  1O7U A;  1M2A A;  2H19 A;  4F0C A;  3MIX A;  5KN2 A;  4V1A g;  5ECM B;  1O8X A;  4TXO A;  2IMI A;  4PXO A;  1A24 A;  3F63 A;  4PGT A;  2VD1 A;  5CRH A;  1KNG A;  1B9X C;  2BJX A;  3GRX A;  3I9V 2;  4K0N A;  1XOB A;  5H5Q A;  3O6T A;  2PVO C;  5B6M A;  1SL2 B;  2PBJ A;  1I9D A;  1JHB A;  1BAY A;  3EYT A;  4IQA A;  3I43 A;  5DQY A;  2R3X A;  2IMD A;  1GSQ A;  4XTS A;  4CY8 A;  3S9F A;  2YJH A;  5BMU A;  1ILO A;  1X5D A;  4O32 A;  1IYI A;  4BL7 B;  4MF7 A;  2PUK C;  2J9H A;  1UVZ A;  5J5N A;  2VCV A;  2L59 A;  1XXU A;  3IK9 A;  4LMW A;  3SBC A;  4MA9 A;  2WJU A;  4I97 A;  1S3C A;  3HA9 A;  3UJ1 A;  5LD0 A;  4GRF A;  3QAW A;  3FRC A;  1Z3E A;  3C1R A;  1T4Y A;  2CZ2 A;  4NMU A;  2XBI A;  2LTK A;  3J7Y k;  1DUG A;  2LRT A;  2CX4 A;  4ECJ A;  4PQ1 A;  4OCF A;  2JZR A;  1YY7 A;  4IP1 A;  1SJI A;  3GV1 A;  3ZIT A;  1O85 A;  1J08 A;  5DAK A;  4PUR A;  1EOG A;  1PA3 A;  3IE3 A;  5CRE A;  4HJ2 A;  3HDC A;  1TJD A;  2FNO A;  5F8B A;  5G2Z A;  4K8M A;  3A3T A;  1XZO A;  12GS A;  2HXK A;  1U6T A;  2CVK A;  2YN1 A;  1XWB A;  2V41 A;  4KH7 A;  4ACS A;  1YZX A;  4MF5 A;  5J9C A;  5F06 A;  4EVM A;  3M8N A;  4F82 A;  3C8E A;  3IAM 2;  4LMV A;  4L0W A;  2JSY A;  2P0G A;  3GH6 A;  4ISD A;  4TR0 A;  3CSH A;  1HYU A;  4J56 E;  1XWC A;  1SU9 A;  4L8E A;  4DSQ A;  4MPG A;  3TRX A;  2HNL A;  3TB2 A;  3GKX A;  1B9Y C;  4USS A;  3KH7 A;  3QDN A;  2H1G A;  4EXJ A;  3I69 A;  2NDO A;  4K1F A;  6GSW A;  3QCP A;  4KW6 A;  4MP4 A;  2GZP A;  4P3Y B;  1FVK A;  2ZUP A;  1OC8 A;  5HR2 A;  1YEP A;  5B8A A;  1YQ1 A;  1SEN A;  2K8S A;  3EMX A;  2D2Z A;  2NVL A;  4WR5 A;  4MJB A;  2GSQ A;  3WT1 A;  3RHC A;  1PN9 A;  2YZU A;  4GF0 A;  1OAZ A;  5CNW A;  4OO5 A;  3GTU A;  4OCE A;  2GT5 A;  3TGZ A;  1PMT A;  5ECI B;  3E0U A;  3RHB A;  2LRC A;  5GAN D;  1A0R P;  5IM9 A;  1YF1 A;  5C00 A;  1XVQ A;  5D9V A;  4A5P A;  5GAP D;  1OVN A;  3UVH A;  4MMM A;  3UVT A;  1GUM A;  5G5E A;  1K0C A;  3F3R A;  3WGD A;  2ON5 A;  4IN0 A;  4NHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...