1Z7PA

Solution structure of reduced glutaredoxin c1 from populus tremula x tremuloides
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
117
structure length
117
Chain Sequence
MASKQELDAALKKAKELASSAPVVVFSKTYCGYCNRVKQLLTQVGASYKVVELDELSDGSQLQSALAHWTGRGTVPNVFIGGKQIGGCDTVVEKHQRNELLPLLQDAAATAKNPAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords glutaredoxin
publication title Structural Insight into Poplar Glutaredoxin C1 with a Bridging Iron-Sulfur Cluster at the Active Site
pubmed doi rcsb
source organism Populus tremula x populus tremuloides
total genus 41
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2005-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1z7pA00
5DQSA 2B5XA 5CP1A 1FVKA 5IO2A 1OKDA 4EDZA 3VI5A 1OC9A 3DVXA 2DIZA 4J57E 4ECBA 5CNWA 4HU9A 3P2AA 3G7JA 1LU4A 4BPYA 4TN8A 3DEXA 4YAVA 2R37A 4LA1A 2R4VA 3S9FA 2LNTA 3DKSA 3HVSA 4JE1A 1KNGA 1B48A 3GKMA 2E7PA 5ID2A 1O81A 2DJKA 1MDKA 4BWSA 1M9BA 2YV7A 3CSJA 2JZSA 1PD21 1ZYQB 3LYPA 4YQVA 3HYPA 2CAQA 5HR1A 1XCCA 4DEJA 2HZEB 3ZREA 1ERTA 1GLQA 3GSSA 4L5LA 5DCGA 2VLVA 2YJHA 3VK9A 2YWOA 2A2SA 2KOKA 1A0RP 2QKEA 4RI6A 2VL2C 1GSQA 4DSSA 2WCIA 4GSTA 1WE0A 4KNDA 4OO4A 8GSSA 1YZXA 5D73A 4Q5QA 3KJYA 3IPZA 1XOAA 3WT1A 2IIYA 2BJXA 5CYYA 2YJ7A 3BCKA 3EYTA 3I9V2 3OR5A 5COHA 1R5AA 2H0HA 4K8MA 1SJZA 2L5OA 2H75A 4OD7A 2VUPA 1PL1A 2LQQA 4I6XA 2ZCTA 3TDGA 2IMEA 2GT5A 4ZB9A 2AV4A 1GTIA 3ZRDA 4CDOA 20GSA 2B1KA 2VCWA 4F82A 3KH9A 4I97A 4KAEA 2HNLA 3E9JB 1E6BA 2CVDA 2FWGA 3U5RE 5HFIA 4F2IA 3PINA 3GYKA 1VF1A 1UC7A 5J5NA 3F0IA 2IL3A 1BX9A 1AC1A 1QUWA 2B3SA 3IRAA 3F3RA 3FZAA 5ECSA 2X8GA 3RPPA 1XPVA 2H19A 1SK1A 4WR4A 4GSNA 2I1UA 1N8JA 1XWBA 5LNKe 5GZZB 3CMIA 5INYA 1SL0B 3IAS2 2WRTA 3FR6A 1GWCA 3QD9A 1NSWA 1ZOFA 4WKWA 3HVVA 2WS2A 5FHIA 4MF7A 1TJDA 1TRWA 2GTUA 3TRXA 2JL4A 4TR0A 1HYUA 4MPFA 3EE2A 4YAPA 3KP8A 1FHEA 1Z7RA 3GUSA 2MMZA 3F8UA 2O8VB 4ECCA 4KB3A 1SL1B 2H0GA 4PUFC 3HJMA 3LEFA 4KW6A 2VCQA 1H75A 19GSA 5HR0A 2N5BA 3MWHA 3D21A 4PURA 4GRFA 1GH2A 3C71A 3APOA 3EURA 2YP6A 4ZBAA 1EP7A 2GZYA 3TKSA 3IXRA 5LCZA 1TK5B 3NIVA 3GHAA 2C3NA 4XS1A 4BVYA 1X9SB 1Z7PA 4IS0A 1XW9A 1K0CA 2MBSA 3KIJA 5C00A 4HZ2A 4XHMA 5J9BA 5F05A 3ISOA 17GSA 5ECPB 2P0GA 3GL5A 4TR3A 1V40A 1J9BA 2O89A 5LD0A 1NW2A 3L9VA 4WBRD 2R5GA 4IN0A 2P5QA 2B1LA 6GSYA 2C0EA 2H1AA 1B9YC 3K8NA 1XIYA 5ECKB 3F63A 4TVEA 4NAXA 3WT2A 4PQHA 3P8WA 4F0BA 4IGJA 3WGDA 1WOUA 4I5QA 2RM5A 4GCIA 1A0FA 5A4WA 3KGKA 5DAKB 2PVOC 4IHUA 3APSA 1SENA 5G5EA 5A4VA 1PX6A 4CW9A 1GTUA 1JHBA 3HDCA 3IBHA 4MZWA 3ZFLA 2LEGA 3WGEA 3W6GA 3ERFA 4NHWA 6GSTA 3F6DA 1IYHA 1YDKA 1GSDA 1O6JA 2DJ3A 3QOUA 1EV9A 2WULA 5ELAA 2P31A 4MP4A 3C8EA 4ZXGA 2EIOA 4KA0A 3TJFA 1XOBA 3LXZA 3AY8A 4LLRA 4PGTA 1QK8A 4GSSA 2RM6A 2F51A 3ZVJD 1Z9HA 5KN2A 3SBCA 4ECJA 2PU9C 4KE3A 2LRNA 3APQA 4JR6A 1UA5A 3F6FA 4POKA 3TKPA 3UMAA 2EIQA 4X0XA 4K9ZA 4ZILA 2XPEA 3GTUA 4OFTA 2IPAA 1O7UA 4MH2A 2DLXA 2CZ3A 3UVHA 5G2ZA 1GULA 2FWEA 1O8XA 2IJYA 3GX0A 3HY2A 5G5FA 5KN3A 2F8FA 4NHZA 2EC4A 3QFAC 4HS1A 5ECIB 3TJKA 4DSRA 3GH9A 4IW9A 3M9JA 1V2AA 2OE0A 2C1YA 1ERVA 1TRVA 4PQIA 3ZITA 3ZIVA 3KH7A 2F8AA 3EWLA 2PGTA 3GN3A 3HA9A 1T00A 4MF6A 3UEMA 4XRAA 1TDIA 4TOPA 3RHBA 4ML6A 3MDKA 1LJRA 2LV3A 1HD2A 1T3BA 3O6TA 3QDNA 2XPDA 4WBJA 3HJPA 4J2FA 3L9UA 5CRGA 4HQSA 4IJ3A 1U6TA 4KDXA 5L71A 5JWOB 3GX8A 3TKQA 1QFNA 3J7Yk 1RQMA 2FNOA 1JFUA 2K6VA 2V41A 3CRTA 1I9DA 4G19A 1OC9B 1RW1A 1M9AA 1YKCA 2FY6A 4I2TA 1JZWA 2REMA 1EP8A 3F4RA 2X64A 2WDUA 2MYGA 5DBQA 2JACA 3M3MA 3WD6A 2JZTA 3LWAA 3QAGA 3GMFA 3RHCA 3ZMKA 2H72A 3CXGA 3LYKA 4P3YB 1YQ1A 3A2VA 2V32A 3VURA 3HZ8A 3TRPA 3RAZA 5ID2B 1G7OA 1EGRA 3SWLA 1W89A 2YANA 1NM3A 3JCML 5CREA 2FA4A 3GRXA 2CQ9A 2HE3A 4JBBA 1ERWA 4IELA 1SJ6A 5F06A 1ST9A 1EZKA 2KUCA 1Q98A 5CRDA 5EVOA 1V57A 1OE7A 4KUNA 5ABRA 3EMPA 3IV4A 2CA8A 2H01A 1FB6A 3GKKA 5B8AA 1B4PA 4DSSB 3FYGA 4ULXA 4F03A 2J9HA 4V2LA 1TI3A 3UVTA 5J9CA 4V2MA 2PBJA 4I8BA 1KTEA 1HQOA 1WPIA 2C3QA 22GSA 2M46A 4EDYA 4HJ2A 2LNSA 3TJBA 1NHYA 4V1Ag 5IMDA 3PGTA 4PX1A 1XVWA 2GZPA 1SD9A 4ISDA 2C0GA 3L78A 2KLXA 3F4SA 3KXOA 1T8EB 2E0QA 3FKFA 4ZL7A 1SJIA 2FD3A 5D9XA 2HRNA 18GSA 2IFQA 5DQYA 4KDYA 2VLTA 4KSMA 2AJQB 3D4MA 2VM1A 3FY7A 1SYXA 4NV5A 4KX4A 2FLSA 4TW5A 3D22A 4ZL8A 4GQFA 4LMVA 2GQKA 1MDIA 3ME8A 4ACSA 2VCVA 4LL4B 4FO5A 1O8WA 5IMVA 5ECRB 4OCFA 1K3OA 1R26A 5G31A 2L5LA 2XBIA 2R2JA 2H1GA 2HRFA 3VI7A 2VL9A 3QCPA 2QC7A 4IP1A 3UBKA 1C72A 2JU5A 4AJ6A 3C73A 1I5GA 2OJLA 1ZGNA 1XXUA 2PVQA 4HI7A 4MK3A 4JU5A 1EV4A 1UN2A 4OMVA 3VWVA 5GAND 4N0ZA 1AW9A 4MZBA 2VD0A 4NMUA 2ES7A 1W4VA 3A2WA 3NOFA 5IO0A 4RUVA 3UL3A 1H4OA 4E8HA 1A8LA 3ZMLA 3EMXA 1GTBA 4TR1A 2HSHA 1K0OA 4TR4A 1DUGA 4BA7A 4HU7A 1PMTA 1T4YA 1X0RA 3MSZA 1K0NA 3IHQA 13GSA 1ZMAA 4KGIA 2IMFA 2GLRA 1GLPA 1K3YA 5DDLA 4MLYA 2HZEA 3VFIA 5JWRB 1XZOA 4MJEA 1AAZA 3TB2A 2M80A 2PN8A 1OE8A 1M7TA 4HZ4A 4F9ZA 2HYXA 1G6WA 4G2EA 1USBA 2VLUA 2DBCA 3TKSC 1SKSB 4K7NA 2R6KA 1Z6MA 5ELGA 2YWIA 1X5CA 4GQCA 1RK4A 3QAVA 3ZL5A 2FWFA 1GSFA 3H1NA 5IPHA 1Z5YE 4HQZA 3C1RA 4MF5A 4ML1A 2X8CA 3FZ9A 2PERA 2K8VA 4Q5FA 1F3AA 4AGSA 4X1UA 4HOJA 2OA7A 2GZZA 2O7KA 2AUVA 4N10A 1VF3A 2F9SA 1OAZA 3UARA 3LORA 1DE2A 4XRDA 4D73B 6GSWA 3Q18A 5HFKA 5CRHA 3IAM2 3HJOA 1GSUA 4K0NA 5FWGA 2GT6A 2YNXA 1LBKA 3F9UA 2JZRA 3IA1A 2BMXA 1GSYA 2DJ2A 3QR6A 2OKAA 4PUAA 3ERGA 5EL8A 2IN3A 4WF4A 5ECHB 2GQMA 2B7JA 1ERUA 2ON5A 1GTAA 2ON7A 1XWCA 2C8UA 3A3TA 1JZRA 3MAKA 2CV4A 2V6KA 4YH2A 1KEBA 4NXIA 2FCHA 2YOIA 2YN1A 2MMAA 3TUEA 12GSA 1TI1A 3IDVA 1E2YA 5G1KA 4OCEA 1TXXA 1TK8B 1V98A 2IMDA 2VO4A 2D2ZA 2FWHA 5B6MA 4XIHA 3GKXA 5J3RA 1GNEA 4TKYA 4MJCA 3GTUB 4JEDA 4H86A 4MMMA 2CAIA 2GS3A 2I9HA 4FH8A 1R7HA 4EO3A 2VAFA 3EU4A 3ZTLA 4NV2A 2PWJA 3KP9A 1SK2A 3QAWA 4Z7XA 1AQXA 3G7YA 4K6XA 3EVIA 3E0UA 4LMWA 1T1VA 1JZDA 4XS4B 1TU7A 1WWJA 5G1LA 1ON4A 3UBLA 2WB9A 4PNGA 2BTOT 1HNAA 3IK7A 4K7IA 4HEA2 2CX4A 4GXZA 2I3YA 3CTFA 2IMIA 1ZZYA 2E2GA 2YCDA 2L6CA 1Y6EA 3DIEA 2DC5A 1PL2A 1PX7A 4ILFA 1XWGA 2OBKA 2RUEA 2B5EA 1ZL9A 4EXJA 3KTBA 2H6ZA 2LQOA 1WJKA 2O87A 3HHVA 2OE3A 1A2LA 3FR3A 4DSQA 2H8LA 4XS6A 3IK9A 5AIVA 1WP0A 1AQVA 3EINA 2AHEA 2I81A 2L4CA 1K0BA 1B8XA 14GSA 3ZLPA 5HR3A 3RDWA 1A8YA 3IR4A 2YV9A 3A2XA 3LFLA 3PR8A 1T7PB 4N0VA 3GNJA 4JR4A 2K8SA 4OFMA 5J4UA 2HT9A 3QMXA 3FZ4A 1GSEA 1SKWB 1U3IA 9GSSA 5E59A 4DVCA 5IMAA 1XFLA 1XBSA 2DJ0A 4JZQA 3HKRA 5F8BA 16GSA 2HXKA 4IVFA 1PGTA 2CVBA 4AJ8A 4TXVA 4K1FA 4HJMA 3TOUA 2WFCA 2GQLA 3M9KA 2JSZA 2L6DA 3ERWA 2LSTA 1JZOA 4FYCA 5A4UA 5DALA 3D6IA 3I43A 1G6YA 3KTLA 2H6XA 1IYIA 1U3AA 5JCGA 2PMTA 4ZIJA 4G10A 3M0FA 2GSTA 5IMCA 2H0IA 2DJJA 4POBA 2A2RA 3EC3A 3CSIA 2X99A 3ZIJA 1THOA 3IOSA 1F9MA 2ZNMA 5JCWA 2HZFA 1FO5A 5AGYA 5H5QA 3TJJA 1MD4A 3MNGA 5KN1A 2K9FA 1GL8A 2H73A 3LG6A 3TRQA 2B5YA 4KSOA 1GUKA 1SU9A 2HLSA 2L59A 1WIKA 2FUG2 4MJBA 3ZZXA 2LJAA 5EPFA 1PSQA 3G7IA 5IMFA 5KEJA 4V1Ap 1KBNA 3I69A 3M8NA 3R2QA 5GSSA 3CYNA 5EY6A 1XW6A 4YQMA 1MDJA 5D9WA 2GDRA 3HXSA 2H70A 4TXOA 4X43A 4BWQA 4IKHA 2MZCA 4O7HA 1VGLA 2JADA 3W8JA 5FT3A 4Q5NA 3TOTA 5B6NA 3DVWA 2R3XA 6GSVA 3E3EA 4YQUA 1OKTA 4FIWA 2TIRA 3FW2A 2DJ1A 4MJAA 1YJ6A 3HZ4A 5IM9A 2PUKC 5F07A 2K18A 4EVMA 4TRXA 4HDEA 4MDCA 2RIIA 2LJRA 2V6OA 4JRRA 4WEYA 2VOCA 2MBTA 4Q5RA 1DBYA 3DGQA 2NTOA 1B4QA 3F3QA 5CAXA 3GKNA 2WGRA 3TKSE 1QMVA 4BL7A 3IC4A 3FZ5A 4WF5A 1XWAA 4WETA 2N5AA 1YF0A 3BCIA 1M0UA 1VRSD 3F4TA 1TRSA 4TR1B 2GSRA 1QQ2A 2H30A 2MMOA 1ML6A 4ECIA 1A2JA 3KD0A 4F0CA 3TKRA 2OE1A 5F0GA 1AIUA 2H1DA 2CT6A 1SKRB 2LRTA 5JCUA 3H8QA 3M1GA 4L8EA 1THXA 3FRCA 3D4TA 4QL9A 2C0DA 5JWQB 1X9WB 3LQ7A 1R4WA 3TGZA 2B7KA 2KP2A 4GLTA 5ECNB 3VLNA 3VWUA 1V58A 2V1MA 4FYBA 1O85A 2V2GA 4IQAA 1VF2A 6GSSA 4GTUA 1A24A 1F6MC 4KCEA 4POLA 3HVXA 1FW1A 2IMKA 3VWXA 1G0TA 3P90A 2VCZA 1HNCA 4PQ1A 5HR2A 3NZNA 1MTCA 2VIMA 4NPBA 4MA9A 1F3BA 3G9BA 3VWWA 1YKAA 1X5EA 2GGTA 2HI7A 1PRXA 1M2DA 2LUSA 1K3LA 4AF2A 4LL1B 3LJRA 3RPNA 5IOXA 2XC2A 3LXTA 2DIYA 1EOHA 2FHEA 1PQNA 4V2NA 1NHOA 4ID0A 2HFDA 3GA4A 4E8EA 3BD2A 3L9SA 4I2UA 2DSAA 3P7XA 3UAPA 1GNWA 1J0FA 3GFKA 5HQPA 2YZUA 4IP6A 1AXDA 2J23A 2KP1A 4MH3A 2VCXA 2L57A 1BAYA 4K2DA 1K0MA 3GV1A 1U87A 2LJKA 2QSIA 3D0ZA 4L0WA 5ENUA 3V1WA 2H6YA 1EWXA 2C80A 2VL2A 5AISA 1B9XC 3KM6A 5IPGA 1F2EA 4HUAA 2NDOA 3C7MA 3N9JA 1YEXA 3GURA 3N5OA 1PKZA 4ZBBA 1Z6NA 4XTSA 4EL1A 2CVKA 2DMLA 4NWYA 1FAAA 2FA8A 2NPBA 3ZYWA 1OC8A 4WXTA 1FVJA 4POMA 3H4KA 2F3MA 3GSTA 2IWTA 2C3TA 2YWMA 1EEMA 2VM2A 4MPGA 3LGCA 3ZVJA 3DYRA 5DVBA 2E2MA 5GAPD 4IQ1A 10GSA 6GSUA 3L0HA 5GSTA 1FG4A 1Q4JA 1FB0A 3D5JA 2H71A 3U6VA 2ZUPA 4ZL9A 3ED3A 1EGOA 1OYJA 1WMJA 2A4VA 4K7OA 1EEJA 2GSQA 3EU3A 3Q6OA 2NBSA 4L0UA 4RQXA 3C1SA 1HNBA 1ZCPA 4EE0A 4PNFA 1YEPA 1EOGA 4K0GA 6GSXA 2N5FA 1S3AA 1X5DA 4OWYA 2CX3A 4N30A 3TCOA 1Y25A 3TJGA 1ILOA 1V9WA 5KN0A 2X8HA 4MABA 4MCUA 3VPQA 1BJXA 1S3CA 5H5SA 2MMNA 5DCHA 2VCTA 1BYEA 3ZFBA 2LRCA 2NVLA 1ZYEA 4ZBDA 4OO5A 1QGVA 3QPMA 1TTZA 3PH9A 2G0FA 5D8IA 2DMMA 2AB6A 1G7EA 1M2AA 4J56E 2LKUA 3O76A 2LS5A 1XWKA 4ZB6A 3KCMA 2QGVA 5DJMA 2HSYA 5G30A 1URMA 5CRWA 2FGXA 4OFNA 1X9MB 1TW9A 1A2MA 1BQ7A 3A5WA 1M99A 3CRUA 2L4QA 3KEBA 1Z3EA 3Q19A 4D73A 1PN9A 2GVPA 5IOWA 2H66A 3VPTA 4EUYA 2RLIA 1R5PA 5ECLB 2YWNA 1U88A 1VF4A 4QL7A 3O3TA 2PPTA 2AAWA 4G9HA 4PXOA 1TOFA 4ZB8A 1GSSA 4KDUA 3CTGA 1FOVA 4WR5A 3I6AA 3BJ5A 1T4ZA 3WYWA 5DJLA 2C4JA 1BG5A 3HD5A 3QFBC 5DALB 3GIXA 3KMNA 5B8BA 3DD3A 4L5OA 1GUHA 4IJIA 2G2QA 2KHPA 4CHSA 5CO3A 3CSHA 2OBIA 3DMLA 5IQYA 1A23A 3Q74A 1MD3A 1SK0A 3UOMA 1YF1A 3FHKA 4GF0A 3BBYA 4MZCA 3UJ1A 4BVXA 5IMZA 2EIRA 1GRXA 3CBUA 1SYRA 2XHFA 2VL3A 5DAKA 4O92A 4XCSA 3BOAA 2P5RA 3H93A 4KH7A 3KZQA 2YZHA 4GWRA 5ECOB 2AYTA 4RQRA 2B6MA 3FK8A 3KMOA 4XS4A 7GSSA 1AQWA 2H1BA 1K0DA 5D93A 3WGXA 5B7CA 4EC0A 1SD8A 5ECQB 3H79A 3US3A 1JLVA 5H5RA 4TXOB 1BEDA 5AN1A 5D9TA 4QQ7A 2OACA 1N2AA 3DWVA 5IIZA 1PA3A 4AJ7A 5A5KA 1AUCA 1XVQA 1WRYA 3J7Yb 2WJUA 1SL2B 1F37A 1PKWA 3FR9A 1JLWA 4O5RA 3UIWA 3W8SA 2OADA 2ALBA 2TRXA 2Z9SA 1UVZA 5E4WA 2M72A 5D96A 2YPMA 1ACVA 1M2BA 2C0FA 2XBQA 4RI7A 2IFQB 3DXBA 4FYUA 3ME7A 3FEUA 3HCZA 4EF0A 3GH6A 1GP1A 1OVNA 1TKDB 5D9VA 3GL3A 1MEKA 1TP9A 4IBPA 2I4AA 2CZ2A 5ECMB 2JSYA 1QXHA 5AIXA 2TRCP 3IE3A 1XW5A 2GSSA 5C04A 3L4NA 1CQGA 5HFGA 1GUMA 3LSZA 4N11A 4EKZA 4KCAA 1DSBA 2H76A 2VD1A 11GSA 1DE1A 2LTKA 4O32A 1O73A 1OC3A 1K0AA 1CQHA 5J41A 3RBTA 2H74A 1YY7A 1S3DA 3DRNA 1ABAA 2WZ9A 1TRUA 1TK0B 2O85A 1J08A 1TU8A 2RUFA
chains in the Genus database with same CATH superfamily
5DQSA 2B5XA 5CP1A 1FVKA 5IO2A 1OKDA 4EDZA 3VI5A 1OC9A 3DVXA 2DIZA 4J57E 4ECBA 2HRKA 5CNWA 4HU9A 3P2AA 3G7JA 1LU4A 4BPYA 4TN8A 3DEXA 4YAVA 2R37A 4LA1A 2R4VA 3S9FA 2LNTA 3DKSA 3HVSA 4JE1A 1KNGA 1B48A 3GKMA 4CY8A 2E7PA 5ID2A 1O81A 2DJKA 1MDKA 4BWSA 1M9BA 2YV7A 3CSJA 2JZSA 1PD21 1ZYQB 3LYPA 4YQVA 3HYPA 2CAQA 5HR1A 1XCCA 4DEJA 2HZEB 3ZREA 1ERTA 1GLQA 3GSSA 4L5LA 5DCGA 2VLVA 2YJHA 3VK9A 2YWOA 2A2SA 2KOKA 1A0RP 2QKEA 4RI6A 2VL2C 1GSQA 4DSSA 2WCIA 4GSTA 1WE0A 4KNDA 4OO4A 8GSSA 1YZXA 5D73A 4Q5QA 3KJYA 4K5SA 3IPZA 1XOAA 3WT1A 2IIYA 2BJXA 5CYYA 2YJ7A 3BCKA 3EYTA 3MYDA 3I9V2 3OR5A 5COHA 1R5AA 2H0HA 4K8MA 1SJZA 2L5OA 2H75A 4OD7A 2VUPA 1PL1A 2LQQA 4I6XA 2ZCTA 3TDGA 2IMEA 2GT5A 4ZB9A 2AV4A 1GTIA 3ZRDA 4CDOA 20GSA 2B1KA 2VCWA 4F82A 3KH9A 4I97A 4KAEA 2HNLA 3E9JB 1E6BA 2CVDA 2FWGA 3U5RE 5HFIA 3CQFA 4F2IA 3PINA 3GYKA 1VF1A 1UC7A 5J5NA 3F0IA 4HSCX 2IL3A 1BX9A 1AC1A 1QUWA 2B3SA 3IRAA 3F3RA 4G0IA 3FZAA 5ECSA 2X8GA 3RPPA 1XPVA 2H19A 1SK1A 4WR4A 4X4JA 4GSNA 2I1UA 1N8JA 1XWBA 5LNKe 5GZZB 3CMIA 5INYA 1SL0B 3A5IA 3IAS2 2WRTA 3FR6A 1GWCA 1ZYPA 3QD9A 1NSWA 1ZOFA 4WKWA 3HVVA 2WS2A 5FHIA 4MF7A 1TJDA 1TRWA 2GTUA 3TRXA 2JL4A 4TR0A 1HYUA 4MPFA 3EE2A 4YAPA 3KP8A 1FHEA 1Z7RA 3GUSA 2MMZA 3F8UA 2O8VB 4ECCA 4KB3A 1SL1B 4ICYA 2H0GA 4PUFC 3HJMA 3LEFA 4KW6A 2VCQA 1H75A 19GSA 5HR0A 2N5BA 3MWHA 3D21A 4PURA 4GRFA 1GH2A 3C71A 3APOA 3EURA 2YP6A 4ZBAA 1EP7A 2GZYA 3TKSA 3IXRA 5LCZA 4O5QA 1TK5B 3NIVA 3GHAA 2C3NA 4XS1A 4BVYA 1X9SB 1Z7PA 4IS0A 1XW9A 1K0CA 2MBSA 3KIJA 5C00A 4HZ2A 2R0PA 4XHMA 5J9BA 5F05A 3ISOA 17GSA 5ECPB 2P0GA 3FMWA 3GL5A 4TR3A 1V40A 1J9BA 2O89A 5LD0A 1NW2A 3L9VA 4WBRD 2R5GA 4IN0A 2P5QA 2B1LA 6GSYA 2C0EA 2H1AA 1B9YC 3K8NA 1XIYA 5ECKB 3F63A 4TVEA 4NAXA 3WT2A 4PQHA 3P8WA 4F0BA 4IGJA 3WGDA 2UZ8A 1WOUA 4I5QA 2RM5A 4GCIA 1A0FA 5A4WA 3KGKA 5DAKB 2PVOC 4IHUA 3APSA 4KF9A 2X4AA 2R0GA 1SENA 5G5EA 5A4VA 4Z2UA 1PX6A 4CW9A 1GTUA 1JHBA 3HDCA 3IBHA 4MZWA 3ZFLA 2LEGA 3WGEA 3W6GA 3ERFA 4NHWA 6GSTA 3F6DA 1IYHA 1YDKA 1GSDA 1O6JA 2DJ3A 3QOUA 1EV9A 2WULA 5ELAA 2P31A 2HRAA 4MP4A 3C8EA 4ZXGA 2EIOA 4KA0A 3TJFA 1XOBA 3LXZA 3AY8A 4LLRA 4PGTA 1QK8A 4GSSA 2RM6A 2F51A 3ZVJD 1Z9HA 5KN2A 3SBCA 4ECJA 2PU9C 4KE3A 2HSMA 2LRNA 3APQA 4JR6A 1UA5A 3F6FA 4POKA 3TKPA 3UMAA 2EIQA 4X0XA 4K9ZA 4ZILA 2XPEA 3GTUA 4OFTA 2IPAA 1O7UA 4MH2A 2DLXA 2CZ3A 3UVHA 5G2ZA 1GULA 2FWEA 3R3EA 1O8XA 2IJYA 3GX0A 3HY2A 5G5FA 5KN3A 2F8FA 4NHZA 2EC4A 3QFAC 4HS1A 5ECIB 3TJKA 4DSRA 3GH9A 4IW9A 3M9JA 1V2AA 2OE0A 2C1YA 1ERVA 1TRVA 4PQIA 3ZITA 3ZIVA 3KH7A 2F8AA 3EWLA 2PGTA 3GN3A 3HA9A 1T00A 4MF6A 3UEMA 4XRAA 1TDIA 4TOPA 3RHBA 4ML6A 3MDKA 1LJRA 2LV3A 1PN0A 1HD2A 1T3BA 3O6TA 3QDNA 2XPDA 4WBJA 3HJPA 4J2FA 3L9UA 5CRGA 4HQSA 4IJ3A 1U6TA 4KDXA 5L71A 5JWOB 3GX8A 3TKQA 1QFNA 3J7Yk 1RQMA 2FNOA 4K2XA 1JFUA 2K6VA 2V41A 3CRTA 1I9DA 4G19A 1OC9B 1RW1A 1M9AA 1YKCA 2FY6A 4I2TA 1JZWA 2REMA 1EP8A 3F4RA 2X64A 2WDUA 2MYGA 5DBQA 2JACA 3M3MA 3WD6A 2JZTA 3LWAA 3QAGA 3GMFA 3RHCA 3ZMKA 2H72A 3CXGA 3LYKA 4P3YB 1YQ1A 3A2VA 2V32A 3VURA 3HZ8A 3TRPA 3RAZA 5ID2B 1G7OA 1EGRA 3SWLA 1W89A 2YANA 1NM3A 3JCML 4USSA 5CREA 3IC8A 2FA4A 3GRXA 2CQ9A 2HE3A 4JBBA 1ERWA 4IELA 1SJ6A 5F06A 1ST9A 1EZKA 2KUCA 1Q98A 5CRDA 5EVOA 1V57A 1OE7A 4KUNA 5ABRA 3EMPA 3IV4A 2CA8A 2H01A 1FB6A 3GKKA 5B8AA 4EIPA 1B4PA 4DSSB 3FYGA 4ULXA 4F03A 2J9HA 4V2LA 1TI3A 4PTSA 3UVTA 5J9CA 4V2MA 2PBJA 4I8BA 1KTEA 1HQOA 1WPIA 5BRTA 2C3QA 22GSA 2M46A 4EDYA 4HJ2A 2LNSA 3TJBA 1NHYA 4V1Ag 5IMDA 3PGTA 4PX1A 1XVWA 2GZPA 4YKGA 1SD9A 4ISDA 2C0GA 3L78A 2KLXA 3F4SA 3KXOA 1T8EB 2E0QA 3FKFA 4ZL7A 1SJIA 2FD3A 5D9XA 2HRNA 18GSA 2IFQA 5DQYA 4KDYA 2VLTA 4KSMA 2AJQB 3D4MA 2VM1A 3FY7A 1SYXA 4NV5A 4KX4A 2FLSA 4TW5A 3D22A 4ZL8A 4GQFA 4LMVA 2GQKA 1MDIA 3ME8A 4ACSA 2VCVA 4LL4B 4FO5A 1O8WA 5IMVA 5ECRB 4OCFA 1K3OA 1R26A 5G31A 2L5LA 2XBIA 2R2JA 2H1GA 2HRFA 3VI7A 2VL9A 3QCPA 2QC7A 4IP1A 3UBKA 1C72A 2JU5A 4AJ6A 2DKHA 3C73A 1I5GA 2OJLA 1ZGNA 1XXUA 2PVQA 4HI7A 4MK3A 4JU5A 1EV4A 1UN2A 4OMVA 3VWVA 5GAND 4N0ZA 1AW9A 4MZBA 2VD0A 4NMUA 2ES7A 1W4VA 3A2WA 3NOFA 5IO0A 4RUVA 3UL3A 1H4OA 4E8HA 1A8LA 3ZMLA 3EMXA 1GTBA 4TR1A 2HSHA 4G0KA 1K0OA 4TR4A 1DUGA 4BA7A 4HU7A 1PMTA 1T4YA 1X0RA 3MSZA 1K0NA 3IHQA 13GSA 1ZMAA 4KGIA 2IMFA 2GLRA 1GLPA 1K3YA 5DDLA 4MLYA 2HZEA 3VFIA 5JWRB 1XZOA 4MJEA 1AAZA 3TB2A 3PPUA 2M80A 2PN8A 1OE8A 1M7TA 4HZ4A 4F9ZA 2HYXA 2X49A 1G6WA 4G2EA 4BVYB 1USBA 2VLUA 2DBCA 3TKSC 1FOHA 1SKSB 4K7NA 2R6KA 1Z6MA 5ELGA 2YWIA 4EIQA 1X5CA 4GQCA 1RK4A 3QAVA 3ZL5A 2FWFA 1GSFA 3H1NA 5IPHA 1Z5YE 4HQZA 1M3JA 3C1RA 4MF5A 4ML1A 2X8CA 3FZ9A 2PERA 2K8VA 4Q5FA 1F3AA 4AGSA 4X1UA 4HOJA 2OA7A 2GZZA 2O7KA 2AUVA 4N10A 1VF3A 2F9SA 2A4HA 1OAZA 3UARA 3LORA 1DE2A 4XRDA 4D73B 6GSWA 3Q18A 5HFKA 5CRHA 3IAM2 3HJOA 4CY6A 1GSUA 4K0NA 5FWGA 2GT6A 2YNXA 1LBKA 3F9UA 2JZRA 3IA1A 2BMXA 1GSYA 2DJ2A 3QR6A 2OKAA 4PUAA 3ERGA 5EL8A 2IN3A 4WF4A 5ECHB 2GQMA 2B7JA 1ERUA 2ON5A 1GTAA 2ON7A 1XWCA 2C8UA 3A3TA 1JZRA 3MAKA 2CV4A 1XG8A 2V6KA 4YH2A 1KEBA 4NXIA 2FCHA 2YOIA 2YN1A 2MMAA 3TUEA 12GSA 1TI1A 3IDVA 1E2YA 5G1KA 4OCEA 1TXXA 1TK8B 1V98A 2IMDA 2VO4A 2D2ZA 2FWHA 5B6MA 4XIHA 3GKXA 5J3RA 1GNEA 4TKYA 4MJCA 3GTUB 4JEDA 4H86A 4MMMA 4BVXB 2CAIA 2GS3A 2I9HA 4FH8A 1R7HA 4EO3A 2VAFA 3EU4A 3ZTLA 4NV2A 2PWJA 3KP9A 1SK2A 3QAWA 4Z7XA 1AQXA 3G7YA 4K6XA 3EVIA 3E0UA 4LMWA 1T1VA 1JZDA 4XS4B 1TU7A 1WWJA 5G1LA 1ON4A 3UBLA 2WB9A 4PNGA 2BTOT 1HNAA 3IK7A 4K7IA 4HEA2 2CX4A 4GXZA 2I3YA 3CTFA 2IMIA 1ZZYA 2E2GA 2YCDA 2L6CA 1Y6EA 3DIEA 2DC5A 1PL2A 1PX7A 4ILFA 1XWGA 2OBKA 2RUEA 2B5EA 1ZL9A 4EXJA 3KTBA 2H6ZA 2LQOA 1WJKA 2O87A 3HHVA 2OE3A 1A2LA 3FR3A 4DSQA 2H8LA 4XS6A 3IK9A 5AIVA 1WP0A 1AQVA 3EINA 2AHEA 2I81A 2L4CA 1K0BA 4Z2RA 1B8XA 14GSA 3ZLPA 5HR3A 3RDWA 1A8YA 3IR4A 2YV9A 3A2XA 3LFLA 3PR8A 1T7PB 4N0VA 3GNJA 4JR4A 2K8SA 4OFMA 5J4UA 2HT9A 3QMXA 3FZ4A 1GSEA 1SKWB 1U3IA 9GSSA 5E59A 4DVCA 5IMAA 1XFLA 1XBSA 2DJ0A 4JZQA 3HKRA 5F8BA 16GSA 2HXKA 4IVFA 1PGTA 2CVBA 4AJ8A 3MIXA 4TXVA 4K1FA 4HJMA 3TOUA 2WFCA 2GQLA 3M9KA 2JSZA 2L6DA 3ERWA 2LSTA 1JZOA 4FYCA 5A4UA 5DALA 3D6IA 3I43A 1G6YA 3KTLA 2H6XA 2QA1A 1IYIA 1U3AA 5JCGA 2PMTA 4ZIJA 4G10A 3M0FA 2GSTA 5IMCA 2H0IA 2DJJA 4POBA 2A2RA 3EC3A 3CSIA 2X99A 3ZIJA 1THOA 3IOSA 1F9MA 2ZNMA 5JCWA 2HZFA 4K5RA 1FO5A 5AGYA 5H5QA 3TJJA 1MD4A 3MNGA 5KN1A 2K9FA 1GL8A 2H73A 3LG6A 3TRQA 2B5YA 4KSOA 1GUKA 1SU9A 2HLSA 2L59A 1WIKA 2FUG2 4MJBA 3ZZXA 2LJAA 5EPFA 1PSQA 3G7IA 5IMFA 5KEJA 4V1Ap 1KBNA 3I69A 3M8NA 3IHGA 3R2QA 5GSSA 3CYNA 5EY6A 1XW6A 4YQMA 1MDJA 5D9WA 2GDRA 3HXSA 2H70A 4TXOA 4X43A 4BWQA 4IKHA 2MZCA 4O7HA 1VGLA 2JADA 3W8JA 5FT3A 4Q5NA 3TOTA 5B6NA 3DVWA 4MNNA 2R3XA 6GSVA 3E3EA 4YQUA 1OKTA 4FIWA 2TIRA 3FW2A 2DJ1A 4MJAA 1YJ6A 3HZ4A 5IM9A 2PUKC 5F07A 2K18A 4EVMA 4TRXA 4HDEA 4MDCA 2RIIA 2LJRA 2V6OA 4JRRA 4WEYA 2VOCA 2MBTA 4Q5RA 1DBYA 3DGQA 2NTOA 1B4QA 3F3QA 5CAXA 3GKNA 2WGRA 3TKSE 1QMVA 4BL7A 3IC4A 3FZ5A 4WF5A 1XWAA 4WETA 2N5AA 1YF0A 3BCIA 1M0UA 1VRSD 3F4TA 1TRSA 4TR1B 2GSRA 1QQ2A 2H30A 2MMOA 1ML6A 4ECIA 1A2JA 3KD0A 4F0CA 3TKRA 2OE1A 5F0GA 5KOXA 4Z2TA 1AIUA 2H1DA 2CT6A 1SKRB 2LRTA 5JCUA 3H8QA 3LW9A 3M1GA 4L8EA 1THXA 3FRCA 3D4TA 4QL9A 2C0DA 5JWQB 1X9WB 3LQ7A 1R4WA 3TGZA 2B7KA 2KP2A 4GLTA 5ECNB 3VLNA 3VWUA 1V58A 2V1MA 4FYBA 1O85A 2V2GA 4IQAA 1VF2A 6GSSA 4GTUA 1A24A 1F6MC 4KCEA 4POLA 3HVXA 1FW1A 2IMKA 3VWXA 1G0TA 3P90A 2VCZA 1HNCA 4PQ1A 5HR2A 3NZNA 1MTCA 2VIMA 4NPBA 4MA9A 1F3BA 3G9BA 3VWWA 1YKAA 1X5EA 2GGTA 2HI7A 1PRXA 1M2DA 4FQUA 2LUSA 1K3LA 4AF2A 4LL1B 3LJRA 3RPNA 5IOXA 2XC2A 3LXTA 2DIYA 1EOHA 2FHEA 1PQNA 4V2NA 1NHOA 4BIKA 4ID0A 2HFDA 3GA4A 4E8EA 3BD2A 3L9SA 4I2UA 2DSAA 3P7XA 3UAPA 1GNWA 1J0FA 3GFKA 5HQPA 2YZUA 4IP6A 1AXDA 2J23A 2KP1A 4MH3A 2VCXA 2L57A 1BAYA 4K2DA 1K0MA 3GV1A 1U87A 2LJKA 2QSIA 3D0ZA 4L0WA 5ENUA 3V1WA 2H6YA 1EWXA 2C80A 2VL2A 5AISA 1B9XC 3KM6A 5IPGA 1F2EA 4HUAA 2NDOA 3C7MA 1PFOA 3N9JA 1YEXA 1M3IA 3GURA 3N5OA 1PKZA 2A2PA 4ZBBA 1Z6NA 3EPTA 4XTSA 4EL1A 2CVKA 2DMLA 4NWYA 1FAAA 2FA8A 2NPBA 3ZYWA 1OC8A 4WXTA 1FVJA 4POMA 3H4KA 2F3MA 3GSTA 2IWTA 2C3TA 2YWMA 1EEMA 2VM2A 4MPGA 3LGCA 3ZVJA 1ZYNA 3DYRA 5DVBA 2E2MA 5GAPD 4IQ1A 10GSA 6GSUA 3L0HA 5GSTA 1FG4A 1Q4JA 1FB0A 3D5JA 2H71A 3U6VA 2ZUPA 4ZL9A 3ED3A 1EGOA 1OYJA 1WMJA 2A4VA 4K7OA 1EEJA 2GSQA 3EU3A 4O5UA 3Q6OA 2NBSA 4L0UA 4RQXA 5BMUA 3C1SA 1HNBA 1ZCPA 2QA2A 4EE0A 4PNFA 1YEPA 1EOGA 4K0GA 6GSXA 2N5FA 1S3AA 1X5DA 4OWYA 2CX3A 4N30A 3TCOA 1Y25A 3TJGA 1ILOA 1V9WA 5KN0A 2X8HA 5KOWA 4MABA 4MCUA 3VPQA 1BJXA 1S3CA 5H5SA 2MMNA 5DCHA 2VCTA 1BYEA 3ZFBA 2LRCA 2NVLA 1ZYEA 4ZBDA 4OO5A 1QGVA 3QPMA 1TTZA 3PH9A 2G0FA 5D8IA 2DMMA 2AB6A 1G7EA 1M2AA 4J56E 2LKUA 3O76A 2LS5A 1XWKA 4ZB6A 3KCMA 2QGVA 5DJMA 2HSYA 5G30A 1URMA 5CRWA 2FGXA 4OFNA 1X9MB 1TW9A 1A2MA 1BQ7A 3A5WA 1M99A 3CRUA 2L4QA 3KEBA 1Z3EA 3Q19A 4D73A 1PN9A 2GVPA 4YKFA 5IOWA 2H66A 3VPTA 4EUYA 2RLIA 1R5PA 5ECLB 2YWNA 1U88A 1VF4A 4QL7A 3O3TA 2PPTA 2AAWA 4G9HA 4PXOA 2R0CA 1TOFA 4ZB8A 1GSSA 4KDUA 3CTGA 1FOVA 4WR5A 3I6AA 3BJ5A 1T4ZA 3WYWA 5DJLA 2C4JA 1BG5A 1S3RA 3HD5A 3QFBC 5DALB 3GIXA 3KMNA 5B8BA 3DD3A 4L5OA 1GUHA 4IJIA 2G2QA 2KHPA 4CHSA 5CO3A 3CSHA 2OBIA 3DMLA 2DKIA 5IQYA 1A23A 3Q74A 1MD3A 1SK0A 3UOMA 1YF1A 3FHKA 4GF0A 3BBYA 4MZCA 3UJ1A 4BVXA 5IMZA 2EIRA 1GRXA 3CBUA 1SYRA 2XHFA 2VL3A 5DAKA 4O92A 4XCSA 3BOAA 2P5RA 3H93A 4KH7A 3KZQA 2YZHA 4GWRA 5ECOB 2AYTA 4RQRA 2B6MA 3FK8A 3KMOA 4XS4A 7GSSA 1AQWA 2H1BA 1K0DA 5D93A 3WGXA 4G0LA 5B7CA 4EC0A 1SD8A 5ECQB 3H79A 3US3A 1JLVA 5H5RA 4TXOB 1BEDA 3HVNA 5AN1A 5D9TA 4QQ7A 2OACA 1N2AA 3DWVA 5IIZA 1PA3A 4AJ7A 5A5KA 1AUCA 1XVQA 1WRYA 3J7Yb 2WJUA 1SL2B 1F37A 1PKWA 3FR9A 1JLWA 4O5RA 3UIWA 3W8SA 2OADA 2ALBA 2TRXA 2Z9SA 1UVZA 5E4WA 2M72A 5D96A 2YPMA 1ACVA 1M2BA 2C0FA 2XBQA 4RI7A 2IFQB 3DXBA 4BL7B 4FYUA 3ME7A 3FEUA 3HCZA 4EF0A 3GH6A 1GP1A 1OVNA 1TKDB 5D9VA 3GL3A 1MEKA 1TP9A 4IBPA 2I4AA 2CZ2A 5ECMB 2JSYA 1QXHA 5AIXA 2TRCP 3IE3A 1XW5A 2GSSA 5C04A 3L4NA 1CQGA 5HFGA 1GUMA 3LSZA 4N11A 4EKZA 4KCAA 1DSBA 2H76A 2VD1A 11GSA 1DE1A 2LTKA 4O32A 1O73A 1OC3A 1K0AA 1CQHA 5J41A 3RBTA 2H74A 1YY7A 1S3DA 3DRNA 1ABAA 2WZ9A 1TRUA 1TK0B 2O85A 1J08A 4A5PA 1TU8A 2RUFA
chains in the Genus database with same CATH topology
5DQSA 2B5XA 5CP1A 1FVKA 5IO2A 1OKDA 4EDZA 3VI5A 1OC9A 3DVXA 2DIZA 4J57E 4ECBA 2HRKA 5CNWA 4HU9A 3P2AA 3G7JA 1LU4A 4BPYA 4TN8A 3DEXA 4YAVA 2R37A 4LA1A 2R4VA 3S9FA 2LNTA 3DKSA 3HVSA 4JE1A 1KNGA 1B48A 3GKMA 4CY8A 2E7PA 5ID2A 1O81A 2DJKA 1MDKA 4BWSA 1M9BA 2YV7A 3CSJA 2JZSA 1PD21 1ZYQB 3LYPA 4YQVA 3HYPA 2CAQA 5HR1A 1XCCA 4DEJA 2HZEB 3ZREA 1ERTA 1GLQA 3GSSA 4L5LA 5DCGA 2VLVA 2YJHA 3VK9A 2YWOA 2A2SA 2KOKA 1A0RP 2QKEA 4RI6A 2VL2C 1GSQA 4DSSA 2WCIA 4GSTA 1WE0A 4KNDA 4OO4A 8GSSA 1YZXA 5D73A 4Q5QA 3KJYA 4K5SA 3IPZA 1XOAA 3WT1A 2IIYA 2BJXA 5CYYA 2YJ7A 3BCKA 3EYTA 3MYDA 3I9V2 3OR5A 5COHA 1R5AA 2H0HA 4K8MA 1SJZA 2L5OA 2H75A 4OD7A 2VUPA 1PL1A 2LQQA 4I6XA 2ZCTA 3TDGA 2IMEA 2GT5A 4ZB9A 2AV4A 1GTIA 3ZRDA 4CDOA 20GSA 2B1KA 2VCWA 4F82A 3KH9A 4I97A 4KAEA 2HNLA 3E9JB 1E6BA 2CVDA 2FWGA 3U5RE 5HFIA 4F2IA 3PINA 3GYKA 1VF1A 1UC7A 5J5NA 3F0IA 2IL3A 1BX9A 1AC1A 1QUWA 2B3SA 3IRAA 3F3RA 4G0IA 3FZAA 5ECSA 2X8GA 3RPPA 1XPVA 2H19A 1SK1A 4WR4A 4X4JA 4GSNA 2I1UA 1N8JA 1XWBA 5LNKe 5GZZB 3CMIA 5INYA 1SL0B 3A5IA 3IAS2 2WRTA 3FR6A 1GWCA 1ZYPA 3QD9A 1NSWA 1ZOFA 4WKWA 3HVVA 2WS2A 5FHIA 4MF7A 1TJDA 1TRWA 2GTUA 3TRXA 2JL4A 4TR0A 1HYUA 4MPFA 3EE2A 4YAPA 3KP8A 1FHEA 1Z7RA 3GUSA 2MMZA 3F8UA 2O8VB 4ECCA 4KB3A 1SL1B 4ICYA 2H0GA 4PUFC 3HJMA 3LEFA 4KW6A 2VCQA 1H75A 19GSA 5HR0A 2N5BA 3MWHA 3D21A 4PURA 4GRFA 1GH2A 3C71A 3APOA 3EURA 2YP6A 4ZBAA 1EP7A 2GZYA 3TKSA 3IXRA 5LCZA 4O5QA 1TK5B 3NIVA 3GHAA 2C3NA 4XS1A 4BVYA 1X9SB 1Z7PA 4IS0A 1XW9A 1K0CA 2MBSA 3KIJA 5C00A 4HZ2A 2R0PA 4XHMA 5J9BA 5F05A 3ISOA 17GSA 5ECPB 2P0GA 3FMWA 3GL5A 4TR3A 1V40A 1J9BA 2O89A 5LD0A 1NW2A 3L9VA 4WBRD 2R5GA 4IN0A 2P5QA 2B1LA 6GSYA 2C0EA 2H1AA 1B9YC 3K8NA 1XIYA 5ECKB 3F63A 4TVEA 4NAXA 3WT2A 4PQHA 3P8WA 4F0BA 4IGJA 3WGDA 2UZ8A 1WOUA 4I5QA 2RM5A 4GCIA 1A0FA 5A4WA 3KGKA 5DAKB 2PVOC 4IHUA 3APSA 4KF9A 2X4AA 2R0GA 1SENA 5G5EA 5A4VA 4Z2UA 1PX6A 4CW9A 1GTUA 1JHBA 3HDCA 3IBHA 4MZWA 3ZFLA 2LEGA 3WGEA 3W6GA 3ERFA 4NHWA 6GSTA 3F6DA 1IYHA 1YDKA 1GSDA 1O6JA 2DJ3A 3QOUA 1EV9A 2WULA 5ELAA 2P31A 2HRAA 4MP4A 3C8EA 4ZXGA 2EIOA 4KA0A 3TJFA 1XOBA 3LXZA 3AY8A 4LLRA 4PGTA 1QK8A 4GSSA 2RM6A 2F51A 3ZVJD 1Z9HA 5KN2A 3SBCA 4ECJA 2PU9C 4KE3A 2HSMA 2LRNA 3APQA 4JR6A 1UA5A 3F6FA 4POKA 3TKPA 3UMAA 2EIQA 4X0XA 4K9ZA 4ZILA 2XPEA 3GTUA 4OFTA 2IPAA 1O7UA 4MH2A 2DLXA 2CZ3A 3UVHA 5G2ZA 1GULA 2FWEA 3R3EA 1O8XA 2IJYA 3GX0A 3HY2A 5G5FA 5KN3A 2F8FA 4NHZA 2EC4A 3QFAC 4HS1A 5ECIB 3TJKA 4DSRA 3GH9A 4IW9A 3M9JA 1V2AA 2OE0A 2C1YA 1ERVA 1TRVA 4PQIA 3ZITA 3ZIVA 3KH7A 2F8AA 3EWLA 2PGTA 3GN3A 3HA9A 1T00A 4MF6A 3UEMA 4XRAA 1TDIA 4TOPA 3RHBA 4ML6A 3MDKA 1LJRA 2LV3A 1PN0A 1HD2A 1T3BA 3O6TA 3QDNA 2XPDA 4WBJA 3HJPA 4J2FA 3L9UA 5CRGA 4HQSA 4IJ3A 1U6TA 4KDXA 5L71A 5JWOB 3GX8A 3TKQA 1QFNA 3J7Yk 1RQMA 2FNOA 4K2XA 1JFUA 2K6VA 2V41A 3CRTA 1I9DA 4G19A 1OC9B 1RW1A 1M9AA 1YKCA 2FY6A 4I2TA 1JZWA 2REMA 1EP8A 3F4RA 2X64A 2WDUA 2MYGA 5DBQA 2JACA 3M3MA 3WD6A 2JZTA 3LWAA 3QAGA 3GMFA 3RHCA 3ZMKA 2H72A 3CXGA 3LYKA 4P3YB 1YQ1A 3A2VA 2V32A 3VURA 3HZ8A 3TRPA 3RAZA 5ID2B 1G7OA 1EGRA 3SWLA 1W89A 2YANA 1NM3A 3JCML 4USSA 5CREA 3IC8A 2FA4A 3GRXA 2CQ9A 2HE3A 4JBBA 1ERWA 4IELA 1SJ6A 5F06A 1ST9A 1EZKA 2KUCA 1Q98A 5CRDA 5EVOA 1V57A 1OE7A 4KUNA 5ABRA 3EMPA 3IV4A 2CA8A 2H01A 1FB6A 3GKKA 5B8AA 4EIPA 1B4PA 4DSSB 3FYGA 4ULXA 4F03A 2J9HA 4V2LA 1TI3A 4PTSA 3UVTA 5J9CA 4V2MA 2PBJA 4I8BA 1KTEA 1HQOA 1WPIA 5BRTA 2C3QA 22GSA 2M46A 4EDYA 4HJ2A 2LNSA 3TJBA 1NHYA 4V1Ag 5IMDA 3PGTA 4PX1A 1XVWA 2GZPA 4YKGA 1SD9A 4ISDA 2C0GA 3L78A 2KLXA 3F4SA 3KXOA 1T8EB 2E0QA 3FKFA 4ZL7A 1SJIA 2FD3A 5D9XA 2HRNA 18GSA 2IFQA 5DQYA 4KDYA 2VLTA 4KSMA 2AJQB 3D4MA 2VM1A 3FY7A 1SYXA 4NV5A 4KX4A 2FLSA 4TW5A 3D22A 4ZL8A 4GQFA 4LMVA 2GQKA 1MDIA 3ME8A 4ACSA 2VCVA 4LL4B 4FO5A 1O8WA 5IMVA 5ECRB 4OCFA 1K3OA 1R26A 5G31A 2L5LA 2XBIA 2R2JA 2H1GA 2HRFA 3VI7A 2VL9A 3QCPA 2QC7A 4IP1A 3UBKA 1C72A 2JU5A 4AJ6A 2DKHA 3C73A 1I5GA 2OJLA 1ZGNA 1XXUA 2PVQA 4HI7A 4MK3A 4JU5A 1EV4A 1UN2A 4OMVA 3VWVA 5GAND 4N0ZA 1AW9A 4MZBA 2VD0A 4NMUA 2ES7A 1W4VA 3A2WA 3NOFA 5IO0A 4RUVA 3UL3A 1H4OA 4E8HA 1A8LA 3ZMLA 3EMXA 1GTBA 4TR1A 2HSHA 4G0KA 1K0OA 4TR4A 1DUGA 4BA7A 4HU7A 1PMTA 1T4YA 1X0RA 3MSZA 1K0NA 3IHQA 13GSA 1ZMAA 4KGIA 2IMFA 2GLRA 1GLPA 1K3YA 5DDLA 4MLYA 2HZEA 3VFIA 5JWRB 1XZOA 4MJEA 1AAZA 3TB2A 3PPUA 2M80A 2PN8A 1OE8A 1M7TA 4HZ4A 4F9ZA 2HYXA 2X49A 1G6WA 4G2EA 4BVYB 1USBA 2VLUA 2DBCA 3TKSC 1FOHA 1SKSB 4K7NA 2R6KA 1Z6MA 5ELGA 2YWIA 4EIQA 1X5CA 4GQCA 1RK4A 3QAVA 3ZL5A 2FWFA 1GSFA 3H1NA 5IPHA 1Z5YE 4HQZA 3C1RA 4MF5A 4ML1A 2X8CA 3FZ9A 2PERA 2K8VA 4Q5FA 1F3AA 4AGSA 4X1UA 4HOJA 2OA7A 2GZZA 2O7KA 2AUVA 4N10A 1VF3A 2F9SA 2A4HA 1OAZA 3UARA 3LORA 1DE2A 4XRDA 4D73B 6GSWA 3Q18A 5HFKA 5CRHA 3IAM2 3HJOA 4CY6A 1GSUA 4K0NA 5FWGA 2GT6A 2YNXA 1LBKA 3F9UA 2JZRA 3IA1A 2BMXA 1GSYA 2DJ2A 3QR6A 2OKAA 4PUAA 3ERGA 5EL8A 2IN3A 4WF4A 5ECHB 2GQMA 2B7JA 1ERUA 2ON5A 1GTAA 2ON7A 1XWCA 2C8UA 3A3TA 1JZRA 3MAKA 2CV4A 2V6KA 4YH2A 1KEBA 4NXIA 2FCHA 2YOIA 2YN1A 2MMAA 3TUEA 12GSA 1TI1A 3IDVA 1E2YA 5G1KA 4OCEA 1TXXA 1TK8B 1V98A 2IMDA 2VO4A 2D2ZA 2FWHA 5B6MA 4XIHA 3GKXA 5J3RA 1GNEA 4TKYA 4MJCA 3GTUB 4JEDA 4H86A 4MMMA 4BVXB 2CAIA 2GS3A 2I9HA 4FH8A 1R7HA 4EO3A 2VAFA 3EU4A 3ZTLA 4NV2A 2PWJA 3KP9A 1SK2A 3QAWA 4Z7XA 1AQXA 3G7YA 4K6XA 3EVIA 3E0UA 4LMWA 1T1VA 1JZDA 4XS4B 1TU7A 1WWJA 5G1LA 1ON4A 3UBLA 2WB9A 4PNGA 2BTOT 1HNAA 3IK7A 4K7IA 4HEA2 2CX4A 4GXZA 2I3YA 3CTFA 2IMIA 1ZZYA 2E2GA 2YCDA 2L6CA 1Y6EA 3DIEA 2DC5A 1PL2A 1PX7A 4ILFA 1XWGA 2OBKA 2RUEA 2B5EA 1ZL9A 4EXJA 3KTBA 2H6ZA 2LQOA 1WJKA 2O87A 3HHVA 2OE3A 1A2LA 3FR3A 4DSQA 2H8LA 4XS6A 3IK9A 5AIVA 1WP0A 1AQVA 3EINA 2AHEA 2I81A 2L4CA 1K0BA 4Z2RA 1B8XA 14GSA 3ZLPA 5HR3A 3RDWA 1A8YA 3IR4A 2YV9A 3A2XA 3LFLA 3PR8A 1T7PB 4N0VA 3GNJA 4JR4A 2K8SA 4OFMA 5J4UA 2HT9A 3QMXA 3FZ4A 1GSEA 1SKWB 1U3IA 9GSSA 5E59A 4DVCA 5IMAA 1XFLA 1XBSA 2DJ0A 4JZQA 3HKRA 5F8BA 16GSA 2HXKA 4IVFA 1PGTA 2CVBA 4AJ8A 3MIXA 4TXVA 4K1FA 4HJMA 3TOUA 2WFCA 2GQLA 3M9KA 2JSZA 2L6DA 3ERWA 2LSTA 1JZOA 4FYCA 5A4UA 5DALA 3D6IA 3I43A 1G6YA 3KTLA 2H6XA 2QA1A 1IYIA 1U3AA 5JCGA 2PMTA 4ZIJA 4G10A 3M0FA 2GSTA 5IMCA 2H0IA 2DJJA 4POBA 2A2RA 3EC3A 3CSIA 2X99A 3ZIJA 1THOA 3IOSA 1F9MA 2ZNMA 5JCWA 2HZFA 4K5RA 1FO5A 5AGYA 5H5QA 3TJJA 1MD4A 3MNGA 5KN1A 2K9FA 1GL8A 2H73A 3LG6A 3TRQA 2B5YA 4KSOA 1GUKA 1SU9A 2HLSA 2L59A 1WIKA 2FUG2 4MJBA 3ZZXA 2LJAA 5EPFA 1PSQA 3G7IA 5IMFA 5KEJA 4V1Ap 1KBNA 3I69A 3M8NA 3IHGA 3R2QA 5GSSA 3CYNA 5EY6A 1XW6A 4YQMA 1MDJA 5D9WA 2GDRA 3HXSA 2H70A 4TXOA 4X43A 4BWQA 4IKHA 2MZCA 4O7HA 1VGLA 2JADA 3W8JA 5FT3A 4Q5NA 3TOTA 5B6NA 3DVWA 4MNNA 2R3XA 6GSVA 3E3EA 4YQUA 1OKTA 4FIWA 2TIRA 3FW2A 2DJ1A 4MJAA 1YJ6A 3HZ4A 5IM9A 2PUKC 5F07A 2K18A 4EVMA 4TRXA 4HDEA 4MDCA 2RIIA 2LJRA 2V6OA 4JRRA 4WEYA 2VOCA 2MBTA 4Q5RA 1DBYA 3DGQA 2NTOA 1B4QA 3F3QA 5CAXA 3GKNA 2WGRA 3TKSE 1QMVA 4BL7A 3IC4A 3FZ5A 4WF5A 1XWAA 4WETA 2N5AA 1YF0A 3BCIA 1M0UA 1VRSD 3F4TA 1TRSA 4TR1B 2GSRA 1QQ2A 2H30A 2MMOA 1ML6A 4ECIA 1A2JA 3KD0A 4F0CA 3TKRA 2OE1A 5F0GA 5KOXA 4Z2TA 1AIUA 2H1DA 2CT6A 1SKRB 2LRTA 5JCUA 3H8QA 3LW9A 3M1GA 4L8EA 1THXA 3FRCA 3D4TA 4QL9A 2C0DA 5JWQB 1X9WB 3LQ7A 1R4WA 3TGZA 2B7KA 2KP2A 4GLTA 5ECNB 3VLNA 3VWUA 1V58A 2V1MA 4FYBA 1O85A 2V2GA 4IQAA 1VF2A 6GSSA 4GTUA 1A24A 1F6MC 4KCEA 4POLA 3HVXA 1FW1A 2IMKA 3VWXA 1G0TA 3P90A 2VCZA 1HNCA 4PQ1A 5HR2A 3NZNA 1MTCA 2VIMA 4NPBA 4MA9A 1F3BA 3G9BA 3VWWA 1YKAA 1X5EA 2GGTA 2HI7A 1PRXA 1M2DA 4FQUA 2LUSA 1K3LA 4AF2A 4LL1B 3LJRA 3RPNA 5IOXA 2XC2A 3LXTA 2DIYA 1EOHA 2FHEA 1PQNA 4V2NA 1NHOA 4ID0A 2HFDA 3GA4A 4E8EA 3BD2A 3L9SA 4I2UA 2DSAA 3P7XA 3UAPA 1GNWA 1J0FA 3GFKA 5HQPA 2YZUA 4IP6A 1AXDA 2J23A 2KP1A 4MH3A 2VCXA 2L57A 1BAYA 4K2DA 1K0MA 3GV1A 1U87A 2LJKA 2QSIA 3D0ZA 4L0WA 5ENUA 3V1WA 2H6YA 1EWXA 2C80A 2VL2A 5AISA 1B9XC 3KM6A 5IPGA 1F2EA 4HUAA 2NDOA 3C7MA 3N9JA 1YEXA 3GURA 3N5OA 1PKZA 2A2PA 4ZBBA 1Z6NA 3EPTA 4XTSA 4EL1A 2CVKA 2DMLA 4NWYA 1FAAA 2FA8A 2NPBA 3ZYWA 1OC8A 4WXTA 1FVJA 4POMA 3H4KA 2F3MA 3GSTA 2IWTA 2C3TA 2YWMA 1EEMA 2VM2A 4MPGA 3LGCA 3ZVJA 1ZYNA 3DYRA 5DVBA 2E2MA 5GAPD 4IQ1A 10GSA 6GSUA 3L0HA 5GSTA 1FG4A 1Q4JA 1FB0A 3D5JA 2H71A 3U6VA 2ZUPA 4ZL9A 3ED3A 1EGOA 1OYJA 1WMJA 2A4VA 4K7OA 1EEJA 2GSQA 3EU3A 4O5UA 3Q6OA 2NBSA 4L0UA 4RQXA 5BMUA 3C1SA 1HNBA 1ZCPA 2QA2A 4EE0A 4PNFA 1YEPA 1EOGA 4K0GA 6GSXA 2N5FA 1S3AA 1X5DA 4OWYA 2CX3A 4N30A 3TCOA 1Y25A 3TJGA 1ILOA 1V9WA 5KN0A 2X8HA 5KOWA 4MABA 4MCUA 3VPQA 1BJXA 1S3CA 5H5SA 2MMNA 5DCHA 2VCTA 1BYEA 3ZFBA 2LRCA 2NVLA 1ZYEA 4ZBDA 4OO5A 1QGVA 3QPMA 1TTZA 3PH9A 2G0FA 5D8IA 2DMMA 2AB6A 1G7EA 1M2AA 4J56E 2LKUA 3O76A 2LS5A 1XWKA 4ZB6A 3KCMA 2QGVA 5DJMA 2HSYA 5G30A 1URMA 5CRWA 2FGXA 4OFNA 1X9MB 1TW9A 1A2MA 1BQ7A 3A5WA 1M99A 3CRUA 2L4QA 3KEBA 1Z3EA 3Q19A 4D73A 1PN9A 2GVPA 4YKFA 5IOWA 2H66A 3VPTA 4EUYA 2RLIA 1R5PA 5ECLB 2YWNA 1U88A 1VF4A 4QL7A 3O3TA 2PPTA 2AAWA 4G9HA 4PXOA 2R0CA 1TOFA 4ZB8A 1GSSA 4KDUA 3CTGA 1FOVA 4WR5A 3I6AA 3BJ5A 1T4ZA 3WYWA 5DJLA 2C4JA 1BG5A 3HD5A 3QFBC 5DALB 3GIXA 3KMNA 5B8BA 3DD3A 4L5OA 1GUHA 4IJIA 2G2QA 2KHPA 4CHSA 5CO3A 3CSHA 2OBIA 3DMLA 2DKIA 5IQYA 1A23A 3Q74A 1MD3A 1SK0A 3UOMA 1YF1A 3FHKA 4GF0A 3BBYA 4MZCA 3UJ1A 4BVXA 5IMZA 2EIRA 1GRXA 3CBUA 1SYRA 2XHFA 2VL3A 5DAKA 4O92A 4XCSA 3BOAA 2P5RA 3H93A 4KH7A 3KZQA 2YZHA 4GWRA 5ECOB 2AYTA 4RQRA 2B6MA 3FK8A 3KMOA 4XS4A 7GSSA 1AQWA 2H1BA 1K0DA 5D93A 3WGXA 4G0LA 5B7CA 4EC0A 1SD8A 5ECQB 3H79A 3US3A 1JLVA 5H5RA 4TXOB 1BEDA 5AN1A 5D9TA 4QQ7A 2OACA 1N2AA 3DWVA 5IIZA 1PA3A 4AJ7A 5A5KA 1AUCA 1XVQA 1WRYA 3J7Yb 2WJUA 1SL2B 1F37A 1PKWA 3FR9A 1JLWA 4O5RA 3UIWA 3W8SA 2OADA 2ALBA 2TRXA 2Z9SA 1UVZA 5E4WA 2M72A 5D96A 2YPMA 1ACVA 1M2BA 2C0FA 2XBQA 4RI7A 2IFQB 3DXBA 4BL7B 4FYUA 3ME7A 3FEUA 3HCZA 4EF0A 3GH6A 1GP1A 1OVNA 1TKDB 5D9VA 3GL3A 1MEKA 1TP9A 4IBPA 2I4AA 2CZ2A 5ECMB 2JSYA 1QXHA 5AIXA 2TRCP 3IE3A 1XW5A 2GSSA 5C04A 3L4NA 1CQGA 5HFGA 1GUMA 3LSZA 4N11A 4EKZA 4KCAA 1DSBA 2H76A 2VD1A 11GSA 1DE1A 2LTKA 4O32A 1O73A 1OC3A 1K0AA 1CQHA 5J41A 3RBTA 2H74A 1YY7A 1S3DA 3DRNA 1ABAA 2WZ9A 1TRUA 1TK0B 2O85A 1J08A 4A5PA 1TU8A 2RUFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DQS A;  2B5X A;  5CP1 A;  1FVK A;  5IO2 A;  1OKD A;  4EDZ A;  3VI5 A;  1OC9 A;  3DVX A;  2DIZ A;  4J57 E;  4ECB A;  5CNW A;  4HU9 A;  3P2A A;  3G7J A;  1LU4 A;  4BPY A;  4TN8 A;  3DEX A;  4YAV A;  2R37 A;  4LA1 A;  2R4V A;  3S9F A;  2LNT A;  3DKS A;  3HVS A;  4JE1 A;  1KNG A;  1B48 A;  3GKM A;  2E7P A;  5ID2 A;  1O81 A;  2DJK A;  1MDK A;  4BWS A;  1M9B A;  2YV7 A;  3CSJ A;  2JZS A;  1PD2 1;  1ZYQ B;  3LYP A;  4YQV A;  3HYP A;  2CAQ A;  5HR1 A;  1XCC A;  4DEJ A;  2HZE B;  3ZRE A;  1ERT A;  1GLQ A;  3GSS A;  4L5L A;  5DCG A;  2VLV A;  2YJH A;  3VK9 A;  2YWO A;  2A2S A;  2KOK A;  1A0R P;  2QKE A;  4RI6 A;  2VL2 C;  1GSQ A;  4DSS A;  2WCI A;  4GST A;  1WE0 A;  4KND A;  4OO4 A;  8GSS A;  1YZX A;  5D73 A;  4Q5Q A;  3KJY A;  3IPZ A;  1XOA A;  3WT1 A;  2IIY A;  2BJX A;  5CYY A;  2YJ7 A;  3BCK A;  3EYT A;  3I9V 2;  3OR5 A;  5COH A;  1R5A A;  2H0H A;  4K8M A;  1SJZ A;  2L5O A;  2H75 A;  4OD7 A;  2VUP A;  1PL1 A;  2LQQ A;  4I6X A;  2ZCT A;  3TDG A;  2IME A;  2GT5 A;  4ZB9 A;  2AV4 A;  1GTI A;  3ZRD A;  4CDO A;  20GS A;  2B1K A;  2VCW A;  4F82 A;  3KH9 A;  4I97 A;  4KAE A;  2HNL A;  3E9J B;  1E6B A;  2CVD A;  2FWG A;  3U5R E;  5HFI A;  4F2I A;  3PIN A;  3GYK A;  1VF1 A;  1UC7 A;  5J5N A;  3F0I A;  2IL3 A;  1BX9 A;  1AC1 A;  1QUW A;  2B3S A;  3IRA A;  3F3R A;  3FZA A;  5ECS A;  2X8G A;  3RPP A;  1XPV A;  2H19 A;  1SK1 A;  4WR4 A;  4GSN A;  2I1U A;  1N8J A;  1XWB A;  5LNK e;  5GZZ B;  3CMI A;  5INY A;  1SL0 B;  3IAS 2;  2WRT A;  3FR6 A;  1GWC A;  3QD9 A;  1NSW A;  1ZOF A;  4WKW A;  3HVV A;  2WS2 A;  5FHI A;  4MF7 A;  1TJD A;  1TRW A;  2GTU A;  3TRX A;  2JL4 A;  4TR0 A;  1HYU A;  4MPF A;  3EE2 A;  4YAP A;  3KP8 A;  1FHE A;  1Z7R A;  3GUS A;  2MMZ A;  3F8U A;  2O8V B;  4ECC A;  4KB3 A;  1SL1 B;  2H0G A;  4PUF C;  3HJM A;  3LEF A;  4KW6 A;  2VCQ A;  1H75 A;  19GS A;  5HR0 A;  2N5B A;  3MWH A;  3D21 A;  4PUR A;  4GRF A;  1GH2 A;  3C71 A;  3APO A;  3EUR A;  2YP6 A;  4ZBA A;  1EP7 A;  2GZY A;  3TKS A;  3IXR A;  5LCZ A;  1TK5 B;  3NIV A;  3GHA A;  2C3N A;  4XS1 A;  4BVY A;  1X9S B;  1Z7P A;  4IS0 A;  1XW9 A;  1K0C A;  2MBS A;  3KIJ A;  5C00 A;  4HZ2 A;  4XHM A;  5J9B A;  5F05 A;  3ISO A;  17GS A;  5ECP B;  2P0G A;  3GL5 A;  4TR3 A;  1V40 A;  1J9B A;  2O89 A;  5LD0 A;  1NW2 A;  3L9V A;  4WBR D;  2R5G A;  4IN0 A;  2P5Q A;  2B1L A;  6GSY A;  2C0E A;  2H1A A;  1B9Y C;  3K8N A;  1XIY A;  5ECK B;  3F63 A;  4TVE A;  4NAX A;  3WT2 A;  4PQH A;  3P8W A;  4F0B A;  4IGJ A;  3WGD A;  1WOU A;  4I5Q A;  2RM5 A;  4GCI A;  1A0F A;  5A4W A;  3KGK A;  5DAK B;  2PVO C;  4IHU A;  3APS A;  1SEN A;  5G5E A;  5A4V A;  1PX6 A;  4CW9 A;  1GTU A;  1JHB A;  3HDC A;  3IBH A;  4MZW A;  3ZFL A;  2LEG A;  3WGE A;  3W6G A;  3ERF A;  4NHW A;  6GST A;  3F6D A;  1IYH A;  1YDK A;  1GSD A;  1O6J A;  2DJ3 A;  3QOU A;  1EV9 A;  2WUL A;  5ELA A;  2P31 A;  4MP4 A;  3C8E A;  4ZXG A;  2EIO A;  4KA0 A;  3TJF A;  1XOB A;  3LXZ A;  3AY8 A;  4LLR A;  4PGT A;  1QK8 A;  4GSS A;  2RM6 A;  2F51 A;  3ZVJ D;  1Z9H A;  5KN2 A;  3SBC A;  4ECJ A;  2PU9 C;  4KE3 A;  2LRN A;  3APQ A;  4JR6 A;  1UA5 A;  3F6F A;  4POK A;  3TKP A;  3UMA A;  2EIQ A;  4X0X A;  4K9Z A;  4ZIL A;  2XPE A;  3GTU A;  4OFT A;  2IPA A;  1O7U A;  4MH2 A;  2DLX A;  2CZ3 A;  3UVH A;  5G2Z A;  1GUL A;  2FWE A;  1O8X A;  2IJY A;  3GX0 A;  3HY2 A;  5G5F A;  5KN3 A;  2F8F A;  4NHZ A;  2EC4 A;  3QFA C;  4HS1 A;  5ECI B;  3TJK A;  4DSR A;  3GH9 A;  4IW9 A;  3M9J A;  1V2A A;  2OE0 A;  2C1Y A;  1ERV A;  1TRV A;  4PQI A;  3ZIT A;  3ZIV A;  3KH7 A;  2F8A A;  3EWL A;  2PGT A;  3GN3 A;  3HA9 A;  1T00 A;  4MF6 A;  3UEM A;  4XRA A;  1TDI A;  4TOP A;  3RHB A;  4ML6 A;  3MDK A;  1LJR A;  2LV3 A;  1HD2 A;  1T3B A;  3O6T A;  3QDN A;  2XPD A;  4WBJ A;  3HJP A;  4J2F A;  3L9U A;  5CRG A;  4HQS A;  4IJ3 A;  1U6T A;  4KDX A;  5L71 A;  5JWO B;  3GX8 A;  3TKQ A;  1QFN A;  3J7Y k;  1RQM A;  2FNO A;  1JFU A;  2K6V A;  2V41 A;  3CRT A;  1I9D A;  4G19 A;  1OC9 B;  1RW1 A;  1M9A A;  1YKC A;  2FY6 A;  4I2T A;  1JZW A;  2REM A;  1EP8 A;  3F4R A;  2X64 A;  2WDU A;  2MYG A;  5DBQ A;  2JAC A;  3M3M A;  3WD6 A;  2JZT A;  3LWA A;  3QAG A;  3GMF A;  3RHC A;  3ZMK A;  2H72 A;  3CXG A;  3LYK A;  4P3Y B;  1YQ1 A;  3A2V A;  2V32 A;  3VUR A;  3HZ8 A;  3TRP A;  3RAZ A;  5ID2 B;  1G7O A;  1EGR A;  3SWL A;  1W89 A;  2YAN A;  1NM3 A;  3JCM L;  5CRE A;  2FA4 A;  3GRX A;  2CQ9 A;  2HE3 A;  4JBB A;  1ERW A;  4IEL A;  1SJ6 A;  5F06 A;  1ST9 A;  1EZK A;  2KUC A;  1Q98 A;  5CRD A;  5EVO A;  1V57 A;  1OE7 A;  4KUN A;  5ABR A;  3EMP A;  3IV4 A;  2CA8 A;  2H01 A;  1FB6 A;  3GKK A;  5B8A A;  1B4P A;  4DSS B;  3FYG A;  4ULX A;  4F03 A;  2J9H A;  4V2L A;  1TI3 A;  3UVT A;  5J9C A;  4V2M A;  2PBJ A;  4I8B A;  1KTE A;  1HQO A;  1WPI A;  2C3Q A;  22GS A;  2M46 A;  4EDY A;  4HJ2 A;  2LNS A;  3TJB A;  1NHY A;  4V1A g;  5IMD A;  3PGT A;  4PX1 A;  1XVW A;  2GZP A;  1SD9 A;  4ISD A;  2C0G A;  3L78 A;  2KLX A;  3F4S A;  3KXO A;  1T8E B;  2E0Q A;  3FKF A;  4ZL7 A;  1SJI A;  2FD3 A;  5D9X A;  2HRN A;  18GS A;  2IFQ A;  5DQY A;  4KDY A;  2VLT A;  4KSM A;  2AJQ B;  3D4M A;  2VM1 A;  3FY7 A;  1SYX A;  4NV5 A;  4KX4 A;  2FLS A;  4TW5 A;  3D22 A;  4ZL8 A;  4GQF A;  4LMV A;  2GQK A;  1MDI A;  3ME8 A;  4ACS A;  2VCV A;  4LL4 B;  4FO5 A;  1O8W A;  5IMV A;  5ECR B;  4OCF A;  1K3O A;  1R26 A;  5G31 A;  2L5L A;  2XBI A;  2R2J A;  2H1G A;  2HRF A;  3VI7 A;  2VL9 A;  3QCP A;  2QC7 A;  4IP1 A;  3UBK A;  1C72 A;  2JU5 A;  4AJ6 A;  3C73 A;  1I5G A;  2OJL A;  1ZGN A;  1XXU A;  2PVQ A;  4HI7 A;  4MK3 A;  4JU5 A;  1EV4 A;  1UN2 A;  4OMV A;  3VWV A;  5GAN D;  4N0Z A;  1AW9 A;  4MZB A;  2VD0 A;  4NMU A;  2ES7 A;  1W4V A;  3A2W A;  3NOF A;  5IO0 A;  4RUV A;  3UL3 A;  1H4O A;  4E8H A;  1A8L A;  3ZML A;  3EMX A;  1GTB A;  4TR1 A;  2HSH A;  1K0O A;  4TR4 A;  1DUG A;  4BA7 A;  4HU7 A;  1PMT A;  1T4Y A;  1X0R A;  3MSZ A;  1K0N A;  3IHQ A;  13GS A;  1ZMA A;  4KGI A;  2IMF A;  2GLR A;  1GLP A;  1K3Y A;  5DDL A;  4MLY A;  2HZE A;  3VFI A;  5JWR B;  1XZO A;  4MJE A;  1AAZ A;  3TB2 A;  2M80 A;  2PN8 A;  1OE8 A;  1M7T A;  4HZ4 A;  4F9Z A;  2HYX A;  1G6W A;  4G2E A;  1USB A;  2VLU A;  2DBC A;  3TKS C;  1SKS B;  4K7N A;  2R6K A;  1Z6M A;  5ELG A;  2YWI A;  1X5C A;  4GQC A;  1RK4 A;  3QAV A;  3ZL5 A;  2FWF A;  1GSF A;  3H1N A;  5IPH A;  1Z5Y E;  4HQZ A;  3C1R A;  4MF5 A;  4ML1 A;  2X8C A;  3FZ9 A;  2PER A;  2K8V A;  4Q5F A;  1F3A A;  4AGS A;  4X1U A;  4HOJ A;  2OA7 A;  2GZZ A;  2O7K A;  2AUV A;  4N10 A;  1VF3 A;  2F9S A;  1OAZ A;  3UAR A;  3LOR A;  1DE2 A;  4XRD A;  4D73 B;  6GSW A;  3Q18 A;  5HFK A;  5CRH A;  3IAM 2;  3HJO A;  1GSU A;  4K0N A;  5FWG A;  2GT6 A;  2YNX A;  1LBK A;  3F9U A;  2JZR A;  3IA1 A;  2BMX A;  1GSY A;  2DJ2 A;  3QR6 A;  2OKA A;  4PUA A;  3ERG A;  5EL8 A;  2IN3 A;  4WF4 A;  5ECH B;  2GQM A;  2B7J A;  1ERU A;  2ON5 A;  1GTA A;  2ON7 A;  1XWC A;  2C8U A;  3A3T A;  1JZR A;  3MAK A;  2CV4 A;  2V6K A;  4YH2 A;  1KEB A;  4NXI A;  2FCH A;  2YOI A;  2YN1 A;  2MMA A;  3TUE A;  12GS A;  1TI1 A;  3IDV A;  1E2Y A;  5G1K A;  4OCE A;  1TXX A;  1TK8 B;  1V98 A;  2IMD A;  2VO4 A;  2D2Z A;  2FWH A;  5B6M A;  4XIH A;  3GKX A;  5J3R A;  1GNE A;  4TKY A;  4MJC A;  3GTU B;  4JED A;  4H86 A;  4MMM A;  2CAI A;  2GS3 A;  2I9H A;  4FH8 A;  1R7H A;  4EO3 A;  2VAF A;  3EU4 A;  3ZTL A;  4NV2 A;  2PWJ A;  3KP9 A;  1SK2 A;  3QAW A;  4Z7X A;  1AQX A;  3G7Y A;  4K6X A;  3EVI A;  3E0U A;  4LMW A;  1T1V A;  1JZD A;  4XS4 B;  1TU7 A;  1WWJ A;  5G1L A;  1ON4 A;  3UBL A;  2WB9 A;  4PNG A;  2BTO T;  1HNA A;  3IK7 A;  4K7I A;  4HEA 2;  2CX4 A;  4GXZ A;  2I3Y A;  3CTF A;  2IMI A;  1ZZY A;  2E2G A;  2YCD A;  2L6C A;  1Y6E A;  3DIE A;  2DC5 A;  1PL2 A;  1PX7 A;  4ILF A;  1XWG A;  2OBK A;  2RUE A;  2B5E A;  1ZL9 A;  4EXJ A;  3KTB A;  2H6Z A;  2LQO A;  1WJK A;  2O87 A;  3HHV A;  2OE3 A;  1A2L A;  3FR3 A;  4DSQ A;  2H8L A;  4XS6 A;  3IK9 A;  5AIV A;  1WP0 A;  1AQV A;  3EIN A;  2AHE A;  2I81 A;  2L4C A;  1K0B A;  1B8X A;  14GS A;  3ZLP A;  5HR3 A;  3RDW A;  1A8Y A;  3IR4 A;  2YV9 A;  3A2X A;  3LFL A;  3PR8 A;  1T7P B;  4N0V A;  3GNJ A;  4JR4 A;  2K8S A;  4OFM A;  5J4U A;  2HT9 A;  3QMX A;  3FZ4 A;  1GSE A;  1SKW B;  1U3I A;  9GSS A;  5E59 A;  4DVC A;  5IMA A;  1XFL A;  1XBS A;  2DJ0 A;  4JZQ A;  3HKR A;  5F8B A;  16GS A;  2HXK A;  4IVF A;  1PGT A;  2CVB A;  4AJ8 A;  4TXV A;  4K1F A;  4HJM A;  3TOU A;  2WFC A;  2GQL A;  3M9K A;  2JSZ A;  2L6D A;  3ERW A;  2LST A;  1JZO A;  4FYC A;  5A4U A;  5DAL A;  3D6I A;  3I43 A;  1G6Y A;  3KTL A;  2H6X A;  1IYI A;  1U3A A;  5JCG A;  2PMT A;  4ZIJ A;  4G10 A;  3M0F A;  2GST A;  5IMC A;  2H0I A;  2DJJ A;  4POB A;  2A2R A;  3EC3 A;  3CSI A;  2X99 A;  3ZIJ A;  1THO A;  3IOS A;  1F9M A;  2ZNM A;  5JCW A;  2HZF A;  1FO5 A;  5AGY A;  5H5Q A;  3TJJ A;  1MD4 A;  3MNG A;  5KN1 A;  2K9F A;  1GL8 A;  2H73 A;  3LG6 A;  3TRQ A;  2B5Y A;  4KSO A;  1GUK A;  1SU9 A;  2HLS A;  2L59 A;  1WIK A;  2FUG 2;  4MJB A;  3ZZX A;  2LJA A;  5EPF A;  1PSQ A;  3G7I A;  5IMF A;  5KEJ A;  4V1A p;  1KBN A;  3I69 A;  3M8N A;  3R2Q A;  5GSS A;  3CYN A;  5EY6 A;  1XW6 A;  4YQM A;  1MDJ A;  5D9W A;  2GDR A;  3HXS A;  2H70 A;  4TXO A;  4X43 A;  4BWQ A;  4IKH A;  2MZC A;  4O7H A;  1VGL A;  2JAD A;  3W8J A;  5FT3 A;  4Q5N A;  3TOT A;  5B6N A;  3DVW A;  2R3X A;  6GSV A;  3E3E A;  4YQU A;  1OKT A;  4FIW A;  2TIR A;  3FW2 A;  2DJ1 A;  4MJA A;  1YJ6 A;  3HZ4 A;  5IM9 A;  2PUK C;  5F07 A;  2K18 A;  4EVM A;  4TRX A;  4HDE A;  4MDC A;  2RII A;  2LJR A;  2V6O A;  4JRR A;  4WEY A;  2VOC A;  2MBT A;  4Q5R A;  1DBY A;  3DGQ A;  2NTO A;  1B4Q A;  3F3Q A;  5CAX A;  3GKN A;  2WGR A;  3TKS E;  1QMV A;  4BL7 A;  3IC4 A;  3FZ5 A;  4WF5 A;  1XWA A;  4WET A;  2N5A A;  1YF0 A;  3BCI A;  1M0U A;  1VRS D;  3F4T A;  1TRS A;  4TR1 B;  2GSR A;  1QQ2 A;  2H30 A;  2MMO A;  1ML6 A;  4ECI A;  1A2J A;  3KD0 A;  4F0C A;  3TKR A;  2OE1 A;  5F0G A;  1AIU A;  2H1D A;  2CT6 A;  1SKR B;  2LRT A;  5JCU A;  3H8Q A;  3M1G A;  4L8E A;  1THX A;  3FRC A;  3D4T A;  4QL9 A;  2C0D A;  5JWQ B;  1X9W B;  3LQ7 A;  1R4W A;  3TGZ A;  2B7K A;  2KP2 A;  4GLT A;  5ECN B;  3VLN A;  3VWU A;  1V58 A;  2V1M A;  4FYB A;  1O85 A;  2V2G A;  4IQA A;  1VF2 A;  6GSS A;  4GTU A;  1A24 A;  1F6M C;  4KCE A;  4POL A;  3HVX A;  1FW1 A;  2IMK A;  3VWX A;  1G0T A;  3P90 A;  2VCZ A;  1HNC A;  4PQ1 A;  5HR2 A;  3NZN A;  1MTC A;  2VIM A;  4NPB A;  4MA9 A;  1F3B A;  3G9B A;  3VWW A;  1YKA A;  1X5E A;  2GGT A;  2HI7 A;  1PRX A;  1M2D A;  2LUS A;  1K3L A;  4AF2 A;  4LL1 B;  3LJR A;  3RPN A;  5IOX A;  2XC2 A;  3LXT A;  2DIY A;  1EOH A;  2FHE A;  1PQN A;  4V2N A;  1NHO A;  4ID0 A;  2HFD A;  3GA4 A;  4E8E A;  3BD2 A;  3L9S A;  4I2U A;  2DSA A;  3P7X A;  3UAP A;  1GNW A;  1J0F A;  3GFK A;  5HQP A;  2YZU A;  4IP6 A;  1AXD A;  2J23 A;  2KP1 A;  4MH3 A;  2VCX A;  2L57 A;  1BAY A;  4K2D A;  1K0M A;  3GV1 A;  1U87 A;  2LJK A;  2QSI A;  3D0Z A;  4L0W A;  5ENU A;  3V1W A;  2H6Y A;  1EWX A;  2C80 A;  2VL2 A;  5AIS A;  1B9X C;  3KM6 A;  5IPG A;  1F2E A;  4HUA A;  2NDO A;  3C7M A;  3N9J A;  1YEX A;  3GUR A;  3N5O A;  1PKZ A;  4ZBB A;  1Z6N A;  4XTS A;  4EL1 A;  2CVK A;  2DML A;  4NWY A;  1FAA A;  2FA8 A;  2NPB A;  3ZYW A;  1OC8 A;  4WXT A;  1FVJ A;  4POM A;  3H4K A;  2F3M A;  3GST A;  2IWT A;  2C3T A;  2YWM A;  1EEM A;  2VM2 A;  4MPG A;  3LGC A;  3ZVJ A;  3DYR A;  5DVB A;  2E2M A;  5GAP D;  4IQ1 A;  10GS A;  6GSU A;  3L0H A;  5GST A;  1FG4 A;  1Q4J A;  1FB0 A;  3D5J A;  2H71 A;  3U6V A;  2ZUP A;  4ZL9 A;  3ED3 A;  1EGO A;  1OYJ A;  1WMJ A;  2A4V A;  4K7O A;  1EEJ A;  2GSQ A;  3EU3 A;  3Q6O A;  2NBS A;  4L0U A;  4RQX A;  3C1S A;  1HNB A;  1ZCP A;  4EE0 A;  4PNF A;  1YEP A;  1EOG A;  4K0G A;  6GSX A;  2N5F A;  1S3A A;  1X5D A;  4OWY A;  2CX3 A;  4N30 A;  3TCO A;  1Y25 A;  3TJG A;  1ILO A;  1V9W A;  5KN0 A;  2X8H A;  4MAB A;  4MCU A;  3VPQ A;  1BJX A;  1S3C A;  5H5S A;  2MMN A;  5DCH A;  2VCT A;  1BYE A;  3ZFB A;  2LRC A;  2NVL A;  1ZYE A;  4ZBD A;  4OO5 A;  1QGV A;  3QPM A;  1TTZ A;  3PH9 A;  2G0F A;  5D8I A;  2DMM A;  2AB6 A;  1G7E A;  1M2A A;  4J56 E;  2LKU A;  3O76 A;  2LS5 A;  1XWK A;  4ZB6 A;  3KCM A;  2QGV A;  5DJM A;  2HSY A;  5G30 A;  1URM A;  5CRW A;  2FGX A;  4OFN A;  1X9M B;  1TW9 A;  1A2M A;  1BQ7 A;  3A5W A;  1M99 A;  3CRU A;  2L4Q A;  3KEB A;  1Z3E A;  3Q19 A;  4D73 A;  1PN9 A;  2GVP A;  5IOW A;  2H66 A;  3VPT A;  4EUY A;  2RLI A;  1R5P A;  5ECL B;  2YWN A;  1U88 A;  1VF4 A;  4QL7 A;  3O3T A;  2PPT A;  2AAW A;  4G9H A;  4PXO A;  1TOF A;  4ZB8 A;  1GSS A;  4KDU A;  3CTG A;  1FOV A;  4WR5 A;  3I6A A;  3BJ5 A;  1T4Z A;  3WYW A;  5DJL A;  2C4J A;  1BG5 A;  3HD5 A;  3QFB C;  5DAL B;  3GIX A;  3KMN A;  5B8B A;  3DD3 A;  4L5O A;  1GUH A;  4IJI A;  2G2Q A;  2KHP A;  4CHS A;  5CO3 A;  3CSH A;  2OBI A;  3DML A;  5IQY A;  1A23 A;  3Q74 A;  1MD3 A;  1SK0 A;  3UOM A;  1YF1 A;  3FHK A;  4GF0 A;  3BBY A;  4MZC A;  3UJ1 A;  4BVX A;  5IMZ A;  2EIR A;  1GRX A;  3CBU A;  1SYR A;  2XHF A;  2VL3 A;  5DAK A;  4O92 A;  4XCS A;  3BOA A;  2P5R A;  3H93 A;  4KH7 A;  3KZQ A;  2YZH A;  4GWR A;  5ECO B;  2AYT A;  4RQR A;  2B6M A;  3FK8 A;  3KMO A;  4XS4 A;  7GSS A;  1AQW A;  2H1B A;  1K0D A;  5D93 A;  3WGX A;  5B7C A;  4EC0 A;  1SD8 A;  5ECQ B;  3H79 A;  3US3 A;  1JLV A;  5H5R A;  4TXO B;  1BED A;  5AN1 A;  5D9T A;  4QQ7 A;  2OAC A;  1N2A A;  3DWV A;  5IIZ A;  1PA3 A;  4AJ7 A;  5A5K A;  1AUC A;  1XVQ A;  1WRY A;  3J7Y b;  2WJU A;  1SL2 B;  1F37 A;  1PKW A;  3FR9 A;  1JLW A;  4O5R A;  3UIW A;  3W8S A;  2OAD A;  2ALB A;  2TRX A;  2Z9S A;  1UVZ A;  5E4W A;  2M72 A;  5D96 A;  2YPM A;  1ACV A;  1M2B A;  2C0F A;  2XBQ A;  4RI7 A;  2IFQ B;  3DXB A;  4FYU A;  3ME7 A;  3FEU A;  3HCZ A;  4EF0 A;  3GH6 A;  1GP1 A;  1OVN A;  1TKD B;  5D9V A;  3GL3 A;  1MEK A;  1TP9 A;  4IBP A;  2I4A A;  2CZ2 A;  5ECM B;  2JSY A;  1QXH A;  5AIX A;  2TRC P;  3IE3 A;  1XW5 A;  2GSS A;  5C04 A;  3L4N A;  1CQG A;  5HFG A;  1GUM A;  3LSZ A;  4N11 A;  4EKZ A;  4KCA A;  1DSB A;  2H76 A;  2VD1 A;  11GS A;  1DE1 A;  2LTK A;  4O32 A;  1O73 A;  1OC3 A;  1K0A A;  1CQH A;  5J41 A;  3RBT A;  2H74 A;  1YY7 A;  1S3D A;  3DRN A;  1ABA A;  2WZ9 A;  1TRU A;  1TK0 B;  2O85 A;  1J08 A;  1TU8 A;  2RUF A; 
#chains in the Genus database with same CATH topology
 5DQS A;  2B5X A;  5CP1 A;  1FVK A;  5IO2 A;  1OKD A;  4EDZ A;  3VI5 A;  1OC9 A;  3DVX A;  2DIZ A;  4J57 E;  4ECB A;  2HRK A;  5CNW A;  4HU9 A;  3P2A A;  3G7J A;  1LU4 A;  4BPY A;  4TN8 A;  3DEX A;  4YAV A;  2R37 A;  4LA1 A;  2R4V A;  3S9F A;  2LNT A;  3DKS A;  3HVS A;  4JE1 A;  1KNG A;  1B48 A;  3GKM A;  4CY8 A;  2E7P A;  5ID2 A;  1O81 A;  2DJK A;  1MDK A;  4BWS A;  1M9B A;  2YV7 A;  3CSJ A;  2JZS A;  1PD2 1;  1ZYQ B;  3LYP A;  4YQV A;  3HYP A;  2CAQ A;  5HR1 A;  1XCC A;  4DEJ A;  2HZE B;  3ZRE A;  1ERT A;  1GLQ A;  3GSS A;  4L5L A;  5DCG A;  2VLV A;  2YJH A;  3VK9 A;  2YWO A;  2A2S A;  2KOK A;  1A0R P;  2QKE A;  4RI6 A;  2VL2 C;  1GSQ A;  4DSS A;  2WCI A;  4GST A;  1WE0 A;  4KND A;  4OO4 A;  8GSS A;  1YZX A;  5D73 A;  4Q5Q A;  3KJY A;  4K5S A;  3IPZ A;  1XOA A;  3WT1 A;  2IIY A;  2BJX A;  5CYY A;  2YJ7 A;  3BCK A;  3EYT A;  3MYD A;  3I9V 2;  3OR5 A;  5COH A;  1R5A A;  2H0H A;  4K8M A;  1SJZ A;  2L5O A;  2H75 A;  4OD7 A;  2VUP A;  1PL1 A;  2LQQ A;  4I6X A;  2ZCT A;  3TDG A;  2IME A;  2GT5 A;  4ZB9 A;  2AV4 A;  1GTI A;  3ZRD A;  4CDO A;  20GS A;  2B1K A;  2VCW A;  4F82 A;  3KH9 A;  4I97 A;  4KAE A;  2HNL A;  3E9J B;  1E6B A;  2CVD A;  2FWG A;  3U5R E;  5HFI A;  3CQF A;  4F2I A;  3PIN A;  3GYK A;  1VF1 A;  1UC7 A;  5J5N A;  3F0I A;  4HSC X;  2IL3 A;  1BX9 A;  1AC1 A;  1QUW A;  2B3S A;  3IRA A;  3F3R A;  4G0I A;  3FZA A;  5ECS A;  2X8G A;  3RPP A;  1XPV A;  2H19 A;  1SK1 A;  4WR4 A;  4X4J A;  4GSN A;  2I1U A;  1N8J A;  1XWB A;  5LNK e;  5GZZ B;  3CMI A;  5INY A;  1SL0 B;  3A5I A;  3IAS 2;  2WRT A;  3FR6 A;  1GWC A;  1ZYP A;  3QD9 A;  1NSW A;  1ZOF A;  4WKW A;  3HVV A;  2WS2 A;  5FHI A;  4MF7 A;  1TJD A;  1TRW A;  2GTU A;  3TRX A;  2JL4 A;  4TR0 A;  1HYU A;  4MPF A;  3EE2 A;  4YAP A;  3KP8 A;  1FHE A;  1Z7R A;  3GUS A;  2MMZ A;  3F8U A;  2O8V B;  4ECC A;  4KB3 A;  1SL1 B;  4ICY A;  2H0G A;  4PUF C;  3HJM A;  3LEF A;  4KW6 A;  2VCQ A;  1H75 A;  19GS A;  5HR0 A;  2N5B A;  3MWH A;  3D21 A;  4PUR A;  4GRF A;  1GH2 A;  3C71 A;  3APO A;  3EUR A;  2YP6 A;  4ZBA A;  1EP7 A;  2GZY A;  3TKS A;  3IXR A;  5LCZ A;  4O5Q A;  1TK5 B;  3NIV A;  3GHA A;  2C3N A;  4XS1 A;  4BVY A;  1X9S B;  1Z7P A;  4IS0 A;  1XW9 A;  1K0C A;  2MBS A;  3KIJ A;  5C00 A;  4HZ2 A;  2R0P A;  4XHM A;  5J9B A;  5F05 A;  3ISO A;  17GS A;  5ECP B;  2P0G A;  3FMW A;  3GL5 A;  4TR3 A;  1V40 A;  1J9B A;  2O89 A;  5LD0 A;  1NW2 A;  3L9V A;  4WBR D;  2R5G A;  4IN0 A;  2P5Q A;  2B1L A;  6GSY A;  2C0E A;  2H1A A;  1B9Y C;  3K8N A;  1XIY A;  5ECK B;  3F63 A;  4TVE A;  4NAX A;  3WT2 A;  4PQH A;  3P8W A;  4F0B A;  4IGJ A;  3WGD A;  2UZ8 A;  1WOU A;  4I5Q A;  2RM5 A;  4GCI A;  1A0F A;  5A4W A;  3KGK A;  5DAK B;  2PVO C;  4IHU A;  3APS A;  4KF9 A;  2X4A A;  2R0G A;  1SEN A;  5G5E A;  5A4V A;  4Z2U A;  1PX6 A;  4CW9 A;  1GTU A;  1JHB A;  3HDC A;  3IBH A;  4MZW A;  3ZFL A;  2LEG A;  3WGE A;  3W6G A;  3ERF A;  4NHW A;  6GST A;  3F6D A;  1IYH A;  1YDK A;  1GSD A;  1O6J A;  2DJ3 A;  3QOU A;  1EV9 A;  2WUL A;  5ELA A;  2P31 A;  2HRA A;  4MP4 A;  3C8E A;  4ZXG A;  2EIO A;  4KA0 A;  3TJF A;  1XOB A;  3LXZ A;  3AY8 A;  4LLR A;  4PGT A;  1QK8 A;  4GSS A;  2RM6 A;  2F51 A;  3ZVJ D;  1Z9H A;  5KN2 A;  3SBC A;  4ECJ A;  2PU9 C;  4KE3 A;  2HSM A;  2LRN A;  3APQ A;  4JR6 A;  1UA5 A;  3F6F A;  4POK A;  3TKP A;  3UMA A;  2EIQ A;  4X0X A;  4K9Z A;  4ZIL A;  2XPE A;  3GTU A;  4OFT A;  2IPA A;  1O7U A;  4MH2 A;  2DLX A;  2CZ3 A;  3UVH A;  5G2Z A;  1GUL A;  2FWE A;  3R3E A;  1O8X A;  2IJY A;  3GX0 A;  3HY2 A;  5G5F A;  5KN3 A;  2F8F A;  4NHZ A;  2EC4 A;  3QFA C;  4HS1 A;  5ECI B;  3TJK A;  4DSR A;  3GH9 A;  4IW9 A;  3M9J A;  1V2A A;  2OE0 A;  2C1Y A;  1ERV A;  1TRV A;  4PQI A;  3ZIT A;  3ZIV A;  3KH7 A;  2F8A A;  3EWL A;  2PGT A;  3GN3 A;  3HA9 A;  1T00 A;  4MF6 A;  3UEM A;  4XRA A;  1TDI A;  4TOP A;  3RHB A;  4ML6 A;  3MDK A;  1LJR A;  2LV3 A;  1PN0 A;  1HD2 A;  1T3B A;  3O6T A;  3QDN A;  2XPD A;  4WBJ A;  3HJP A;  4J2F A;  3L9U A;  5CRG A;  4HQS A;  4IJ3 A;  1U6T A;  4KDX A;  5L71 A;  5JWO B;  3GX8 A;  3TKQ A;  1QFN A;  3J7Y k;  1RQM A;  2FNO A;  4K2X A;  1JFU A;  2K6V A;  2V41 A;  3CRT A;  1I9D A;  4G19 A;  1OC9 B;  1RW1 A;  1M9A A;  1YKC A;  2FY6 A;  4I2T A;  1JZW A;  2REM A;  1EP8 A;  3F4R A;  2X64 A;  2WDU A;  2MYG A;  5DBQ A;  2JAC A;  3M3M A;  3WD6 A;  2JZT A;  3LWA A;  3QAG A;  3GMF A;  3RHC A;  3ZMK A;  2H72 A;  3CXG A;  3LYK A;  4P3Y B;  1YQ1 A;  3A2V A;  2V32 A;  3VUR A;  3HZ8 A;  3TRP A;  3RAZ A;  5ID2 B;  1G7O A;  1EGR A;  3SWL A;  1W89 A;  2YAN A;  1NM3 A;  3JCM L;  4USS A;  5CRE A;  3IC8 A;  2FA4 A;  3GRX A;  2CQ9 A;  2HE3 A;  4JBB A;  1ERW A;  4IEL A;  1SJ6 A;  5F06 A;  1ST9 A;  1EZK A;  2KUC A;  1Q98 A;  5CRD A;  5EVO A;  1V57 A;  1OE7 A;  4KUN A;  5ABR A;  3EMP A;  3IV4 A;  2CA8 A;  2H01 A;  1FB6 A;  3GKK A;  5B8A A;  4EIP A;  1B4P A;  4DSS B;  3FYG A;  4ULX A;  4F03 A;  2J9H A;  4V2L A;  1TI3 A;  4PTS A;  3UVT A;  5J9C A;  4V2M A;  2PBJ A;  4I8B A;  1KTE A;  1HQO A;  1WPI A;  5BRT A;  2C3Q A;  22GS A;  2M46 A;  4EDY A;  4HJ2 A;  2LNS A;  3TJB A;  1NHY A;  4V1A g;  5IMD A;  3PGT A;  4PX1 A;  1XVW A;  2GZP A;  4YKG A;  1SD9 A;  4ISD A;  2C0G A;  3L78 A;  2KLX A;  3F4S A;  3KXO A;  1T8E B;  2E0Q A;  3FKF A;  4ZL7 A;  1SJI A;  2FD3 A;  5D9X A;  2HRN A;  18GS A;  2IFQ A;  5DQY A;  4KDY A;  2VLT A;  4KSM A;  2AJQ B;  3D4M A;  2VM1 A;  3FY7 A;  1SYX A;  4NV5 A;  4KX4 A;  2FLS A;  4TW5 A;  3D22 A;  4ZL8 A;  4GQF A;  4LMV A;  2GQK A;  1MDI A;  3ME8 A;  4ACS A;  2VCV A;  4LL4 B;  4FO5 A;  1O8W A;  5IMV A;  5ECR B;  4OCF A;  1K3O A;  1R26 A;  5G31 A;  2L5L A;  2XBI A;  2R2J A;  2H1G A;  2HRF A;  3VI7 A;  2VL9 A;  3QCP A;  2QC7 A;  4IP1 A;  3UBK A;  1C72 A;  2JU5 A;  4AJ6 A;  2DKH A;  3C73 A;  1I5G A;  2OJL A;  1ZGN A;  1XXU A;  2PVQ A;  4HI7 A;  4MK3 A;  4JU5 A;  1EV4 A;  1UN2 A;  4OMV A;  3VWV A;  5GAN D;  4N0Z A;  1AW9 A;  4MZB A;  2VD0 A;  4NMU A;  2ES7 A;  1W4V A;  3A2W A;  3NOF A;  5IO0 A;  4RUV A;  3UL3 A;  1H4O A;  4E8H A;  1A8L A;  3ZML A;  3EMX A;  1GTB A;  4TR1 A;  2HSH A;  4G0K A;  1K0O A;  4TR4 A;  1DUG A;  4BA7 A;  4HU7 A;  1PMT A;  1T4Y A;  1X0R A;  3MSZ A;  1K0N A;  3IHQ A;  13GS A;  1ZMA A;  4KGI A;  2IMF A;  2GLR A;  1GLP A;  1K3Y A;  5DDL A;  4MLY A;  2HZE A;  3VFI A;  5JWR B;  1XZO A;  4MJE A;  1AAZ A;  3TB2 A;  3PPU A;  2M80 A;  2PN8 A;  1OE8 A;  1M7T A;  4HZ4 A;  4F9Z A;  2HYX A;  2X49 A;  1G6W A;  4G2E A;  4BVY B;  1USB A;  2VLU A;  2DBC A;  3TKS C;  1FOH A;  1SKS B;  4K7N A;  2R6K A;  1Z6M A;  5ELG A;  2YWI A;  4EIQ A;  1X5C A;  4GQC A;  1RK4 A;  3QAV A;  3ZL5 A;  2FWF A;  1GSF A;  3H1N A;  5IPH A;  1Z5Y E;  4HQZ A;  1M3J A;  3C1R A;  4MF5 A;  4ML1 A;  2X8C A;  3FZ9 A;  2PER A;  2K8V A;  4Q5F A;  1F3A A;  4AGS A;  4X1U A;  4HOJ A;  2OA7 A;  2GZZ A;  2O7K A;  2AUV A;  4N10 A;  1VF3 A;  2F9S A;  2A4H A;  1OAZ A;  3UAR A;  3LOR A;  1DE2 A;  4XRD A;  4D73 B;  6GSW A;  3Q18 A;  5HFK A;  5CRH A;  3IAM 2;  3HJO A;  4CY6 A;  1GSU A;  4K0N A;  5FWG A;  2GT6 A;  2YNX A;  1LBK A;  3F9U A;  2JZR A;  3IA1 A;  2BMX A;  1GSY A;  2DJ2 A;  3QR6 A;  2OKA A;  4PUA A;  3ERG A;  5EL8 A;  2IN3 A;  4WF4 A;  5ECH B;  2GQM A;  2B7J A;  1ERU A;  2ON5 A;  1GTA A;  2ON7 A;  1XWC A;  2C8U A;  3A3T A;  1JZR A;  3MAK A;  2CV4 A;  1XG8 A;  2V6K A;  4YH2 A;  1KEB A;  4NXI A;  2FCH A;  2YOI A;  2YN1 A;  2MMA A;  3TUE A;  12GS A;  1TI1 A;  3IDV A;  1E2Y A;  5G1K A;  4OCE A;  1TXX A;  1TK8 B;  1V98 A;  2IMD A;  2VO4 A;  2D2Z A;  2FWH A;  5B6M A;  4XIH A;  3GKX A;  5J3R A;  1GNE A;  4TKY A;  4MJC A;  3GTU B;  4JED A;  4H86 A;  4MMM A;  4BVX B;  2CAI A;  2GS3 A;  2I9H A;  4FH8 A;  1R7H A;  4EO3 A;  2VAF A;  3EU4 A;  3ZTL A;  4NV2 A;  2PWJ A;  3KP9 A;  1SK2 A;  3QAW A;  4Z7X A;  1AQX A;  3G7Y A;  4K6X A;  3EVI A;  3E0U A;  4LMW A;  1T1V A;  1JZD A;  4XS4 B;  1TU7 A;  1WWJ A;  5G1L A;  1ON4 A;  3UBL A;  2WB9 A;  4PNG A;  2BTO T;  1HNA A;  3IK7 A;  4K7I A;  4HEA 2;  2CX4 A;  4GXZ A;  2I3Y A;  3CTF A;  2IMI A;  1ZZY A;  2E2G A;  2YCD A;  2L6C A;  1Y6E A;  3DIE A;  2DC5 A;  1PL2 A;  1PX7 A;  4ILF A;  1XWG A;  2OBK A;  2RUE A;  2B5E A;  1ZL9 A;  4EXJ A;  3KTB A;  2H6Z A;  2LQO A;  1WJK A;  2O87 A;  3HHV A;  2OE3 A;  1A2L A;  3FR3 A;  4DSQ A;  2H8L A;  4XS6 A;  3IK9 A;  5AIV A;  1WP0 A;  1AQV A;  3EIN A;  2AHE A;  2I81 A;  2L4C A;  1K0B A;  4Z2R A;  1B8X A;  14GS A;  3ZLP A;  5HR3 A;  3RDW A;  1A8Y A;  3IR4 A;  2YV9 A;  3A2X A;  3LFL A;  3PR8 A;  1T7P B;  4N0V A;  3GNJ A;  4JR4 A;  2K8S A;  4OFM A;  5J4U A;  2HT9 A;  3QMX A;  3FZ4 A;  1GSE A;  1SKW B;  1U3I A;  9GSS A;  5E59 A;  4DVC A;  5IMA A;  1XFL A;  1XBS A;  2DJ0 A;  4JZQ A;  3HKR A;  5F8B A;  16GS A;  2HXK A;  4IVF A;  1PGT A;  2CVB A;  4AJ8 A;  3MIX A;  4TXV A;  4K1F A;  4HJM A;  3TOU A;  2WFC A;  2GQL A;  3M9K A;  2JSZ A;  2L6D A;  3ERW A;  2LST A;  1JZO A;  4FYC A;  5A4U A;  5DAL A;  3D6I A;  3I43 A;  1G6Y A;  3KTL A;  2H6X A;  2QA1 A;  1IYI A;  1U3A A;  5JCG A;  2PMT A;  4ZIJ A;  4G10 A;  3M0F A;  2GST A;  5IMC A;  2H0I A;  2DJJ A;  4POB A;  2A2R A;  3EC3 A;  3CSI A;  2X99 A;  3ZIJ A;  1THO A;  3IOS A;  1F9M A;  2ZNM A;  5JCW A;  2HZF A;  4K5R A;  1FO5 A;  5AGY A;  5H5Q A;  3TJJ A;  1MD4 A;  3MNG A;  5KN1 A;  2K9F A;  1GL8 A;  2H73 A;  3LG6 A;  3TRQ A;  2B5Y A;  4KSO A;  1GUK A;  1SU9 A;  2HLS A;  2L59 A;  1WIK A;  2FUG 2;  4MJB A;  3ZZX A;  2LJA A;  5EPF A;  1PSQ A;  3G7I A;  5IMF A;  5KEJ A;  4V1A p;  1KBN A;  3I69 A;  3M8N A;  3IHG A;  3R2Q A;  5GSS A;  3CYN A;  5EY6 A;  1XW6 A;  4YQM A;  1MDJ A;  5D9W A;  2GDR A;  3HXS A;  2H70 A;  4TXO A;  4X43 A;  4BWQ A;  4IKH A;  2MZC A;  4O7H A;  1VGL A;  2JAD A;  3W8J A;  5FT3 A;  4Q5N A;  3TOT A;  5B6N A;  3DVW A;  4MNN A;  2R3X A;  6GSV A;  3E3E A;  4YQU A;  1OKT A;  4FIW A;  2TIR A;  3FW2 A;  2DJ1 A;  4MJA A;  1YJ6 A;  3HZ4 A;  5IM9 A;  2PUK C;  5F07 A;  2K18 A;  4EVM A;  4TRX A;  4HDE A;  4MDC A;  2RII A;  2LJR A;  2V6O A;  4JRR A;  4WEY A;  2VOC A;  2MBT A;  4Q5R A;  1DBY A;  3DGQ A;  2NTO A;  1B4Q A;  3F3Q A;  5CAX A;  3GKN A;  2WGR A;  3TKS E;  1QMV A;  4BL7 A;  3IC4 A;  3FZ5 A;  4WF5 A;  1XWA A;  4WET A;  2N5A A;  1YF0 A;  3BCI A;  1M0U A;  1VRS D;  3F4T A;  1TRS A;  4TR1 B;  2GSR A;  1QQ2 A;  2H30 A;  2MMO A;  1ML6 A;  4ECI A;  1A2J A;  3KD0 A;  4F0C A;  3TKR A;  2OE1 A;  5F0G A;  5KOX A;  4Z2T A;  1AIU A;  2H1D A;  2CT6 A;  1SKR B;  2LRT A;  5JCU A;  3H8Q A;  3LW9 A;  3M1G A;  4L8E A;  1THX A;  3FRC A;  3D4T A;  4QL9 A;  2C0D A;  5JWQ B;  1X9W B;  3LQ7 A;  1R4W A;  3TGZ A;  2B7K A;  2KP2 A;  4GLT A;  5ECN B;  3VLN A;  3VWU A;  1V58 A;  2V1M A;  4FYB A;  1O85 A;  2V2G A;  4IQA A;  1VF2 A;  6GSS A;  4GTU A;  1A24 A;  1F6M C;  4KCE A;  4POL A;  3HVX A;  1FW1 A;  2IMK A;  3VWX A;  1G0T A;  3P90 A;  2VCZ A;  1HNC A;  4PQ1 A;  5HR2 A;  3NZN A;  1MTC A;  2VIM A;  4NPB A;  4MA9 A;  1F3B A;  3G9B A;  3VWW A;  1YKA A;  1X5E A;  2GGT A;  2HI7 A;  1PRX A;  1M2D A;  4FQU A;  2LUS A;  1K3L A;  4AF2 A;  4LL1 B;  3LJR A;  3RPN A;  5IOX A;  2XC2 A;  3LXT A;  2DIY A;  1EOH A;  2FHE A;  1PQN A;  4V2N A;  1NHO A;  4BIK A;  4ID0 A;  2HFD A;  3GA4 A;  4E8E A;  3BD2 A;  3L9S A;  4I2U A;  2DSA A;  3P7X A;  3UAP A;  1GNW A;  1J0F A;  3GFK A;  5HQP A;  2YZU A;  4IP6 A;  1AXD A;  2J23 A;  2KP1 A;  4MH3 A;  2VCX A;  2L57 A;  1BAY A;  4K2D A;  1K0M A;  3GV1 A;  1U87 A;  2LJK A;  2QSI A;  3D0Z A;  4L0W A;  5ENU A;  3V1W A;  2H6Y A;  1EWX A;  2C80 A;  2VL2 A;  5AIS A;  1B9X C;  3KM6 A;  5IPG A;  1F2E A;  4HUA A;  2NDO A;  3C7M A;  1PFO A;  3N9J A;  1YEX A;  1M3I A;  3GUR A;  3N5O A;  1PKZ A;  2A2P A;  4ZBB A;  1Z6N A;  3EPT A;  4XTS A;  4EL1 A;  2CVK A;  2DML A;  4NWY A;  1FAA A;  2FA8 A;  2NPB A;  3ZYW A;  1OC8 A;  4WXT A;  1FVJ A;  4POM A;  3H4K A;  2F3M A;  3GST A;  2IWT A;  2C3T A;  2YWM A;  1EEM A;  2VM2 A;  4MPG A;  3LGC A;  3ZVJ A;  1ZYN A;  3DYR A;  5DVB A;  2E2M A;  5GAP D;  4IQ1 A;  10GS A;  6GSU A;  3L0H A;  5GST A;  1FG4 A;  1Q4J A;  1FB0 A;  3D5J A;  2H71 A;  3U6V A;  2ZUP A;  4ZL9 A;  3ED3 A;  1EGO A;  1OYJ A;  1WMJ A;  2A4V A;  4K7O A;  1EEJ A;  2GSQ A;  3EU3 A;  4O5U A;  3Q6O A;  2NBS A;  4L0U A;  4RQX A;  5BMU A;  3C1S A;  1HNB A;  1ZCP A;  2QA2 A;  4EE0 A;  4PNF A;  1YEP A;  1EOG A;  4K0G A;  6GSX A;  2N5F A;  1S3A A;  1X5D A;  4OWY A;  2CX3 A;  4N30 A;  3TCO A;  1Y25 A;  3TJG A;  1ILO A;  1V9W A;  5KN0 A;  2X8H A;  5KOW A;  4MAB A;  4MCU A;  3VPQ A;  1BJX A;  1S3C A;  5H5S A;  2MMN A;  5DCH A;  2VCT A;  1BYE A;  3ZFB A;  2LRC A;  2NVL A;  1ZYE A;  4ZBD A;  4OO5 A;  1QGV A;  3QPM A;  1TTZ A;  3PH9 A;  2G0F A;  5D8I A;  2DMM A;  2AB6 A;  1G7E A;  1M2A A;  4J56 E;  2LKU A;  3O76 A;  2LS5 A;  1XWK A;  4ZB6 A;  3KCM A;  2QGV A;  5DJM A;  2HSY A;  5G30 A;  1URM A;  5CRW A;  2FGX A;  4OFN A;  1X9M B;  1TW9 A;  1A2M A;  1BQ7 A;  3A5W A;  1M99 A;  3CRU A;  2L4Q A;  3KEB A;  1Z3E A;  3Q19 A;  4D73 A;  1PN9 A;  2GVP A;  4YKF A;  5IOW A;  2H66 A;  3VPT A;  4EUY A;  2RLI A;  1R5P A;  5ECL B;  2YWN A;  1U88 A;  1VF4 A;  4QL7 A;  3O3T A;  2PPT A;  2AAW A;  4G9H A;  4PXO A;  2R0C A;  1TOF A;  4ZB8 A;  1GSS A;  4KDU A;  3CTG A;  1FOV A;  4WR5 A;  3I6A A;  3BJ5 A;  1T4Z A;  3WYW A;  5DJL A;  2C4J A;  1BG5 A;  1S3R A;  3HD5 A;  3QFB C;  5DAL B;  3GIX A;  3KMN A;  5B8B A;  3DD3 A;  4L5O A;  1GUH A;  4IJI A;  2G2Q A;  2KHP A;  4CHS A;  5CO3 A;  3CSH A;  2OBI A;  3DML A;  2DKI A;  5IQY A;  1A23 A;  3Q74 A;  1MD3 A;  1SK0 A;  3UOM A;  1YF1 A;  3FHK A;  4GF0 A;  3BBY A;  4MZC A;  3UJ1 A;  4BVX A;  5IMZ A;  2EIR A;  1GRX A;  3CBU A;  1SYR A;  2XHF A;  2VL3 A;  5DAK A;  4O92 A;  4XCS A;  3BOA A;  2P5R A;  3H93 A;  4KH7 A;  3KZQ A;  2YZH A;  4GWR A;  5ECO B;  2AYT A;  4RQR A;  2B6M A;  3FK8 A;  3KMO A;  4XS4 A;  7GSS A;  1AQW A;  2H1B A;  1K0D A;  5D93 A;  3WGX A;  4G0L A;  5B7C A;  4EC0 A;  1SD8 A;  5ECQ B;  3H79 A;  3US3 A;  1JLV A;  5H5R A;  4TXO B;  1BED A;  3HVN A;  5AN1 A;  5D9T A;  4QQ7 A;  2OAC A;  1N2A A;  3DWV A;  5IIZ A;  1PA3 A;  4AJ7 A;  5A5K A;  1AUC A;  1XVQ A;  1WRY A;  3J7Y b;  2WJU A;  1SL2 B;  1F37 A;  1PKW A;  3FR9 A;  1JLW A;  4O5R A;  3UIW A;  3W8S A;  2OAD A;  2ALB A;  2TRX A;  2Z9S A;  1UVZ A;  5E4W A;  2M72 A;  5D96 A;  2YPM A;  1ACV A;  1M2B A;  2C0F A;  2XBQ A;  4RI7 A;  2IFQ B;  3DXB A;  4BL7 B;  4FYU A;  3ME7 A;  3FEU A;  3HCZ A;  4EF0 A;  3GH6 A;  1GP1 A;  1OVN A;  1TKD B;  5D9V A;  3GL3 A;  1MEK A;  1TP9 A;  4IBP A;  2I4A A;  2CZ2 A;  5ECM B;  2JSY A;  1QXH A;  5AIX A;  2TRC P;  3IE3 A;  1XW5 A;  2GSS A;  5C04 A;  3L4N A;  1CQG A;  5HFG A;  1GUM A;  3LSZ A;  4N11 A;  4EKZ A;  4KCA A;  1DSB A;  2H76 A;  2VD1 A;  11GS A;  1DE1 A;  2LTK A;  4O32 A;  1O73 A;  1OC3 A;  1K0A A;  1CQH A;  5J41 A;  3RBT A;  2H74 A;  1YY7 A;  1S3D A;  3DRN A;  1ABA A;  2WZ9 A;  1TRU A;  1TK0 B;  2O85 A;  1J08 A;  4A5P A;  1TU8 A;  2RUF A; 
#chains in the Genus database with same CATH homology
 5DQS A;  2B5X A;  5CP1 A;  1FVK A;  5IO2 A;  1OKD A;  4EDZ A;  3VI5 A;  1OC9 A;  3DVX A;  2DIZ A;  4J57 E;  4ECB A;  2HRK A;  5CNW A;  4HU9 A;  3P2A A;  3G7J A;  1LU4 A;  4BPY A;  4TN8 A;  3DEX A;  4YAV A;  2R37 A;  4LA1 A;  2R4V A;  3S9F A;  2LNT A;  3DKS A;  3HVS A;  4JE1 A;  1KNG A;  1B48 A;  3GKM A;  4CY8 A;  2E7P A;  5ID2 A;  1O81 A;  2DJK A;  1MDK A;  4BWS A;  1M9B A;  2YV7 A;  3CSJ A;  2JZS A;  1PD2 1;  1ZYQ B;  3LYP A;  4YQV A;  3HYP A;  2CAQ A;  5HR1 A;  1XCC A;  4DEJ A;  2HZE B;  3ZRE A;  1ERT A;  1GLQ A;  3GSS A;  4L5L A;  5DCG A;  2VLV A;  2YJH A;  3VK9 A;  2YWO A;  2A2S A;  2KOK A;  1A0R P;  2QKE A;  4RI6 A;  2VL2 C;  1GSQ A;  4DSS A;  2WCI A;  4GST A;  1WE0 A;  4KND A;  4OO4 A;  8GSS A;  1YZX A;  5D73 A;  4Q5Q A;  3KJY A;  4K5S A;  3IPZ A;  1XOA A;  3WT1 A;  2IIY A;  2BJX A;  5CYY A;  2YJ7 A;  3BCK A;  3EYT A;  3MYD A;  3I9V 2;  3OR5 A;  5COH A;  1R5A A;  2H0H A;  4K8M A;  1SJZ A;  2L5O A;  2H75 A;  4OD7 A;  2VUP A;  1PL1 A;  2LQQ A;  4I6X A;  2ZCT A;  3TDG A;  2IME A;  2GT5 A;  4ZB9 A;  2AV4 A;  1GTI A;  3ZRD A;  4CDO A;  20GS A;  2B1K A;  2VCW A;  4F82 A;  3KH9 A;  4I97 A;  4KAE A;  2HNL A;  3E9J B;  1E6B A;  2CVD A;  2FWG A;  3U5R E;  5HFI A;  4F2I A;  3PIN A;  3GYK A;  1VF1 A;  1UC7 A;  5J5N A;  3F0I A;  2IL3 A;  1BX9 A;  1AC1 A;  1QUW A;  2B3S A;  3IRA A;  3F3R A;  4G0I A;  3FZA A;  5ECS A;  2X8G A;  3RPP A;  1XPV A;  2H19 A;  1SK1 A;  4WR4 A;  4X4J A;  4GSN A;  2I1U A;  1N8J A;  1XWB A;  5LNK e;  5GZZ B;  3CMI A;  5INY A;  1SL0 B;  3A5I A;  3IAS 2;  2WRT A;  3FR6 A;  1GWC A;  1ZYP A;  3QD9 A;  1NSW A;  1ZOF A;  4WKW A;  3HVV A;  2WS2 A;  5FHI A;  4MF7 A;  1TJD A;  1TRW A;  2GTU A;  3TRX A;  2JL4 A;  4TR0 A;  1HYU A;  4MPF A;  3EE2 A;  4YAP A;  3KP8 A;  1FHE A;  1Z7R A;  3GUS A;  2MMZ A;  3F8U A;  2O8V B;  4ECC A;  4KB3 A;  1SL1 B;  4ICY A;  2H0G A;  4PUF C;  3HJM A;  3LEF A;  4KW6 A;  2VCQ A;  1H75 A;  19GS A;  5HR0 A;  2N5B A;  3MWH A;  3D21 A;  4PUR A;  4GRF A;  1GH2 A;  3C71 A;  3APO A;  3EUR A;  2YP6 A;  4ZBA A;  1EP7 A;  2GZY A;  3TKS A;  3IXR A;  5LCZ A;  4O5Q A;  1TK5 B;  3NIV A;  3GHA A;  2C3N A;  4XS1 A;  4BVY A;  1X9S B;  1Z7P A;  4IS0 A;  1XW9 A;  1K0C A;  2MBS A;  3KIJ A;  5C00 A;  4HZ2 A;  2R0P A;  4XHM A;  5J9B A;  5F05 A;  3ISO A;  17GS A;  5ECP B;  2P0G A;  3FMW A;  3GL5 A;  4TR3 A;  1V40 A;  1J9B A;  2O89 A;  5LD0 A;  1NW2 A;  3L9V A;  4WBR D;  2R5G A;  4IN0 A;  2P5Q A;  2B1L A;  6GSY A;  2C0E A;  2H1A A;  1B9Y C;  3K8N A;  1XIY A;  5ECK B;  3F63 A;  4TVE A;  4NAX A;  3WT2 A;  4PQH A;  3P8W A;  4F0B A;  4IGJ A;  3WGD A;  2UZ8 A;  1WOU A;  4I5Q A;  2RM5 A;  4GCI A;  1A0F A;  5A4W A;  3KGK A;  5DAK B;  2PVO C;  4IHU A;  3APS A;  4KF9 A;  2X4A A;  2R0G A;  1SEN A;  5G5E A;  5A4V A;  4Z2U A;  1PX6 A;  4CW9 A;  1GTU A;  1JHB A;  3HDC A;  3IBH A;  4MZW A;  3ZFL A;  2LEG A;  3WGE A;  3W6G A;  3ERF A;  4NHW A;  6GST A;  3F6D A;  1IYH A;  1YDK A;  1GSD A;  1O6J A;  2DJ3 A;  3QOU A;  1EV9 A;  2WUL A;  5ELA A;  2P31 A;  2HRA A;  4MP4 A;  3C8E A;  4ZXG A;  2EIO A;  4KA0 A;  3TJF A;  1XOB A;  3LXZ A;  3AY8 A;  4LLR A;  4PGT A;  1QK8 A;  4GSS A;  2RM6 A;  2F51 A;  3ZVJ D;  1Z9H A;  5KN2 A;  3SBC A;  4ECJ A;  2PU9 C;  4KE3 A;  2HSM A;  2LRN A;  3APQ A;  4JR6 A;  1UA5 A;  3F6F A;  4POK A;  3TKP A;  3UMA A;  2EIQ A;  4X0X A;  4K9Z A;  4ZIL A;  2XPE A;  3GTU A;  4OFT A;  2IPA A;  1O7U A;  4MH2 A;  2DLX A;  2CZ3 A;  3UVH A;  5G2Z A;  1GUL A;  2FWE A;  3R3E A;  1O8X A;  2IJY A;  3GX0 A;  3HY2 A;  5G5F A;  5KN3 A;  2F8F A;  4NHZ A;  2EC4 A;  3QFA C;  4HS1 A;  5ECI B;  3TJK A;  4DSR A;  3GH9 A;  4IW9 A;  3M9J A;  1V2A A;  2OE0 A;  2C1Y A;  1ERV A;  1TRV A;  4PQI A;  3ZIT A;  3ZIV A;  3KH7 A;  2F8A A;  3EWL A;  2PGT A;  3GN3 A;  3HA9 A;  1T00 A;  4MF6 A;  3UEM A;  4XRA A;  1TDI A;  4TOP A;  3RHB A;  4ML6 A;  3MDK A;  1LJR A;  2LV3 A;  1PN0 A;  1HD2 A;  1T3B A;  3O6T A;  3QDN A;  2XPD A;  4WBJ A;  3HJP A;  4J2F A;  3L9U A;  5CRG A;  4HQS A;  4IJ3 A;  1U6T A;  4KDX A;  5L71 A;  5JWO B;  3GX8 A;  3TKQ A;  1QFN A;  3J7Y k;  1RQM A;  2FNO A;  4K2X A;  1JFU A;  2K6V A;  2V41 A;  3CRT A;  1I9D A;  4G19 A;  1OC9 B;  1RW1 A;  1M9A A;  1YKC A;  2FY6 A;  4I2T A;  1JZW A;  2REM A;  1EP8 A;  3F4R A;  2X64 A;  2WDU A;  2MYG A;  5DBQ A;  2JAC A;  3M3M A;  3WD6 A;  2JZT A;  3LWA A;  3QAG A;  3GMF A;  3RHC A;  3ZMK A;  2H72 A;  3CXG A;  3LYK A;  4P3Y B;  1YQ1 A;  3A2V A;  2V32 A;  3VUR A;  3HZ8 A;  3TRP A;  3RAZ A;  5ID2 B;  1G7O A;  1EGR A;  3SWL A;  1W89 A;  2YAN A;  1NM3 A;  3JCM L;  4USS A;  5CRE A;  3IC8 A;  2FA4 A;  3GRX A;  2CQ9 A;  2HE3 A;  4JBB A;  1ERW A;  4IEL A;  1SJ6 A;  5F06 A;  1ST9 A;  1EZK A;  2KUC A;  1Q98 A;  5CRD A;  5EVO A;  1V57 A;  1OE7 A;  4KUN A;  5ABR A;  3EMP A;  3IV4 A;  2CA8 A;  2H01 A;  1FB6 A;  3GKK A;  5B8A A;  4EIP A;  1B4P A;  4DSS B;  3FYG A;  4ULX A;  4F03 A;  2J9H A;  4V2L A;  1TI3 A;  4PTS A;  3UVT A;  5J9C A;  4V2M A;  2PBJ A;  4I8B A;  1KTE A;  1HQO A;  1WPI A;  5BRT A;  2C3Q A;  22GS A;  2M46 A;  4EDY A;  4HJ2 A;  2LNS A;  3TJB A;  1NHY A;  4V1A g;  5IMD A;  3PGT A;  4PX1 A;  1XVW A;  2GZP A;  4YKG A;  1SD9 A;  4ISD A;  2C0G A;  3L78 A;  2KLX A;  3F4S A;  3KXO A;  1T8E B;  2E0Q A;  3FKF A;  4ZL7 A;  1SJI A;  2FD3 A;  5D9X A;  2HRN A;  18GS A;  2IFQ A;  5DQY A;  4KDY A;  2VLT A;  4KSM A;  2AJQ B;  3D4M A;  2VM1 A;  3FY7 A;  1SYX A;  4NV5 A;  4KX4 A;  2FLS A;  4TW5 A;  3D22 A;  4ZL8 A;  4GQF A;  4LMV A;  2GQK A;  1MDI A;  3ME8 A;  4ACS A;  2VCV A;  4LL4 B;  4FO5 A;  1O8W A;  5IMV A;  5ECR B;  4OCF A;  1K3O A;  1R26 A;  5G31 A;  2L5L A;  2XBI A;  2R2J A;  2H1G A;  2HRF A;  3VI7 A;  2VL9 A;  3QCP A;  2QC7 A;  4IP1 A;  3UBK A;  1C72 A;  2JU5 A;  4AJ6 A;  2DKH A;  3C73 A;  1I5G A;  2OJL A;  1ZGN A;  1XXU A;  2PVQ A;  4HI7 A;  4MK3 A;  4JU5 A;  1EV4 A;  1UN2 A;  4OMV A;  3VWV A;  5GAN D;  4N0Z A;  1AW9 A;  4MZB A;  2VD0 A;  4NMU A;  2ES7 A;  1W4V A;  3A2W A;  3NOF A;  5IO0 A;  4RUV A;  3UL3 A;  1H4O A;  4E8H A;  1A8L A;  3ZML A;  3EMX A;  1GTB A;  4TR1 A;  2HSH A;  4G0K A;  1K0O A;  4TR4 A;  1DUG A;  4BA7 A;  4HU7 A;  1PMT A;  1T4Y A;  1X0R A;  3MSZ A;  1K0N A;  3IHQ A;  13GS A;  1ZMA A;  4KGI A;  2IMF A;  2GLR A;  1GLP A;  1K3Y A;  5DDL A;  4MLY A;  2HZE A;  3VFI A;  5JWR B;  1XZO A;  4MJE A;  1AAZ A;  3TB2 A;  3PPU A;  2M80 A;  2PN8 A;  1OE8 A;  1M7T A;  4HZ4 A;  4F9Z A;  2HYX A;  2X49 A;  1G6W A;  4G2E A;  4BVY B;  1USB A;  2VLU A;  2DBC A;  3TKS C;  1FOH A;  1SKS B;  4K7N A;  2R6K A;  1Z6M A;  5ELG A;  2YWI A;  4EIQ A;  1X5C A;  4GQC A;  1RK4 A;  3QAV A;  3ZL5 A;  2FWF A;  1GSF A;  3H1N A;  5IPH A;  1Z5Y E;  4HQZ A;  3C1R A;  4MF5 A;  4ML1 A;  2X8C A;  3FZ9 A;  2PER A;  2K8V A;  4Q5F A;  1F3A A;  4AGS A;  4X1U A;  4HOJ A;  2OA7 A;  2GZZ A;  2O7K A;  2AUV A;  4N10 A;  1VF3 A;  2F9S A;  2A4H A;  1OAZ A;  3UAR A;  3LOR A;  1DE2 A;  4XRD A;  4D73 B;  6GSW A;  3Q18 A;  5HFK A;  5CRH A;  3IAM 2;  3HJO A;  4CY6 A;  1GSU A;  4K0N A;  5FWG A;  2GT6 A;  2YNX A;  1LBK A;  3F9U A;  2JZR A;  3IA1 A;  2BMX A;  1GSY A;  2DJ2 A;  3QR6 A;  2OKA A;  4PUA A;  3ERG A;  5EL8 A;  2IN3 A;  4WF4 A;  5ECH B;  2GQM A;  2B7J A;  1ERU A;  2ON5 A;  1GTA A;  2ON7 A;  1XWC A;  2C8U A;  3A3T A;  1JZR A;  3MAK A;  2CV4 A;  2V6K A;  4YH2 A;  1KEB A;  4NXI A;  2FCH A;  2YOI A;  2YN1 A;  2MMA A;  3TUE A;  12GS A;  1TI1 A;  3IDV A;  1E2Y A;  5G1K A;  4OCE A;  1TXX A;  1TK8 B;  1V98 A;  2IMD A;  2VO4 A;  2D2Z A;  2FWH A;  5B6M A;  4XIH A;  3GKX A;  5J3R A;  1GNE A;  4TKY A;  4MJC A;  3GTU B;  4JED A;  4H86 A;  4MMM A;  4BVX B;  2CAI A;  2GS3 A;  2I9H A;  4FH8 A;  1R7H A;  4EO3 A;  2VAF A;  3EU4 A;  3ZTL A;  4NV2 A;  2PWJ A;  3KP9 A;  1SK2 A;  3QAW A;  4Z7X A;  1AQX A;  3G7Y A;  4K6X A;  3EVI A;  3E0U A;  4LMW A;  1T1V A;  1JZD A;  4XS4 B;  1TU7 A;  1WWJ A;  5G1L A;  1ON4 A;  3UBL A;  2WB9 A;  4PNG A;  2BTO T;  1HNA A;  3IK7 A;  4K7I A;  4HEA 2;  2CX4 A;  4GXZ A;  2I3Y A;  3CTF A;  2IMI A;  1ZZY A;  2E2G A;  2YCD A;  2L6C A;  1Y6E A;  3DIE A;  2DC5 A;  1PL2 A;  1PX7 A;  4ILF A;  1XWG A;  2OBK A;  2RUE A;  2B5E A;  1ZL9 A;  4EXJ A;  3KTB A;  2H6Z A;  2LQO A;  1WJK A;  2O87 A;  3HHV A;  2OE3 A;  1A2L A;  3FR3 A;  4DSQ A;  2H8L A;  4XS6 A;  3IK9 A;  5AIV A;  1WP0 A;  1AQV A;  3EIN A;  2AHE A;  2I81 A;  2L4C A;  1K0B A;  4Z2R A;  1B8X A;  14GS A;  3ZLP A;  5HR3 A;  3RDW A;  1A8Y A;  3IR4 A;  2YV9 A;  3A2X A;  3LFL A;  3PR8 A;  1T7P B;  4N0V A;  3GNJ A;  4JR4 A;  2K8S A;  4OFM A;  5J4U A;  2HT9 A;  3QMX A;  3FZ4 A;  1GSE A;  1SKW B;  1U3I A;  9GSS A;  5E59 A;  4DVC A;  5IMA A;  1XFL A;  1XBS A;  2DJ0 A;  4JZQ A;  3HKR A;  5F8B A;  16GS A;  2HXK A;  4IVF A;  1PGT A;  2CVB A;  4AJ8 A;  3MIX A;  4TXV A;  4K1F A;  4HJM A;  3TOU A;  2WFC A;  2GQL A;  3M9K A;  2JSZ A;  2L6D A;  3ERW A;  2LST A;  1JZO A;  4FYC A;  5A4U A;  5DAL A;  3D6I A;  3I43 A;  1G6Y A;  3KTL A;  2H6X A;  2QA1 A;  1IYI A;  1U3A A;  5JCG A;  2PMT A;  4ZIJ A;  4G10 A;  3M0F A;  2GST A;  5IMC A;  2H0I A;  2DJJ A;  4POB A;  2A2R A;  3EC3 A;  3CSI A;  2X99 A;  3ZIJ A;  1THO A;  3IOS A;  1F9M A;  2ZNM A;  5JCW A;  2HZF A;  4K5R A;  1FO5 A;  5AGY A;  5H5Q A;  3TJJ A;  1MD4 A;  3MNG A;  5KN1 A;  2K9F A;  1GL8 A;  2H73 A;  3LG6 A;  3TRQ A;  2B5Y A;  4KSO A;  1GUK A;  1SU9 A;  2HLS A;  2L59 A;  1WIK A;  2FUG 2;  4MJB A;  3ZZX A;  2LJA A;  5EPF A;  1PSQ A;  3G7I A;  5IMF A;  5KEJ A;  4V1A p;  1KBN A;  3I69 A;  3M8N A;  3IHG A;  3R2Q A;  5GSS A;  3CYN A;  5EY6 A;  1XW6 A;  4YQM A;  1MDJ A;  5D9W A;  2GDR A;  3HXS A;  2H70 A;  4TXO A;  4X43 A;  4BWQ A;  4IKH A;  2MZC A;  4O7H A;  1VGL A;  2JAD A;  3W8J A;  5FT3 A;  4Q5N A;  3TOT A;  5B6N A;  3DVW A;  4MNN A;  2R3X A;  6GSV A;  3E3E A;  4YQU A;  1OKT A;  4FIW A;  2TIR A;  3FW2 A;  2DJ1 A;  4MJA A;  1YJ6 A;  3HZ4 A;  5IM9 A;  2PUK C;  5F07 A;  2K18 A;  4EVM A;  4TRX A;  4HDE A;  4MDC A;  2RII A;  2LJR A;  2V6O A;  4JRR A;  4WEY A;  2VOC A;  2MBT A;  4Q5R A;  1DBY A;  3DGQ A;  2NTO A;  1B4Q A;  3F3Q A;  5CAX A;  3GKN A;  2WGR A;  3TKS E;  1QMV A;  4BL7 A;  3IC4 A;  3FZ5 A;  4WF5 A;  1XWA A;  4WET A;  2N5A A;  1YF0 A;  3BCI A;  1M0U A;  1VRS D;  3F4T A;  1TRS A;  4TR1 B;  2GSR A;  1QQ2 A;  2H30 A;  2MMO A;  1ML6 A;  4ECI A;  1A2J A;  3KD0 A;  4F0C A;  3TKR A;  2OE1 A;  5F0G A;  5KOX A;  4Z2T A;  1AIU A;  2H1D A;  2CT6 A;  1SKR B;  2LRT A;  5JCU A;  3H8Q A;  3LW9 A;  3M1G A;  4L8E A;  1THX A;  3FRC A;  3D4T A;  4QL9 A;  2C0D A;  5JWQ B;  1X9W B;  3LQ7 A;  1R4W A;  3TGZ A;  2B7K A;  2KP2 A;  4GLT A;  5ECN B;  3VLN A;  3VWU A;  1V58 A;  2V1M A;  4FYB A;  1O85 A;  2V2G A;  4IQA A;  1VF2 A;  6GSS A;  4GTU A;  1A24 A;  1F6M C;  4KCE A;  4POL A;  3HVX A;  1FW1 A;  2IMK A;  3VWX A;  1G0T A;  3P90 A;  2VCZ A;  1HNC A;  4PQ1 A;  5HR2 A;  3NZN A;  1MTC A;  2VIM A;  4NPB A;  4MA9 A;  1F3B A;  3G9B A;  3VWW A;  1YKA A;  1X5E A;  2GGT A;  2HI7 A;  1PRX A;  1M2D A;  4FQU A;  2LUS A;  1K3L A;  4AF2 A;  4LL1 B;  3LJR A;  3RPN A;  5IOX A;  2XC2 A;  3LXT A;  2DIY A;  1EOH A;  2FHE A;  1PQN A;  4V2N A;  1NHO A;  4ID0 A;  2HFD A;  3GA4 A;  4E8E A;  3BD2 A;  3L9S A;  4I2U A;  2DSA A;  3P7X A;  3UAP A;  1GNW A;  1J0F A;  3GFK A;  5HQP A;  2YZU A;  4IP6 A;  1AXD A;  2J23 A;  2KP1 A;  4MH3 A;  2VCX A;  2L57 A;  1BAY A;  4K2D A;  1K0M A;  3GV1 A;  1U87 A;  2LJK A;  2QSI A;  3D0Z A;  4L0W A;  5ENU A;  3V1W A;  2H6Y A;  1EWX A;  2C80 A;  2VL2 A;  5AIS A;  1B9X C;  3KM6 A;  5IPG A;  1F2E A;  4HUA A;  2NDO A;  3C7M A;  3N9J A;  1YEX A;  3GUR A;  3N5O A;  1PKZ A;  2A2P A;  4ZBB A;  1Z6N A;  3EPT A;  4XTS A;  4EL1 A;  2CVK A;  2DML A;  4NWY A;  1FAA A;  2FA8 A;  2NPB A;  3ZYW A;  1OC8 A;  4WXT A;  1FVJ A;  4POM A;  3H4K A;  2F3M A;  3GST A;  2IWT A;  2C3T A;  2YWM A;  1EEM A;  2VM2 A;  4MPG A;  3LGC A;  3ZVJ A;  1ZYN A;  3DYR A;  5DVB A;  2E2M A;  5GAP D;  4IQ1 A;  10GS A;  6GSU A;  3L0H A;  5GST A;  1FG4 A;  1Q4J A;  1FB0 A;  3D5J A;  2H71 A;  3U6V A;  2ZUP A;  4ZL9 A;  3ED3 A;  1EGO A;  1OYJ A;  1WMJ A;  2A4V A;  4K7O A;  1EEJ A;  2GSQ A;  3EU3 A;  4O5U A;  3Q6O A;  2NBS A;  4L0U A;  4RQX A;  5BMU A;  3C1S A;  1HNB A;  1ZCP A;  2QA2 A;  4EE0 A;  4PNF A;  1YEP A;  1EOG A;  4K0G A;  6GSX A;  2N5F A;  1S3A A;  1X5D A;  4OWY A;  2CX3 A;  4N30 A;  3TCO A;  1Y25 A;  3TJG A;  1ILO A;  1V9W A;  5KN0 A;  2X8H A;  5KOW A;  4MAB A;  4MCU A;  3VPQ A;  1BJX A;  1S3C A;  5H5S A;  2MMN A;  5DCH A;  2VCT A;  1BYE A;  3ZFB A;  2LRC A;  2NVL A;  1ZYE A;  4ZBD A;  4OO5 A;  1QGV A;  3QPM A;  1TTZ A;  3PH9 A;  2G0F A;  5D8I A;  2DMM A;  2AB6 A;  1G7E A;  1M2A A;  4J56 E;  2LKU A;  3O76 A;  2LS5 A;  1XWK A;  4ZB6 A;  3KCM A;  2QGV A;  5DJM A;  2HSY A;  5G30 A;  1URM A;  5CRW A;  2FGX A;  4OFN A;  1X9M B;  1TW9 A;  1A2M A;  1BQ7 A;  3A5W A;  1M99 A;  3CRU A;  2L4Q A;  3KEB A;  1Z3E A;  3Q19 A;  4D73 A;  1PN9 A;  2GVP A;  4YKF A;  5IOW A;  2H66 A;  3VPT A;  4EUY A;  2RLI A;  1R5P A;  5ECL B;  2YWN A;  1U88 A;  1VF4 A;  4QL7 A;  3O3T A;  2PPT A;  2AAW A;  4G9H A;  4PXO A;  2R0C A;  1TOF A;  4ZB8 A;  1GSS A;  4KDU A;  3CTG A;  1FOV A;  4WR5 A;  3I6A A;  3BJ5 A;  1T4Z A;  3WYW A;  5DJL A;  2C4J A;  1BG5 A;  3HD5 A;  3QFB C;  5DAL B;  3GIX A;  3KMN A;  5B8B A;  3DD3 A;  4L5O A;  1GUH A;  4IJI A;  2G2Q A;  2KHP A;  4CHS A;  5CO3 A;  3CSH A;  2OBI A;  3DML A;  2DKI A;  5IQY A;  1A23 A;  3Q74 A;  1MD3 A;  1SK0 A;  3UOM A;  1YF1 A;  3FHK A;  4GF0 A;  3BBY A;  4MZC A;  3UJ1 A;  4BVX A;  5IMZ A;  2EIR A;  1GRX A;  3CBU A;  1SYR A;  2XHF A;  2VL3 A;  5DAK A;  4O92 A;  4XCS A;  3BOA A;  2P5R A;  3H93 A;  4KH7 A;  3KZQ A;  2YZH A;  4GWR A;  5ECO B;  2AYT A;  4RQR A;  2B6M A;  3FK8 A;  3KMO A;  4XS4 A;  7GSS A;  1AQW A;  2H1B A;  1K0D A;  5D93 A;  3WGX A;  4G0L A;  5B7C A;  4EC0 A;  1SD8 A;  5ECQ B;  3H79 A;  3US3 A;  1JLV A;  5H5R A;  4TXO B;  1BED A;  5AN1 A;  5D9T A;  4QQ7 A;  2OAC A;  1N2A A;  3DWV A;  5IIZ A;  1PA3 A;  4AJ7 A;  5A5K A;  1AUC A;  1XVQ A;  1WRY A;  3J7Y b;  2WJU A;  1SL2 B;  1F37 A;  1PKW A;  3FR9 A;  1JLW A;  4O5R A;  3UIW A;  3W8S A;  2OAD A;  2ALB A;  2TRX A;  2Z9S A;  1UVZ A;  5E4W A;  2M72 A;  5D96 A;  2YPM A;  1ACV A;  1M2B A;  2C0F A;  2XBQ A;  4RI7 A;  2IFQ B;  3DXB A;  4BL7 B;  4FYU A;  3ME7 A;  3FEU A;  3HCZ A;  4EF0 A;  3GH6 A;  1GP1 A;  1OVN A;  1TKD B;  5D9V A;  3GL3 A;  1MEK A;  1TP9 A;  4IBP A;  2I4A A;  2CZ2 A;  5ECM B;  2JSY A;  1QXH A;  5AIX A;  2TRC P;  3IE3 A;  1XW5 A;  2GSS A;  5C04 A;  3L4N A;  1CQG A;  5HFG A;  1GUM A;  3LSZ A;  4N11 A;  4EKZ A;  4KCA A;  1DSB A;  2H76 A;  2VD1 A;  11GS A;  1DE1 A;  2LTK A;  4O32 A;  1O73 A;  1OC3 A;  1K0A A;  1CQH A;  5J41 A;  3RBT A;  2H74 A;  1YY7 A;  1S3D A;  3DRN A;  1ABA A;  2WZ9 A;  1TRU A;  1TK0 B;  2O85 A;  1J08 A;  4A5P A;  1TU8 A;  2RUF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...