1ZCPA

Crystal structure of a catalytic site mutant e. coli trxa (caca)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
DKIIHLTDDSFDTDVLKADGAILVDFWAEWCACAKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin 1
publication title The crystal structure of TrxA(CACA): Insights into the formation of a [2Fe-2S] iron-sulfur cluster in an Escherichia coli thioredoxin mutant
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
total genus 30
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2005-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1zcpA00
1QFNA 1OC9B 2H66A 3MWHA 1WWJA 2YWOA 2I1UA 3F3RA 4N0VA 1ACVA 4KA0A 4KDYA 2H30A 1Y6EA 5JCUA 1QXHA 4XS6A 4F2IA 1GL8A 2HZFA 4KNDA 1S3CA 4HJMA 6GSUA 5GZZB 4K0NA 5GSSA 4KDXA 4PGTA 1YF0A 1XWKA 4GTUA 4KCAA 2N5AA 1B8XA 2O85A 1BX9A 3FKFA 2MBSA 2OBIA 3G9BA 2MMOA 3VWXA 3EYTA 4MABA 1EP8A 2HRFA 3RHBA 1A2LA 1GLPA 3UARA 1Q4JA 1EOHA 1JZOA 4PNGA 3TKRA 1T00A 3HA9A 3M9JA 1G6WA 3GUSA 3KH9A 2LJAA 4Q5FA 1DSBA 1A2JA 5HFGA 3DKSA 1FB0A 2GVPA 2C1YA 3UOMA 2BMXA 3KEBA 3KJYA 1BEDA 2VL2C 3M0FA 5A4UA 1M0UA 3F4TA 4BL7A 2GQKA 2IMKA 5ENUA 2FCHA 4XCSA 4Q5QA 1SYRA 4D73B 1V58A 3WT1A 1O73A 1K0NA 2RM6A 4CDOA 4WF4A 2IPAA 4PQ1A 3QDNA 4LMVA 3RHCA 1YKCA 4ECCA 2OE1A 13GSA 1U3IA 4F9ZA 1U87A 1FHEA 2B7KA 5ECOB 4IP6A 2O87A 4JE1A 1DE1A 3TCOA 1KEBA 4TR1B 3TKSA 1ERUA 3DEXA 2KP1A 3Q6OA 5D8IA 1KBNA 3D5JA 5E59A 1ZYEA 1ST9A 1SJIA 3LQ7A 2LQOA 2H0GA 2H6ZA 2X8GA 5G31A 1FW1A 1GNEA 2F51A 2DIZA 1H75A 1USBA 2RIIA 4IKHA 2VM2A 1GNWA 4N10A 1YEPA 2YWNA 3A2WA 3TGZA 1BYEA 4H86A 2GDRA 1WE0A 4JR6A 2P0GA 3J7Yb 4WBRD 3VWVA 1B9XC 1Y25A 4PNFA 4L0UA 3D4TA 2F3MA 2I4AA 2VD0A 4POLA 2GT5A 3IR4A 1TI3A 3TJFA 3C1SA 3DVXA 5AISA 1V9WA 4KUNA 4E8EA 4ECBA 4WR5A 3TJGA 2H19A 3L78A 1XWBA 1JZRA 2G0FA 2E2MA 1T4YA 5COHA 2CVBA 3UAPA 5G2ZA 1VF3A 3ME8A 5HR1A 5ELAA 3GX0A 4V2LA 6GSSA 3IV4A 3HHVA 1BG5A 5CRWA 4WXTA 3CRUA 3VURA 4PURA 3IK9A 3GFKA 4WF5A 2K8VA 2NBSA 3EMXA 2VOCA 4GCIA 2HNLA 2L57A 2XC2A 3F6FA 4K0GA 2N5BA 3IC4A 3QFAC 4GSTA 1MD4A 1PN9A 4DSSB 4BVYA 2BTOT 1H4OA 2JZTA 3QOUA 5IMDA 4XS4B 3EURA 1XWAA 2J9HA 3R2QA 2K6VA 3ISOA 4CHSA 1TU8A 1RK4A 4O92A 2R6KA 5ID2A 4WR4A 2JL4A 2B3SA 3CXGA 1XVQA 1XOAA 3Q74A 5LD0A 3SWLA 5LNKe 2DJJA 1YF1A 2JADA 1M9AA 1THXA 2GSQA 5IMCA 3BD2A 5CP1A 3CMIA 3MDKA 1J08A 6GSTA 1XZOA 3LYPA 4X43A 5IMVA 1JHBA 2QC7A 3TRPA 4K2DA 4QL9A 4NHZA 3EMPA 4XRAA 1R7HA 3JCML 1SL0B 1GRXA 1OE8A 2GQLA 3HJMA 1S3AA 4V2MA 3IOSA 1OC9A 4YQVA 1U6TA 5H5RA 3HZ4A 3IK7A 6GSXA 3D4MA 3QFBC 3GN3A 3UEMA 1FVKA 4O32A 1NSWA 4NAXA 4JZQA 3GA4A 3P90A 3HCZA 5JCGA 1GSQA 2XPDA 4N0ZA 4WKWA 5D73A 4IW9A 4LL4B 2BJXA 2PMTA 3M3MA 2HFDA 1GSEA 1M2BA 3M1GA 1XWCA 3I6AA 3TOTA 1OE7A 3LFLA 5CO3A 3VWUA 2H75A 2LJKA 2H74A 3F6DA 2H8LA 2HI7A 1YY7A 3DGQA 1O6JA 2HZEA 3GNJA 4HU7A 3FRCA 1PL1A 3VK9A 3ZVJD 4ILFA 4K8MA 1EOGA 1JZWA 2IFQA 2PN8A 4NV5A 3NOFA 1OC8A 1XXUA 4GSNA 3QAGA 2F9SA 4TR3A 1K3OA 5A5KA 2GZYA 2GSRA 4YQUA 3ZZXA 4HUAA 1SU9A 5ECLB 4G19A 4I2UA 4PUFC 2H6XA 2PU9C 5HFIA 1Q98A 3HY2A 3KMNA 4RI6A 4DSQA 2QGVA 4BVXA 2FA8A 2OACA 1X9WB 2P5RA 3PR8A 4WEYA 3KTBA 5F06A 1E2YA 1WOUA 1O81A 2C0DA 4EVMA 5IIZA 4TR1A 1G7EA 2HRNA 1ZZYA 2L4QA 5F07A 3DXBA 2P5QA 3LXZA 5ELGA 3ED3A 2VCZA 1HD2A 4N30A 1OYJA 1B4QA 1TTZA 4MPFA 1YDKA 4OD7A 1PSQA 4MLYA 2O7KA 3J7Yk 4FYCA 5G5EA 5D9XA 1V2AA 1I5GA 1JLVA 2ZNMA 2OE0A 4HS1A 3NZNA 3HKRA 17GSA 2LRNA 1NHOA 1GLQA 2FWFA 4IGJA 2A4VA 5AIXA 4RUVA 3DYRA 3BCIA 3LYKA 3TUEA 2VIMA 1XFLA 1QGVA 1FO5A 1AQXA 3BJ5A 1EZKA 3KD0A 3ZFLA 1MDIA 5DALA 4JEDA 3ERFA 3HVSA 2LEGA 1EV4A 1Z7RA 1J9BA 2V32A 2MYGA 1AW9A 2GSTA 3IA1A 1TU7A 3W8JA 2RUEA 2JU5A 1C72A 4LA1A 3ZMLA 5ECMB 5ECRB 3IHQA 3FZ4A 1GH2A 2GTUA 1TDIA 3FK8A 3E3EA 1GWCA 1A23A 4FIWA 1TRSA 3KCMA 1FG4A 4ZBAA 5INYA 2IMFA 1PD21 3UIWA 1DE2A 1LU4A 2B1LA 5CYYA 4V1Ag 4MZCA 4MJCA 1TI1A 1HNBA 2R37A 5EY6A 3HJOA 1SENA 4MP4A 4KW6A 1TK0B 3UMAA 1G7OA 2YZHA 4KGIA 4O5RA 5HFKA 4TN8A 5DJLA 5F0GA 3KXOA 2H1GA 4ML6A 3FYGA 4TXOB 5FHIA 2YWIA 4IELA 2KP2A 2WJUA 2WS2A 1A8YA 1EP7A 4IBPA 4O7HA 1JZDA 3GH6A 5FT3A 3IDVA 6GSWA 2C4JA 1TRVA 2YNXA 2DMLA 2L59A 4JU5A 1B48A 2VCQA 3P2AA 1YQ1A 2GZZA 1W4VA 2CVKA 4XHMA 3WT2A 3UVHA 1JFUA 2V6OA 5ECSA 2L5LA 4FH8A 3C71A 4DEJA 1QUWA 1XPVA 4TKYA 5JCWA 1OKTA 1TKDB 5IOXA 2HXKA 5FWGA 2DIYA 3TRXA 1SJZA 4LLRA 4PX1A 1QQ2A 4FO5A 2FY6A 1ZOFA 3VFIA 2DJ2A 2M72A 1AC1A 3L9VA 2C3TA 4NXIA 1EGOA 5DJMA 3GTUB 3UVTA 4OO4A 5E4WA 4QQ7A 3CYNA 4GRFA 4J2FA 1LJRA 4HQZA 1NHYA 1UN2A 1ABAA 4KDUA 4ID0A 4ZL8A 1LBKA 1SKWB 4EDZA 5B8AA 3U5RE 1EGRA 4YAPA 5IPHA 1A2MA 2C8UA 3LJRA 2GT6A 3F4SA 5DCHA 3E0UA 2PWJA 4K9ZA 3OR5A 4BWSA 2VLVA 2KOKA 2RUFA 3ME7A 2FLSA 4JRRA 2C3QA 2EIQA 4MA9A 2LRCA 1TXXA 2F8AA 1T3BA 2A2SA 3RPPA 1PMTA 3FZ9A 5D9TA 1F6MC 5DBQA 4F03A 2TRCP 3ZREA 1ERWA 2AB6A 4HDEA 3A5WA 4GQCA 3FW2A 2PUKC 1SYXA 1ILOA 3C73A 5J5NA 4G2EA 4F0CA 1XWGA 4ZBDA 2XHFA 5ECPB 2J23A 2YN1A 2LSTA 2NVLA 5EPFA 3I9V2 3ZLPA 4HU9A 2AUVA 4AGSA 2ON5A 3QAVA 5DVBA 5J4UA 2FA4A 4DSRA 3O3TA 1O7UA 2AHEA 2OBKA 4OCFA 4AF2A 1VF1A 1WP0A 1YJ6A 4K7OA 3EWLA 3EC3A 22GSA 4F82A 1NW2A 2RLIA 1I9DA 4ZL9A 1OAZA 4WETA 3ZITA 4ECIA 1Z9HA 1YKAA 3GKXA 2HYXA 2DJ1A 2OKAA 3FZ5A 5CRHA 4EUYA 1X5CA 2IIYA 2FNOA 2H1AA 2EIRA 3MNGA 5DQYA 1XIYA 3IAM2 2TRXA 3L4NA 3DRNA 5ECHB 4EO3A 1GP1A 4ZB8A 5F8BA 1OVNA 1FAAA 5CNWA 5GSTA 1GUMA 3PINA 2IN3A 4KX4A 1SKRB 1CQGA 1R5PA 2HLSA 5KEJA 4IS0A 1EEMA 2EIOA 4PQIA 2JSZA 4EF0A 1WMJA 5DAKB 1G0TA 4KAEA 14GSA 1S3DA 4TW5A 3MAKA 4I5QA 2PERA 3P8WA 1F9MA 3SBCA 2H73A 5J3RA 3IAS2 1MTCA 3KTLA 5AIVA 2XPEA 3G7JA 2B1KA 3GURA 3GYKA 4BWQA 4YAVA 1AQWA 3CBUA 1QMVA 3N5OA 4Z7XA 1VRSD 2E7PA 3FEUA 2H1DA 2JSYA 2X8HA 1BJXA 3VWWA 1BAYA 2YJ7A 1M2AA 3FR6A 4FYUA 1R26A 4TXVA 3O6TA 4L5OA 2QKEA 2WCIA 5KN2A 4HZ4A 4K7IA 4IQAA 5G5FA 1PRXA 19GSA 4MH2A 3KZQA 18GSA 2REMA 5A4VA 1HNCA 2VM1A 1WJKA 1T4ZA 1YZXA 4NMUA 4MF6A 4I8BA 4MCUA 11GSA 1SL1B 1RQMA 3M8NA 2LQQA 1ZCPA 3H93A 4K7NA 5DCGA 4OFTA 4EC0A 2H71A 3C7MA 1EEJA 2NTOA 1FB6A 4RI7A 3HVXA 5IOWA 3W6GA 4BPYA 1THOA 3TJBA 5C00A 2YCDA 3CTGA 3ZYWA 1DBYA 4KCEA 4HEA2 1TRWA 1ON4A 1NM3A 2FGXA 4OMVA 1UC7A 3F63A 4HJ2A 2HT9A 3Q19A 3LEFA 4V2NA 1GUHA 4HI7A 4D73A 2OE3A 2WULA 3GIXA 4E8HA 1SK2A 4YH2A 3APQA 2K9FA 4GXZA 4CW9A 2MMNA 1W89A 3GSSA 3IE3A 4MDCA 3RBTA 2LUSA 2ON7A 1GSUA 3EVIA 1TRUA 3GSTA 3GRXA 3WD6A 2WRTA 2CZ2A 1Z5YE 2O89A 2QSIA 3D21A 1XCCA 1TOFA 1T1VA 1T7PB 3LXTA 2GLRA 3HDCA 3GKNA 1YEXA 2MZCA 3CSHA 4GWRA 1TK8B 16GSA 5IM9A 3A3TA 1ML6A 1UA5A 1O85A 2YANA 1ZGNA 3HYPA 2DJ3A 2JZSA 1A0FA 1X9SB 1M99A 3FZAA 3ERWA 5H5QA 5C04A 1ZMAA 2V2GA 4TR4A 5B6MA 5EL8A 4POMA 3IXRA 4OCEA 2FWEA 1M7TA 2GGTA 3RAZA 4G10A 2I81A 1AXDA 4P3YB 4V1Ap 1F3BA 3TKSC 3DVWA 3FR3A 3KGKA 2B6MA 3GKMA 1SD8A 1QK8A 4L0WA 1GULA 4ZBBA 3D0ZA 3PGTA 3VLNA 2OJLA 1XW5A 3ZL5A 3A2XA 2N5FA 3F8UA 1OKDA 1PL2A 2WDUA 4KH7A 2CX4A 4KB3A 3F0IA 4LMWA 2YV9A 2CT6A 1XW9A 4AJ6A 1TW9A 2H1BA 2KHPA 4HOJA 1PGTA 3CTFA 3DWVA 1V40A 1OC3A 1M9BA 4N11A 3UL3A 1HQOA 3APOA 3TJJA 2DMMA 5F05A 4GSSA 4DSSA 2V41A 6GSYA 1BQ7A 3U6VA 2NPBA 3CSJA 3F9UA 4NV2A 4XS4A 5IMAA 1F3AA 4TR0A 2DC5A 2IJYA 5DQSA 5H5SA 2YOIA 4L5LA 3ZMKA 3KP8A 2GQMA 1X5DA 3IPZA 3LSZA 1VF2A 4EE0A 3L9UA 5KN1A 5CRGA 2VUPA 5D93A 3I43A 10GSA 2H76A 1TJDA 3H4KA 3H79A 2KLXA 2DLXA 2AJQB 3O76A 2L6DA 2R3XA 1SK1A 3F4RA 5ABRA 4MZWA 2VCXA 1RW1A 2L6CA 2K18A 4NPBA 1XOBA 8GSSA 1M2DA 1MDJA 4TOPA 2GS3A 3ZTLA 3NIVA 1A0RP 20GSA 2FHEA 4IQ1A 4EDYA 4EXJA 1K0DA 4KSMA 3TKQA 5D9VA 4I97A 4MF5A 2RM5A 2DBCA 2CVDA 4AJ7A 1SD9A 3LG6A 4MH3A 3W8SA 2LTKA 3BCKA 2ALBA 2E0QA 3ERGA 2HZEB 4TVEA 2OADA 2AAWA 4JR4A 4POBA 5D96A 2IFQB 4ML1A 3KP9A 1GSSA 2CA8A 1CQHA 1GSFA 3HD5A 2PVOC 4I6XA 2AYTA 3US3A 2O8VB 3VPQA 1SK0A 5LCZA 5J9BA 1PKZA 1AQVA 5CREA 5IO0A 2LKUA 5ECIB 4XRDA 1DUGA 2YP6A 1SKSB 1URMA 5D9WA 2H72A 3QAWA 3A2VA 2G2QA 3MSZA 2NDOA 5JWQB 4BA7A 2WB9A 1SL2B 1IYIA 1WRYA 2LJRA 1Z6NA 2H6YA 1GUKA 4IJIA 4YQMA 2B5YA 2B5XA 1R5AA 3UJ1A 4L8EA 4ECJA 2L5OA 2R4VA 2DJ0A 5G1LA 4IJ3A 1JLWA 2ZCTA 2C0FA 5JWOB 3G7IA 4J56E 2L4CA 4LL1B 3QR6A 4ZB9A 3G7YA 3ZFBA 4Q5NA 3FY7A 1AAZA 3EU3A 2IMIA 3E9JB 3C1RA 3ZIVA 4OFNA 3GL3A 1GTUA 1EWXA 2PBJA 3AY8A 5J9CA 3L9SA 3HZ8A 1MEKA 4PXOA 5EVOA 3F3QA 2C0GA 3WGEA 2A2RA 4IVFA 4ZIJA 5AGYA 5HR3A 5DALB 4TRXA 4MF7A 1KTEA 2H01A 3H8QA 2DJKA 3QCPA 1TK5B 4XIHA 2AV4A 5CRDA 1GTBA 1PX6A 4HQSA 3K8NA 5J41A 2HSHA 3D22A 4MK3A 2X99A 5B7CA 4IHUA 3UBLA 3EU4A 2IMDA 2TIRA 2VL3A 2X8CA 4DVCA 1R4WA 1GTAA 2IL3A 2FWGA 4OWYA 2H70A 1MD3A 2D2ZA 2MMAA 3ZIJA 5IMZA 3TB2A 2VCVA 4ULXA 1K0MA 3DIEA 2YV7A 3P7XA 4KE3A 2IWTA 1XVWA 3EE2A 4GQFA 3C8EA 3DD3A 1AIUA 4X0XA 3VI7A 2VL2A 2YJHA 1V98A 5B6NA 2K8SA 3L0HA 1K0OA 1FOVA 1WIKA 9GSSA 7GSSA 2X64A 2GSSA 4MJAA 1ERVA 2R5GA 3LWAA 5AN1A 3V1WA 1U88A 3FR9A 2C3NA 3KH7A 2PPTA 3N9JA 4F0BA 4RQXA 12GSA 1K3LA 1K0CA 2YWMA 4MMMA 3WGXA 2WGRA 1X9MB 5G30A 2M46A 4MJBA 4TXOA 2OA7A 4NHWA 2CV4A 2PVQA 1FVJA 4WBJA 1XW6A 5B8BA 5GAND 3GV1A 4FYBA 3TDGA 5ECNB 4ZB6A 1Z3EA 2CZ3A 2V1MA 5JWRB 4I2TA 5A4WA 4EL1A 1UVZA 2FD3A 5ECKB 2DSAA 2CAQA 2F8FA 2VO4A 5G1KA 5ECQB 4OO5A 2LNTA 2FUG2 1TP9A 2VLTA 3PH9A 4ACSA 3ZRDA 4IN0A 2VAFA 4Q5RA 1Z7PA 1HYUA 3M9KA 2JACA 1ZYQB 1Z6MA 3KM6A 3HJPA 1PQNA 3KIJA 1O8XA 1X0RA 4K6XA 1J0FA 3GTUA 2YZUA 4QL7A 3Q18A 3TOUA 2LRTA 3QD9A 1B9YC 3GMFA 4NWYA 1EV9A 4POKA 2MBTA 1G6YA 2Z9SA 4MZBA 3H1NA 3GKKA 3TRQA 1O8WA 2B5EA 2ZUPA 3HVVA 2HE3A 2ES7A 2VL9A 1T8EB 2CQ9A 2P31A 4ZXGA 1HNAA 4JBBA 4MJEA 4HZ2A 2E2GA 3GH9A 3CSIA 3UBKA 3FHKA 4MPGA 2LS5A 1F2EA 3WGDA 4XTSA 1PKWA 1MDKA 1ERTA 3GL5A 2B7JA 3I69A 2VLUA 1N8JA 2XBIA 2KUCA 2I9HA 2LNSA 2VD1A 2WZ9A 1PA3A 3IBHA 5KN0A 4G9HA 4ISDA 2WFCA 2R2JA 2V6KA 3APSA 5KN3A 1SJ6A 1XBSA 2IMEA 3ZVJA 5HR0A 1WPIA 3D6IA 1K0BA 5CAXA 2C80A 4K1FA 1E6BA 3KMOA 4KSOA 4RQRA 1GSDA 1IYHA 1V57A 3QPMA 2YPMA 3TJKA 4GF0A 3BOAA 3TKPA 3LORA 5DDLA 1K0AA 3VPTA 2M80A 1N2AA 2EC4A 4ZL7A 2LV3A 5IQYA 2PGTA 1PX7A 5IMFA 4XS1A 2MMZA 3EINA 4PUAA 2CAIA 2HSYA 1VGLA 1A8LA 2GZPA 2C0EA 3HXSA 4GLTA 1K3YA 4IP1A 3DMLA 4OFMA 3RDWA 3RPNA 4ZILA 2VCTA 2FWHA 3GHAA 5ID2B 5IPGA 4AJ8A 6GSVA 1F37A 3S9FA 2JZRA 1GSYA 5GAPD 1GTIA 4PQHA 3TKSE 3QMXA 3LGCA 1A24A 1AUCA 3VI5A 3BBYA 3GX8A 4X1UA 2VCWA 5L71A 2CX3A 5HR2A 2XBQA 2H0HA 2H0IA 1KNGA 1ZL9A 3WYWA 2I3YA 1VF4A 4J57E 5DAKA 3IRAA 1U3AA 4EKZA 3CRTA 5IO2A 5HQPA 1B4PA 1X5EA
chains in the Genus database with same CATH superfamily
1QFNA 1OC9B 2H66A 3MWHA 1WWJA 2YWOA 2I1UA 3F3RA 4N0VA 1ACVA 4KA0A 4KDYA 2H30A 1Y6EA 5JCUA 1QXHA 4XS6A 4F2IA 1GL8A 2HZFA 4KNDA 1S3CA 4HJMA 6GSUA 5GZZB 4K0NA 5GSSA 4KDXA 4PGTA 1YF0A 1XWKA 4GTUA 4KCAA 2N5AA 1B8XA 2O85A 1BX9A 3FKFA 2MBSA 2OBIA 3G9BA 2MMOA 3VWXA 3EYTA 4MABA 1EP8A 2HRFA 3RHBA 1A2LA 1GLPA 3UARA 1Q4JA 1EOHA 1JZOA 4PNGA 3TKRA 1T00A 3HA9A 3M9JA 1G6WA 3GUSA 3KH9A 2LJAA 4Q5FA 1DSBA 1A2JA 5HFGA 3DKSA 1FB0A 2GVPA 2C1YA 3UOMA 2BMXA 3KEBA 3KJYA 2HRKA 1BEDA 2VL2C 3M0FA 5A4UA 1M0UA 3F4TA 4BL7A 1M3JA 2GQKA 2IMKA 5ENUA 2FCHA 4XCSA 4Q5QA 1SYRA 4D73B 1V58A 3WT1A 1O73A 1K0NA 2RM6A 4CDOA 4WF4A 2IPAA 4PQ1A 3QDNA 4LMVA 3RHCA 1YKCA 4ECCA 2OE1A 13GSA 1U3IA 4F9ZA 1U87A 1FHEA 2B7KA 5ECOB 4IP6A 2O87A 4O5UA 4JE1A 1DE1A 3TCOA 1KEBA 4TR1B 3TKSA 1ERUA 3DEXA 2KP1A 3Q6OA 4USSA 1KBNA 3D5JA 5D8IA 5E59A 1ZYEA 1ST9A 1SJIA 3LQ7A 2LQOA 2H0GA 2H6ZA 2X8GA 5G31A 1FW1A 1GNEA 2F51A 2DIZA 1H75A 1USBA 2RIIA 4IKHA 2VM2A 1GNWA 4N10A 1YEPA 2YWNA 3A2WA 3TGZA 1BYEA 4H86A 2GDRA 1WE0A 2DKIA 4JR6A 2P0GA 3J7Yb 4WBRD 3VWVA 1B9XC 1Y25A 4PNFA 4L0UA 3D4TA 2F3MA 2I4AA 2VD0A 4POLA 2GT5A 3IR4A 1TI3A 3TJFA 3C1SA 3DVXA 5AISA 1V9WA 4KUNA 4E8EA 4ECBA 4WR5A 3TJGA 2H19A 3L78A 1XWBA 1JZRA 4Z2UA 2G0FA 2E2MA 1T4YA 5COHA 2CVBA 3UAPA 5G2ZA 2A4HA 1VF3A 3ME8A 5HR1A 5ELAA 3GX0A 4V2LA 6GSSA 3IV4A 3HHVA 1BG5A 5CRWA 4WXTA 3CRUA 4X4JA 3VURA 4PURA 3IK9A 3GFKA 4WF5A 2K8VA 2NBSA 3EMXA 2VOCA 4GCIA 2HNLA 2L57A 2XC2A 3F6FA 4K0GA 2N5BA 3IC4A 3QFAC 4GSTA 1MD4A 1PN9A 4DSSB 4BVYA 2BTOT 1H4OA 2JZTA 3QOUA 5IMDA 4XS4B 3EURA 1XWAA 2J9HA 3R2QA 2K6VA 3ISOA 4CHSA 1TU8A 1RK4A 4O92A 2R6KA 5ID2A 4WR4A 2JL4A 2B3SA 3CXGA 1XVQA 1XOAA 3Q74A 5LD0A 3SWLA 5LNKe 2DJJA 1YF1A 2JADA 1M9AA 1THXA 2GSQA 5IMCA 3BD2A 5CP1A 3CMIA 3MDKA 1J08A 6GSTA 1XZOA 3LYPA 1ZYPA 4X43A 5IMVA 1JHBA 2QC7A 3TRPA 4K2DA 4QL9A 1XG8A 4NHZA 3EMPA 4XRAA 1R7HA 3JCML 1SL0B 1GRXA 1OE8A 2GQLA 3HJMA 1S3AA 4V2MA 3IOSA 1OC9A 4YQVA 1U6TA 5H5RA 3HZ4A 3IK7A 6GSXA 3D4MA 3QFBC 3GN3A 3UEMA 1FVKA 4O32A 1NSWA 4NAXA 4JZQA 3GA4A 3R3EA 3P90A 3HCZA 5JCGA 1GSQA 2XPDA 4N0ZA 4WKWA 5D73A 4IW9A 4LL4B 2BJXA 4YKFA 2PMTA 3M3MA 2HFDA 1GSEA 1M2BA 3M1GA 1XWCA 3I6AA 3TOTA 1OE7A 3LFLA 5CO3A 3VWUA 4G0LA 2H75A 2LJKA 2H74A 3F6DA 2H8LA 2HI7A 1YY7A 3DGQA 1O6JA 2HZEA 3GNJA 3MYDA 4HU7A 3FRCA 1PL1A 3VK9A 3ZVJD 4ILFA 4K8MA 1EOGA 1JZWA 2IFQA 2PN8A 4NV5A 3NOFA 1OC8A 1XXUA 4GSNA 3QAGA 2F9SA 4TR3A 2HSMA 1K3OA 5A5KA 2GZYA 4EIPA 2GSRA 4YQUA 3ZZXA 4HUAA 1SU9A 5ECLB 3IHGA 4G19A 4I2UA 4PUFC 2H6XA 2PU9C 5HFIA 1Q98A 3HY2A 3KMNA 4RI6A 4DSQA 2QGVA 4BVXA 2FA8A 2OACA 1X9WB 2P5RA 3PR8A 4WEYA 3KTBA 5F06A 1E2YA 1WOUA 1O81A 2C0DA 4EVMA 5IIZA 4TR1A 1G7EA 2HRNA 1ZZYA 2L4QA 5F07A 3DXBA 4Z2TA 2P5QA 3LXZA 5ELGA 4CY8A 3ED3A 2VCZA 1HD2A 4N30A 1OYJA 1B4QA 1TTZA 4MPFA 1YDKA 4OD7A 1PSQA 4MLYA 2O7KA 3J7Yk 4FYCA 5G5EA 3A5IA 5D9XA 1V2AA 1I5GA 1JLVA 2ZNMA 2OE0A 4HS1A 3NZNA 3HKRA 17GSA 2LRNA 1NHOA 1GLQA 2FWFA 4IGJA 2A4VA 5AIXA 4RUVA 3DYRA 3BCIA 3LYKA 3TUEA 2VIMA 1XFLA 1QGVA 1FO5A 1AQXA 3BJ5A 1EZKA 3KD0A 3ZFLA 1MDIA 5DALA 4JEDA 3ERFA 3HVSA 2LEGA 1EV4A 1Z7RA 1FOHA 1J9BA 2V32A 2MYGA 1AW9A 2GSTA 3IA1A 1TU7A 3W8JA 2RUEA 2JU5A 1C72A 4LA1A 3ZMLA 5ECMB 5ECRB 3IHQA 3FZ4A 1GH2A 2GTUA 1TDIA 3FK8A 3E3EA 1GWCA 1A23A 4FIWA 1TRSA 3KCMA 1FG4A 4ZBAA 5INYA 2IMFA 1PD21 3UIWA 1DE2A 1LU4A 2B1LA 4V1Ag 5CYYA 4MZCA 4MJCA 1TI1A 1HNBA 2R37A 5EY6A 3HJOA 1SENA 4MP4A 4KW6A 1TK0B 3UMAA 1G7OA 2YZHA 4KGIA 4O5RA 5HFKA 4TN8A 5DJLA 5F0GA 3KXOA 2H1GA 4ML6A 3FYGA 4TXOB 5FHIA 2YWIA 4IELA 2KP2A 2WJUA 2WS2A 1A8YA 1EP7A 2R0GA 4IBPA 4O7HA 1JZDA 3GH6A 5FT3A 3IDVA 6GSWA 2C4JA 1TRVA 2YNXA 2DMLA 2L59A 4JU5A 1B48A 2VCQA 3P2AA 1YQ1A 2GZZA 1W4VA 2CVKA 4ICYA 4XHMA 3WT2A 3UVHA 1JFUA 2V6OA 5ECSA 2R0PA 2L5LA 4FH8A 4CY6A 3C71A 4DEJA 1QUWA 1XPVA 4TKYA 5JCWA 1OKTA 1TKDB 5IOXA 2HXKA 5FWGA 2DIYA 3TRXA 1SJZA 4LLRA 4PX1A 1QQ2A 4FO5A 2FY6A 1ZOFA 3VFIA 2DJ2A 2M72A 1AC1A 3L9VA 2C3TA 4NXIA 1EGOA 5DJMA 3GTUB 3UVTA 4OO4A 5E4WA 4QQ7A 3CYNA 4GRFA 4J2FA 1LJRA 4HQZA 1NHYA 1UN2A 1ABAA 4KDUA 4ID0A 5BRTA 4ZL8A 1LBKA 1SKWB 4EDZA 5B8AA 3U5RE 1EGRA 4YAPA 5IPHA 1A2MA 2C8UA 3LJRA 2GT6A 4PTSA 3F4SA 5DCHA 3E0UA 2PWJA 4K9ZA 3OR5A 4BWSA 2VLVA 2KOKA 2RUFA 3ME7A 2FLSA 4JRRA 2C3QA 2EIQA 4MA9A 2LRCA 1TXXA 2F8AA 1T3BA 2A2SA 3RPPA 1PMTA 3FZ9A 5D9TA 4G0IA 1F6MC 5DBQA 4F03A 5BMUA 2TRCP 3ZREA 1ERWA 2AB6A 4HDEA 3A5WA 4A5PA 4GQCA 3FW2A 2PUKC 1SYXA 1ILOA 3C73A 5J5NA 4G2EA 4F0CA 1XWGA 4MNNA 4ZBDA 2XHFA 5ECPB 2J23A 2YN1A 2LSTA 2NVLA 5EPFA 3I9V2 3ZLPA 4HU9A 2AUVA 4AGSA 2ON5A 3QAVA 5DVBA 5J4UA 2FA4A 4DSRA 3O3TA 1O7UA 2AHEA 2OBKA 4OCFA 4AF2A 1VF1A 1WP0A 1YJ6A 4K7OA 3EWLA 3EC3A 22GSA 4F82A 1NW2A 2RLIA 1I9DA 4ZL9A 1OAZA 4WETA 3ZITA 4ECIA 1Z9HA 1YKAA 4EIQA 3GKXA 2HYXA 2DJ1A 2OKAA 3FZ5A 5CRHA 4EUYA 1X5CA 2IIYA 2FNOA 2H1AA 2EIRA 3MNGA 5DQYA 1XIYA 3IAM2 2TRXA 3L4NA 3DRNA 5ECHB 4EO3A 1GP1A 4ZB8A 5F8BA 1OVNA 1FAAA 5CNWA 5GSTA 1GUMA 3PINA 2IN3A 5KOWA 4KX4A 1SKRB 1CQGA 1R5PA 2HLSA 5KEJA 4IS0A 1EEMA 2EIOA 4PQIA 2JSZA 3IC8A 4EF0A 1WMJA 5DAKB 1G0TA 4KAEA 14GSA 1S3DA 4TW5A 3MAKA 4I5QA 2PERA 3P8WA 1F9MA 3SBCA 2H73A 5J3RA 3IAS2 1MTCA 3KTLA 5AIVA 2XPEA 3G7JA 2B1KA 3GURA 3GYKA 4BWQA 4YAVA 1AQWA 3CBUA 1QMVA 3N5OA 4Z7XA 1VRSD 2E7PA 3FEUA 2H1DA 2JSYA 2X8HA 1BJXA 3VWWA 1BAYA 2YJ7A 1M2AA 3FR6A 4FYUA 1R26A 4TXVA 3O6TA 4L5OA 2QKEA 2WCIA 5KN2A 4HZ4A 4K7IA 4IQAA 5G5FA 1PRXA 19GSA 4MH2A 3KZQA 18GSA 2REMA 5A4VA 1HNCA 2VM1A 1WJKA 1T4ZA 1YZXA 4NMUA 4MF6A 4I8BA 4MCUA 11GSA 2X49A 1SL1B 4BL7B 1RQMA 3M8NA 2LQQA 1ZCPA 3H93A 4K7NA 5DCGA 4OFTA 4EC0A 2H71A 3C7MA 1EEJA 2NTOA 1FB6A 4RI7A 3PPUA 3HVXA 5IOWA 3W6GA 4BPYA 1THOA 3TJBA 5C00A 2YCDA 3CTGA 3ZYWA 1DBYA 4KCEA 4HEA2 1TRWA 1ON4A 1NM3A 2FGXA 4OMVA 1UC7A 3F63A 4HJ2A 2HT9A 3Q19A 3LEFA 4V2NA 1GUHA 4HI7A 4D73A 2OE3A 2WULA 3GIXA 4E8HA 1SK2A 4YH2A 3APQA 2K9FA 4GXZA 4CW9A 2MMNA 1W89A 3GSSA 3IE3A 4MDCA 3RBTA 2LUSA 2ON7A 1GSUA 3EVIA 1TRUA 3GSTA 3GRXA 3WD6A 2WRTA 2CZ2A 1Z5YE 2O89A 2QSIA 3D21A 1XCCA 1TOFA 1T1VA 1T7PB 3LXTA 2GLRA 3HDCA 2A2PA 3GKNA 1YEXA 2MZCA 3CSHA 4GWRA 1TK8B 16GSA 5IM9A 3A3TA 1ML6A 1UA5A 1O85A 2YANA 1ZGNA 3HYPA 2DJ3A 2JZSA 1A0FA 4HSCX 1X9SB 1M99A 3FZAA 3ERWA 5H5QA 5C04A 1ZMAA 2V2GA 4TR4A 5B6MA 5EL8A 4POMA 3IXRA 4OCEA 2FWEA 1M7TA 2GGTA 3RAZA 4G10A 2I81A 1AXDA 4P3YB 4V1Ap 1F3BA 3TKSC 3DVWA 3FR3A 3KGKA 2B6MA 3GKMA 1SD8A 1QK8A 4L0WA 1GULA 4ZBBA 3D0ZA 3PGTA 3VLNA 2OJLA 1XW5A 3ZL5A 2QA2A 3A2XA 2N5FA 3F8UA 1OKDA 1PL2A 2WDUA 4KH7A 2CX4A 4KB3A 3F0IA 4LMWA 4G0KA 2YV9A 2CT6A 1XW9A 4AJ6A 1TW9A 2H1BA 2KHPA 4HOJA 1PGTA 3CTFA 3DWVA 1V40A 1OC3A 1M9BA 4N11A 3UL3A 1HQOA 3APOA 3TJJA 2DMMA 5F05A 4GSSA 4DSSA 2V41A 6GSYA 1BQ7A 3U6VA 2NPBA 3CSJA 3F9UA 4NV2A 4XS4A 5IMAA 1F3AA 4TR0A 2DC5A 2IJYA 5DQSA 5H5SA 2YOIA 4L5LA 3ZMKA 3KP8A 2GQMA 4K5SA 1X5DA 3IPZA 3LSZA 1VF2A 4EE0A 3L9UA 5KN1A 5CRGA 2VUPA 5D93A 3I43A 10GSA 2H76A 1TJDA 3H4KA 3H79A 2KLXA 2DLXA 2AJQB 3O76A 2L6DA 2R3XA 1SK1A 3F4RA 5ABRA 4MZWA 2VCXA 1RW1A 4YKGA 2L6CA 2K18A 4NPBA 1XOBA 8GSSA 1M2DA 1MDJA 4TOPA 2GS3A 3ZTLA 5KOXA 3NIVA 1A0RP 20GSA 2FHEA 4IQ1A 4KF9A 4EDYA 4EXJA 1K0DA 4KSMA 3TKQA 5D9VA 4I97A 4MF5A 2RM5A 2DBCA 1PN0A 4K5RA 2CVDA 4AJ7A 1SD9A 3LG6A 4MH3A 3W8SA 2LTKA 3BCKA 2ALBA 2E0QA 3ERGA 2HZEB 4TVEA 2OADA 2AAWA 4JR4A 4POBA 5D96A 2IFQB 4ML1A 3KP9A 1GSSA 2CA8A 1CQHA 2UZ8A 1GSFA 3HD5A 2HRAA 2PVOC 4I6XA 2AYTA 3US3A 2O8VB 3VPQA 1SK0A 5LCZA 5J9BA 3LW9A 1PKZA 1AQVA 5CREA 5IO0A 2LKUA 5ECIB 4BVXB 4XRDA 1DUGA 2YP6A 1SKSB 1URMA 5D9WA 2H72A 3QAWA 3A2VA 2G2QA 3MSZA 2NDOA 5JWQB 4BA7A 2WB9A 1SL2B 1IYIA 1WRYA 2LJRA 1Z6NA 2H6YA 1GUKA 4IJIA 4YQMA 2B5YA 2B5XA 1R5AA 3UJ1A 4L8EA 4ECJA 2L5OA 2R4VA 2DJ0A 5G1LA 4IJ3A 1JLWA 2ZCTA 2C0FA 5JWOB 3G7IA 4J56E 2L4CA 4LL1B 3QR6A 4ZB9A 3G7YA 3ZFBA 4Q5NA 3FY7A 1AAZA 3EU3A 2IMIA 3E9JB 3C1RA 3ZIVA 4OFNA 3GL3A 1GTUA 1EWXA 2PBJA 3AY8A 5J9CA 3L9SA 3HZ8A 1MEKA 1PFOA 4PXOA 5EVOA 3F3QA 2C0GA 3WGEA 2A2RA 4IVFA 4ZIJA 5AGYA 5HR3A 5DALB 4TRXA 4MF7A 1KTEA 2H01A 3H8QA 2DJKA 3QCPA 1TK5B 4XIHA 2AV4A 5CRDA 1GTBA 1PX6A 4HQSA 3K8NA 5J41A 2HSHA 3D22A 2R0CA 4MK3A 2X99A 5B7CA 4IHUA 3UBLA 3EU4A 2IMDA 2TIRA 2VL3A 2X8CA 4DVCA 1R4WA 1GTAA 2IL3A 2FWGA 4OWYA 2H70A 1MD3A 2D2ZA 2MMAA 3ZIJA 5IMZA 3TB2A 2VCVA 4ULXA 1K0MA 3DIEA 2YV7A 3P7XA 4KE3A 2IWTA 1XVWA 3EE2A 4GQFA 4Z2RA 3C8EA 3DD3A 1AIUA 4X0XA 3VI7A 2VL2A 2QA1A 2YJHA 1V98A 5B6NA 2K8SA 3L0HA 1K0OA 1FOVA 1WIKA 9GSSA 7GSSA 2X64A 2GSSA 4MJAA 1ERVA 2R5GA 3LWAA 5AN1A 3V1WA 1U88A 3FR9A 2C3NA 3KH7A 2PPTA 3N9JA 4F0BA 4RQXA 12GSA 1K3LA 1K0CA 2YWMA 4K2XA 1M3IA 4MMMA 3WGXA 2WGRA 1X9MB 5G30A 2M46A 4MJBA 4TXOA 2OA7A 4NHWA 2CV4A 2PVQA 1FVJA 4WBJA 1XW6A 5B8BA 5GAND 3GV1A 4FYBA 3TDGA 5ECNB 4ZB6A 1Z3EA 2CZ3A 2V1MA 5JWRB 4I2TA 5A4WA 4EL1A 1UVZA 2FD3A 5ECKB 2DSAA 4O5QA 2CAQA 2F8FA 2VO4A 5G1KA 5ECQB 3EPTA 4OO5A 2LNTA 2FUG2 1TP9A 2VLTA 3PH9A 4ACSA 3ZRDA 4IN0A 2VAFA 4Q5RA 1Z7PA 1HYUA 3M9KA 2JACA 1ZYQB 1Z6MA 3KM6A 4FQUA 3HJPA 1PQNA 3KIJA 1O8XA 1X0RA 4K6XA 1J0FA 3GTUA 2YZUA 4QL7A 3Q18A 3TOUA 2LRTA 3QD9A 1B9YC 3GMFA 4NWYA 2DKHA 1EV9A 4POKA 2MBTA 1G6YA 2Z9SA 4MZBA 3H1NA 3GKKA 3TRQA 1ZYNA 1O8WA 2B5EA 2ZUPA 3HVNA 3HVVA 4BIKA 2HE3A 2ES7A 2VL9A 1T8EB 2CQ9A 2P31A 4ZXGA 1HNAA 4JBBA 3MIXA 4MJEA 4HZ2A 2E2GA 3GH9A 3CSIA 3UBKA 3FHKA 4MPGA 2LS5A 1F2EA 3WGDA 4XTSA 1PKWA 1MDKA 1ERTA 3GL5A 2B7JA 3I69A 2VLUA 1N8JA 2XBIA 2KUCA 2I9HA 2LNSA 2VD1A 2WZ9A 1PA3A 3IBHA 5KN0A 4G9HA 4ISDA 2WFCA 2R2JA 2V6KA 3APSA 5KN3A 1SJ6A 1XBSA 2IMEA 3ZVJA 1S3RA 5HR0A 1WPIA 3D6IA 1K0BA 5CAXA 2C80A 4K1FA 1E6BA 3KMOA 4KSOA 4RQRA 1GSDA 1IYHA 1V57A 3QPMA 2YPMA 3TJKA 4GF0A 3BOAA 3TKPA 3LORA 5DDLA 1K0AA 3VPTA 2M80A 4BVYB 1N2AA 2EC4A 4ZL7A 2LV3A 5IQYA 2PGTA 3FMWA 1PX7A 5IMFA 4XS1A 2MMZA 3CQFA 3EINA 4PUAA 2CAIA 2HSYA 1VGLA 1A8LA 2GZPA 2X4AA 2C0EA 3HXSA 4GLTA 4IP1A 1K3YA 3DMLA 4OFMA 3RDWA 3RPNA 4ZILA 2VCTA 2FWHA 3GHAA 5ID2B 5IPGA 4AJ8A 6GSVA 1F37A 3S9FA 2JZRA 1GSYA 5GAPD 1GTIA 4PQHA 3TKSE 3QMXA 3LGCA 1A24A 1AUCA 3VI5A 3BBYA 3GX8A 4X1UA 2VCWA 5L71A 2CX3A 5HR2A 2XBQA 2H0HA 2H0IA 1KNGA 1ZL9A 3WYWA 2I3YA 1VF4A 4J57E 5DAKA 3IRAA 1U3AA 4EKZA 3CRTA 5IO2A 5HQPA 1B4PA 1X5EA
chains in the Genus database with same CATH topology
1QFNA 1OC9B 2H66A 3MWHA 1WWJA 2YWOA 2I1UA 3F3RA 4N0VA 1ACVA 4KA0A 4KDYA 2H30A 1Y6EA 5JCUA 1QXHA 4XS6A 4F2IA 1GL8A 2HZFA 4KNDA 1S3CA 4HJMA 6GSUA 5GZZB 4K0NA 5GSSA 4KDXA 4PGTA 1YF0A 1XWKA 4GTUA 4KCAA 2N5AA 1B8XA 2O85A 1BX9A 3FKFA 2MBSA 2OBIA 3G9BA 2MMOA 3VWXA 3EYTA 4MABA 1EP8A 2HRFA 3RHBA 1A2LA 1GLPA 3UARA 1Q4JA 1EOHA 1JZOA 4PNGA 3TKRA 1T00A 3HA9A 3M9JA 1G6WA 3GUSA 3KH9A 2LJAA 4Q5FA 1DSBA 1A2JA 5HFGA 3DKSA 1FB0A 2GVPA 2C1YA 3UOMA 2BMXA 3KEBA 3KJYA 2HRKA 1BEDA 2VL2C 3M0FA 5A4UA 1M0UA 3F4TA 4BL7A 2GQKA 2IMKA 5ENUA 2FCHA 4XCSA 4Q5QA 1SYRA 4D73B 1V58A 3WT1A 1O73A 1K0NA 2RM6A 4CDOA 4WF4A 2IPAA 4PQ1A 3QDNA 4LMVA 3RHCA 1YKCA 4ECCA 2OE1A 13GSA 1U3IA 4F9ZA 1U87A 1FHEA 2B7KA 5ECOB 4IP6A 2O87A 4O5UA 4JE1A 1DE1A 3TCOA 1KEBA 4TR1B 3TKSA 1ERUA 3DEXA 2KP1A 3Q6OA 4USSA 1KBNA 3D5JA 5D8IA 5E59A 1ZYEA 1ST9A 1SJIA 3LQ7A 2LQOA 2H0GA 2H6ZA 2X8GA 5G31A 1FW1A 1GNEA 2F51A 2DIZA 1H75A 1USBA 2RIIA 4IKHA 2VM2A 1GNWA 4N10A 1YEPA 2YWNA 3A2WA 3TGZA 1BYEA 4H86A 2GDRA 1WE0A 2DKIA 4JR6A 2P0GA 3J7Yb 4WBRD 3VWVA 1B9XC 1Y25A 4PNFA 4L0UA 3D4TA 2F3MA 2I4AA 2VD0A 4POLA 2GT5A 3IR4A 1TI3A 3TJFA 3C1SA 3DVXA 5AISA 1V9WA 4KUNA 4E8EA 4ECBA 4WR5A 3TJGA 2H19A 3L78A 1XWBA 1JZRA 4Z2UA 2G0FA 2E2MA 1T4YA 5COHA 2CVBA 3UAPA 5G2ZA 2A4HA 1VF3A 3ME8A 5HR1A 5ELAA 3GX0A 4V2LA 6GSSA 3IV4A 3HHVA 1BG5A 5CRWA 4WXTA 3CRUA 4X4JA 3VURA 4PURA 3IK9A 3GFKA 4WF5A 2K8VA 2NBSA 3EMXA 2VOCA 4GCIA 2HNLA 2L57A 2XC2A 3F6FA 4K0GA 2N5BA 3IC4A 3QFAC 4GSTA 1MD4A 1PN9A 4DSSB 4BVYA 2BTOT 1H4OA 2JZTA 3QOUA 5IMDA 4XS4B 3EURA 1XWAA 2J9HA 3R2QA 2K6VA 3ISOA 4CHSA 1TU8A 1RK4A 4O92A 2R6KA 5ID2A 4WR4A 2JL4A 2B3SA 3CXGA 1XVQA 1XOAA 3Q74A 5LD0A 3SWLA 5LNKe 2DJJA 1YF1A 2JADA 1M9AA 1THXA 2GSQA 5IMCA 3BD2A 5CP1A 3CMIA 3MDKA 1J08A 6GSTA 1XZOA 3LYPA 1ZYPA 4X43A 5IMVA 1JHBA 2QC7A 3TRPA 4K2DA 4QL9A 4NHZA 3EMPA 4XRAA 1R7HA 3JCML 1SL0B 1GRXA 1OE8A 2GQLA 3HJMA 1S3AA 4V2MA 3IOSA 1OC9A 4YQVA 1U6TA 5H5RA 3HZ4A 3IK7A 6GSXA 3D4MA 3QFBC 3GN3A 3UEMA 1FVKA 4O32A 1NSWA 4NAXA 4JZQA 3GA4A 3R3EA 3P90A 3HCZA 5JCGA 1GSQA 2XPDA 4N0ZA 4WKWA 5D73A 4IW9A 4LL4B 2BJXA 4YKFA 2PMTA 3M3MA 2HFDA 1GSEA 1M2BA 3M1GA 1XWCA 3I6AA 3TOTA 1OE7A 3LFLA 5CO3A 3VWUA 4G0LA 2H75A 2LJKA 2H74A 3F6DA 2H8LA 2HI7A 1YY7A 3DGQA 1O6JA 2HZEA 3GNJA 3MYDA 4HU7A 3FRCA 1PL1A 3VK9A 3ZVJD 4ILFA 4K8MA 1EOGA 1JZWA 2IFQA 2PN8A 4NV5A 3NOFA 1OC8A 1XXUA 4GSNA 3QAGA 2F9SA 4TR3A 2HSMA 1K3OA 5A5KA 2GZYA 4EIPA 2GSRA 4YQUA 3ZZXA 4HUAA 1SU9A 5ECLB 3IHGA 4G19A 4I2UA 4PUFC 2H6XA 2PU9C 5HFIA 1Q98A 3HY2A 3KMNA 4RI6A 4DSQA 2QGVA 4BVXA 2FA8A 2OACA 1X9WB 2P5RA 3PR8A 4WEYA 3KTBA 5F06A 1E2YA 1WOUA 1O81A 2C0DA 4EVMA 5IIZA 4TR1A 1G7EA 2HRNA 1ZZYA 2L4QA 5F07A 3DXBA 4Z2TA 2P5QA 3LXZA 5ELGA 4CY8A 3ED3A 2VCZA 1HD2A 4N30A 1OYJA 1B4QA 1TTZA 4MPFA 1YDKA 4OD7A 1PSQA 4MLYA 2O7KA 3J7Yk 4FYCA 5G5EA 3A5IA 5D9XA 1V2AA 1I5GA 1JLVA 2ZNMA 2OE0A 4HS1A 3NZNA 3HKRA 17GSA 2LRNA 1NHOA 1GLQA 2FWFA 4IGJA 2A4VA 5AIXA 4RUVA 3DYRA 3BCIA 3LYKA 3TUEA 2VIMA 1XFLA 1QGVA 1FO5A 1AQXA 3BJ5A 1EZKA 3KD0A 3ZFLA 1MDIA 5DALA 4JEDA 3ERFA 3HVSA 2LEGA 1EV4A 1Z7RA 1FOHA 1J9BA 2V32A 2MYGA 1AW9A 2GSTA 3IA1A 1TU7A 3W8JA 2RUEA 2JU5A 1C72A 4LA1A 3ZMLA 5ECMB 5ECRB 3IHQA 3FZ4A 1GH2A 2GTUA 1TDIA 3FK8A 3E3EA 1GWCA 1A23A 4FIWA 1TRSA 3KCMA 1FG4A 4ZBAA 5INYA 2IMFA 1PD21 3UIWA 1DE2A 1LU4A 2B1LA 5CYYA 4V1Ag 4MZCA 4MJCA 1TI1A 1HNBA 2R37A 5EY6A 3HJOA 1SENA 4MP4A 4KW6A 1TK0B 3UMAA 1G7OA 2YZHA 4KGIA 4O5RA 5HFKA 4TN8A 5DJLA 5F0GA 3KXOA 2H1GA 4ML6A 3FYGA 4TXOB 5FHIA 2YWIA 4IELA 2KP2A 2WJUA 2WS2A 1A8YA 1EP7A 2R0GA 4IBPA 4O7HA 1JZDA 3GH6A 5FT3A 3IDVA 6GSWA 2C4JA 1TRVA 2YNXA 2DMLA 2L59A 4JU5A 1B48A 2VCQA 3P2AA 1YQ1A 2GZZA 1W4VA 2CVKA 4ICYA 4XHMA 3WT2A 3UVHA 1JFUA 2V6OA 5ECSA 2R0PA 2L5LA 4FH8A 4CY6A 3C71A 4DEJA 1QUWA 1XPVA 4TKYA 5JCWA 1OKTA 1TKDB 5IOXA 2HXKA 5FWGA 2DIYA 3TRXA 1SJZA 4LLRA 4PX1A 1QQ2A 4FO5A 2FY6A 1ZOFA 3VFIA 2DJ2A 2M72A 1AC1A 3L9VA 2C3TA 4NXIA 1EGOA 5DJMA 3GTUB 3UVTA 4OO4A 5E4WA 4QQ7A 3CYNA 4GRFA 4J2FA 1LJRA 4HQZA 1NHYA 1UN2A 1ABAA 4KDUA 4ID0A 5BRTA 4ZL8A 1LBKA 1SKWB 4EDZA 5B8AA 3U5RE 1EGRA 4YAPA 5IPHA 1A2MA 2C8UA 3LJRA 2GT6A 4PTSA 3F4SA 5DCHA 3E0UA 2PWJA 4K9ZA 3OR5A 4BWSA 2VLVA 2KOKA 2RUFA 3ME7A 2FLSA 4JRRA 2C3QA 2EIQA 4MA9A 2LRCA 1TXXA 2F8AA 1T3BA 2A2SA 3RPPA 1PMTA 3FZ9A 5D9TA 4G0IA 1F6MC 5DBQA 4F03A 5BMUA 2TRCP 3ZREA 1ERWA 2AB6A 4HDEA 3A5WA 4A5PA 4GQCA 3FW2A 2PUKC 1SYXA 1ILOA 3C73A 5J5NA 4G2EA 4F0CA 1XWGA 4MNNA 4ZBDA 2XHFA 5ECPB 2J23A 2YN1A 2LSTA 2NVLA 5EPFA 3I9V2 3ZLPA 4HU9A 2AUVA 4AGSA 2ON5A 3QAVA 5DVBA 5J4UA 2FA4A 4DSRA 3O3TA 1O7UA 2AHEA 2OBKA 4OCFA 4AF2A 1VF1A 1WP0A 1YJ6A 4K7OA 3EWLA 3EC3A 22GSA 4F82A 1NW2A 2RLIA 1I9DA 4ZL9A 1OAZA 4WETA 3ZITA 4ECIA 1Z9HA 1YKAA 4EIQA 3GKXA 2HYXA 2DJ1A 2OKAA 3FZ5A 5CRHA 4EUYA 1X5CA 2IIYA 2FNOA 2H1AA 2EIRA 3MNGA 5DQYA 1XIYA 3IAM2 2TRXA 3L4NA 3DRNA 5ECHB 4EO3A 1GP1A 4ZB8A 5F8BA 1OVNA 1FAAA 5CNWA 5GSTA 1GUMA 3PINA 2IN3A 5KOWA 4KX4A 1SKRB 1CQGA 1R5PA 2HLSA 5KEJA 4IS0A 1EEMA 2EIOA 4PQIA 2JSZA 3IC8A 4EF0A 1WMJA 5DAKB 1G0TA 4KAEA 14GSA 1S3DA 4TW5A 3MAKA 4I5QA 2PERA 3P8WA 1F9MA 3SBCA 2H73A 5J3RA 3IAS2 1MTCA 3KTLA 5AIVA 2XPEA 3G7JA 2B1KA 3GURA 3GYKA 4BWQA 4YAVA 1AQWA 3CBUA 1QMVA 3N5OA 4Z7XA 1VRSD 2E7PA 3FEUA 2H1DA 2JSYA 2X8HA 1BJXA 3VWWA 1BAYA 2YJ7A 1M2AA 3FR6A 4FYUA 1R26A 4TXVA 3O6TA 4L5OA 2QKEA 2WCIA 5KN2A 4HZ4A 4K7IA 4IQAA 5G5FA 1PRXA 19GSA 4MH2A 3KZQA 18GSA 2REMA 5A4VA 1HNCA 2VM1A 1WJKA 1T4ZA 1YZXA 4NMUA 4MF6A 4I8BA 4MCUA 11GSA 2X49A 1SL1B 4BL7B 1RQMA 3M8NA 2LQQA 1ZCPA 3H93A 4K7NA 5DCGA 4OFTA 4EC0A 2H71A 3C7MA 1EEJA 2NTOA 1FB6A 4RI7A 3PPUA 3HVXA 5IOWA 3W6GA 4BPYA 1THOA 3TJBA 5C00A 2YCDA 3CTGA 3ZYWA 1DBYA 4KCEA 4HEA2 1TRWA 1ON4A 1NM3A 2FGXA 4OMVA 1UC7A 3F63A 4HJ2A 2HT9A 3Q19A 3LEFA 4V2NA 1GUHA 4HI7A 4D73A 2OE3A 2WULA 3GIXA 4E8HA 1SK2A 4YH2A 3APQA 2K9FA 4GXZA 4CW9A 2MMNA 1W89A 3GSSA 3IE3A 4MDCA 3RBTA 2LUSA 2ON7A 1GSUA 3EVIA 1TRUA 3GSTA 3GRXA 3WD6A 2WRTA 2CZ2A 1Z5YE 2O89A 2QSIA 3D21A 1XCCA 1TOFA 1T1VA 1T7PB 3LXTA 2GLRA 3HDCA 2A2PA 3GKNA 1YEXA 2MZCA 3CSHA 4GWRA 1TK8B 16GSA 5IM9A 3A3TA 1ML6A 1UA5A 1O85A 2YANA 1ZGNA 3HYPA 2DJ3A 2JZSA 1A0FA 1X9SB 1M99A 3FZAA 3ERWA 5H5QA 5C04A 1ZMAA 2V2GA 4TR4A 5B6MA 5EL8A 4POMA 3IXRA 4OCEA 2FWEA 1M7TA 2GGTA 3RAZA 4G10A 2I81A 1AXDA 4P3YB 4V1Ap 1F3BA 3TKSC 3DVWA 3FR3A 3KGKA 2B6MA 3GKMA 1SD8A 1QK8A 4L0WA 1GULA 4ZBBA 3D0ZA 3PGTA 3VLNA 2OJLA 1XW5A 3ZL5A 2QA2A 3A2XA 2N5FA 3F8UA 1OKDA 1PL2A 2WDUA 4KH7A 2CX4A 4KB3A 3F0IA 4LMWA 4G0KA 2YV9A 2CT6A 1XW9A 4AJ6A 1TW9A 2H1BA 2KHPA 4HOJA 1PGTA 3CTFA 3DWVA 1V40A 1OC3A 1M9BA 4N11A 3UL3A 1HQOA 3APOA 3TJJA 2DMMA 5F05A 4GSSA 4DSSA 2V41A 6GSYA 1BQ7A 3U6VA 2NPBA 3CSJA 3F9UA 4NV2A 4XS4A 5IMAA 1F3AA 4TR0A 2DC5A 2IJYA 5DQSA 5H5SA 2YOIA 4L5LA 3ZMKA 3KP8A 2GQMA 4K5SA 1X5DA 3IPZA 3LSZA 1VF2A 4EE0A 3L9UA 5KN1A 5CRGA 2VUPA 5D93A 3I43A 10GSA 2H76A 1TJDA 3H4KA 3H79A 2KLXA 2DLXA 2AJQB 3O76A 2L6DA 2R3XA 1SK1A 3F4RA 5ABRA 4MZWA 2VCXA 1RW1A 4YKGA 2L6CA 2K18A 4NPBA 1XOBA 8GSSA 1M2DA 1MDJA 4TOPA 2GS3A 3ZTLA 5KOXA 3NIVA 1A0RP 20GSA 2FHEA 4IQ1A 4KF9A 4EDYA 4EXJA 1K0DA 4KSMA 3TKQA 5D9VA 4I97A 4MF5A 2RM5A 2DBCA 1PN0A 4K5RA 2CVDA 4AJ7A 1SD9A 3LG6A 4MH3A 3W8SA 2LTKA 3BCKA 2ALBA 2E0QA 3ERGA 2HZEB 4TVEA 2OADA 2AAWA 4JR4A 4POBA 5D96A 2IFQB 4ML1A 3KP9A 1GSSA 2CA8A 1CQHA 2UZ8A 1GSFA 3HD5A 2HRAA 2PVOC 4I6XA 2AYTA 3US3A 2O8VB 3VPQA 1SK0A 5LCZA 5J9BA 3LW9A 1PKZA 1AQVA 5CREA 5IO0A 2LKUA 5ECIB 4BVXB 4XRDA 1DUGA 2YP6A 1SKSB 1URMA 5D9WA 2H72A 3QAWA 3A2VA 2G2QA 3MSZA 2NDOA 5JWQB 4BA7A 2WB9A 1SL2B 1IYIA 1WRYA 2LJRA 1Z6NA 2H6YA 1GUKA 4IJIA 4YQMA 2B5YA 2B5XA 1R5AA 3UJ1A 4L8EA 4ECJA 2L5OA 2R4VA 2DJ0A 5G1LA 4IJ3A 1JLWA 2ZCTA 2C0FA 5JWOB 3G7IA 4J56E 2L4CA 4LL1B 3QR6A 4ZB9A 3G7YA 3ZFBA 4Q5NA 3FY7A 1AAZA 3EU3A 2IMIA 3E9JB 3C1RA 3ZIVA 4OFNA 3GL3A 1GTUA 1EWXA 2PBJA 3AY8A 5J9CA 3L9SA 3HZ8A 1MEKA 4PXOA 5EVOA 3F3QA 2C0GA 3WGEA 2A2RA 4IVFA 4ZIJA 5AGYA 5HR3A 5DALB 4TRXA 4MF7A 1KTEA 2H01A 3H8QA 2DJKA 3QCPA 1TK5B 4XIHA 2AV4A 5CRDA 1GTBA 1PX6A 4HQSA 3K8NA 5J41A 2HSHA 3D22A 2R0CA 4MK3A 2X99A 5B7CA 4IHUA 3UBLA 3EU4A 2IMDA 2TIRA 2VL3A 2X8CA 4DVCA 1R4WA 1GTAA 2IL3A 2FWGA 4OWYA 2H70A 1MD3A 2D2ZA 2MMAA 3ZIJA 5IMZA 3TB2A 2VCVA 4ULXA 1K0MA 3DIEA 2YV7A 3P7XA 4KE3A 2IWTA 1XVWA 3EE2A 4GQFA 4Z2RA 3C8EA 3DD3A 1AIUA 4X0XA 3VI7A 2VL2A 2QA1A 2YJHA 1V98A 5B6NA 2K8SA 3L0HA 1K0OA 1FOVA 1WIKA 9GSSA 7GSSA 2X64A 2GSSA 4MJAA 1ERVA 2R5GA 3LWAA 5AN1A 3V1WA 1U88A 3FR9A 2C3NA 3KH7A 2PPTA 3N9JA 4F0BA 4RQXA 12GSA 1K3LA 1K0CA 2YWMA 4K2XA 4MMMA 3WGXA 2WGRA 1X9MB 5G30A 2M46A 4MJBA 4TXOA 2OA7A 4NHWA 2CV4A 2PVQA 1FVJA 4WBJA 1XW6A 5B8BA 5GAND 3GV1A 4FYBA 3TDGA 5ECNB 4ZB6A 1Z3EA 2CZ3A 2V1MA 5JWRB 4I2TA 5A4WA 4EL1A 1UVZA 2FD3A 5ECKB 2DSAA 4O5QA 2CAQA 2F8FA 2VO4A 5G1KA 5ECQB 3EPTA 4OO5A 2LNTA 2FUG2 1TP9A 2VLTA 3PH9A 4ACSA 3ZRDA 4IN0A 2VAFA 4Q5RA 1Z7PA 1HYUA 3M9KA 2JACA 1ZYQB 1Z6MA 3KM6A 4FQUA 3HJPA 1PQNA 3KIJA 1O8XA 1X0RA 4K6XA 1J0FA 3GTUA 2YZUA 4QL7A 3Q18A 3TOUA 2LRTA 3QD9A 1B9YC 3GMFA 4NWYA 2DKHA 1EV9A 4POKA 2MBTA 1G6YA 2Z9SA 4MZBA 3H1NA 3GKKA 3TRQA 1ZYNA 1O8WA 2B5EA 2ZUPA 3HVVA 2HE3A 2ES7A 2VL9A 1T8EB 2CQ9A 2P31A 4ZXGA 1HNAA 4JBBA 3MIXA 4MJEA 4HZ2A 2E2GA 3GH9A 3CSIA 3UBKA 3FHKA 4MPGA 2LS5A 1F2EA 3WGDA 4XTSA 1PKWA 1MDKA 1ERTA 3GL5A 2B7JA 3I69A 2VLUA 1N8JA 2XBIA 2KUCA 2I9HA 2LNSA 2VD1A 2WZ9A 1PA3A 3IBHA 5KN0A 4G9HA 4ISDA 2WFCA 2R2JA 2V6KA 3APSA 5KN3A 1SJ6A 1XBSA 2IMEA 3ZVJA 5HR0A 1WPIA 3D6IA 1K0BA 5CAXA 2C80A 4K1FA 1E6BA 3KMOA 4KSOA 4RQRA 1GSDA 1IYHA 1V57A 3QPMA 2YPMA 3TJKA 4GF0A 3BOAA 3TKPA 3LORA 5DDLA 1K0AA 3VPTA 2M80A 4BVYB 1N2AA 2EC4A 4ZL7A 2LV3A 5IQYA 2PGTA 3FMWA 1PX7A 5IMFA 4XS1A 2MMZA 3EINA 4PUAA 2CAIA 2HSYA 1VGLA 1A8LA 2GZPA 2X4AA 2C0EA 3HXSA 4GLTA 4IP1A 1K3YA 3DMLA 4OFMA 3RDWA 3RPNA 4ZILA 2VCTA 2FWHA 3GHAA 5ID2B 5IPGA 4AJ8A 6GSVA 1F37A 3S9FA 2JZRA 1GSYA 5GAPD 1GTIA 4PQHA 3TKSE 3QMXA 3LGCA 1A24A 1AUCA 3VI5A 3BBYA 3GX8A 4X1UA 2VCWA 5L71A 2CX3A 5HR2A 2XBQA 2H0HA 2H0IA 1KNGA 1ZL9A 3WYWA 2I3YA 1VF4A 4J57E 5DAKA 3IRAA 1U3AA 4EKZA 3CRTA 5IO2A 5HQPA 1B4PA 1X5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QFN A;  1OC9 B;  2H66 A;  3MWH A;  1WWJ A;  2YWO A;  2I1U A;  3F3R A;  4N0V A;  1ACV A;  4KA0 A;  4KDY A;  2H30 A;  1Y6E A;  5JCU A;  1QXH A;  4XS6 A;  4F2I A;  1GL8 A;  2HZF A;  4KND A;  1S3C A;  4HJM A;  6GSU A;  5GZZ B;  4K0N A;  5GSS A;  4KDX A;  4PGT A;  1YF0 A;  1XWK A;  4GTU A;  4KCA A;  2N5A A;  1B8X A;  2O85 A;  1BX9 A;  3FKF A;  2MBS A;  2OBI A;  3G9B A;  2MMO A;  3VWX A;  3EYT A;  4MAB A;  1EP8 A;  2HRF A;  3RHB A;  1A2L A;  1GLP A;  3UAR A;  1Q4J A;  1EOH A;  1JZO A;  4PNG A;  3TKR A;  1T00 A;  3HA9 A;  3M9J A;  1G6W A;  3GUS A;  3KH9 A;  2LJA A;  4Q5F A;  1DSB A;  1A2J A;  5HFG A;  3DKS A;  1FB0 A;  2GVP A;  2C1Y A;  3UOM A;  2BMX A;  3KEB A;  3KJY A;  1BED A;  2VL2 C;  3M0F A;  5A4U A;  1M0U A;  3F4T A;  4BL7 A;  2GQK A;  2IMK A;  5ENU A;  2FCH A;  4XCS A;  4Q5Q A;  1SYR A;  4D73 B;  1V58 A;  3WT1 A;  1O73 A;  1K0N A;  2RM6 A;  4CDO A;  4WF4 A;  2IPA A;  4PQ1 A;  3QDN A;  4LMV A;  3RHC A;  1YKC A;  4ECC A;  2OE1 A;  13GS A;  1U3I A;  4F9Z A;  1U87 A;  1FHE A;  2B7K A;  5ECO B;  4IP6 A;  2O87 A;  4JE1 A;  1DE1 A;  3TCO A;  1KEB A;  4TR1 B;  3TKS A;  1ERU A;  3DEX A;  2KP1 A;  3Q6O A;  5D8I A;  1KBN A;  3D5J A;  5E59 A;  1ZYE A;  1ST9 A;  1SJI A;  3LQ7 A;  2LQO A;  2H0G A;  2H6Z A;  2X8G A;  5G31 A;  1FW1 A;  1GNE A;  2F51 A;  2DIZ A;  1H75 A;  1USB A;  2RII A;  4IKH A;  2VM2 A;  1GNW A;  4N10 A;  1YEP A;  2YWN A;  3A2W A;  3TGZ A;  1BYE A;  4H86 A;  2GDR A;  1WE0 A;  4JR6 A;  2P0G A;  3J7Y b;  4WBR D;  3VWV A;  1B9X C;  1Y25 A;  4PNF A;  4L0U A;  3D4T A;  2F3M A;  2I4A A;  2VD0 A;  4POL A;  2GT5 A;  3IR4 A;  1TI3 A;  3TJF A;  3C1S A;  3DVX A;  5AIS A;  1V9W A;  4KUN A;  4E8E A;  4ECB A;  4WR5 A;  3TJG A;  2H19 A;  3L78 A;  1XWB A;  1JZR A;  2G0F A;  2E2M A;  1T4Y A;  5COH A;  2CVB A;  3UAP A;  5G2Z A;  1VF3 A;  3ME8 A;  5HR1 A;  5ELA A;  3GX0 A;  4V2L A;  6GSS A;  3IV4 A;  3HHV A;  1BG5 A;  5CRW A;  4WXT A;  3CRU A;  3VUR A;  4PUR A;  3IK9 A;  3GFK A;  4WF5 A;  2K8V A;  2NBS A;  3EMX A;  2VOC A;  4GCI A;  2HNL A;  2L57 A;  2XC2 A;  3F6F A;  4K0G A;  2N5B A;  3IC4 A;  3QFA C;  4GST A;  1MD4 A;  1PN9 A;  4DSS B;  4BVY A;  2BTO T;  1H4O A;  2JZT A;  3QOU A;  5IMD A;  4XS4 B;  3EUR A;  1XWA A;  2J9H A;  3R2Q A;  2K6V A;  3ISO A;  4CHS A;  1TU8 A;  1RK4 A;  4O92 A;  2R6K A;  5ID2 A;  4WR4 A;  2JL4 A;  2B3S A;  3CXG A;  1XVQ A;  1XOA A;  3Q74 A;  5LD0 A;  3SWL A;  5LNK e;  2DJJ A;  1YF1 A;  2JAD A;  1M9A A;  1THX A;  2GSQ A;  5IMC A;  3BD2 A;  5CP1 A;  3CMI A;  3MDK A;  1J08 A;  6GST A;  1XZO A;  3LYP A;  4X43 A;  5IMV A;  1JHB A;  2QC7 A;  3TRP A;  4K2D A;  4QL9 A;  4NHZ A;  3EMP A;  4XRA A;  1R7H A;  3JCM L;  1SL0 B;  1GRX A;  1OE8 A;  2GQL A;  3HJM A;  1S3A A;  4V2M A;  3IOS A;  1OC9 A;  4YQV A;  1U6T A;  5H5R A;  3HZ4 A;  3IK7 A;  6GSX A;  3D4M A;  3QFB C;  3GN3 A;  3UEM A;  1FVK A;  4O32 A;  1NSW A;  4NAX A;  4JZQ A;  3GA4 A;  3P90 A;  3HCZ A;  5JCG A;  1GSQ A;  2XPD A;  4N0Z A;  4WKW A;  5D73 A;  4IW9 A;  4LL4 B;  2BJX A;  2PMT A;  3M3M A;  2HFD A;  1GSE A;  1M2B A;  3M1G A;  1XWC A;  3I6A A;  3TOT A;  1OE7 A;  3LFL A;  5CO3 A;  3VWU A;  2H75 A;  2LJK A;  2H74 A;  3F6D A;  2H8L A;  2HI7 A;  1YY7 A;  3DGQ A;  1O6J A;  2HZE A;  3GNJ A;  4HU7 A;  3FRC A;  1PL1 A;  3VK9 A;  3ZVJ D;  4ILF A;  4K8M A;  1EOG A;  1JZW A;  2IFQ A;  2PN8 A;  4NV5 A;  3NOF A;  1OC8 A;  1XXU A;  4GSN A;  3QAG A;  2F9S A;  4TR3 A;  1K3O A;  5A5K A;  2GZY A;  2GSR A;  4YQU A;  3ZZX A;  4HUA A;  1SU9 A;  5ECL B;  4G19 A;  4I2U A;  4PUF C;  2H6X A;  2PU9 C;  5HFI A;  1Q98 A;  3HY2 A;  3KMN A;  4RI6 A;  4DSQ A;  2QGV A;  4BVX A;  2FA8 A;  2OAC A;  1X9W B;  2P5R A;  3PR8 A;  4WEY A;  3KTB A;  5F06 A;  1E2Y A;  1WOU A;  1O81 A;  2C0D A;  4EVM A;  5IIZ A;  4TR1 A;  1G7E A;  2HRN A;  1ZZY A;  2L4Q A;  5F07 A;  3DXB A;  2P5Q A;  3LXZ A;  5ELG A;  3ED3 A;  2VCZ A;  1HD2 A;  4N30 A;  1OYJ A;  1B4Q A;  1TTZ A;  4MPF A;  1YDK A;  4OD7 A;  1PSQ A;  4MLY A;  2O7K A;  3J7Y k;  4FYC A;  5G5E A;  5D9X A;  1V2A A;  1I5G A;  1JLV A;  2ZNM A;  2OE0 A;  4HS1 A;  3NZN A;  3HKR A;  17GS A;  2LRN A;  1NHO A;  1GLQ A;  2FWF A;  4IGJ A;  2A4V A;  5AIX A;  4RUV A;  3DYR A;  3BCI A;  3LYK A;  3TUE A;  2VIM A;  1XFL A;  1QGV A;  1FO5 A;  1AQX A;  3BJ5 A;  1EZK A;  3KD0 A;  3ZFL A;  1MDI A;  5DAL A;  4JED A;  3ERF A;  3HVS A;  2LEG A;  1EV4 A;  1Z7R A;  1J9B A;  2V32 A;  2MYG A;  1AW9 A;  2GST A;  3IA1 A;  1TU7 A;  3W8J A;  2RUE A;  2JU5 A;  1C72 A;  4LA1 A;  3ZML A;  5ECM B;  5ECR B;  3IHQ A;  3FZ4 A;  1GH2 A;  2GTU A;  1TDI A;  3FK8 A;  3E3E A;  1GWC A;  1A23 A;  4FIW A;  1TRS A;  3KCM A;  1FG4 A;  4ZBA A;  5INY A;  2IMF A;  1PD2 1;  3UIW A;  1DE2 A;  1LU4 A;  2B1L A;  5CYY A;  4V1A g;  4MZC A;  4MJC A;  1TI1 A;  1HNB A;  2R37 A;  5EY6 A;  3HJO A;  1SEN A;  4MP4 A;  4KW6 A;  1TK0 B;  3UMA A;  1G7O A;  2YZH A;  4KGI A;  4O5R A;  5HFK A;  4TN8 A;  5DJL A;  5F0G A;  3KXO A;  2H1G A;  4ML6 A;  3FYG A;  4TXO B;  5FHI A;  2YWI A;  4IEL A;  2KP2 A;  2WJU A;  2WS2 A;  1A8Y A;  1EP7 A;  4IBP A;  4O7H A;  1JZD A;  3GH6 A;  5FT3 A;  3IDV A;  6GSW A;  2C4J A;  1TRV A;  2YNX A;  2DML A;  2L59 A;  4JU5 A;  1B48 A;  2VCQ A;  3P2A A;  1YQ1 A;  2GZZ A;  1W4V A;  2CVK A;  4XHM A;  3WT2 A;  3UVH A;  1JFU A;  2V6O A;  5ECS A;  2L5L A;  4FH8 A;  3C71 A;  4DEJ A;  1QUW A;  1XPV A;  4TKY A;  5JCW A;  1OKT A;  1TKD B;  5IOX A;  2HXK A;  5FWG A;  2DIY A;  3TRX A;  1SJZ A;  4LLR A;  4PX1 A;  1QQ2 A;  4FO5 A;  2FY6 A;  1ZOF A;  3VFI A;  2DJ2 A;  2M72 A;  1AC1 A;  3L9V A;  2C3T A;  4NXI A;  1EGO A;  5DJM A;  3GTU B;  3UVT A;  4OO4 A;  5E4W A;  4QQ7 A;  3CYN A;  4GRF A;  4J2F A;  1LJR A;  4HQZ A;  1NHY A;  1UN2 A;  1ABA A;  4KDU A;  4ID0 A;  4ZL8 A;  1LBK A;  1SKW B;  4EDZ A;  5B8A A;  3U5R E;  1EGR A;  4YAP A;  5IPH A;  1A2M A;  2C8U A;  3LJR A;  2GT6 A;  3F4S A;  5DCH A;  3E0U A;  2PWJ A;  4K9Z A;  3OR5 A;  4BWS A;  2VLV A;  2KOK A;  2RUF A;  3ME7 A;  2FLS A;  4JRR A;  2C3Q A;  2EIQ A;  4MA9 A;  2LRC A;  1TXX A;  2F8A A;  1T3B A;  2A2S A;  3RPP A;  1PMT A;  3FZ9 A;  5D9T A;  1F6M C;  5DBQ A;  4F03 A;  2TRC P;  3ZRE A;  1ERW A;  2AB6 A;  4HDE A;  3A5W A;  4GQC A;  3FW2 A;  2PUK C;  1SYX A;  1ILO A;  3C73 A;  5J5N A;  4G2E A;  4F0C A;  1XWG A;  4ZBD A;  2XHF A;  5ECP B;  2J23 A;  2YN1 A;  2LST A;  2NVL A;  5EPF A;  3I9V 2;  3ZLP A;  4HU9 A;  2AUV A;  4AGS A;  2ON5 A;  3QAV A;  5DVB A;  5J4U A;  2FA4 A;  4DSR A;  3O3T A;  1O7U A;  2AHE A;  2OBK A;  4OCF A;  4AF2 A;  1VF1 A;  1WP0 A;  1YJ6 A;  4K7O A;  3EWL A;  3EC3 A;  22GS A;  4F82 A;  1NW2 A;  2RLI A;  1I9D A;  4ZL9 A;  1OAZ A;  4WET A;  3ZIT A;  4ECI A;  1Z9H A;  1YKA A;  3GKX A;  2HYX A;  2DJ1 A;  2OKA A;  3FZ5 A;  5CRH A;  4EUY A;  1X5C A;  2IIY A;  2FNO A;  2H1A A;  2EIR A;  3MNG A;  5DQY A;  1XIY A;  3IAM 2;  2TRX A;  3L4N A;  3DRN A;  5ECH B;  4EO3 A;  1GP1 A;  4ZB8 A;  5F8B A;  1OVN A;  1FAA A;  5CNW A;  5GST A;  1GUM A;  3PIN A;  2IN3 A;  4KX4 A;  1SKR B;  1CQG A;  1R5P A;  2HLS A;  5KEJ A;  4IS0 A;  1EEM A;  2EIO A;  4PQI A;  2JSZ A;  4EF0 A;  1WMJ A;  5DAK B;  1G0T A;  4KAE A;  14GS A;  1S3D A;  4TW5 A;  3MAK A;  4I5Q A;  2PER A;  3P8W A;  1F9M A;  3SBC A;  2H73 A;  5J3R A;  3IAS 2;  1MTC A;  3KTL A;  5AIV A;  2XPE A;  3G7J A;  2B1K A;  3GUR A;  3GYK A;  4BWQ A;  4YAV A;  1AQW A;  3CBU A;  1QMV A;  3N5O A;  4Z7X A;  1VRS D;  2E7P A;  3FEU A;  2H1D A;  2JSY A;  2X8H A;  1BJX A;  3VWW A;  1BAY A;  2YJ7 A;  1M2A A;  3FR6 A;  4FYU A;  1R26 A;  4TXV A;  3O6T A;  4L5O A;  2QKE A;  2WCI A;  5KN2 A;  4HZ4 A;  4K7I A;  4IQA A;  5G5F A;  1PRX A;  19GS A;  4MH2 A;  3KZQ A;  18GS A;  2REM A;  5A4V A;  1HNC A;  2VM1 A;  1WJK A;  1T4Z A;  1YZX A;  4NMU A;  4MF6 A;  4I8B A;  4MCU A;  11GS A;  1SL1 B;  1RQM A;  3M8N A;  2LQQ A;  1ZCP A;  3H93 A;  4K7N A;  5DCG A;  4OFT A;  4EC0 A;  2H71 A;  3C7M A;  1EEJ A;  2NTO A;  1FB6 A;  4RI7 A;  3HVX A;  5IOW A;  3W6G A;  4BPY A;  1THO A;  3TJB A;  5C00 A;  2YCD A;  3CTG A;  3ZYW A;  1DBY A;  4KCE A;  4HEA 2;  1TRW A;  1ON4 A;  1NM3 A;  2FGX A;  4OMV A;  1UC7 A;  3F63 A;  4HJ2 A;  2HT9 A;  3Q19 A;  3LEF A;  4V2N A;  1GUH A;  4HI7 A;  4D73 A;  2OE3 A;  2WUL A;  3GIX A;  4E8H A;  1SK2 A;  4YH2 A;  3APQ A;  2K9F A;  4GXZ A;  4CW9 A;  2MMN A;  1W89 A;  3GSS A;  3IE3 A;  4MDC A;  3RBT A;  2LUS A;  2ON7 A;  1GSU A;  3EVI A;  1TRU A;  3GST A;  3GRX A;  3WD6 A;  2WRT A;  2CZ2 A;  1Z5Y E;  2O89 A;  2QSI A;  3D21 A;  1XCC A;  1TOF A;  1T1V A;  1T7P B;  3LXT A;  2GLR A;  3HDC A;  3GKN A;  1YEX A;  2MZC A;  3CSH A;  4GWR A;  1TK8 B;  16GS A;  5IM9 A;  3A3T A;  1ML6 A;  1UA5 A;  1O85 A;  2YAN A;  1ZGN A;  3HYP A;  2DJ3 A;  2JZS A;  1A0F A;  1X9S B;  1M99 A;  3FZA A;  3ERW A;  5H5Q A;  5C04 A;  1ZMA A;  2V2G A;  4TR4 A;  5B6M A;  5EL8 A;  4POM A;  3IXR A;  4OCE A;  2FWE A;  1M7T A;  2GGT A;  3RAZ A;  4G10 A;  2I81 A;  1AXD A;  4P3Y B;  4V1A p;  1F3B A;  3TKS C;  3DVW A;  3FR3 A;  3KGK A;  2B6M A;  3GKM A;  1SD8 A;  1QK8 A;  4L0W A;  1GUL A;  4ZBB A;  3D0Z A;  3PGT A;  3VLN A;  2OJL A;  1XW5 A;  3ZL5 A;  3A2X A;  2N5F A;  3F8U A;  1OKD A;  1PL2 A;  2WDU A;  4KH7 A;  2CX4 A;  4KB3 A;  3F0I A;  4LMW A;  2YV9 A;  2CT6 A;  1XW9 A;  4AJ6 A;  1TW9 A;  2H1B A;  2KHP A;  4HOJ A;  1PGT A;  3CTF A;  3DWV A;  1V40 A;  1OC3 A;  1M9B A;  4N11 A;  3UL3 A;  1HQO A;  3APO A;  3TJJ A;  2DMM A;  5F05 A;  4GSS A;  4DSS A;  2V41 A;  6GSY A;  1BQ7 A;  3U6V A;  2NPB A;  3CSJ A;  3F9U A;  4NV2 A;  4XS4 A;  5IMA A;  1F3A A;  4TR0 A;  2DC5 A;  2IJY A;  5DQS A;  5H5S A;  2YOI A;  4L5L A;  3ZMK A;  3KP8 A;  2GQM A;  1X5D A;  3IPZ A;  3LSZ A;  1VF2 A;  4EE0 A;  3L9U A;  5KN1 A;  5CRG A;  2VUP A;  5D93 A;  3I43 A;  10GS A;  2H76 A;  1TJD A;  3H4K A;  3H79 A;  2KLX A;  2DLX A;  2AJQ B;  3O76 A;  2L6D A;  2R3X A;  1SK1 A;  3F4R A;  5ABR A;  4MZW A;  2VCX A;  1RW1 A;  2L6C A;  2K18 A;  4NPB A;  1XOB A;  8GSS A;  1M2D A;  1MDJ A;  4TOP A;  2GS3 A;  3ZTL A;  3NIV A;  1A0R P;  20GS A;  2FHE A;  4IQ1 A;  4EDY A;  4EXJ A;  1K0D A;  4KSM A;  3TKQ A;  5D9V A;  4I97 A;  4MF5 A;  2RM5 A;  2DBC A;  2CVD A;  4AJ7 A;  1SD9 A;  3LG6 A;  4MH3 A;  3W8S A;  2LTK A;  3BCK A;  2ALB A;  2E0Q A;  3ERG A;  2HZE B;  4TVE A;  2OAD A;  2AAW A;  4JR4 A;  4POB A;  5D96 A;  2IFQ B;  4ML1 A;  3KP9 A;  1GSS A;  2CA8 A;  1CQH A;  1GSF A;  3HD5 A;  2PVO C;  4I6X A;  2AYT A;  3US3 A;  2O8V B;  3VPQ A;  1SK0 A;  5LCZ A;  5J9B A;  1PKZ A;  1AQV A;  5CRE A;  5IO0 A;  2LKU A;  5ECI B;  4XRD A;  1DUG A;  2YP6 A;  1SKS B;  1URM A;  5D9W A;  2H72 A;  3QAW A;  3A2V A;  2G2Q A;  3MSZ A;  2NDO A;  5JWQ B;  4BA7 A;  2WB9 A;  1SL2 B;  1IYI A;  1WRY A;  2LJR A;  1Z6N A;  2H6Y A;  1GUK A;  4IJI A;  4YQM A;  2B5Y A;  2B5X A;  1R5A A;  3UJ1 A;  4L8E A;  4ECJ A;  2L5O A;  2R4V A;  2DJ0 A;  5G1L A;  4IJ3 A;  1JLW A;  2ZCT A;  2C0F A;  5JWO B;  3G7I A;  4J56 E;  2L4C A;  4LL1 B;  3QR6 A;  4ZB9 A;  3G7Y A;  3ZFB A;  4Q5N A;  3FY7 A;  1AAZ A;  3EU3 A;  2IMI A;  3E9J B;  3C1R A;  3ZIV A;  4OFN A;  3GL3 A;  1GTU A;  1EWX A;  2PBJ A;  3AY8 A;  5J9C A;  3L9S A;  3HZ8 A;  1MEK A;  4PXO A;  5EVO A;  3F3Q A;  2C0G A;  3WGE A;  2A2R A;  4IVF A;  4ZIJ A;  5AGY A;  5HR3 A;  5DAL B;  4TRX A;  4MF7 A;  1KTE A;  2H01 A;  3H8Q A;  2DJK A;  3QCP A;  1TK5 B;  4XIH A;  2AV4 A;  5CRD A;  1GTB A;  1PX6 A;  4HQS A;  3K8N A;  5J41 A;  2HSH A;  3D22 A;  4MK3 A;  2X99 A;  5B7C A;  4IHU A;  3UBL A;  3EU4 A;  2IMD A;  2TIR A;  2VL3 A;  2X8C A;  4DVC A;  1R4W A;  1GTA A;  2IL3 A;  2FWG A;  4OWY A;  2H70 A;  1MD3 A;  2D2Z A;  2MMA A;  3ZIJ A;  5IMZ A;  3TB2 A;  2VCV A;  4ULX A;  1K0M A;  3DIE A;  2YV7 A;  3P7X A;  4KE3 A;  2IWT A;  1XVW A;  3EE2 A;  4GQF A;  3C8E A;  3DD3 A;  1AIU A;  4X0X A;  3VI7 A;  2VL2 A;  2YJH A;  1V98 A;  5B6N A;  2K8S A;  3L0H A;  1K0O A;  1FOV A;  1WIK A;  9GSS A;  7GSS A;  2X64 A;  2GSS A;  4MJA A;  1ERV A;  2R5G A;  3LWA A;  5AN1 A;  3V1W A;  1U88 A;  3FR9 A;  2C3N A;  3KH7 A;  2PPT A;  3N9J A;  4F0B A;  4RQX A;  12GS A;  1K3L A;  1K0C A;  2YWM A;  4MMM A;  3WGX A;  2WGR A;  1X9M B;  5G30 A;  2M46 A;  4MJB A;  4TXO A;  2OA7 A;  4NHW A;  2CV4 A;  2PVQ A;  1FVJ A;  4WBJ A;  1XW6 A;  5B8B A;  5GAN D;  3GV1 A;  4FYB A;  3TDG A;  5ECN B;  4ZB6 A;  1Z3E A;  2CZ3 A;  2V1M A;  5JWR B;  4I2T A;  5A4W A;  4EL1 A;  1UVZ A;  2FD3 A;  5ECK B;  2DSA A;  2CAQ A;  2F8F A;  2VO4 A;  5G1K A;  5ECQ B;  4OO5 A;  2LNT A;  2FUG 2;  1TP9 A;  2VLT A;  3PH9 A;  4ACS A;  3ZRD A;  4IN0 A;  2VAF A;  4Q5R A;  1Z7P A;  1HYU A;  3M9K A;  2JAC A;  1ZYQ B;  1Z6M A;  3KM6 A;  3HJP A;  1PQN A;  3KIJ A;  1O8X A;  1X0R A;  4K6X A;  1J0F A;  3GTU A;  2YZU A;  4QL7 A;  3Q18 A;  3TOU A;  2LRT A;  3QD9 A;  1B9Y C;  3GMF A;  4NWY A;  1EV9 A;  4POK A;  2MBT A;  1G6Y A;  2Z9S A;  4MZB A;  3H1N A;  3GKK A;  3TRQ A;  1O8W A;  2B5E A;  2ZUP A;  3HVV A;  2HE3 A;  2ES7 A;  2VL9 A;  1T8E B;  2CQ9 A;  2P31 A;  4ZXG A;  1HNA A;  4JBB A;  4MJE A;  4HZ2 A;  2E2G A;  3GH9 A;  3CSI A;  3UBK A;  3FHK A;  4MPG A;  2LS5 A;  1F2E A;  3WGD A;  4XTS A;  1PKW A;  1MDK A;  1ERT A;  3GL5 A;  2B7J A;  3I69 A;  2VLU A;  1N8J A;  2XBI A;  2KUC A;  2I9H A;  2LNS A;  2VD1 A;  2WZ9 A;  1PA3 A;  3IBH A;  5KN0 A;  4G9H A;  4ISD A;  2WFC A;  2R2J A;  2V6K A;  3APS A;  5KN3 A;  1SJ6 A;  1XBS A;  2IME A;  3ZVJ A;  5HR0 A;  1WPI A;  3D6I A;  1K0B A;  5CAX A;  2C80 A;  4K1F A;  1E6B A;  3KMO A;  4KSO A;  4RQR A;  1GSD A;  1IYH A;  1V57 A;  3QPM A;  2YPM A;  3TJK A;  4GF0 A;  3BOA A;  3TKP A;  3LOR A;  5DDL A;  1K0A A;  3VPT A;  2M80 A;  1N2A A;  2EC4 A;  4ZL7 A;  2LV3 A;  5IQY A;  2PGT A;  1PX7 A;  5IMF A;  4XS1 A;  2MMZ A;  3EIN A;  4PUA A;  2CAI A;  2HSY A;  1VGL A;  1A8L A;  2GZP A;  2C0E A;  3HXS A;  4GLT A;  1K3Y A;  4IP1 A;  3DML A;  4OFM A;  3RDW A;  3RPN A;  4ZIL A;  2VCT A;  2FWH A;  3GHA A;  5ID2 B;  5IPG A;  4AJ8 A;  6GSV A;  1F37 A;  3S9F A;  2JZR A;  1GSY A;  5GAP D;  1GTI A;  4PQH A;  3TKS E;  3QMX A;  3LGC A;  1A24 A;  1AUC A;  3VI5 A;  3BBY A;  3GX8 A;  4X1U A;  2VCW A;  5L71 A;  2CX3 A;  5HR2 A;  2XBQ A;  2H0H A;  2H0I A;  1KNG A;  1ZL9 A;  3WYW A;  2I3Y A;  1VF4 A;  4J57 E;  5DAK A;  3IRA A;  1U3A A;  4EKZ A;  3CRT A;  5IO2 A;  5HQP A;  1B4P A;  1X5E A; 
#chains in the Genus database with same CATH topology
 1QFN A;  1OC9 B;  2H66 A;  3MWH A;  1WWJ A;  2YWO A;  2I1U A;  3F3R A;  4N0V A;  1ACV A;  4KA0 A;  4KDY A;  2H30 A;  1Y6E A;  5JCU A;  1QXH A;  4XS6 A;  4F2I A;  1GL8 A;  2HZF A;  4KND A;  1S3C A;  4HJM A;  6GSU A;  5GZZ B;  4K0N A;  5GSS A;  4KDX A;  4PGT A;  1YF0 A;  1XWK A;  4GTU A;  4KCA A;  2N5A A;  1B8X A;  2O85 A;  1BX9 A;  3FKF A;  2MBS A;  2OBI A;  3G9B A;  2MMO A;  3VWX A;  3EYT A;  4MAB A;  1EP8 A;  2HRF A;  3RHB A;  1A2L A;  1GLP A;  3UAR A;  1Q4J A;  1EOH A;  1JZO A;  4PNG A;  3TKR A;  1T00 A;  3HA9 A;  3M9J A;  1G6W A;  3GUS A;  3KH9 A;  2LJA A;  4Q5F A;  1DSB A;  1A2J A;  5HFG A;  3DKS A;  1FB0 A;  2GVP A;  2C1Y A;  3UOM A;  2BMX A;  3KEB A;  3KJY A;  2HRK A;  1BED A;  2VL2 C;  3M0F A;  5A4U A;  1M0U A;  3F4T A;  4BL7 A;  1M3J A;  2GQK A;  2IMK A;  5ENU A;  2FCH A;  4XCS A;  4Q5Q A;  1SYR A;  4D73 B;  1V58 A;  3WT1 A;  1O73 A;  1K0N A;  2RM6 A;  4CDO A;  4WF4 A;  2IPA A;  4PQ1 A;  3QDN A;  4LMV A;  3RHC A;  1YKC A;  4ECC A;  2OE1 A;  13GS A;  1U3I A;  4F9Z A;  1U87 A;  1FHE A;  2B7K A;  5ECO B;  4IP6 A;  2O87 A;  4O5U A;  4JE1 A;  1DE1 A;  3TCO A;  1KEB A;  4TR1 B;  3TKS A;  1ERU A;  3DEX A;  2KP1 A;  3Q6O A;  4USS A;  1KBN A;  3D5J A;  5D8I A;  5E59 A;  1ZYE A;  1ST9 A;  1SJI A;  3LQ7 A;  2LQO A;  2H0G A;  2H6Z A;  2X8G A;  5G31 A;  1FW1 A;  1GNE A;  2F51 A;  2DIZ A;  1H75 A;  1USB A;  2RII A;  4IKH A;  2VM2 A;  1GNW A;  4N10 A;  1YEP A;  2YWN A;  3A2W A;  3TGZ A;  1BYE A;  4H86 A;  2GDR A;  1WE0 A;  2DKI A;  4JR6 A;  2P0G A;  3J7Y b;  4WBR D;  3VWV A;  1B9X C;  1Y25 A;  4PNF A;  4L0U A;  3D4T A;  2F3M A;  2I4A A;  2VD0 A;  4POL A;  2GT5 A;  3IR4 A;  1TI3 A;  3TJF A;  3C1S A;  3DVX A;  5AIS A;  1V9W A;  4KUN A;  4E8E A;  4ECB A;  4WR5 A;  3TJG A;  2H19 A;  3L78 A;  1XWB A;  1JZR A;  4Z2U A;  2G0F A;  2E2M A;  1T4Y A;  5COH A;  2CVB A;  3UAP A;  5G2Z A;  2A4H A;  1VF3 A;  3ME8 A;  5HR1 A;  5ELA A;  3GX0 A;  4V2L A;  6GSS A;  3IV4 A;  3HHV A;  1BG5 A;  5CRW A;  4WXT A;  3CRU A;  4X4J A;  3VUR A;  4PUR A;  3IK9 A;  3GFK A;  4WF5 A;  2K8V A;  2NBS A;  3EMX A;  2VOC A;  4GCI A;  2HNL A;  2L57 A;  2XC2 A;  3F6F A;  4K0G A;  2N5B A;  3IC4 A;  3QFA C;  4GST A;  1MD4 A;  1PN9 A;  4DSS B;  4BVY A;  2BTO T;  1H4O A;  2JZT A;  3QOU A;  5IMD A;  4XS4 B;  3EUR A;  1XWA A;  2J9H A;  3R2Q A;  2K6V A;  3ISO A;  4CHS A;  1TU8 A;  1RK4 A;  4O92 A;  2R6K A;  5ID2 A;  4WR4 A;  2JL4 A;  2B3S A;  3CXG A;  1XVQ A;  1XOA A;  3Q74 A;  5LD0 A;  3SWL A;  5LNK e;  2DJJ A;  1YF1 A;  2JAD A;  1M9A A;  1THX A;  2GSQ A;  5IMC A;  3BD2 A;  5CP1 A;  3CMI A;  3MDK A;  1J08 A;  6GST A;  1XZO A;  3LYP A;  1ZYP A;  4X43 A;  5IMV A;  1JHB A;  2QC7 A;  3TRP A;  4K2D A;  4QL9 A;  1XG8 A;  4NHZ A;  3EMP A;  4XRA A;  1R7H A;  3JCM L;  1SL0 B;  1GRX A;  1OE8 A;  2GQL A;  3HJM A;  1S3A A;  4V2M A;  3IOS A;  1OC9 A;  4YQV A;  1U6T A;  5H5R A;  3HZ4 A;  3IK7 A;  6GSX A;  3D4M A;  3QFB C;  3GN3 A;  3UEM A;  1FVK A;  4O32 A;  1NSW A;  4NAX A;  4JZQ A;  3GA4 A;  3R3E A;  3P90 A;  3HCZ A;  5JCG A;  1GSQ A;  2XPD A;  4N0Z A;  4WKW A;  5D73 A;  4IW9 A;  4LL4 B;  2BJX A;  4YKF A;  2PMT A;  3M3M A;  2HFD A;  1GSE A;  1M2B A;  3M1G A;  1XWC A;  3I6A A;  3TOT A;  1OE7 A;  3LFL A;  5CO3 A;  3VWU A;  4G0L A;  2H75 A;  2LJK A;  2H74 A;  3F6D A;  2H8L A;  2HI7 A;  1YY7 A;  3DGQ A;  1O6J A;  2HZE A;  3GNJ A;  3MYD A;  4HU7 A;  3FRC A;  1PL1 A;  3VK9 A;  3ZVJ D;  4ILF A;  4K8M A;  1EOG A;  1JZW A;  2IFQ A;  2PN8 A;  4NV5 A;  3NOF A;  1OC8 A;  1XXU A;  4GSN A;  3QAG A;  2F9S A;  4TR3 A;  2HSM A;  1K3O A;  5A5K A;  2GZY A;  4EIP A;  2GSR A;  4YQU A;  3ZZX A;  4HUA A;  1SU9 A;  5ECL B;  3IHG A;  4G19 A;  4I2U A;  4PUF C;  2H6X A;  2PU9 C;  5HFI A;  1Q98 A;  3HY2 A;  3KMN A;  4RI6 A;  4DSQ A;  2QGV A;  4BVX A;  2FA8 A;  2OAC A;  1X9W B;  2P5R A;  3PR8 A;  4WEY A;  3KTB A;  5F06 A;  1E2Y A;  1WOU A;  1O81 A;  2C0D A;  4EVM A;  5IIZ A;  4TR1 A;  1G7E A;  2HRN A;  1ZZY A;  2L4Q A;  5F07 A;  3DXB A;  4Z2T A;  2P5Q A;  3LXZ A;  5ELG A;  4CY8 A;  3ED3 A;  2VCZ A;  1HD2 A;  4N30 A;  1OYJ A;  1B4Q A;  1TTZ A;  4MPF A;  1YDK A;  4OD7 A;  1PSQ A;  4MLY A;  2O7K A;  3J7Y k;  4FYC A;  5G5E A;  3A5I A;  5D9X A;  1V2A A;  1I5G A;  1JLV A;  2ZNM A;  2OE0 A;  4HS1 A;  3NZN A;  3HKR A;  17GS A;  2LRN A;  1NHO A;  1GLQ A;  2FWF A;  4IGJ A;  2A4V A;  5AIX A;  4RUV A;  3DYR A;  3BCI A;  3LYK A;  3TUE A;  2VIM A;  1XFL A;  1QGV A;  1FO5 A;  1AQX A;  3BJ5 A;  1EZK A;  3KD0 A;  3ZFL A;  1MDI A;  5DAL A;  4JED A;  3ERF A;  3HVS A;  2LEG A;  1EV4 A;  1Z7R A;  1FOH A;  1J9B A;  2V32 A;  2MYG A;  1AW9 A;  2GST A;  3IA1 A;  1TU7 A;  3W8J A;  2RUE A;  2JU5 A;  1C72 A;  4LA1 A;  3ZML A;  5ECM B;  5ECR B;  3IHQ A;  3FZ4 A;  1GH2 A;  2GTU A;  1TDI A;  3FK8 A;  3E3E A;  1GWC A;  1A23 A;  4FIW A;  1TRS A;  3KCM A;  1FG4 A;  4ZBA A;  5INY A;  2IMF A;  1PD2 1;  3UIW A;  1DE2 A;  1LU4 A;  2B1L A;  4V1A g;  5CYY A;  4MZC A;  4MJC A;  1TI1 A;  1HNB A;  2R37 A;  5EY6 A;  3HJO A;  1SEN A;  4MP4 A;  4KW6 A;  1TK0 B;  3UMA A;  1G7O A;  2YZH A;  4KGI A;  4O5R A;  5HFK A;  4TN8 A;  5DJL A;  5F0G A;  3KXO A;  2H1G A;  4ML6 A;  3FYG A;  4TXO B;  5FHI A;  2YWI A;  4IEL A;  2KP2 A;  2WJU A;  2WS2 A;  1A8Y A;  1EP7 A;  2R0G A;  4IBP A;  4O7H A;  1JZD A;  3GH6 A;  5FT3 A;  3IDV A;  6GSW A;  2C4J A;  1TRV A;  2YNX A;  2DML A;  2L59 A;  4JU5 A;  1B48 A;  2VCQ A;  3P2A A;  1YQ1 A;  2GZZ A;  1W4V A;  2CVK A;  4ICY A;  4XHM A;  3WT2 A;  3UVH A;  1JFU A;  2V6O A;  5ECS A;  2R0P A;  2L5L A;  4FH8 A;  4CY6 A;  3C71 A;  4DEJ A;  1QUW A;  1XPV A;  4TKY A;  5JCW A;  1OKT A;  1TKD B;  5IOX A;  2HXK A;  5FWG A;  2DIY A;  3TRX A;  1SJZ A;  4LLR A;  4PX1 A;  1QQ2 A;  4FO5 A;  2FY6 A;  1ZOF A;  3VFI A;  2DJ2 A;  2M72 A;  1AC1 A;  3L9V A;  2C3T A;  4NXI A;  1EGO A;  5DJM A;  3GTU B;  3UVT A;  4OO4 A;  5E4W A;  4QQ7 A;  3CYN A;  4GRF A;  4J2F A;  1LJR A;  4HQZ A;  1NHY A;  1UN2 A;  1ABA A;  4KDU A;  4ID0 A;  5BRT A;  4ZL8 A;  1LBK A;  1SKW B;  4EDZ A;  5B8A A;  3U5R E;  1EGR A;  4YAP A;  5IPH A;  1A2M A;  2C8U A;  3LJR A;  2GT6 A;  4PTS A;  3F4S A;  5DCH A;  3E0U A;  2PWJ A;  4K9Z A;  3OR5 A;  4BWS A;  2VLV A;  2KOK A;  2RUF A;  3ME7 A;  2FLS A;  4JRR A;  2C3Q A;  2EIQ A;  4MA9 A;  2LRC A;  1TXX A;  2F8A A;  1T3B A;  2A2S A;  3RPP A;  1PMT A;  3FZ9 A;  5D9T A;  4G0I A;  1F6M C;  5DBQ A;  4F03 A;  5BMU A;  2TRC P;  3ZRE A;  1ERW A;  2AB6 A;  4HDE A;  3A5W A;  4A5P A;  4GQC A;  3FW2 A;  2PUK C;  1SYX A;  1ILO A;  3C73 A;  5J5N A;  4G2E A;  4F0C A;  1XWG A;  4MNN A;  4ZBD A;  2XHF A;  5ECP B;  2J23 A;  2YN1 A;  2LST A;  2NVL A;  5EPF A;  3I9V 2;  3ZLP A;  4HU9 A;  2AUV A;  4AGS A;  2ON5 A;  3QAV A;  5DVB A;  5J4U A;  2FA4 A;  4DSR A;  3O3T A;  1O7U A;  2AHE A;  2OBK A;  4OCF A;  4AF2 A;  1VF1 A;  1WP0 A;  1YJ6 A;  4K7O A;  3EWL A;  3EC3 A;  22GS A;  4F82 A;  1NW2 A;  2RLI A;  1I9D A;  4ZL9 A;  1OAZ A;  4WET A;  3ZIT A;  4ECI A;  1Z9H A;  1YKA A;  4EIQ A;  3GKX A;  2HYX A;  2DJ1 A;  2OKA A;  3FZ5 A;  5CRH A;  4EUY A;  1X5C A;  2IIY A;  2FNO A;  2H1A A;  2EIR A;  3MNG A;  5DQY A;  1XIY A;  3IAM 2;  2TRX A;  3L4N A;  3DRN A;  5ECH B;  4EO3 A;  1GP1 A;  4ZB8 A;  5F8B A;  1OVN A;  1FAA A;  5CNW A;  5GST A;  1GUM A;  3PIN A;  2IN3 A;  5KOW A;  4KX4 A;  1SKR B;  1CQG A;  1R5P A;  2HLS A;  5KEJ A;  4IS0 A;  1EEM A;  2EIO A;  4PQI A;  2JSZ A;  3IC8 A;  4EF0 A;  1WMJ A;  5DAK B;  1G0T A;  4KAE A;  14GS A;  1S3D A;  4TW5 A;  3MAK A;  4I5Q A;  2PER A;  3P8W A;  1F9M A;  3SBC A;  2H73 A;  5J3R A;  3IAS 2;  1MTC A;  3KTL A;  5AIV A;  2XPE A;  3G7J A;  2B1K A;  3GUR A;  3GYK A;  4BWQ A;  4YAV A;  1AQW A;  3CBU A;  1QMV A;  3N5O A;  4Z7X A;  1VRS D;  2E7P A;  3FEU A;  2H1D A;  2JSY A;  2X8H A;  1BJX A;  3VWW A;  1BAY A;  2YJ7 A;  1M2A A;  3FR6 A;  4FYU A;  1R26 A;  4TXV A;  3O6T A;  4L5O A;  2QKE A;  2WCI A;  5KN2 A;  4HZ4 A;  4K7I A;  4IQA A;  5G5F A;  1PRX A;  19GS A;  4MH2 A;  3KZQ A;  18GS A;  2REM A;  5A4V A;  1HNC A;  2VM1 A;  1WJK A;  1T4Z A;  1YZX A;  4NMU A;  4MF6 A;  4I8B A;  4MCU A;  11GS A;  2X49 A;  1SL1 B;  4BL7 B;  1RQM A;  3M8N A;  2LQQ A;  1ZCP A;  3H93 A;  4K7N A;  5DCG A;  4OFT A;  4EC0 A;  2H71 A;  3C7M A;  1EEJ A;  2NTO A;  1FB6 A;  4RI7 A;  3PPU A;  3HVX A;  5IOW A;  3W6G A;  4BPY A;  1THO A;  3TJB A;  5C00 A;  2YCD A;  3CTG A;  3ZYW A;  1DBY A;  4KCE A;  4HEA 2;  1TRW A;  1ON4 A;  1NM3 A;  2FGX A;  4OMV A;  1UC7 A;  3F63 A;  4HJ2 A;  2HT9 A;  3Q19 A;  3LEF A;  4V2N A;  1GUH A;  4HI7 A;  4D73 A;  2OE3 A;  2WUL A;  3GIX A;  4E8H A;  1SK2 A;  4YH2 A;  3APQ A;  2K9F A;  4GXZ A;  4CW9 A;  2MMN A;  1W89 A;  3GSS A;  3IE3 A;  4MDC A;  3RBT A;  2LUS A;  2ON7 A;  1GSU A;  3EVI A;  1TRU A;  3GST A;  3GRX A;  3WD6 A;  2WRT A;  2CZ2 A;  1Z5Y E;  2O89 A;  2QSI A;  3D21 A;  1XCC A;  1TOF A;  1T1V A;  1T7P B;  3LXT A;  2GLR A;  3HDC A;  2A2P A;  3GKN A;  1YEX A;  2MZC A;  3CSH A;  4GWR A;  1TK8 B;  16GS A;  5IM9 A;  3A3T A;  1ML6 A;  1UA5 A;  1O85 A;  2YAN A;  1ZGN A;  3HYP A;  2DJ3 A;  2JZS A;  1A0F A;  4HSC X;  1X9S B;  1M99 A;  3FZA A;  3ERW A;  5H5Q A;  5C04 A;  1ZMA A;  2V2G A;  4TR4 A;  5B6M A;  5EL8 A;  4POM A;  3IXR A;  4OCE A;  2FWE A;  1M7T A;  2GGT A;  3RAZ A;  4G10 A;  2I81 A;  1AXD A;  4P3Y B;  4V1A p;  1F3B A;  3TKS C;  3DVW A;  3FR3 A;  3KGK A;  2B6M A;  3GKM A;  1SD8 A;  1QK8 A;  4L0W A;  1GUL A;  4ZBB A;  3D0Z A;  3PGT A;  3VLN A;  2OJL A;  1XW5 A;  3ZL5 A;  2QA2 A;  3A2X A;  2N5F A;  3F8U A;  1OKD A;  1PL2 A;  2WDU A;  4KH7 A;  2CX4 A;  4KB3 A;  3F0I A;  4LMW A;  4G0K A;  2YV9 A;  2CT6 A;  1XW9 A;  4AJ6 A;  1TW9 A;  2H1B A;  2KHP A;  4HOJ A;  1PGT A;  3CTF A;  3DWV A;  1V40 A;  1OC3 A;  1M9B A;  4N11 A;  3UL3 A;  1HQO A;  3APO A;  3TJJ A;  2DMM A;  5F05 A;  4GSS A;  4DSS A;  2V41 A;  6GSY A;  1BQ7 A;  3U6V A;  2NPB A;  3CSJ A;  3F9U A;  4NV2 A;  4XS4 A;  5IMA A;  1F3A A;  4TR0 A;  2DC5 A;  2IJY A;  5DQS A;  5H5S A;  2YOI A;  4L5L A;  3ZMK A;  3KP8 A;  2GQM A;  4K5S A;  1X5D A;  3IPZ A;  3LSZ A;  1VF2 A;  4EE0 A;  3L9U A;  5KN1 A;  5CRG A;  2VUP A;  5D93 A;  3I43 A;  10GS A;  2H76 A;  1TJD A;  3H4K A;  3H79 A;  2KLX A;  2DLX A;  2AJQ B;  3O76 A;  2L6D A;  2R3X A;  1SK1 A;  3F4R A;  5ABR A;  4MZW A;  2VCX A;  1RW1 A;  4YKG A;  2L6C A;  2K18 A;  4NPB A;  1XOB A;  8GSS A;  1M2D A;  1MDJ A;  4TOP A;  2GS3 A;  3ZTL A;  5KOX A;  3NIV A;  1A0R P;  20GS A;  2FHE A;  4IQ1 A;  4KF9 A;  4EDY A;  4EXJ A;  1K0D A;  4KSM A;  3TKQ A;  5D9V A;  4I97 A;  4MF5 A;  2RM5 A;  2DBC A;  1PN0 A;  4K5R A;  2CVD A;  4AJ7 A;  1SD9 A;  3LG6 A;  4MH3 A;  3W8S A;  2LTK A;  3BCK A;  2ALB A;  2E0Q A;  3ERG A;  2HZE B;  4TVE A;  2OAD A;  2AAW A;  4JR4 A;  4POB A;  5D96 A;  2IFQ B;  4ML1 A;  3KP9 A;  1GSS A;  2CA8 A;  1CQH A;  2UZ8 A;  1GSF A;  3HD5 A;  2HRA A;  2PVO C;  4I6X A;  2AYT A;  3US3 A;  2O8V B;  3VPQ A;  1SK0 A;  5LCZ A;  5J9B A;  3LW9 A;  1PKZ A;  1AQV A;  5CRE A;  5IO0 A;  2LKU A;  5ECI B;  4BVX B;  4XRD A;  1DUG A;  2YP6 A;  1SKS B;  1URM A;  5D9W A;  2H72 A;  3QAW A;  3A2V A;  2G2Q A;  3MSZ A;  2NDO A;  5JWQ B;  4BA7 A;  2WB9 A;  1SL2 B;  1IYI A;  1WRY A;  2LJR A;  1Z6N A;  2H6Y A;  1GUK A;  4IJI A;  4YQM A;  2B5Y A;  2B5X A;  1R5A A;  3UJ1 A;  4L8E A;  4ECJ A;  2L5O A;  2R4V A;  2DJ0 A;  5G1L A;  4IJ3 A;  1JLW A;  2ZCT A;  2C0F A;  5JWO B;  3G7I A;  4J56 E;  2L4C A;  4LL1 B;  3QR6 A;  4ZB9 A;  3G7Y A;  3ZFB A;  4Q5N A;  3FY7 A;  1AAZ A;  3EU3 A;  2IMI A;  3E9J B;  3C1R A;  3ZIV A;  4OFN A;  3GL3 A;  1GTU A;  1EWX A;  2PBJ A;  3AY8 A;  5J9C A;  3L9S A;  3HZ8 A;  1MEK A;  1PFO A;  4PXO A;  5EVO A;  3F3Q A;  2C0G A;  3WGE A;  2A2R A;  4IVF A;  4ZIJ A;  5AGY A;  5HR3 A;  5DAL B;  4TRX A;  4MF7 A;  1KTE A;  2H01 A;  3H8Q A;  2DJK A;  3QCP A;  1TK5 B;  4XIH A;  2AV4 A;  5CRD A;  1GTB A;  1PX6 A;  4HQS A;  3K8N A;  5J41 A;  2HSH A;  3D22 A;  2R0C A;  4MK3 A;  2X99 A;  5B7C A;  4IHU A;  3UBL A;  3EU4 A;  2IMD A;  2TIR A;  2VL3 A;  2X8C A;  4DVC A;  1R4W A;  1GTA A;  2IL3 A;  2FWG A;  4OWY A;  2H70 A;  1MD3 A;  2D2Z A;  2MMA A;  3ZIJ A;  5IMZ A;  3TB2 A;  2VCV A;  4ULX A;  1K0M A;  3DIE A;  2YV7 A;  3P7X A;  4KE3 A;  2IWT A;  1XVW A;  3EE2 A;  4GQF A;  4Z2R A;  3C8E A;  3DD3 A;  1AIU A;  4X0X A;  3VI7 A;  2VL2 A;  2QA1 A;  2YJH A;  1V98 A;  5B6N A;  2K8S A;  3L0H A;  1K0O A;  1FOV A;  1WIK A;  9GSS A;  7GSS A;  2X64 A;  2GSS A;  4MJA A;  1ERV A;  2R5G A;  3LWA A;  5AN1 A;  3V1W A;  1U88 A;  3FR9 A;  2C3N A;  3KH7 A;  2PPT A;  3N9J A;  4F0B A;  4RQX A;  12GS A;  1K3L A;  1K0C A;  2YWM A;  4K2X A;  1M3I A;  4MMM A;  3WGX A;  2WGR A;  1X9M B;  5G30 A;  2M46 A;  4MJB A;  4TXO A;  2OA7 A;  4NHW A;  2CV4 A;  2PVQ A;  1FVJ A;  4WBJ A;  1XW6 A;  5B8B A;  5GAN D;  3GV1 A;  4FYB A;  3TDG A;  5ECN B;  4ZB6 A;  1Z3E A;  2CZ3 A;  2V1M A;  5JWR B;  4I2T A;  5A4W A;  4EL1 A;  1UVZ A;  2FD3 A;  5ECK B;  2DSA A;  4O5Q A;  2CAQ A;  2F8F A;  2VO4 A;  5G1K A;  5ECQ B;  3EPT A;  4OO5 A;  2LNT A;  2FUG 2;  1TP9 A;  2VLT A;  3PH9 A;  4ACS A;  3ZRD A;  4IN0 A;  2VAF A;  4Q5R A;  1Z7P A;  1HYU A;  3M9K A;  2JAC A;  1ZYQ B;  1Z6M A;  3KM6 A;  4FQU A;  3HJP A;  1PQN A;  3KIJ A;  1O8X A;  1X0R A;  4K6X A;  1J0F A;  3GTU A;  2YZU A;  4QL7 A;  3Q18 A;  3TOU A;  2LRT A;  3QD9 A;  1B9Y C;  3GMF A;  4NWY A;  2DKH A;  1EV9 A;  4POK A;  2MBT A;  1G6Y A;  2Z9S A;  4MZB A;  3H1N A;  3GKK A;  3TRQ A;  1ZYN A;  1O8W A;  2B5E A;  2ZUP A;  3HVN A;  3HVV A;  4BIK A;  2HE3 A;  2ES7 A;  2VL9 A;  1T8E B;  2CQ9 A;  2P31 A;  4ZXG A;  1HNA A;  4JBB A;  3MIX A;  4MJE A;  4HZ2 A;  2E2G A;  3GH9 A;  3CSI A;  3UBK A;  3FHK A;  4MPG A;  2LS5 A;  1F2E A;  3WGD A;  4XTS A;  1PKW A;  1MDK A;  1ERT A;  3GL5 A;  2B7J A;  3I69 A;  2VLU A;  1N8J A;  2XBI A;  2KUC A;  2I9H A;  2LNS A;  2VD1 A;  2WZ9 A;  1PA3 A;  3IBH A;  5KN0 A;  4G9H A;  4ISD A;  2WFC A;  2R2J A;  2V6K A;  3APS A;  5KN3 A;  1SJ6 A;  1XBS A;  2IME A;  3ZVJ A;  1S3R A;  5HR0 A;  1WPI A;  3D6I A;  1K0B A;  5CAX A;  2C80 A;  4K1F A;  1E6B A;  3KMO A;  4KSO A;  4RQR A;  1GSD A;  1IYH A;  1V57 A;  3QPM A;  2YPM A;  3TJK A;  4GF0 A;  3BOA A;  3TKP A;  3LOR A;  5DDL A;  1K0A A;  3VPT A;  2M80 A;  4BVY B;  1N2A A;  2EC4 A;  4ZL7 A;  2LV3 A;  5IQY A;  2PGT A;  3FMW A;  1PX7 A;  5IMF A;  4XS1 A;  2MMZ A;  3CQF A;  3EIN A;  4PUA A;  2CAI A;  2HSY A;  1VGL A;  1A8L A;  2GZP A;  2X4A A;  2C0E A;  3HXS A;  4GLT A;  4IP1 A;  1K3Y A;  3DML A;  4OFM A;  3RDW A;  3RPN A;  4ZIL A;  2VCT A;  2FWH A;  3GHA A;  5ID2 B;  5IPG A;  4AJ8 A;  6GSV A;  1F37 A;  3S9F A;  2JZR A;  1GSY A;  5GAP D;  1GTI A;  4PQH A;  3TKS E;  3QMX A;  3LGC A;  1A24 A;  1AUC A;  3VI5 A;  3BBY A;  3GX8 A;  4X1U A;  2VCW A;  5L71 A;  2CX3 A;  5HR2 A;  2XBQ A;  2H0H A;  2H0I A;  1KNG A;  1ZL9 A;  3WYW A;  2I3Y A;  1VF4 A;  4J57 E;  5DAK A;  3IRA A;  1U3A A;  4EKZ A;  3CRT A;  5IO2 A;  5HQP A;  1B4P A;  1X5E A; 
#chains in the Genus database with same CATH homology
 1QFN A;  1OC9 B;  2H66 A;  3MWH A;  1WWJ A;  2YWO A;  2I1U A;  3F3R A;  4N0V A;  1ACV A;  4KA0 A;  4KDY A;  2H30 A;  1Y6E A;  5JCU A;  1QXH A;  4XS6 A;  4F2I A;  1GL8 A;  2HZF A;  4KND A;  1S3C A;  4HJM A;  6GSU A;  5GZZ B;  4K0N A;  5GSS A;  4KDX A;  4PGT A;  1YF0 A;  1XWK A;  4GTU A;  4KCA A;  2N5A A;  1B8X A;  2O85 A;  1BX9 A;  3FKF A;  2MBS A;  2OBI A;  3G9B A;  2MMO A;  3VWX A;  3EYT A;  4MAB A;  1EP8 A;  2HRF A;  3RHB A;  1A2L A;  1GLP A;  3UAR A;  1Q4J A;  1EOH A;  1JZO A;  4PNG A;  3TKR A;  1T00 A;  3HA9 A;  3M9J A;  1G6W A;  3GUS A;  3KH9 A;  2LJA A;  4Q5F A;  1DSB A;  1A2J A;  5HFG A;  3DKS A;  1FB0 A;  2GVP A;  2C1Y A;  3UOM A;  2BMX A;  3KEB A;  3KJY A;  2HRK A;  1BED A;  2VL2 C;  3M0F A;  5A4U A;  1M0U A;  3F4T A;  4BL7 A;  2GQK A;  2IMK A;  5ENU A;  2FCH A;  4XCS A;  4Q5Q A;  1SYR A;  4D73 B;  1V58 A;  3WT1 A;  1O73 A;  1K0N A;  2RM6 A;  4CDO A;  4WF4 A;  2IPA A;  4PQ1 A;  3QDN A;  4LMV A;  3RHC A;  1YKC A;  4ECC A;  2OE1 A;  13GS A;  1U3I A;  4F9Z A;  1U87 A;  1FHE A;  2B7K A;  5ECO B;  4IP6 A;  2O87 A;  4O5U A;  4JE1 A;  1DE1 A;  3TCO A;  1KEB A;  4TR1 B;  3TKS A;  1ERU A;  3DEX A;  2KP1 A;  3Q6O A;  4USS A;  1KBN A;  3D5J A;  5D8I A;  5E59 A;  1ZYE A;  1ST9 A;  1SJI A;  3LQ7 A;  2LQO A;  2H0G A;  2H6Z A;  2X8G A;  5G31 A;  1FW1 A;  1GNE A;  2F51 A;  2DIZ A;  1H75 A;  1USB A;  2RII A;  4IKH A;  2VM2 A;  1GNW A;  4N10 A;  1YEP A;  2YWN A;  3A2W A;  3TGZ A;  1BYE A;  4H86 A;  2GDR A;  1WE0 A;  2DKI A;  4JR6 A;  2P0G A;  3J7Y b;  4WBR D;  3VWV A;  1B9X C;  1Y25 A;  4PNF A;  4L0U A;  3D4T A;  2F3M A;  2I4A A;  2VD0 A;  4POL A;  2GT5 A;  3IR4 A;  1TI3 A;  3TJF A;  3C1S A;  3DVX A;  5AIS A;  1V9W A;  4KUN A;  4E8E A;  4ECB A;  4WR5 A;  3TJG A;  2H19 A;  3L78 A;  1XWB A;  1JZR A;  4Z2U A;  2G0F A;  2E2M A;  1T4Y A;  5COH A;  2CVB A;  3UAP A;  5G2Z A;  2A4H A;  1VF3 A;  3ME8 A;  5HR1 A;  5ELA A;  3GX0 A;  4V2L A;  6GSS A;  3IV4 A;  3HHV A;  1BG5 A;  5CRW A;  4WXT A;  3CRU A;  4X4J A;  3VUR A;  4PUR A;  3IK9 A;  3GFK A;  4WF5 A;  2K8V A;  2NBS A;  3EMX A;  2VOC A;  4GCI A;  2HNL A;  2L57 A;  2XC2 A;  3F6F A;  4K0G A;  2N5B A;  3IC4 A;  3QFA C;  4GST A;  1MD4 A;  1PN9 A;  4DSS B;  4BVY A;  2BTO T;  1H4O A;  2JZT A;  3QOU A;  5IMD A;  4XS4 B;  3EUR A;  1XWA A;  2J9H A;  3R2Q A;  2K6V A;  3ISO A;  4CHS A;  1TU8 A;  1RK4 A;  4O92 A;  2R6K A;  5ID2 A;  4WR4 A;  2JL4 A;  2B3S A;  3CXG A;  1XVQ A;  1XOA A;  3Q74 A;  5LD0 A;  3SWL A;  5LNK e;  2DJJ A;  1YF1 A;  2JAD A;  1M9A A;  1THX A;  2GSQ A;  5IMC A;  3BD2 A;  5CP1 A;  3CMI A;  3MDK A;  1J08 A;  6GST A;  1XZO A;  3LYP A;  1ZYP A;  4X43 A;  5IMV A;  1JHB A;  2QC7 A;  3TRP A;  4K2D A;  4QL9 A;  4NHZ A;  3EMP A;  4XRA A;  1R7H A;  3JCM L;  1SL0 B;  1GRX A;  1OE8 A;  2GQL A;  3HJM A;  1S3A A;  4V2M A;  3IOS A;  1OC9 A;  4YQV A;  1U6T A;  5H5R A;  3HZ4 A;  3IK7 A;  6GSX A;  3D4M A;  3QFB C;  3GN3 A;  3UEM A;  1FVK A;  4O32 A;  1NSW A;  4NAX A;  4JZQ A;  3GA4 A;  3R3E A;  3P90 A;  3HCZ A;  5JCG A;  1GSQ A;  2XPD A;  4N0Z A;  4WKW A;  5D73 A;  4IW9 A;  4LL4 B;  2BJX A;  4YKF A;  2PMT A;  3M3M A;  2HFD A;  1GSE A;  1M2B A;  3M1G A;  1XWC A;  3I6A A;  3TOT A;  1OE7 A;  3LFL A;  5CO3 A;  3VWU A;  4G0L A;  2H75 A;  2LJK A;  2H74 A;  3F6D A;  2H8L A;  2HI7 A;  1YY7 A;  3DGQ A;  1O6J A;  2HZE A;  3GNJ A;  3MYD A;  4HU7 A;  3FRC A;  1PL1 A;  3VK9 A;  3ZVJ D;  4ILF A;  4K8M A;  1EOG A;  1JZW A;  2IFQ A;  2PN8 A;  4NV5 A;  3NOF A;  1OC8 A;  1XXU A;  4GSN A;  3QAG A;  2F9S A;  4TR3 A;  2HSM A;  1K3O A;  5A5K A;  2GZY A;  4EIP A;  2GSR A;  4YQU A;  3ZZX A;  4HUA A;  1SU9 A;  5ECL B;  3IHG A;  4G19 A;  4I2U A;  4PUF C;  2H6X A;  2PU9 C;  5HFI A;  1Q98 A;  3HY2 A;  3KMN A;  4RI6 A;  4DSQ A;  2QGV A;  4BVX A;  2FA8 A;  2OAC A;  1X9W B;  2P5R A;  3PR8 A;  4WEY A;  3KTB A;  5F06 A;  1E2Y A;  1WOU A;  1O81 A;  2C0D A;  4EVM A;  5IIZ A;  4TR1 A;  1G7E A;  2HRN A;  1ZZY A;  2L4Q A;  5F07 A;  3DXB A;  4Z2T A;  2P5Q A;  3LXZ A;  5ELG A;  4CY8 A;  3ED3 A;  2VCZ A;  1HD2 A;  4N30 A;  1OYJ A;  1B4Q A;  1TTZ A;  4MPF A;  1YDK A;  4OD7 A;  1PSQ A;  4MLY A;  2O7K A;  3J7Y k;  4FYC A;  5G5E A;  3A5I A;  5D9X A;  1V2A A;  1I5G A;  1JLV A;  2ZNM A;  2OE0 A;  4HS1 A;  3NZN A;  3HKR A;  17GS A;  2LRN A;  1NHO A;  1GLQ A;  2FWF A;  4IGJ A;  2A4V A;  5AIX A;  4RUV A;  3DYR A;  3BCI A;  3LYK A;  3TUE A;  2VIM A;  1XFL A;  1QGV A;  1FO5 A;  1AQX A;  3BJ5 A;  1EZK A;  3KD0 A;  3ZFL A;  1MDI A;  5DAL A;  4JED A;  3ERF A;  3HVS A;  2LEG A;  1EV4 A;  1Z7R A;  1FOH A;  1J9B A;  2V32 A;  2MYG A;  1AW9 A;  2GST A;  3IA1 A;  1TU7 A;  3W8J A;  2RUE A;  2JU5 A;  1C72 A;  4LA1 A;  3ZML A;  5ECM B;  5ECR B;  3IHQ A;  3FZ4 A;  1GH2 A;  2GTU A;  1TDI A;  3FK8 A;  3E3E A;  1GWC A;  1A23 A;  4FIW A;  1TRS A;  3KCM A;  1FG4 A;  4ZBA A;  5INY A;  2IMF A;  1PD2 1;  3UIW A;  1DE2 A;  1LU4 A;  2B1L A;  5CYY A;  4V1A g;  4MZC A;  4MJC A;  1TI1 A;  1HNB A;  2R37 A;  5EY6 A;  3HJO A;  1SEN A;  4MP4 A;  4KW6 A;  1TK0 B;  3UMA A;  1G7O A;  2YZH A;  4KGI A;  4O5R A;  5HFK A;  4TN8 A;  5DJL A;  5F0G A;  3KXO A;  2H1G A;  4ML6 A;  3FYG A;  4TXO B;  5FHI A;  2YWI A;  4IEL A;  2KP2 A;  2WJU A;  2WS2 A;  1A8Y A;  1EP7 A;  2R0G A;  4IBP A;  4O7H A;  1JZD A;  3GH6 A;  5FT3 A;  3IDV A;  6GSW A;  2C4J A;  1TRV A;  2YNX A;  2DML A;  2L59 A;  4JU5 A;  1B48 A;  2VCQ A;  3P2A A;  1YQ1 A;  2GZZ A;  1W4V A;  2CVK A;  4ICY A;  4XHM A;  3WT2 A;  3UVH A;  1JFU A;  2V6O A;  5ECS A;  2R0P A;  2L5L A;  4FH8 A;  4CY6 A;  3C71 A;  4DEJ A;  1QUW A;  1XPV A;  4TKY A;  5JCW A;  1OKT A;  1TKD B;  5IOX A;  2HXK A;  5FWG A;  2DIY A;  3TRX A;  1SJZ A;  4LLR A;  4PX1 A;  1QQ2 A;  4FO5 A;  2FY6 A;  1ZOF A;  3VFI A;  2DJ2 A;  2M72 A;  1AC1 A;  3L9V A;  2C3T A;  4NXI A;  1EGO A;  5DJM A;  3GTU B;  3UVT A;  4OO4 A;  5E4W A;  4QQ7 A;  3CYN A;  4GRF A;  4J2F A;  1LJR A;  4HQZ A;  1NHY A;  1UN2 A;  1ABA A;  4KDU A;  4ID0 A;  5BRT A;  4ZL8 A;  1LBK A;  1SKW B;  4EDZ A;  5B8A A;  3U5R E;  1EGR A;  4YAP A;  5IPH A;  1A2M A;  2C8U A;  3LJR A;  2GT6 A;  4PTS A;  3F4S A;  5DCH A;  3E0U A;  2PWJ A;  4K9Z A;  3OR5 A;  4BWS A;  2VLV A;  2KOK A;  2RUF A;  3ME7 A;  2FLS A;  4JRR A;  2C3Q A;  2EIQ A;  4MA9 A;  2LRC A;  1TXX A;  2F8A A;  1T3B A;  2A2S A;  3RPP A;  1PMT A;  3FZ9 A;  5D9T A;  4G0I A;  1F6M C;  5DBQ A;  4F03 A;  5BMU A;  2TRC P;  3ZRE A;  1ERW A;  2AB6 A;  4HDE A;  3A5W A;  4A5P A;  4GQC A;  3FW2 A;  2PUK C;  1SYX A;  1ILO A;  3C73 A;  5J5N A;  4G2E A;  4F0C A;  1XWG A;  4MNN A;  4ZBD A;  2XHF A;  5ECP B;  2J23 A;  2YN1 A;  2LST A;  2NVL A;  5EPF A;  3I9V 2;  3ZLP A;  4HU9 A;  2AUV A;  4AGS A;  2ON5 A;  3QAV A;  5DVB A;  5J4U A;  2FA4 A;  4DSR A;  3O3T A;  1O7U A;  2AHE A;  2OBK A;  4OCF A;  4AF2 A;  1VF1 A;  1WP0 A;  1YJ6 A;  4K7O A;  3EWL A;  3EC3 A;  22GS A;  4F82 A;  1NW2 A;  2RLI A;  1I9D A;  4ZL9 A;  1OAZ A;  4WET A;  3ZIT A;  4ECI A;  1Z9H A;  1YKA A;  4EIQ A;  3GKX A;  2HYX A;  2DJ1 A;  2OKA A;  3FZ5 A;  5CRH A;  4EUY A;  1X5C A;  2IIY A;  2FNO A;  2H1A A;  2EIR A;  3MNG A;  5DQY A;  1XIY A;  3IAM 2;  2TRX A;  3L4N A;  3DRN A;  5ECH B;  4EO3 A;  1GP1 A;  4ZB8 A;  5F8B A;  1OVN A;  1FAA A;  5CNW A;  5GST A;  1GUM A;  3PIN A;  2IN3 A;  5KOW A;  4KX4 A;  1SKR B;  1CQG A;  1R5P A;  2HLS A;  5KEJ A;  4IS0 A;  1EEM A;  2EIO A;  4PQI A;  2JSZ A;  3IC8 A;  4EF0 A;  1WMJ A;  5DAK B;  1G0T A;  4KAE A;  14GS A;  1S3D A;  4TW5 A;  3MAK A;  4I5Q A;  2PER A;  3P8W A;  1F9M A;  3SBC A;  2H73 A;  5J3R A;  3IAS 2;  1MTC A;  3KTL A;  5AIV A;  2XPE A;  3G7J A;  2B1K A;  3GUR A;  3GYK A;  4BWQ A;  4YAV A;  1AQW A;  3CBU A;  1QMV A;  3N5O A;  4Z7X A;  1VRS D;  2E7P A;  3FEU A;  2H1D A;  2JSY A;  2X8H A;  1BJX A;  3VWW A;  1BAY A;  2YJ7 A;  1M2A A;  3FR6 A;  4FYU A;  1R26 A;  4TXV A;  3O6T A;  4L5O A;  2QKE A;  2WCI A;  5KN2 A;  4HZ4 A;  4K7I A;  4IQA A;  5G5F A;  1PRX A;  19GS A;  4MH2 A;  3KZQ A;  18GS A;  2REM A;  5A4V A;  1HNC A;  2VM1 A;  1WJK A;  1T4Z A;  1YZX A;  4NMU A;  4MF6 A;  4I8B A;  4MCU A;  11GS A;  2X49 A;  1SL1 B;  4BL7 B;  1RQM A;  3M8N A;  2LQQ A;  1ZCP A;  3H93 A;  4K7N A;  5DCG A;  4OFT A;  4EC0 A;  2H71 A;  3C7M A;  1EEJ A;  2NTO A;  1FB6 A;  4RI7 A;  3PPU A;  3HVX A;  5IOW A;  3W6G A;  4BPY A;  1THO A;  3TJB A;  5C00 A;  2YCD A;  3CTG A;  3ZYW A;  1DBY A;  4KCE A;  4HEA 2;  1TRW A;  1ON4 A;  1NM3 A;  2FGX A;  4OMV A;  1UC7 A;  3F63 A;  4HJ2 A;  2HT9 A;  3Q19 A;  3LEF A;  4V2N A;  1GUH A;  4HI7 A;  4D73 A;  2OE3 A;  2WUL A;  3GIX A;  4E8H A;  1SK2 A;  4YH2 A;  3APQ A;  2K9F A;  4GXZ A;  4CW9 A;  2MMN A;  1W89 A;  3GSS A;  3IE3 A;  4MDC A;  3RBT A;  2LUS A;  2ON7 A;  1GSU A;  3EVI A;  1TRU A;  3GST A;  3GRX A;  3WD6 A;  2WRT A;  2CZ2 A;  1Z5Y E;  2O89 A;  2QSI A;  3D21 A;  1XCC A;  1TOF A;  1T1V A;  1T7P B;  3LXT A;  2GLR A;  3HDC A;  2A2P A;  3GKN A;  1YEX A;  2MZC A;  3CSH A;  4GWR A;  1TK8 B;  16GS A;  5IM9 A;  3A3T A;  1ML6 A;  1UA5 A;  1O85 A;  2YAN A;  1ZGN A;  3HYP A;  2DJ3 A;  2JZS A;  1A0F A;  1X9S B;  1M99 A;  3FZA A;  3ERW A;  5H5Q A;  5C04 A;  1ZMA A;  2V2G A;  4TR4 A;  5B6M A;  5EL8 A;  4POM A;  3IXR A;  4OCE A;  2FWE A;  1M7T A;  2GGT A;  3RAZ A;  4G10 A;  2I81 A;  1AXD A;  4P3Y B;  4V1A p;  1F3B A;  3TKS C;  3DVW A;  3FR3 A;  3KGK A;  2B6M A;  3GKM A;  1SD8 A;  1QK8 A;  4L0W A;  1GUL A;  4ZBB A;  3D0Z A;  3PGT A;  3VLN A;  2OJL A;  1XW5 A;  3ZL5 A;  2QA2 A;  3A2X A;  2N5F A;  3F8U A;  1OKD A;  1PL2 A;  2WDU A;  4KH7 A;  2CX4 A;  4KB3 A;  3F0I A;  4LMW A;  4G0K A;  2YV9 A;  2CT6 A;  1XW9 A;  4AJ6 A;  1TW9 A;  2H1B A;  2KHP A;  4HOJ A;  1PGT A;  3CTF A;  3DWV A;  1V40 A;  1OC3 A;  1M9B A;  4N11 A;  3UL3 A;  1HQO A;  3APO A;  3TJJ A;  2DMM A;  5F05 A;  4GSS A;  4DSS A;  2V41 A;  6GSY A;  1BQ7 A;  3U6V A;  2NPB A;  3CSJ A;  3F9U A;  4NV2 A;  4XS4 A;  5IMA A;  1F3A A;  4TR0 A;  2DC5 A;  2IJY A;  5DQS A;  5H5S A;  2YOI A;  4L5L A;  3ZMK A;  3KP8 A;  2GQM A;  4K5S A;  1X5D A;  3IPZ A;  3LSZ A;  1VF2 A;  4EE0 A;  3L9U A;  5KN1 A;  5CRG A;  2VUP A;  5D93 A;  3I43 A;  10GS A;  2H76 A;  1TJD A;  3H4K A;  3H79 A;  2KLX A;  2DLX A;  2AJQ B;  3O76 A;  2L6D A;  2R3X A;  1SK1 A;  3F4R A;  5ABR A;  4MZW A;  2VCX A;  1RW1 A;  4YKG A;  2L6C A;  2K18 A;  4NPB A;  1XOB A;  8GSS A;  1M2D A;  1MDJ A;  4TOP A;  2GS3 A;  3ZTL A;  5KOX A;  3NIV A;  1A0R P;  20GS A;  2FHE A;  4IQ1 A;  4KF9 A;  4EDY A;  4EXJ A;  1K0D A;  4KSM A;  3TKQ A;  5D9V A;  4I97 A;  4MF5 A;  2RM5 A;  2DBC A;  1PN0 A;  4K5R A;  2CVD A;  4AJ7 A;  1SD9 A;  3LG6 A;  4MH3 A;  3W8S A;  2LTK A;  3BCK A;  2ALB A;  2E0Q A;  3ERG A;  2HZE B;  4TVE A;  2OAD A;  2AAW A;  4JR4 A;  4POB A;  5D96 A;  2IFQ B;  4ML1 A;  3KP9 A;  1GSS A;  2CA8 A;  1CQH A;  2UZ8 A;  1GSF A;  3HD5 A;  2HRA A;  2PVO C;  4I6X A;  2AYT A;  3US3 A;  2O8V B;  3VPQ A;  1SK0 A;  5LCZ A;  5J9B A;  3LW9 A;  1PKZ A;  1AQV A;  5CRE A;  5IO0 A;  2LKU A;  5ECI B;  4BVX B;  4XRD A;  1DUG A;  2YP6 A;  1SKS B;  1URM A;  5D9W A;  2H72 A;  3QAW A;  3A2V A;  2G2Q A;  3MSZ A;  2NDO A;  5JWQ B;  4BA7 A;  2WB9 A;  1SL2 B;  1IYI A;  1WRY A;  2LJR A;  1Z6N A;  2H6Y A;  1GUK A;  4IJI A;  4YQM A;  2B5Y A;  2B5X A;  1R5A A;  3UJ1 A;  4L8E A;  4ECJ A;  2L5O A;  2R4V A;  2DJ0 A;  5G1L A;  4IJ3 A;  1JLW A;  2ZCT A;  2C0F A;  5JWO B;  3G7I A;  4J56 E;  2L4C A;  4LL1 B;  3QR6 A;  4ZB9 A;  3G7Y A;  3ZFB A;  4Q5N A;  3FY7 A;  1AAZ A;  3EU3 A;  2IMI A;  3E9J B;  3C1R A;  3ZIV A;  4OFN A;  3GL3 A;  1GTU A;  1EWX A;  2PBJ A;  3AY8 A;  5J9C A;  3L9S A;  3HZ8 A;  1MEK A;  4PXO A;  5EVO A;  3F3Q A;  2C0G A;  3WGE A;  2A2R A;  4IVF A;  4ZIJ A;  5AGY A;  5HR3 A;  5DAL B;  4TRX A;  4MF7 A;  1KTE A;  2H01 A;  3H8Q A;  2DJK A;  3QCP A;  1TK5 B;  4XIH A;  2AV4 A;  5CRD A;  1GTB A;  1PX6 A;  4HQS A;  3K8N A;  5J41 A;  2HSH A;  3D22 A;  2R0C A;  4MK3 A;  2X99 A;  5B7C A;  4IHU A;  3UBL A;  3EU4 A;  2IMD A;  2TIR A;  2VL3 A;  2X8C A;  4DVC A;  1R4W A;  1GTA A;  2IL3 A;  2FWG A;  4OWY A;  2H70 A;  1MD3 A;  2D2Z A;  2MMA A;  3ZIJ A;  5IMZ A;  3TB2 A;  2VCV A;  4ULX A;  1K0M A;  3DIE A;  2YV7 A;  3P7X A;  4KE3 A;  2IWT A;  1XVW A;  3EE2 A;  4GQF A;  4Z2R A;  3C8E A;  3DD3 A;  1AIU A;  4X0X A;  3VI7 A;  2VL2 A;  2QA1 A;  2YJH A;  1V98 A;  5B6N A;  2K8S A;  3L0H A;  1K0O A;  1FOV A;  1WIK A;  9GSS A;  7GSS A;  2X64 A;  2GSS A;  4MJA A;  1ERV A;  2R5G A;  3LWA A;  5AN1 A;  3V1W A;  1U88 A;  3FR9 A;  2C3N A;  3KH7 A;  2PPT A;  3N9J A;  4F0B A;  4RQX A;  12GS A;  1K3L A;  1K0C A;  2YWM A;  4K2X A;  4MMM A;  3WGX A;  2WGR A;  1X9M B;  5G30 A;  2M46 A;  4MJB A;  4TXO A;  2OA7 A;  4NHW A;  2CV4 A;  2PVQ A;  1FVJ A;  4WBJ A;  1XW6 A;  5B8B A;  5GAN D;  3GV1 A;  4FYB A;  3TDG A;  5ECN B;  4ZB6 A;  1Z3E A;  2CZ3 A;  2V1M A;  5JWR B;  4I2T A;  5A4W A;  4EL1 A;  1UVZ A;  2FD3 A;  5ECK B;  2DSA A;  4O5Q A;  2CAQ A;  2F8F A;  2VO4 A;  5G1K A;  5ECQ B;  3EPT A;  4OO5 A;  2LNT A;  2FUG 2;  1TP9 A;  2VLT A;  3PH9 A;  4ACS A;  3ZRD A;  4IN0 A;  2VAF A;  4Q5R A;  1Z7P A;  1HYU A;  3M9K A;  2JAC A;  1ZYQ B;  1Z6M A;  3KM6 A;  4FQU A;  3HJP A;  1PQN A;  3KIJ A;  1O8X A;  1X0R A;  4K6X A;  1J0F A;  3GTU A;  2YZU A;  4QL7 A;  3Q18 A;  3TOU A;  2LRT A;  3QD9 A;  1B9Y C;  3GMF A;  4NWY A;  2DKH A;  1EV9 A;  4POK A;  2MBT A;  1G6Y A;  2Z9S A;  4MZB A;  3H1N A;  3GKK A;  3TRQ A;  1ZYN A;  1O8W A;  2B5E A;  2ZUP A;  3HVV A;  2HE3 A;  2ES7 A;  2VL9 A;  1T8E B;  2CQ9 A;  2P31 A;  4ZXG A;  1HNA A;  4JBB A;  3MIX A;  4MJE A;  4HZ2 A;  2E2G A;  3GH9 A;  3CSI A;  3UBK A;  3FHK A;  4MPG A;  2LS5 A;  1F2E A;  3WGD A;  4XTS A;  1PKW A;  1MDK A;  1ERT A;  3GL5 A;  2B7J A;  3I69 A;  2VLU A;  1N8J A;  2XBI A;  2KUC A;  2I9H A;  2LNS A;  2VD1 A;  2WZ9 A;  1PA3 A;  3IBH A;  5KN0 A;  4G9H A;  4ISD A;  2WFC A;  2R2J A;  2V6K A;  3APS A;  5KN3 A;  1SJ6 A;  1XBS A;  2IME A;  3ZVJ A;  5HR0 A;  1WPI A;  3D6I A;  1K0B A;  5CAX A;  2C80 A;  4K1F A;  1E6B A;  3KMO A;  4KSO A;  4RQR A;  1GSD A;  1IYH A;  1V57 A;  3QPM A;  2YPM A;  3TJK A;  4GF0 A;  3BOA A;  3TKP A;  3LOR A;  5DDL A;  1K0A A;  3VPT A;  2M80 A;  4BVY B;  1N2A A;  2EC4 A;  4ZL7 A;  2LV3 A;  5IQY A;  2PGT A;  3FMW A;  1PX7 A;  5IMF A;  4XS1 A;  2MMZ A;  3EIN A;  4PUA A;  2CAI A;  2HSY A;  1VGL A;  1A8L A;  2GZP A;  2X4A A;  2C0E A;  3HXS A;  4GLT A;  4IP1 A;  1K3Y A;  3DML A;  4OFM A;  3RDW A;  3RPN A;  4ZIL A;  2VCT A;  2FWH A;  3GHA A;  5ID2 B;  5IPG A;  4AJ8 A;  6GSV A;  1F37 A;  3S9F A;  2JZR A;  1GSY A;  5GAP D;  1GTI A;  4PQH A;  3TKS E;  3QMX A;  3LGC A;  1A24 A;  1AUC A;  3VI5 A;  3BBY A;  3GX8 A;  4X1U A;  2VCW A;  5L71 A;  2CX3 A;  5HR2 A;  2XBQ A;  2H0H A;  2H0I A;  1KNG A;  1ZL9 A;  3WYW A;  2I3Y A;  1VF4 A;  4J57 E;  5DAK A;  3IRA A;  1U3A A;  4EKZ A;  3CRT A;  5IO2 A;  5HQP A;  1B4P A;  1X5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...