4WF4A

Crystal structure of e.coli dsba co-crystallised in complex with compound 4
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
188
structure length
188
Chain Sequence
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Thiol:disulfide interchange protein
publication title Application of Fragment-Based Screening to the Design of Inhibitors of Escherichia coli DsbA.
pubmed doi rcsb
total genus 63
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature ec 1.8.4.2: Protein-disulfide reductase (glutathione).
pdb deposition date 2014-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4wf4A00
2A2RA 1K3OA 3PINA 3C71A 3VURA 5ENUA 2VL2A 7GSSA 2IJYA 5DCHA 3GH9A 4ZBDA 5ABRA 2OA7A 4OO5A 3APOA 3K8NA 5ECSA 4MF7A 4POBA 4LMWA 5DAKA 3LORA 3L9SA 3NIVA 4ECJA 1OC9A 4ID0A 1AQXA 2H6XA 3M9JA 2H0HA 4KDYA 1I5GA 5J4UA 4F9ZA 1F9MA 1GNEA 3DWVA 2R37A 1ZL9A 4MA9A 2H8LA 3TKSA 2JACA 1NW2A 3LYKA 1K3LA 1HD2A 2CVBA 4K8MA 3RAZA 3R2QA 1PX7A 3CSIA 2YZHA 5IOWA 1PKWA 4TR0A 3D5JA 1FB6A 1XBSA 2R3XA 1DSBA 1G7OA 4Z7XA 2V41A 1UC7A 2VCVA 2WGRA 3NOFA 1B9YC 3NZNA 4EC0A 2TIRA 2X64A 2GZZA 1EZKA 5CYYA 1GRXA 4RUVA 4FYUA 22GSA 5ELAA 2FD3A 4CHSA 2VUPA 2HSHA 3UEMA 2C0DA 2PBJA 1XVWA 2VM1A 4F82A 4KB3A 1FW1A 1GTAA 2H70A 4ECBA 1TU8A 1ERUA 1VF3A 5CO3A 1U3AA 2H1GA 3Q74A 1SKSB 1QFNA 4MK3A 4WF5A 3FHKA 4DSSA 5G2ZA 3VWUA 1TW9A 5HR0A 2IFQA 2XBQA 20GSA 4KNDA 2B7KA 2KOKA 5HQPA 4MF6A 5DALA 2HXKA 1K0CA 1UA5A 4D73B 5F07A 3RBTA 1CQGA 2BMXA 2HT9A 4XS6A 2JZRA 3IC4A 1SK2A 4HJMA 5CP1A 2RIIA 1F6MC 4K1FA 2DMLA 4N11A 1NHOA 2OBIA 4ECIA 3KP9A 4AJ6A 4K9ZA 1XPVA 4KSOA 4KW6A 4H86A 4N0ZA 1GWCA 2YWMA 3ZL5A 3TKQA 4BWQA 2YOIA 2M72A 3C73A 18GSA 2LJKA 5IMFA 1HNAA 2H1DA 2LQQA 4HZ2A 1TP9A 2LEGA 3WGDA 3TJJA 1GUMA 2YANA 5KN0A 1YF0A 2CVDA 2P31A 5G30A 2OE1A 3TJBA 1TU7A 2BTOT 5DDLA 5AISA 1O81A 5H5SA 1C72A 4KE3A 1AQWA 3G7YA 2I9HA 2B5EA 19GSA 3C7MA 3L78A 1UVZA 3EINA 3M8NA 2B5YA 5A4VA 2QKEA 3CMIA 4PURA 2OADA 4F0CA 2KP2A 3TJGA 3D0ZA 3IXRA 2WS2A 2HZEB 4X1UA 5KN3A 1G0TA 3P8WA 2TRCP 2IL3A 2H30A 5DBQA 3CBUA 4OFNA 2YN1A 3FR9A 3N5OA 2IWTA 2LJRA 5HFIA 1X0RA 3HJPA 2HLSA 3TRPA 3TKPA 3CRTA 5ECNB 3GX0A 4L8EA 3GIXA 4NAXA 4ML1A 1YY7A 4F0BA 3IR4A 3FZ9A 2FHEA 4RI7A 2MBSA 2K8VA 1GLPA 1XW9A 1SJZA 4QQ7A 5KEJA 4MJAA 5CREA 4KUNA 4AJ8A 3VWXA 2IMKA 1OE7A 1EV4A 2ON7A 3CYNA 1EGOA 1GSEA 1YDKA 4I97A 4XCSA 3GRXA 1TJDA 4ZIJA 5JWOB 3IAM2 4IJ3A 4WETA 1G6YA 4NV5A 1G6WA 3FRCA 2K9FA 1GUHA 2JZSA 2IPAA 1Z6MA 3LGCA 4I8BA 2GZYA 5J9CA 5G1KA 5AIVA 3GA4A 4K0NA 2KUCA 2PERA 4EDYA 2VCQA 1ERVA 1TRSA 1O8WA 3KIJA 2H6YA 3DD3A 3QAWA 1JZWA 1M99A 4L5OA 1FG4A 1XOAA 3IPZA 1F2EA 2DLXA 1VF1A 1SL1B 1MDIA 3HY2A 4KSMA 2QGVA 3S9FA 3VI5A 4Q5NA 2LRTA 1FB0A 4OFTA 5CNWA 3ZIVA 1IYHA 5G5EA 4NHWA 2IMIA 2IMFA 5JCWA 4HS1A 4IN0A 3F9UA 2JL4A 4E8EA 1WIKA 3TKSE 2GGTA 3ZLPA 1SK1A 4GCIA 2LRNA 4E8HA 4XS1A 4WBRD 1HNCA 1TRWA 1BEDA 1R5AA 3J7Yb 1OE8A 1SJIA 5GSSA 2WULA 1QMVA 3F4SA 2AAWA 3F63A 2MMNA 4TKYA 2DJ0A 1AIUA 2OBKA 4O5RA 5A4WA 4KCEA 3TRXA 1QQ2A 1DE2A 4RI6A 4MCUA 1M2DA 4J56E 2L6DA 4ZB6A 1V58A 2L5OA 3GKMA 5FHIA 1J08A 2EIRA 4NV2A 3QDNA 2VL3A 3IOSA 2V2GA 3GFKA 5G1LA 1PX6A 1WP0A 3VWWA 4YH2A 1SYRA 2H01A 1ERWA 1ZYEA 4ISDA 1LU4A 2IN3A 2X8GA 2YWNA 1AAZA 4N0VA 3IDVA 14GSA 2YNXA 1NM3A 4PUFC 1PQNA 3LQ7A 4L0WA 1AQVA 1VF2A 2FWFA 1YEPA 1Q98A 5ID2B 3PGTA 1QUWA 2FWEA 8GSSA 1GSYA 2VLVA 3M9KA 3F3QA 2AJQB 2NPBA 3H79A 2ZNMA 2V32A 3ED3A 3L9VA 1E6BA 1Q4JA 2ON5A 2EC4A 3O6TA 2RUEA 1MDJA 5B8AA 1WWJA 5IMCA 3FK8A 1GH2A 2L59A 4IP6A 4K6XA 3WGEA 4WKWA 2DIZA 3DIEA 3GN3A 1J9BA 2VCWA 4PQHA 2NTOA 3WGXA 3GKNA 1B4QA 1EGRA 3GYKA 4GXZA 4TRXA 4GSNA 2F8AA 4GSSA 1M7TA 1WPIA 3D6IA 4ZL9A 2WZ9A 3ZIJA 1TTZA 3UARA 4XS4B 1M9BA 3GSSA 4KAEA 4TXOA 1PD21 4TW5A 4YQVA 4K2DA 3UMAA 1YKCA 2J23A 1PN9A 1KTEA 3IV4A 3EYTA 1BAYA 6GSYA 3QOUA 2H66A 4POLA 3QFBC 1H4OA 3UOMA 1GUKA 4K0GA 1QXHA 1XWBA 4DEJA 5D8IA 3I43A 1G7EA 3KM6A 1EP8A 1YZXA 4AJ7A 1PGTA 5C00A 1A2MA 4JU5A 2E7PA 6GSXA 4IHUA 1LJRA 5IM9A 2C3QA 4L5LA 1FVJA 2WDUA 3DMLA 1SJ6A 1O73A 5LNKe 13GSA 4I2TA 1F37A 4OO4A 2MMZA 3QCPA 5IMZA 1XW6A 4TR4A 2HZFA 5ECIB 1FHEA 5G5FA 4POKA 3WYWA 4HI7A 3LG6A 1NHYA 2VO4A 1MD4A 5ECLB 3KTBA 3GURA 5JWRB 2WJUA 1AW9A 3ZMKA 1JZOA 1R26A 4GSTA 2DSAA 4GTUA 3TOTA 4ZXGA 4NXIA 5ECHB 1XVQA 1ILOA 1FOVA 5ID2A 1BYEA 1O8XA 3GH6A 1HYUA 2LS5A 5F06A 4KA0A 4HZ4A 1YEXA 3GSTA 4JRRA 3LJRA 2HE3A 3EMPA 5IMDA 4JR4A 5A4UA 1EWXA 2FA4A 11GSA 5IMAA 2RUFA 2P5QA 5ECPB 2YZUA 2X8HA 5IO0A 2EIOA 5ECKB 1A0FA 4NHZA 2JSZA 1TRVA 2CVKA 3TOUA 4HJ2A 5EY6A 3A5WA 2P0GA 2GLRA 3BCKA 2LSTA 1EV9A 3UBLA 2C8UA 3GUSA 1SD9A 1XZOA 5IQYA 1U6TA 2JZTA 1TOFA 1KNGA 3A2WA 2FWHA 2GS3A 3HDCA 1USBA 3IHQA 5JWQB 4ML6A 1A2JA 3GL3A 2H72A 2OJLA 4PGTA 4AF2A 1SL0B 4XS4A 2V1MA 2PVOC 1Y6EA 5D9VA 2X99A 3ERWA 3SWLA 2CT6A 5D96A 4Q5QA 4CW9A 1XWCA 2LTKA 4HUAA 4YAVA 4V2LA 1XXUA 3APSA 1U88A 5D9TA 16GSA 4DSQA 3HVXA 1SK0A 3EC3A 1R5PA 1SENA 3HZ8A 2LNSA 4POMA 3TB2A 3VPTA 1OVNA 3IRAA 2I81A 1PRXA 4PX1A 3U6VA 1Y25A 1M2BA 3RHBA 3H1NA 2FGXA 2AUVA 1THXA 5KN2A 2H75A 4I5QA 3TDGA 3KMOA 3HVSA 2C0FA 4IP1A 3BOAA 1AXDA 5GAPD 2XPEA 1S3CA 4MF5A 2F51A 3ZRDA 2F8FA 1OKTA 5AGYA 4OMVA 3GV1A 5L71A 3PR8A 3KZQA 1THOA 3TRQA 3GKKA 3V1WA 2AYTA 5DQYA 1Z7RA 2AHEA 3UIWA 4EF0A 4V2NA 2M80A 4ZBBA 3FZAA 2B6MA 1GLQA 2CQ9A 1OYJA 4OFMA 1HQOA 5C04A 3P90A 3ZVJD 2VL2C 5A5KA 2HSYA 4KDUA 2K8SA 5JCGA 4ACSA 1XWGA 4WR5A 3L0HA 4LL1B 3ZZXA 1WE0A 2HYXA 2KHPA 4XIHA 1T8EB 1X9MB 2HI7A 2VIMA 9GSSA 5B7CA 5IIZA 1XFLA 4EL1A 2GT6A 2XBIA 1XWKA 6GSSA 2VLTA 4WBJA 3IAS2 3W8JA 4DVCA 1OC8A 3LYPA 4KGIA 3GX8A 3VI7A 4JR6A 3MSZA 3TKSC 2K18A 4V1Ap 4WXTA 2C0EA 2G0FA 2PMTA 1GULA 2VCXA 1T3BA 1EEMA 3ZTLA 1ZOFA 3FKFA 5EPFA 1JZDA 2H73A 4FYBA 1AUCA 4NMUA 5ECRB 2CAIA 1GSUA 1A8LA 3ERFA 5IPHA 2O7KA 5G31A 3P2AA 4D73A 2R5GA 4FIWA 3M1GA 3GNJA 4LMVA 2F9SA 1YKAA 3EMXA 1JZRA 1K0MA 4X43A 2DJKA 1DUGA 2NBSA 2RLIA 1VRSD 2MZCA 3VLNA 2I3YA 4GQCA 1RK4A 4GRFA 3RPNA 3EU3A 1LBKA 2C80A 2FNOA 2XC2A 2XHFA 3F3RA 4V1Ag 3IK9A 2WRTA 2I1UA 1V2AA 1ZGNA 1X5EA 4G2EA 4AGSA 4QL7A 2L4QA 2IMDA 3J7Yk 5IMVA 1Z7PA 5HFKA 1T4YA 3HYPA 3IA1A 4NWYA 3FY7A 1MDKA 3G7IA 2B1KA 5ELGA 1SD8A 4MABA 1GTBA 2FWGA 2HNLA 3OR5A 4YQMA 2OE0A 3O3TA 1V9WA 3QAVA 2GSTA 4O32A 2YJHA 2DBCA 2PWJA 1TK0B 1B9XC 3F4TA 3FW2A 3DGQA 4BWSA 3WT2A 2JSYA 2HZEA 2V6OA 4K7NA 1VGLA 5EL8A 2CA8A 1SKWB 2VLUA 1M2AA 1W89A 1TI1A 1F3BA 3FEUA 1YF1A 2H19A 2A2SA 3ME7A 3FZ4A 1E2YA 3I69A 3IE3A 2H6ZA 1TK8B 1EOHA 4XTSA 3BBYA 3VK9A 1B8XA 5HR2A 5JCUA 4GLTA 4MJBA 1GSFA 3CRUA 2FUG2 1ML6A 5DAKB 4G9HA 2B3SA 1Z5YE 3TJFA 4MH2A 3H4KA 1OC9B 3GMFA 2PPTA 3M3MA 3FR3A 1A2LA 3ERGA 4IS0A 3AY8A 2DIYA 3ZYWA 2R2JA 4BL7A 2L6CA 2AB6A 5LCZA 1O6JA 2LJAA 1BX9A 2WCIA 4F2IA 3CTFA 1W4VA 2RM6A 1J0FA 4EE0A 4HDEA 1FVKA 3WT1A 2R4VA 3UVHA 1PA3A 2TRXA 3UAPA 4X0XA 3DEXA 2C0GA 3PH9A 1K3YA 3Q6OA 1ZZYA 3KCMA 4I6XA 2ZUPA 1CQHA 2H1BA 2QC7A 4MPFA 3MNGA 5IOXA 5B8BA 5E4WA 1A24A 1TI3A 3CSJA 4JE1A 2E2MA 2CAQA 1QGVA 3LWAA 3A2VA 4ECCA 1X5CA 1ERTA 4LL4B 4OD7A 2VL9A 2GDRA 4RQRA 1ST9A 1K0OA 3A3TA 3UBKA 4PQ1A 4DSSB 2PN8A 3BCIA 3LXTA 2RM5A 2GQKA 2IFQB 1TKDB 4OWYA 4NPBA 1WMJA 4KDXA 5DALB 2O8VB 2CX3A 2J9HA 4IQAA 3GKXA 1WJKA 1ABAA 3Q19A 3ZFBA 3TUEA 3QR6A 2B7JA 4TN8A 1GSSA 3I6AA 1SU9A 1OKDA 1BJXA 5H5RA 1Z9HA 2QSIA 2YJ7A 4PNGA 5B6MA 4ULXA 4HU9A 2E0QA 3GTUB 1O7UA 4GWRA 3BJ5A 2B1LA 2GSRA 4L0UA 4BVXA 2OKAA 4IW9A 5E59A 5J3RA 3TJKA 4XHMA 5CRDA 4TR1B 1XOBA 3U5RE 1GSDA 3E9JB 4KH7A 5D93A 3DVWA 2DJ2A 2Z9SA 4JBBA 1R4WA 1BQ7A 1SYXA 2FLSA 3VPQA 3M0FA 4PUAA 1EP7A 2HRFA 3EU4A 2LUSA 4ZILA 2IIYA 4ZBAA 2G2QA 4MMMA 3DVXA 10GSA 3DYRA 3F8UA 3HA9A 1YJ6A 5FT3A 1MEKA 3VWVA 5COHA 1S3DA 4LLRA 5ECMB 3KD0A 4JEDA 4FO5A 4MH3A 1GSQA 3G7JA 1R7HA 2VM2A 4WR4A 4ILFA 4BA7A 5CRHA 1N2AA 3QPMA 4I2UA 4K7OA 2I4AA 2WB9A 2GVPA 2PGTA 4QL9A 4IGJA 4TOPA 1SL2B 1NSWA 1AC1A 2GT5A 2V6KA 3QD9A 1TK5B 1RW1A 1Z6NA 1U87A 1GTUA 4YQUA 3GHAA 2DJJA 2DJ1A 4MP4A 1V98A 2H0IA 1VF4A 5DQSA 5AIXA 1T4ZA 4EO3A 3ZVJA 2C4JA 4ZB8A 4G19A 5GZZB 2X8CA 3CTGA 2N5AA 1ZCPA 2K6VA 5F8BA 3F6FA 2HFDA 3FZ5A 4G10A 1PKZA 5H5QA 4Q5RA 2PU9C 2MMOA 1EOGA 2P5RA 4ZL7A 3EE2A 5LD0A 4ZL8A 4MJCA 3F4RA 4OCFA 2O87A 5IO2A 1N8JA 3HZ4A 2IMEA 4MZBA 1GNWA 2CZ2A 1FO5A 1XWAA 3GTUA 5HR1A 6GSTA 2GZPA 2CV4A 2EIQA 4DSRA 3MAKA 2PVQA 3HD5A 3HKRA 4PQIA 3F0IA 4MJEA 4TR1A 5DJLA 4GQFA 1KEBA 4P3YB 2H0GA 3SBCA 1JLVA 1XIYA 4MZCA 4KX4A 2LRCA 1T7PB 1U3IA 2FA8A 2JADA 2VCTA 1T1VA 2H71A 3RPPA 1OAZA 1A8YA 1DBYA 4WF4A 4J2FA 2NVLA 1K0BA 1O85A 2ES7A 4K7IA 2DMMA 4MZWA 3GL5A 2YWIA 3EWLA 1V40A 2C3TA 2F3MA 4TR3A 3HXSA 5HFGA 2L4CA 2VOCA 1BG5A 4IJIA 5DJMA 3P7XA 2C1YA 3MDKA 4IKHA 5J9BA 1K0NA 5DVBA 4OCEA 3TCOA 5GAND 5ECOB 2NDOA 2CZ3A 3RHCA 3O76A 4HQZA 3JCML 5D9WA 1K0DA 4KCAA 5F0GA 3HHVA 3UL3A 3CXGA 1UN2A 2HRNA 3UVTA 1JHBA 1RQMA 5GSTA 2LNTA 2OACA 5DCGA 1I9DA 1ZMAA 1JLWA 2OE3A 2N5FA 4EDZA 3I9V2 3HJMA 1TXXA 1PL2A 4F03A 3ME8A 1WRYA 6GSVA 4PXOA 1PL1A 1MTCA 2MMAA 2YWOA 1GP1A 1YQ1A 3LFLA 4MLYA 3APQA 2FY6A 4FYCA 2B5XA 4PNFA 3EURA 3ZITA 1S3AA 5J41A 3DRNA 2LKUA 1EEJA 1QK8A 1A23A 2MYGA 3N9JA 3L4NA 4JZQA 4XRDA 2DJ3A 2D2ZA 3EVIA 3E3EA 3L9UA 2H1AA 4RQXA 3KEBA 3H93A 3BD2A 2AV4A 3W8SA 4TXVA 6GSWA 1IYIA 3HCZA 2VCZA 3KJYA 4TXOB 3ZREA 1M0UA 1OC3A 3US3A 3LSZA 5HR3A 2L5LA 3Q18A 4ZB9A 1B48A 4LA1A 1B4PA 1X9SB 2YPMA 1TDIA 2A4VA 5FWGA 1WOUA 4MDCA 1URMA 3UJ1A 2E2GA 4WEYA 17GSA 3DXBA 3E0UA 3HJOA 3KH9A 5CRGA 1SKRB 2PUKC 2VAFA 1F3AA 2YV9A 3C1SA 2GTUA 4O92A 1XW5A 2O85A 4GF0A 2KP1A 3D4TA 3ISOA 4EKZA 4EUYA 5INYA 1X5DA 1PSQA 1TRUA 2VD1A 5KN1A 4CDOA 2LV3A 3IBHA 2YP6A 1H75A 2FCHA 4IBPA 1X9WB 4EXJA 4HQSA 3H8QA 4YAPA 3RDWA 1GTIA 5EVOA 4EVMA 2WFCA 5D73A 2XPDA 2LQOA 1V57A 2BJXA 2ZCTA 3FYGA 2C3NA 4IELA 2R6KA 4FH8A 12GSA 1HNBA 3LEFA 5B6NA 2H76A 1A0RP 1ON4A 4TVEA 4BVYA 3TKRA 4XRAA 2KLXA 1ZYQB 3ZFLA 3KP8A 5D9XA 3LXZA 3W6GA 4IQ1A 2DC5A 1T00A 3G9BA 5F05A 4V2MA 2H74A 1ACVA 2VD0A 3CSHA 1GL8A 3F6DA 1XCCA 4MPGA 1K0AA 1FAAA 3KXOA 4HEA2 3KGKA 3DKSA 4N10A 2MBTA 3D21A 2YV7A 4HOJA 5ECQB 2M46A 3KTLA 4Q5FA 6GSUA 3VFIA 3KMNA 5AN1A 1JFUA 2JU5A 5IPGA 3FR6A 5J5NA 5CRWA 4BPYA 3C8EA 3QFAC 3QAGA 2GSQA 3C1RA 2O89A 3WD6A 4J57E 3D22A 3A2XA 1DE1A 4IVFA 2N5BA 2GQMA 3IK7A 1M9AA 1KBNA 1Z3EA 2REMA 1PMTA 3ZMLA 1MD3A 3HVVA 5CAXA 4HU7A 2CX4A 4N30A 3TGZA 3QMXA 2YCDA 2ALBA 2GSSA 2GQLA 3KH7A 3D4MA 3MWHA 2L57A 4O7HA
chains in the Genus database with same CATH superfamily
2A2RA 1K3OA 3PINA 3C71A 3VURA 5ENUA 2VL2A 7GSSA 2IJYA 1ZYPA 5DCHA 3GH9A 4ZBDA 5ABRA 2OA7A 4OO5A 3APOA 3K8NA 5ECSA 4MF7A 4POBA 4LMWA 5DAKA 3LORA 3L9SA 3NIVA 4ECJA 1OC9A 4ID0A 1AQXA 2H6XA 3M9JA 2H0HA 4KDYA 1I5GA 5J4UA 4F9ZA 1F9MA 1GNEA 3DWVA 2R37A 1ZL9A 4MA9A 2H8LA 3TKSA 2JACA 1NW2A 3LYKA 1K3LA 1HD2A 2CVBA 4K8MA 3RAZA 3R2QA 1PX7A 3CSIA 2YZHA 5IOWA 1PKWA 4TR0A 3D5JA 1FB6A 1XBSA 2R3XA 1DSBA 1G7OA 4Z7XA 2V41A 1UC7A 2VCVA 2WGRA 3NOFA 1B9YC 3NZNA 4EC0A 2TIRA 2UZ8A 2X64A 2GZZA 1EZKA 5CYYA 1GRXA 4RUVA 4FYUA 22GSA 5ELAA 2FD3A 4CHSA 2VUPA 2HSHA 4O5QA 3UEMA 2C0DA 2PBJA 1XVWA 2VM1A 4F82A 4KB3A 1FW1A 1PN0A 1GTAA 2H70A 4ECBA 1TU8A 1ERUA 1VF3A 5CO3A 1U3AA 2H1GA 3Q74A 1SKSB 1QFNA 4MK3A 4WF5A 3FHKA 4DSSA 5G2ZA 3VWUA 1TW9A 5HR0A 4BIKA 2IFQA 2XBQA 20GSA 4KNDA 2B7KA 2KOKA 5HQPA 4MF6A 5DALA 2HXKA 1K0CA 1UA5A 4D73B 5F07A 3RBTA 1CQGA 2BMXA 2HT9A 4XS6A 2JZRA 3IC4A 1SK2A 4HJMA 5CP1A 2RIIA 1F6MC 4K1FA 2DMLA 4N11A 1NHOA 2DKHA 2OBIA 4ECIA 3KP9A 4AJ6A 4K9ZA 1XPVA 4KSOA 4KW6A 4H86A 4N0ZA 1GWCA 2YWMA 3ZL5A 3TKQA 4BWQA 2YOIA 2M72A 3C73A 18GSA 2LJKA 5IMFA 1HNAA 2H1DA 2LQQA 4HZ2A 1TP9A 2LEGA 3WGDA 3TJJA 1GUMA 2YANA 5KN0A 1YF0A 2CVDA 2P31A 5G30A 2OE1A 3TJBA 1TU7A 2BTOT 5DDLA 5AISA 1O81A 5H5SA 1C72A 4KE3A 1AQWA 3G7YA 2I9HA 2B5EA 19GSA 3C7MA 3L78A 1UVZA 3EINA 3M8NA 2B5YA 5KOXA 5A4VA 2QKEA 3CMIA 4PTSA 4PURA 2OADA 4F0CA 2KP2A 3TJGA 3D0ZA 3IXRA 2WS2A 1M3JA 2HZEB 4X1UA 5KN3A 1S3RA 1G0TA 3P8WA 2TRCP 2IL3A 2H30A 5DBQA 3CBUA 4OFNA 2YN1A 3FR9A 3N5OA 2IWTA 2LJRA 5HFIA 1X0RA 3HJPA 2HLSA 3TRPA 3TKPA 3CRTA 5ECNB 3GX0A 4L8EA 3GIXA 4NAXA 4ML1A 1YY7A 4F0BA 3IR4A 3FZ9A 2FHEA 4RI7A 2MBSA 2K8VA 1GLPA 1XW9A 1SJZA 4QQ7A 5KEJA 4MJAA 5CREA 4KUNA 4AJ8A 3VWXA 2IMKA 1OE7A 1EV4A 2ON7A 3CYNA 1EGOA 1GSEA 1YDKA 4EIPA 4I97A 4XCSA 3GRXA 1TJDA 4ZIJA 5JWOB 3IAM2 4IJ3A 4WETA 1G6YA 4NV5A 1G6WA 3FRCA 2K9FA 1GUHA 2JZSA 2IPAA 1Z6MA 3LGCA 4EIQA 4I8BA 2GZYA 5J9CA 5G1KA 5AIVA 3GA4A 4K0NA 2KUCA 2PERA 4EDYA 2VCQA 1ERVA 1TRSA 1O8WA 3KIJA 2H6YA 3DD3A 3QAWA 1JZWA 1M99A 4L5OA 1FG4A 1XOAA 3IPZA 1F2EA 2DLXA 1VF1A 1SL1B 1MDIA 3HY2A 4KSMA 2QGVA 3S9FA 3VI5A 4Q5NA 2LRTA 1FB0A 4OFTA 5CNWA 3ZIVA 1IYHA 5G5EA 4NHWA 2IMIA 2IMFA 5JCWA 4HS1A 4IN0A 3F9UA 2JL4A 4E8EA 1WIKA 3TKSE 2GGTA 3ZLPA 1SK1A 4GCIA 2LRNA 4E8HA 4XS1A 4WBRD 1HNCA 1TRWA 1BEDA 1R5AA 3IHGA 3J7Yb 1OE8A 1SJIA 5GSSA 3A5IA 2WULA 1QMVA 3F4SA 2AAWA 3F63A 2MMNA 4TKYA 2DJ0A 1AIUA 2OBKA 4O5RA 5A4WA 4KCEA 3TRXA 1QQ2A 1DE2A 4RI6A 4MCUA 1M2DA 4J56E 2L6DA 4ZB6A 1V58A 2L5OA 3GKMA 5FHIA 1J08A 2EIRA 4NV2A 3QDNA 2VL3A 3IOSA 2V2GA 3GFKA 5G1LA 1PX6A 1WP0A 3VWWA 4YH2A 1SYRA 2H01A 1ERWA 1ZYEA 4ISDA 4BVXB 2DKIA 1LU4A 2IN3A 2X8GA 2YWNA 1AAZA 4N0VA 3IDVA 14GSA 2YNXA 1NM3A 4PUFC 1PQNA 3LQ7A 4L0WA 1AQVA 1VF2A 2FWFA 1YEPA 1Q98A 5ID2B 3PGTA 1QUWA 2FWEA 8GSSA 1GSYA 4G0KA 2VLVA 3M9KA 3F3QA 2AJQB 2NPBA 3H79A 2ZNMA 2V32A 3ED3A 3L9VA 1E6BA 1Q4JA 2ON5A 1XG8A 4K2XA 2EC4A 3O6TA 2A4HA 2RUEA 1MDJA 5B8AA 5BMUA 1WWJA 5IMCA 3FK8A 1GH2A 2L59A 4IP6A 4K6XA 3WGEA 4WKWA 2DIZA 3DIEA 3GN3A 1J9BA 2VCWA 4PQHA 2NTOA 3WGXA 3GKNA 1B4QA 1EGRA 3GYKA 4GXZA 4TRXA 4GSNA 2F8AA 4GSSA 1M7TA 1WPIA 3D6IA 4ZL9A 2WZ9A 3ZIJA 1TTZA 3UARA 4XS4B 1M9BA 3GSSA 4KAEA 4TXOA 1PD21 4TW5A 4YQVA 4K2DA 3UMAA 1YKCA 2J23A 2QA1A 1PN9A 4ICYA 1KTEA 3IV4A 3EYTA 1BAYA 6GSYA 3QOUA 2H66A 4POLA 3QFBC 1H4OA 3UOMA 1GUKA 4K0GA 1QXHA 1XWBA 4DEJA 5D8IA 3I43A 1G7EA 3KM6A 1EP8A 1YZXA 4AJ7A 1PGTA 5C00A 1A2MA 4JU5A 2E7PA 6GSXA 4IHUA 1LJRA 5IM9A 2C3QA 4L5LA 1FVJA 2WDUA 3DMLA 1SJ6A 1O73A 5LNKe 13GSA 4I2TA 1F37A 4OO4A 2MMZA 3QCPA 5IMZA 1XW6A 4TR4A 2HZFA 5ECIB 1FHEA 3IC8A 5G5FA 4POKA 3WYWA 4HI7A 3LG6A 1NHYA 2VO4A 1MD4A 5ECLB 3KTBA 3GURA 5JWRB 2WJUA 1AW9A 3ZMKA 1JZOA 1R26A 4GSTA 2DSAA 4GTUA 3TOTA 4ZXGA 4NXIA 5ECHB 1XVQA 1ILOA 1FOVA 5ID2A 1BYEA 1O8XA 3GH6A 1HYUA 2LS5A 5F06A 4KA0A 4HZ4A 1YEXA 3GSTA 4JRRA 3LJRA 2HE3A 3EMPA 5IMDA 4JR4A 5A4UA 1EWXA 2FA4A 11GSA 5IMAA 2RUFA 2P5QA 5ECPB 2YZUA 2X8HA 5IO0A 2EIOA 4NHZA 1A0FA 5ECKB 2JSZA 1TRVA 2CVKA 3TOUA 4HJ2A 5EY6A 3A5WA 2P0GA 2GLRA 3BCKA 2LSTA 1EV9A 3UBLA 2C8UA 3GUSA 1SD9A 1XZOA 5IQYA 1U6TA 2JZTA 1TOFA 1KNGA 3A2WA 2FWHA 2GS3A 3HDCA 1USBA 3IHQA 5JWQB 4ML6A 1A2JA 3GL3A 2H72A 2OJLA 4PGTA 4AF2A 1SL0B 4XS4A 2V1MA 2PVOC 1Y6EA 5D9VA 2X99A 3ERWA 3SWLA 2CT6A 5D96A 4Q5QA 4CW9A 1XWCA 2LTKA 4HUAA 4YAVA 4MNNA 4V2LA 1XXUA 3APSA 1U88A 5D9TA 16GSA 4DSQA 3HVXA 1SK0A 3EC3A 1R5PA 1SENA 3HZ8A 2LNSA 4POMA 3TB2A 3VPTA 1OVNA 3IRAA 2I81A 1PRXA 4PX1A 3U6VA 1Y25A 1M2BA 3RHBA 3H1NA 2FGXA 2AUVA 1THXA 5KN2A 2H75A 4I5QA 3MYDA 3TDGA 3KMOA 3HVSA 2X49A 2C0FA 4IP1A 3BOAA 1AXDA 5GAPD 2XPEA 1S3CA 4MF5A 2F51A 3ZRDA 2F8FA 1OKTA 5AGYA 4OMVA 3GV1A 5L71A 3PR8A 3KZQA 1THOA 3TRQA 3GKKA 2X4AA 3V1WA 2AYTA 5DQYA 1Z7RA 2AHEA 3UIWA 4EF0A 4V2NA 2M80A 4ZBBA 3FZAA 2B6MA 1GLQA 2CQ9A 1OYJA 4OFMA 1HQOA 5C04A 3P90A 3ZVJD 2VL2C 5A5KA 2HSYA 4KDUA 2K8SA 5JCGA 4ACSA 1XWGA 4WR5A 3L0HA 4LL1B 3ZZXA 1WE0A 2HYXA 2KHPA 4XIHA 1T8EB 1X9MB 2HI7A 2VIMA 9GSSA 5B7CA 5IIZA 1XFLA 4EL1A 4Z2TA 2GT6A 2XBIA 1XWKA 6GSSA 5BRTA 2VLTA 4WBJA 3IAS2 3W8JA 4DVCA 1OC8A 3LYPA 4KGIA 3GX8A 3VI7A 4JR6A 5KOWA 3MSZA 3TKSC 2K18A 4V1Ap 4WXTA 2C0EA 2G0FA 3FMWA 2PMTA 1GULA 2VCXA 1T3BA 1EEMA 3ZTLA 1ZOFA 3FKFA 5EPFA 1JZDA 2H73A 4BVYB 4FYBA 4BL7B 1AUCA 4NMUA 5ECRB 2CAIA 1GSUA 1A8LA 3ERFA 5IPHA 2O7KA 5G31A 3P2AA 4D73A 2R5GA 4FIWA 3M1GA 3GNJA 4LMVA 2F9SA 1YKAA 3EMXA 1JZRA 1K0MA 4X43A 4X4JA 2DJKA 1DUGA 2NBSA 2RLIA 1VRSD 4K5RA 2MZCA 3VLNA 2I3YA 4GQCA 1RK4A 4GRFA 3RPNA 3EU3A 1LBKA 2C80A 2FNOA 2XC2A 2XHFA 3F3RA 4V1Ag 3IK9A 2WRTA 2I1UA 4G0LA 1V2AA 1ZGNA 1X5EA 4G2EA 4AGSA 4QL7A 2L4QA 2IMDA 3J7Yk 5IMVA 1Z7PA 5HFKA 1T4YA 3HYPA 3IA1A 4NWYA 4Z2UA 3FY7A 1MDKA 3G7IA 2B1KA 5ELGA 1SD8A 4MABA 1GTBA 2FWGA 2HNLA 3OR5A 4YQMA 2OE0A 3O3TA 1V9WA 3QAVA 2GSTA 4O32A 2YJHA 2DBCA 2PWJA 1TK0B 1B9XC 3F4TA 3FW2A 3DGQA 4BWSA 3WT2A 3HVNA 2JSYA 2HZEA 2V6OA 4K7NA 1VGLA 5EL8A 2CA8A 1SKWB 2VLUA 1M2AA 1W89A 1TI1A 1F3BA 3FEUA 1YF1A 2H19A 2A2SA 3ME7A 3FZ4A 1E2YA 3I69A 3IE3A 2H6ZA 1TK8B 1EOHA 2A2PA 4XTSA 3BBYA 3VK9A 4CY8A 1B8XA 5HR2A 5JCUA 4GLTA 4MJBA 1GSFA 3CRUA 2FUG2 1ML6A 5DAKB 4G9HA 2B3SA 1Z5YE 3TJFA 4MH2A 3H4KA 1OC9B 3GMFA 2PPTA 3M3MA 3FR3A 1A2LA 3ERGA 4IS0A 3AY8A 2DIYA 3ZYWA 2R2JA 4BL7A 2L6CA 3EPTA 2AB6A 5LCZA 1O6JA 2LJAA 1BX9A 2WCIA 4F2IA 3CTFA 1W4VA 2RM6A 1J0FA 4G0IA 4EE0A 4HDEA 1FVKA 3WT1A 2R4VA 2R0PA 3UVHA 1PA3A 2TRXA 3UAPA 4X0XA 3DEXA 2C0GA 3PH9A 1FOHA 1K3YA 3Q6OA 1ZZYA 3KCMA 4I6XA 2ZUPA 1CQHA 2H1BA 2QC7A 4MPFA 3MNGA 5IOXA 5B8BA 5E4WA 1A24A 4O5UA 2R0GA 1TI3A 3CSJA 4JE1A 2E2MA 2CAQA 1QGVA 3LWAA 3A2VA 4ECCA 1X5CA 3R3EA 1ERTA 4LL4B 4A5PA 4OD7A 2VL9A 2GDRA 4RQRA 2HRAA 1ST9A 1K0OA 3A3TA 3UBKA 4PQ1A 4DSSB 2PN8A 3BCIA 3LXTA 2RM5A 2GQKA 2IFQB 1TKDB 4OWYA 4NPBA 4YKGA 1WMJA 4KDXA 5DALB 2O8VB 2CX3A 2J9HA 4IQAA 3GKXA 1WJKA 1ABAA 3Q19A 3ZFBA 3TUEA 3QR6A 2B7JA 4TN8A 1GSSA 3I6AA 1SU9A 1OKDA 1BJXA 5H5RA 1Z9HA 2QSIA 2YJ7A 4PNGA 5B6MA 4ULXA 4Z2RA 4HU9A 2E0QA 3GTUB 1O7UA 4GWRA 3BJ5A 2B1LA 2GSRA 4L0UA 4BVXA 2OKAA 4IW9A 5E59A 5J3RA 3TJKA 4XHMA 5CRDA 4TR1B 1XOBA 3U5RE 1GSDA 3E9JB 4KH7A 5D93A 3DVWA 2DJ2A 2Z9SA 4JBBA 1R4WA 1BQ7A 1SYXA 2FLSA 3VPQA 3M0FA 4KF9A 4PUAA 1EP7A 2HRFA 3EU4A 2LUSA 4ZILA 2IIYA 4ZBAA 2G2QA 4MMMA 3DVXA 10GSA 3DYRA 3F8UA 3HA9A 1YJ6A 5FT3A 1MEKA 3VWVA 5COHA 1S3DA 4LLRA 5ECMB 3KD0A 2R0CA 4JEDA 4FO5A 4MH3A 1GSQA 3G7JA 1R7HA 2VM2A 4WR4A 4ILFA 4BA7A 5CRHA 1N2AA 3QPMA 4I2UA 4K7OA 2I4AA 2WB9A 2GVPA 2PGTA 4QL9A 4IGJA 4TOPA 1SL2B 1NSWA 2QA2A 1AC1A 2GT5A 3CQFA 2V6KA 3QD9A 1TK5B 1RW1A 1Z6NA 1U87A 1GTUA 4YQUA 3GHAA 2DJJA 2DJ1A 4MP4A 1V98A 2H0IA 1VF4A 5DQSA 5AIXA 1T4ZA 4EO3A 3ZVJA 2C4JA 4ZB8A 4G19A 5GZZB 2X8CA 3CTGA 2N5AA 1PFOA 1ZCPA 4K5SA 2K6VA 5F8BA 3F6FA 2HFDA 3FZ5A 4G10A 1PKZA 5H5QA 4Q5RA 2PU9C 2MMOA 1EOGA 2P5RA 4ZL7A 3EE2A 5LD0A 4ZL8A 4MJCA 3F4RA 4OCFA 2O87A 5IO2A 1N8JA 3HZ4A 2IMEA 4MZBA 1GNWA 2CZ2A 4YKFA 1FO5A 1XWAA 3GTUA 5HR1A 6GSTA 2GZPA 2CV4A 2EIQA 4DSRA 3MAKA 2PVQA 3HD5A 3HKRA 4PQIA 3F0IA 4MJEA 4TR1A 5DJLA 4GQFA 1KEBA 4P3YB 2H0GA 3SBCA 1JLVA 1XIYA 4MZCA 4KX4A 2LRCA 1T7PB 1U3IA 2FA8A 2JADA 2VCTA 1T1VA 2H71A 3RPPA 1OAZA 1A8YA 1DBYA 4WF4A 4J2FA 3MIXA 2NVLA 1K0BA 1O85A 2ES7A 4K7IA 2DMMA 4MZWA 3GL5A 2YWIA 3EWLA 1V40A 2C3TA 2F3MA 4TR3A 3HXSA 5HFGA 2L4CA 2VOCA 1BG5A 4IJIA 5DJMA 3P7XA 2C1YA 3MDKA 4IKHA 5J9BA 1K0NA 5DVBA 4OCEA 3TCOA 5GAND 5ECOB 2NDOA 2CZ3A 3RHCA 3O76A 4HQZA 3JCML 5D9WA 1K0DA 4KCAA 5F0GA 3HHVA 3UL3A 3CXGA 1UN2A 3PPUA 2HRNA 3UVTA 1JHBA 1RQMA 5GSTA 2LNTA 2OACA 5DCGA 1I9DA 1ZMAA 1JLWA 2OE3A 2N5FA 4EDZA 3I9V2 3HJMA 1TXXA 1PL2A 4FQUA 4F03A 3ME8A 1WRYA 6GSVA 4PXOA 1PL1A 1MTCA 2MMAA 2YWOA 1GP1A 1YQ1A 3LFLA 4MLYA 4HSCX 3APQA 2FY6A 4FYCA 2B5XA 4PNFA 3EURA 2HRKA 3ZITA 1S3AA 5J41A 3DRNA 2LKUA 1EEJA 1QK8A 1A23A 2MYGA 3N9JA 3L4NA 4JZQA 4XRDA 2DJ3A 2D2ZA 3EVIA 3E3EA 3L9UA 2H1AA 4RQXA 3KEBA 3H93A 3BD2A 2AV4A 3W8SA 4TXVA 6GSWA 1IYIA 3HCZA 2VCZA 3KJYA 4TXOB 3ZREA 1M0UA 1OC3A 3US3A 3LSZA 5HR3A 2L5LA 3Q18A 4ZB9A 1B48A 4LA1A 1B4PA 1X9SB 2YPMA 1TDIA 2A4VA 5FWGA 1WOUA 4MDCA 1URMA 3UJ1A 2E2GA 4WEYA 17GSA 3DXBA 3E0UA 3HJOA 3KH9A 5CRGA 1SKRB 2PUKC 2VAFA 1F3AA 2YV9A 3C1SA 2GTUA 2HSMA 4O92A 1XW5A 2O85A 4GF0A 2KP1A 3D4TA 3ISOA 4EKZA 4EUYA 5INYA 1X5DA 1PSQA 1TRUA 2VD1A 5KN1A 4CDOA 2LV3A 3IBHA 2YP6A 1H75A 2FCHA 4IBPA 1X9WB 4EXJA 4HQSA 3H8QA 4YAPA 3RDWA 1GTIA 5EVOA 4EVMA 2WFCA 5D73A 2XPDA 1ZYNA 2LQOA 1M3IA 1V57A 2BJXA 2ZCTA 3FYGA 2C3NA 4IELA 2R6KA 4FH8A 12GSA 1HNBA 3LEFA 5B6NA 2H76A 1A0RP 1ON4A 4TVEA 3LW9A 4BVYA 3TKRA 4XRAA 2KLXA 1ZYQB 3ZFLA 3KP8A 5D9XA 3LXZA 3W6GA 4IQ1A 2DC5A 1T00A 3G9BA 5F05A 4V2MA 2H74A 1ACVA 2VD0A 3CSHA 1GL8A 3F6DA 1XCCA 4MPGA 1K0AA 1FAAA 3KXOA 4HEA2 3KGKA 3DKSA 4N10A 2MBTA 3D21A 2YV7A 4HOJA 5ECQB 2M46A 3KTLA 4Q5FA 6GSUA 3VFIA 3KMNA 4USSA 5AN1A 1JFUA 2JU5A 5IPGA 3FR6A 5J5NA 5CRWA 4BPYA 3C8EA 3QFAC 3QAGA 2GSQA 3C1RA 2O89A 3WD6A 4J57E 3D22A 3A2XA 1DE1A 4IVFA 2N5BA 2GQMA 3IK7A 1M9AA 4CY6A 1KBNA 1Z3EA 2REMA 1PMTA 3ZMLA 1MD3A 3HVVA 5CAXA 4HU7A 2CX4A 4N30A 3TGZA 3QMXA 2YCDA 2ALBA 2GSSA 2GQLA 3KH7A 3D4MA 3MWHA 2L57A 4O7HA
chains in the Genus database with same CATH topology
2A2RA 1K3OA 3PINA 3C71A 3VURA 5ENUA 2VL2A 7GSSA 2IJYA 1ZYPA 5DCHA 3GH9A 4ZBDA 5ABRA 2OA7A 4OO5A 3APOA 3K8NA 5ECSA 4MF7A 4POBA 4LMWA 5DAKA 3LORA 3L9SA 3NIVA 4ECJA 1OC9A 4ID0A 1AQXA 2H6XA 3M9JA 2H0HA 4KDYA 1I5GA 5J4UA 4F9ZA 1F9MA 1GNEA 3DWVA 2R37A 1ZL9A 4MA9A 2H8LA 3TKSA 2JACA 1NW2A 3LYKA 1K3LA 1HD2A 2CVBA 4K8MA 3RAZA 3R2QA 1PX7A 3CSIA 2YZHA 5IOWA 1PKWA 4TR0A 3D5JA 1FB6A 1XBSA 2R3XA 1DSBA 1G7OA 4Z7XA 2V41A 1UC7A 2VCVA 2WGRA 3NOFA 1B9YC 3NZNA 4EC0A 2TIRA 2UZ8A 2X64A 2GZZA 1EZKA 5CYYA 1GRXA 4RUVA 4FYUA 22GSA 5ELAA 2FD3A 4CHSA 2VUPA 2HSHA 4O5QA 3UEMA 2C0DA 2PBJA 1XVWA 2VM1A 4F82A 4KB3A 1FW1A 1PN0A 1GTAA 2H70A 4ECBA 1TU8A 1ERUA 1VF3A 5CO3A 1U3AA 2H1GA 3Q74A 1SKSB 1QFNA 4MK3A 4WF5A 3FHKA 4DSSA 5G2ZA 3VWUA 1TW9A 5HR0A 2IFQA 2XBQA 20GSA 4KNDA 2B7KA 2KOKA 5HQPA 4MF6A 5DALA 2HXKA 1K0CA 1UA5A 4D73B 5F07A 3RBTA 1CQGA 2BMXA 2HT9A 4XS6A 2JZRA 3IC4A 1SK2A 4HJMA 5CP1A 2RIIA 1F6MC 4K1FA 2DMLA 4N11A 1NHOA 2DKHA 2OBIA 4ECIA 3KP9A 4AJ6A 4K9ZA 1XPVA 4KSOA 4KW6A 4H86A 4N0ZA 1GWCA 2YWMA 3ZL5A 3TKQA 4BWQA 2YOIA 2M72A 3C73A 18GSA 2LJKA 5IMFA 1HNAA 2H1DA 2LQQA 4HZ2A 1TP9A 2LEGA 3WGDA 3TJJA 1GUMA 2YANA 5KN0A 1YF0A 2CVDA 2P31A 5G30A 2OE1A 3TJBA 1TU7A 2BTOT 5DDLA 5AISA 1O81A 5H5SA 1C72A 4KE3A 1AQWA 3G7YA 2I9HA 2B5EA 19GSA 3C7MA 3L78A 1UVZA 3EINA 3M8NA 2B5YA 5KOXA 5A4VA 2QKEA 3CMIA 4PTSA 4PURA 2OADA 4F0CA 2KP2A 3TJGA 3D0ZA 3IXRA 2WS2A 2HZEB 4X1UA 5KN3A 1G0TA 3P8WA 2TRCP 2IL3A 2H30A 5DBQA 3CBUA 4OFNA 2YN1A 3FR9A 3N5OA 2IWTA 2LJRA 5HFIA 1X0RA 3HJPA 2HLSA 3TRPA 3TKPA 3CRTA 5ECNB 3GX0A 4L8EA 3GIXA 4NAXA 4ML1A 1YY7A 4F0BA 3IR4A 3FZ9A 2FHEA 4RI7A 2MBSA 2K8VA 1GLPA 1XW9A 1SJZA 4QQ7A 5KEJA 4MJAA 5CREA 4KUNA 4AJ8A 3VWXA 2IMKA 1OE7A 1EV4A 2ON7A 3CYNA 1EGOA 1GSEA 1YDKA 4EIPA 4I97A 4XCSA 3GRXA 1TJDA 4ZIJA 5JWOB 3IAM2 4IJ3A 4WETA 1G6YA 4NV5A 1G6WA 3FRCA 2K9FA 1GUHA 2JZSA 2IPAA 1Z6MA 3LGCA 4EIQA 4I8BA 2GZYA 5J9CA 5G1KA 5AIVA 3GA4A 4K0NA 2KUCA 2PERA 4EDYA 2VCQA 1ERVA 1TRSA 1O8WA 3KIJA 2H6YA 3DD3A 3QAWA 1JZWA 1M99A 4L5OA 1FG4A 1XOAA 3IPZA 1F2EA 2DLXA 1VF1A 1SL1B 1MDIA 3HY2A 4KSMA 2QGVA 3S9FA 3VI5A 4Q5NA 2LRTA 1FB0A 4OFTA 5CNWA 3ZIVA 1IYHA 5G5EA 4NHWA 2IMIA 2IMFA 5JCWA 4HS1A 4IN0A 3F9UA 2JL4A 4E8EA 1WIKA 3TKSE 2GGTA 3ZLPA 1SK1A 4GCIA 2LRNA 4E8HA 4XS1A 4WBRD 1HNCA 1TRWA 1BEDA 1R5AA 3IHGA 3J7Yb 1OE8A 1SJIA 5GSSA 3A5IA 2WULA 1QMVA 3F4SA 2AAWA 3F63A 2MMNA 4TKYA 2DJ0A 1AIUA 2OBKA 4O5RA 5A4WA 4KCEA 3TRXA 1QQ2A 1DE2A 4RI6A 4MCUA 1M2DA 4J56E 2L6DA 4ZB6A 1V58A 2L5OA 3GKMA 5FHIA 1J08A 2EIRA 4NV2A 3QDNA 2VL3A 3IOSA 2V2GA 3GFKA 5G1LA 1PX6A 1WP0A 3VWWA 4YH2A 1SYRA 2H01A 1ERWA 1ZYEA 4ISDA 4BVXB 2DKIA 1LU4A 2IN3A 2X8GA 2YWNA 1AAZA 4N0VA 3IDVA 14GSA 2YNXA 1NM3A 4PUFC 1PQNA 3LQ7A 4L0WA 1AQVA 1VF2A 2FWFA 1YEPA 1Q98A 5ID2B 3PGTA 1QUWA 2FWEA 8GSSA 1GSYA 4G0KA 2VLVA 3M9KA 3F3QA 2AJQB 2NPBA 3H79A 2ZNMA 2V32A 3ED3A 3L9VA 1E6BA 1Q4JA 2ON5A 4K2XA 2EC4A 3O6TA 2A4HA 2RUEA 1MDJA 5B8AA 5BMUA 1WWJA 5IMCA 3FK8A 1GH2A 2L59A 4IP6A 4K6XA 3WGEA 4WKWA 2DIZA 3DIEA 3GN3A 1J9BA 2VCWA 4PQHA 2NTOA 3WGXA 3GKNA 1B4QA 1EGRA 3GYKA 4GXZA 4TRXA 4GSNA 2F8AA 4GSSA 1M7TA 1WPIA 3D6IA 4ZL9A 2WZ9A 3ZIJA 1TTZA 3UARA 4XS4B 1M9BA 3GSSA 4KAEA 4TXOA 1PD21 4TW5A 4YQVA 4K2DA 3UMAA 1YKCA 2J23A 2QA1A 1PN9A 4ICYA 1KTEA 3IV4A 3EYTA 1BAYA 6GSYA 3QOUA 2H66A 4POLA 3QFBC 1H4OA 3UOMA 1GUKA 4K0GA 1QXHA 1XWBA 4DEJA 5D8IA 3I43A 1G7EA 3KM6A 1EP8A 1YZXA 4AJ7A 1PGTA 5C00A 1A2MA 4JU5A 2E7PA 6GSXA 4IHUA 1LJRA 5IM9A 2C3QA 4L5LA 1FVJA 2WDUA 3DMLA 1SJ6A 1O73A 5LNKe 13GSA 4I2TA 1F37A 4OO4A 2MMZA 3QCPA 5IMZA 1XW6A 4TR4A 2HZFA 5ECIB 1FHEA 3IC8A 5G5FA 4POKA 3WYWA 4HI7A 3LG6A 1NHYA 2VO4A 1MD4A 5ECLB 3KTBA 3GURA 5JWRB 2WJUA 1AW9A 3ZMKA 1JZOA 1R26A 4GSTA 2DSAA 4GTUA 3TOTA 4ZXGA 4NXIA 5ECHB 1XVQA 1ILOA 1FOVA 5ID2A 1BYEA 1O8XA 3GH6A 1HYUA 2LS5A 5F06A 4KA0A 4HZ4A 1YEXA 3GSTA 4JRRA 3LJRA 2HE3A 3EMPA 5IMDA 4JR4A 5A4UA 1EWXA 2FA4A 11GSA 5IMAA 2RUFA 2P5QA 5ECPB 2YZUA 2X8HA 5IO0A 2EIOA 4NHZA 1A0FA 5ECKB 2JSZA 1TRVA 2CVKA 3TOUA 4HJ2A 5EY6A 3A5WA 2P0GA 2GLRA 3BCKA 2LSTA 1EV9A 3UBLA 2C8UA 3GUSA 1SD9A 1XZOA 5IQYA 1U6TA 2JZTA 1TOFA 1KNGA 3A2WA 2FWHA 2GS3A 3HDCA 1USBA 3IHQA 5JWQB 4ML6A 1A2JA 3GL3A 2H72A 2OJLA 4PGTA 4AF2A 1SL0B 4XS4A 2V1MA 2PVOC 1Y6EA 5D9VA 2X99A 3ERWA 3SWLA 2CT6A 5D96A 4Q5QA 4CW9A 1XWCA 2LTKA 4HUAA 4YAVA 4MNNA 4V2LA 1XXUA 3APSA 1U88A 5D9TA 16GSA 4DSQA 3HVXA 1SK0A 3EC3A 1R5PA 1SENA 3HZ8A 2LNSA 4POMA 3TB2A 3VPTA 1OVNA 3IRAA 2I81A 1PRXA 4PX1A 3U6VA 1Y25A 1M2BA 3RHBA 3H1NA 2FGXA 2AUVA 1THXA 5KN2A 2H75A 4I5QA 3MYDA 3TDGA 3KMOA 3HVSA 2X49A 2C0FA 4IP1A 3BOAA 1AXDA 5GAPD 2XPEA 1S3CA 4MF5A 2F51A 3ZRDA 2F8FA 1OKTA 5AGYA 4OMVA 3GV1A 5L71A 3PR8A 3KZQA 1THOA 3TRQA 3GKKA 2X4AA 3V1WA 2AYTA 5DQYA 1Z7RA 2AHEA 3UIWA 4EF0A 4V2NA 2M80A 4ZBBA 3FZAA 2B6MA 1GLQA 2CQ9A 1OYJA 4OFMA 1HQOA 5C04A 3P90A 3ZVJD 2VL2C 5A5KA 2HSYA 4KDUA 2K8SA 5JCGA 4ACSA 1XWGA 4WR5A 3L0HA 4LL1B 3ZZXA 1WE0A 2HYXA 2KHPA 4XIHA 1T8EB 1X9MB 2HI7A 2VIMA 9GSSA 5B7CA 5IIZA 1XFLA 4EL1A 4Z2TA 2GT6A 2XBIA 1XWKA 6GSSA 5BRTA 2VLTA 4WBJA 3IAS2 3W8JA 4DVCA 1OC8A 3LYPA 4KGIA 3GX8A 3VI7A 4JR6A 5KOWA 3MSZA 3TKSC 2K18A 4V1Ap 4WXTA 2C0EA 2G0FA 3FMWA 2PMTA 1GULA 2VCXA 1T3BA 1EEMA 3ZTLA 1ZOFA 3FKFA 5EPFA 1JZDA 2H73A 4BVYB 4FYBA 4BL7B 1AUCA 4NMUA 5ECRB 2CAIA 1GSUA 1A8LA 3ERFA 5IPHA 2O7KA 5G31A 3P2AA 4D73A 2R5GA 4FIWA 3M1GA 3GNJA 4LMVA 2F9SA 1YKAA 3EMXA 1JZRA 1K0MA 4X43A 4X4JA 2DJKA 1DUGA 2NBSA 2RLIA 1VRSD 4K5RA 2MZCA 3VLNA 2I3YA 4GQCA 1RK4A 4GRFA 3RPNA 3EU3A 1LBKA 2C80A 2FNOA 2XC2A 2XHFA 3F3RA 4V1Ag 3IK9A 2WRTA 2I1UA 4G0LA 1V2AA 1ZGNA 1X5EA 4G2EA 4AGSA 4QL7A 2L4QA 2IMDA 3J7Yk 5IMVA 1Z7PA 5HFKA 1T4YA 3HYPA 3IA1A 4NWYA 4Z2UA 3FY7A 1MDKA 3G7IA 2B1KA 5ELGA 1SD8A 4MABA 1GTBA 2FWGA 2HNLA 3OR5A 4YQMA 2OE0A 3O3TA 1V9WA 3QAVA 2GSTA 4O32A 2YJHA 2DBCA 2PWJA 1TK0B 1B9XC 3F4TA 3FW2A 3DGQA 4BWSA 3WT2A 2JSYA 2HZEA 2V6OA 4K7NA 1VGLA 5EL8A 2CA8A 1SKWB 2VLUA 1M2AA 1W89A 1TI1A 1F3BA 3FEUA 1YF1A 2H19A 2A2SA 3ME7A 3FZ4A 1E2YA 3I69A 3IE3A 2H6ZA 1TK8B 1EOHA 2A2PA 4XTSA 3BBYA 3VK9A 4CY8A 1B8XA 5HR2A 5JCUA 4GLTA 4MJBA 1GSFA 3CRUA 2FUG2 1ML6A 5DAKB 4G9HA 2B3SA 1Z5YE 3TJFA 4MH2A 3H4KA 1OC9B 3GMFA 2PPTA 3M3MA 3FR3A 1A2LA 3ERGA 4IS0A 3AY8A 2DIYA 3ZYWA 2R2JA 4BL7A 2L6CA 3EPTA 2AB6A 5LCZA 1O6JA 2LJAA 1BX9A 2WCIA 4F2IA 3CTFA 1W4VA 2RM6A 1J0FA 4G0IA 4EE0A 4HDEA 1FVKA 3WT1A 2R4VA 2R0PA 3UVHA 1PA3A 2TRXA 3UAPA 4X0XA 3DEXA 2C0GA 3PH9A 1FOHA 1K3YA 3Q6OA 1ZZYA 3KCMA 4I6XA 2ZUPA 1CQHA 2H1BA 2QC7A 4MPFA 3MNGA 5IOXA 5B8BA 5E4WA 1A24A 4O5UA 2R0GA 1TI3A 3CSJA 4JE1A 2E2MA 2CAQA 1QGVA 3LWAA 3A2VA 4ECCA 1X5CA 3R3EA 1ERTA 4LL4B 4A5PA 4OD7A 2VL9A 2GDRA 4RQRA 2HRAA 1ST9A 1K0OA 3A3TA 3UBKA 4PQ1A 4DSSB 2PN8A 3BCIA 3LXTA 2RM5A 2GQKA 2IFQB 1TKDB 4OWYA 4NPBA 4YKGA 1WMJA 4KDXA 5DALB 2O8VB 2CX3A 2J9HA 4IQAA 3GKXA 1WJKA 1ABAA 3Q19A 3ZFBA 3TUEA 3QR6A 2B7JA 4TN8A 1GSSA 3I6AA 1SU9A 1OKDA 1BJXA 5H5RA 1Z9HA 2QSIA 2YJ7A 4PNGA 5B6MA 4ULXA 4Z2RA 4HU9A 2E0QA 3GTUB 1O7UA 4GWRA 3BJ5A 2B1LA 2GSRA 4L0UA 4BVXA 2OKAA 4IW9A 5E59A 5J3RA 3TJKA 4XHMA 5CRDA 4TR1B 1XOBA 3U5RE 1GSDA 3E9JB 4KH7A 5D93A 3DVWA 2DJ2A 2Z9SA 4JBBA 1R4WA 1BQ7A 1SYXA 2FLSA 3VPQA 3M0FA 4KF9A 4PUAA 1EP7A 2HRFA 3EU4A 2LUSA 4ZILA 2IIYA 4ZBAA 2G2QA 4MMMA 3DVXA 10GSA 3DYRA 3F8UA 3HA9A 1YJ6A 5FT3A 1MEKA 3VWVA 5COHA 1S3DA 4LLRA 5ECMB 3KD0A 2R0CA 4JEDA 4FO5A 4MH3A 1GSQA 3G7JA 1R7HA 2VM2A 4WR4A 4ILFA 4BA7A 5CRHA 1N2AA 3QPMA 4I2UA 4K7OA 2I4AA 2WB9A 2GVPA 2PGTA 4QL9A 4IGJA 4TOPA 1SL2B 1NSWA 2QA2A 1AC1A 2GT5A 2V6KA 3QD9A 1TK5B 1RW1A 1Z6NA 1U87A 1GTUA 4YQUA 3GHAA 2DJJA 2DJ1A 4MP4A 1V98A 2H0IA 1VF4A 5DQSA 5AIXA 1T4ZA 4EO3A 3ZVJA 2C4JA 4ZB8A 4G19A 5GZZB 2X8CA 3CTGA 2N5AA 1ZCPA 4K5SA 2K6VA 5F8BA 3F6FA 2HFDA 3FZ5A 4G10A 1PKZA 5H5QA 4Q5RA 2PU9C 2MMOA 1EOGA 2P5RA 4ZL7A 3EE2A 5LD0A 4ZL8A 4MJCA 3F4RA 4OCFA 2O87A 5IO2A 1N8JA 3HZ4A 2IMEA 4MZBA 1GNWA 2CZ2A 4YKFA 1FO5A 1XWAA 3GTUA 5HR1A 6GSTA 2GZPA 2CV4A 2EIQA 4DSRA 3MAKA 2PVQA 3HD5A 3HKRA 4PQIA 3F0IA 4MJEA 4TR1A 5DJLA 4GQFA 1KEBA 4P3YB 2H0GA 3SBCA 1JLVA 1XIYA 4MZCA 4KX4A 2LRCA 1T7PB 1U3IA 2FA8A 2JADA 2VCTA 1T1VA 2H71A 3RPPA 1OAZA 1A8YA 1DBYA 4WF4A 4J2FA 3MIXA 2NVLA 1K0BA 1O85A 2ES7A 4K7IA 2DMMA 4MZWA 3GL5A 2YWIA 3EWLA 1V40A 2C3TA 2F3MA 4TR3A 3HXSA 5HFGA 2L4CA 2VOCA 1BG5A 4IJIA 5DJMA 3P7XA 2C1YA 3MDKA 4IKHA 5J9BA 1K0NA 5DVBA 4OCEA 3TCOA 5GAND 5ECOB 2NDOA 2CZ3A 3RHCA 3O76A 4HQZA 3JCML 5D9WA 1K0DA 4KCAA 5F0GA 3HHVA 3UL3A 3CXGA 1UN2A 3PPUA 2HRNA 3UVTA 1JHBA 1RQMA 5GSTA 2LNTA 2OACA 5DCGA 1I9DA 1ZMAA 1JLWA 2OE3A 2N5FA 4EDZA 3I9V2 3HJMA 1TXXA 1PL2A 4FQUA 4F03A 3ME8A 1WRYA 6GSVA 4PXOA 1PL1A 1MTCA 2MMAA 2YWOA 1GP1A 1YQ1A 3LFLA 4MLYA 3APQA 2FY6A 4FYCA 2B5XA 4PNFA 3EURA 2HRKA 3ZITA 1S3AA 5J41A 3DRNA 2LKUA 1EEJA 1QK8A 1A23A 2MYGA 3N9JA 3L4NA 4JZQA 4XRDA 2DJ3A 2D2ZA 3EVIA 3E3EA 3L9UA 2H1AA 4RQXA 3KEBA 3H93A 3BD2A 2AV4A 3W8SA 4TXVA 6GSWA 1IYIA 3HCZA 2VCZA 3KJYA 4TXOB 3ZREA 1M0UA 1OC3A 3US3A 3LSZA 5HR3A 2L5LA 3Q18A 4ZB9A 1B48A 4LA1A 1B4PA 1X9SB 2YPMA 1TDIA 2A4VA 5FWGA 1WOUA 4MDCA 1URMA 3UJ1A 2E2GA 4WEYA 17GSA 3DXBA 3E0UA 3HJOA 3KH9A 5CRGA 1SKRB 2PUKC 2VAFA 1F3AA 2YV9A 3C1SA 2GTUA 2HSMA 4O92A 1XW5A 2O85A 4GF0A 2KP1A 3D4TA 3ISOA 4EKZA 4EUYA 5INYA 1X5DA 1PSQA 1TRUA 2VD1A 5KN1A 4CDOA 2LV3A 3IBHA 2YP6A 1H75A 2FCHA 4IBPA 1X9WB 4EXJA 4HQSA 3H8QA 4YAPA 3RDWA 1GTIA 5EVOA 4EVMA 2WFCA 5D73A 2XPDA 1ZYNA 2LQOA 1V57A 2BJXA 2ZCTA 3FYGA 2C3NA 4IELA 2R6KA 4FH8A 12GSA 1HNBA 3LEFA 5B6NA 2H76A 1A0RP 1ON4A 4TVEA 3LW9A 4BVYA 3TKRA 4XRAA 2KLXA 1ZYQB 3ZFLA 3KP8A 5D9XA 3LXZA 3W6GA 4IQ1A 2DC5A 1T00A 3G9BA 5F05A 4V2MA 2H74A 1ACVA 2VD0A 3CSHA 1GL8A 3F6DA 1XCCA 4MPGA 1K0AA 1FAAA 3KXOA 4HEA2 3KGKA 3DKSA 4N10A 2MBTA 3D21A 2YV7A 4HOJA 5ECQB 2M46A 3KTLA 4Q5FA 6GSUA 3VFIA 3KMNA 4USSA 5AN1A 1JFUA 2JU5A 5IPGA 3FR6A 5J5NA 5CRWA 4BPYA 3C8EA 3QFAC 3QAGA 2GSQA 3C1RA 2O89A 3WD6A 4J57E 3D22A 3A2XA 1DE1A 4IVFA 2N5BA 2GQMA 3IK7A 1M9AA 4CY6A 1KBNA 1Z3EA 2REMA 1PMTA 3ZMLA 1MD3A 3HVVA 5CAXA 4HU7A 2CX4A 4N30A 3TGZA 3QMXA 2YCDA 2ALBA 2GSSA 2GQLA 3KH7A 3D4MA 3MWHA 2L57A 4O7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A2R A;  1K3O A;  3PIN A;  3C71 A;  3VUR A;  5ENU A;  2VL2 A;  7GSS A;  2IJY A;  5DCH A;  3GH9 A;  4ZBD A;  5ABR A;  2OA7 A;  4OO5 A;  3APO A;  3K8N A;  5ECS A;  4MF7 A;  4POB A;  4LMW A;  5DAK A;  3LOR A;  3L9S A;  3NIV A;  4ECJ A;  1OC9 A;  4ID0 A;  1AQX A;  2H6X A;  3M9J A;  2H0H A;  4KDY A;  1I5G A;  5J4U A;  4F9Z A;  1F9M A;  1GNE A;  3DWV A;  2R37 A;  1ZL9 A;  4MA9 A;  2H8L A;  3TKS A;  2JAC A;  1NW2 A;  3LYK A;  1K3L A;  1HD2 A;  2CVB A;  4K8M A;  3RAZ A;  3R2Q A;  1PX7 A;  3CSI A;  2YZH A;  5IOW A;  1PKW A;  4TR0 A;  3D5J A;  1FB6 A;  1XBS A;  2R3X A;  1DSB A;  1G7O A;  4Z7X A;  2V41 A;  1UC7 A;  2VCV A;  2WGR A;  3NOF A;  1B9Y C;  3NZN A;  4EC0 A;  2TIR A;  2X64 A;  2GZZ A;  1EZK A;  5CYY A;  1GRX A;  4RUV A;  4FYU A;  22GS A;  5ELA A;  2FD3 A;  4CHS A;  2VUP A;  2HSH A;  3UEM A;  2C0D A;  2PBJ A;  1XVW A;  2VM1 A;  4F82 A;  4KB3 A;  1FW1 A;  1GTA A;  2H70 A;  4ECB A;  1TU8 A;  1ERU A;  1VF3 A;  5CO3 A;  1U3A A;  2H1G A;  3Q74 A;  1SKS B;  1QFN A;  4MK3 A;  4WF5 A;  3FHK A;  4DSS A;  5G2Z A;  3VWU A;  1TW9 A;  5HR0 A;  2IFQ A;  2XBQ A;  20GS A;  4KND A;  2B7K A;  2KOK A;  5HQP A;  4MF6 A;  5DAL A;  2HXK A;  1K0C A;  1UA5 A;  4D73 B;  5F07 A;  3RBT A;  1CQG A;  2BMX A;  2HT9 A;  4XS6 A;  2JZR A;  3IC4 A;  1SK2 A;  4HJM A;  5CP1 A;  2RII A;  1F6M C;  4K1F A;  2DML A;  4N11 A;  1NHO A;  2OBI A;  4ECI A;  3KP9 A;  4AJ6 A;  4K9Z A;  1XPV A;  4KSO A;  4KW6 A;  4H86 A;  4N0Z A;  1GWC A;  2YWM A;  3ZL5 A;  3TKQ A;  4BWQ A;  2YOI A;  2M72 A;  3C73 A;  18GS A;  2LJK A;  5IMF A;  1HNA A;  2H1D A;  2LQQ A;  4HZ2 A;  1TP9 A;  2LEG A;  3WGD A;  3TJJ A;  1GUM A;  2YAN A;  5KN0 A;  1YF0 A;  2CVD A;  2P31 A;  5G30 A;  2OE1 A;  3TJB A;  1TU7 A;  2BTO T;  5DDL A;  5AIS A;  1O81 A;  5H5S A;  1C72 A;  4KE3 A;  1AQW A;  3G7Y A;  2I9H A;  2B5E A;  19GS A;  3C7M A;  3L78 A;  1UVZ A;  3EIN A;  3M8N A;  2B5Y A;  5A4V A;  2QKE A;  3CMI A;  4PUR A;  2OAD A;  4F0C A;  2KP2 A;  3TJG A;  3D0Z A;  3IXR A;  2WS2 A;  2HZE B;  4X1U A;  5KN3 A;  1G0T A;  3P8W A;  2TRC P;  2IL3 A;  2H30 A;  5DBQ A;  3CBU A;  4OFN A;  2YN1 A;  3FR9 A;  3N5O A;  2IWT A;  2LJR A;  5HFI A;  1X0R A;  3HJP A;  2HLS A;  3TRP A;  3TKP A;  3CRT A;  5ECN B;  3GX0 A;  4L8E A;  3GIX A;  4NAX A;  4ML1 A;  1YY7 A;  4F0B A;  3IR4 A;  3FZ9 A;  2FHE A;  4RI7 A;  2MBS A;  2K8V A;  1GLP A;  1XW9 A;  1SJZ A;  4QQ7 A;  5KEJ A;  4MJA A;  5CRE A;  4KUN A;  4AJ8 A;  3VWX A;  2IMK A;  1OE7 A;  1EV4 A;  2ON7 A;  3CYN A;  1EGO A;  1GSE A;  1YDK A;  4I97 A;  4XCS A;  3GRX A;  1TJD A;  4ZIJ A;  5JWO B;  3IAM 2;  4IJ3 A;  4WET A;  1G6Y A;  4NV5 A;  1G6W A;  3FRC A;  2K9F A;  1GUH A;  2JZS A;  2IPA A;  1Z6M A;  3LGC A;  4I8B A;  2GZY A;  5J9C A;  5G1K A;  5AIV A;  3GA4 A;  4K0N A;  2KUC A;  2PER A;  4EDY A;  2VCQ A;  1ERV A;  1TRS A;  1O8W A;  3KIJ A;  2H6Y A;  3DD3 A;  3QAW A;  1JZW A;  1M99 A;  4L5O A;  1FG4 A;  1XOA A;  3IPZ A;  1F2E A;  2DLX A;  1VF1 A;  1SL1 B;  1MDI A;  3HY2 A;  4KSM A;  2QGV A;  3S9F A;  3VI5 A;  4Q5N A;  2LRT A;  1FB0 A;  4OFT A;  5CNW A;  3ZIV A;  1IYH A;  5G5E A;  4NHW A;  2IMI A;  2IMF A;  5JCW A;  4HS1 A;  4IN0 A;  3F9U A;  2JL4 A;  4E8E A;  1WIK A;  3TKS E;  2GGT A;  3ZLP A;  1SK1 A;  4GCI A;  2LRN A;  4E8H A;  4XS1 A;  4WBR D;  1HNC A;  1TRW A;  1BED A;  1R5A A;  3J7Y b;  1OE8 A;  1SJI A;  5GSS A;  2WUL A;  1QMV A;  3F4S A;  2AAW A;  3F63 A;  2MMN A;  4TKY A;  2DJ0 A;  1AIU A;  2OBK A;  4O5R A;  5A4W A;  4KCE A;  3TRX A;  1QQ2 A;  1DE2 A;  4RI6 A;  4MCU A;  1M2D A;  4J56 E;  2L6D A;  4ZB6 A;  1V58 A;  2L5O A;  3GKM A;  5FHI A;  1J08 A;  2EIR A;  4NV2 A;  3QDN A;  2VL3 A;  3IOS A;  2V2G A;  3GFK A;  5G1L A;  1PX6 A;  1WP0 A;  3VWW A;  4YH2 A;  1SYR A;  2H01 A;  1ERW A;  1ZYE A;  4ISD A;  1LU4 A;  2IN3 A;  2X8G A;  2YWN A;  1AAZ A;  4N0V A;  3IDV A;  14GS A;  2YNX A;  1NM3 A;  4PUF C;  1PQN A;  3LQ7 A;  4L0W A;  1AQV A;  1VF2 A;  2FWF A;  1YEP A;  1Q98 A;  5ID2 B;  3PGT A;  1QUW A;  2FWE A;  8GSS A;  1GSY A;  2VLV A;  3M9K A;  3F3Q A;  2AJQ B;  2NPB A;  3H79 A;  2ZNM A;  2V32 A;  3ED3 A;  3L9V A;  1E6B A;  1Q4J A;  2ON5 A;  2EC4 A;  3O6T A;  2RUE A;  1MDJ A;  5B8A A;  1WWJ A;  5IMC A;  3FK8 A;  1GH2 A;  2L59 A;  4IP6 A;  4K6X A;  3WGE A;  4WKW A;  2DIZ A;  3DIE A;  3GN3 A;  1J9B A;  2VCW A;  4PQH A;  2NTO A;  3WGX A;  3GKN A;  1B4Q A;  1EGR A;  3GYK A;  4GXZ A;  4TRX A;  4GSN A;  2F8A A;  4GSS A;  1M7T A;  1WPI A;  3D6I A;  4ZL9 A;  2WZ9 A;  3ZIJ A;  1TTZ A;  3UAR A;  4XS4 B;  1M9B A;  3GSS A;  4KAE A;  4TXO A;  1PD2 1;  4TW5 A;  4YQV A;  4K2D A;  3UMA A;  1YKC A;  2J23 A;  1PN9 A;  1KTE A;  3IV4 A;  3EYT A;  1BAY A;  6GSY A;  3QOU A;  2H66 A;  4POL A;  3QFB C;  1H4O A;  3UOM A;  1GUK A;  4K0G A;  1QXH A;  1XWB A;  4DEJ A;  5D8I A;  3I43 A;  1G7E A;  3KM6 A;  1EP8 A;  1YZX A;  4AJ7 A;  1PGT A;  5C00 A;  1A2M A;  4JU5 A;  2E7P A;  6GSX A;  4IHU A;  1LJR A;  5IM9 A;  2C3Q A;  4L5L A;  1FVJ A;  2WDU A;  3DML A;  1SJ6 A;  1O73 A;  5LNK e;  13GS A;  4I2T A;  1F37 A;  4OO4 A;  2MMZ A;  3QCP A;  5IMZ A;  1XW6 A;  4TR4 A;  2HZF A;  5ECI B;  1FHE A;  5G5F A;  4POK A;  3WYW A;  4HI7 A;  3LG6 A;  1NHY A;  2VO4 A;  1MD4 A;  5ECL B;  3KTB A;  3GUR A;  5JWR B;  2WJU A;  1AW9 A;  3ZMK A;  1JZO A;  1R26 A;  4GST A;  2DSA A;  4GTU A;  3TOT A;  4ZXG A;  4NXI A;  5ECH B;  1XVQ A;  1ILO A;  1FOV A;  5ID2 A;  1BYE A;  1O8X A;  3GH6 A;  1HYU A;  2LS5 A;  5F06 A;  4KA0 A;  4HZ4 A;  1YEX A;  3GST A;  4JRR A;  3LJR A;  2HE3 A;  3EMP A;  5IMD A;  4JR4 A;  5A4U A;  1EWX A;  2FA4 A;  11GS A;  5IMA A;  2RUF A;  2P5Q A;  5ECP B;  2YZU A;  2X8H A;  5IO0 A;  2EIO A;  5ECK B;  1A0F A;  4NHZ A;  2JSZ A;  1TRV A;  2CVK A;  3TOU A;  4HJ2 A;  5EY6 A;  3A5W A;  2P0G A;  2GLR A;  3BCK A;  2LST A;  1EV9 A;  3UBL A;  2C8U A;  3GUS A;  1SD9 A;  1XZO A;  5IQY A;  1U6T A;  2JZT A;  1TOF A;  1KNG A;  3A2W A;  2FWH A;  2GS3 A;  3HDC A;  1USB A;  3IHQ A;  5JWQ B;  4ML6 A;  1A2J A;  3GL3 A;  2H72 A;  2OJL A;  4PGT A;  4AF2 A;  1SL0 B;  4XS4 A;  2V1M A;  2PVO C;  1Y6E A;  5D9V A;  2X99 A;  3ERW A;  3SWL A;  2CT6 A;  5D96 A;  4Q5Q A;  4CW9 A;  1XWC A;  2LTK A;  4HUA A;  4YAV A;  4V2L A;  1XXU A;  3APS A;  1U88 A;  5D9T A;  16GS A;  4DSQ A;  3HVX A;  1SK0 A;  3EC3 A;  1R5P A;  1SEN A;  3HZ8 A;  2LNS A;  4POM A;  3TB2 A;  3VPT A;  1OVN A;  3IRA A;  2I81 A;  1PRX A;  4PX1 A;  3U6V A;  1Y25 A;  1M2B A;  3RHB A;  3H1N A;  2FGX A;  2AUV A;  1THX A;  5KN2 A;  2H75 A;  4I5Q A;  3TDG A;  3KMO A;  3HVS A;  2C0F A;  4IP1 A;  3BOA A;  1AXD A;  5GAP D;  2XPE A;  1S3C A;  4MF5 A;  2F51 A;  3ZRD A;  2F8F A;  1OKT A;  5AGY A;  4OMV A;  3GV1 A;  5L71 A;  3PR8 A;  3KZQ A;  1THO A;  3TRQ A;  3GKK A;  3V1W A;  2AYT A;  5DQY A;  1Z7R A;  2AHE A;  3UIW A;  4EF0 A;  4V2N A;  2M80 A;  4ZBB A;  3FZA A;  2B6M A;  1GLQ A;  2CQ9 A;  1OYJ A;  4OFM A;  1HQO A;  5C04 A;  3P90 A;  3ZVJ D;  2VL2 C;  5A5K A;  2HSY A;  4KDU A;  2K8S A;  5JCG A;  4ACS A;  1XWG A;  4WR5 A;  3L0H A;  4LL1 B;  3ZZX A;  1WE0 A;  2HYX A;  2KHP A;  4XIH A;  1T8E B;  1X9M B;  2HI7 A;  2VIM A;  9GSS A;  5B7C A;  5IIZ A;  1XFL A;  4EL1 A;  2GT6 A;  2XBI A;  1XWK A;  6GSS A;  2VLT A;  4WBJ A;  3IAS 2;  3W8J A;  4DVC A;  1OC8 A;  3LYP A;  4KGI A;  3GX8 A;  3VI7 A;  4JR6 A;  3MSZ A;  3TKS C;  2K18 A;  4V1A p;  4WXT A;  2C0E A;  2G0F A;  2PMT A;  1GUL A;  2VCX A;  1T3B A;  1EEM A;  3ZTL A;  1ZOF A;  3FKF A;  5EPF A;  1JZD A;  2H73 A;  4FYB A;  1AUC A;  4NMU A;  5ECR B;  2CAI A;  1GSU A;  1A8L A;  3ERF A;  5IPH A;  2O7K A;  5G31 A;  3P2A A;  4D73 A;  2R5G A;  4FIW A;  3M1G A;  3GNJ A;  4LMV A;  2F9S A;  1YKA A;  3EMX A;  1JZR A;  1K0M A;  4X43 A;  2DJK A;  1DUG A;  2NBS A;  2RLI A;  1VRS D;  2MZC A;  3VLN A;  2I3Y A;  4GQC A;  1RK4 A;  4GRF A;  3RPN A;  3EU3 A;  1LBK A;  2C80 A;  2FNO A;  2XC2 A;  2XHF A;  3F3R A;  4V1A g;  3IK9 A;  2WRT A;  2I1U A;  1V2A A;  1ZGN A;  1X5E A;  4G2E A;  4AGS A;  4QL7 A;  2L4Q A;  2IMD A;  3J7Y k;  5IMV A;  1Z7P A;  5HFK A;  1T4Y A;  3HYP A;  3IA1 A;  4NWY A;  3FY7 A;  1MDK A;  3G7I A;  2B1K A;  5ELG A;  1SD8 A;  4MAB A;  1GTB A;  2FWG A;  2HNL A;  3OR5 A;  4YQM A;  2OE0 A;  3O3T A;  1V9W A;  3QAV A;  2GST A;  4O32 A;  2YJH A;  2DBC A;  2PWJ A;  1TK0 B;  1B9X C;  3F4T A;  3FW2 A;  3DGQ A;  4BWS A;  3WT2 A;  2JSY A;  2HZE A;  2V6O A;  4K7N A;  1VGL A;  5EL8 A;  2CA8 A;  1SKW B;  2VLU A;  1M2A A;  1W89 A;  1TI1 A;  1F3B A;  3FEU A;  1YF1 A;  2H19 A;  2A2S A;  3ME7 A;  3FZ4 A;  1E2Y A;  3I69 A;  3IE3 A;  2H6Z A;  1TK8 B;  1EOH A;  4XTS A;  3BBY A;  3VK9 A;  1B8X A;  5HR2 A;  5JCU A;  4GLT A;  4MJB A;  1GSF A;  3CRU A;  2FUG 2;  1ML6 A;  5DAK B;  4G9H A;  2B3S A;  1Z5Y E;  3TJF A;  4MH2 A;  3H4K A;  1OC9 B;  3GMF A;  2PPT A;  3M3M A;  3FR3 A;  1A2L A;  3ERG A;  4IS0 A;  3AY8 A;  2DIY A;  3ZYW A;  2R2J A;  4BL7 A;  2L6C A;  2AB6 A;  5LCZ A;  1O6J A;  2LJA A;  1BX9 A;  2WCI A;  4F2I A;  3CTF A;  1W4V A;  2RM6 A;  1J0F A;  4EE0 A;  4HDE A;  1FVK A;  3WT1 A;  2R4V A;  3UVH A;  1PA3 A;  2TRX A;  3UAP A;  4X0X A;  3DEX A;  2C0G A;  3PH9 A;  1K3Y A;  3Q6O A;  1ZZY A;  3KCM A;  4I6X A;  2ZUP A;  1CQH A;  2H1B A;  2QC7 A;  4MPF A;  3MNG A;  5IOX A;  5B8B A;  5E4W A;  1A24 A;  1TI3 A;  3CSJ A;  4JE1 A;  2E2M A;  2CAQ A;  1QGV A;  3LWA A;  3A2V A;  4ECC A;  1X5C A;  1ERT A;  4LL4 B;  4OD7 A;  2VL9 A;  2GDR A;  4RQR A;  1ST9 A;  1K0O A;  3A3T A;  3UBK A;  4PQ1 A;  4DSS B;  2PN8 A;  3BCI A;  3LXT A;  2RM5 A;  2GQK A;  2IFQ B;  1TKD B;  4OWY A;  4NPB A;  1WMJ A;  4KDX A;  5DAL B;  2O8V B;  2CX3 A;  2J9H A;  4IQA A;  3GKX A;  1WJK A;  1ABA A;  3Q19 A;  3ZFB A;  3TUE A;  3QR6 A;  2B7J A;  4TN8 A;  1GSS A;  3I6A A;  1SU9 A;  1OKD A;  1BJX A;  5H5R A;  1Z9H A;  2QSI A;  2YJ7 A;  4PNG A;  5B6M A;  4ULX A;  4HU9 A;  2E0Q A;  3GTU B;  1O7U A;  4GWR A;  3BJ5 A;  2B1L A;  2GSR A;  4L0U A;  4BVX A;  2OKA A;  4IW9 A;  5E59 A;  5J3R A;  3TJK A;  4XHM A;  5CRD A;  4TR1 B;  1XOB A;  3U5R E;  1GSD A;  3E9J B;  4KH7 A;  5D93 A;  3DVW A;  2DJ2 A;  2Z9S A;  4JBB A;  1R4W A;  1BQ7 A;  1SYX A;  2FLS A;  3VPQ A;  3M0F A;  4PUA A;  1EP7 A;  2HRF A;  3EU4 A;  2LUS A;  4ZIL A;  2IIY A;  4ZBA A;  2G2Q A;  4MMM A;  3DVX A;  10GS A;  3DYR A;  3F8U A;  3HA9 A;  1YJ6 A;  5FT3 A;  1MEK A;  3VWV A;  5COH A;  1S3D A;  4LLR A;  5ECM B;  3KD0 A;  4JED A;  4FO5 A;  4MH3 A;  1GSQ A;  3G7J A;  1R7H A;  2VM2 A;  4WR4 A;  4ILF A;  4BA7 A;  5CRH A;  1N2A A;  3QPM A;  4I2U A;  4K7O A;  2I4A A;  2WB9 A;  2GVP A;  2PGT A;  4QL9 A;  4IGJ A;  4TOP A;  1SL2 B;  1NSW A;  1AC1 A;  2GT5 A;  2V6K A;  3QD9 A;  1TK5 B;  1RW1 A;  1Z6N A;  1U87 A;  1GTU A;  4YQU A;  3GHA A;  2DJJ A;  2DJ1 A;  4MP4 A;  1V98 A;  2H0I A;  1VF4 A;  5DQS A;  5AIX A;  1T4Z A;  4EO3 A;  3ZVJ A;  2C4J A;  4ZB8 A;  4G19 A;  5GZZ B;  2X8C A;  3CTG A;  2N5A A;  1ZCP A;  2K6V A;  5F8B A;  3F6F A;  2HFD A;  3FZ5 A;  4G10 A;  1PKZ A;  5H5Q A;  4Q5R A;  2PU9 C;  2MMO A;  1EOG A;  2P5R A;  4ZL7 A;  3EE2 A;  5LD0 A;  4ZL8 A;  4MJC A;  3F4R A;  4OCF A;  2O87 A;  5IO2 A;  1N8J A;  3HZ4 A;  2IME A;  4MZB A;  1GNW A;  2CZ2 A;  1FO5 A;  1XWA A;  3GTU A;  5HR1 A;  6GST A;  2GZP A;  2CV4 A;  2EIQ A;  4DSR A;  3MAK A;  2PVQ A;  3HD5 A;  3HKR A;  4PQI A;  3F0I A;  4MJE A;  4TR1 A;  5DJL A;  4GQF A;  1KEB A;  4P3Y B;  2H0G A;  3SBC A;  1JLV A;  1XIY A;  4MZC A;  4KX4 A;  2LRC A;  1T7P B;  1U3I A;  2FA8 A;  2JAD A;  2VCT A;  1T1V A;  2H71 A;  3RPP A;  1OAZ A;  1A8Y A;  1DBY A;  4WF4 A;  4J2F A;  2NVL A;  1K0B A;  1O85 A;  2ES7 A;  4K7I A;  2DMM A;  4MZW A;  3GL5 A;  2YWI A;  3EWL A;  1V40 A;  2C3T A;  2F3M A;  4TR3 A;  3HXS A;  5HFG A;  2L4C A;  2VOC A;  1BG5 A;  4IJI A;  5DJM A;  3P7X A;  2C1Y A;  3MDK A;  4IKH A;  5J9B A;  1K0N A;  5DVB A;  4OCE A;  3TCO A;  5GAN D;  5ECO B;  2NDO A;  2CZ3 A;  3RHC A;  3O76 A;  4HQZ A;  3JCM L;  5D9W A;  1K0D A;  4KCA A;  5F0G A;  3HHV A;  3UL3 A;  3CXG A;  1UN2 A;  2HRN A;  3UVT A;  1JHB A;  1RQM A;  5GST A;  2LNT A;  2OAC A;  5DCG A;  1I9D A;  1ZMA A;  1JLW A;  2OE3 A;  2N5F A;  4EDZ A;  3I9V 2;  3HJM A;  1TXX A;  1PL2 A;  4F03 A;  3ME8 A;  1WRY A;  6GSV A;  4PXO A;  1PL1 A;  1MTC A;  2MMA A;  2YWO A;  1GP1 A;  1YQ1 A;  3LFL A;  4MLY A;  3APQ A;  2FY6 A;  4FYC A;  2B5X A;  4PNF A;  3EUR A;  3ZIT A;  1S3A A;  5J41 A;  3DRN A;  2LKU A;  1EEJ A;  1QK8 A;  1A23 A;  2MYG A;  3N9J A;  3L4N A;  4JZQ A;  4XRD A;  2DJ3 A;  2D2Z A;  3EVI A;  3E3E A;  3L9U A;  2H1A A;  4RQX A;  3KEB A;  3H93 A;  3BD2 A;  2AV4 A;  3W8S A;  4TXV A;  6GSW A;  1IYI A;  3HCZ A;  2VCZ A;  3KJY A;  4TXO B;  3ZRE A;  1M0U A;  1OC3 A;  3US3 A;  3LSZ A;  5HR3 A;  2L5L A;  3Q18 A;  4ZB9 A;  1B48 A;  4LA1 A;  1B4P A;  1X9S B;  2YPM A;  1TDI A;  2A4V A;  5FWG A;  1WOU A;  4MDC A;  1URM A;  3UJ1 A;  2E2G A;  4WEY A;  17GS A;  3DXB A;  3E0U A;  3HJO A;  3KH9 A;  5CRG A;  1SKR B;  2PUK C;  2VAF A;  1F3A A;  2YV9 A;  3C1S A;  2GTU A;  4O92 A;  1XW5 A;  2O85 A;  4GF0 A;  2KP1 A;  3D4T A;  3ISO A;  4EKZ A;  4EUY A;  5INY A;  1X5D A;  1PSQ A;  1TRU A;  2VD1 A;  5KN1 A;  4CDO A;  2LV3 A;  3IBH A;  2YP6 A;  1H75 A;  2FCH A;  4IBP A;  1X9W B;  4EXJ A;  4HQS A;  3H8Q A;  4YAP A;  3RDW A;  1GTI A;  5EVO A;  4EVM A;  2WFC A;  5D73 A;  2XPD A;  2LQO A;  1V57 A;  2BJX A;  2ZCT A;  3FYG A;  2C3N A;  4IEL A;  2R6K A;  4FH8 A;  12GS A;  1HNB A;  3LEF A;  5B6N A;  2H76 A;  1A0R P;  1ON4 A;  4TVE A;  4BVY A;  3TKR A;  4XRA A;  2KLX A;  1ZYQ B;  3ZFL A;  3KP8 A;  5D9X A;  3LXZ A;  3W6G A;  4IQ1 A;  2DC5 A;  1T00 A;  3G9B A;  5F05 A;  4V2M A;  2H74 A;  1ACV A;  2VD0 A;  3CSH A;  1GL8 A;  3F6D A;  1XCC A;  4MPG A;  1K0A A;  1FAA A;  3KXO A;  4HEA 2;  3KGK A;  3DKS A;  4N10 A;  2MBT A;  3D21 A;  2YV7 A;  4HOJ A;  5ECQ B;  2M46 A;  3KTL A;  4Q5F A;  6GSU A;  3VFI A;  3KMN A;  5AN1 A;  1JFU A;  2JU5 A;  5IPG A;  3FR6 A;  5J5N A;  5CRW A;  4BPY A;  3C8E A;  3QFA C;  3QAG A;  2GSQ A;  3C1R A;  2O89 A;  3WD6 A;  4J57 E;  3D22 A;  3A2X A;  1DE1 A;  4IVF A;  2N5B A;  2GQM A;  3IK7 A;  1M9A A;  1KBN A;  1Z3E A;  2REM A;  1PMT A;  3ZML A;  1MD3 A;  3HVV A;  5CAX A;  4HU7 A;  2CX4 A;  4N30 A;  3TGZ A;  3QMX A;  2YCD A;  2ALB A;  2GSS A;  2GQL A;  3KH7 A;  3D4M A;  3MWH A;  2L57 A;  4O7H A; 
#chains in the Genus database with same CATH topology
 2A2R A;  1K3O A;  3PIN A;  3C71 A;  3VUR A;  5ENU A;  2VL2 A;  7GSS A;  2IJY A;  1ZYP A;  5DCH A;  3GH9 A;  4ZBD A;  5ABR A;  2OA7 A;  4OO5 A;  3APO A;  3K8N A;  5ECS A;  4MF7 A;  4POB A;  4LMW A;  5DAK A;  3LOR A;  3L9S A;  3NIV A;  4ECJ A;  1OC9 A;  4ID0 A;  1AQX A;  2H6X A;  3M9J A;  2H0H A;  4KDY A;  1I5G A;  5J4U A;  4F9Z A;  1F9M A;  1GNE A;  3DWV A;  2R37 A;  1ZL9 A;  4MA9 A;  2H8L A;  3TKS A;  2JAC A;  1NW2 A;  3LYK A;  1K3L A;  1HD2 A;  2CVB A;  4K8M A;  3RAZ A;  3R2Q A;  1PX7 A;  3CSI A;  2YZH A;  5IOW A;  1PKW A;  4TR0 A;  3D5J A;  1FB6 A;  1XBS A;  2R3X A;  1DSB A;  1G7O A;  4Z7X A;  2V41 A;  1UC7 A;  2VCV A;  2WGR A;  3NOF A;  1B9Y C;  3NZN A;  4EC0 A;  2TIR A;  2UZ8 A;  2X64 A;  2GZZ A;  1EZK A;  5CYY A;  1GRX A;  4RUV A;  4FYU A;  22GS A;  5ELA A;  2FD3 A;  4CHS A;  2VUP A;  2HSH A;  4O5Q A;  3UEM A;  2C0D A;  2PBJ A;  1XVW A;  2VM1 A;  4F82 A;  4KB3 A;  1FW1 A;  1PN0 A;  1GTA A;  2H70 A;  4ECB A;  1TU8 A;  1ERU A;  1VF3 A;  5CO3 A;  1U3A A;  2H1G A;  3Q74 A;  1SKS B;  1QFN A;  4MK3 A;  4WF5 A;  3FHK A;  4DSS A;  5G2Z A;  3VWU A;  1TW9 A;  5HR0 A;  4BIK A;  2IFQ A;  2XBQ A;  20GS A;  4KND A;  2B7K A;  2KOK A;  5HQP A;  4MF6 A;  5DAL A;  2HXK A;  1K0C A;  1UA5 A;  4D73 B;  5F07 A;  3RBT A;  1CQG A;  2BMX A;  2HT9 A;  4XS6 A;  2JZR A;  3IC4 A;  1SK2 A;  4HJM A;  5CP1 A;  2RII A;  1F6M C;  4K1F A;  2DML A;  4N11 A;  1NHO A;  2DKH A;  2OBI A;  4ECI A;  3KP9 A;  4AJ6 A;  4K9Z A;  1XPV A;  4KSO A;  4KW6 A;  4H86 A;  4N0Z A;  1GWC A;  2YWM A;  3ZL5 A;  3TKQ A;  4BWQ A;  2YOI A;  2M72 A;  3C73 A;  18GS A;  2LJK A;  5IMF A;  1HNA A;  2H1D A;  2LQQ A;  4HZ2 A;  1TP9 A;  2LEG A;  3WGD A;  3TJJ A;  1GUM A;  2YAN A;  5KN0 A;  1YF0 A;  2CVD A;  2P31 A;  5G30 A;  2OE1 A;  3TJB A;  1TU7 A;  2BTO T;  5DDL A;  5AIS A;  1O81 A;  5H5S A;  1C72 A;  4KE3 A;  1AQW A;  3G7Y A;  2I9H A;  2B5E A;  19GS A;  3C7M A;  3L78 A;  1UVZ A;  3EIN A;  3M8N A;  2B5Y A;  5KOX A;  5A4V A;  2QKE A;  3CMI A;  4PTS A;  4PUR A;  2OAD A;  4F0C A;  2KP2 A;  3TJG A;  3D0Z A;  3IXR A;  2WS2 A;  1M3J A;  2HZE B;  4X1U A;  5KN3 A;  1S3R A;  1G0T A;  3P8W A;  2TRC P;  2IL3 A;  2H30 A;  5DBQ A;  3CBU A;  4OFN A;  2YN1 A;  3FR9 A;  3N5O A;  2IWT A;  2LJR A;  5HFI A;  1X0R A;  3HJP A;  2HLS A;  3TRP A;  3TKP A;  3CRT A;  5ECN B;  3GX0 A;  4L8E A;  3GIX A;  4NAX A;  4ML1 A;  1YY7 A;  4F0B A;  3IR4 A;  3FZ9 A;  2FHE A;  4RI7 A;  2MBS A;  2K8V A;  1GLP A;  1XW9 A;  1SJZ A;  4QQ7 A;  5KEJ A;  4MJA A;  5CRE A;  4KUN A;  4AJ8 A;  3VWX A;  2IMK A;  1OE7 A;  1EV4 A;  2ON7 A;  3CYN A;  1EGO A;  1GSE A;  1YDK A;  4EIP A;  4I97 A;  4XCS A;  3GRX A;  1TJD A;  4ZIJ A;  5JWO B;  3IAM 2;  4IJ3 A;  4WET A;  1G6Y A;  4NV5 A;  1G6W A;  3FRC A;  2K9F A;  1GUH A;  2JZS A;  2IPA A;  1Z6M A;  3LGC A;  4EIQ A;  4I8B A;  2GZY A;  5J9C A;  5G1K A;  5AIV A;  3GA4 A;  4K0N A;  2KUC A;  2PER A;  4EDY A;  2VCQ A;  1ERV A;  1TRS A;  1O8W A;  3KIJ A;  2H6Y A;  3DD3 A;  3QAW A;  1JZW A;  1M99 A;  4L5O A;  1FG4 A;  1XOA A;  3IPZ A;  1F2E A;  2DLX A;  1VF1 A;  1SL1 B;  1MDI A;  3HY2 A;  4KSM A;  2QGV A;  3S9F A;  3VI5 A;  4Q5N A;  2LRT A;  1FB0 A;  4OFT A;  5CNW A;  3ZIV A;  1IYH A;  5G5E A;  4NHW A;  2IMI A;  2IMF A;  5JCW A;  4HS1 A;  4IN0 A;  3F9U A;  2JL4 A;  4E8E A;  1WIK A;  3TKS E;  2GGT A;  3ZLP A;  1SK1 A;  4GCI A;  2LRN A;  4E8H A;  4XS1 A;  4WBR D;  1HNC A;  1TRW A;  1BED A;  1R5A A;  3IHG A;  3J7Y b;  1OE8 A;  1SJI A;  5GSS A;  3A5I A;  2WUL A;  1QMV A;  3F4S A;  2AAW A;  3F63 A;  2MMN A;  4TKY A;  2DJ0 A;  1AIU A;  2OBK A;  4O5R A;  5A4W A;  4KCE A;  3TRX A;  1QQ2 A;  1DE2 A;  4RI6 A;  4MCU A;  1M2D A;  4J56 E;  2L6D A;  4ZB6 A;  1V58 A;  2L5O A;  3GKM A;  5FHI A;  1J08 A;  2EIR A;  4NV2 A;  3QDN A;  2VL3 A;  3IOS A;  2V2G A;  3GFK A;  5G1L A;  1PX6 A;  1WP0 A;  3VWW A;  4YH2 A;  1SYR A;  2H01 A;  1ERW A;  1ZYE A;  4ISD A;  4BVX B;  2DKI A;  1LU4 A;  2IN3 A;  2X8G A;  2YWN A;  1AAZ A;  4N0V A;  3IDV A;  14GS A;  2YNX A;  1NM3 A;  4PUF C;  1PQN A;  3LQ7 A;  4L0W A;  1AQV A;  1VF2 A;  2FWF A;  1YEP A;  1Q98 A;  5ID2 B;  3PGT A;  1QUW A;  2FWE A;  8GSS A;  1GSY A;  4G0K A;  2VLV A;  3M9K A;  3F3Q A;  2AJQ B;  2NPB A;  3H79 A;  2ZNM A;  2V32 A;  3ED3 A;  3L9V A;  1E6B A;  1Q4J A;  2ON5 A;  1XG8 A;  4K2X A;  2EC4 A;  3O6T A;  2A4H A;  2RUE A;  1MDJ A;  5B8A A;  5BMU A;  1WWJ A;  5IMC A;  3FK8 A;  1GH2 A;  2L59 A;  4IP6 A;  4K6X A;  3WGE A;  4WKW A;  2DIZ A;  3DIE A;  3GN3 A;  1J9B A;  2VCW A;  4PQH A;  2NTO A;  3WGX A;  3GKN A;  1B4Q A;  1EGR A;  3GYK A;  4GXZ A;  4TRX A;  4GSN A;  2F8A A;  4GSS A;  1M7T A;  1WPI A;  3D6I A;  4ZL9 A;  2WZ9 A;  3ZIJ A;  1TTZ A;  3UAR A;  4XS4 B;  1M9B A;  3GSS A;  4KAE A;  4TXO A;  1PD2 1;  4TW5 A;  4YQV A;  4K2D A;  3UMA A;  1YKC A;  2J23 A;  2QA1 A;  1PN9 A;  4ICY A;  1KTE A;  3IV4 A;  3EYT A;  1BAY A;  6GSY A;  3QOU A;  2H66 A;  4POL A;  3QFB C;  1H4O A;  3UOM A;  1GUK A;  4K0G A;  1QXH A;  1XWB A;  4DEJ A;  5D8I A;  3I43 A;  1G7E A;  3KM6 A;  1EP8 A;  1YZX A;  4AJ7 A;  1PGT A;  5C00 A;  1A2M A;  4JU5 A;  2E7P A;  6GSX A;  4IHU A;  1LJR A;  5IM9 A;  2C3Q A;  4L5L A;  1FVJ A;  2WDU A;  3DML A;  1SJ6 A;  1O73 A;  5LNK e;  13GS A;  4I2T A;  1F37 A;  4OO4 A;  2MMZ A;  3QCP A;  5IMZ A;  1XW6 A;  4TR4 A;  2HZF A;  5ECI B;  1FHE A;  3IC8 A;  5G5F A;  4POK A;  3WYW A;  4HI7 A;  3LG6 A;  1NHY A;  2VO4 A;  1MD4 A;  5ECL B;  3KTB A;  3GUR A;  5JWR B;  2WJU A;  1AW9 A;  3ZMK A;  1JZO A;  1R26 A;  4GST A;  2DSA A;  4GTU A;  3TOT A;  4ZXG A;  4NXI A;  5ECH B;  1XVQ A;  1ILO A;  1FOV A;  5ID2 A;  1BYE A;  1O8X A;  3GH6 A;  1HYU A;  2LS5 A;  5F06 A;  4KA0 A;  4HZ4 A;  1YEX A;  3GST A;  4JRR A;  3LJR A;  2HE3 A;  3EMP A;  5IMD A;  4JR4 A;  5A4U A;  1EWX A;  2FA4 A;  11GS A;  5IMA A;  2RUF A;  2P5Q A;  5ECP B;  2YZU A;  2X8H A;  5IO0 A;  2EIO A;  4NHZ A;  1A0F A;  5ECK B;  2JSZ A;  1TRV A;  2CVK A;  3TOU A;  4HJ2 A;  5EY6 A;  3A5W A;  2P0G A;  2GLR A;  3BCK A;  2LST A;  1EV9 A;  3UBL A;  2C8U A;  3GUS A;  1SD9 A;  1XZO A;  5IQY A;  1U6T A;  2JZT A;  1TOF A;  1KNG A;  3A2W A;  2FWH A;  2GS3 A;  3HDC A;  1USB A;  3IHQ A;  5JWQ B;  4ML6 A;  1A2J A;  3GL3 A;  2H72 A;  2OJL A;  4PGT A;  4AF2 A;  1SL0 B;  4XS4 A;  2V1M A;  2PVO C;  1Y6E A;  5D9V A;  2X99 A;  3ERW A;  3SWL A;  2CT6 A;  5D96 A;  4Q5Q A;  4CW9 A;  1XWC A;  2LTK A;  4HUA A;  4YAV A;  4MNN A;  4V2L A;  1XXU A;  3APS A;  1U88 A;  5D9T A;  16GS A;  4DSQ A;  3HVX A;  1SK0 A;  3EC3 A;  1R5P A;  1SEN A;  3HZ8 A;  2LNS A;  4POM A;  3TB2 A;  3VPT A;  1OVN A;  3IRA A;  2I81 A;  1PRX A;  4PX1 A;  3U6V A;  1Y25 A;  1M2B A;  3RHB A;  3H1N A;  2FGX A;  2AUV A;  1THX A;  5KN2 A;  2H75 A;  4I5Q A;  3MYD A;  3TDG A;  3KMO A;  3HVS A;  2X49 A;  2C0F A;  4IP1 A;  3BOA A;  1AXD A;  5GAP D;  2XPE A;  1S3C A;  4MF5 A;  2F51 A;  3ZRD A;  2F8F A;  1OKT A;  5AGY A;  4OMV A;  3GV1 A;  5L71 A;  3PR8 A;  3KZQ A;  1THO A;  3TRQ A;  3GKK A;  2X4A A;  3V1W A;  2AYT A;  5DQY A;  1Z7R A;  2AHE A;  3UIW A;  4EF0 A;  4V2N A;  2M80 A;  4ZBB A;  3FZA A;  2B6M A;  1GLQ A;  2CQ9 A;  1OYJ A;  4OFM A;  1HQO A;  5C04 A;  3P90 A;  3ZVJ D;  2VL2 C;  5A5K A;  2HSY A;  4KDU A;  2K8S A;  5JCG A;  4ACS A;  1XWG A;  4WR5 A;  3L0H A;  4LL1 B;  3ZZX A;  1WE0 A;  2HYX A;  2KHP A;  4XIH A;  1T8E B;  1X9M B;  2HI7 A;  2VIM A;  9GSS A;  5B7C A;  5IIZ A;  1XFL A;  4EL1 A;  4Z2T A;  2GT6 A;  2XBI A;  1XWK A;  6GSS A;  5BRT A;  2VLT A;  4WBJ A;  3IAS 2;  3W8J A;  4DVC A;  1OC8 A;  3LYP A;  4KGI A;  3GX8 A;  3VI7 A;  4JR6 A;  5KOW A;  3MSZ A;  3TKS C;  2K18 A;  4V1A p;  4WXT A;  2C0E A;  2G0F A;  3FMW A;  2PMT A;  1GUL A;  2VCX A;  1T3B A;  1EEM A;  3ZTL A;  1ZOF A;  3FKF A;  5EPF A;  1JZD A;  2H73 A;  4BVY B;  4FYB A;  4BL7 B;  1AUC A;  4NMU A;  5ECR B;  2CAI A;  1GSU A;  1A8L A;  3ERF A;  5IPH A;  2O7K A;  5G31 A;  3P2A A;  4D73 A;  2R5G A;  4FIW A;  3M1G A;  3GNJ A;  4LMV A;  2F9S A;  1YKA A;  3EMX A;  1JZR A;  1K0M A;  4X43 A;  4X4J A;  2DJK A;  1DUG A;  2NBS A;  2RLI A;  1VRS D;  4K5R A;  2MZC A;  3VLN A;  2I3Y A;  4GQC A;  1RK4 A;  4GRF A;  3RPN A;  3EU3 A;  1LBK A;  2C80 A;  2FNO A;  2XC2 A;  2XHF A;  3F3R A;  4V1A g;  3IK9 A;  2WRT A;  2I1U A;  4G0L A;  1V2A A;  1ZGN A;  1X5E A;  4G2E A;  4AGS A;  4QL7 A;  2L4Q A;  2IMD A;  3J7Y k;  5IMV A;  1Z7P A;  5HFK A;  1T4Y A;  3HYP A;  3IA1 A;  4NWY A;  4Z2U A;  3FY7 A;  1MDK A;  3G7I A;  2B1K A;  5ELG A;  1SD8 A;  4MAB A;  1GTB A;  2FWG A;  2HNL A;  3OR5 A;  4YQM A;  2OE0 A;  3O3T A;  1V9W A;  3QAV A;  2GST A;  4O32 A;  2YJH A;  2DBC A;  2PWJ A;  1TK0 B;  1B9X C;  3F4T A;  3FW2 A;  3DGQ A;  4BWS A;  3WT2 A;  3HVN A;  2JSY A;  2HZE A;  2V6O A;  4K7N A;  1VGL A;  5EL8 A;  2CA8 A;  1SKW B;  2VLU A;  1M2A A;  1W89 A;  1TI1 A;  1F3B A;  3FEU A;  1YF1 A;  2H19 A;  2A2S A;  3ME7 A;  3FZ4 A;  1E2Y A;  3I69 A;  3IE3 A;  2H6Z A;  1TK8 B;  1EOH A;  2A2P A;  4XTS A;  3BBY A;  3VK9 A;  4CY8 A;  1B8X A;  5HR2 A;  5JCU A;  4GLT A;  4MJB A;  1GSF A;  3CRU A;  2FUG 2;  1ML6 A;  5DAK B;  4G9H A;  2B3S A;  1Z5Y E;  3TJF A;  4MH2 A;  3H4K A;  1OC9 B;  3GMF A;  2PPT A;  3M3M A;  3FR3 A;  1A2L A;  3ERG A;  4IS0 A;  3AY8 A;  2DIY A;  3ZYW A;  2R2J A;  4BL7 A;  2L6C A;  3EPT A;  2AB6 A;  5LCZ A;  1O6J A;  2LJA A;  1BX9 A;  2WCI A;  4F2I A;  3CTF A;  1W4V A;  2RM6 A;  1J0F A;  4G0I A;  4EE0 A;  4HDE A;  1FVK A;  3WT1 A;  2R4V A;  2R0P A;  3UVH A;  1PA3 A;  2TRX A;  3UAP A;  4X0X A;  3DEX A;  2C0G A;  3PH9 A;  1FOH A;  1K3Y A;  3Q6O A;  1ZZY A;  3KCM A;  4I6X A;  2ZUP A;  1CQH A;  2H1B A;  2QC7 A;  4MPF A;  3MNG A;  5IOX A;  5B8B A;  5E4W A;  1A24 A;  4O5U A;  2R0G A;  1TI3 A;  3CSJ A;  4JE1 A;  2E2M A;  2CAQ A;  1QGV A;  3LWA A;  3A2V A;  4ECC A;  1X5C A;  3R3E A;  1ERT A;  4LL4 B;  4A5P A;  4OD7 A;  2VL9 A;  2GDR A;  4RQR A;  2HRA A;  1ST9 A;  1K0O A;  3A3T A;  3UBK A;  4PQ1 A;  4DSS B;  2PN8 A;  3BCI A;  3LXT A;  2RM5 A;  2GQK A;  2IFQ B;  1TKD B;  4OWY A;  4NPB A;  4YKG A;  1WMJ A;  4KDX A;  5DAL B;  2O8V B;  2CX3 A;  2J9H A;  4IQA A;  3GKX A;  1WJK A;  1ABA A;  3Q19 A;  3ZFB A;  3TUE A;  3QR6 A;  2B7J A;  4TN8 A;  1GSS A;  3I6A A;  1SU9 A;  1OKD A;  1BJX A;  5H5R A;  1Z9H A;  2QSI A;  2YJ7 A;  4PNG A;  5B6M A;  4ULX A;  4Z2R A;  4HU9 A;  2E0Q A;  3GTU B;  1O7U A;  4GWR A;  3BJ5 A;  2B1L A;  2GSR A;  4L0U A;  4BVX A;  2OKA A;  4IW9 A;  5E59 A;  5J3R A;  3TJK A;  4XHM A;  5CRD A;  4TR1 B;  1XOB A;  3U5R E;  1GSD A;  3E9J B;  4KH7 A;  5D93 A;  3DVW A;  2DJ2 A;  2Z9S A;  4JBB A;  1R4W A;  1BQ7 A;  1SYX A;  2FLS A;  3VPQ A;  3M0F A;  4KF9 A;  4PUA A;  1EP7 A;  2HRF A;  3EU4 A;  2LUS A;  4ZIL A;  2IIY A;  4ZBA A;  2G2Q A;  4MMM A;  3DVX A;  10GS A;  3DYR A;  3F8U A;  3HA9 A;  1YJ6 A;  5FT3 A;  1MEK A;  3VWV A;  5COH A;  1S3D A;  4LLR A;  5ECM B;  3KD0 A;  2R0C A;  4JED A;  4FO5 A;  4MH3 A;  1GSQ A;  3G7J A;  1R7H A;  2VM2 A;  4WR4 A;  4ILF A;  4BA7 A;  5CRH A;  1N2A A;  3QPM A;  4I2U A;  4K7O A;  2I4A A;  2WB9 A;  2GVP A;  2PGT A;  4QL9 A;  4IGJ A;  4TOP A;  1SL2 B;  1NSW A;  2QA2 A;  1AC1 A;  2GT5 A;  3CQF A;  2V6K A;  3QD9 A;  1TK5 B;  1RW1 A;  1Z6N A;  1U87 A;  1GTU A;  4YQU A;  3GHA A;  2DJJ A;  2DJ1 A;  4MP4 A;  1V98 A;  2H0I A;  1VF4 A;  5DQS A;  5AIX A;  1T4Z A;  4EO3 A;  3ZVJ A;  2C4J A;  4ZB8 A;  4G19 A;  5GZZ B;  2X8C A;  3CTG A;  2N5A A;  1PFO A;  1ZCP A;  4K5S A;  2K6V A;  5F8B A;  3F6F A;  2HFD A;  3FZ5 A;  4G10 A;  1PKZ A;  5H5Q A;  4Q5R A;  2PU9 C;  2MMO A;  1EOG A;  2P5R A;  4ZL7 A;  3EE2 A;  5LD0 A;  4ZL8 A;  4MJC A;  3F4R A;  4OCF A;  2O87 A;  5IO2 A;  1N8J A;  3HZ4 A;  2IME A;  4MZB A;  1GNW A;  2CZ2 A;  4YKF A;  1FO5 A;  1XWA A;  3GTU A;  5HR1 A;  6GST A;  2GZP A;  2CV4 A;  2EIQ A;  4DSR A;  3MAK A;  2PVQ A;  3HD5 A;  3HKR A;  4PQI A;  3F0I A;  4MJE A;  4TR1 A;  5DJL A;  4GQF A;  1KEB A;  4P3Y B;  2H0G A;  3SBC A;  1JLV A;  1XIY A;  4MZC A;  4KX4 A;  2LRC A;  1T7P B;  1U3I A;  2FA8 A;  2JAD A;  2VCT A;  1T1V A;  2H71 A;  3RPP A;  1OAZ A;  1A8Y A;  1DBY A;  4WF4 A;  4J2F A;  3MIX A;  2NVL A;  1K0B A;  1O85 A;  2ES7 A;  4K7I A;  2DMM A;  4MZW A;  3GL5 A;  2YWI A;  3EWL A;  1V40 A;  2C3T A;  2F3M A;  4TR3 A;  3HXS A;  5HFG A;  2L4C A;  2VOC A;  1BG5 A;  4IJI A;  5DJM A;  3P7X A;  2C1Y A;  3MDK A;  4IKH A;  5J9B A;  1K0N A;  5DVB A;  4OCE A;  3TCO A;  5GAN D;  5ECO B;  2NDO A;  2CZ3 A;  3RHC A;  3O76 A;  4HQZ A;  3JCM L;  5D9W A;  1K0D A;  4KCA A;  5F0G A;  3HHV A;  3UL3 A;  3CXG A;  1UN2 A;  3PPU A;  2HRN A;  3UVT A;  1JHB A;  1RQM A;  5GST A;  2LNT A;  2OAC A;  5DCG A;  1I9D A;  1ZMA A;  1JLW A;  2OE3 A;  2N5F A;  4EDZ A;  3I9V 2;  3HJM A;  1TXX A;  1PL2 A;  4FQU A;  4F03 A;  3ME8 A;  1WRY A;  6GSV A;  4PXO A;  1PL1 A;  1MTC A;  2MMA A;  2YWO A;  1GP1 A;  1YQ1 A;  3LFL A;  4MLY A;  4HSC X;  3APQ A;  2FY6 A;  4FYC A;  2B5X A;  4PNF A;  3EUR A;  2HRK A;  3ZIT A;  1S3A A;  5J41 A;  3DRN A;  2LKU A;  1EEJ A;  1QK8 A;  1A23 A;  2MYG A;  3N9J A;  3L4N A;  4JZQ A;  4XRD A;  2DJ3 A;  2D2Z A;  3EVI A;  3E3E A;  3L9U A;  2H1A A;  4RQX A;  3KEB A;  3H93 A;  3BD2 A;  2AV4 A;  3W8S A;  4TXV A;  6GSW A;  1IYI A;  3HCZ A;  2VCZ A;  3KJY A;  4TXO B;  3ZRE A;  1M0U A;  1OC3 A;  3US3 A;  3LSZ A;  5HR3 A;  2L5L A;  3Q18 A;  4ZB9 A;  1B48 A;  4LA1 A;  1B4P A;  1X9S B;  2YPM A;  1TDI A;  2A4V A;  5FWG A;  1WOU A;  4MDC A;  1URM A;  3UJ1 A;  2E2G A;  4WEY A;  17GS A;  3DXB A;  3E0U A;  3HJO A;  3KH9 A;  5CRG A;  1SKR B;  2PUK C;  2VAF A;  1F3A A;  2YV9 A;  3C1S A;  2GTU A;  2HSM A;  4O92 A;  1XW5 A;  2O85 A;  4GF0 A;  2KP1 A;  3D4T A;  3ISO A;  4EKZ A;  4EUY A;  5INY A;  1X5D A;  1PSQ A;  1TRU A;  2VD1 A;  5KN1 A;  4CDO A;  2LV3 A;  3IBH A;  2YP6 A;  1H75 A;  2FCH A;  4IBP A;  1X9W B;  4EXJ A;  4HQS A;  3H8Q A;  4YAP A;  3RDW A;  1GTI A;  5EVO A;  4EVM A;  2WFC A;  5D73 A;  2XPD A;  1ZYN A;  2LQO A;  1M3I A;  1V57 A;  2BJX A;  2ZCT A;  3FYG A;  2C3N A;  4IEL A;  2R6K A;  4FH8 A;  12GS A;  1HNB A;  3LEF A;  5B6N A;  2H76 A;  1A0R P;  1ON4 A;  4TVE A;  3LW9 A;  4BVY A;  3TKR A;  4XRA A;  2KLX A;  1ZYQ B;  3ZFL A;  3KP8 A;  5D9X A;  3LXZ A;  3W6G A;  4IQ1 A;  2DC5 A;  1T00 A;  3G9B A;  5F05 A;  4V2M A;  2H74 A;  1ACV A;  2VD0 A;  3CSH A;  1GL8 A;  3F6D A;  1XCC A;  4MPG A;  1K0A A;  1FAA A;  3KXO A;  4HEA 2;  3KGK A;  3DKS A;  4N10 A;  2MBT A;  3D21 A;  2YV7 A;  4HOJ A;  5ECQ B;  2M46 A;  3KTL A;  4Q5F A;  6GSU A;  3VFI A;  3KMN A;  4USS A;  5AN1 A;  1JFU A;  2JU5 A;  5IPG A;  3FR6 A;  5J5N A;  5CRW A;  4BPY A;  3C8E A;  3QFA C;  3QAG A;  2GSQ A;  3C1R A;  2O89 A;  3WD6 A;  4J57 E;  3D22 A;  3A2X A;  1DE1 A;  4IVF A;  2N5B A;  2GQM A;  3IK7 A;  1M9A A;  4CY6 A;  1KBN A;  1Z3E A;  2REM A;  1PMT A;  3ZML A;  1MD3 A;  3HVV A;  5CAX A;  4HU7 A;  2CX4 A;  4N30 A;  3TGZ A;  3QMX A;  2YCD A;  2ALB A;  2GSS A;  2GQL A;  3KH7 A;  3D4M A;  3MWH A;  2L57 A;  4O7H A; 
#chains in the Genus database with same CATH homology
 2A2R A;  1K3O A;  3PIN A;  3C71 A;  3VUR A;  5ENU A;  2VL2 A;  7GSS A;  2IJY A;  1ZYP A;  5DCH A;  3GH9 A;  4ZBD A;  5ABR A;  2OA7 A;  4OO5 A;  3APO A;  3K8N A;  5ECS A;  4MF7 A;  4POB A;  4LMW A;  5DAK A;  3LOR A;  3L9S A;  3NIV A;  4ECJ A;  1OC9 A;  4ID0 A;  1AQX A;  2H6X A;  3M9J A;  2H0H A;  4KDY A;  1I5G A;  5J4U A;  4F9Z A;  1F9M A;  1GNE A;  3DWV A;  2R37 A;  1ZL9 A;  4MA9 A;  2H8L A;  3TKS A;  2JAC A;  1NW2 A;  3LYK A;  1K3L A;  1HD2 A;  2CVB A;  4K8M A;  3RAZ A;  3R2Q A;  1PX7 A;  3CSI A;  2YZH A;  5IOW A;  1PKW A;  4TR0 A;  3D5J A;  1FB6 A;  1XBS A;  2R3X A;  1DSB A;  1G7O A;  4Z7X A;  2V41 A;  1UC7 A;  2VCV A;  2WGR A;  3NOF A;  1B9Y C;  3NZN A;  4EC0 A;  2TIR A;  2UZ8 A;  2X64 A;  2GZZ A;  1EZK A;  5CYY A;  1GRX A;  4RUV A;  4FYU A;  22GS A;  5ELA A;  2FD3 A;  4CHS A;  2VUP A;  2HSH A;  4O5Q A;  3UEM A;  2C0D A;  2PBJ A;  1XVW A;  2VM1 A;  4F82 A;  4KB3 A;  1FW1 A;  1PN0 A;  1GTA A;  2H70 A;  4ECB A;  1TU8 A;  1ERU A;  1VF3 A;  5CO3 A;  1U3A A;  2H1G A;  3Q74 A;  1SKS B;  1QFN A;  4MK3 A;  4WF5 A;  3FHK A;  4DSS A;  5G2Z A;  3VWU A;  1TW9 A;  5HR0 A;  2IFQ A;  2XBQ A;  20GS A;  4KND A;  2B7K A;  2KOK A;  5HQP A;  4MF6 A;  5DAL A;  2HXK A;  1K0C A;  1UA5 A;  4D73 B;  5F07 A;  3RBT A;  1CQG A;  2BMX A;  2HT9 A;  4XS6 A;  2JZR A;  3IC4 A;  1SK2 A;  4HJM A;  5CP1 A;  2RII A;  1F6M C;  4K1F A;  2DML A;  4N11 A;  1NHO A;  2DKH A;  2OBI A;  4ECI A;  3KP9 A;  4AJ6 A;  4K9Z A;  1XPV A;  4KSO A;  4KW6 A;  4H86 A;  4N0Z A;  1GWC A;  2YWM A;  3ZL5 A;  3TKQ A;  4BWQ A;  2YOI A;  2M72 A;  3C73 A;  18GS A;  2LJK A;  5IMF A;  1HNA A;  2H1D A;  2LQQ A;  4HZ2 A;  1TP9 A;  2LEG A;  3WGD A;  3TJJ A;  1GUM A;  2YAN A;  5KN0 A;  1YF0 A;  2CVD A;  2P31 A;  5G30 A;  2OE1 A;  3TJB A;  1TU7 A;  2BTO T;  5DDL A;  5AIS A;  1O81 A;  5H5S A;  1C72 A;  4KE3 A;  1AQW A;  3G7Y A;  2I9H A;  2B5E A;  19GS A;  3C7M A;  3L78 A;  1UVZ A;  3EIN A;  3M8N A;  2B5Y A;  5KOX A;  5A4V A;  2QKE A;  3CMI A;  4PTS A;  4PUR A;  2OAD A;  4F0C A;  2KP2 A;  3TJG A;  3D0Z A;  3IXR A;  2WS2 A;  2HZE B;  4X1U A;  5KN3 A;  1G0T A;  3P8W A;  2TRC P;  2IL3 A;  2H30 A;  5DBQ A;  3CBU A;  4OFN A;  2YN1 A;  3FR9 A;  3N5O A;  2IWT A;  2LJR A;  5HFI A;  1X0R A;  3HJP A;  2HLS A;  3TRP A;  3TKP A;  3CRT A;  5ECN B;  3GX0 A;  4L8E A;  3GIX A;  4NAX A;  4ML1 A;  1YY7 A;  4F0B A;  3IR4 A;  3FZ9 A;  2FHE A;  4RI7 A;  2MBS A;  2K8V A;  1GLP A;  1XW9 A;  1SJZ A;  4QQ7 A;  5KEJ A;  4MJA A;  5CRE A;  4KUN A;  4AJ8 A;  3VWX A;  2IMK A;  1OE7 A;  1EV4 A;  2ON7 A;  3CYN A;  1EGO A;  1GSE A;  1YDK A;  4EIP A;  4I97 A;  4XCS A;  3GRX A;  1TJD A;  4ZIJ A;  5JWO B;  3IAM 2;  4IJ3 A;  4WET A;  1G6Y A;  4NV5 A;  1G6W A;  3FRC A;  2K9F A;  1GUH A;  2JZS A;  2IPA A;  1Z6M A;  3LGC A;  4EIQ A;  4I8B A;  2GZY A;  5J9C A;  5G1K A;  5AIV A;  3GA4 A;  4K0N A;  2KUC A;  2PER A;  4EDY A;  2VCQ A;  1ERV A;  1TRS A;  1O8W A;  3KIJ A;  2H6Y A;  3DD3 A;  3QAW A;  1JZW A;  1M99 A;  4L5O A;  1FG4 A;  1XOA A;  3IPZ A;  1F2E A;  2DLX A;  1VF1 A;  1SL1 B;  1MDI A;  3HY2 A;  4KSM A;  2QGV A;  3S9F A;  3VI5 A;  4Q5N A;  2LRT A;  1FB0 A;  4OFT A;  5CNW A;  3ZIV A;  1IYH A;  5G5E A;  4NHW A;  2IMI A;  2IMF A;  5JCW A;  4HS1 A;  4IN0 A;  3F9U A;  2JL4 A;  4E8E A;  1WIK A;  3TKS E;  2GGT A;  3ZLP A;  1SK1 A;  4GCI A;  2LRN A;  4E8H A;  4XS1 A;  4WBR D;  1HNC A;  1TRW A;  1BED A;  1R5A A;  3IHG A;  3J7Y b;  1OE8 A;  1SJI A;  5GSS A;  3A5I A;  2WUL A;  1QMV A;  3F4S A;  2AAW A;  3F63 A;  2MMN A;  4TKY A;  2DJ0 A;  1AIU A;  2OBK A;  4O5R A;  5A4W A;  4KCE A;  3TRX A;  1QQ2 A;  1DE2 A;  4RI6 A;  4MCU A;  1M2D A;  4J56 E;  2L6D A;  4ZB6 A;  1V58 A;  2L5O A;  3GKM A;  5FHI A;  1J08 A;  2EIR A;  4NV2 A;  3QDN A;  2VL3 A;  3IOS A;  2V2G A;  3GFK A;  5G1L A;  1PX6 A;  1WP0 A;  3VWW A;  4YH2 A;  1SYR A;  2H01 A;  1ERW A;  1ZYE A;  4ISD A;  4BVX B;  2DKI A;  1LU4 A;  2IN3 A;  2X8G A;  2YWN A;  1AAZ A;  4N0V A;  3IDV A;  14GS A;  2YNX A;  1NM3 A;  4PUF C;  1PQN A;  3LQ7 A;  4L0W A;  1AQV A;  1VF2 A;  2FWF A;  1YEP A;  1Q98 A;  5ID2 B;  3PGT A;  1QUW A;  2FWE A;  8GSS A;  1GSY A;  4G0K A;  2VLV A;  3M9K A;  3F3Q A;  2AJQ B;  2NPB A;  3H79 A;  2ZNM A;  2V32 A;  3ED3 A;  3L9V A;  1E6B A;  1Q4J A;  2ON5 A;  4K2X A;  2EC4 A;  3O6T A;  2A4H A;  2RUE A;  1MDJ A;  5B8A A;  5BMU A;  1WWJ A;  5IMC A;  3FK8 A;  1GH2 A;  2L59 A;  4IP6 A;  4K6X A;  3WGE A;  4WKW A;  2DIZ A;  3DIE A;  3GN3 A;  1J9B A;  2VCW A;  4PQH A;  2NTO A;  3WGX A;  3GKN A;  1B4Q A;  1EGR A;  3GYK A;  4GXZ A;  4TRX A;  4GSN A;  2F8A A;  4GSS A;  1M7T A;  1WPI A;  3D6I A;  4ZL9 A;  2WZ9 A;  3ZIJ A;  1TTZ A;  3UAR A;  4XS4 B;  1M9B A;  3GSS A;  4KAE A;  4TXO A;  1PD2 1;  4TW5 A;  4YQV A;  4K2D A;  3UMA A;  1YKC A;  2J23 A;  2QA1 A;  1PN9 A;  4ICY A;  1KTE A;  3IV4 A;  3EYT A;  1BAY A;  6GSY A;  3QOU A;  2H66 A;  4POL A;  3QFB C;  1H4O A;  3UOM A;  1GUK A;  4K0G A;  1QXH A;  1XWB A;  4DEJ A;  5D8I A;  3I43 A;  1G7E A;  3KM6 A;  1EP8 A;  1YZX A;  4AJ7 A;  1PGT A;  5C00 A;  1A2M A;  4JU5 A;  2E7P A;  6GSX A;  4IHU A;  1LJR A;  5IM9 A;  2C3Q A;  4L5L A;  1FVJ A;  2WDU A;  3DML A;  1SJ6 A;  1O73 A;  5LNK e;  13GS A;  4I2T A;  1F37 A;  4OO4 A;  2MMZ A;  3QCP A;  5IMZ A;  1XW6 A;  4TR4 A;  2HZF A;  5ECI B;  1FHE A;  3IC8 A;  5G5F A;  4POK A;  3WYW A;  4HI7 A;  3LG6 A;  1NHY A;  2VO4 A;  1MD4 A;  5ECL B;  3KTB A;  3GUR A;  5JWR B;  2WJU A;  1AW9 A;  3ZMK A;  1JZO A;  1R26 A;  4GST A;  2DSA A;  4GTU A;  3TOT A;  4ZXG A;  4NXI A;  5ECH B;  1XVQ A;  1ILO A;  1FOV A;  5ID2 A;  1BYE A;  1O8X A;  3GH6 A;  1HYU A;  2LS5 A;  5F06 A;  4KA0 A;  4HZ4 A;  1YEX A;  3GST A;  4JRR A;  3LJR A;  2HE3 A;  3EMP A;  5IMD A;  4JR4 A;  5A4U A;  1EWX A;  2FA4 A;  11GS A;  5IMA A;  2RUF A;  2P5Q A;  5ECP B;  2YZU A;  2X8H A;  5IO0 A;  2EIO A;  4NHZ A;  1A0F A;  5ECK B;  2JSZ A;  1TRV A;  2CVK A;  3TOU A;  4HJ2 A;  5EY6 A;  3A5W A;  2P0G A;  2GLR A;  3BCK A;  2LST A;  1EV9 A;  3UBL A;  2C8U A;  3GUS A;  1SD9 A;  1XZO A;  5IQY A;  1U6T A;  2JZT A;  1TOF A;  1KNG A;  3A2W A;  2FWH A;  2GS3 A;  3HDC A;  1USB A;  3IHQ A;  5JWQ B;  4ML6 A;  1A2J A;  3GL3 A;  2H72 A;  2OJL A;  4PGT A;  4AF2 A;  1SL0 B;  4XS4 A;  2V1M A;  2PVO C;  1Y6E A;  5D9V A;  2X99 A;  3ERW A;  3SWL A;  2CT6 A;  5D96 A;  4Q5Q A;  4CW9 A;  1XWC A;  2LTK A;  4HUA A;  4YAV A;  4MNN A;  4V2L A;  1XXU A;  3APS A;  1U88 A;  5D9T A;  16GS A;  4DSQ A;  3HVX A;  1SK0 A;  3EC3 A;  1R5P A;  1SEN A;  3HZ8 A;  2LNS A;  4POM A;  3TB2 A;  3VPT A;  1OVN A;  3IRA A;  2I81 A;  1PRX A;  4PX1 A;  3U6V A;  1Y25 A;  1M2B A;  3RHB A;  3H1N A;  2FGX A;  2AUV A;  1THX A;  5KN2 A;  2H75 A;  4I5Q A;  3MYD A;  3TDG A;  3KMO A;  3HVS A;  2X49 A;  2C0F A;  4IP1 A;  3BOA A;  1AXD A;  5GAP D;  2XPE A;  1S3C A;  4MF5 A;  2F51 A;  3ZRD A;  2F8F A;  1OKT A;  5AGY A;  4OMV A;  3GV1 A;  5L71 A;  3PR8 A;  3KZQ A;  1THO A;  3TRQ A;  3GKK A;  2X4A A;  3V1W A;  2AYT A;  5DQY A;  1Z7R A;  2AHE A;  3UIW A;  4EF0 A;  4V2N A;  2M80 A;  4ZBB A;  3FZA A;  2B6M A;  1GLQ A;  2CQ9 A;  1OYJ A;  4OFM A;  1HQO A;  5C04 A;  3P90 A;  3ZVJ D;  2VL2 C;  5A5K A;  2HSY A;  4KDU A;  2K8S A;  5JCG A;  4ACS A;  1XWG A;  4WR5 A;  3L0H A;  4LL1 B;  3ZZX A;  1WE0 A;  2HYX A;  2KHP A;  4XIH A;  1T8E B;  1X9M B;  2HI7 A;  2VIM A;  9GSS A;  5B7C A;  5IIZ A;  1XFL A;  4EL1 A;  4Z2T A;  2GT6 A;  2XBI A;  1XWK A;  6GSS A;  5BRT A;  2VLT A;  4WBJ A;  3IAS 2;  3W8J A;  4DVC A;  1OC8 A;  3LYP A;  4KGI A;  3GX8 A;  3VI7 A;  4JR6 A;  5KOW A;  3MSZ A;  3TKS C;  2K18 A;  4V1A p;  4WXT A;  2C0E A;  2G0F A;  3FMW A;  2PMT A;  1GUL A;  2VCX A;  1T3B A;  1EEM A;  3ZTL A;  1ZOF A;  3FKF A;  5EPF A;  1JZD A;  2H73 A;  4BVY B;  4FYB A;  4BL7 B;  1AUC A;  4NMU A;  5ECR B;  2CAI A;  1GSU A;  1A8L A;  3ERF A;  5IPH A;  2O7K A;  5G31 A;  3P2A A;  4D73 A;  2R5G A;  4FIW A;  3M1G A;  3GNJ A;  4LMV A;  2F9S A;  1YKA A;  3EMX A;  1JZR A;  1K0M A;  4X43 A;  4X4J A;  2DJK A;  1DUG A;  2NBS A;  2RLI A;  1VRS D;  4K5R A;  2MZC A;  3VLN A;  2I3Y A;  4GQC A;  1RK4 A;  4GRF A;  3RPN A;  3EU3 A;  1LBK A;  2C80 A;  2FNO A;  2XC2 A;  2XHF A;  3F3R A;  4V1A g;  3IK9 A;  2WRT A;  2I1U A;  4G0L A;  1V2A A;  1ZGN A;  1X5E A;  4G2E A;  4AGS A;  4QL7 A;  2L4Q A;  2IMD A;  3J7Y k;  5IMV A;  1Z7P A;  5HFK A;  1T4Y A;  3HYP A;  3IA1 A;  4NWY A;  4Z2U A;  3FY7 A;  1MDK A;  3G7I A;  2B1K A;  5ELG A;  1SD8 A;  4MAB A;  1GTB A;  2FWG A;  2HNL A;  3OR5 A;  4YQM A;  2OE0 A;  3O3T A;  1V9W A;  3QAV A;  2GST A;  4O32 A;  2YJH A;  2DBC A;  2PWJ A;  1TK0 B;  1B9X C;  3F4T A;  3FW2 A;  3DGQ A;  4BWS A;  3WT2 A;  2JSY A;  2HZE A;  2V6O A;  4K7N A;  1VGL A;  5EL8 A;  2CA8 A;  1SKW B;  2VLU A;  1M2A A;  1W89 A;  1TI1 A;  1F3B A;  3FEU A;  1YF1 A;  2H19 A;  2A2S A;  3ME7 A;  3FZ4 A;  1E2Y A;  3I69 A;  3IE3 A;  2H6Z A;  1TK8 B;  1EOH A;  2A2P A;  4XTS A;  3BBY A;  3VK9 A;  4CY8 A;  1B8X A;  5HR2 A;  5JCU A;  4GLT A;  4MJB A;  1GSF A;  3CRU A;  2FUG 2;  1ML6 A;  5DAK B;  4G9H A;  2B3S A;  1Z5Y E;  3TJF A;  4MH2 A;  3H4K A;  1OC9 B;  3GMF A;  2PPT A;  3M3M A;  3FR3 A;  1A2L A;  3ERG A;  4IS0 A;  3AY8 A;  2DIY A;  3ZYW A;  2R2J A;  4BL7 A;  2L6C A;  3EPT A;  2AB6 A;  5LCZ A;  1O6J A;  2LJA A;  1BX9 A;  2WCI A;  4F2I A;  3CTF A;  1W4V A;  2RM6 A;  1J0F A;  4G0I A;  4EE0 A;  4HDE A;  1FVK A;  3WT1 A;  2R4V A;  2R0P A;  3UVH A;  1PA3 A;  2TRX A;  3UAP A;  4X0X A;  3DEX A;  2C0G A;  3PH9 A;  1FOH A;  1K3Y A;  3Q6O A;  1ZZY A;  3KCM A;  4I6X A;  2ZUP A;  1CQH A;  2H1B A;  2QC7 A;  4MPF A;  3MNG A;  5IOX A;  5B8B A;  5E4W A;  1A24 A;  4O5U A;  2R0G A;  1TI3 A;  3CSJ A;  4JE1 A;  2E2M A;  2CAQ A;  1QGV A;  3LWA A;  3A2V A;  4ECC A;  1X5C A;  3R3E A;  1ERT A;  4LL4 B;  4A5P A;  4OD7 A;  2VL9 A;  2GDR A;  4RQR A;  2HRA A;  1ST9 A;  1K0O A;  3A3T A;  3UBK A;  4PQ1 A;  4DSS B;  2PN8 A;  3BCI A;  3LXT A;  2RM5 A;  2GQK A;  2IFQ B;  1TKD B;  4OWY A;  4NPB A;  4YKG A;  1WMJ A;  4KDX A;  5DAL B;  2O8V B;  2CX3 A;  2J9H A;  4IQA A;  3GKX A;  1WJK A;  1ABA A;  3Q19 A;  3ZFB A;  3TUE A;  3QR6 A;  2B7J A;  4TN8 A;  1GSS A;  3I6A A;  1SU9 A;  1OKD A;  1BJX A;  5H5R A;  1Z9H A;  2QSI A;  2YJ7 A;  4PNG A;  5B6M A;  4ULX A;  4Z2R A;  4HU9 A;  2E0Q A;  3GTU B;  1O7U A;  4GWR A;  3BJ5 A;  2B1L A;  2GSR A;  4L0U A;  4BVX A;  2OKA A;  4IW9 A;  5E59 A;  5J3R A;  3TJK A;  4XHM A;  5CRD A;  4TR1 B;  1XOB A;  3U5R E;  1GSD A;  3E9J B;  4KH7 A;  5D93 A;  3DVW A;  2DJ2 A;  2Z9S A;  4JBB A;  1R4W A;  1BQ7 A;  1SYX A;  2FLS A;  3VPQ A;  3M0F A;  4KF9 A;  4PUA A;  1EP7 A;  2HRF A;  3EU4 A;  2LUS A;  4ZIL A;  2IIY A;  4ZBA A;  2G2Q A;  4MMM A;  3DVX A;  10GS A;  3DYR A;  3F8U A;  3HA9 A;  1YJ6 A;  5FT3 A;  1MEK A;  3VWV A;  5COH A;  1S3D A;  4LLR A;  5ECM B;  3KD0 A;  2R0C A;  4JED A;  4FO5 A;  4MH3 A;  1GSQ A;  3G7J A;  1R7H A;  2VM2 A;  4WR4 A;  4ILF A;  4BA7 A;  5CRH A;  1N2A A;  3QPM A;  4I2U A;  4K7O A;  2I4A A;  2WB9 A;  2GVP A;  2PGT A;  4QL9 A;  4IGJ A;  4TOP A;  1SL2 B;  1NSW A;  2QA2 A;  1AC1 A;  2GT5 A;  2V6K A;  3QD9 A;  1TK5 B;  1RW1 A;  1Z6N A;  1U87 A;  1GTU A;  4YQU A;  3GHA A;  2DJJ A;  2DJ1 A;  4MP4 A;  1V98 A;  2H0I A;  1VF4 A;  5DQS A;  5AIX A;  1T4Z A;  4EO3 A;  3ZVJ A;  2C4J A;  4ZB8 A;  4G19 A;  5GZZ B;  2X8C A;  3CTG A;  2N5A A;  1ZCP A;  4K5S A;  2K6V A;  5F8B A;  3F6F A;  2HFD A;  3FZ5 A;  4G10 A;  1PKZ A;  5H5Q A;  4Q5R A;  2PU9 C;  2MMO A;  1EOG A;  2P5R A;  4ZL7 A;  3EE2 A;  5LD0 A;  4ZL8 A;  4MJC A;  3F4R A;  4OCF A;  2O87 A;  5IO2 A;  1N8J A;  3HZ4 A;  2IME A;  4MZB A;  1GNW A;  2CZ2 A;  4YKF A;  1FO5 A;  1XWA A;  3GTU A;  5HR1 A;  6GST A;  2GZP A;  2CV4 A;  2EIQ A;  4DSR A;  3MAK A;  2PVQ A;  3HD5 A;  3HKR A;  4PQI A;  3F0I A;  4MJE A;  4TR1 A;  5DJL A;  4GQF A;  1KEB A;  4P3Y B;  2H0G A;  3SBC A;  1JLV A;  1XIY A;  4MZC A;  4KX4 A;  2LRC A;  1T7P B;  1U3I A;  2FA8 A;  2JAD A;  2VCT A;  1T1V A;  2H71 A;  3RPP A;  1OAZ A;  1A8Y A;  1DBY A;  4WF4 A;  4J2F A;  3MIX A;  2NVL A;  1K0B A;  1O85 A;  2ES7 A;  4K7I A;  2DMM A;  4MZW A;  3GL5 A;  2YWI A;  3EWL A;  1V40 A;  2C3T A;  2F3M A;  4TR3 A;  3HXS A;  5HFG A;  2L4C A;  2VOC A;  1BG5 A;  4IJI A;  5DJM A;  3P7X A;  2C1Y A;  3MDK A;  4IKH A;  5J9B A;  1K0N A;  5DVB A;  4OCE A;  3TCO A;  5GAN D;  5ECO B;  2NDO A;  2CZ3 A;  3RHC A;  3O76 A;  4HQZ A;  3JCM L;  5D9W A;  1K0D A;  4KCA A;  5F0G A;  3HHV A;  3UL3 A;  3CXG A;  1UN2 A;  3PPU A;  2HRN A;  3UVT A;  1JHB A;  1RQM A;  5GST A;  2LNT A;  2OAC A;  5DCG A;  1I9D A;  1ZMA A;  1JLW A;  2OE3 A;  2N5F A;  4EDZ A;  3I9V 2;  3HJM A;  1TXX A;  1PL2 A;  4FQU A;  4F03 A;  3ME8 A;  1WRY A;  6GSV A;  4PXO A;  1PL1 A;  1MTC A;  2MMA A;  2YWO A;  1GP1 A;  1YQ1 A;  3LFL A;  4MLY A;  3APQ A;  2FY6 A;  4FYC A;  2B5X A;  4PNF A;  3EUR A;  2HRK A;  3ZIT A;  1S3A A;  5J41 A;  3DRN A;  2LKU A;  1EEJ A;  1QK8 A;  1A23 A;  2MYG A;  3N9J A;  3L4N A;  4JZQ A;  4XRD A;  2DJ3 A;  2D2Z A;  3EVI A;  3E3E A;  3L9U A;  2H1A A;  4RQX A;  3KEB A;  3H93 A;  3BD2 A;  2AV4 A;  3W8S A;  4TXV A;  6GSW A;  1IYI A;  3HCZ A;  2VCZ A;  3KJY A;  4TXO B;  3ZRE A;  1M0U A;  1OC3 A;  3US3 A;  3LSZ A;  5HR3 A;  2L5L A;  3Q18 A;  4ZB9 A;  1B48 A;  4LA1 A;  1B4P A;  1X9S B;  2YPM A;  1TDI A;  2A4V A;  5FWG A;  1WOU A;  4MDC A;  1URM A;  3UJ1 A;  2E2G A;  4WEY A;  17GS A;  3DXB A;  3E0U A;  3HJO A;  3KH9 A;  5CRG A;  1SKR B;  2PUK C;  2VAF A;  1F3A A;  2YV9 A;  3C1S A;  2GTU A;  2HSM A;  4O92 A;  1XW5 A;  2O85 A;  4GF0 A;  2KP1 A;  3D4T A;  3ISO A;  4EKZ A;  4EUY A;  5INY A;  1X5D A;  1PSQ A;  1TRU A;  2VD1 A;  5KN1 A;  4CDO A;  2LV3 A;  3IBH A;  2YP6 A;  1H75 A;  2FCH A;  4IBP A;  1X9W B;  4EXJ A;  4HQS A;  3H8Q A;  4YAP A;  3RDW A;  1GTI A;  5EVO A;  4EVM A;  2WFC A;  5D73 A;  2XPD A;  1ZYN A;  2LQO A;  1V57 A;  2BJX A;  2ZCT A;  3FYG A;  2C3N A;  4IEL A;  2R6K A;  4FH8 A;  12GS A;  1HNB A;  3LEF A;  5B6N A;  2H76 A;  1A0R P;  1ON4 A;  4TVE A;  3LW9 A;  4BVY A;  3TKR A;  4XRA A;  2KLX A;  1ZYQ B;  3ZFL A;  3KP8 A;  5D9X A;  3LXZ A;  3W6G A;  4IQ1 A;  2DC5 A;  1T00 A;  3G9B A;  5F05 A;  4V2M A;  2H74 A;  1ACV A;  2VD0 A;  3CSH A;  1GL8 A;  3F6D A;  1XCC A;  4MPG A;  1K0A A;  1FAA A;  3KXO A;  4HEA 2;  3KGK A;  3DKS A;  4N10 A;  2MBT A;  3D21 A;  2YV7 A;  4HOJ A;  5ECQ B;  2M46 A;  3KTL A;  4Q5F A;  6GSU A;  3VFI A;  3KMN A;  4USS A;  5AN1 A;  1JFU A;  2JU5 A;  5IPG A;  3FR6 A;  5J5N A;  5CRW A;  4BPY A;  3C8E A;  3QFA C;  3QAG A;  2GSQ A;  3C1R A;  2O89 A;  3WD6 A;  4J57 E;  3D22 A;  3A2X A;  1DE1 A;  4IVF A;  2N5B A;  2GQM A;  3IK7 A;  1M9A A;  4CY6 A;  1KBN A;  1Z3E A;  2REM A;  1PMT A;  3ZML A;  1MD3 A;  3HVV A;  5CAX A;  4HU7 A;  2CX4 A;  4N30 A;  3TGZ A;  3QMX A;  2YCD A;  2ALB A;  2GSS A;  2GQL A;  3KH7 A;  3D4M A;  3MWH A;  2L57 A;  4O7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...