2V2GA

Crystal structure of the c45s mutant of the peroxiredoxin 6 of arenicola marina. monoclinic form
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
220
structure length
220
Chain Sequence
GITLGEVFPNFEADSTIGKLKFHDWLGNSWGVLFSHPRDFTPVSTTELGRVIQLEGDFKKRGVKLIALSCDNVADHKEWSEDVKCLSGVKGDMPYPIIADETRELAVKLGMVDPDERTSTGMPLTCRAVFIIGPDKKLKLSILYPATTGRNFSEILRVIDSLQLTAQKKVATPADWQPGDRCMVVPGVSAEEAKTLFPNMEVKAVPSGKGYLRYTPQPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXIREDOXIN 6
publication title The Crystal Structure of the C45S Mutant of Annelid Arenicola Marina Peroxiredoxin 6 Supports its Assignment to the Mechanistically Typical 2- Cys Subfamily without Any Formation of Toroid- Shaped Decamers.
pubmed doi rcsb
source organism Arenicola marina
molecule tags Oxidoreductase
total genus 71
structure length 220
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2007-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1020.10 Alpha Beta 2-Layer Sandwich Antioxidant, Horf6; Chain A, domain 2 Antioxidant, Horf6; Chain A, domain2 2v2gA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2v2gA01
2NVLA 2H70A 1OE7A 3KTLA 1MTCA 2LS5A 1YDKA 4KDYA 1KTEA 2GGTA 5IPGA 1YEXA 1V58A 4K1FA 4YQVA 1Q4JA 3Q18A 2F8AA 1AQXA 3F4RA 3VI5A 2XPEA 3EU4A 5D93A 1B48A 2E2GA 4LMWA 2KP2A 3GKMA 5DBQA 2VLVA 3HXSA 1Z5YE 1TI3A 5JCUA 1NM3A 3IAM2 5CRDA 4QL9A 3KH9A 4KA0A 4NMUA 3M1GA 2ALBA 2PMTA 1T8EB 4F9ZA 1OE8A 3DXBA 1M9BA 20GSA 1DUGA 3EMXA 3UVHA 1BX9A 5HR3A 1M7TA 1T4YA 3V1WA 3UMAA 2DJ2A 4DSSB 2H73A 4FH8A 1FB6A 3RPNA 1BG5A 2CVKA 1YF0A 1O85A 2H76A 3HKRA 4MMMA 5IO0A 4WR5A 2LNTA 1R26A 1ERTA 1X5CA 3KJYA 4L0WA 2RM6A 1SL0B 1X9SB 2FD3A 2IMEA 2MMOA 2DJKA 22GSA 4FYBA 4TVEA 2C0EA 3ZTLA 5CRGA 1TRSA 13GSA 1SJZA 1OC9B 1ZYQB 1PN9A 3ZITA 3UBKA 4G10A 3TUEA 3TJFA 4OO5A 1WPIA 4GSSA 4TR3A 4HU7A 2E7PA 1MDKA 3EC3A 1GSDA 4KAEA 3L0HA 4DSSA 4EVMA 4K7IA 2GQKA 4FIWA 5F07A 1M0UA 3GX0A 2YJHA 3EVIA 1MD3A 1AIUA 4BWSA 3BBYA 4HS1A 1F9MA 5F05A 3GIXA 2OBIA 6GSVA 4ILFA 5AISA 4MJEA 5G31A 4IELA 4I6XA 2CQ9A 2CV4A 3RPPA 6GSUA 1JLVA 4DSQA 4GWRA 1YF1A 4I97A 2N5AA 1A8LA 4N30A 3WT2A 3ZMKA 2LNSA 2A4VA 1XOBA 1K0BA 4TXVA 1TKDB 2GLRA 2QC7A 4N0ZA 2YV9A 1SL1B 3SBCA 2EIQA 6GSSA 1GWCA 1QFNA 1X5EA 2PWJA 1HD2A 3GSTA 5DJLA 3M8NA 2OE3A 2CAQA 4K6XA 12GSA 1BAYA 2H1AA 3DIEA 1W4VA 1AXDA 3UBLA 3C7MA 4NV5A 4JU5A 2GDRA 1N2AA 2L4CA 5FWGA 4BA7A 3C73A 4OO4A 1V2AA 2KUCA 3RAZA 2OE1A 5EVOA 2TRXA 3TJJA 4OWYA 3ZREA 3GYKA 1PMTA 3TKRA 3O76A 4KSMA 1J9BA 5EPFA 2H0IA 1AQWA 5HR2A 3WT1A 5HR1A 3FHKA 3CTGA 1GSUA 1V40A 3GSSA 3HZ8A 2HSYA 4IQ1A 1AUCA 2F9SA 3TB2A 4KH7A 1V57A 1VRSD 2FHEA 1O6JA 1MD4A 4OCFA 5KN1A 2C80A 2F51A 6GSXA 1GUHA 4IP1A 5L71A 5KN3A 2HXKA 3CRUA 5ELGA 2VCXA 1JLWA 2AB6A 2PUKC 5B8AA 4KX4A 4ZILA 2CVBA 3C1SA 3F0IA 2YWNA 1KNGA 4EUYA 4KE3A 3CXGA 1FVKA 3VPQA 3P7XA 2CVDA 3OR5A 1TK8B 3D22A 1GUMA 4MCUA 4POLA 2JU5A 1SL2B 5CRWA 3HJMA 4DSRA 4LA1A 1DSBA 4ZL9A 3A2VA 1EGOA 1K0CA 3QOUA 2F3MA 2GS3A 3ZFLA 3UJ1A 4HJMA 1TOFA 4AF2A 4ZL7A 1AW9A 2V32A 3DVXA 1ACVA 3HVVA 2O89A 1SKWB 3FYGA 2C4JA 5KN0A 2Z9SA 2LRNA 3APQA 3BD2A 2AYTA 5DCGA 3FKFA 1BQ7A 3VWWA 3KMOA 1YQ1A 1FOVA 4YQUA 2FA8A 4V2NA 1XBSA 3RDWA 2LKUA 2DIZA 3GV1A 1TU8A 2K9FA 1AAZA 3DYRA 2VOCA 1FVJA 1K3OA 4HI7A 3KMNA 2FCHA 2WS2A 4NXIA 1XOAA 5J5NA 2IWTA 1XWCA 3KCMA 1G6WA 2JADA 1XWGA 3FR9A 2B3SA 4J57E 3JCML 4EE0A 3ZZXA 3IAS2 4EC0A 4Q5RA 2WCIA 4POMA 1EEMA 5E4WA 3G7YA 1UN2A 1R5AA 2B7KA 1N8JA 4L5LA 4NHZA 3E0UA 1C72A 3LYKA 3A3TA 2L57A 3HVXA 4MJBA 2JZTA 1H4OA 1M2AA 5B7CA 4O92A 4PQ1A 2V2GA 2GT6A 3O3TA 4PQIA 2NTOA 2IMDA 4ZBDA 2PERA 1PX7A 1SK2A 3N5OA 2FWFA 5COHA 3US3A 3F4SA 3HZ4A 3HHVA 3GL3A 3HDCA 3ZVJD 1I9DA 1GP1A 3IDVA 2H19A 2LRTA 3CBUA 4ZB9A 4NPBA 3WGEA 1S3DA 1ERVA 4LLRA 4G19A 1F3AA 4KDXA 2G0FA 1E6BA 2VCTA 2MBTA 2VD0A 2KHPA 3DKSA 2I3YA 3ZIVA 5KEJA 2X8HA 2QSIA 2H72A 4H86A 1XFLA 2VCZA 5DVBA 2H8LA 4DVCA 1UC7A 3R2QA 1GSYA 2H1DA 2XHFA 4V1Ap 3WYWA 4X1UA 1XWKA 3ERFA 3FR6A 3LXZA 3PGTA 2JACA 3WGDA 2HZFA 3IBHA 4Z7XA 3VPTA 1TK5B 3FZ4A 3TOUA 3P8WA 4YAVA 10GSA 3FZ5A 4XCSA 2BTOT 4IHUA 1QQ2A 4MF7A 3D6IA 1OKTA 4OMVA 3Q19A 4ECCA 3C8EA 4XRAA 3UEMA 4KGIA 1YY7A 3P2AA 2O7KA 2CX4A 1S3AA 2B5YA 3W8JA 3KM6A 4E8HA 4NWYA 3TKSA 3TJBA 17GSA 2VL9A 2PGTA 1FW1A 1JZRA 4NHWA 4WETA 18GSA 4MZBA 2HT9A 5D96A 4IKHA 1VF3A 1Q98A 2CZ2A 2V6OA 1PKZA 3F4TA 2DMLA 4POBA 5CP1A 4I2TA 4D73B 1XWBA 3PH9A 1A8YA 5DCHA 1OC3A 1ZL9A 1THOA 2HLSA 3ED3A 5A4WA 1WRYA 2IJYA 4GSNA 3Q6OA 3F63A 3J7Yk 3L78A 3ERGA 1YZXA 2YWMA 4FYCA 2ES7A 1B9YC 4J56E 1XW6A 1K3LA 5J3RA 2K8VA 1K0AA 2WDUA 3TKSC 2C0DA 2TIRA 3GUSA 3P90A 4FYUA 3LJRA 1V9WA 1A2JA 1PKWA 4PQHA 5D9TA 3O6TA 2O8VB 4N10A 1V98A 3LGCA 3TKPA 4AJ8A 1EP8A 3LWAA 4MJCA 1JZWA 1VF2A 2MBSA 4K0NA 4D73A 5DQYA 1A23A 1ST9A 2C8UA 1TK0B 5CNWA 1QUWA 3QAGA 2L59A 1EOHA 4JRRA 2YP6A 1X5DA 2H6YA 4CDOA 2PU9C 2AHEA 4MZCA 4V2LA 5GSSA 4HJ2A 5IMVA 4GSTA 4IJIA 4L8EA 3ZRDA 1SK0A 4AGSA 19GSA 3TGZA 4KUNA 3SWLA 3FR3A 5JWOB 2FA4A 4GF0A 1SJ6A 1X9WB 3IOSA 3L9UA 2R37A 2PVQA 4GRFA 5LCZA 4HOJA 1TDIA 14GSA 3QAWA 4WR4A 3QR6A 5CAXA 3VFIA 1K3YA 2HRNA 1EEJA 2QGVA 3K8NA 1MEKA 4TKYA 2HNLA 2OADA 5ECSA 4ECBA 4AJ6A 1F6MC 4MF6A 2WJUA 1GSSA 4OFTA 3LORA 1PL1A 1OC9A 1ON4A 2WGRA 4KB3A 2GZZA 4JE1A 2LJRA 1B4QA 5JWQB 2NPBA 1GTIA 3PINA 4MH3A 1LU4A 4PX1A 4QL7A 1ILOA 1Z6MA 2WZ9A 2LUSA 1U88A 4MK3A 1R4WA 3LSZA 4GQFA 5ECRB 2MZCA 1GUKA 1S3CA 4X0XA 4XRDA 3UOMA 3DMLA 1Z7PA 2JZSA 2GSRA 4V1Ag 3BCKA 4EDYA 2M80A 1O7UA 3IE3A 3TJGA 3GH9A 1FHEA 3UL3A 2FWEA 2HI7A 3ME7A 1A2LA 1EOGA 1ABAA 1ZCPA 2VIMA 3I69A 1JZOA 2VD1A 3C71A 3TJKA 2IMIA 2PN8A 4BPYA 4KW6A 5G5EA 2IMKA 4WBJA 2EC4A 1NW2A 4JZQA 1G7EA 4RQXA 1SYXA 1TJDA 1J08A 5AIXA 2OACA 4PGTA 3APSA 1GLQA 3D21A 3QPMA 2H6XA 2P0GA 3LG6A 2OA7A 2DC5A 2O85A 4XS1A 5FHIA 1O73A 1DBYA 1WWJA 2JZRA 1Z9HA 2VLUA 1XW9A 3KP9A 2R3XA 1USBA 5GSTA 4J2FA 3IHQA 1ML6A 4PURA 4F0BA 1JHBA 3GX8A 4CHSA 4GQCA 1VF4A 4MDCA 1AC1A 3GKXA 2CT6A 3CTFA 2OKAA 4G2EA 5JCWA 2O87A 2FUG2 2YZUA 2ZNMA 4GTUA 4CW9A 3GURA 2GT5A 2ON5A 3G9BA 4PUFC 5D8IA 2GSTA 2CZ3A 2FLSA 1A2MA 3D5JA 3UAPA 1G7OA 2LJKA 1QMVA 1I5GA 3GFKA 4WBRD 3EINA 3I6AA 3IV4A 6GSWA 4F2IA 5ABRA 3FK8A 1T4ZA 4LL1B 1SD8A 2B6MA 3H79A 2LV3A 4LMVA 2DMMA 4YQMA 1F37A 1NHYA 2H1GA 4KCAA 1SENA 3KP8A 2X64A 2YJ7A 1Z6NA 9GSSA 2VCWA 1GTUA 2MYGA 2EIRA 2GZYA 2DJ3A 2R6KA 4HZ2A 4OFMA 3U6VA 3HD5A 4HU9A 1BJXA 2TRCP 1DE2A 4WXTA 4POKA 1NHOA 1Z7RA 5G2ZA 3DEXA 5H5QA 3VK9A 2VAFA 2I4AA 4IBPA 2J9HA 1X9MB 1PQNA 3HJOA 2IPAA 1MDJA 3EYTA 3F9UA 3CSHA 4OFNA 5FT3A 3ERWA 2XBIA 2XC2A 3QFBC 3APOA 5ID2B 3F6DA 3CSJA 2H6ZA 3HA9A 6GSYA 1WOUA 1BEDA 2JSZA 3FW2A 5IMDA 1J0FA 4JBBA 2C0FA 1HQOA 2AUVA 2GVPA 3KD0A 4IS0A 2B5EA 2GSSA 3KZQA 4PNFA 1EV9A 3GKKA 2X8GA 5ENUA 3VWVA 1ZMAA 3M9KA 5LNKe 4K0GA 3Q74A 4N0VA 3GNJA 2JSYA 1GLPA 3MDKA 4NV2A 5ID2A 1XIYA 4KNDA 3L9VA 4L5OA 5ECKB 2CX3A 3H4KA 1TXXA 2LSTA 1SD9A 2DJ0A 1HNAA 3LYPA 1IYIA 3EU3A 5G30A 2H66A 1U3IA 4JR6A 1U87A 2E0QA 3ME8A 1IYHA 1O81A 4IQAA 5F8BA 3ZVJA 1XXUA 8GSSA 3ZFBA 1TRUA 3IR4A 4K9ZA 4ZB8A 1FO5A 5AIVA 3PR8A 2MMNA 4XIHA 3S9FA 4X43A 2B7JA 3LFLA 2IIYA 2MMAA 1GNEA 2RUFA 1HYUA 3WGXA 4MH2A 5JCGA 2PPTA 1ZZYA 2VCQA 2BJXA 3RHCA 1PSQA 5JWRB 4HZ4A 3G7JA 3GA4A 2LTKA 2V6KA 5HQPA 5AN1A 2MMZA 5CO3A 1YKCA 3DVWA 5ECHB 2RLIA 3IK9A 4DEJA 3NZNA 5A4VA 2FY6A 3UIWA 2HE3A 5DALB 2H30A 1NSWA 5IQYA 4ZBBA 3M9JA 1WE0A 2IN3A 1FB0A 1R5PA 2L6CA 1MDIA 5HFIA 3GL5A 3QMXA 2H74A 5CREA 3FZ9A 3VURA 1ZOFA 4QQ7A 5HFGA 5EL8A 5B6MA 1B9XC 2C0GA 7GSSA 4TR4A 1XPVA 2IL3A 4XS6A 3UARA 1YJ6A 4ZXGA 4BVXA 4K8MA 3TRPA 4GLTA 4IP6A 4F03A 1T3BA 1THXA 3VI7A 4MA9A 3RHBA 5HR0A 5DALA 2CA8A 3IA1A 1QGVA 4MJAA 3GMFA 4P3YB 5F06A 3TKSE 5E59A 1PRXA 2L4QA 3IXRA 3L4NA 3F3QA 3VWXA 2HRFA 5DDLA 3KEBA 2JL4A 3H93A 3GKNA 2YZHA 1GH2A 3CRTA 1B8XA 2B1KA 1AQVA 1JZDA 2K6VA 1XZOA 4LL4B 2OE0A 1VGLA 4ZBAA 2YWIA 3ZLPA 2XBQA 1XW5A 1U3AA 4AJ7A 2K18A 4PNGA 2HSHA 4IW9A 3DGQA 3IPZA 2EIOA 2H0HA 1URMA 3UVTA 2NDOA 4BL7A 2G2QA 2YNXA 3WD6A 1RQMA 1CQGA 4RI7A 1EGRA 3MSZA 2M72A 3QDNA 1ERUA 2KOKA 2N5BA 2P5QA 5IMCA 6GSTA 2DLXA 2YV7A 2FGXA 5ELAA 1SJIA 1XVQA 2J23A 1RW1A 1ZGNA 1PGTA 2H71A 1FAAA 1DE1A 3I9V2 5GZZB 5J4UA 1OC8A 3EE2A 1CQHA 1FG4A 5IM9A 3U5RE 2N5FA 4RUVA 1T1VA 5CYYA 4XHMA 1VF1A 2A2SA 4O32A 5ECQB 3HY2A 2L5LA 4JEDA 1GL8A 4WKWA 1O8WA 4RQRA 2X99A 3BJ5A 4XS4B 2E2MA 3GHAA 2VCVA 3BOAA 5KN2A 2REMA 1YKAA 2FNOA 2K8SA 4EO3A 4I2UA 2QKEA 2AV4A 4N11A 3KXOA 5GAND 1PD21 2YCDA 4TW5A 5G1LA 4EXJA 3EMPA 1GRXA 1A0FA 3ZIJA 2RIIA 3VLNA 4ULXA 4EKZA 5C00A 2H0GA 4ML6A 1WJKA 3FRCA 2LQOA 1UVZA 3TKQA 1YEPA 1LBKA 3QCPA 3KTBA 3KH7A 2OBKA 4MF5A 4IGJA 5A5KA 2IMFA 3IK7A 4XS4A 2I1UA 1M2BA 1GSQA 5ECIB 2VL2A 4MZWA 2PVOC 3BCIA 3FZAA 5IMFA 4WF4A 1QK8A 1F3BA 5C04A 1TI1A 4MABA 3L9SA 3LQ7A 2RUEA 1K0MA 4TRXA 1T7PB 4K7OA 4V2MA 3ZYWA 3E9JB 1WMJA 1SKSB 4F82A 5B6NA 3ZMLA 2KP1A 2C3QA 2DBCA 3H1NA 5IO2A 2HYXA 2M46A 3D4MA 5ECPB 3I43A 4YAPA 1E2YA 3F8UA 2LEGA 2VL2C 3LXTA 1SYRA 2VM2A 2I81A 2R2JA 4HQSA 2A2RA 3E3EA 3QD9A 4PUAA 4ACSA 3ZL5A 1G6YA 4E8EA 16GSA 5D9XA 5IOXA 5H5RA 1QXHA 1XVWA 4TR0A 1A24A 1WP0A 4Q5NA 4TR1B 2L5OA 2H75A 3FY7A 2L6DA 2AAWA 5DAKB 2C3NA 4HDEA 2AJQB 1M99A 2YPMA 4ZIJA 1M2DA 3GTUB 1TTZA 4I5QA 2ZUPA 1GNWA 4KDUA 4MLYA 4ZL8A 3HVSA 1KBNA 2B5XA 1HNBA 3AY8A 3HYPA 4EDZA 4O5RA 5IMZA 3N9JA 3F6FA 4K2DA 5A4UA 1K0OA 3HCZA 4TR1A 3EWLA 4Q5FA 3GN3A 4HUAA 2DJ1A 2DSAA 1GTBA 5B8BA 5DAKA 5IIZA 4OCEA 3VWUA 4OD7A 4ECJA 2BMXA 3MWHA 1OVNA 4YH2A 2C3TA 3LEFA 3W6GA 2WULA 2VM1A 3GRXA 3MNGA 2PBJA 3GTUA 3KIJA 1G0TA 4ZB6A 2GSQA 2OJLA 1EP7A 3CYNA 5F0GA 2LQQA 1TRWA 5ECLB 2NBSA 2YOIA 4TOPA 2H1BA 2HFDA 3TCOA 1EV4A 2R5GA 4MPFA 4MPGA 4GXZA 2V1MA 2CAIA 1T00A 1KEBA 2ZCTA 4KSOA 4HEA2 3RBTA 3IC4A 4XTSA 1OAZA 5ECMB 1Z3EA 1HNCA 2IFQB 2YANA 2LJAA 3CSIA 3C1RA 4L0UA 4TXOB 5IOWA 2YN1A 1X0RA 2YWOA 4O7HA 5HFKA 3EURA 1RK4A 5LD0A 2P31A 4IJ3A 1K0DA 1M9AA 1WIKA 1XWAA 3M0FA 1F2EA 5EY6A 4HQZA 5ECOB 3FEUA 1JFUA 2HZEB 4RI6A 4ECIA 1A0RP 1B4PA 4GCIA 4IN0A 2FWGA 3KGKA 1TP9A 1K0NA 3W8SA 4F0CA 3M3MA 2GZPA 3TOTA 2IFQA 1TU7A 4ML1A 1BYEA 1OYJA 3QFAC 4TXOA 5J9BA 1GSEA 1ERWA 4EF0A 2B1LA 4K7NA 1Y25A 5D9WA 4IVFA 1SKRB 3DRNA 3H8QA 4NAXA 3TRXA 3A2XA 4JR4A 2DJJA 1SK1A 5DQSA 2VL3A 1H75A 4ISDA 1TW9A 2WFCA 3NOFA 5IMAA 5GAPD 2P5RA 2GTUA 2WB9A 5DJMA 1TRVA 1W89A 2WRTA 3CMIA 2VO4A 2VUPA 4KCEA 4I8BA 2HZEA 2VLTA 3TDGA 3DWVA 5D9VA 2KLXA 3GH6A 3A2WA 1R7HA 3QAVA 2XPDA 5IPHA 3D4TA 3F3RA 1GULA 5G5FA 2I9HA 1SU9A 3G7IA 5J9CA 2RM5A 5ECNB 3IRAA 4WF5A 1UA5A 3NIVA 11GSA 3J7Yb 1PL2A 2C1YA 4TN8A 2LRCA 5J41A 3HJPA 4EL1A 1EWXA 1PX6A 4BWQA 3ISOA 1OKDA 4MP4A 3TRQA 5D73A 5CRHA 1LJRA 2F8FA 3DD3A 3MAKA 2X8CA 1EZKA 2DIYA 4G9HA 2V41A 1U6TA 1GTAA 2R4VA 1Y6EA 2D2ZA 3A5WA 1GSFA 5AGYA 2H01A 4PXOA 1O8XA 2ON7A 4FO5A 5H5SA 4ID0A 4WEYA 1XCCA 1PA3A 2GQLA 2GQMA 5INYA 4BVYA 2FWHA 4Q5QA 1ZYEA 3D0ZA 5G1KA
chains in the Genus database with same CATH superfamily
2NVLA 2H70A 1OE7A 3KTLA 1MTCA 2LS5A 1YDKA 4KDYA 1KTEA 2GGTA 5IPGA 1YEXA 1V58A 4K1FA 4YQVA 1Q4JA 3Q18A 2F8AA 1AQXA 3F4RA 3VI5A 2XPEA 3EU4A 5D93A 1B48A 2E2GA 4LMWA 2KP2A 3GKMA 5DBQA 2VLVA 3HXSA 1Z5YE 1TI3A 5JCUA 1NM3A 3IAM2 5CRDA 4QL9A 3KH9A 4KA0A 4NMUA 3M1GA 2ALBA 2PMTA 1T8EB 4F9ZA 1OE8A 3DXBA 1PFOA 1M9BA 20GSA 1DUGA 3EMXA 3CQFA 3UVHA 3FMWA 1BX9A 5HR3A 1M7TA 1T4YA 3V1WA 3UMAA 2DJ2A 4DSSB 2H73A 4FH8A 1FB6A 3RPNA 1BG5A 2CVKA 1YF0A 1O85A 2H76A 3HKRA 4MMMA 5IO0A 3A5IA 4WR5A 2LNTA 1R26A 1ERTA 1X5CA 3KJYA 4L0WA 2RM6A 1SL0B 1X9SB 2FD3A 2IMEA 2MMOA 2DJKA 22GSA 4FYBA 4TVEA 2C0EA 3ZTLA 5CRGA 1TRSA 13GSA 1SJZA 1OC9B 1ZYQB 1PN9A 3ZITA 3UBKA 4G10A 3TUEA 3TJFA 4OO5A 1WPIA 4GSSA 4TR3A 4HU7A 2E7PA 1MDKA 3EC3A 1GSDA 4KAEA 3L0HA 4DSSA 4EVMA 4K7IA 2GQKA 4FIWA 5F07A 1M0UA 3GX0A 2YJHA 3EVIA 1MD3A 1AIUA 4BWSA 3BBYA 4HS1A 1F9MA 5F05A 3GIXA 2OBIA 6GSVA 4ILFA 5AISA 4MJEA 5G31A 4IELA 4I6XA 2CV4A 2CQ9A 3RPPA 6GSUA 1JLVA 4DSQA 4GWRA 1YF1A 4I97A 2N5AA 1A8LA 4N30A 3WT2A 3ZMKA 2LNSA 4X4JA 2A4VA 1XOBA 1K0BA 4TXVA 1TKDB 2GLRA 2QC7A 4N0ZA 2YV9A 1SL1B 3SBCA 2EIQA 6GSSA 1GWCA 1QFNA 1X5EA 2PWJA 1HD2A 3GSTA 5DJLA 3M8NA 2OE3A 2CAQA 4K6XA 12GSA 1BAYA 2H1AA 3DIEA 1W4VA 1AXDA 3UBLA 3C7MA 4NV5A 4JU5A 2GDRA 1N2AA 2L4CA 5FWGA 4BA7A 3C73A 4OO4A 1V2AA 2KUCA 3RAZA 2OE1A 5EVOA 2TRXA 3TJJA 4OWYA 3ZREA 3EPTA 5BRTA 3GYKA 1PMTA 3TKRA 3O76A 4KSMA 1J9BA 5EPFA 2H0IA 3IC8A 1AQWA 5HR2A 3WT1A 5HR1A 3FHKA 3CTGA 1GSUA 1V40A 3GSSA 3HZ8A 2HSYA 4IQ1A 1AUCA 2F9SA 3TB2A 4KH7A 1V57A 1VRSD 2FHEA 1O6JA 1MD4A 4OCFA 5KN1A 2C80A 2F51A 6GSXA 1GUHA 4IP1A 5L71A 5KN3A 3R3EA 2HXKA 3CRUA 5ELGA 2VCXA 1JLWA 2AB6A 2PUKC 5B8AA 4KX4A 4ZILA 2CVBA 3C1SA 3F0IA 2YWNA 1KNGA 4EUYA 4KE3A 3CXGA 1FVKA 3VPQA 3P7XA 2CVDA 3OR5A 1TK8B 3D22A 1GUMA 1M3JA 4MCUA 4POLA 2JU5A 1SL2B 5CRWA 3HJMA 4DSRA 4LA1A 1DSBA 4ZL9A 3A2VA 1EGOA 4K2XA 1K0CA 3QOUA 2F3MA 2GS3A 3ZFLA 3UJ1A 4HJMA 1TOFA 4AF2A 4ZL7A 1AW9A 2V32A 3DVXA 1ACVA 3HVVA 2O89A 1SKWB 3FYGA 2C4JA 5KN0A 2Z9SA 2LRNA 3APQA 3BD2A 2AYTA 5DCGA 3FKFA 1BQ7A 3VWWA 3KMOA 1YQ1A 1FOVA 4YQUA 2FA8A 4V2NA 1XBSA 2X4AA 3RDWA 2LKUA 2DIZA 3GV1A 1TU8A 2K9FA 1AAZA 3DYRA 2VOCA 1FVJA 1K3OA 4FQUA 4HI7A 3MYDA 3KMNA 2FCHA 2WS2A 4NXIA 1XOAA 5J5NA 2IWTA 1XWCA 3KCMA 1G6WA 2JADA 1XWGA 3FR9A 2B3SA 4J57E 3JCML 4EE0A 3ZZXA 3IAS2 4EC0A 4Q5RA 2WCIA 4POMA 1EEMA 4O5QA 3G7YA 5E4WA 1UN2A 1R5AA 2B7KA 1N8JA 4L5LA 4NHZA 3E0UA 1C72A 3LYKA 3A3TA 2L57A 4K5SA 3HVXA 4MJBA 2JZTA 1H4OA 1M2AA 5B7CA 4O92A 4PQ1A 2V2GA 2GT6A 3O3TA 4PQIA 2NTOA 2IMDA 4ZBDA 2PERA 1PX7A 1SK2A 3N5OA 2FWFA 5COHA 3US3A 3F4SA 3HZ4A 3HHVA 3GL3A 3HDCA 3ZVJD 1I9DA 1GP1A 3IDVA 2H19A 2LRTA 3CBUA 4ZB9A 4NPBA 3WGEA 1S3DA 1ERVA 4LLRA 4G19A 1F3AA 4KDXA 2G0FA 1E6BA 2VCTA 2MBTA 2VD0A 3MIXA 2KHPA 3DKSA 2I3YA 3ZIVA 5KEJA 2X8HA 2QSIA 2H72A 4H86A 1XFLA 2VCZA 5DVBA 2H8LA 4DVCA 1UC7A 3R2QA 1GSYA 2H1DA 2XHFA 4V1Ap 3WYWA 4X1UA 1XWKA 3ERFA 3FR6A 3LXZA 3PGTA 2JACA 2A4HA 3WGDA 2HZFA 3IBHA 4Z7XA 3VPTA 1TK5B 3FZ4A 3TOUA 3P8WA 4YAVA 10GSA 3FZ5A 4XCSA 2BTOT 4IHUA 1QQ2A 4MF7A 3D6IA 1OKTA 4OMVA 3Q19A 4ECCA 3C8EA 4XRAA 3UEMA 4KGIA 1YY7A 3P2AA 2O7KA 2CX4A 1S3AA 2B5YA 1XG8A 3KM6A 3W8JA 4NWYA 4A5PA 3TKSA 3TJBA 4E8HA 17GSA 2VL9A 2PGTA 1FW1A 1JZRA 4NHWA 2HRAA 18GSA 4WETA 4MZBA 2HT9A 5D96A 2DKIA 4IKHA 1VF3A 1Q98A 2CZ2A 2V6OA 1PKZA 3F4TA 2DMLA 4POBA 5CP1A 4I2TA 4D73B 1XWBA 3PH9A 1A8YA 5DCHA 1OC3A 1ZL9A 1THOA 2HLSA 3ED3A 5A4WA 1WRYA 2IJYA 4GSNA 3Q6OA 3F63A 3J7Yk 3L78A 3ERGA 1YZXA 2YWMA 4FYCA 2ES7A 1B9YC 4J56E 1XW6A 1K3LA 5J3RA 2K8VA 1K0AA 2WDUA 3TKSC 2C0DA 2TIRA 3GUSA 3P90A 4FYUA 3LJRA 1V9WA 1A2JA 1PKWA 4PQHA 5D9TA 3O6TA 2O8VB 4N10A 1V98A 3LGCA 3TKPA 4AJ8A 1EP8A 3LWAA 4MJCA 1JZWA 1VF2A 2MBSA 4K0NA 4D73A 5DQYA 1A23A 1ST9A 2C8UA 1TK0B 5CNWA 1QUWA 3QAGA 4O5UA 2L59A 4BIKA 1EOHA 4JRRA 2YP6A 1X5DA 2H6YA 4CDOA 2PU9C 2AHEA 4MZCA 4V2LA 5GSSA 4HJ2A 5IMVA 4GSTA 4IJIA 4L8EA 3ZRDA 1SK0A 4AGSA 19GSA 3TGZA 4Z2UA 4KUNA 3SWLA 3FR3A 5JWOB 2FA4A 4GF0A 1SJ6A 1X9WB 3IOSA 3L9UA 2R37A 2PVQA 4GRFA 4CY6A 5LCZA 4HOJA 1TDIA 14GSA 3QAWA 4WR4A 3QR6A 5CAXA 3VFIA 1K3YA 2HRNA 1EEJA 2QGVA 2QA2A 3K8NA 1MEKA 4TKYA 2HNLA 2OADA 5ECSA 4ECBA 4AJ6A 1F6MC 4MF6A 2WJUA 4G0LA 2HSMA 1GSSA 5KOWA 4OFTA 3LORA 1PL1A 1OC9A 1ON4A 2WGRA 4KB3A 2GZZA 4JE1A 2LJRA 1B4QA 5JWQB 2NPBA 1GTIA 3PINA 4MH3A 1LU4A 4PX1A 4QL7A 1ILOA 1Z6MA 2WZ9A 2LUSA 1U88A 4MK3A 1R4WA 3LSZA 4GQFA 5ECRB 3HVNA 2MZCA 1GUKA 1S3CA 4X0XA 4XRDA 3UOMA 3DMLA 1Z7PA 2JZSA 2GSRA 4V1Ag 3BCKA 4EDYA 2M80A 1O7UA 3IE3A 3TJGA 3GH9A 1FHEA 4EIPA 3UL3A 2FWEA 2HI7A 3ME7A 1A2LA 1EOGA 1ABAA 1ZCPA 2VIMA 3I69A 1JZOA 2VD1A 3C71A 3TJKA 2IMIA 2PN8A 4BPYA 4KW6A 5G5EA 2IMKA 3IHGA 4WBJA 2EC4A 1NW2A 4JZQA 4EIQA 1G7EA 4RQXA 1SYXA 1TJDA 1PN0A 1J08A 5AIXA 2OACA 4PGTA 3APSA 1GLQA 3D21A 3QPMA 2H6XA 2P0GA 3LG6A 2OA7A 2DC5A 2O85A 4XS1A 5FHIA 4G0KA 1O73A 1DBYA 1WWJA 2JZRA 1Z9HA 2VLUA 1XW9A 3KP9A 2R3XA 1USBA 5GSTA 4J2FA 3IHQA 1ML6A 4PURA 4F0BA 1JHBA 3GX8A 4CHSA 4GQCA 1VF4A 4MDCA 1AC1A 3GKXA 2CT6A 3CTFA 2OKAA 4G2EA 5JCWA 2O87A 2FUG2 2YZUA 2ZNMA 4GTUA 4CW9A 3GURA 2GT5A 2ON5A 3G9BA 4PUFC 5D8IA 4KF9A 4Z2TA 2GSTA 2CZ3A 2FLSA 1A2MA 3D5JA 3UAPA 1G7OA 2LJKA 1QMVA 1I5GA 3GFKA 4WBRD 2QA1A 3EINA 3I6AA 3IV4A 6GSWA 4F2IA 5ABRA 2X49A 3FK8A 1T4ZA 4LL1B 1SD8A 2B6MA 3H79A 2LV3A 4LMVA 2DMMA 4YQMA 1F37A 1NHYA 2H1GA 4KCAA 1SENA 3KP8A 2X64A 2YJ7A 1Z6NA 9GSSA 2VCWA 1GTUA 2MYGA 2EIRA 2GZYA 2DJ3A 2R6KA 4HZ2A 4OFMA 3U6VA 3HD5A 4HU9A 1BJXA 2TRCP 3LW9A 3PPUA 1DE2A 4WXTA 4POKA 1NHOA 1Z7RA 5G2ZA 3DEXA 5H5QA 3VK9A 2VAFA 2I4AA 4G0IA 4IBPA 2J9HA 1X9MB 1PQNA 3HJOA 2IPAA 1MDJA 3EYTA 3F9UA 3CSHA 4OFNA 1FOHA 5FT3A 3ERWA 2XBIA 2XC2A 3QFBC 3APOA 5ID2B 3F6DA 3CSJA 2H6ZA 3HA9A 6GSYA 1WOUA 1BEDA 2JSZA 3FW2A 5IMDA 1J0FA 4JBBA 2C0FA 1HQOA 2AUVA 2GVPA 3KD0A 4IS0A 2B5EA 2GSSA 3KZQA 4PNFA 1EV9A 3GKKA 2X8GA 2R0GA 5ENUA 3VWVA 1ZMAA 3M9KA 5LNKe 4K0GA 3Q74A 4N0VA 3GNJA 2JSYA 1GLPA 3MDKA 2UZ8A 4NV2A 5ID2A 1XIYA 4KNDA 3L9VA 4L5OA 5ECKB 2CX3A 3H4KA 1TXXA 2LSTA 1SD9A 2DJ0A 1HNAA 3LYPA 1IYIA 3EU3A 5G30A 2H66A 1U3IA 4JR6A 1U87A 2E0QA 3ME8A 1IYHA 1O81A 4IQAA 5F8BA 3ZVJA 1XXUA 8GSSA 3ZFBA 1TRUA 3IR4A 4K9ZA 4ZB8A 1FO5A 5AIVA 3PR8A 2MMNA 4XIHA 3S9FA 4X43A 4PTSA 2B7JA 3LFLA 2IIYA 2MMAA 1GNEA 2RUFA 1HYUA 3WGXA 4MH2A 5JCGA 2PPTA 1ZZYA 2VCQA 2BJXA 3RHCA 4USSA 1PSQA 5JWRB 4HZ4A 3G7JA 3GA4A 2LTKA 2V6KA 2DKHA 5HQPA 5AN1A 2MMZA 4BVXB 5CO3A 1YKCA 3DVWA 5ECHB 2RLIA 3IK9A 4DEJA 3NZNA 5A4VA 2FY6A 3UIWA 2HE3A 5DALB 2H30A 1NSWA 5IQYA 4ZBBA 3M9JA 1WE0A 2IN3A 1FB0A 1R5PA 2L6CA 1MDIA 5HFIA 3GL5A 3QMXA 2H74A 5CREA 3FZ9A 3VURA 1ZOFA 4QQ7A 5HFGA 5EL8A 5B6MA 1B9XC 2C0GA 7GSSA 4TR4A 1XPVA 2IL3A 1S3RA 4XS6A 3UARA 1YJ6A 4ZXGA 4BVXA 4K8MA 3TRPA 4GLTA 4IP6A 4F03A 1T3BA 1THXA 3VI7A 4MA9A 3RHBA 5HR0A 5DALA 2CA8A 3IA1A 1QGVA 4MJAA 3GMFA 4P3YB 5F06A 4BL7B 3TKSE 5E59A 1PRXA 2L4QA 3IXRA 3L4NA 3F3QA 3VWXA 2HRFA 5DDLA 3KEBA 2JL4A 3H93A 3GKNA 2YZHA 1GH2A 3CRTA 1B8XA 2B1KA 1AQVA 1JZDA 2K6VA 1XZOA 4LL4B 2OE0A 1VGLA 4ZBAA 4Z2RA 2YWIA 3ZLPA 2XBQA 1XW5A 1U3AA 4AJ7A 2K18A 4PNGA 2HSHA 4IW9A 3DGQA 3IPZA 2EIOA 2H0HA 1URMA 3UVTA 2NDOA 4BL7A 2G2QA 2YNXA 3WD6A 1RQMA 1CQGA 4RI7A 1EGRA 3MSZA 2M72A 3QDNA 1ERUA 2KOKA 2N5BA 2P5QA 5IMCA 6GSTA 2DLXA 2YV7A 2FGXA 5ELAA 1SJIA 4ICYA 1XVQA 2J23A 1RW1A 1ZGNA 1PGTA 2H71A 1FAAA 1DE1A 3I9V2 5GZZB 5J4UA 1OC8A 3EE2A 1CQHA 1FG4A 5IM9A 3U5RE 2N5FA 4RUVA 1T1VA 5CYYA 4XHMA 1VF1A 2A2SA 4O32A 4CY8A 5ECQB 3HY2A 2L5LA 4JEDA 1GL8A 4WKWA 1O8WA 4RQRA 2X99A 3BJ5A 4XS4B 2E2MA 3GHAA 2VCVA 3BOAA 5KN2A 2REMA 1YKAA 2FNOA 2K8SA 4EO3A 4I2UA 2QKEA 2AV4A 4N11A 3KXOA 5GAND 1PD21 2YCDA 4TW5A 5G1LA 4EXJA 3EMPA 1GRXA 1A0FA 3ZIJA 2RIIA 3VLNA 4ULXA 4EKZA 5C00A 2H0GA 4ML6A 1WJKA 3FRCA 2LQOA 1UVZA 3TKQA 1YEPA 1LBKA 3QCPA 3KTBA 3KH7A 2OBKA 4MF5A 4IGJA 5A5KA 2IMFA 3IK7A 4XS4A 2I1UA 1M2BA 1GSQA 5ECIB 2VL2A 4MZWA 2PVOC 3BCIA 3FZAA 5IMFA 4WF4A 1QK8A 1F3BA 5C04A 1TI1A 4MABA 3L9SA 3LQ7A 1ZYPA 2RUEA 1K0MA 4TRXA 1T7PB 4K7OA 4V2MA 3ZYWA 3E9JB 1WMJA 1SKSB 4YKFA 4F82A 5B6NA 3ZMLA 2KP1A 2C3QA 2DBCA 3H1NA 5IO2A 2HYXA 2M46A 3D4MA 5ECPB 3I43A 4YAPA 1E2YA 3F8UA 2LEGA 2VL2C 3LXTA 1SYRA 2VM2A 2I81A 2R2JA 4HQSA 2A2RA 3E3EA 3QD9A 4PUAA 4ACSA 3ZL5A 1G6YA 4E8EA 16GSA 5D9XA 5IOXA 5H5RA 1QXHA 1XVWA 4TR0A 1A24A 2R0PA 1WP0A 4YKGA 4Q5NA 4TR1B 2L5OA 2H75A 1M3IA 3FY7A 2L6DA 2AAWA 5DAKB 2C3NA 4HDEA 2AJQB 1M99A 2YPMA 4ZIJA 1M2DA 3GTUB 2R0CA 1TTZA 4I5QA 2ZUPA 1GNWA 4KDUA 4MLYA 4ZL8A 3HVSA 1KBNA 2B5XA 1HNBA 3AY8A 3HYPA 4EDZA 4O5RA 5IMZA 3N9JA 3F6FA 4K2DA 5A4UA 1K0OA 3HCZA 5BMUA 4TR1A 3EWLA 4Q5FA 3GN3A 4HUAA 2DJ1A 2DSAA 1GTBA 5B8BA 5DAKA 5IIZA 4OCEA 3VWUA 4OD7A 4ECJA 2BMXA 3MWHA 1OVNA 4YH2A 2C3TA 3LEFA 3W6GA 2WULA 2VM1A 3GRXA 3MNGA 2PBJA 3GTUA 4HSCX 3KIJA 1G0TA 4ZB6A 2GSQA 2OJLA 1EP7A 3CYNA 5F0GA 2LQQA 1TRWA 5ECLB 2NBSA 2YOIA 4TOPA 2H1BA 2HFDA 3TCOA 1EV4A 2R5GA 4MPFA 4MPGA 4GXZA 2V1MA 2CAIA 1T00A 1KEBA 2ZCTA 4KSOA 4HEA2 3RBTA 3IC4A 4XTSA 1OAZA 5ECMB 1Z3EA 1HNCA 2IFQB 4MNNA 2YANA 2LJAA 3CSIA 3C1RA 4L0UA 4TXOB 5IOWA 2YN1A 1X0RA 2YWOA 4O7HA 5HFKA 3EURA 1RK4A 5KOXA 5LD0A 2P31A 4IJ3A 1K0DA 1M9AA 1WIKA 1XWAA 3M0FA 1F2EA 5EY6A 4HQZA 5ECOB 3FEUA 1JFUA 2HZEB 4RI6A 4ECIA 1A0RP 1B4PA 4GCIA 4IN0A 2FWGA 2HRKA 3KGKA 1TP9A 1K0NA 3W8SA 4F0CA 1ZYNA 3M3MA 2GZPA 3TOTA 2IFQA 4K5RA 1TU7A 4ML1A 1BYEA 1OYJA 3QFAC 4TXOA 5J9BA 1GSEA 1ERWA 4EF0A 2B1LA 4K7NA 1Y25A 5D9WA 4IVFA 1SKRB 3DRNA 3H8QA 4NAXA 3TRXA 3A2XA 4JR4A 2DJJA 1SK1A 5DQSA 2VL3A 1H75A 4ISDA 1TW9A 2WFCA 3NOFA 5IMAA 5GAPD 2P5RA 2GTUA 2WB9A 5DJMA 1TRVA 1W89A 2WRTA 3CMIA 2VO4A 2VUPA 4KCEA 4I8BA 2HZEA 2VLTA 3TDGA 3DWVA 5D9VA 2KLXA 3GH6A 3A2WA 1R7HA 3QAVA 2XPDA 5IPHA 3D4TA 3F3RA 1GULA 5G5FA 2I9HA 1SU9A 3G7IA 5J9CA 2RM5A 4BVYB 5ECNB 3IRAA 4WF5A 1UA5A 3NIVA 11GSA 3J7Yb 1PL2A 2C1YA 4TN8A 2LRCA 5J41A 3HJPA 4EL1A 1EWXA 1PX6A 4BWQA 3ISOA 1OKDA 4MP4A 3TRQA 5D73A 5CRHA 1LJRA 2F8FA 3DD3A 3MAKA 2X8CA 1EZKA 2DIYA 4G9HA 2V41A 2A2PA 1U6TA 1GTAA 2R4VA 1Y6EA 2D2ZA 3A5WA 1GSFA 5AGYA 2H01A 4PXOA 1O8XA 2ON7A 4FO5A 5H5SA 4ID0A 4WEYA 1XCCA 1PA3A 2GQLA 2GQMA 5INYA 4BVYA 2FWHA 4Q5QA 1ZYEA 3D0ZA 5G1KA
chains in the Genus database with same CATH topology
2NVLA 2H70A 1OE7A 3KTLA 1MTCA 2LS5A 1YDKA 4KDYA 1KTEA 2GGTA 5IPGA 1YEXA 1V58A 4K1FA 4YQVA 1Q4JA 3Q18A 2F8AA 1AQXA 3F4RA 3VI5A 2XPEA 3EU4A 5D93A 1B48A 2E2GA 4LMWA 2KP2A 3GKMA 5DBQA 2VLVA 3HXSA 1Z5YE 1TI3A 5JCUA 1NM3A 3IAM2 5CRDA 4QL9A 3KH9A 4KA0A 4NMUA 3M1GA 2ALBA 2PMTA 1T8EB 4F9ZA 1OE8A 3DXBA 1M9BA 20GSA 1DUGA 3EMXA 3UVHA 3FMWA 1BX9A 5HR3A 1M7TA 1T4YA 3V1WA 3UMAA 2DJ2A 4DSSB 2H73A 4FH8A 1FB6A 3RPNA 1BG5A 2CVKA 1YF0A 1O85A 2H76A 3HKRA 4MMMA 5IO0A 3A5IA 4WR5A 2LNTA 1R26A 1ERTA 1X5CA 3KJYA 4L0WA 2RM6A 1SL0B 1X9SB 2FD3A 2IMEA 2MMOA 2DJKA 22GSA 4FYBA 4TVEA 2C0EA 3ZTLA 5CRGA 1TRSA 13GSA 1SJZA 1OC9B 1ZYQB 1PN9A 3ZITA 3UBKA 4G10A 3TUEA 3TJFA 4OO5A 1WPIA 4GSSA 4TR3A 4HU7A 2E7PA 1MDKA 3EC3A 1GSDA 4KAEA 3L0HA 4DSSA 4EVMA 4K7IA 2GQKA 4FIWA 5F07A 1M0UA 3GX0A 2YJHA 3EVIA 1MD3A 1AIUA 4BWSA 3BBYA 4HS1A 1F9MA 5F05A 3GIXA 2OBIA 6GSVA 4ILFA 5AISA 4MJEA 5G31A 4IELA 4I6XA 2CQ9A 2CV4A 3RPPA 6GSUA 1JLVA 4DSQA 4GWRA 1YF1A 4I97A 2N5AA 1A8LA 4N30A 3WT2A 3ZMKA 2LNSA 4X4JA 2A4VA 1XOBA 1K0BA 4TXVA 1TKDB 2GLRA 2QC7A 4N0ZA 2YV9A 1SL1B 3SBCA 2EIQA 6GSSA 1GWCA 1QFNA 1X5EA 2PWJA 1HD2A 3GSTA 5DJLA 3M8NA 2OE3A 2CAQA 4K6XA 12GSA 1BAYA 2H1AA 3DIEA 1W4VA 1AXDA 3UBLA 3C7MA 4NV5A 4JU5A 2GDRA 1N2AA 2L4CA 5FWGA 4BA7A 3C73A 4OO4A 1V2AA 2KUCA 3RAZA 2OE1A 5EVOA 2TRXA 3TJJA 4OWYA 3ZREA 3EPTA 5BRTA 3GYKA 1PMTA 3TKRA 3O76A 4KSMA 1J9BA 5EPFA 2H0IA 3IC8A 1AQWA 5HR2A 3WT1A 5HR1A 3FHKA 3CTGA 1GSUA 1V40A 3GSSA 3HZ8A 2HSYA 4IQ1A 1AUCA 2F9SA 3TB2A 4KH7A 1V57A 1VRSD 2FHEA 1O6JA 1MD4A 4OCFA 5KN1A 2C80A 2F51A 6GSXA 1GUHA 4IP1A 5L71A 5KN3A 3R3EA 2HXKA 3CRUA 5ELGA 2VCXA 1JLWA 2AB6A 2PUKC 5B8AA 4KX4A 4ZILA 2CVBA 3C1SA 3F0IA 2YWNA 1KNGA 4EUYA 4KE3A 3CXGA 1FVKA 3VPQA 3P7XA 2CVDA 3OR5A 1TK8B 3D22A 1GUMA 4MCUA 4POLA 2JU5A 1SL2B 5CRWA 3HJMA 4DSRA 4LA1A 1DSBA 4ZL9A 3A2VA 1EGOA 4K2XA 1K0CA 3QOUA 2F3MA 2GS3A 3ZFLA 3UJ1A 4HJMA 1TOFA 4AF2A 4ZL7A 1AW9A 2V32A 3DVXA 1ACVA 3HVVA 2O89A 1SKWB 3FYGA 2C4JA 5KN0A 2Z9SA 2LRNA 3APQA 3BD2A 2AYTA 5DCGA 3FKFA 1BQ7A 3VWWA 3KMOA 1YQ1A 1FOVA 4YQUA 2FA8A 4V2NA 1XBSA 2X4AA 3RDWA 2LKUA 2DIZA 3GV1A 1TU8A 2K9FA 1AAZA 3DYRA 2VOCA 1FVJA 1K3OA 4FQUA 4HI7A 3MYDA 3KMNA 2FCHA 2WS2A 4NXIA 1XOAA 5J5NA 2IWTA 1XWCA 3KCMA 1G6WA 2JADA 1XWGA 3FR9A 2B3SA 4J57E 3JCML 4EE0A 3ZZXA 3IAS2 4EC0A 4Q5RA 2WCIA 4POMA 1EEMA 4O5QA 3G7YA 5E4WA 1UN2A 1R5AA 2B7KA 1N8JA 4L5LA 4NHZA 3E0UA 1C72A 3LYKA 3A3TA 2L57A 4K5SA 3HVXA 4MJBA 2JZTA 1H4OA 1M2AA 5B7CA 4O92A 4PQ1A 2V2GA 2GT6A 3O3TA 4PQIA 2NTOA 2IMDA 4ZBDA 2PERA 1PX7A 1SK2A 3N5OA 2FWFA 5COHA 3US3A 3F4SA 3HZ4A 3HHVA 3GL3A 3HDCA 3ZVJD 1I9DA 1GP1A 3IDVA 2H19A 2LRTA 3CBUA 4ZB9A 4NPBA 3WGEA 1S3DA 1ERVA 4LLRA 4G19A 1F3AA 4KDXA 2G0FA 1E6BA 2VCTA 2MBTA 2VD0A 3MIXA 2KHPA 3DKSA 2I3YA 3ZIVA 5KEJA 2X8HA 2QSIA 2H72A 4H86A 1XFLA 2VCZA 5DVBA 2H8LA 4DVCA 1UC7A 3R2QA 1GSYA 2H1DA 2XHFA 4V1Ap 3WYWA 4X1UA 1XWKA 3ERFA 3FR6A 3LXZA 3PGTA 2JACA 2A4HA 3WGDA 2HZFA 3IBHA 4Z7XA 3VPTA 1TK5B 3FZ4A 3TOUA 3P8WA 4YAVA 10GSA 3FZ5A 4XCSA 2BTOT 4IHUA 1QQ2A 4MF7A 3D6IA 1OKTA 4OMVA 3Q19A 4ECCA 3C8EA 4XRAA 3UEMA 4KGIA 1YY7A 3P2AA 2O7KA 2CX4A 1S3AA 2B5YA 3W8JA 3KM6A 4A5PA 4NWYA 4E8HA 3TKSA 3TJBA 17GSA 2VL9A 2PGTA 1FW1A 1JZRA 4NHWA 2HRAA 18GSA 4WETA 4MZBA 2HT9A 5D96A 2DKIA 4IKHA 1VF3A 1Q98A 2CZ2A 2V6OA 1PKZA 3F4TA 2DMLA 4POBA 5CP1A 4I2TA 4D73B 1XWBA 3PH9A 1A8YA 5DCHA 1OC3A 1ZL9A 1THOA 2HLSA 3ED3A 5A4WA 1WRYA 2IJYA 4GSNA 3Q6OA 3F63A 3J7Yk 3L78A 3ERGA 1YZXA 2YWMA 4FYCA 2ES7A 1B9YC 4J56E 1XW6A 1K3LA 5J3RA 2K8VA 1K0AA 2WDUA 3TKSC 2C0DA 2TIRA 3GUSA 3P90A 4FYUA 3LJRA 1V9WA 1A2JA 1PKWA 4PQHA 5D9TA 3O6TA 2O8VB 4N10A 1V98A 3LGCA 3TKPA 4AJ8A 1EP8A 3LWAA 4MJCA 1JZWA 1VF2A 2MBSA 4K0NA 4D73A 5DQYA 1A23A 1ST9A 2C8UA 1TK0B 5CNWA 1QUWA 3QAGA 4O5UA 2L59A 1EOHA 4JRRA 2YP6A 1X5DA 2H6YA 4CDOA 2PU9C 2AHEA 4MZCA 4V2LA 5GSSA 4HJ2A 5IMVA 4GSTA 4IJIA 4L8EA 3ZRDA 1SK0A 4AGSA 19GSA 3TGZA 4Z2UA 4KUNA 3SWLA 3FR3A 5JWOB 2FA4A 4GF0A 1SJ6A 1X9WB 3IOSA 3L9UA 2R37A 2PVQA 4GRFA 4CY6A 5LCZA 4HOJA 1TDIA 14GSA 3QAWA 4WR4A 3QR6A 5CAXA 3VFIA 1K3YA 2HRNA 1EEJA 2QGVA 2QA2A 3K8NA 1MEKA 4TKYA 2HNLA 2OADA 5ECSA 4ECBA 4AJ6A 1F6MC 4MF6A 2WJUA 4G0LA 2HSMA 1GSSA 5KOWA 4OFTA 3LORA 1PL1A 1OC9A 1ON4A 2WGRA 4KB3A 2GZZA 4JE1A 2LJRA 1B4QA 5JWQB 2NPBA 1GTIA 3PINA 4MH3A 1LU4A 4PX1A 4QL7A 1ILOA 1Z6MA 2WZ9A 2LUSA 1U88A 4MK3A 1R4WA 3LSZA 4GQFA 5ECRB 2MZCA 1GUKA 1S3CA 4X0XA 4XRDA 3UOMA 3DMLA 1Z7PA 2JZSA 2GSRA 4V1Ag 3BCKA 4EDYA 2M80A 1O7UA 3IE3A 3TJGA 3GH9A 1FHEA 4EIPA 3UL3A 2FWEA 2HI7A 3ME7A 1A2LA 1EOGA 1ABAA 1ZCPA 2VIMA 3I69A 1JZOA 2VD1A 3C71A 3TJKA 2IMIA 2PN8A 4BPYA 4KW6A 5G5EA 2IMKA 3IHGA 4WBJA 2EC4A 1NW2A 4JZQA 4EIQA 1G7EA 4RQXA 1SYXA 1TJDA 1PN0A 1J08A 5AIXA 2OACA 4PGTA 3APSA 1GLQA 3D21A 3QPMA 2H6XA 2P0GA 3LG6A 2OA7A 2DC5A 2O85A 4XS1A 5FHIA 4G0KA 1O73A 1DBYA 1WWJA 2JZRA 1Z9HA 2VLUA 1XW9A 3KP9A 2R3XA 1USBA 5GSTA 4J2FA 3IHQA 1ML6A 4PURA 4F0BA 1JHBA 3GX8A 4CHSA 4GQCA 1VF4A 4MDCA 1AC1A 3GKXA 2CT6A 3CTFA 2OKAA 4G2EA 5JCWA 2O87A 2FUG2 2YZUA 2ZNMA 4GTUA 4CW9A 3GURA 2GT5A 2ON5A 3G9BA 4PUFC 5D8IA 4KF9A 4Z2TA 2GSTA 2CZ3A 2FLSA 1A2MA 3D5JA 3UAPA 1G7OA 2LJKA 1QMVA 1I5GA 3GFKA 4WBRD 2QA1A 3EINA 3I6AA 3IV4A 6GSWA 4F2IA 5ABRA 2X49A 3FK8A 1T4ZA 4LL1B 1SD8A 2B6MA 3H79A 2LV3A 4LMVA 2DMMA 4YQMA 1F37A 1NHYA 2H1GA 4KCAA 1SENA 3KP8A 2X64A 2YJ7A 1Z6NA 9GSSA 2VCWA 1GTUA 2MYGA 2EIRA 2GZYA 2DJ3A 2R6KA 4HZ2A 4OFMA 3U6VA 3HD5A 4HU9A 1BJXA 2TRCP 3LW9A 3PPUA 1DE2A 4WXTA 4POKA 1NHOA 1Z7RA 5G2ZA 3DEXA 5H5QA 3VK9A 2VAFA 2I4AA 4G0IA 4IBPA 2J9HA 1X9MB 1PQNA 3HJOA 2IPAA 1MDJA 3EYTA 3F9UA 3CSHA 4OFNA 1FOHA 5FT3A 3ERWA 2XBIA 2XC2A 3QFBC 3APOA 5ID2B 3F6DA 3CSJA 2H6ZA 3HA9A 6GSYA 1WOUA 1BEDA 2JSZA 3FW2A 5IMDA 1J0FA 4JBBA 2C0FA 1HQOA 2AUVA 2GVPA 3KD0A 4IS0A 2B5EA 2GSSA 3KZQA 4PNFA 1EV9A 3GKKA 2X8GA 2R0GA 5ENUA 3VWVA 1ZMAA 3M9KA 5LNKe 4K0GA 3Q74A 4N0VA 3GNJA 2JSYA 1GLPA 3MDKA 2UZ8A 4NV2A 5ID2A 1XIYA 4KNDA 3L9VA 4L5OA 5ECKB 2CX3A 3H4KA 1TXXA 2LSTA 1SD9A 2DJ0A 1HNAA 3LYPA 1IYIA 3EU3A 5G30A 2H66A 1U3IA 4JR6A 1U87A 2E0QA 3ME8A 1IYHA 1O81A 4IQAA 5F8BA 3ZVJA 1XXUA 8GSSA 3ZFBA 1TRUA 3IR4A 4K9ZA 4ZB8A 1FO5A 5AIVA 3PR8A 2MMNA 4XIHA 3S9FA 4X43A 4PTSA 2B7JA 3LFLA 2IIYA 2MMAA 1GNEA 2RUFA 1HYUA 3WGXA 4MH2A 5JCGA 2PPTA 1ZZYA 2VCQA 2BJXA 3RHCA 4USSA 1PSQA 5JWRB 4HZ4A 3G7JA 3GA4A 2LTKA 2V6KA 2DKHA 5HQPA 5AN1A 2MMZA 4BVXB 5CO3A 1YKCA 3DVWA 5ECHB 2RLIA 3IK9A 4DEJA 3NZNA 5A4VA 2FY6A 3UIWA 2HE3A 5DALB 2H30A 1NSWA 5IQYA 4ZBBA 3M9JA 1WE0A 2IN3A 1FB0A 1R5PA 2L6CA 1MDIA 5HFIA 3GL5A 3QMXA 2H74A 5CREA 3FZ9A 3VURA 1ZOFA 4QQ7A 5HFGA 5EL8A 5B6MA 1B9XC 2C0GA 7GSSA 4TR4A 1XPVA 2IL3A 4XS6A 3UARA 1YJ6A 4ZXGA 4BVXA 4K8MA 3TRPA 4GLTA 4IP6A 4F03A 1T3BA 1THXA 3VI7A 4MA9A 3RHBA 5HR0A 5DALA 2CA8A 3IA1A 1QGVA 4MJAA 3GMFA 4P3YB 5F06A 4BL7B 3TKSE 5E59A 1PRXA 2L4QA 3IXRA 3L4NA 3F3QA 3VWXA 2HRFA 5DDLA 3KEBA 2JL4A 3H93A 3GKNA 2YZHA 1GH2A 3CRTA 1B8XA 2B1KA 1AQVA 1JZDA 2K6VA 1XZOA 4LL4B 2OE0A 1VGLA 4ZBAA 4Z2RA 2YWIA 3ZLPA 2XBQA 1XW5A 1U3AA 4AJ7A 2K18A 4PNGA 2HSHA 4IW9A 3DGQA 3IPZA 2EIOA 2H0HA 1URMA 3UVTA 2NDOA 4BL7A 2G2QA 2YNXA 3WD6A 1RQMA 1CQGA 4RI7A 1EGRA 3MSZA 2M72A 3QDNA 1ERUA 2KOKA 2N5BA 2P5QA 5IMCA 6GSTA 2DLXA 2YV7A 2FGXA 5ELAA 1SJIA 4ICYA 1XVQA 2J23A 1RW1A 1ZGNA 1PGTA 2H71A 1FAAA 1DE1A 3I9V2 5GZZB 5J4UA 1OC8A 3EE2A 1CQHA 1FG4A 5IM9A 3U5RE 2N5FA 4RUVA 1T1VA 5CYYA 4XHMA 1VF1A 2A2SA 4O32A 4CY8A 5ECQB 3HY2A 2L5LA 4JEDA 1GL8A 4WKWA 1O8WA 4RQRA 2X99A 3BJ5A 4XS4B 2E2MA 3GHAA 2VCVA 3BOAA 5KN2A 2REMA 1YKAA 2FNOA 2K8SA 4EO3A 4I2UA 2QKEA 2AV4A 4N11A 3KXOA 5GAND 1PD21 2YCDA 4TW5A 5G1LA 4EXJA 3EMPA 1GRXA 1A0FA 3ZIJA 2RIIA 3VLNA 4ULXA 4EKZA 5C00A 2H0GA 4ML6A 1WJKA 3FRCA 2LQOA 1UVZA 3TKQA 1YEPA 1LBKA 3QCPA 3KTBA 3KH7A 2OBKA 4MF5A 4IGJA 5A5KA 2IMFA 3IK7A 4XS4A 2I1UA 1M2BA 1GSQA 5ECIB 2VL2A 4MZWA 2PVOC 3BCIA 3FZAA 5IMFA 4WF4A 1QK8A 1F3BA 5C04A 1TI1A 4MABA 3L9SA 3LQ7A 1ZYPA 2RUEA 1K0MA 4TRXA 1T7PB 4K7OA 4V2MA 3ZYWA 3E9JB 1WMJA 1SKSB 4YKFA 4F82A 5B6NA 3ZMLA 2KP1A 2C3QA 2DBCA 3H1NA 5IO2A 2HYXA 2M46A 3D4MA 5ECPB 3I43A 4YAPA 1E2YA 3F8UA 2LEGA 2VL2C 3LXTA 1SYRA 2VM2A 2I81A 2R2JA 4HQSA 2A2RA 3E3EA 3QD9A 4PUAA 4ACSA 3ZL5A 1G6YA 4E8EA 16GSA 5D9XA 5IOXA 5H5RA 1QXHA 1XVWA 4TR0A 1A24A 2R0PA 1WP0A 4YKGA 4Q5NA 4TR1B 2L5OA 2H75A 3FY7A 2L6DA 2AAWA 5DAKB 2C3NA 4HDEA 2AJQB 1M99A 2YPMA 4ZIJA 1M2DA 3GTUB 2R0CA 1TTZA 4I5QA 2ZUPA 1GNWA 4KDUA 4MLYA 4ZL8A 3HVSA 1KBNA 2B5XA 1HNBA 3AY8A 3HYPA 4EDZA 4O5RA 5IMZA 3N9JA 3F6FA 4K2DA 5A4UA 1K0OA 3HCZA 5BMUA 4TR1A 3EWLA 4Q5FA 3GN3A 4HUAA 2DJ1A 2DSAA 1GTBA 5B8BA 5DAKA 5IIZA 4OCEA 3VWUA 4OD7A 4ECJA 2BMXA 3MWHA 1OVNA 4YH2A 2C3TA 3LEFA 3W6GA 2WULA 2VM1A 3GRXA 3MNGA 2PBJA 3GTUA 3KIJA 1G0TA 4ZB6A 2GSQA 2OJLA 1EP7A 3CYNA 5F0GA 2LQQA 1TRWA 5ECLB 2NBSA 2YOIA 4TOPA 2H1BA 2HFDA 3TCOA 1EV4A 2R5GA 4MPFA 4MPGA 4GXZA 2V1MA 2CAIA 1T00A 1KEBA 2ZCTA 4KSOA 4HEA2 3RBTA 3IC4A 4XTSA 1OAZA 5ECMB 1Z3EA 1HNCA 2IFQB 4MNNA 2YANA 2LJAA 3CSIA 3C1RA 4L0UA 4TXOB 5IOWA 2YN1A 1X0RA 2YWOA 4O7HA 5HFKA 3EURA 1RK4A 5KOXA 5LD0A 2P31A 4IJ3A 1K0DA 1M9AA 1WIKA 1XWAA 3M0FA 1F2EA 5EY6A 4HQZA 5ECOB 3FEUA 1JFUA 2HZEB 4RI6A 4ECIA 1A0RP 1B4PA 4GCIA 4IN0A 2FWGA 2HRKA 3KGKA 1TP9A 1K0NA 3W8SA 4F0CA 1ZYNA 3M3MA 2GZPA 3TOTA 2IFQA 4K5RA 1TU7A 4ML1A 1BYEA 1OYJA 3QFAC 4TXOA 5J9BA 1GSEA 1ERWA 4EF0A 2B1LA 4K7NA 1Y25A 5D9WA 4IVFA 1SKRB 3DRNA 3H8QA 4NAXA 3TRXA 3A2XA 4JR4A 2DJJA 1SK1A 5DQSA 2VL3A 1H75A 4ISDA 1TW9A 2WFCA 3NOFA 5IMAA 5GAPD 2P5RA 2GTUA 2WB9A 5DJMA 1TRVA 1W89A 2WRTA 3CMIA 2VO4A 2VUPA 4KCEA 4I8BA 2HZEA 2VLTA 3TDGA 3DWVA 5D9VA 2KLXA 3GH6A 3A2WA 1R7HA 3QAVA 2XPDA 5IPHA 3D4TA 3F3RA 1GULA 5G5FA 2I9HA 1SU9A 3G7IA 5J9CA 2RM5A 4BVYB 5ECNB 3IRAA 4WF5A 1UA5A 3NIVA 11GSA 3J7Yb 1PL2A 2C1YA 4TN8A 2LRCA 5J41A 3HJPA 4EL1A 1EWXA 1PX6A 4BWQA 3ISOA 1OKDA 4MP4A 3TRQA 5D73A 5CRHA 1LJRA 2F8FA 3DD3A 3MAKA 2X8CA 1EZKA 2DIYA 4G9HA 2V41A 2A2PA 1U6TA 1GTAA 2R4VA 1Y6EA 2D2ZA 3A5WA 1GSFA 5AGYA 2H01A 4PXOA 1O8XA 2ON7A 4FO5A 5H5SA 4ID0A 4WEYA 1XCCA 1PA3A 2GQLA 2GQMA 5INYA 4BVYA 2FWHA 4Q5QA 1ZYEA 3D0ZA 5G1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVL A;  2H70 A;  1OE7 A;  3KTL A;  1MTC A;  2LS5 A;  1YDK A;  4KDY A;  1KTE A;  2GGT A;  5IPG A;  1YEX A;  1V58 A;  4K1F A;  4YQV A;  1Q4J A;  3Q18 A;  2F8A A;  1AQX A;  3F4R A;  3VI5 A;  2XPE A;  3EU4 A;  5D93 A;  1B48 A;  2E2G A;  4LMW A;  2KP2 A;  3GKM A;  5DBQ A;  2VLV A;  3HXS A;  1Z5Y E;  1TI3 A;  5JCU A;  1NM3 A;  3IAM 2;  5CRD A;  4QL9 A;  3KH9 A;  4KA0 A;  4NMU A;  3M1G A;  2ALB A;  2PMT A;  1T8E B;  4F9Z A;  1OE8 A;  3DXB A;  1M9B A;  20GS A;  1DUG A;  3EMX A;  3UVH A;  1BX9 A;  5HR3 A;  1M7T A;  1T4Y A;  3V1W A;  3UMA A;  2DJ2 A;  4DSS B;  2H73 A;  4FH8 A;  1FB6 A;  3RPN A;  1BG5 A;  2CVK A;  1YF0 A;  1O85 A;  2H76 A;  3HKR A;  4MMM A;  5IO0 A;  4WR5 A;  2LNT A;  1R26 A;  1ERT A;  1X5C A;  3KJY A;  4L0W A;  2RM6 A;  1SL0 B;  1X9S B;  2FD3 A;  2IME A;  2MMO A;  2DJK A;  22GS A;  4FYB A;  4TVE A;  2C0E A;  3ZTL A;  5CRG A;  1TRS A;  13GS A;  1SJZ A;  1OC9 B;  1ZYQ B;  1PN9 A;  3ZIT A;  3UBK A;  4G10 A;  3TUE A;  3TJF A;  4OO5 A;  1WPI A;  4GSS A;  4TR3 A;  4HU7 A;  2E7P A;  1MDK A;  3EC3 A;  1GSD A;  4KAE A;  3L0H A;  4DSS A;  4EVM A;  4K7I A;  2GQK A;  4FIW A;  5F07 A;  1M0U A;  3GX0 A;  2YJH A;  3EVI A;  1MD3 A;  1AIU A;  4BWS A;  3BBY A;  4HS1 A;  1F9M A;  5F05 A;  3GIX A;  2OBI A;  6GSV A;  4ILF A;  5AIS A;  4MJE A;  5G31 A;  4IEL A;  4I6X A;  2CQ9 A;  2CV4 A;  3RPP A;  6GSU A;  1JLV A;  4DSQ A;  4GWR A;  1YF1 A;  4I97 A;  2N5A A;  1A8L A;  4N30 A;  3WT2 A;  3ZMK A;  2LNS A;  2A4V A;  1XOB A;  1K0B A;  4TXV A;  1TKD B;  2GLR A;  2QC7 A;  4N0Z A;  2YV9 A;  1SL1 B;  3SBC A;  2EIQ A;  6GSS A;  1GWC A;  1QFN A;  1X5E A;  2PWJ A;  1HD2 A;  3GST A;  5DJL A;  3M8N A;  2OE3 A;  2CAQ A;  4K6X A;  12GS A;  1BAY A;  2H1A A;  3DIE A;  1W4V A;  1AXD A;  3UBL A;  3C7M A;  4NV5 A;  4JU5 A;  2GDR A;  1N2A A;  2L4C A;  5FWG A;  4BA7 A;  3C73 A;  4OO4 A;  1V2A A;  2KUC A;  3RAZ A;  2OE1 A;  5EVO A;  2TRX A;  3TJJ A;  4OWY A;  3ZRE A;  3GYK A;  1PMT A;  3TKR A;  3O76 A;  4KSM A;  1J9B A;  5EPF A;  2H0I A;  1AQW A;  5HR2 A;  3WT1 A;  5HR1 A;  3FHK A;  3CTG A;  1GSU A;  1V40 A;  3GSS A;  3HZ8 A;  2HSY A;  4IQ1 A;  1AUC A;  2F9S A;  3TB2 A;  4KH7 A;  1V57 A;  1VRS D;  2FHE A;  1O6J A;  1MD4 A;  4OCF A;  5KN1 A;  2C80 A;  2F51 A;  6GSX A;  1GUH A;  4IP1 A;  5L71 A;  5KN3 A;  2HXK A;  3CRU A;  5ELG A;  2VCX A;  1JLW A;  2AB6 A;  2PUK C;  5B8A A;  4KX4 A;  4ZIL A;  2CVB A;  3C1S A;  3F0I A;  2YWN A;  1KNG A;  4EUY A;  4KE3 A;  3CXG A;  1FVK A;  3VPQ A;  3P7X A;  2CVD A;  3OR5 A;  1TK8 B;  3D22 A;  1GUM A;  4MCU A;  4POL A;  2JU5 A;  1SL2 B;  5CRW A;  3HJM A;  4DSR A;  4LA1 A;  1DSB A;  4ZL9 A;  3A2V A;  1EGO A;  1K0C A;  3QOU A;  2F3M A;  2GS3 A;  3ZFL A;  3UJ1 A;  4HJM A;  1TOF A;  4AF2 A;  4ZL7 A;  1AW9 A;  2V32 A;  3DVX A;  1ACV A;  3HVV A;  2O89 A;  1SKW B;  3FYG A;  2C4J A;  5KN0 A;  2Z9S A;  2LRN A;  3APQ A;  3BD2 A;  2AYT A;  5DCG A;  3FKF A;  1BQ7 A;  3VWW A;  3KMO A;  1YQ1 A;  1FOV A;  4YQU A;  2FA8 A;  4V2N A;  1XBS A;  3RDW A;  2LKU A;  2DIZ A;  3GV1 A;  1TU8 A;  2K9F A;  1AAZ A;  3DYR A;  2VOC A;  1FVJ A;  1K3O A;  4HI7 A;  3KMN A;  2FCH A;  2WS2 A;  4NXI A;  1XOA A;  5J5N A;  2IWT A;  1XWC A;  3KCM A;  1G6W A;  2JAD A;  1XWG A;  3FR9 A;  2B3S A;  4J57 E;  3JCM L;  4EE0 A;  3ZZX A;  3IAS 2;  4EC0 A;  4Q5R A;  2WCI A;  4POM A;  1EEM A;  5E4W A;  3G7Y A;  1UN2 A;  1R5A A;  2B7K A;  1N8J A;  4L5L A;  4NHZ A;  3E0U A;  1C72 A;  3LYK A;  3A3T A;  2L57 A;  3HVX A;  4MJB A;  2JZT A;  1H4O A;  1M2A A;  5B7C A;  4O92 A;  4PQ1 A;  2V2G A;  2GT6 A;  3O3T A;  4PQI A;  2NTO A;  2IMD A;  4ZBD A;  2PER A;  1PX7 A;  1SK2 A;  3N5O A;  2FWF A;  5COH A;  3US3 A;  3F4S A;  3HZ4 A;  3HHV A;  3GL3 A;  3HDC A;  3ZVJ D;  1I9D A;  1GP1 A;  3IDV A;  2H19 A;  2LRT A;  3CBU A;  4ZB9 A;  4NPB A;  3WGE A;  1S3D A;  1ERV A;  4LLR A;  4G19 A;  1F3A A;  4KDX A;  2G0F A;  1E6B A;  2VCT A;  2MBT A;  2VD0 A;  2KHP A;  3DKS A;  2I3Y A;  3ZIV A;  5KEJ A;  2X8H A;  2QSI A;  2H72 A;  4H86 A;  1XFL A;  2VCZ A;  5DVB A;  2H8L A;  4DVC A;  1UC7 A;  3R2Q A;  1GSY A;  2H1D A;  2XHF A;  4V1A p;  3WYW A;  4X1U A;  1XWK A;  3ERF A;  3FR6 A;  3LXZ A;  3PGT A;  2JAC A;  3WGD A;  2HZF A;  3IBH A;  4Z7X A;  3VPT A;  1TK5 B;  3FZ4 A;  3TOU A;  3P8W A;  4YAV A;  10GS A;  3FZ5 A;  4XCS A;  2BTO T;  4IHU A;  1QQ2 A;  4MF7 A;  3D6I A;  1OKT A;  4OMV A;  3Q19 A;  4ECC A;  3C8E A;  4XRA A;  3UEM A;  4KGI A;  1YY7 A;  3P2A A;  2O7K A;  2CX4 A;  1S3A A;  2B5Y A;  3W8J A;  3KM6 A;  4E8H A;  4NWY A;  3TKS A;  3TJB A;  17GS A;  2VL9 A;  2PGT A;  1FW1 A;  1JZR A;  4NHW A;  4WET A;  18GS A;  4MZB A;  2HT9 A;  5D96 A;  4IKH A;  1VF3 A;  1Q98 A;  2CZ2 A;  2V6O A;  1PKZ A;  3F4T A;  2DML A;  4POB A;  5CP1 A;  4I2T A;  4D73 B;  1XWB A;  3PH9 A;  1A8Y A;  5DCH A;  1OC3 A;  1ZL9 A;  1THO A;  2HLS A;  3ED3 A;  5A4W A;  1WRY A;  2IJY A;  4GSN A;  3Q6O A;  3F63 A;  3J7Y k;  3L78 A;  3ERG A;  1YZX A;  2YWM A;  4FYC A;  2ES7 A;  1B9Y C;  4J56 E;  1XW6 A;  1K3L A;  5J3R A;  2K8V A;  1K0A A;  2WDU A;  3TKS C;  2C0D A;  2TIR A;  3GUS A;  3P90 A;  4FYU A;  3LJR A;  1V9W A;  1A2J A;  1PKW A;  4PQH A;  5D9T A;  3O6T A;  2O8V B;  4N10 A;  1V98 A;  3LGC A;  3TKP A;  4AJ8 A;  1EP8 A;  3LWA A;  4MJC A;  1JZW A;  1VF2 A;  2MBS A;  4K0N A;  4D73 A;  5DQY A;  1A23 A;  1ST9 A;  2C8U A;  1TK0 B;  5CNW A;  1QUW A;  3QAG A;  2L59 A;  1EOH A;  4JRR A;  2YP6 A;  1X5D A;  2H6Y A;  4CDO A;  2PU9 C;  2AHE A;  4MZC A;  4V2L A;  5GSS A;  4HJ2 A;  5IMV A;  4GST A;  4IJI A;  4L8E A;  3ZRD A;  1SK0 A;  4AGS A;  19GS A;  3TGZ A;  4KUN A;  3SWL A;  3FR3 A;  5JWO B;  2FA4 A;  4GF0 A;  1SJ6 A;  1X9W B;  3IOS A;  3L9U A;  2R37 A;  2PVQ A;  4GRF A;  5LCZ A;  4HOJ A;  1TDI A;  14GS A;  3QAW A;  4WR4 A;  3QR6 A;  5CAX A;  3VFI A;  1K3Y A;  2HRN A;  1EEJ A;  2QGV A;  3K8N A;  1MEK A;  4TKY A;  2HNL A;  2OAD A;  5ECS A;  4ECB A;  4AJ6 A;  1F6M C;  4MF6 A;  2WJU A;  1GSS A;  4OFT A;  3LOR A;  1PL1 A;  1OC9 A;  1ON4 A;  2WGR A;  4KB3 A;  2GZZ A;  4JE1 A;  2LJR A;  1B4Q A;  5JWQ B;  2NPB A;  1GTI A;  3PIN A;  4MH3 A;  1LU4 A;  4PX1 A;  4QL7 A;  1ILO A;  1Z6M A;  2WZ9 A;  2LUS A;  1U88 A;  4MK3 A;  1R4W A;  3LSZ A;  4GQF A;  5ECR B;  2MZC A;  1GUK A;  1S3C A;  4X0X A;  4XRD A;  3UOM A;  3DML A;  1Z7P A;  2JZS A;  2GSR A;  4V1A g;  3BCK A;  4EDY A;  2M80 A;  1O7U A;  3IE3 A;  3TJG A;  3GH9 A;  1FHE A;  3UL3 A;  2FWE A;  2HI7 A;  3ME7 A;  1A2L A;  1EOG A;  1ABA A;  1ZCP A;  2VIM A;  3I69 A;  1JZO A;  2VD1 A;  3C71 A;  3TJK A;  2IMI A;  2PN8 A;  4BPY A;  4KW6 A;  5G5E A;  2IMK A;  4WBJ A;  2EC4 A;  1NW2 A;  4JZQ A;  1G7E A;  4RQX A;  1SYX A;  1TJD A;  1J08 A;  5AIX A;  2OAC A;  4PGT A;  3APS A;  1GLQ A;  3D21 A;  3QPM A;  2H6X A;  2P0G A;  3LG6 A;  2OA7 A;  2DC5 A;  2O85 A;  4XS1 A;  5FHI A;  1O73 A;  1DBY A;  1WWJ A;  2JZR A;  1Z9H A;  2VLU A;  1XW9 A;  3KP9 A;  2R3X A;  1USB A;  5GST A;  4J2F A;  3IHQ A;  1ML6 A;  4PUR A;  4F0B A;  1JHB A;  3GX8 A;  4CHS A;  4GQC A;  1VF4 A;  4MDC A;  1AC1 A;  3GKX A;  2CT6 A;  3CTF A;  2OKA A;  4G2E A;  5JCW A;  2O87 A;  2FUG 2;  2YZU A;  2ZNM A;  4GTU A;  4CW9 A;  3GUR A;  2GT5 A;  2ON5 A;  3G9B A;  4PUF C;  5D8I A;  2GST A;  2CZ3 A;  2FLS A;  1A2M A;  3D5J A;  3UAP A;  1G7O A;  2LJK A;  1QMV A;  1I5G A;  3GFK A;  4WBR D;  3EIN A;  3I6A A;  3IV4 A;  6GSW A;  4F2I A;  5ABR A;  3FK8 A;  1T4Z A;  4LL1 B;  1SD8 A;  2B6M A;  3H79 A;  2LV3 A;  4LMV A;  2DMM A;  4YQM A;  1F37 A;  1NHY A;  2H1G A;  4KCA A;  1SEN A;  3KP8 A;  2X64 A;  2YJ7 A;  1Z6N A;  9GSS A;  2VCW A;  1GTU A;  2MYG A;  2EIR A;  2GZY A;  2DJ3 A;  2R6K A;  4HZ2 A;  4OFM A;  3U6V A;  3HD5 A;  4HU9 A;  1BJX A;  2TRC P;  1DE2 A;  4WXT A;  4POK A;  1NHO A;  1Z7R A;  5G2Z A;  3DEX A;  5H5Q A;  3VK9 A;  2VAF A;  2I4A A;  4IBP A;  2J9H A;  1X9M B;  1PQN A;  3HJO A;  2IPA A;  1MDJ A;  3EYT A;  3F9U A;  3CSH A;  4OFN A;  5FT3 A;  3ERW A;  2XBI A;  2XC2 A;  3QFB C;  3APO A;  5ID2 B;  3F6D A;  3CSJ A;  2H6Z A;  3HA9 A;  6GSY A;  1WOU A;  1BED A;  2JSZ A;  3FW2 A;  5IMD A;  1J0F A;  4JBB A;  2C0F A;  1HQO A;  2AUV A;  2GVP A;  3KD0 A;  4IS0 A;  2B5E A;  2GSS A;  3KZQ A;  4PNF A;  1EV9 A;  3GKK A;  2X8G A;  5ENU A;  3VWV A;  1ZMA A;  3M9K A;  5LNK e;  4K0G A;  3Q74 A;  4N0V A;  3GNJ A;  2JSY A;  1GLP A;  3MDK A;  4NV2 A;  5ID2 A;  1XIY A;  4KND A;  3L9V A;  4L5O A;  5ECK B;  2CX3 A;  3H4K A;  1TXX A;  2LST A;  1SD9 A;  2DJ0 A;  1HNA A;  3LYP A;  1IYI A;  3EU3 A;  5G30 A;  2H66 A;  1U3I A;  4JR6 A;  1U87 A;  2E0Q A;  3ME8 A;  1IYH A;  1O81 A;  4IQA A;  5F8B A;  3ZVJ A;  1XXU A;  8GSS A;  3ZFB A;  1TRU A;  3IR4 A;  4K9Z A;  4ZB8 A;  1FO5 A;  5AIV A;  3PR8 A;  2MMN A;  4XIH A;  3S9F A;  4X43 A;  2B7J A;  3LFL A;  2IIY A;  2MMA A;  1GNE A;  2RUF A;  1HYU A;  3WGX A;  4MH2 A;  5JCG A;  2PPT A;  1ZZY A;  2VCQ A;  2BJX A;  3RHC A;  1PSQ A;  5JWR B;  4HZ4 A;  3G7J A;  3GA4 A;  2LTK A;  2V6K A;  5HQP A;  5AN1 A;  2MMZ A;  5CO3 A;  1YKC A;  3DVW A;  5ECH B;  2RLI A;  3IK9 A;  4DEJ A;  3NZN A;  5A4V A;  2FY6 A;  3UIW A;  2HE3 A;  5DAL B;  2H30 A;  1NSW A;  5IQY A;  4ZBB A;  3M9J A;  1WE0 A;  2IN3 A;  1FB0 A;  1R5P A;  2L6C A;  1MDI A;  5HFI A;  3GL5 A;  3QMX A;  2H74 A;  5CRE A;  3FZ9 A;  3VUR A;  1ZOF A;  4QQ7 A;  5HFG A;  5EL8 A;  5B6M A;  1B9X C;  2C0G A;  7GSS A;  4TR4 A;  1XPV A;  2IL3 A;  4XS6 A;  3UAR A;  1YJ6 A;  4ZXG A;  4BVX A;  4K8M A;  3TRP A;  4GLT A;  4IP6 A;  4F03 A;  1T3B A;  1THX A;  3VI7 A;  4MA9 A;  3RHB A;  5HR0 A;  5DAL A;  2CA8 A;  3IA1 A;  1QGV A;  4MJA A;  3GMF A;  4P3Y B;  5F06 A;  3TKS E;  5E59 A;  1PRX A;  2L4Q A;  3IXR A;  3L4N A;  3F3Q A;  3VWX A;  2HRF A;  5DDL A;  3KEB A;  2JL4 A;  3H93 A;  3GKN A;  2YZH A;  1GH2 A;  3CRT A;  1B8X A;  2B1K A;  1AQV A;  1JZD A;  2K6V A;  1XZO A;  4LL4 B;  2OE0 A;  1VGL A;  4ZBA A;  2YWI A;  3ZLP A;  2XBQ A;  1XW5 A;  1U3A A;  4AJ7 A;  2K18 A;  4PNG A;  2HSH A;  4IW9 A;  3DGQ A;  3IPZ A;  2EIO A;  2H0H A;  1URM A;  3UVT A;  2NDO A;  4BL7 A;  2G2Q A;  2YNX A;  3WD6 A;  1RQM A;  1CQG A;  4RI7 A;  1EGR A;  3MSZ A;  2M72 A;  3QDN A;  1ERU A;  2KOK A;  2N5B A;  2P5Q A;  5IMC A;  6GST A;  2DLX A;  2YV7 A;  2FGX A;  5ELA A;  1SJI A;  1XVQ A;  2J23 A;  1RW1 A;  1ZGN A;  1PGT A;  2H71 A;  1FAA A;  1DE1 A;  3I9V 2;  5GZZ B;  5J4U A;  1OC8 A;  3EE2 A;  1CQH A;  1FG4 A;  5IM9 A;  3U5R E;  2N5F A;  4RUV A;  1T1V A;  5CYY A;  4XHM A;  1VF1 A;  2A2S A;  4O32 A;  5ECQ B;  3HY2 A;  2L5L A;  4JED A;  1GL8 A;  4WKW A;  1O8W A;  4RQR A;  2X99 A;  3BJ5 A;  4XS4 B;  2E2M A;  3GHA A;  2VCV A;  3BOA A;  5KN2 A;  2REM A;  1YKA A;  2FNO A;  2K8S A;  4EO3 A;  4I2U A;  2QKE A;  2AV4 A;  4N11 A;  3KXO A;  5GAN D;  1PD2 1;  2YCD A;  4TW5 A;  5G1L A;  4EXJ A;  3EMP A;  1GRX A;  1A0F A;  3ZIJ A;  2RII A;  3VLN A;  4ULX A;  4EKZ A;  5C00 A;  2H0G A;  4ML6 A;  1WJK A;  3FRC A;  2LQO A;  1UVZ A;  3TKQ A;  1YEP A;  1LBK A;  3QCP A;  3KTB A;  3KH7 A;  2OBK A;  4MF5 A;  4IGJ A;  5A5K A;  2IMF A;  3IK7 A;  4XS4 A;  2I1U A;  1M2B A;  1GSQ A;  5ECI B;  2VL2 A;  4MZW A;  2PVO C;  3BCI A;  3FZA A;  5IMF A;  4WF4 A;  1QK8 A;  1F3B A;  5C04 A;  1TI1 A;  4MAB A;  3L9S A;  3LQ7 A;  2RUE A;  1K0M A;  4TRX A;  1T7P B;  4K7O A;  4V2M A;  3ZYW A;  3E9J B;  1WMJ A;  1SKS B;  4F82 A;  5B6N A;  3ZML A;  2KP1 A;  2C3Q A;  2DBC A;  3H1N A;  5IO2 A;  2HYX A;  2M46 A;  3D4M A;  5ECP B;  3I43 A;  4YAP A;  1E2Y A;  3F8U A;  2LEG A;  2VL2 C;  3LXT A;  1SYR A;  2VM2 A;  2I81 A;  2R2J A;  4HQS A;  2A2R A;  3E3E A;  3QD9 A;  4PUA A;  4ACS A;  3ZL5 A;  1G6Y A;  4E8E A;  16GS A;  5D9X A;  5IOX A;  5H5R A;  1QXH A;  1XVW A;  4TR0 A;  1A24 A;  1WP0 A;  4Q5N A;  4TR1 B;  2L5O A;  2H75 A;  3FY7 A;  2L6D A;  2AAW A;  5DAK B;  2C3N A;  4HDE A;  2AJQ B;  1M99 A;  2YPM A;  4ZIJ A;  1M2D A;  3GTU B;  1TTZ A;  4I5Q A;  2ZUP A;  1GNW A;  4KDU A;  4MLY A;  4ZL8 A;  3HVS A;  1KBN A;  2B5X A;  1HNB A;  3AY8 A;  3HYP A;  4EDZ A;  4O5R A;  5IMZ A;  3N9J A;  3F6F A;  4K2D A;  5A4U A;  1K0O A;  3HCZ A;  4TR1 A;  3EWL A;  4Q5F A;  3GN3 A;  4HUA A;  2DJ1 A;  2DSA A;  1GTB A;  5B8B A;  5DAK A;  5IIZ A;  4OCE A;  3VWU A;  4OD7 A;  4ECJ A;  2BMX A;  3MWH A;  1OVN A;  4YH2 A;  2C3T A;  3LEF A;  3W6G A;  2WUL A;  2VM1 A;  3GRX A;  3MNG A;  2PBJ A;  3GTU A;  3KIJ A;  1G0T A;  4ZB6 A;  2GSQ A;  2OJL A;  1EP7 A;  3CYN A;  5F0G A;  2LQQ A;  1TRW A;  5ECL B;  2NBS A;  2YOI A;  4TOP A;  2H1B A;  2HFD A;  3TCO A;  1EV4 A;  2R5G A;  4MPF A;  4MPG A;  4GXZ A;  2V1M A;  2CAI A;  1T00 A;  1KEB A;  2ZCT A;  4KSO A;  4HEA 2;  3RBT A;  3IC4 A;  4XTS A;  1OAZ A;  5ECM B;  1Z3E A;  1HNC A;  2IFQ B;  2YAN A;  2LJA A;  3CSI A;  3C1R A;  4L0U A;  4TXO B;  5IOW A;  2YN1 A;  1X0R A;  2YWO A;  4O7H A;  5HFK A;  3EUR A;  1RK4 A;  5LD0 A;  2P31 A;  4IJ3 A;  1K0D A;  1M9A A;  1WIK A;  1XWA A;  3M0F A;  1F2E A;  5EY6 A;  4HQZ A;  5ECO B;  3FEU A;  1JFU A;  2HZE B;  4RI6 A;  4ECI A;  1A0R P;  1B4P A;  4GCI A;  4IN0 A;  2FWG A;  3KGK A;  1TP9 A;  1K0N A;  3W8S A;  4F0C A;  3M3M A;  2GZP A;  3TOT A;  2IFQ A;  1TU7 A;  4ML1 A;  1BYE A;  1OYJ A;  3QFA C;  4TXO A;  5J9B A;  1GSE A;  1ERW A;  4EF0 A;  2B1L A;  4K7N A;  1Y25 A;  5D9W A;  4IVF A;  1SKR B;  3DRN A;  3H8Q A;  4NAX A;  3TRX A;  3A2X A;  4JR4 A;  2DJJ A;  1SK1 A;  5DQS A;  2VL3 A;  1H75 A;  4ISD A;  1TW9 A;  2WFC A;  3NOF A;  5IMA A;  5GAP D;  2P5R A;  2GTU A;  2WB9 A;  5DJM A;  1TRV A;  1W89 A;  2WRT A;  3CMI A;  2VO4 A;  2VUP A;  4KCE A;  4I8B A;  2HZE A;  2VLT A;  3TDG A;  3DWV A;  5D9V A;  2KLX A;  3GH6 A;  3A2W A;  1R7H A;  3QAV A;  2XPD A;  5IPH A;  3D4T A;  3F3R A;  1GUL A;  5G5F A;  2I9H A;  1SU9 A;  3G7I A;  5J9C A;  2RM5 A;  5ECN B;  3IRA A;  4WF5 A;  1UA5 A;  3NIV A;  11GS A;  3J7Y b;  1PL2 A;  2C1Y A;  4TN8 A;  2LRC A;  5J41 A;  3HJP A;  4EL1 A;  1EWX A;  1PX6 A;  4BWQ A;  3ISO A;  1OKD A;  4MP4 A;  3TRQ A;  5D73 A;  5CRH A;  1LJR A;  2F8F A;  3DD3 A;  3MAK A;  2X8C A;  1EZK A;  2DIY A;  4G9H A;  2V41 A;  1U6T A;  1GTA A;  2R4V A;  1Y6E A;  2D2Z A;  3A5W A;  1GSF A;  5AGY A;  2H01 A;  4PXO A;  1O8X A;  2ON7 A;  4FO5 A;  5H5S A;  4ID0 A;  4WEY A;  1XCC A;  1PA3 A;  2GQL A;  2GQM A;  5INY A;  4BVY A;  2FWH A;  4Q5Q A;  1ZYE A;  3D0Z A;  5G1K A; 
#chains in the Genus database with same CATH topology
 2NVL A;  2H70 A;  1OE7 A;  3KTL A;  1MTC A;  2LS5 A;  1YDK A;  4KDY A;  1KTE A;  2GGT A;  5IPG A;  1YEX A;  1V58 A;  4K1F A;  4YQV A;  1Q4J A;  3Q18 A;  2F8A A;  1AQX A;  3F4R A;  3VI5 A;  2XPE A;  3EU4 A;  5D93 A;  1B48 A;  2E2G A;  4LMW A;  2KP2 A;  3GKM A;  5DBQ A;  2VLV A;  3HXS A;  1Z5Y E;  1TI3 A;  5JCU A;  1NM3 A;  3IAM 2;  5CRD A;  4QL9 A;  3KH9 A;  4KA0 A;  4NMU A;  3M1G A;  2ALB A;  2PMT A;  1T8E B;  4F9Z A;  1OE8 A;  3DXB A;  1PFO A;  1M9B A;  20GS A;  1DUG A;  3EMX A;  3CQF A;  3UVH A;  3FMW A;  1BX9 A;  5HR3 A;  1M7T A;  1T4Y A;  3V1W A;  3UMA A;  2DJ2 A;  4DSS B;  2H73 A;  4FH8 A;  1FB6 A;  3RPN A;  1BG5 A;  2CVK A;  1YF0 A;  1O85 A;  2H76 A;  3HKR A;  4MMM A;  5IO0 A;  3A5I A;  4WR5 A;  2LNT A;  1R26 A;  1ERT A;  1X5C A;  3KJY A;  4L0W A;  2RM6 A;  1SL0 B;  1X9S B;  2FD3 A;  2IME A;  2MMO A;  2DJK A;  22GS A;  4FYB A;  4TVE A;  2C0E A;  3ZTL A;  5CRG A;  1TRS A;  13GS A;  1SJZ A;  1OC9 B;  1ZYQ B;  1PN9 A;  3ZIT A;  3UBK A;  4G10 A;  3TUE A;  3TJF A;  4OO5 A;  1WPI A;  4GSS A;  4TR3 A;  4HU7 A;  2E7P A;  1MDK A;  3EC3 A;  1GSD A;  4KAE A;  3L0H A;  4DSS A;  4EVM A;  4K7I A;  2GQK A;  4FIW A;  5F07 A;  1M0U A;  3GX0 A;  2YJH A;  3EVI A;  1MD3 A;  1AIU A;  4BWS A;  3BBY A;  4HS1 A;  1F9M A;  5F05 A;  3GIX A;  2OBI A;  6GSV A;  4ILF A;  5AIS A;  4MJE A;  5G31 A;  4IEL A;  4I6X A;  2CV4 A;  2CQ9 A;  3RPP A;  6GSU A;  1JLV A;  4DSQ A;  4GWR A;  1YF1 A;  4I97 A;  2N5A A;  1A8L A;  4N30 A;  3WT2 A;  3ZMK A;  2LNS A;  4X4J A;  2A4V A;  1XOB A;  1K0B A;  4TXV A;  1TKD B;  2GLR A;  2QC7 A;  4N0Z A;  2YV9 A;  1SL1 B;  3SBC A;  2EIQ A;  6GSS A;  1GWC A;  1QFN A;  1X5E A;  2PWJ A;  1HD2 A;  3GST A;  5DJL A;  3M8N A;  2OE3 A;  2CAQ A;  4K6X A;  12GS A;  1BAY A;  2H1A A;  3DIE A;  1W4V A;  1AXD A;  3UBL A;  3C7M A;  4NV5 A;  4JU5 A;  2GDR A;  1N2A A;  2L4C A;  5FWG A;  4BA7 A;  3C73 A;  4OO4 A;  1V2A A;  2KUC A;  3RAZ A;  2OE1 A;  5EVO A;  2TRX A;  3TJJ A;  4OWY A;  3ZRE A;  3EPT A;  5BRT A;  3GYK A;  1PMT A;  3TKR A;  3O76 A;  4KSM A;  1J9B A;  5EPF A;  2H0I A;  3IC8 A;  1AQW A;  5HR2 A;  3WT1 A;  5HR1 A;  3FHK A;  3CTG A;  1GSU A;  1V40 A;  3GSS A;  3HZ8 A;  2HSY A;  4IQ1 A;  1AUC A;  2F9S A;  3TB2 A;  4KH7 A;  1V57 A;  1VRS D;  2FHE A;  1O6J A;  1MD4 A;  4OCF A;  5KN1 A;  2C80 A;  2F51 A;  6GSX A;  1GUH A;  4IP1 A;  5L71 A;  5KN3 A;  3R3E A;  2HXK A;  3CRU A;  5ELG A;  2VCX A;  1JLW A;  2AB6 A;  2PUK C;  5B8A A;  4KX4 A;  4ZIL A;  2CVB A;  3C1S A;  3F0I A;  2YWN A;  1KNG A;  4EUY A;  4KE3 A;  3CXG A;  1FVK A;  3VPQ A;  3P7X A;  2CVD A;  3OR5 A;  1TK8 B;  3D22 A;  1GUM A;  1M3J A;  4MCU A;  4POL A;  2JU5 A;  1SL2 B;  5CRW A;  3HJM A;  4DSR A;  4LA1 A;  1DSB A;  4ZL9 A;  3A2V A;  1EGO A;  4K2X A;  1K0C A;  3QOU A;  2F3M A;  2GS3 A;  3ZFL A;  3UJ1 A;  4HJM A;  1TOF A;  4AF2 A;  4ZL7 A;  1AW9 A;  2V32 A;  3DVX A;  1ACV A;  3HVV A;  2O89 A;  1SKW B;  3FYG A;  2C4J A;  5KN0 A;  2Z9S A;  2LRN A;  3APQ A;  3BD2 A;  2AYT A;  5DCG A;  3FKF A;  1BQ7 A;  3VWW A;  3KMO A;  1YQ1 A;  1FOV A;  4YQU A;  2FA8 A;  4V2N A;  1XBS A;  2X4A A;  3RDW A;  2LKU A;  2DIZ A;  3GV1 A;  1TU8 A;  2K9F A;  1AAZ A;  3DYR A;  2VOC A;  1FVJ A;  1K3O A;  4FQU A;  4HI7 A;  3MYD A;  3KMN A;  2FCH A;  2WS2 A;  4NXI A;  1XOA A;  5J5N A;  2IWT A;  1XWC A;  3KCM A;  1G6W A;  2JAD A;  1XWG A;  3FR9 A;  2B3S A;  4J57 E;  3JCM L;  4EE0 A;  3ZZX A;  3IAS 2;  4EC0 A;  4Q5R A;  2WCI A;  4POM A;  1EEM A;  4O5Q A;  3G7Y A;  5E4W A;  1UN2 A;  1R5A A;  2B7K A;  1N8J A;  4L5L A;  4NHZ A;  3E0U A;  1C72 A;  3LYK A;  3A3T A;  2L57 A;  4K5S A;  3HVX A;  4MJB A;  2JZT A;  1H4O A;  1M2A A;  5B7C A;  4O92 A;  4PQ1 A;  2V2G A;  2GT6 A;  3O3T A;  4PQI A;  2NTO A;  2IMD A;  4ZBD A;  2PER A;  1PX7 A;  1SK2 A;  3N5O A;  2FWF A;  5COH A;  3US3 A;  3F4S A;  3HZ4 A;  3HHV A;  3GL3 A;  3HDC A;  3ZVJ D;  1I9D A;  1GP1 A;  3IDV A;  2H19 A;  2LRT A;  3CBU A;  4ZB9 A;  4NPB A;  3WGE A;  1S3D A;  1ERV A;  4LLR A;  4G19 A;  1F3A A;  4KDX A;  2G0F A;  1E6B A;  2VCT A;  2MBT A;  2VD0 A;  3MIX A;  2KHP A;  3DKS A;  2I3Y A;  3ZIV A;  5KEJ A;  2X8H A;  2QSI A;  2H72 A;  4H86 A;  1XFL A;  2VCZ A;  5DVB A;  2H8L A;  4DVC A;  1UC7 A;  3R2Q A;  1GSY A;  2H1D A;  2XHF A;  4V1A p;  3WYW A;  4X1U A;  1XWK A;  3ERF A;  3FR6 A;  3LXZ A;  3PGT A;  2JAC A;  2A4H A;  3WGD A;  2HZF A;  3IBH A;  4Z7X A;  3VPT A;  1TK5 B;  3FZ4 A;  3TOU A;  3P8W A;  4YAV A;  10GS A;  3FZ5 A;  4XCS A;  2BTO T;  4IHU A;  1QQ2 A;  4MF7 A;  3D6I A;  1OKT A;  4OMV A;  3Q19 A;  4ECC A;  3C8E A;  4XRA A;  3UEM A;  4KGI A;  1YY7 A;  3P2A A;  2O7K A;  2CX4 A;  1S3A A;  2B5Y A;  1XG8 A;  3KM6 A;  3W8J A;  4NWY A;  4A5P A;  3TKS A;  3TJB A;  4E8H A;  17GS A;  2VL9 A;  2PGT A;  1FW1 A;  1JZR A;  4NHW A;  2HRA A;  18GS A;  4WET A;  4MZB A;  2HT9 A;  5D96 A;  2DKI A;  4IKH A;  1VF3 A;  1Q98 A;  2CZ2 A;  2V6O A;  1PKZ A;  3F4T A;  2DML A;  4POB A;  5CP1 A;  4I2T A;  4D73 B;  1XWB A;  3PH9 A;  1A8Y A;  5DCH A;  1OC3 A;  1ZL9 A;  1THO A;  2HLS A;  3ED3 A;  5A4W A;  1WRY A;  2IJY A;  4GSN A;  3Q6O A;  3F63 A;  3J7Y k;  3L78 A;  3ERG A;  1YZX A;  2YWM A;  4FYC A;  2ES7 A;  1B9Y C;  4J56 E;  1XW6 A;  1K3L A;  5J3R A;  2K8V A;  1K0A A;  2WDU A;  3TKS C;  2C0D A;  2TIR A;  3GUS A;  3P90 A;  4FYU A;  3LJR A;  1V9W A;  1A2J A;  1PKW A;  4PQH A;  5D9T A;  3O6T A;  2O8V B;  4N10 A;  1V98 A;  3LGC A;  3TKP A;  4AJ8 A;  1EP8 A;  3LWA A;  4MJC A;  1JZW A;  1VF2 A;  2MBS A;  4K0N A;  4D73 A;  5DQY A;  1A23 A;  1ST9 A;  2C8U A;  1TK0 B;  5CNW A;  1QUW A;  3QAG A;  4O5U A;  2L59 A;  4BIK A;  1EOH A;  4JRR A;  2YP6 A;  1X5D A;  2H6Y A;  4CDO A;  2PU9 C;  2AHE A;  4MZC A;  4V2L A;  5GSS A;  4HJ2 A;  5IMV A;  4GST A;  4IJI A;  4L8E A;  3ZRD A;  1SK0 A;  4AGS A;  19GS A;  3TGZ A;  4Z2U A;  4KUN A;  3SWL A;  3FR3 A;  5JWO B;  2FA4 A;  4GF0 A;  1SJ6 A;  1X9W B;  3IOS A;  3L9U A;  2R37 A;  2PVQ A;  4GRF A;  4CY6 A;  5LCZ A;  4HOJ A;  1TDI A;  14GS A;  3QAW A;  4WR4 A;  3QR6 A;  5CAX A;  3VFI A;  1K3Y A;  2HRN A;  1EEJ A;  2QGV A;  2QA2 A;  3K8N A;  1MEK A;  4TKY A;  2HNL A;  2OAD A;  5ECS A;  4ECB A;  4AJ6 A;  1F6M C;  4MF6 A;  2WJU A;  4G0L A;  2HSM A;  1GSS A;  5KOW A;  4OFT A;  3LOR A;  1PL1 A;  1OC9 A;  1ON4 A;  2WGR A;  4KB3 A;  2GZZ A;  4JE1 A;  2LJR A;  1B4Q A;  5JWQ B;  2NPB A;  1GTI A;  3PIN A;  4MH3 A;  1LU4 A;  4PX1 A;  4QL7 A;  1ILO A;  1Z6M A;  2WZ9 A;  2LUS A;  1U88 A;  4MK3 A;  1R4W A;  3LSZ A;  4GQF A;  5ECR B;  3HVN A;  2MZC A;  1GUK A;  1S3C A;  4X0X A;  4XRD A;  3UOM A;  3DML A;  1Z7P A;  2JZS A;  2GSR A;  4V1A g;  3BCK A;  4EDY A;  2M80 A;  1O7U A;  3IE3 A;  3TJG A;  3GH9 A;  1FHE A;  4EIP A;  3UL3 A;  2FWE A;  2HI7 A;  3ME7 A;  1A2L A;  1EOG A;  1ABA A;  1ZCP A;  2VIM A;  3I69 A;  1JZO A;  2VD1 A;  3C71 A;  3TJK A;  2IMI A;  2PN8 A;  4BPY A;  4KW6 A;  5G5E A;  2IMK A;  3IHG A;  4WBJ A;  2EC4 A;  1NW2 A;  4JZQ A;  4EIQ A;  1G7E A;  4RQX A;  1SYX A;  1TJD A;  1PN0 A;  1J08 A;  5AIX A;  2OAC A;  4PGT A;  3APS A;  1GLQ A;  3D21 A;  3QPM A;  2H6X A;  2P0G A;  3LG6 A;  2OA7 A;  2DC5 A;  2O85 A;  4XS1 A;  5FHI A;  4G0K A;  1O73 A;  1DBY A;  1WWJ A;  2JZR A;  1Z9H A;  2VLU A;  1XW9 A;  3KP9 A;  2R3X A;  1USB A;  5GST A;  4J2F A;  3IHQ A;  1ML6 A;  4PUR A;  4F0B A;  1JHB A;  3GX8 A;  4CHS A;  4GQC A;  1VF4 A;  4MDC A;  1AC1 A;  3GKX A;  2CT6 A;  3CTF A;  2OKA A;  4G2E A;  5JCW A;  2O87 A;  2FUG 2;  2YZU A;  2ZNM A;  4GTU A;  4CW9 A;  3GUR A;  2GT5 A;  2ON5 A;  3G9B A;  4PUF C;  5D8I A;  4KF9 A;  4Z2T A;  2GST A;  2CZ3 A;  2FLS A;  1A2M A;  3D5J A;  3UAP A;  1G7O A;  2LJK A;  1QMV A;  1I5G A;  3GFK A;  4WBR D;  2QA1 A;  3EIN A;  3I6A A;  3IV4 A;  6GSW A;  4F2I A;  5ABR A;  2X49 A;  3FK8 A;  1T4Z A;  4LL1 B;  1SD8 A;  2B6M A;  3H79 A;  2LV3 A;  4LMV A;  2DMM A;  4YQM A;  1F37 A;  1NHY A;  2H1G A;  4KCA A;  1SEN A;  3KP8 A;  2X64 A;  2YJ7 A;  1Z6N A;  9GSS A;  2VCW A;  1GTU A;  2MYG A;  2EIR A;  2GZY A;  2DJ3 A;  2R6K A;  4HZ2 A;  4OFM A;  3U6V A;  3HD5 A;  4HU9 A;  1BJX A;  2TRC P;  3LW9 A;  3PPU A;  1DE2 A;  4WXT A;  4POK A;  1NHO A;  1Z7R A;  5G2Z A;  3DEX A;  5H5Q A;  3VK9 A;  2VAF A;  2I4A A;  4G0I A;  4IBP A;  2J9H A;  1X9M B;  1PQN A;  3HJO A;  2IPA A;  1MDJ A;  3EYT A;  3F9U A;  3CSH A;  4OFN A;  1FOH A;  5FT3 A;  3ERW A;  2XBI A;  2XC2 A;  3QFB C;  3APO A;  5ID2 B;  3F6D A;  3CSJ A;  2H6Z A;  3HA9 A;  6GSY A;  1WOU A;  1BED A;  2JSZ A;  3FW2 A;  5IMD A;  1J0F A;  4JBB A;  2C0F A;  1HQO A;  2AUV A;  2GVP A;  3KD0 A;  4IS0 A;  2B5E A;  2GSS A;  3KZQ A;  4PNF A;  1EV9 A;  3GKK A;  2X8G A;  2R0G A;  5ENU A;  3VWV A;  1ZMA A;  3M9K A;  5LNK e;  4K0G A;  3Q74 A;  4N0V A;  3GNJ A;  2JSY A;  1GLP A;  3MDK A;  2UZ8 A;  4NV2 A;  5ID2 A;  1XIY A;  4KND A;  3L9V A;  4L5O A;  5ECK B;  2CX3 A;  3H4K A;  1TXX A;  2LST A;  1SD9 A;  2DJ0 A;  1HNA A;  3LYP A;  1IYI A;  3EU3 A;  5G30 A;  2H66 A;  1U3I A;  4JR6 A;  1U87 A;  2E0Q A;  3ME8 A;  1IYH A;  1O81 A;  4IQA A;  5F8B A;  3ZVJ A;  1XXU A;  8GSS A;  3ZFB A;  1TRU A;  3IR4 A;  4K9Z A;  4ZB8 A;  1FO5 A;  5AIV A;  3PR8 A;  2MMN A;  4XIH A;  3S9F A;  4X43 A;  4PTS A;  2B7J A;  3LFL A;  2IIY A;  2MMA A;  1GNE A;  2RUF A;  1HYU A;  3WGX A;  4MH2 A;  5JCG A;  2PPT A;  1ZZY A;  2VCQ A;  2BJX A;  3RHC A;  4USS A;  1PSQ A;  5JWR B;  4HZ4 A;  3G7J A;  3GA4 A;  2LTK A;  2V6K A;  2DKH A;  5HQP A;  5AN1 A;  2MMZ A;  4BVX B;  5CO3 A;  1YKC A;  3DVW A;  5ECH B;  2RLI A;  3IK9 A;  4DEJ A;  3NZN A;  5A4V A;  2FY6 A;  3UIW A;  2HE3 A;  5DAL B;  2H30 A;  1NSW A;  5IQY A;  4ZBB A;  3M9J A;  1WE0 A;  2IN3 A;  1FB0 A;  1R5P A;  2L6C A;  1MDI A;  5HFI A;  3GL5 A;  3QMX A;  2H74 A;  5CRE A;  3FZ9 A;  3VUR A;  1ZOF A;  4QQ7 A;  5HFG A;  5EL8 A;  5B6M A;  1B9X C;  2C0G A;  7GSS A;  4TR4 A;  1XPV A;  2IL3 A;  1S3R A;  4XS6 A;  3UAR A;  1YJ6 A;  4ZXG A;  4BVX A;  4K8M A;  3TRP A;  4GLT A;  4IP6 A;  4F03 A;  1T3B A;  1THX A;  3VI7 A;  4MA9 A;  3RHB A;  5HR0 A;  5DAL A;  2CA8 A;  3IA1 A;  1QGV A;  4MJA A;  3GMF A;  4P3Y B;  5F06 A;  4BL7 B;  3TKS E;  5E59 A;  1PRX A;  2L4Q A;  3IXR A;  3L4N A;  3F3Q A;  3VWX A;  2HRF A;  5DDL A;  3KEB A;  2JL4 A;  3H93 A;  3GKN A;  2YZH A;  1GH2 A;  3CRT A;  1B8X A;  2B1K A;  1AQV A;  1JZD A;  2K6V A;  1XZO A;  4LL4 B;  2OE0 A;  1VGL A;  4ZBA A;  4Z2R A;  2YWI A;  3ZLP A;  2XBQ A;  1XW5 A;  1U3A A;  4AJ7 A;  2K18 A;  4PNG A;  2HSH A;  4IW9 A;  3DGQ A;  3IPZ A;  2EIO A;  2H0H A;  1URM A;  3UVT A;  2NDO A;  4BL7 A;  2G2Q A;  2YNX A;  3WD6 A;  1RQM A;  1CQG A;  4RI7 A;  1EGR A;  3MSZ A;  2M72 A;  3QDN A;  1ERU A;  2KOK A;  2N5B A;  2P5Q A;  5IMC A;  6GST A;  2DLX A;  2YV7 A;  2FGX A;  5ELA A;  1SJI A;  4ICY A;  1XVQ A;  2J23 A;  1RW1 A;  1ZGN A;  1PGT A;  2H71 A;  1FAA A;  1DE1 A;  3I9V 2;  5GZZ B;  5J4U A;  1OC8 A;  3EE2 A;  1CQH A;  1FG4 A;  5IM9 A;  3U5R E;  2N5F A;  4RUV A;  1T1V A;  5CYY A;  4XHM A;  1VF1 A;  2A2S A;  4O32 A;  4CY8 A;  5ECQ B;  3HY2 A;  2L5L A;  4JED A;  1GL8 A;  4WKW A;  1O8W A;  4RQR A;  2X99 A;  3BJ5 A;  4XS4 B;  2E2M A;  3GHA A;  2VCV A;  3BOA A;  5KN2 A;  2REM A;  1YKA A;  2FNO A;  2K8S A;  4EO3 A;  4I2U A;  2QKE A;  2AV4 A;  4N11 A;  3KXO A;  5GAN D;  1PD2 1;  2YCD A;  4TW5 A;  5G1L A;  4EXJ A;  3EMP A;  1GRX A;  1A0F A;  3ZIJ A;  2RII A;  3VLN A;  4ULX A;  4EKZ A;  5C00 A;  2H0G A;  4ML6 A;  1WJK A;  3FRC A;  2LQO A;  1UVZ A;  3TKQ A;  1YEP A;  1LBK A;  3QCP A;  3KTB A;  3KH7 A;  2OBK A;  4MF5 A;  4IGJ A;  5A5K A;  2IMF A;  3IK7 A;  4XS4 A;  2I1U A;  1M2B A;  1GSQ A;  5ECI B;  2VL2 A;  4MZW A;  2PVO C;  3BCI A;  3FZA A;  5IMF A;  4WF4 A;  1QK8 A;  1F3B A;  5C04 A;  1TI1 A;  4MAB A;  3L9S A;  3LQ7 A;  1ZYP A;  2RUE A;  1K0M A;  4TRX A;  1T7P B;  4K7O A;  4V2M A;  3ZYW A;  3E9J B;  1WMJ A;  1SKS B;  4YKF A;  4F82 A;  5B6N A;  3ZML A;  2KP1 A;  2C3Q A;  2DBC A;  3H1N A;  5IO2 A;  2HYX A;  2M46 A;  3D4M A;  5ECP B;  3I43 A;  4YAP A;  1E2Y A;  3F8U A;  2LEG A;  2VL2 C;  3LXT A;  1SYR A;  2VM2 A;  2I81 A;  2R2J A;  4HQS A;  2A2R A;  3E3E A;  3QD9 A;  4PUA A;  4ACS A;  3ZL5 A;  1G6Y A;  4E8E A;  16GS A;  5D9X A;  5IOX A;  5H5R A;  1QXH A;  1XVW A;  4TR0 A;  1A24 A;  2R0P A;  1WP0 A;  4YKG A;  4Q5N A;  4TR1 B;  2L5O A;  2H75 A;  1M3I A;  3FY7 A;  2L6D A;  2AAW A;  5DAK B;  2C3N A;  4HDE A;  2AJQ B;  1M99 A;  2YPM A;  4ZIJ A;  1M2D A;  3GTU B;  2R0C A;  1TTZ A;  4I5Q A;  2ZUP A;  1GNW A;  4KDU A;  4MLY A;  4ZL8 A;  3HVS A;  1KBN A;  2B5X A;  1HNB A;  3AY8 A;  3HYP A;  4EDZ A;  4O5R A;  5IMZ A;  3N9J A;  3F6F A;  4K2D A;  5A4U A;  1K0O A;  3HCZ A;  5BMU A;  4TR1 A;  3EWL A;  4Q5F A;  3GN3 A;  4HUA A;  2DJ1 A;  2DSA A;  1GTB A;  5B8B A;  5DAK A;  5IIZ A;  4OCE A;  3VWU A;  4OD7 A;  4ECJ A;  2BMX A;  3MWH A;  1OVN A;  4YH2 A;  2C3T A;  3LEF A;  3W6G A;  2WUL A;  2VM1 A;  3GRX A;  3MNG A;  2PBJ A;  3GTU A;  4HSC X;  3KIJ A;  1G0T A;  4ZB6 A;  2GSQ A;  2OJL A;  1EP7 A;  3CYN A;  5F0G A;  2LQQ A;  1TRW A;  5ECL B;  2NBS A;  2YOI A;  4TOP A;  2H1B A;  2HFD A;  3TCO A;  1EV4 A;  2R5G A;  4MPF A;  4MPG A;  4GXZ A;  2V1M A;  2CAI A;  1T00 A;  1KEB A;  2ZCT A;  4KSO A;  4HEA 2;  3RBT A;  3IC4 A;  4XTS A;  1OAZ A;  5ECM B;  1Z3E A;  1HNC A;  2IFQ B;  4MNN A;  2YAN A;  2LJA A;  3CSI A;  3C1R A;  4L0U A;  4TXO B;  5IOW A;  2YN1 A;  1X0R A;  2YWO A;  4O7H A;  5HFK A;  3EUR A;  1RK4 A;  5KOX A;  5LD0 A;  2P31 A;  4IJ3 A;  1K0D A;  1M9A A;  1WIK A;  1XWA A;  3M0F A;  1F2E A;  5EY6 A;  4HQZ A;  5ECO B;  3FEU A;  1JFU A;  2HZE B;  4RI6 A;  4ECI A;  1A0R P;  1B4P A;  4GCI A;  4IN0 A;  2FWG A;  2HRK A;  3KGK A;  1TP9 A;  1K0N A;  3W8S A;  4F0C A;  1ZYN A;  3M3M A;  2GZP A;  3TOT A;  2IFQ A;  4K5R A;  1TU7 A;  4ML1 A;  1BYE A;  1OYJ A;  3QFA C;  4TXO A;  5J9B A;  1GSE A;  1ERW A;  4EF0 A;  2B1L A;  4K7N A;  1Y25 A;  5D9W A;  4IVF A;  1SKR B;  3DRN A;  3H8Q A;  4NAX A;  3TRX A;  3A2X A;  4JR4 A;  2DJJ A;  1SK1 A;  5DQS A;  2VL3 A;  1H75 A;  4ISD A;  1TW9 A;  2WFC A;  3NOF A;  5IMA A;  5GAP D;  2P5R A;  2GTU A;  2WB9 A;  5DJM A;  1TRV A;  1W89 A;  2WRT A;  3CMI A;  2VO4 A;  2VUP A;  4KCE A;  4I8B A;  2HZE A;  2VLT A;  3TDG A;  3DWV A;  5D9V A;  2KLX A;  3GH6 A;  3A2W A;  1R7H A;  3QAV A;  2XPD A;  5IPH A;  3D4T A;  3F3R A;  1GUL A;  5G5F A;  2I9H A;  1SU9 A;  3G7I A;  5J9C A;  2RM5 A;  4BVY B;  5ECN B;  3IRA A;  4WF5 A;  1UA5 A;  3NIV A;  11GS A;  3J7Y b;  1PL2 A;  2C1Y A;  4TN8 A;  2LRC A;  5J41 A;  3HJP A;  4EL1 A;  1EWX A;  1PX6 A;  4BWQ A;  3ISO A;  1OKD A;  4MP4 A;  3TRQ A;  5D73 A;  5CRH A;  1LJR A;  2F8F A;  3DD3 A;  3MAK A;  2X8C A;  1EZK A;  2DIY A;  4G9H A;  2V41 A;  2A2P A;  1U6T A;  1GTA A;  2R4V A;  1Y6E A;  2D2Z A;  3A5W A;  1GSF A;  5AGY A;  2H01 A;  4PXO A;  1O8X A;  2ON7 A;  4FO5 A;  5H5S A;  4ID0 A;  4WEY A;  1XCC A;  1PA3 A;  2GQL A;  2GQM A;  5INY A;  4BVY A;  2FWH A;  4Q5Q A;  1ZYE A;  3D0Z A;  5G1K A; 
#chains in the Genus database with same CATH homology
 2NVL A;  2H70 A;  1OE7 A;  3KTL A;  1MTC A;  2LS5 A;  1YDK A;  4KDY A;  1KTE A;  2GGT A;  5IPG A;  1YEX A;  1V58 A;  4K1F A;  4YQV A;  1Q4J A;  3Q18 A;  2F8A A;  1AQX A;  3F4R A;  3VI5 A;  2XPE A;  3EU4 A;  5D93 A;  1B48 A;  2E2G A;  4LMW A;  2KP2 A;  3GKM A;  5DBQ A;  2VLV A;  3HXS A;  1Z5Y E;  1TI3 A;  5JCU A;  1NM3 A;  3IAM 2;  5CRD A;  4QL9 A;  3KH9 A;  4KA0 A;  4NMU A;  3M1G A;  2ALB A;  2PMT A;  1T8E B;  4F9Z A;  1OE8 A;  3DXB A;  1M9B A;  20GS A;  1DUG A;  3EMX A;  3UVH A;  3FMW A;  1BX9 A;  5HR3 A;  1M7T A;  1T4Y A;  3V1W A;  3UMA A;  2DJ2 A;  4DSS B;  2H73 A;  4FH8 A;  1FB6 A;  3RPN A;  1BG5 A;  2CVK A;  1YF0 A;  1O85 A;  2H76 A;  3HKR A;  4MMM A;  5IO0 A;  3A5I A;  4WR5 A;  2LNT A;  1R26 A;  1ERT A;  1X5C A;  3KJY A;  4L0W A;  2RM6 A;  1SL0 B;  1X9S B;  2FD3 A;  2IME A;  2MMO A;  2DJK A;  22GS A;  4FYB A;  4TVE A;  2C0E A;  3ZTL A;  5CRG A;  1TRS A;  13GS A;  1SJZ A;  1OC9 B;  1ZYQ B;  1PN9 A;  3ZIT A;  3UBK A;  4G10 A;  3TUE A;  3TJF A;  4OO5 A;  1WPI A;  4GSS A;  4TR3 A;  4HU7 A;  2E7P A;  1MDK A;  3EC3 A;  1GSD A;  4KAE A;  3L0H A;  4DSS A;  4EVM A;  4K7I A;  2GQK A;  4FIW A;  5F07 A;  1M0U A;  3GX0 A;  2YJH A;  3EVI A;  1MD3 A;  1AIU A;  4BWS A;  3BBY A;  4HS1 A;  1F9M A;  5F05 A;  3GIX A;  2OBI A;  6GSV A;  4ILF A;  5AIS A;  4MJE A;  5G31 A;  4IEL A;  4I6X A;  2CQ9 A;  2CV4 A;  3RPP A;  6GSU A;  1JLV A;  4DSQ A;  4GWR A;  1YF1 A;  4I97 A;  2N5A A;  1A8L A;  4N30 A;  3WT2 A;  3ZMK A;  2LNS A;  4X4J A;  2A4V A;  1XOB A;  1K0B A;  4TXV A;  1TKD B;  2GLR A;  2QC7 A;  4N0Z A;  2YV9 A;  1SL1 B;  3SBC A;  2EIQ A;  6GSS A;  1GWC A;  1QFN A;  1X5E A;  2PWJ A;  1HD2 A;  3GST A;  5DJL A;  3M8N A;  2OE3 A;  2CAQ A;  4K6X A;  12GS A;  1BAY A;  2H1A A;  3DIE A;  1W4V A;  1AXD A;  3UBL A;  3C7M A;  4NV5 A;  4JU5 A;  2GDR A;  1N2A A;  2L4C A;  5FWG A;  4BA7 A;  3C73 A;  4OO4 A;  1V2A A;  2KUC A;  3RAZ A;  2OE1 A;  5EVO A;  2TRX A;  3TJJ A;  4OWY A;  3ZRE A;  3EPT A;  5BRT A;  3GYK A;  1PMT A;  3TKR A;  3O76 A;  4KSM A;  1J9B A;  5EPF A;  2H0I A;  3IC8 A;  1AQW A;  5HR2 A;  3WT1 A;  5HR1 A;  3FHK A;  3CTG A;  1GSU A;  1V40 A;  3GSS A;  3HZ8 A;  2HSY A;  4IQ1 A;  1AUC A;  2F9S A;  3TB2 A;  4KH7 A;  1V57 A;  1VRS D;  2FHE A;  1O6J A;  1MD4 A;  4OCF A;  5KN1 A;  2C80 A;  2F51 A;  6GSX A;  1GUH A;  4IP1 A;  5L71 A;  5KN3 A;  3R3E A;  2HXK A;  3CRU A;  5ELG A;  2VCX A;  1JLW A;  2AB6 A;  2PUK C;  5B8A A;  4KX4 A;  4ZIL A;  2CVB A;  3C1S A;  3F0I A;  2YWN A;  1KNG A;  4EUY A;  4KE3 A;  3CXG A;  1FVK A;  3VPQ A;  3P7X A;  2CVD A;  3OR5 A;  1TK8 B;  3D22 A;  1GUM A;  4MCU A;  4POL A;  2JU5 A;  1SL2 B;  5CRW A;  3HJM A;  4DSR A;  4LA1 A;  1DSB A;  4ZL9 A;  3A2V A;  1EGO A;  4K2X A;  1K0C A;  3QOU A;  2F3M A;  2GS3 A;  3ZFL A;  3UJ1 A;  4HJM A;  1TOF A;  4AF2 A;  4ZL7 A;  1AW9 A;  2V32 A;  3DVX A;  1ACV A;  3HVV A;  2O89 A;  1SKW B;  3FYG A;  2C4J A;  5KN0 A;  2Z9S A;  2LRN A;  3APQ A;  3BD2 A;  2AYT A;  5DCG A;  3FKF A;  1BQ7 A;  3VWW A;  3KMO A;  1YQ1 A;  1FOV A;  4YQU A;  2FA8 A;  4V2N A;  1XBS A;  2X4A A;  3RDW A;  2LKU A;  2DIZ A;  3GV1 A;  1TU8 A;  2K9F A;  1AAZ A;  3DYR A;  2VOC A;  1FVJ A;  1K3O A;  4FQU A;  4HI7 A;  3MYD A;  3KMN A;  2FCH A;  2WS2 A;  4NXI A;  1XOA A;  5J5N A;  2IWT A;  1XWC A;  3KCM A;  1G6W A;  2JAD A;  1XWG A;  3FR9 A;  2B3S A;  4J57 E;  3JCM L;  4EE0 A;  3ZZX A;  3IAS 2;  4EC0 A;  4Q5R A;  2WCI A;  4POM A;  1EEM A;  4O5Q A;  3G7Y A;  5E4W A;  1UN2 A;  1R5A A;  2B7K A;  1N8J A;  4L5L A;  4NHZ A;  3E0U A;  1C72 A;  3LYK A;  3A3T A;  2L57 A;  4K5S A;  3HVX A;  4MJB A;  2JZT A;  1H4O A;  1M2A A;  5B7C A;  4O92 A;  4PQ1 A;  2V2G A;  2GT6 A;  3O3T A;  4PQI A;  2NTO A;  2IMD A;  4ZBD A;  2PER A;  1PX7 A;  1SK2 A;  3N5O A;  2FWF A;  5COH A;  3US3 A;  3F4S A;  3HZ4 A;  3HHV A;  3GL3 A;  3HDC A;  3ZVJ D;  1I9D A;  1GP1 A;  3IDV A;  2H19 A;  2LRT A;  3CBU A;  4ZB9 A;  4NPB A;  3WGE A;  1S3D A;  1ERV A;  4LLR A;  4G19 A;  1F3A A;  4KDX A;  2G0F A;  1E6B A;  2VCT A;  2MBT A;  2VD0 A;  3MIX A;  2KHP A;  3DKS A;  2I3Y A;  3ZIV A;  5KEJ A;  2X8H A;  2QSI A;  2H72 A;  4H86 A;  1XFL A;  2VCZ A;  5DVB A;  2H8L A;  4DVC A;  1UC7 A;  3R2Q A;  1GSY A;  2H1D A;  2XHF A;  4V1A p;  3WYW A;  4X1U A;  1XWK A;  3ERF A;  3FR6 A;  3LXZ A;  3PGT A;  2JAC A;  2A4H A;  3WGD A;  2HZF A;  3IBH A;  4Z7X A;  3VPT A;  1TK5 B;  3FZ4 A;  3TOU A;  3P8W A;  4YAV A;  10GS A;  3FZ5 A;  4XCS A;  2BTO T;  4IHU A;  1QQ2 A;  4MF7 A;  3D6I A;  1OKT A;  4OMV A;  3Q19 A;  4ECC A;  3C8E A;  4XRA A;  3UEM A;  4KGI A;  1YY7 A;  3P2A A;  2O7K A;  2CX4 A;  1S3A A;  2B5Y A;  3W8J A;  3KM6 A;  4A5P A;  4NWY A;  4E8H A;  3TKS A;  3TJB A;  17GS A;  2VL9 A;  2PGT A;  1FW1 A;  1JZR A;  4NHW A;  2HRA A;  18GS A;  4WET A;  4MZB A;  2HT9 A;  5D96 A;  2DKI A;  4IKH A;  1VF3 A;  1Q98 A;  2CZ2 A;  2V6O A;  1PKZ A;  3F4T A;  2DML A;  4POB A;  5CP1 A;  4I2T A;  4D73 B;  1XWB A;  3PH9 A;  1A8Y A;  5DCH A;  1OC3 A;  1ZL9 A;  1THO A;  2HLS A;  3ED3 A;  5A4W A;  1WRY A;  2IJY A;  4GSN A;  3Q6O A;  3F63 A;  3J7Y k;  3L78 A;  3ERG A;  1YZX A;  2YWM A;  4FYC A;  2ES7 A;  1B9Y C;  4J56 E;  1XW6 A;  1K3L A;  5J3R A;  2K8V A;  1K0A A;  2WDU A;  3TKS C;  2C0D A;  2TIR A;  3GUS A;  3P90 A;  4FYU A;  3LJR A;  1V9W A;  1A2J A;  1PKW A;  4PQH A;  5D9T A;  3O6T A;  2O8V B;  4N10 A;  1V98 A;  3LGC A;  3TKP A;  4AJ8 A;  1EP8 A;  3LWA A;  4MJC A;  1JZW A;  1VF2 A;  2MBS A;  4K0N A;  4D73 A;  5DQY A;  1A23 A;  1ST9 A;  2C8U A;  1TK0 B;  5CNW A;  1QUW A;  3QAG A;  4O5U A;  2L59 A;  1EOH A;  4JRR A;  2YP6 A;  1X5D A;  2H6Y A;  4CDO A;  2PU9 C;  2AHE A;  4MZC A;  4V2L A;  5GSS A;  4HJ2 A;  5IMV A;  4GST A;  4IJI A;  4L8E A;  3ZRD A;  1SK0 A;  4AGS A;  19GS A;  3TGZ A;  4Z2U A;  4KUN A;  3SWL A;  3FR3 A;  5JWO B;  2FA4 A;  4GF0 A;  1SJ6 A;  1X9W B;  3IOS A;  3L9U A;  2R37 A;  2PVQ A;  4GRF A;  4CY6 A;  5LCZ A;  4HOJ A;  1TDI A;  14GS A;  3QAW A;  4WR4 A;  3QR6 A;  5CAX A;  3VFI A;  1K3Y A;  2HRN A;  1EEJ A;  2QGV A;  2QA2 A;  3K8N A;  1MEK A;  4TKY A;  2HNL A;  2OAD A;  5ECS A;  4ECB A;  4AJ6 A;  1F6M C;  4MF6 A;  2WJU A;  4G0L A;  2HSM A;  1GSS A;  5KOW A;  4OFT A;  3LOR A;  1PL1 A;  1OC9 A;  1ON4 A;  2WGR A;  4KB3 A;  2GZZ A;  4JE1 A;  2LJR A;  1B4Q A;  5JWQ B;  2NPB A;  1GTI A;  3PIN A;  4MH3 A;  1LU4 A;  4PX1 A;  4QL7 A;  1ILO A;  1Z6M A;  2WZ9 A;  2LUS A;  1U88 A;  4MK3 A;  1R4W A;  3LSZ A;  4GQF A;  5ECR B;  2MZC A;  1GUK A;  1S3C A;  4X0X A;  4XRD A;  3UOM A;  3DML A;  1Z7P A;  2JZS A;  2GSR A;  4V1A g;  3BCK A;  4EDY A;  2M80 A;  1O7U A;  3IE3 A;  3TJG A;  3GH9 A;  1FHE A;  4EIP A;  3UL3 A;  2FWE A;  2HI7 A;  3ME7 A;  1A2L A;  1EOG A;  1ABA A;  1ZCP A;  2VIM A;  3I69 A;  1JZO A;  2VD1 A;  3C71 A;  3TJK A;  2IMI A;  2PN8 A;  4BPY A;  4KW6 A;  5G5E A;  2IMK A;  3IHG A;  4WBJ A;  2EC4 A;  1NW2 A;  4JZQ A;  4EIQ A;  1G7E A;  4RQX A;  1SYX A;  1TJD A;  1PN0 A;  1J08 A;  5AIX A;  2OAC A;  4PGT A;  3APS A;  1GLQ A;  3D21 A;  3QPM A;  2H6X A;  2P0G A;  3LG6 A;  2OA7 A;  2DC5 A;  2O85 A;  4XS1 A;  5FHI A;  4G0K A;  1O73 A;  1DBY A;  1WWJ A;  2JZR A;  1Z9H A;  2VLU A;  1XW9 A;  3KP9 A;  2R3X A;  1USB A;  5GST A;  4J2F A;  3IHQ A;  1ML6 A;  4PUR A;  4F0B A;  1JHB A;  3GX8 A;  4CHS A;  4GQC A;  1VF4 A;  4MDC A;  1AC1 A;  3GKX A;  2CT6 A;  3CTF A;  2OKA A;  4G2E A;  5JCW A;  2O87 A;  2FUG 2;  2YZU A;  2ZNM A;  4GTU A;  4CW9 A;  3GUR A;  2GT5 A;  2ON5 A;  3G9B A;  4PUF C;  5D8I A;  4KF9 A;  4Z2T A;  2GST A;  2CZ3 A;  2FLS A;  1A2M A;  3D5J A;  3UAP A;  1G7O A;  2LJK A;  1QMV A;  1I5G A;  3GFK A;  4WBR D;  2QA1 A;  3EIN A;  3I6A A;  3IV4 A;  6GSW A;  4F2I A;  5ABR A;  2X49 A;  3FK8 A;  1T4Z A;  4LL1 B;  1SD8 A;  2B6M A;  3H79 A;  2LV3 A;  4LMV A;  2DMM A;  4YQM A;  1F37 A;  1NHY A;  2H1G A;  4KCA A;  1SEN A;  3KP8 A;  2X64 A;  2YJ7 A;  1Z6N A;  9GSS A;  2VCW A;  1GTU A;  2MYG A;  2EIR A;  2GZY A;  2DJ3 A;  2R6K A;  4HZ2 A;  4OFM A;  3U6V A;  3HD5 A;  4HU9 A;  1BJX A;  2TRC P;  3LW9 A;  3PPU A;  1DE2 A;  4WXT A;  4POK A;  1NHO A;  1Z7R A;  5G2Z A;  3DEX A;  5H5Q A;  3VK9 A;  2VAF A;  2I4A A;  4G0I A;  4IBP A;  2J9H A;  1X9M B;  1PQN A;  3HJO A;  2IPA A;  1MDJ A;  3EYT A;  3F9U A;  3CSH A;  4OFN A;  1FOH A;  5FT3 A;  3ERW A;  2XBI A;  2XC2 A;  3QFB C;  3APO A;  5ID2 B;  3F6D A;  3CSJ A;  2H6Z A;  3HA9 A;  6GSY A;  1WOU A;  1BED A;  2JSZ A;  3FW2 A;  5IMD A;  1J0F A;  4JBB A;  2C0F A;  1HQO A;  2AUV A;  2GVP A;  3KD0 A;  4IS0 A;  2B5E A;  2GSS A;  3KZQ A;  4PNF A;  1EV9 A;  3GKK A;  2X8G A;  2R0G A;  5ENU A;  3VWV A;  1ZMA A;  3M9K A;  5LNK e;  4K0G A;  3Q74 A;  4N0V A;  3GNJ A;  2JSY A;  1GLP A;  3MDK A;  2UZ8 A;  4NV2 A;  5ID2 A;  1XIY A;  4KND A;  3L9V A;  4L5O A;  5ECK B;  2CX3 A;  3H4K A;  1TXX A;  2LST A;  1SD9 A;  2DJ0 A;  1HNA A;  3LYP A;  1IYI A;  3EU3 A;  5G30 A;  2H66 A;  1U3I A;  4JR6 A;  1U87 A;  2E0Q A;  3ME8 A;  1IYH A;  1O81 A;  4IQA A;  5F8B A;  3ZVJ A;  1XXU A;  8GSS A;  3ZFB A;  1TRU A;  3IR4 A;  4K9Z A;  4ZB8 A;  1FO5 A;  5AIV A;  3PR8 A;  2MMN A;  4XIH A;  3S9F A;  4X43 A;  4PTS A;  2B7J A;  3LFL A;  2IIY A;  2MMA A;  1GNE A;  2RUF A;  1HYU A;  3WGX A;  4MH2 A;  5JCG A;  2PPT A;  1ZZY A;  2VCQ A;  2BJX A;  3RHC A;  4USS A;  1PSQ A;  5JWR B;  4HZ4 A;  3G7J A;  3GA4 A;  2LTK A;  2V6K A;  2DKH A;  5HQP A;  5AN1 A;  2MMZ A;  4BVX B;  5CO3 A;  1YKC A;  3DVW A;  5ECH B;  2RLI A;  3IK9 A;  4DEJ A;  3NZN A;  5A4V A;  2FY6 A;  3UIW A;  2HE3 A;  5DAL B;  2H30 A;  1NSW A;  5IQY A;  4ZBB A;  3M9J A;  1WE0 A;  2IN3 A;  1FB0 A;  1R5P A;  2L6C A;  1MDI A;  5HFI A;  3GL5 A;  3QMX A;  2H74 A;  5CRE A;  3FZ9 A;  3VUR A;  1ZOF A;  4QQ7 A;  5HFG A;  5EL8 A;  5B6M A;  1B9X C;  2C0G A;  7GSS A;  4TR4 A;  1XPV A;  2IL3 A;  4XS6 A;  3UAR A;  1YJ6 A;  4ZXG A;  4BVX A;  4K8M A;  3TRP A;  4GLT A;  4IP6 A;  4F03 A;  1T3B A;  1THX A;  3VI7 A;  4MA9 A;  3RHB A;  5HR0 A;  5DAL A;  2CA8 A;  3IA1 A;  1QGV A;  4MJA A;  3GMF A;  4P3Y B;  5F06 A;  4BL7 B;  3TKS E;  5E59 A;  1PRX A;  2L4Q A;  3IXR A;  3L4N A;  3F3Q A;  3VWX A;  2HRF A;  5DDL A;  3KEB A;  2JL4 A;  3H93 A;  3GKN A;  2YZH A;  1GH2 A;  3CRT A;  1B8X A;  2B1K A;  1AQV A;  1JZD A;  2K6V A;  1XZO A;  4LL4 B;  2OE0 A;  1VGL A;  4ZBA A;  4Z2R A;  2YWI A;  3ZLP A;  2XBQ A;  1XW5 A;  1U3A A;  4AJ7 A;  2K18 A;  4PNG A;  2HSH A;  4IW9 A;  3DGQ A;  3IPZ A;  2EIO A;  2H0H A;  1URM A;  3UVT A;  2NDO A;  4BL7 A;  2G2Q A;  2YNX A;  3WD6 A;  1RQM A;  1CQG A;  4RI7 A;  1EGR A;  3MSZ A;  2M72 A;  3QDN A;  1ERU A;  2KOK A;  2N5B A;  2P5Q A;  5IMC A;  6GST A;  2DLX A;  2YV7 A;  2FGX A;  5ELA A;  1SJI A;  4ICY A;  1XVQ A;  2J23 A;  1RW1 A;  1ZGN A;  1PGT A;  2H71 A;  1FAA A;  1DE1 A;  3I9V 2;  5GZZ B;  5J4U A;  1OC8 A;  3EE2 A;  1CQH A;  1FG4 A;  5IM9 A;  3U5R E;  2N5F A;  4RUV A;  1T1V A;  5CYY A;  4XHM A;  1VF1 A;  2A2S A;  4O32 A;  4CY8 A;  5ECQ B;  3HY2 A;  2L5L A;  4JED A;  1GL8 A;  4WKW A;  1O8W A;  4RQR A;  2X99 A;  3BJ5 A;  4XS4 B;  2E2M A;  3GHA A;  2VCV A;  3BOA A;  5KN2 A;  2REM A;  1YKA A;  2FNO A;  2K8S A;  4EO3 A;  4I2U A;  2QKE A;  2AV4 A;  4N11 A;  3KXO A;  5GAN D;  1PD2 1;  2YCD A;  4TW5 A;  5G1L A;  4EXJ A;  3EMP A;  1GRX A;  1A0F A;  3ZIJ A;  2RII A;  3VLN A;  4ULX A;  4EKZ A;  5C00 A;  2H0G A;  4ML6 A;  1WJK A;  3FRC A;  2LQO A;  1UVZ A;  3TKQ A;  1YEP A;  1LBK A;  3QCP A;  3KTB A;  3KH7 A;  2OBK A;  4MF5 A;  4IGJ A;  5A5K A;  2IMF A;  3IK7 A;  4XS4 A;  2I1U A;  1M2B A;  1GSQ A;  5ECI B;  2VL2 A;  4MZW A;  2PVO C;  3BCI A;  3FZA A;  5IMF A;  4WF4 A;  1QK8 A;  1F3B A;  5C04 A;  1TI1 A;  4MAB A;  3L9S A;  3LQ7 A;  1ZYP A;  2RUE A;  1K0M A;  4TRX A;  1T7P B;  4K7O A;  4V2M A;  3ZYW A;  3E9J B;  1WMJ A;  1SKS B;  4YKF A;  4F82 A;  5B6N A;  3ZML A;  2KP1 A;  2C3Q A;  2DBC A;  3H1N A;  5IO2 A;  2HYX A;  2M46 A;  3D4M A;  5ECP B;  3I43 A;  4YAP A;  1E2Y A;  3F8U A;  2LEG A;  2VL2 C;  3LXT A;  1SYR A;  2VM2 A;  2I81 A;  2R2J A;  4HQS A;  2A2R A;  3E3E A;  3QD9 A;  4PUA A;  4ACS A;  3ZL5 A;  1G6Y A;  4E8E A;  16GS A;  5D9X A;  5IOX A;  5H5R A;  1QXH A;  1XVW A;  4TR0 A;  1A24 A;  2R0P A;  1WP0 A;  4YKG A;  4Q5N A;  4TR1 B;  2L5O A;  2H75 A;  3FY7 A;  2L6D A;  2AAW A;  5DAK B;  2C3N A;  4HDE A;  2AJQ B;  1M99 A;  2YPM A;  4ZIJ A;  1M2D A;  3GTU B;  2R0C A;  1TTZ A;  4I5Q A;  2ZUP A;  1GNW A;  4KDU A;  4MLY A;  4ZL8 A;  3HVS A;  1KBN A;  2B5X A;  1HNB A;  3AY8 A;  3HYP A;  4EDZ A;  4O5R A;  5IMZ A;  3N9J A;  3F6F A;  4K2D A;  5A4U A;  1K0O A;  3HCZ A;  5BMU A;  4TR1 A;  3EWL A;  4Q5F A;  3GN3 A;  4HUA A;  2DJ1 A;  2DSA A;  1GTB A;  5B8B A;  5DAK A;  5IIZ A;  4OCE A;  3VWU A;  4OD7 A;  4ECJ A;  2BMX A;  3MWH A;  1OVN A;  4YH2 A;  2C3T A;  3LEF A;  3W6G A;  2WUL A;  2VM1 A;  3GRX A;  3MNG A;  2PBJ A;  3GTU A;  3KIJ A;  1G0T A;  4ZB6 A;  2GSQ A;  2OJL A;  1EP7 A;  3CYN A;  5F0G A;  2LQQ A;  1TRW A;  5ECL B;  2NBS A;  2YOI A;  4TOP A;  2H1B A;  2HFD A;  3TCO A;  1EV4 A;  2R5G A;  4MPF A;  4MPG A;  4GXZ A;  2V1M A;  2CAI A;  1T00 A;  1KEB A;  2ZCT A;  4KSO A;  4HEA 2;  3RBT A;  3IC4 A;  4XTS A;  1OAZ A;  5ECM B;  1Z3E A;  1HNC A;  2IFQ B;  4MNN A;  2YAN A;  2LJA A;  3CSI A;  3C1R A;  4L0U A;  4TXO B;  5IOW A;  2YN1 A;  1X0R A;  2YWO A;  4O7H A;  5HFK A;  3EUR A;  1RK4 A;  5KOX A;  5LD0 A;  2P31 A;  4IJ3 A;  1K0D A;  1M9A A;  1WIK A;  1XWA A;  3M0F A;  1F2E A;  5EY6 A;  4HQZ A;  5ECO B;  3FEU A;  1JFU A;  2HZE B;  4RI6 A;  4ECI A;  1A0R P;  1B4P A;  4GCI A;  4IN0 A;  2FWG A;  2HRK A;  3KGK A;  1TP9 A;  1K0N A;  3W8S A;  4F0C A;  1ZYN A;  3M3M A;  2GZP A;  3TOT A;  2IFQ A;  4K5R A;  1TU7 A;  4ML1 A;  1BYE A;  1OYJ A;  3QFA C;  4TXO A;  5J9B A;  1GSE A;  1ERW A;  4EF0 A;  2B1L A;  4K7N A;  1Y25 A;  5D9W A;  4IVF A;  1SKR B;  3DRN A;  3H8Q A;  4NAX A;  3TRX A;  3A2X A;  4JR4 A;  2DJJ A;  1SK1 A;  5DQS A;  2VL3 A;  1H75 A;  4ISD A;  1TW9 A;  2WFC A;  3NOF A;  5IMA A;  5GAP D;  2P5R A;  2GTU A;  2WB9 A;  5DJM A;  1TRV A;  1W89 A;  2WRT A;  3CMI A;  2VO4 A;  2VUP A;  4KCE A;  4I8B A;  2HZE A;  2VLT A;  3TDG A;  3DWV A;  5D9V A;  2KLX A;  3GH6 A;  3A2W A;  1R7H A;  3QAV A;  2XPD A;  5IPH A;  3D4T A;  3F3R A;  1GUL A;  5G5F A;  2I9H A;  1SU9 A;  3G7I A;  5J9C A;  2RM5 A;  4BVY B;  5ECN B;  3IRA A;  4WF5 A;  1UA5 A;  3NIV A;  11GS A;  3J7Y b;  1PL2 A;  2C1Y A;  4TN8 A;  2LRC A;  5J41 A;  3HJP A;  4EL1 A;  1EWX A;  1PX6 A;  4BWQ A;  3ISO A;  1OKD A;  4MP4 A;  3TRQ A;  5D73 A;  5CRH A;  1LJR A;  2F8F A;  3DD3 A;  3MAK A;  2X8C A;  1EZK A;  2DIY A;  4G9H A;  2V41 A;  2A2P A;  1U6T A;  1GTA A;  2R4V A;  1Y6E A;  2D2Z A;  3A5W A;  1GSF A;  5AGY A;  2H01 A;  4PXO A;  1O8X A;  2ON7 A;  4FO5 A;  5H5S A;  4ID0 A;  4WEY A;  1XCC A;  1PA3 A;  2GQL A;  2GQM A;  5INY A;  4BVY A;  2FWH A;  4Q5Q A;  1ZYE A;  3D0Z A;  5G1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...