2V2GA

Crystal structure of the c45s mutant of the peroxiredoxin 6 of arenicola marina. monoclinic form
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
220
structure length
220
Chain Sequence
GITLGEVFPNFEADSTIGKLKFHDWLGNSWGVLFSHPRDFTPVSTTELGRVIQLEGDFKKRGVKLIALSCDNVADHKEWSEDVKCLSGVKGDMPYPIIADETRELAVKLGMVDPDERTSTGMPLTCRAVFIIGPDKKLKLSILYPATTGRNFSEILRVIDSLQLTAQKKVATPADWQPGDRCMVVPGVSAEEAKTLFPNMEVKAVPSGKGYLRYTPQPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords PEROXIREDOXIN 6
publication title The Crystal Structure of the C45S Mutant of Annelid Arenicola Marina Peroxiredoxin 6 Supports its Assignment to the Mechanistically Typical 2- Cys Subfamily without Any Formation of Toroid- Shaped Decamers.
pubmed doi rcsb
source organism Arenicola marina
total genus 71
structure length 220
sequence length 220
chains with identical sequence B, C, D
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2007-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1020.10 Alpha Beta 2-Layer Sandwich Antioxidant, Horf6; Chain A, domain 2 Antioxidant, Horf6; Chain A, domain2 2v2gA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2v2gA01
1K0BA 3RPPA 3M8NA 1XCCA 6GSSA 5G2ZA 3GV1A 3D21A 2L57A 3GH6A 2I3YA 1THOA 2AJQB 1PN9A 1OC9B 1M9BA 3LYPA 1B9YC 1GTAA 2VCWA 5ENUA 3CBUA 1K3LA 3D5JA 2OA7A 3UL3A 1GULA 4MZBA 4HJ2A 1M7TA 4E8HA 3UBLA 2R5GA 3HZ4A 1Z6MA 1AQVA 1CQHA 1EV9A 3PH9A 2VL3A 2H71A 4N30A 3IK7A 4MH3A 3TKPA 4ZBAA 1ERTA 1YF0A 1NSWA 3UIWA 3U5RE 1M99A 4GXZA 3TCOA 1GWCA 4ZBDA 2CV4A 2YZHA 3VWWA 4KUNA 2IIYA 17GSA 4IVFA 3C1SA 4J57E 2VM2A 1N2AA 5CYYA 2IL3A 3KMOA 1IYHA 5IMVA 4KGIA 2H01A 1J08A 3ERFA 1XVWA 1WJKA 5DBQA 4G2EA 5IOXA 2VL2A 4EVMA 1K3OA 3H93A 3ZYWA 2LKUA 2GGTA 4F82A 3KD0A 4HQSA 2MBTA 3FZ9A 4EUYA 1YEXA 1AXDA 2HE3A 2XBIA 4DSSA 1G6WA 5C00A 4KDUA 1ERVA 1FVJA 4MLYA 4XS4A 2VM1A 2H6XA 1VF1A 3L4NA 4D73A 4JEDA 5DCGA 3ZIVA 1GSSA 5CNWA 3GUSA 3N5OA 5HR3A 1O7UA 3U6VA 2FGXA 1K0AA 2VO4A 1LBKA 3E0UA 2YNXA 2PVOC 2GZPA 2R2JA 1YKAA 1KTEA 3EU3A 1PMTA 1J9BA 2V32A 1R5PA 4KCEA 3A3TA 2J9HA 2CZ3A 2GVPA 3VPTA 1SKWB 2HSHA 3M1GA 3EYTA 1XZOA 2PVQA 3FW2A 5C04A 4IHUA 2H70A 4K8MA 1WPIA 4NPBA 1A8YA 3ISOA 4WKWA 4WR4A 2LS5A 2YWIA 1TI1A 2GDRA 4G10A 1O73A 1HYUA 3BOAA 1XXUA 3RDWA 1WIKA 4JR6A 5G1KA 1X0RA 3BD2A 1ML6A 3F3RA 3HKRA 4AJ8A 3BCKA 2GQKA 3US3A 4IGJA 1ERWA 3G7JA 1DUGA 1GUKA 2CAIA 1ZCPA 4I2UA 1GSUA 3KEBA 4K7OA 13GSA 1OC9A 2GSQA 5H5QA 2PN8A 3FR6A 4ML6A 2YWMA 5ECRB 2AB6A 1TU7A 5ECLB 19GSA 2MMAA 2VIMA 2IMEA 1F37A 4PXOA 4F2IA 1PX6A 1XFLA 2P31A 4GQCA 4ULXA 4G9HA 1BX9A 4XHMA 4NAXA 2IFQB 3L9SA 5E59A 1SKSB 2C0DA 4MZCA 3HY2A 3LXTA 3LFLA 1B4QA 2CAQA 5DAKB 3VI7A 1Y25A 3VPQA 1FB6A 5ECPB 3P8WA 2NDOA 4DSQA 1AIUA 2G2QA 5HR1A 3H4KA 4IQAA 4TRXA 4AJ7A 2DJ1A 4O5RA 1SL0B 3BJ5A 5LCZA 4HEA2 5B8AA 2H73A 4PQHA 5B6NA 2LQQA 4ILFA 4HDEA 1PKZA 5ID2B 1URMA 2JU5A 2DMLA 3IAM2 4MDCA 5J41A 2BJXA 2IPAA 1RQMA 3F3QA 2Z9SA 2YP6A 3RPNA 3ZFLA 2K9FA 3KCMA 1U6TA 3KXOA 2FA8A 2PERA 1QQ2A 2WCIA 1WRYA 5GSTA 1GSFA 4XRAA 3EE2A 10GSA 1GTUA 2WFCA 2NPBA 2YN1A 5H5RA 4MPFA 4ID0A 5HR0A 5L71A 3RHCA 1Z6NA 3FKFA 3ZMKA 2H6ZA 4AF2A 1M9AA 3WYWA 3IR4A 2CT6A 3GKNA 1XWGA 2H66A 3CRTA 4YQMA 1AQXA 1EGOA 4BVYA 2LTKA 2LQOA 1YY7A 3CSHA 2KOKA 2VL9A 3KM6A 3GMFA 3LEFA 1TI3A 2LRCA 2WGRA 2CX3A 3WT1A 2R37A 1V58A 5DVBA 2PPTA 1FHEA 2EIOA 2YZUA 4N0VA 2FCHA 4EE0A 4EXJA 1K0CA 3DMLA 5D9WA 5IMZA 5COHA 2O85A 3MAKA 2REMA 3WGEA 4HS1A 3D4TA 3ZMLA 1GNEA 2H0GA 4PURA 3O3TA 2C1YA 3ZITA 5ECQB 1X5CA 4N11A 5J4UA 1UC7A 2AAWA 1SU9A 5INYA 3H79A 1I5GA 1A2MA 1XIYA 3IA1A 1Q98A 5JWOB 2X8HA 1PX7A 4DVCA 1A0RP 4N0ZA 3IDVA 4X1UA 4I6XA 5EVOA 2VLVA 3UVHA 1EGRA 3V1WA 4ZL8A 1HNCA 2I4AA 5ELAA 1BQ7A 1TDIA 2IFQA 4MH2A 1ST9A 2L59A 3DWVA 3SWLA 1BG5A 5JCUA 1JFUA 5D9XA 5DAKA 4GSTA 1XW5A 4OO4A 3F9UA 4WETA 5A4WA 2H1BA 2YJ7A 1TW9A 2O87A 1OVNA 4NWYA 4RQXA 1A2LA 3IHQA 4TKYA 3P7XA 1GSQA 3KTLA 4NHWA 2YANA 1OC3A 3D6IA 4OCEA 4BL7A 2H76A 1PL1A 2JZSA 4IJIA 1R26A 2MBSA 4WBRD 1NHOA 3EVIA 2MZCA 1R5AA 1W89A 1DE1A 1TRSA 4TR0A 2XBQA 1ZMAA 1JLWA 2J23A 2PU9C 2C0EA 5CAXA 2LNSA 4HJMA 3A2WA 4HUAA 2OBIA 2L5LA 1TK0B 3L0HA 4MP4A 2KUCA 2GQMA 3UEMA 2B6MA 2AYTA 2FWGA 4CW9A 1O81A 3HVXA 4N10A 5D8IA 2H74A 4ZXGA 4X43A 3RAZA 1SJIA 1HD2A 5LNKe 1V98A 1EWXA 2FNOA 4J2FA 5CRGA 1XPVA 1PRXA 1YQ1A 4Q5FA 5HFKA 2DLXA 1VRSD 2LV3A 3GURA 5AGYA 3UAPA 3A2VA 2IMKA 2XPEA 1ZZYA 6GSXA 3PR8A 1Z5YE 5EY6A 1SK2A 2YPMA 2M80A 2R6KA 4OMVA 3L78A 4IBPA 4BVXA 1OAZA 2GT5A 2WS2A 4TR4A 3KTBA 1EEJA 2E7PA 4WR5A 1Q4JA 2OE0A 5J9BA 4IJ3A 3VK9A 2P5RA 5HQPA 1BYEA 2HRNA 2ALBA 3N9JA 3VWVA 4Z7XA 5J5NA 2A2RA 2VUPA 4IELA 1GSDA 2VL2C 5GZZB 2IMFA 1PGTA 2IJYA 4HI7A 4WBJA 1JLVA 3TKSA 1X5EA 4FIWA 2ON5A 5IMCA 1M2DA 2H6YA 5F07A 4TXVA 3DYRA 1BAYA 2JSZA 1JZRA 2YWOA 3A5WA 3QOUA 4I5QA 1JZDA 2IMIA 3TRXA 4NHZA 7GSSA 4KDYA 1SK0A 4ISDA 3I9V2 2RLIA 3NZNA 2VD1A 5ECNB 20GSA 4MJEA 2GSRA 2VCQA 5AIXA 5F8BA 4K0NA 5GAND 3GKMA 1ON4A 1OYJA 1W4VA 5ECMB 2ES7A 3EU4A 4PNFA 3VWXA 3EURA 2V6OA 4HU9A 2B3SA 3C71A 1PD21 1OE8A 5AN1A 2MMNA 2YWNA 3GL3A 2H75A 3WGDA 1THXA 2LRTA 4YQUA 1E6BA 4PGTA 3GKKA 2HXKA 2OADA 4GLTA 5EPFA 1UN2A 4KDXA 4RI7A 4IP6A 4KSMA 4EKZA 3GTUB 2X8GA 2ZNMA 1OKTA 4HZ2A 5CP1A 1YZXA 3ZLPA 1QMVA 1NM3A 5IM9A 4QL7A 4JZQA 4IN0A 1YF1A 1SD8A 3EMXA 4POLA 3G9BA 4TXOA 5DQSA 4XTSA 5J9CA 1K0NA 2HNLA 1USBA 2RUEA 3DEXA 4POMA 1K3YA 4FH8A 5IPGA 3O76A 5G31A 2GSSA 1K0OA 2DSAA 1IYIA 4X0XA 3GNJA 3HJOA 2HZEB 1ZYQB 4BPYA 1ZL9A 2A2SA 1V2AA 3W8JA 3IE3A 3TJJA 3Q19A 1FO5A 1F3BA 2IN3A 1KEBA 1F2EA 2DJ3A 3HJPA 1B48A 2VCXA 2IMDA 2HRFA 2LJAA 1FB0A 3IPZA 5AISA 2GQLA 4IW9A 3KZQA 1HNAA 3WT2A 5CRDA 1BJXA 3MSZA 1O8WA 3GSSA 2GLRA 4PX1A 1Z3EA 4BWSA 1QUWA 4YQVA 5G5EA 2YV9A 14GSA 5F06A 4F0BA 3GN3A 2V2GA 1ILOA 1LU4A 3H1NA 2O8VB 3F8UA 3FZ4A 1NW2A 3KH7A 3P90A 1XOAA 2OE1A 4XCSA 2WZ9A 5D93A 3QFBC 2YJHA 4HZ4A 3KMNA 3D4MA 1MDKA 3GSTA 5F05A 3KGKA 4XIHA 2X64A 1O85A 5ECOB 1LJRA 1XWAA 4IP1A 4E8EA 1GNWA 3KP8A 5ECHB 4ZB8A 3H8QA 3UJ1A 2BMXA 4MZWA 3MWHA 4K2DA 2VLUA 3HVSA 4IQ1A 4MJAA 2H1AA 3GYKA 2B7JA 2L4QA 5A5KA 4ACSA 2GTUA 2DC5A 5DDLA 2JACA 2P0GA 2P5QA 1GP1A 2KP1A 3UOMA 4PUAA 2N5AA 4KB3A 3G7YA 2MYGA 5IOWA 3C8EA 2GSTA 4CDOA 3L9UA 3UBKA 2E0QA 2N5BA 3CRUA 5D96A 4AGSA 1ACVA 1MTCA 1EV4A 1V57A 3IK9A 3FZAA 3GTUA 3TJFA 3VLNA 2I81A 5D73A 2HSYA 5A4VA 1T1VA 1TP9A 1XOBA 2WRTA 4Q5QA 1ZYEA 3FHKA 3APSA 3TRQA 2K8VA 2E2GA 1J0FA 3CSIA 2R3XA 1F9MA 1SD9A 4PUFC 2R4VA 4MJCA 3I69A 2C0FA 2NTOA 3C73A 3LSZA 2YCDA 2H30A 5KN3A 5IMDA 2PMTA 3IXRA 2B5YA 5HR2A 5IIZA 5KN2A 2B5XA 4KE3A 1EEMA 4PNGA 1TOFA 2B5EA 3I6AA 1NHYA 1U3IA 5DQYA 3GX0A 3TRPA 4JU5A 4Q5RA 1GLQA 2HT9A 2HZEA 1VF4A 5J3RA 2DJKA 3C7MA 3TKQA 1MDIA 2X8CA 2OE3A 4K0GA 3TOUA 1AUCA 3CTGA 2WJUA 2E2MA 4RI6A 1S3DA 4K1FA 3LG6A 5IMAA 4I8BA 4K6XA 3R2QA 4FYUA 12GSA 4FO5A 3LXZA 3RBTA 4BWQA 1WWJA 1YJ6A 2CX4A 1QXHA 5AIVA 1ABAA 5KEJA 4DEJA 2L5OA 5F0GA 1S3AA 4KSOA 3ERGA 3GIXA 3KP9A 2H0HA 2LUSA 3OR5A 2VLTA 3HDCA 3D22A 3P2AA 4MJBA 1XWBA 1A2JA 4LMVA 2F51A 2L6CA 1AW9A 3ZTLA 1GSEA 2B1KA 3Q74A 5CO3A 3HHVA 1XBSA 2HYXA 5KN1A 4BA7A 5IO2A 4V1Ag 3LQ7A 2VCVA 5HFIA 4ZB6A 2GS3A 5EL8A 4FYBA 4KNDA 3NOFA 2AHEA 4EF0A 4GSNA 5ID2A 4OFNA 1JZOA 1VF3A 1WOUA 3AY8A 4TN8A 1ZOFA 3QAGA 1GTBA 4KCAA 1A23A 4F0CA 2IWTA 1B9XC 4XS6A 2C4JA 5IMFA 1GUHA 2HZFA 3E3EA 3UMAA 1PKWA 2DJJA 4KAEA 16GSA 3NIVA 4O7HA 22GSA 2ZUPA 1YEPA 1UVZA 2G0FA 3TOTA 1SK1A 2TIRA 2DJ2A 2OACA 2TRXA 1O8XA 1A0FA 6GSVA 5GAPD 1UA5A 1PSQA 1OKDA 3APQA 2GZYA 5B8BA 2B7KA 2KHPA 4V2LA 1YDKA 3EWLA 3TKSC 4G19A 3KH9A 5A4UA 2C0GA 4GWRA 2PBJA 2QKEA 3APOA 2RUFA 4TW5A 5DALB 2HLSA 1TKDB 4GCIA 6GSUA 3TJBA 3CYNA 4K7IA 2LEGA 4LL4B 3CTFA 2YOIA 1TRWA 3UVTA 3FK8A 3J7Yb 1H4OA 3WD6A 2JL4A 4MA9A 2O89A 3A2XA 2PUKC 4V2MA 1SJZA 3ZREA 4FYCA 1G0TA 3F4SA 1ERUA 1FOVA 4EC0A 4TR1B 1TRVA 3ZVJA 4ECBA 3VI5A 1G7EA 4YAPA 4GF0A 2QC7A 5IPHA 3IRAA 2DMMA 3TGZA 3QD9A 3W6GA 4NV5A 2DJ0A 2DBCA 4RQRA 3MNGA 2F3MA 4ECJA 2LJKA 4JR4A 3QFAC 1WE0A 1KBNA 5HFGA 3IBHA 1PL2A 3SBCA 4MCUA 1VF2A 3QAWA 2I1UA 1GRXA 3HJMA 1FAAA 3EINA 2H72A 3ZL5A 1V9WA 1JZWA 3TKRA 1Y6EA 4O32A 2CQ9A 1A24A 4GSSA 3L9VA 4L0UA 4ZILA 4EO3A 1H75A 1T4YA 4POBA 1PA3A 2XHFA 1EZKA 3HYPA 4ZL7A 1Z7RA 3EMPA 4L8EA 5ABRA 2JSYA 3FY7A 2FY6A 4TR3A 3ZIJA 4OD7A 2C3TA 1WMJA 2XPDA 4KW6A 4JRRA 4MPGA 3VFIA 5DJLA 1SL1B 6GSWA 3GHAA 3TUEA 2F9SA 2TRCP 1KNGA 3W8SA 4I2TA 4AJ6A 5D9VA 3TKSE 4WXTA 5IQYA 1U87A 3CMIA 3ME8A 1TXXA 3CSJA 3HZ8A 3IC4A 3QDNA 4QL9A 2DIYA 5CRWA 5G5FA 3FYGA 5JCWA 1T00A 5DCHA 5G1LA 1QK8A 3TJGA 1XVQA 1PQNA 3G7IA 4V1Ap 11GSA 1GTIA 1XWKA 3M9JA 1SENA 5ECIB 2FWFA 2ON7A 1F6MC 4MABA 4YAVA 5DALA 4ZBBA 1EOHA 5D9TA 1SYRA 1RK4A 3PINA 2LJRA 1MDJA 1GLPA 2WB9A 3GFKA 3FEUA 4GRFA 5CREA 3PGTA 1TRUA 1EOGA 3DIEA 3BCIA 3QR6A 4EDZA 1T8EB 1DBYA 2JZTA 5FHIA 5ELGA 2WULA 5ECKB 1U3AA 2FWHA 1CQGA 1ZGNA 3VURA 1B8XA 2H8LA 3TDGA 3FRCA 4EL1A 2BTOT 4TR1A 1MD3A 2V1MA 4WEYA 1GH2A 2VCTA 1VGLA 3LGCA 3MDKA 1XWCA 3QAVA 4P3YB 1T3BA 2FD3A 1GUMA 8GSSA 2RM6A 4MK3A 3F0IA 3LYKA 3HCZA 3F4TA 4MF6A 2M72A 5JWQB 2C3QA 3KIJA 2V6KA 4KH7A 1X5DA 2VD0A 4WF5A 4RUVA 2C8UA 2RM5A 4GTUA 4XS1A 1WP0A 4JBBA 1AC1A 2HFDA 4TOPA 3RHBA 1JHBA 2KP2A 1U88A 4XRDA 2YV7A 3F6FA 4OFTA 2FWEA 3D0ZA 1E2YA 4ECIA 1Z7PA 3ZRDA 2L6DA 5DJMA 2M46A 4V2NA 3BBYA 1TJDA 3M9KA 2PWJA 3ZZXA 2B1LA 4Q5NA 2AUVA 3IAS2 2XC2A 2GZZA 3DVXA 2HI7A 4KX4A 6GSYA 1MEKA 1GSYA 3CXGA 2K6VA 4TVEA 3ZVJD 4F03A 2CA8A 2F8AA 1O6JA 3F63A 18GSA 4POKA 3S9FA 3JCML 4L5LA 5KN0A 4EDYA 1XW6A 3HXSA 1FG4A 3ME7A 1TK8B 2KLXA 3ED3A 4NMUA 4OFMA 1F3AA 3ERWA 5IO0A 1TTZA 3C1RA 3UARA 2LRNA 3DD3A 1DE2A 1A8LA 2RIIA 4J56E 1M2AA 5G30A 4K9ZA 2MMOA 2K18A 2JZRA 1SJ6A 2EIQA 2O7KA 3GA4A 5B6MA 2L4CA 1QGVA 4LMWA 3TJKA 4IS0A 4F9ZA 1X9WB 1HQOA 3LWAA 1FW1A 3GX8A 4WF4A 5GSSA 3LJRA 1FVKA 2CVBA 3HD5A 2X99A 2PGTA 4MF7A 1EP7A 3ZFBA 1SL2B 1B4PA 2FHEA 1QFNA 2H0IA 3WGXA 1TK5B 2N5FA 2EIRA 3FR3A 5FWGA 1G6YA 2H1GA 3DXBA 1MD4A 3FZ5A 3HVVA 2GT6A 2H19A 4OWYA 1K0DA 5CRHA 1I9DA 2VOCA 1XW9A 4QQ7A 1T4ZA 2FLSA 2C80A 4PQIA 4HU7A 2C3NA 1N8JA 3K8NA 1RW1A 4HOJA 4IKHA 4KA0A 4OO5A 4NXIA 2D2ZA 4ML1A 3E9JB 1SKRB 3IOSA 1M0UA 2FUG2 1SYXA 4MMMA 9GSSA 5LD0A 2CVKA 3FR9A 2K8SA 3Q6OA 2OBKA 2AV4A 4GQFA 1DSBA 3I43A 2NVLA 3GKXA 3HA9A 3KJYA 1AAZA 5JCGA 3Q18A 2QSIA 1OC8A 4H86A 5ECSA 5JWRB 2NBSA 6GSTA 2A4VA 5E4WA 3DRNA 2V41A 3F4RA 4OCFA 1G7OA 2MMZA 3O6TA 2QGVA 1T7PB 2LSTA 4ZIJA 3LORA 2F8FA 4DSSB 3VWUA 4L0WA 4XS4B 1Z9HA 3DKSA 3M0FA 3GRXA 2ZCTA 1R7HA 2CVDA 4D73B 2I9HA 2VAFA 3DVWA 3GH9A 4O92A 4LL1B 4YH2A 1V40A 3QCPA 4ZL9A 4NV2A 4DSRA 2DIZA 1BEDA 4HQZA 2FA4A 2OJLA 1GL8A 2JADA 2WDUA 4MF5A 4LLRA 2CZ2A 2VCZA 3M3MA 2EC4A 2H1DA 3QMXA 5FT3A 4TXOB 4ZB9A 3QPMA 1R4WA 1S3CA 1HNBA 2OKAA 4I97A 3TB2A 3DGQA 4PQ1A 4CHSA 4ECCA 1X9SB 3EC3A 3GL5A 3J7Yk 5H5SA 1EP8A 4L5OA 1M2BA 1AQWA 2LNTA 1OE7A 1K0MA 4LA1A 1YKCA 1X9MB 3F6DA 3IV4A 4K7NA 1TU8A 1C72A 5B7CA 4JE1A
chains in the Genus database with same CATH superfamily
1K0BA 3RPPA 3M8NA 1XCCA 6GSSA 5G2ZA 3GV1A 3D21A 2L57A 3GH6A 2I3YA 1THOA 2AJQB 1PN9A 1OC9B 1M9BA 3LYPA 1B9YC 1GTAA 2VCWA 5ENUA 3CBUA 5KOXA 1K3LA 3D5JA 2OA7A 3UL3A 1GULA 4MZBA 4HJ2A 1M7TA 4E8HA 3UBLA 2R5GA 3HZ4A 1Z6MA 1AQVA 1CQHA 1EV9A 3PH9A 2VL3A 4FQUA 2H71A 4N30A 3IK7A 4MH3A 3TKPA 4ZBAA 1ERTA 1YF0A 1NSWA 3UIWA 3U5RE 1M99A 1M3JA 4GXZA 3TCOA 1GWCA 4ZBDA 2CV4A 2YZHA 3VWWA 4KUNA 2IIYA 17GSA 4IVFA 3C1SA 4J57E 2VM2A 1N2AA 5CYYA 2IL3A 3KMOA 1IYHA 5IMVA 4KGIA 2H01A 1J08A 3ERFA 1XVWA 1WJKA 5DBQA 4G2EA 5IOXA 2VL2A 4EVMA 1K3OA 3H93A 3ZYWA 2LKUA 2GGTA 4F82A 3KD0A 4HQSA 2MBTA 3FZ9A 4EUYA 1YEXA 1AXDA 2HE3A 2XBIA 4A5PA 4DSSA 4G0KA 1G6WA 5C00A 4KDUA 1ERVA 1FVJA 4MLYA 4XS4A 2VM1A 2H6XA 1VF1A 3L4NA 4D73A 4JEDA 5DCGA 3ZIVA 1GSSA 5CNWA 3GUSA 3N5OA 5HR3A 1O7UA 3U6VA 2FGXA 1K0AA 2VO4A 1LBKA 3E0UA 2YNXA 2PVOC 2GZPA 2R2JA 1YKAA 1KTEA 3EU3A 1PMTA 1J9BA 2V32A 1R5PA 4BVYB 4KCEA 3A3TA 2J9HA 2CZ3A 2GVPA 3VPTA 1SKWB 2HSHA 3M1GA 3EYTA 1XZOA 2PVQA 3FW2A 5C04A 4IHUA 2H70A 4K8MA 1WPIA 4NPBA 1A8YA 3ISOA 4WKWA 4WR4A 2LS5A 2YWIA 1TI1A 2GDRA 4G10A 1O73A 1HYUA 3BOAA 1XXUA 3RDWA 1WIKA 4JR6A 5G1KA 1X0RA 3BD2A 1ML6A 3F3RA 3HKRA 2A2PA 4AJ8A 3BCKA 2GQKA 3US3A 4IGJA 1ERWA 5KOWA 3G7JA 1PN0A 1DUGA 1GUKA 2CAIA 1ZCPA 4I2UA 1GSUA 3KEBA 4K7OA 13GSA 1OC9A 2GSQA 5H5QA 2PN8A 3FR6A 4ML6A 2YWMA 5ECRB 2AB6A 1TU7A 5ECLB 3A5IA 19GSA 2MMAA 2VIMA 2IMEA 1F37A 4PXOA 4F2IA 1PX6A 1XFLA 2P31A 4GQCA 4ULXA 4G9HA 1BX9A 4XHMA 4NAXA 2IFQB 3L9SA 5E59A 1SKSB 2C0DA 4MZCA 3HY2A 3LXTA 3LFLA 1B4QA 5BMUA 2CAQA 5DAKB 3VI7A 1Y25A 3VPQA 1FB6A 5ECPB 3P8WA 2NDOA 4DSQA 1AIUA 2G2QA 5HR1A 3H4KA 4IQAA 4TRXA 4AJ7A 2DJ1A 4O5RA 1SL0B 3BJ5A 5LCZA 4HEA2 5B8AA 2H73A 4PQHA 5B6NA 2LQQA 4ILFA 4HDEA 1PKZA 5ID2B 1URMA 2JU5A 2DMLA 3IAM2 4MDCA 5J41A 2BJXA 4BL7B 2IPAA 1RQMA 3F3QA 2Z9SA 2YP6A 3RPNA 3ZFLA 2K9FA 3KCMA 1U6TA 3KXOA 2FA8A 2PERA 1QQ2A 2WCIA 1WRYA 5GSTA 1GSFA 4XRAA 3EE2A 10GSA 1GTUA 2WFCA 2NPBA 2YN1A 5H5RA 4MPFA 4ID0A 3LW9A 2HRKA 5HR0A 5L71A 3RHCA 1Z6NA 3FKFA 3ZMKA 2H6ZA 4AF2A 1M9AA 3WYWA 3IR4A 2CT6A 3GKNA 1XWGA 2H66A 3PPUA 3CRTA 4YQMA 1AQXA 1EGOA 4BVYA 2LTKA 2LQOA 1YY7A 3CSHA 2KOKA 2VL9A 3KM6A 3GMFA 3LEFA 4G0IA 1TI3A 2LRCA 2WGRA 4BVXB 2CX3A 3WT1A 2R37A 1V58A 5DVBA 2PPTA 2HRAA 1FHEA 2EIOA 2YZUA 4N0VA 2FCHA 4EE0A 4EXJA 1K0CA 3DMLA 5D9WA 5IMZA 5COHA 2O85A 3MAKA 2REMA 3WGEA 4HS1A 3D4TA 3ZMLA 1GNEA 2H0GA 4PURA 3O3TA 2C1YA 3ZITA 5ECQB 1X5CA 4N11A 2HSMA 5J4UA 1UC7A 2AAWA 1SU9A 5INYA 3H79A 1I5GA 1A2MA 1XIYA 3IA1A 4ICYA 1Q98A 5JWOB 2X8HA 1PX7A 4DVCA 1A0RP 4N0ZA 3IDVA 4X1UA 4I6XA 5EVOA 2VLVA 3UVHA 3MYDA 1EGRA 3V1WA 4ZL8A 1HNCA 2I4AA 5ELAA 1BQ7A 1TDIA 2IFQA 4MH2A 1ST9A 2L59A 3DWVA 3SWLA 1BG5A 5JCUA 1JFUA 5D9XA 5DAKA 4GSTA 1XW5A 4OO4A 3F9UA 4WETA 5A4WA 2H1BA 2YJ7A 1TW9A 2O87A 1OVNA 4NWYA 4RQXA 1A2LA 3IHQA 4TKYA 3P7XA 1GSQA 3KTLA 4NHWA 2YANA 1OC3A 3D6IA 4OCEA 4BL7A 2H76A 1PL1A 2JZSA 4IJIA 1R26A 2MBSA 4WBRD 1NHOA 3EVIA 4EIPA 2MZCA 1R5AA 1W89A 1DE1A 1TRSA 4TR0A 2XBQA 1ZMAA 1JLWA 2J23A 2PU9C 2C0EA 5CAXA 2LNSA 4HJMA 3A2WA 4HUAA 2OBIA 2L5LA 1TK0B 3L0HA 4MP4A 2KUCA 2GQMA 3UEMA 2B6MA 2AYTA 2FWGA 4CW9A 1O81A 3HVXA 4N10A 5D8IA 2H74A 4ZXGA 4X43A 3RAZA 1SJIA 1HD2A 5LNKe 1V98A 1EWXA 2FNOA 4J2FA 5CRGA 1XPVA 1PRXA 1YQ1A 4Q5FA 5HFKA 2DLXA 1VRSD 2LV3A 3GURA 5AGYA 3UAPA 3A2VA 2IMKA 2XPEA 1ZZYA 6GSXA 3PR8A 1Z5YE 5EY6A 1SK2A 2YPMA 2M80A 2R6KA 4OMVA 3L78A 4IBPA 4BVXA 1OAZA 2GT5A 2WS2A 4TR4A 3KTBA 1EEJA 2E7PA 4WR5A 1Q4JA 1FOHA 2OE0A 5J9BA 4IJ3A 3VK9A 2P5RA 5HQPA 1BYEA 3FMWA 2HRNA 2ALBA 3N9JA 3VWVA 4Z7XA 5J5NA 2A2RA 2VUPA 4IELA 1GSDA 2VL2C 5GZZB 2IMFA 1PGTA 2IJYA 4HI7A 4WBJA 1JLVA 3TKSA 1X5EA 4FIWA 2ON5A 5IMCA 1M2DA 2H6YA 5F07A 4TXVA 3DYRA 3A5WA 1BAYA 1JZRA 2JSZA 2YWOA 3QOUA 4G0LA 4I5QA 1JZDA 2IMIA 3TRXA 4NHZA 7GSSA 4KDYA 1SK0A 4ISDA 3I9V2 2RLIA 3NZNA 2VD1A 5ECNB 20GSA 4MJEA 2GSRA 2VCQA 5AIXA 5F8BA 4K0NA 5GAND 3GKMA 1ON4A 1OYJA 1W4VA 5ECMB 2ES7A 3EU4A 2QA2A 4PNFA 3VWXA 3EURA 2V6OA 4HU9A 2B3SA 3C71A 1PD21 1OE8A 5AN1A 2MMNA 2YWNA 3GL3A 2H75A 3WGDA 1THXA 2LRTA 4YQUA 1E6BA 4HSCX 4PGTA 3GKKA 2HXKA 2OADA 4GLTA 5EPFA 1UN2A 4KDXA 4RI7A 4IP6A 4KSMA 4EKZA 3GTUB 2X8GA 2ZNMA 1OKTA 4HZ2A 5CP1A 1YZXA 3ZLPA 4CY6A 1QMVA 1NM3A 5IM9A 4QL7A 4JZQA 4IN0A 1YF1A 1SD8A 3EMXA 4POLA 3G9BA 4TXOA 5DQSA 4XTSA 5J9CA 1K0NA 2HNLA 1USBA 2RUEA 3DEXA 4POMA 1K3YA 4FH8A 5IPGA 3O76A 4K2XA 5G31A 2GSSA 1K0OA 2DSAA 1IYIA 4X0XA 3GNJA 3CQFA 3HJOA 2HZEB 1ZYQB 4BPYA 1ZL9A 2A2SA 1V2AA 3W8JA 3IE3A 3TJJA 3Q19A 1FO5A 1F3BA 2IN3A 1KEBA 1F2EA 2DJ3A 1PFOA 1B48A 3HJPA 2VCXA 2IMDA 2HRFA 2LJAA 1FB0A 3IPZA 5AISA 2GQLA 2QA1A 4IW9A 3KZQA 1HNAA 3WT2A 5CRDA 1BJXA 3MSZA 1O8WA 3GSSA 2GLRA 4PX1A 1Z3EA 4BWSA 3EPTA 1QUWA 4YQVA 5G5EA 2YV9A 14GSA 5F06A 4F0BA 3GN3A 2V2GA 1ILOA 1LU4A 3H1NA 2O8VB 3F8UA 3FZ4A 1NW2A 3KH7A 3P90A 1XG8A 1XOAA 2OE1A 4XCSA 2WZ9A 5D93A 3QFBC 2YJHA 4HZ4A 3KMNA 3D4MA 1MDKA 3GSTA 5F05A 3KGKA 4XIHA 2X64A 1O85A 5ECOB 1LJRA 1XWAA 4IP1A 4E8EA 1GNWA 4EIQA 3KP8A 5ECHB 4ZB8A 3H8QA 3UJ1A 2BMXA 4MZWA 3MWHA 4K2DA 2VLUA 3HVSA 4IQ1A 4MJAA 2H1AA 3GYKA 2B7JA 2L4QA 5A5KA 4ACSA 2GTUA 2DC5A 5DDLA 2JACA 2P0GA 2P5QA 1GP1A 2KP1A 3UOMA 4PUAA 2N5AA 4KB3A 3G7YA 2MYGA 5IOWA 3C8EA 2GSTA 4CDOA 3L9UA 3UBKA 2E0QA 2N5BA 3CRUA 5D96A 4AGSA 1ACVA 1MTCA 1EV4A 1V57A 3IK9A 3FZAA 3GTUA 3TJFA 3VLNA 2I81A 3IHGA 5D73A 2HSYA 5A4VA 1T1VA 1TP9A 1XOBA 2WRTA 4Q5QA 1ZYEA 3FHKA 3APSA 3TRQA 2K8VA 3HVNA 2E2GA 3R3EA 1J0FA 3CSIA 2R3XA 1F9MA 1SD9A 4PUFC 2R4VA 4MJCA 3I69A 2C0FA 2NTOA 3C73A 3LSZA 4MNNA 2YCDA 2H30A 5KN3A 5IMDA 2PMTA 3IXRA 2B5YA 5HR2A 5IIZA 5KN2A 2B5XA 4KE3A 1EEMA 4PNGA 1TOFA 2B5EA 3I6AA 1NHYA 1U3IA 5DQYA 3GX0A 3TRPA 4JU5A 4Q5RA 1GLQA 2HT9A 2HZEA 1VF4A 5J3RA 2DJKA 3C7MA 3TKQA 1MDIA 2X8CA 4USSA 2OE3A 4K0GA 3TOUA 1AUCA 3CTGA 2WJUA 2E2MA 4RI6A 1S3DA 4K1FA 3LG6A 5IMAA 4I8BA 4K6XA 3R2QA 4FYUA 12GSA 4FO5A 3LXZA 3RBTA 4BWQA 1WWJA 1YJ6A 2CX4A 1QXHA 5AIVA 4PTSA 1ABAA 5KEJA 4DEJA 2L5OA 4Z2RA 5F0GA 1S3AA 4KSOA 3ERGA 3GIXA 3KP9A 2H0HA 2LUSA 3OR5A 2VLTA 3HDCA 3D22A 3P2AA 4MJBA 1XWBA 1A2JA 4LMVA 2F51A 2L6CA 1AW9A 3ZTLA 1GSEA 2B1KA 3Q74A 5CO3A 3HHVA 1XBSA 2HYXA 5KN1A 4BA7A 5IO2A 4V1Ag 3LQ7A 2VCVA 5HFIA 4ZB6A 2GS3A 5EL8A 4FYBA 4KNDA 3NOFA 2AHEA 4EF0A 4GSNA 5ID2A 4OFNA 1JZOA 1VF3A 1WOUA 1M3IA 3AY8A 4TN8A 1ZOFA 3QAGA 1GTBA 2X49A 3IC8A 1A23A 4KCAA 4F0CA 2IWTA 1B9XC 1ZYPA 4XS6A 2C4JA 5IMFA 1GUHA 2HZFA 3E3EA 3UMAA 1PKWA 2DJJA 4KAEA 4CY8A 16GSA 3NIVA 4O7HA 2R0PA 22GSA 2ZUPA 1YEPA 4O5QA 1UVZA 2G0FA 3TOTA 1SK1A 2TIRA 2DJ2A 2OACA 2TRXA 1O8XA 1A0FA 6GSVA 5GAPD 1UA5A 1PSQA 1OKDA 3APQA 2GZYA 5B8BA 2B7KA 2KHPA 4V2LA 1YDKA 3EWLA 3TKSC 4G19A 3KH9A 5A4UA 2C0GA 4GWRA 2PBJA 2QKEA 3APOA 2RUFA 4TW5A 4YKFA 5DALB 2HLSA 1TKDB 5BRTA 4GCIA 6GSUA 4X4JA 3TJBA 3CYNA 4K7IA 2LEGA 4LL4B 3CTFA 2YOIA 1TRWA 3UVTA 3FK8A 3J7Yb 1H4OA 3WD6A 2JL4A 4MA9A 2O89A 3A2XA 2PUKC 4V2MA 1SJZA 3ZREA 4FYCA 1G0TA 3F4SA 1ERUA 1FOVA 4EC0A 4TR1B 1TRVA 3ZVJA 2DKHA 4ECBA 3VI5A 1G7EA 4YAPA 4GF0A 2QC7A 5IPHA 3IRAA 2DMMA 3TGZA 3QD9A 3W6GA 4NV5A 2DJ0A 2DBCA 4RQRA 3MNGA 2F3MA 4ECJA 2LJKA 4JR4A 3QFAC 1WE0A 4Z2UA 1KBNA 5HFGA 3IBHA 1PL2A 3SBCA 4MCUA 1VF2A 3QAWA 2I1UA 1GRXA 3HJMA 1FAAA 3EINA 2H72A 3ZL5A 1V9WA 1JZWA 3TKRA 1ZYNA 1Y6EA 4O32A 2CQ9A 1A24A 4GSSA 3L9VA 4L0UA 4ZILA 4EO3A 1H75A 1T4YA 4POBA 1PA3A 3MIXA 2XHFA 1EZKA 3HYPA 4ZL7A 1Z7RA 2R0GA 3EMPA 4L8EA 5ABRA 2JSYA 3FY7A 2FY6A 4TR3A 3ZIJA 4OD7A 2C3TA 1WMJA 2XPDA 4KW6A 4JRRA 4MPGA 3VFIA 5DJLA 1SL1B 6GSWA 3GHAA 3TUEA 2F9SA 2TRCP 1KNGA 3W8SA 4I2TA 4AJ6A 5D9VA 3TKSE 4YKGA 4WXTA 5IQYA 1U87A 3CMIA 3ME8A 1TXXA 3CSJA 3HZ8A 3IC4A 3QDNA 4QL9A 2DIYA 5CRWA 5G5FA 3FYGA 5JCWA 1T00A 5DCHA 5G1LA 1QK8A 2DKIA 3TJGA 1XVQA 1PQNA 3G7IA 4V1Ap 11GSA 1GTIA 1XWKA 3M9JA 1SENA 5ECIB 2FWFA 2ON7A 1F6MC 4MABA 4YAVA 5DALA 4ZBBA 1EOHA 3PINA 1SYRA 1RK4A 5D9TA 2LJRA 1MDJA 1GLPA 2WB9A 3GFKA 3FEUA 4GRFA 5CREA 3PGTA 1TRUA 1EOGA 3DIEA 3BCIA 3QR6A 4EDZA 1T8EB 1DBYA 2JZTA 5FHIA 5ELGA 2WULA 5ECKB 1U3AA 2FWHA 1CQGA 1ZGNA 3VURA 1B8XA 2H8LA 3TDGA 3FRCA 4EL1A 2BTOT 4TR1A 1MD3A 2V1MA 4WEYA 1GH2A 2VCTA 1VGLA 3LGCA 4BIKA 3MDKA 1XWCA 3QAVA 4P3YB 1T3BA 2FD3A 1GUMA 8GSSA 2RM6A 4MK3A 3F0IA 3LYKA 3HCZA 3F4TA 4MF6A 2M72A 5JWQB 2C3QA 3KIJA 2V6KA 4KH7A 1X5DA 2VD0A 4WF5A 4RUVA 2X4AA 2C8UA 2RM5A 4GTUA 4XS1A 1WP0A 4JBBA 1AC1A 2HFDA 4TOPA 3RHBA 1JHBA 2KP2A 1U88A 4KF9A 4XRDA 2YV7A 3F6FA 4OFTA 2FWEA 3D0ZA 1E2YA 4ECIA 1Z7PA 3ZRDA 1S3RA 2L6DA 5DJMA 2M46A 4V2NA 3BBYA 1TJDA 3M9KA 2PWJA 3ZZXA 2B1LA 4Q5NA 2AUVA 3IAS2 2XC2A 2GZZA 3DVXA 2HI7A 4KX4A 6GSYA 1MEKA 1GSYA 3CXGA 2K6VA 4TVEA 3ZVJD 4F03A 2CA8A 2F8AA 1O6JA 3F63A 18GSA 4POKA 3S9FA 3JCML 4L5LA 5KN0A 4EDYA 1XW6A 3HXSA 1FG4A 3ME7A 1TK8B 2KLXA 3ED3A 4NMUA 4OFMA 1F3AA 3ERWA 5IO0A 1TTZA 3C1RA 3UARA 2LRNA 3DD3A 1DE2A 1A8LA 2RIIA 4J56E 1M2AA 5G30A 4K9ZA 2MMOA 2K18A 2JZRA 1SJ6A 2EIQA 4K5SA 2O7KA 3GA4A 5B6MA 2L4CA 1QGVA 4LMWA 3TJKA 4IS0A 4F9ZA 1X9WB 1HQOA 3LWAA 1FW1A 2R0CA 3GX8A 4WF4A 5GSSA 3LJRA 1FVKA 2CVBA 3HD5A 2X99A 2PGTA 4MF7A 1EP7A 3ZFBA 1SL2B 1B4PA 2FHEA 1QFNA 2H0IA 3WGXA 1TK5B 2N5FA 2EIRA 3FR3A 5FWGA 1G6YA 2H1GA 3DXBA 1MD4A 3FZ5A 3HVVA 2GT6A 2H19A 4OWYA 1K0DA 5CRHA 1I9DA 2VOCA 1XW9A 4QQ7A 1T4ZA 2FLSA 2C80A 4PQIA 4HU7A 2C3NA 1N8JA 3K8NA 1RW1A 4Z2TA 4HOJA 4IKHA 4KA0A 4OO5A 4NXIA 2D2ZA 4ML1A 3E9JB 1SKRB 3IOSA 1M0UA 2FUG2 1SYXA 4MMMA 9GSSA 5LD0A 2CVKA 3FR9A 2K8SA 3Q6OA 2OBKA 2AV4A 4GQFA 1DSBA 3I43A 2NVLA 3GKXA 3HA9A 3KJYA 1AAZA 5JCGA 3Q18A 2QSIA 1OC8A 4H86A 5ECSA 5JWRB 2NBSA 6GSTA 2A4VA 5E4WA 3DRNA 2V41A 3F4RA 4OCFA 1G7OA 2MMZA 3O6TA 2QGVA 1T7PB 2LSTA 4ZIJA 3LORA 2F8FA 4DSSB 3VWUA 4L0WA 4XS4B 1Z9HA 3DKSA 3M0FA 3GRXA 2ZCTA 1R7HA 2CVDA 4D73B 2I9HA 2VAFA 3DVWA 3GH9A 4O92A 4LL1B 4YH2A 1V40A 3QCPA 4ZL9A 4NV2A 4DSRA 2DIZA 1BEDA 4HQZA 2FA4A 2OJLA 1GL8A 2JADA 2WDUA 4MF5A 4LLRA 2CZ2A 2VCZA 3M3MA 2EC4A 2H1DA 2A4HA 3QMXA 5FT3A 4TXOB 4ZB9A 3QPMA 1R4WA 2UZ8A 1S3CA 1HNBA 2OKAA 4I97A 3TB2A 3DGQA 4PQ1A 4CHSA 4ECCA 1X9SB 3EC3A 3GL5A 4K5RA 3J7Yk 5H5SA 1EP8A 4L5OA 1M2BA 1AQWA 2LNTA 1OE7A 1K0MA 4LA1A 1YKCA 1X9MB 4O5UA 3F6DA 3IV4A 4K7NA 1TU8A 1C72A 5B7CA 4JE1A
chains in the Genus database with same CATH topology
1K0BA 3RPPA 3M8NA 1XCCA 6GSSA 5G2ZA 3GV1A 3D21A 2L57A 3GH6A 2I3YA 1THOA 2AJQB 1PN9A 1OC9B 1M9BA 3LYPA 1B9YC 1GTAA 2VCWA 5ENUA 3CBUA 5KOXA 1K3LA 3D5JA 2OA7A 3UL3A 1GULA 4MZBA 4HJ2A 1M7TA 4E8HA 3UBLA 2R5GA 3HZ4A 1Z6MA 1AQVA 1CQHA 1EV9A 3PH9A 2VL3A 4FQUA 2H71A 4N30A 3IK7A 4MH3A 3TKPA 4ZBAA 1ERTA 1YF0A 1NSWA 3UIWA 3U5RE 1M99A 4GXZA 3TCOA 1GWCA 4ZBDA 2CV4A 2YZHA 3VWWA 4KUNA 2IIYA 17GSA 4IVFA 3C1SA 4J57E 2VM2A 1N2AA 5CYYA 2IL3A 3KMOA 1IYHA 5IMVA 4KGIA 2H01A 1J08A 3ERFA 1XVWA 1WJKA 5DBQA 4G2EA 5IOXA 2VL2A 4EVMA 1K3OA 3H93A 3ZYWA 2LKUA 2GGTA 4F82A 3KD0A 4HQSA 2MBTA 3FZ9A 4EUYA 1YEXA 1AXDA 2HE3A 2XBIA 4A5PA 4DSSA 4G0KA 1G6WA 5C00A 4KDUA 1ERVA 1FVJA 4MLYA 4XS4A 2VM1A 2H6XA 1VF1A 3L4NA 4D73A 4JEDA 5DCGA 3ZIVA 1GSSA 5CNWA 3GUSA 3N5OA 5HR3A 1O7UA 3U6VA 2FGXA 1K0AA 2VO4A 1LBKA 3E0UA 2YNXA 2PVOC 2GZPA 2R2JA 1YKAA 1KTEA 3EU3A 1PMTA 1J9BA 2V32A 1R5PA 4BVYB 4KCEA 3A3TA 2J9HA 2CZ3A 2GVPA 3VPTA 1SKWB 2HSHA 3M1GA 3EYTA 1XZOA 2PVQA 3FW2A 5C04A 4IHUA 2H70A 4K8MA 1WPIA 4NPBA 1A8YA 3ISOA 4WKWA 4WR4A 2LS5A 2YWIA 1TI1A 2GDRA 4G10A 1O73A 1HYUA 3BOAA 1XXUA 3RDWA 1WIKA 4JR6A 5G1KA 1X0RA 3BD2A 1ML6A 3F3RA 3HKRA 2A2PA 4AJ8A 3BCKA 2GQKA 3US3A 4IGJA 1ERWA 5KOWA 3G7JA 1PN0A 1DUGA 1GUKA 2CAIA 1ZCPA 4I2UA 1GSUA 3KEBA 4K7OA 13GSA 1OC9A 2GSQA 5H5QA 2PN8A 3FR6A 4ML6A 2YWMA 5ECRB 2AB6A 1TU7A 5ECLB 3A5IA 19GSA 2MMAA 2VIMA 2IMEA 1F37A 4PXOA 4F2IA 1PX6A 1XFLA 2P31A 4GQCA 4ULXA 4G9HA 1BX9A 4XHMA 4NAXA 2IFQB 3L9SA 5E59A 1SKSB 2C0DA 4MZCA 3HY2A 3LXTA 3LFLA 1B4QA 5BMUA 2CAQA 5DAKB 3VI7A 1Y25A 3VPQA 1FB6A 5ECPB 3P8WA 2NDOA 4DSQA 1AIUA 2G2QA 5HR1A 3H4KA 4IQAA 4TRXA 4AJ7A 2DJ1A 4O5RA 1SL0B 3BJ5A 5LCZA 4HEA2 5B8AA 2H73A 4PQHA 5B6NA 2LQQA 4ILFA 4HDEA 1PKZA 5ID2B 1URMA 2JU5A 2DMLA 3IAM2 4MDCA 5J41A 2BJXA 4BL7B 2IPAA 1RQMA 3F3QA 2Z9SA 2YP6A 3RPNA 3ZFLA 2K9FA 3KCMA 1U6TA 3KXOA 2FA8A 2PERA 1QQ2A 2WCIA 1WRYA 5GSTA 1GSFA 4XRAA 3EE2A 10GSA 1GTUA 2WFCA 2NPBA 2YN1A 5H5RA 4MPFA 4ID0A 3LW9A 2HRKA 5HR0A 5L71A 3RHCA 1Z6NA 3FKFA 3ZMKA 2H6ZA 4AF2A 1M9AA 3WYWA 3IR4A 2CT6A 3GKNA 1XWGA 2H66A 3PPUA 3CRTA 4YQMA 1AQXA 1EGOA 4BVYA 2LTKA 2LQOA 1YY7A 3CSHA 2KOKA 2VL9A 3KM6A 3GMFA 3LEFA 4G0IA 1TI3A 2LRCA 2WGRA 4BVXB 2CX3A 3WT1A 2R37A 1V58A 5DVBA 2PPTA 2HRAA 1FHEA 2EIOA 2YZUA 4N0VA 2FCHA 4EE0A 4EXJA 1K0CA 3DMLA 5D9WA 5IMZA 5COHA 2O85A 3MAKA 2REMA 3WGEA 4HS1A 3D4TA 3ZMLA 1GNEA 2H0GA 4PURA 3O3TA 2C1YA 3ZITA 5ECQB 1X5CA 4N11A 2HSMA 5J4UA 1UC7A 2AAWA 1SU9A 5INYA 3H79A 1I5GA 1A2MA 1XIYA 3IA1A 4ICYA 1Q98A 5JWOB 2X8HA 1PX7A 4DVCA 1A0RP 4N0ZA 3IDVA 4X1UA 4I6XA 5EVOA 2VLVA 3UVHA 3MYDA 1EGRA 3V1WA 4ZL8A 1HNCA 2I4AA 5ELAA 1BQ7A 1TDIA 2IFQA 4MH2A 1ST9A 2L59A 3DWVA 3SWLA 1BG5A 5JCUA 1JFUA 5D9XA 5DAKA 4GSTA 1XW5A 4OO4A 3F9UA 4WETA 5A4WA 2H1BA 2YJ7A 1TW9A 2O87A 1OVNA 4NWYA 4RQXA 1A2LA 3IHQA 4TKYA 3P7XA 1GSQA 3KTLA 4NHWA 2YANA 1OC3A 3D6IA 4OCEA 4BL7A 2H76A 1PL1A 2JZSA 4IJIA 1R26A 2MBSA 4WBRD 1NHOA 3EVIA 4EIPA 2MZCA 1R5AA 1W89A 1DE1A 1TRSA 4TR0A 2XBQA 1ZMAA 1JLWA 2J23A 2PU9C 2C0EA 5CAXA 2LNSA 4HJMA 3A2WA 4HUAA 2OBIA 2L5LA 1TK0B 3L0HA 4MP4A 2KUCA 2GQMA 3UEMA 2B6MA 2AYTA 2FWGA 4CW9A 1O81A 3HVXA 4N10A 5D8IA 2H74A 4ZXGA 4X43A 3RAZA 1SJIA 1HD2A 5LNKe 1V98A 1EWXA 2FNOA 4J2FA 5CRGA 1XPVA 1PRXA 1YQ1A 4Q5FA 5HFKA 2DLXA 1VRSD 2LV3A 3GURA 5AGYA 3UAPA 3A2VA 2IMKA 2XPEA 1ZZYA 6GSXA 3PR8A 1Z5YE 5EY6A 1SK2A 2YPMA 2M80A 2R6KA 4OMVA 3L78A 4IBPA 4BVXA 1OAZA 2GT5A 2WS2A 4TR4A 3KTBA 1EEJA 2E7PA 4WR5A 1Q4JA 1FOHA 2OE0A 5J9BA 4IJ3A 3VK9A 2P5RA 5HQPA 1BYEA 3FMWA 2HRNA 2ALBA 3N9JA 3VWVA 4Z7XA 5J5NA 2A2RA 2VUPA 4IELA 1GSDA 2VL2C 5GZZB 2IMFA 1PGTA 2IJYA 4HI7A 4WBJA 1JLVA 3TKSA 1X5EA 4FIWA 2ON5A 5IMCA 1M2DA 2H6YA 5F07A 4TXVA 3DYRA 1BAYA 2JSZA 1JZRA 2YWOA 3A5WA 3QOUA 4G0LA 4I5QA 1JZDA 2IMIA 3TRXA 4NHZA 7GSSA 4KDYA 1SK0A 4ISDA 3I9V2 2RLIA 3NZNA 2VD1A 5ECNB 20GSA 4MJEA 2GSRA 2VCQA 5AIXA 5F8BA 4K0NA 5GAND 3GKMA 1ON4A 1OYJA 1W4VA 5ECMB 2ES7A 3EU4A 2QA2A 4PNFA 3VWXA 3EURA 2V6OA 4HU9A 2B3SA 3C71A 1PD21 1OE8A 5AN1A 2MMNA 2YWNA 3GL3A 2H75A 3WGDA 1THXA 2LRTA 4YQUA 1E6BA 4PGTA 3GKKA 2HXKA 2OADA 4GLTA 5EPFA 1UN2A 4KDXA 4RI7A 4IP6A 4KSMA 4EKZA 3GTUB 2X8GA 2ZNMA 1OKTA 4HZ2A 5CP1A 1YZXA 3ZLPA 4CY6A 1QMVA 1NM3A 5IM9A 4QL7A 4JZQA 4IN0A 1YF1A 1SD8A 3EMXA 4POLA 3G9BA 4TXOA 5DQSA 4XTSA 5J9CA 1K0NA 2HNLA 1USBA 2RUEA 3DEXA 4POMA 1K3YA 4FH8A 5IPGA 3O76A 4K2XA 5G31A 2GSSA 1K0OA 2DSAA 1IYIA 4X0XA 3GNJA 3HJOA 2HZEB 1ZYQB 4BPYA 1ZL9A 2A2SA 1V2AA 3W8JA 3IE3A 3TJJA 3Q19A 1FO5A 1F3BA 2IN3A 1KEBA 1F2EA 2DJ3A 3HJPA 1B48A 2VCXA 2IMDA 2HRFA 2LJAA 1FB0A 3IPZA 5AISA 2GQLA 2QA1A 4IW9A 3KZQA 1HNAA 3WT2A 5CRDA 1BJXA 3MSZA 1O8WA 3GSSA 2GLRA 4PX1A 1Z3EA 4BWSA 3EPTA 1QUWA 4YQVA 5G5EA 2YV9A 14GSA 5F06A 4F0BA 3GN3A 2V2GA 1ILOA 1LU4A 3H1NA 2O8VB 3F8UA 3FZ4A 1NW2A 3KH7A 3P90A 1XOAA 2OE1A 4XCSA 2WZ9A 5D93A 3QFBC 2YJHA 4HZ4A 3KMNA 3D4MA 1MDKA 3GSTA 5F05A 3KGKA 4XIHA 2X64A 1O85A 5ECOB 1LJRA 1XWAA 4IP1A 4E8EA 1GNWA 4EIQA 3KP8A 5ECHB 4ZB8A 3H8QA 3UJ1A 2BMXA 4MZWA 3MWHA 4K2DA 2VLUA 3HVSA 4IQ1A 4MJAA 2H1AA 3GYKA 2B7JA 2L4QA 5A5KA 4ACSA 2GTUA 2DC5A 5DDLA 2JACA 2P0GA 2P5QA 1GP1A 2KP1A 3UOMA 4PUAA 2N5AA 4KB3A 3G7YA 2MYGA 5IOWA 3C8EA 2GSTA 4CDOA 3L9UA 3UBKA 2E0QA 2N5BA 3CRUA 5D96A 4AGSA 1ACVA 1MTCA 1EV4A 1V57A 3IK9A 3FZAA 3GTUA 3TJFA 3VLNA 2I81A 3IHGA 5D73A 2HSYA 5A4VA 1T1VA 1TP9A 1XOBA 2WRTA 4Q5QA 1ZYEA 3FHKA 3APSA 3TRQA 2K8VA 2E2GA 3R3EA 1J0FA 3CSIA 2R3XA 1F9MA 1SD9A 4PUFC 2R4VA 4MJCA 3I69A 2C0FA 2NTOA 3C73A 3LSZA 4MNNA 2YCDA 2H30A 5KN3A 5IMDA 2PMTA 3IXRA 2B5YA 5HR2A 5IIZA 5KN2A 2B5XA 4KE3A 1EEMA 4PNGA 1TOFA 2B5EA 3I6AA 1NHYA 1U3IA 5DQYA 3GX0A 3TRPA 4JU5A 4Q5RA 1GLQA 2HT9A 2HZEA 1VF4A 5J3RA 2DJKA 3C7MA 3TKQA 1MDIA 2X8CA 4USSA 2OE3A 4K0GA 3TOUA 1AUCA 3CTGA 2WJUA 2E2MA 4RI6A 1S3DA 4K1FA 3LG6A 5IMAA 4I8BA 4K6XA 3R2QA 4FYUA 12GSA 4FO5A 3LXZA 3RBTA 4BWQA 1WWJA 1YJ6A 2CX4A 1QXHA 5AIVA 4PTSA 1ABAA 5KEJA 4DEJA 2L5OA 4Z2RA 5F0GA 1S3AA 4KSOA 3ERGA 3GIXA 3KP9A 2H0HA 2LUSA 3OR5A 2VLTA 3HDCA 3D22A 3P2AA 4MJBA 1XWBA 1A2JA 4LMVA 2F51A 2L6CA 1AW9A 3ZTLA 1GSEA 2B1KA 3Q74A 5CO3A 3HHVA 1XBSA 2HYXA 5KN1A 4BA7A 5IO2A 4V1Ag 3LQ7A 2VCVA 5HFIA 4ZB6A 2GS3A 5EL8A 4FYBA 4KNDA 3NOFA 2AHEA 4EF0A 4GSNA 5ID2A 4OFNA 1JZOA 1VF3A 1WOUA 3AY8A 4TN8A 1ZOFA 3QAGA 1GTBA 2X49A 3IC8A 1A23A 4KCAA 4F0CA 2IWTA 1B9XC 1ZYPA 4XS6A 2C4JA 5IMFA 1GUHA 2HZFA 3E3EA 3UMAA 1PKWA 2DJJA 4KAEA 4CY8A 16GSA 3NIVA 4O7HA 2R0PA 22GSA 2ZUPA 1YEPA 4O5QA 1UVZA 2G0FA 3TOTA 1SK1A 2TIRA 2DJ2A 2OACA 2TRXA 1O8XA 1A0FA 6GSVA 5GAPD 1UA5A 1PSQA 1OKDA 3APQA 2GZYA 5B8BA 2B7KA 2KHPA 4V2LA 1YDKA 3EWLA 3TKSC 4G19A 3KH9A 5A4UA 2C0GA 4GWRA 2PBJA 2QKEA 3APOA 2RUFA 4TW5A 4YKFA 5DALB 2HLSA 1TKDB 5BRTA 4GCIA 6GSUA 4X4JA 3TJBA 3CYNA 4K7IA 2LEGA 4LL4B 3CTFA 2YOIA 1TRWA 3UVTA 3FK8A 3J7Yb 1H4OA 3WD6A 2JL4A 4MA9A 2O89A 3A2XA 2PUKC 4V2MA 1SJZA 3ZREA 4FYCA 1G0TA 3F4SA 1ERUA 1FOVA 4EC0A 4TR1B 1TRVA 3ZVJA 2DKHA 4ECBA 3VI5A 1G7EA 4YAPA 4GF0A 2QC7A 5IPHA 3IRAA 2DMMA 3TGZA 3QD9A 3W6GA 4NV5A 2DJ0A 2DBCA 4RQRA 3MNGA 2F3MA 4ECJA 2LJKA 4JR4A 3QFAC 1WE0A 4Z2UA 1KBNA 5HFGA 3IBHA 1PL2A 3SBCA 4MCUA 1VF2A 3QAWA 2I1UA 1GRXA 3HJMA 1FAAA 3EINA 2H72A 3ZL5A 1V9WA 1JZWA 3TKRA 1ZYNA 1Y6EA 4O32A 2CQ9A 1A24A 4GSSA 3L9VA 4L0UA 4ZILA 4EO3A 1H75A 1T4YA 4POBA 1PA3A 3MIXA 2XHFA 1EZKA 3HYPA 4ZL7A 1Z7RA 2R0GA 3EMPA 4L8EA 5ABRA 2JSYA 3FY7A 2FY6A 4TR3A 3ZIJA 4OD7A 2C3TA 1WMJA 2XPDA 4KW6A 4JRRA 4MPGA 3VFIA 5DJLA 1SL1B 6GSWA 3GHAA 3TUEA 2F9SA 2TRCP 1KNGA 3W8SA 4I2TA 4AJ6A 5D9VA 3TKSE 4YKGA 4WXTA 5IQYA 1U87A 3CMIA 3ME8A 1TXXA 3CSJA 3HZ8A 3IC4A 3QDNA 4QL9A 2DIYA 5CRWA 5G5FA 3FYGA 5JCWA 1T00A 5DCHA 5G1LA 1QK8A 2DKIA 3TJGA 1XVQA 1PQNA 3G7IA 4V1Ap 11GSA 1GTIA 1XWKA 3M9JA 1SENA 5ECIB 2FWFA 2ON7A 1F6MC 4MABA 4YAVA 5DALA 4ZBBA 1EOHA 3PINA 1SYRA 1RK4A 5D9TA 2LJRA 1MDJA 1GLPA 2WB9A 3GFKA 3FEUA 4GRFA 5CREA 3PGTA 1TRUA 1EOGA 3DIEA 3BCIA 3QR6A 4EDZA 1T8EB 1DBYA 2JZTA 5FHIA 5ELGA 2WULA 5ECKB 1U3AA 2FWHA 1CQGA 1ZGNA 3VURA 1B8XA 2H8LA 3TDGA 3FRCA 4EL1A 2BTOT 4TR1A 1MD3A 2V1MA 4WEYA 1GH2A 2VCTA 1VGLA 3LGCA 3MDKA 1XWCA 3QAVA 4P3YB 1T3BA 2FD3A 1GUMA 8GSSA 2RM6A 4MK3A 3F0IA 3LYKA 3HCZA 3F4TA 4MF6A 2M72A 5JWQB 2C3QA 3KIJA 2V6KA 4KH7A 1X5DA 2VD0A 4WF5A 4RUVA 2X4AA 2C8UA 2RM5A 4GTUA 4XS1A 1WP0A 4JBBA 1AC1A 2HFDA 4TOPA 3RHBA 1JHBA 2KP2A 1U88A 4KF9A 4XRDA 2YV7A 3F6FA 4OFTA 2FWEA 3D0ZA 1E2YA 4ECIA 1Z7PA 3ZRDA 2L6DA 5DJMA 2M46A 4V2NA 3BBYA 1TJDA 3M9KA 2PWJA 3ZZXA 2B1LA 4Q5NA 2AUVA 3IAS2 2XC2A 2GZZA 3DVXA 2HI7A 4KX4A 6GSYA 1MEKA 1GSYA 3CXGA 2K6VA 4TVEA 3ZVJD 4F03A 2CA8A 2F8AA 1O6JA 3F63A 18GSA 4POKA 3S9FA 3JCML 4L5LA 5KN0A 4EDYA 1XW6A 3HXSA 1FG4A 3ME7A 1TK8B 2KLXA 3ED3A 4NMUA 4OFMA 1F3AA 3ERWA 5IO0A 1TTZA 3C1RA 3UARA 2LRNA 3DD3A 1DE2A 1A8LA 2RIIA 4J56E 1M2AA 5G30A 4K9ZA 2MMOA 2K18A 2JZRA 1SJ6A 2EIQA 4K5SA 2O7KA 3GA4A 5B6MA 2L4CA 1QGVA 4LMWA 3TJKA 4IS0A 4F9ZA 1X9WB 1HQOA 3LWAA 1FW1A 2R0CA 3GX8A 4WF4A 5GSSA 3LJRA 1FVKA 2CVBA 3HD5A 2X99A 2PGTA 4MF7A 1EP7A 3ZFBA 1SL2B 1B4PA 2FHEA 1QFNA 2H0IA 3WGXA 1TK5B 2N5FA 2EIRA 3FR3A 5FWGA 1G6YA 2H1GA 3DXBA 1MD4A 3FZ5A 3HVVA 2GT6A 2H19A 4OWYA 1K0DA 5CRHA 1I9DA 2VOCA 1XW9A 4QQ7A 1T4ZA 2FLSA 2C80A 4PQIA 4HU7A 2C3NA 1N8JA 3K8NA 1RW1A 4Z2TA 4HOJA 4IKHA 4KA0A 4OO5A 4NXIA 2D2ZA 4ML1A 3E9JB 1SKRB 3IOSA 1M0UA 2FUG2 1SYXA 4MMMA 9GSSA 5LD0A 2CVKA 3FR9A 2K8SA 3Q6OA 2OBKA 2AV4A 4GQFA 1DSBA 3I43A 2NVLA 3GKXA 3HA9A 3KJYA 1AAZA 5JCGA 3Q18A 2QSIA 1OC8A 4H86A 5ECSA 5JWRB 2NBSA 6GSTA 2A4VA 5E4WA 3DRNA 2V41A 3F4RA 4OCFA 1G7OA 2MMZA 3O6TA 2QGVA 1T7PB 2LSTA 4ZIJA 3LORA 2F8FA 4DSSB 3VWUA 4L0WA 4XS4B 1Z9HA 3DKSA 3M0FA 3GRXA 2ZCTA 1R7HA 2CVDA 4D73B 2I9HA 2VAFA 3DVWA 3GH9A 4O92A 4LL1B 4YH2A 1V40A 3QCPA 4ZL9A 4NV2A 4DSRA 2DIZA 1BEDA 4HQZA 2FA4A 2OJLA 1GL8A 2JADA 2WDUA 4MF5A 4LLRA 2CZ2A 2VCZA 3M3MA 2EC4A 2H1DA 2A4HA 3QMXA 5FT3A 4TXOB 4ZB9A 3QPMA 1R4WA 2UZ8A 1S3CA 1HNBA 2OKAA 4I97A 3TB2A 3DGQA 4PQ1A 4CHSA 4ECCA 1X9SB 3EC3A 3GL5A 4K5RA 3J7Yk 5H5SA 1EP8A 4L5OA 1M2BA 1AQWA 2LNTA 1OE7A 1K0MA 4LA1A 1YKCA 1X9MB 4O5UA 3F6DA 3IV4A 4K7NA 1TU8A 1C72A 5B7CA 4JE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K0B A;  3RPP A;  3M8N A;  1XCC A;  6GSS A;  5G2Z A;  3GV1 A;  3D21 A;  2L57 A;  3GH6 A;  2I3Y A;  1THO A;  2AJQ B;  1PN9 A;  1OC9 B;  1M9B A;  3LYP A;  1B9Y C;  1GTA A;  2VCW A;  5ENU A;  3CBU A;  1K3L A;  3D5J A;  2OA7 A;  3UL3 A;  1GUL A;  4MZB A;  4HJ2 A;  1M7T A;  4E8H A;  3UBL A;  2R5G A;  3HZ4 A;  1Z6M A;  1AQV A;  1CQH A;  1EV9 A;  3PH9 A;  2VL3 A;  2H71 A;  4N30 A;  3IK7 A;  4MH3 A;  3TKP A;  4ZBA A;  1ERT A;  1YF0 A;  1NSW A;  3UIW A;  3U5R E;  1M99 A;  4GXZ A;  3TCO A;  1GWC A;  4ZBD A;  2CV4 A;  2YZH A;  3VWW A;  4KUN A;  2IIY A;  17GS A;  4IVF A;  3C1S A;  4J57 E;  2VM2 A;  1N2A A;  5CYY A;  2IL3 A;  3KMO A;  1IYH A;  5IMV A;  4KGI A;  2H01 A;  1J08 A;  3ERF A;  1XVW A;  1WJK A;  5DBQ A;  4G2E A;  5IOX A;  2VL2 A;  4EVM A;  1K3O A;  3H93 A;  3ZYW A;  2LKU A;  2GGT A;  4F82 A;  3KD0 A;  4HQS A;  2MBT A;  3FZ9 A;  4EUY A;  1YEX A;  1AXD A;  2HE3 A;  2XBI A;  4DSS A;  1G6W A;  5C00 A;  4KDU A;  1ERV A;  1FVJ A;  4MLY A;  4XS4 A;  2VM1 A;  2H6X A;  1VF1 A;  3L4N A;  4D73 A;  4JED A;  5DCG A;  3ZIV A;  1GSS A;  5CNW A;  3GUS A;  3N5O A;  5HR3 A;  1O7U A;  3U6V A;  2FGX A;  1K0A A;  2VO4 A;  1LBK A;  3E0U A;  2YNX A;  2PVO C;  2GZP A;  2R2J A;  1YKA A;  1KTE A;  3EU3 A;  1PMT A;  1J9B A;  2V32 A;  1R5P A;  4KCE A;  3A3T A;  2J9H A;  2CZ3 A;  2GVP A;  3VPT A;  1SKW B;  2HSH A;  3M1G A;  3EYT A;  1XZO A;  2PVQ A;  3FW2 A;  5C04 A;  4IHU A;  2H70 A;  4K8M A;  1WPI A;  4NPB A;  1A8Y A;  3ISO A;  4WKW A;  4WR4 A;  2LS5 A;  2YWI A;  1TI1 A;  2GDR A;  4G10 A;  1O73 A;  1HYU A;  3BOA A;  1XXU A;  3RDW A;  1WIK A;  4JR6 A;  5G1K A;  1X0R A;  3BD2 A;  1ML6 A;  3F3R A;  3HKR A;  4AJ8 A;  3BCK A;  2GQK A;  3US3 A;  4IGJ A;  1ERW A;  3G7J A;  1DUG A;  1GUK A;  2CAI A;  1ZCP A;  4I2U A;  1GSU A;  3KEB A;  4K7O A;  13GS A;  1OC9 A;  2GSQ A;  5H5Q A;  2PN8 A;  3FR6 A;  4ML6 A;  2YWM A;  5ECR B;  2AB6 A;  1TU7 A;  5ECL B;  19GS A;  2MMA A;  2VIM A;  2IME A;  1F37 A;  4PXO A;  4F2I A;  1PX6 A;  1XFL A;  2P31 A;  4GQC A;  4ULX A;  4G9H A;  1BX9 A;  4XHM A;  4NAX A;  2IFQ B;  3L9S A;  5E59 A;  1SKS B;  2C0D A;  4MZC A;  3HY2 A;  3LXT A;  3LFL A;  1B4Q A;  2CAQ A;  5DAK B;  3VI7 A;  1Y25 A;  3VPQ A;  1FB6 A;  5ECP B;  3P8W A;  2NDO A;  4DSQ A;  1AIU A;  2G2Q A;  5HR1 A;  3H4K A;  4IQA A;  4TRX A;  4AJ7 A;  2DJ1 A;  4O5R A;  1SL0 B;  3BJ5 A;  5LCZ A;  4HEA 2;  5B8A A;  2H73 A;  4PQH A;  5B6N A;  2LQQ A;  4ILF A;  4HDE A;  1PKZ A;  5ID2 B;  1URM A;  2JU5 A;  2DML A;  3IAM 2;  4MDC A;  5J41 A;  2BJX A;  2IPA A;  1RQM A;  3F3Q A;  2Z9S A;  2YP6 A;  3RPN A;  3ZFL A;  2K9F A;  3KCM A;  1U6T A;  3KXO A;  2FA8 A;  2PER A;  1QQ2 A;  2WCI A;  1WRY A;  5GST A;  1GSF A;  4XRA A;  3EE2 A;  10GS A;  1GTU A;  2WFC A;  2NPB A;  2YN1 A;  5H5R A;  4MPF A;  4ID0 A;  5HR0 A;  5L71 A;  3RHC A;  1Z6N A;  3FKF A;  3ZMK A;  2H6Z A;  4AF2 A;  1M9A A;  3WYW A;  3IR4 A;  2CT6 A;  3GKN A;  1XWG A;  2H66 A;  3CRT A;  4YQM A;  1AQX A;  1EGO A;  4BVY A;  2LTK A;  2LQO A;  1YY7 A;  3CSH A;  2KOK A;  2VL9 A;  3KM6 A;  3GMF A;  3LEF A;  1TI3 A;  2LRC A;  2WGR A;  2CX3 A;  3WT1 A;  2R37 A;  1V58 A;  5DVB A;  2PPT A;  1FHE A;  2EIO A;  2YZU A;  4N0V A;  2FCH A;  4EE0 A;  4EXJ A;  1K0C A;  3DML A;  5D9W A;  5IMZ A;  5COH A;  2O85 A;  3MAK A;  2REM A;  3WGE A;  4HS1 A;  3D4T A;  3ZML A;  1GNE A;  2H0G A;  4PUR A;  3O3T A;  2C1Y A;  3ZIT A;  5ECQ B;  1X5C A;  4N11 A;  5J4U A;  1UC7 A;  2AAW A;  1SU9 A;  5INY A;  3H79 A;  1I5G A;  1A2M A;  1XIY A;  3IA1 A;  1Q98 A;  5JWO B;  2X8H A;  1PX7 A;  4DVC A;  1A0R P;  4N0Z A;  3IDV A;  4X1U A;  4I6X A;  5EVO A;  2VLV A;  3UVH A;  1EGR A;  3V1W A;  4ZL8 A;  1HNC A;  2I4A A;  5ELA A;  1BQ7 A;  1TDI A;  2IFQ A;  4MH2 A;  1ST9 A;  2L59 A;  3DWV A;  3SWL A;  1BG5 A;  5JCU A;  1JFU A;  5D9X A;  5DAK A;  4GST A;  1XW5 A;  4OO4 A;  3F9U A;  4WET A;  5A4W A;  2H1B A;  2YJ7 A;  1TW9 A;  2O87 A;  1OVN A;  4NWY A;  4RQX A;  1A2L A;  3IHQ A;  4TKY A;  3P7X A;  1GSQ A;  3KTL A;  4NHW A;  2YAN A;  1OC3 A;  3D6I A;  4OCE A;  4BL7 A;  2H76 A;  1PL1 A;  2JZS A;  4IJI A;  1R26 A;  2MBS A;  4WBR D;  1NHO A;  3EVI A;  2MZC A;  1R5A A;  1W89 A;  1DE1 A;  1TRS A;  4TR0 A;  2XBQ A;  1ZMA A;  1JLW A;  2J23 A;  2PU9 C;  2C0E A;  5CAX A;  2LNS A;  4HJM A;  3A2W A;  4HUA A;  2OBI A;  2L5L A;  1TK0 B;  3L0H A;  4MP4 A;  2KUC A;  2GQM A;  3UEM A;  2B6M A;  2AYT A;  2FWG A;  4CW9 A;  1O81 A;  3HVX A;  4N10 A;  5D8I A;  2H74 A;  4ZXG A;  4X43 A;  3RAZ A;  1SJI A;  1HD2 A;  5LNK e;  1V98 A;  1EWX A;  2FNO A;  4J2F A;  5CRG A;  1XPV A;  1PRX A;  1YQ1 A;  4Q5F A;  5HFK A;  2DLX A;  1VRS D;  2LV3 A;  3GUR A;  5AGY A;  3UAP A;  3A2V A;  2IMK A;  2XPE A;  1ZZY A;  6GSX A;  3PR8 A;  1Z5Y E;  5EY6 A;  1SK2 A;  2YPM A;  2M80 A;  2R6K A;  4OMV A;  3L78 A;  4IBP A;  4BVX A;  1OAZ A;  2GT5 A;  2WS2 A;  4TR4 A;  3KTB A;  1EEJ A;  2E7P A;  4WR5 A;  1Q4J A;  2OE0 A;  5J9B A;  4IJ3 A;  3VK9 A;  2P5R A;  5HQP A;  1BYE A;  2HRN A;  2ALB A;  3N9J A;  3VWV A;  4Z7X A;  5J5N A;  2A2R A;  2VUP A;  4IEL A;  1GSD A;  2VL2 C;  5GZZ B;  2IMF A;  1PGT A;  2IJY A;  4HI7 A;  4WBJ A;  1JLV A;  3TKS A;  1X5E A;  4FIW A;  2ON5 A;  5IMC A;  1M2D A;  2H6Y A;  5F07 A;  4TXV A;  3DYR A;  1BAY A;  2JSZ A;  1JZR A;  2YWO A;  3A5W A;  3QOU A;  4I5Q A;  1JZD A;  2IMI A;  3TRX A;  4NHZ A;  7GSS A;  4KDY A;  1SK0 A;  4ISD A;  3I9V 2;  2RLI A;  3NZN A;  2VD1 A;  5ECN B;  20GS A;  4MJE A;  2GSR A;  2VCQ A;  5AIX A;  5F8B A;  4K0N A;  5GAN D;  3GKM A;  1ON4 A;  1OYJ A;  1W4V A;  5ECM B;  2ES7 A;  3EU4 A;  4PNF A;  3VWX A;  3EUR A;  2V6O A;  4HU9 A;  2B3S A;  3C71 A;  1PD2 1;  1OE8 A;  5AN1 A;  2MMN A;  2YWN A;  3GL3 A;  2H75 A;  3WGD A;  1THX A;  2LRT A;  4YQU A;  1E6B A;  4PGT A;  3GKK A;  2HXK A;  2OAD A;  4GLT A;  5EPF A;  1UN2 A;  4KDX A;  4RI7 A;  4IP6 A;  4KSM A;  4EKZ A;  3GTU B;  2X8G A;  2ZNM A;  1OKT A;  4HZ2 A;  5CP1 A;  1YZX A;  3ZLP A;  1QMV A;  1NM3 A;  5IM9 A;  4QL7 A;  4JZQ A;  4IN0 A;  1YF1 A;  1SD8 A;  3EMX A;  4POL A;  3G9B A;  4TXO A;  5DQS A;  4XTS A;  5J9C A;  1K0N A;  2HNL A;  1USB A;  2RUE A;  3DEX A;  4POM A;  1K3Y A;  4FH8 A;  5IPG A;  3O76 A;  5G31 A;  2GSS A;  1K0O A;  2DSA A;  1IYI A;  4X0X A;  3GNJ A;  3HJO A;  2HZE B;  1ZYQ B;  4BPY A;  1ZL9 A;  2A2S A;  1V2A A;  3W8J A;  3IE3 A;  3TJJ A;  3Q19 A;  1FO5 A;  1F3B A;  2IN3 A;  1KEB A;  1F2E A;  2DJ3 A;  3HJP A;  1B48 A;  2VCX A;  2IMD A;  2HRF A;  2LJA A;  1FB0 A;  3IPZ A;  5AIS A;  2GQL A;  4IW9 A;  3KZQ A;  1HNA A;  3WT2 A;  5CRD A;  1BJX A;  3MSZ A;  1O8W A;  3GSS A;  2GLR A;  4PX1 A;  1Z3E A;  4BWS A;  1QUW A;  4YQV A;  5G5E A;  2YV9 A;  14GS A;  5F06 A;  4F0B A;  3GN3 A;  2V2G A;  1ILO A;  1LU4 A;  3H1N A;  2O8V B;  3F8U A;  3FZ4 A;  1NW2 A;  3KH7 A;  3P90 A;  1XOA A;  2OE1 A;  4XCS A;  2WZ9 A;  5D93 A;  3QFB C;  2YJH A;  4HZ4 A;  3KMN A;  3D4M A;  1MDK A;  3GST A;  5F05 A;  3KGK A;  4XIH A;  2X64 A;  1O85 A;  5ECO B;  1LJR A;  1XWA A;  4IP1 A;  4E8E A;  1GNW A;  3KP8 A;  5ECH B;  4ZB8 A;  3H8Q A;  3UJ1 A;  2BMX A;  4MZW A;  3MWH A;  4K2D A;  2VLU A;  3HVS A;  4IQ1 A;  4MJA A;  2H1A A;  3GYK A;  2B7J A;  2L4Q A;  5A5K A;  4ACS A;  2GTU A;  2DC5 A;  5DDL A;  2JAC A;  2P0G A;  2P5Q A;  1GP1 A;  2KP1 A;  3UOM A;  4PUA A;  2N5A A;  4KB3 A;  3G7Y A;  2MYG A;  5IOW A;  3C8E A;  2GST A;  4CDO A;  3L9U A;  3UBK A;  2E0Q A;  2N5B A;  3CRU A;  5D96 A;  4AGS A;  1ACV A;  1MTC A;  1EV4 A;  1V57 A;  3IK9 A;  3FZA A;  3GTU A;  3TJF A;  3VLN A;  2I81 A;  5D73 A;  2HSY A;  5A4V A;  1T1V A;  1TP9 A;  1XOB A;  2WRT A;  4Q5Q A;  1ZYE A;  3FHK A;  3APS A;  3TRQ A;  2K8V A;  2E2G A;  1J0F A;  3CSI A;  2R3X A;  1F9M A;  1SD9 A;  4PUF C;  2R4V A;  4MJC A;  3I69 A;  2C0F A;  2NTO A;  3C73 A;  3LSZ A;  2YCD A;  2H30 A;  5KN3 A;  5IMD A;  2PMT A;  3IXR A;  2B5Y A;  5HR2 A;  5IIZ A;  5KN2 A;  2B5X A;  4KE3 A;  1EEM A;  4PNG A;  1TOF A;  2B5E A;  3I6A A;  1NHY A;  1U3I A;  5DQY A;  3GX0 A;  3TRP A;  4JU5 A;  4Q5R A;  1GLQ A;  2HT9 A;  2HZE A;  1VF4 A;  5J3R A;  2DJK A;  3C7M A;  3TKQ A;  1MDI A;  2X8C A;  2OE3 A;  4K0G A;  3TOU A;  1AUC A;  3CTG A;  2WJU A;  2E2M A;  4RI6 A;  1S3D A;  4K1F A;  3LG6 A;  5IMA A;  4I8B A;  4K6X A;  3R2Q A;  4FYU A;  12GS A;  4FO5 A;  3LXZ A;  3RBT A;  4BWQ A;  1WWJ A;  1YJ6 A;  2CX4 A;  1QXH A;  5AIV A;  1ABA A;  5KEJ A;  4DEJ A;  2L5O A;  5F0G A;  1S3A A;  4KSO A;  3ERG A;  3GIX A;  3KP9 A;  2H0H A;  2LUS A;  3OR5 A;  2VLT A;  3HDC A;  3D22 A;  3P2A A;  4MJB A;  1XWB A;  1A2J A;  4LMV A;  2F51 A;  2L6C A;  1AW9 A;  3ZTL A;  1GSE A;  2B1K A;  3Q74 A;  5CO3 A;  3HHV A;  1XBS A;  2HYX A;  5KN1 A;  4BA7 A;  5IO2 A;  4V1A g;  3LQ7 A;  2VCV A;  5HFI A;  4ZB6 A;  2GS3 A;  5EL8 A;  4FYB A;  4KND A;  3NOF A;  2AHE A;  4EF0 A;  4GSN A;  5ID2 A;  4OFN A;  1JZO A;  1VF3 A;  1WOU A;  3AY8 A;  4TN8 A;  1ZOF A;  3QAG A;  1GTB A;  4KCA A;  1A23 A;  4F0C A;  2IWT A;  1B9X C;  4XS6 A;  2C4J A;  5IMF A;  1GUH A;  2HZF A;  3E3E A;  3UMA A;  1PKW A;  2DJJ A;  4KAE A;  16GS A;  3NIV A;  4O7H A;  22GS A;  2ZUP A;  1YEP A;  1UVZ A;  2G0F A;  3TOT A;  1SK1 A;  2TIR A;  2DJ2 A;  2OAC A;  2TRX A;  1O8X A;  1A0F A;  6GSV A;  5GAP D;  1UA5 A;  1PSQ A;  1OKD A;  3APQ A;  2GZY A;  5B8B A;  2B7K A;  2KHP A;  4V2L A;  1YDK A;  3EWL A;  3TKS C;  4G19 A;  3KH9 A;  5A4U A;  2C0G A;  4GWR A;  2PBJ A;  2QKE A;  3APO A;  2RUF A;  4TW5 A;  5DAL B;  2HLS A;  1TKD B;  4GCI A;  6GSU A;  3TJB A;  3CYN A;  4K7I A;  2LEG A;  4LL4 B;  3CTF A;  2YOI A;  1TRW A;  3UVT A;  3FK8 A;  3J7Y b;  1H4O A;  3WD6 A;  2JL4 A;  4MA9 A;  2O89 A;  3A2X A;  2PUK C;  4V2M A;  1SJZ A;  3ZRE A;  4FYC A;  1G0T A;  3F4S A;  1ERU A;  1FOV A;  4EC0 A;  4TR1 B;  1TRV A;  3ZVJ A;  4ECB A;  3VI5 A;  1G7E A;  4YAP A;  4GF0 A;  2QC7 A;  5IPH A;  3IRA A;  2DMM A;  3TGZ A;  3QD9 A;  3W6G A;  4NV5 A;  2DJ0 A;  2DBC A;  4RQR A;  3MNG A;  2F3M A;  4ECJ A;  2LJK A;  4JR4 A;  3QFA C;  1WE0 A;  1KBN A;  5HFG A;  3IBH A;  1PL2 A;  3SBC A;  4MCU A;  1VF2 A;  3QAW A;  2I1U A;  1GRX A;  3HJM A;  1FAA A;  3EIN A;  2H72 A;  3ZL5 A;  1V9W A;  1JZW A;  3TKR A;  1Y6E A;  4O32 A;  2CQ9 A;  1A24 A;  4GSS A;  3L9V A;  4L0U A;  4ZIL A;  4EO3 A;  1H75 A;  1T4Y A;  4POB A;  1PA3 A;  2XHF A;  1EZK A;  3HYP A;  4ZL7 A;  1Z7R A;  3EMP A;  4L8E A;  5ABR A;  2JSY A;  3FY7 A;  2FY6 A;  4TR3 A;  3ZIJ A;  4OD7 A;  2C3T A;  1WMJ A;  2XPD A;  4KW6 A;  4JRR A;  4MPG A;  3VFI A;  5DJL A;  1SL1 B;  6GSW A;  3GHA A;  3TUE A;  2F9S A;  2TRC P;  1KNG A;  3W8S A;  4I2T A;  4AJ6 A;  5D9V A;  3TKS E;  4WXT A;  5IQY A;  1U87 A;  3CMI A;  3ME8 A;  1TXX A;  3CSJ A;  3HZ8 A;  3IC4 A;  3QDN A;  4QL9 A;  2DIY A;  5CRW A;  5G5F A;  3FYG A;  5JCW A;  1T00 A;  5DCH A;  5G1L A;  1QK8 A;  3TJG A;  1XVQ A;  1PQN A;  3G7I A;  4V1A p;  11GS A;  1GTI A;  1XWK A;  3M9J A;  1SEN A;  5ECI B;  2FWF A;  2ON7 A;  1F6M C;  4MAB A;  4YAV A;  5DAL A;  4ZBB A;  1EOH A;  5D9T A;  1SYR A;  1RK4 A;  3PIN A;  2LJR A;  1MDJ A;  1GLP A;  2WB9 A;  3GFK A;  3FEU A;  4GRF A;  5CRE A;  3PGT A;  1TRU A;  1EOG A;  3DIE A;  3BCI A;  3QR6 A;  4EDZ A;  1T8E B;  1DBY A;  2JZT A;  5FHI A;  5ELG A;  2WUL A;  5ECK B;  1U3A A;  2FWH A;  1CQG A;  1ZGN A;  3VUR A;  1B8X A;  2H8L A;  3TDG A;  3FRC A;  4EL1 A;  2BTO T;  4TR1 A;  1MD3 A;  2V1M A;  4WEY A;  1GH2 A;  2VCT A;  1VGL A;  3LGC A;  3MDK A;  1XWC A;  3QAV A;  4P3Y B;  1T3B A;  2FD3 A;  1GUM A;  8GSS A;  2RM6 A;  4MK3 A;  3F0I A;  3LYK A;  3HCZ A;  3F4T A;  4MF6 A;  2M72 A;  5JWQ B;  2C3Q A;  3KIJ A;  2V6K A;  4KH7 A;  1X5D A;  2VD0 A;  4WF5 A;  4RUV A;  2C8U A;  2RM5 A;  4GTU A;  4XS1 A;  1WP0 A;  4JBB A;  1AC1 A;  2HFD A;  4TOP A;  3RHB A;  1JHB A;  2KP2 A;  1U88 A;  4XRD A;  2YV7 A;  3F6F A;  4OFT A;  2FWE A;  3D0Z A;  1E2Y A;  4ECI A;  1Z7P A;  3ZRD A;  2L6D A;  5DJM A;  2M46 A;  4V2N A;  3BBY A;  1TJD A;  3M9K A;  2PWJ A;  3ZZX A;  2B1L A;  4Q5N A;  2AUV A;  3IAS 2;  2XC2 A;  2GZZ A;  3DVX A;  2HI7 A;  4KX4 A;  6GSY A;  1MEK A;  1GSY A;  3CXG A;  2K6V A;  4TVE A;  3ZVJ D;  4F03 A;  2CA8 A;  2F8A A;  1O6J A;  3F63 A;  18GS A;  4POK A;  3S9F A;  3JCM L;  4L5L A;  5KN0 A;  4EDY A;  1XW6 A;  3HXS A;  1FG4 A;  3ME7 A;  1TK8 B;  2KLX A;  3ED3 A;  4NMU A;  4OFM A;  1F3A A;  3ERW A;  5IO0 A;  1TTZ A;  3C1R A;  3UAR A;  2LRN A;  3DD3 A;  1DE2 A;  1A8L A;  2RII A;  4J56 E;  1M2A A;  5G30 A;  4K9Z A;  2MMO A;  2K18 A;  2JZR A;  1SJ6 A;  2EIQ A;  2O7K A;  3GA4 A;  5B6M A;  2L4C A;  1QGV A;  4LMW A;  3TJK A;  4IS0 A;  4F9Z A;  1X9W B;  1HQO A;  3LWA A;  1FW1 A;  3GX8 A;  4WF4 A;  5GSS A;  3LJR A;  1FVK A;  2CVB A;  3HD5 A;  2X99 A;  2PGT A;  4MF7 A;  1EP7 A;  3ZFB A;  1SL2 B;  1B4P A;  2FHE A;  1QFN A;  2H0I A;  3WGX A;  1TK5 B;  2N5F A;  2EIR A;  3FR3 A;  5FWG A;  1G6Y A;  2H1G A;  3DXB A;  1MD4 A;  3FZ5 A;  3HVV A;  2GT6 A;  2H19 A;  4OWY A;  1K0D A;  5CRH A;  1I9D A;  2VOC A;  1XW9 A;  4QQ7 A;  1T4Z A;  2FLS A;  2C80 A;  4PQI A;  4HU7 A;  2C3N A;  1N8J A;  3K8N A;  1RW1 A;  4HOJ A;  4IKH A;  4KA0 A;  4OO5 A;  4NXI A;  2D2Z A;  4ML1 A;  3E9J B;  1SKR B;  3IOS A;  1M0U A;  2FUG 2;  1SYX A;  4MMM A;  9GSS A;  5LD0 A;  2CVK A;  3FR9 A;  2K8S A;  3Q6O A;  2OBK A;  2AV4 A;  4GQF A;  1DSB A;  3I43 A;  2NVL A;  3GKX A;  3HA9 A;  3KJY A;  1AAZ A;  5JCG A;  3Q18 A;  2QSI A;  1OC8 A;  4H86 A;  5ECS A;  5JWR B;  2NBS A;  6GST A;  2A4V A;  5E4W A;  3DRN A;  2V41 A;  3F4R A;  4OCF A;  1G7O A;  2MMZ A;  3O6T A;  2QGV A;  1T7P B;  2LST A;  4ZIJ A;  3LOR A;  2F8F A;  4DSS B;  3VWU A;  4L0W A;  4XS4 B;  1Z9H A;  3DKS A;  3M0F A;  3GRX A;  2ZCT A;  1R7H A;  2CVD A;  4D73 B;  2I9H A;  2VAF A;  3DVW A;  3GH9 A;  4O92 A;  4LL1 B;  4YH2 A;  1V40 A;  3QCP A;  4ZL9 A;  4NV2 A;  4DSR A;  2DIZ A;  1BED A;  4HQZ A;  2FA4 A;  2OJL A;  1GL8 A;  2JAD A;  2WDU A;  4MF5 A;  4LLR A;  2CZ2 A;  2VCZ A;  3M3M A;  2EC4 A;  2H1D A;  3QMX A;  5FT3 A;  4TXO B;  4ZB9 A;  3QPM A;  1R4W A;  1S3C A;  1HNB A;  2OKA A;  4I97 A;  3TB2 A;  3DGQ A;  4PQ1 A;  4CHS A;  4ECC A;  1X9S B;  3EC3 A;  3GL5 A;  3J7Y k;  5H5S A;  1EP8 A;  4L5O A;  1M2B A;  1AQW A;  2LNT A;  1OE7 A;  1K0M A;  4LA1 A;  1YKC A;  1X9M B;  3F6D A;  3IV4 A;  4K7N A;  1TU8 A;  1C72 A;  5B7C A;  4JE1 A; 
#chains in the Genus database with same CATH topology
 1K0B A;  3RPP A;  3M8N A;  1XCC A;  6GSS A;  5G2Z A;  3GV1 A;  3D21 A;  2L57 A;  3GH6 A;  2I3Y A;  1THO A;  2AJQ B;  1PN9 A;  1OC9 B;  1M9B A;  3LYP A;  1B9Y C;  1GTA A;  2VCW A;  5ENU A;  3CBU A;  5KOX A;  1K3L A;  3D5J A;  2OA7 A;  3UL3 A;  1GUL A;  4MZB A;  4HJ2 A;  1M7T A;  4E8H A;  3UBL A;  2R5G A;  3HZ4 A;  1Z6M A;  1AQV A;  1CQH A;  1EV9 A;  3PH9 A;  2VL3 A;  4FQU A;  2H71 A;  4N30 A;  3IK7 A;  4MH3 A;  3TKP A;  4ZBA A;  1ERT A;  1YF0 A;  1NSW A;  3UIW A;  3U5R E;  1M99 A;  1M3J A;  4GXZ A;  3TCO A;  1GWC A;  4ZBD A;  2CV4 A;  2YZH A;  3VWW A;  4KUN A;  2IIY A;  17GS A;  4IVF A;  3C1S A;  4J57 E;  2VM2 A;  1N2A A;  5CYY A;  2IL3 A;  3KMO A;  1IYH A;  5IMV A;  4KGI A;  2H01 A;  1J08 A;  3ERF A;  1XVW A;  1WJK A;  5DBQ A;  4G2E A;  5IOX A;  2VL2 A;  4EVM A;  1K3O A;  3H93 A;  3ZYW A;  2LKU A;  2GGT A;  4F82 A;  3KD0 A;  4HQS A;  2MBT A;  3FZ9 A;  4EUY A;  1YEX A;  1AXD A;  2HE3 A;  2XBI A;  4A5P A;  4DSS A;  4G0K A;  1G6W A;  5C00 A;  4KDU A;  1ERV A;  1FVJ A;  4MLY A;  4XS4 A;  2VM1 A;  2H6X A;  1VF1 A;  3L4N A;  4D73 A;  4JED A;  5DCG A;  3ZIV A;  1GSS A;  5CNW A;  3GUS A;  3N5O A;  5HR3 A;  1O7U A;  3U6V A;  2FGX A;  1K0A A;  2VO4 A;  1LBK A;  3E0U A;  2YNX A;  2PVO C;  2GZP A;  2R2J A;  1YKA A;  1KTE A;  3EU3 A;  1PMT A;  1J9B A;  2V32 A;  1R5P A;  4BVY B;  4KCE A;  3A3T A;  2J9H A;  2CZ3 A;  2GVP A;  3VPT A;  1SKW B;  2HSH A;  3M1G A;  3EYT A;  1XZO A;  2PVQ A;  3FW2 A;  5C04 A;  4IHU A;  2H70 A;  4K8M A;  1WPI A;  4NPB A;  1A8Y A;  3ISO A;  4WKW A;  4WR4 A;  2LS5 A;  2YWI A;  1TI1 A;  2GDR A;  4G10 A;  1O73 A;  1HYU A;  3BOA A;  1XXU A;  3RDW A;  1WIK A;  4JR6 A;  5G1K A;  1X0R A;  3BD2 A;  1ML6 A;  3F3R A;  3HKR A;  2A2P A;  4AJ8 A;  3BCK A;  2GQK A;  3US3 A;  4IGJ A;  1ERW A;  5KOW A;  3G7J A;  1PN0 A;  1DUG A;  1GUK A;  2CAI A;  1ZCP A;  4I2U A;  1GSU A;  3KEB A;  4K7O A;  13GS A;  1OC9 A;  2GSQ A;  5H5Q A;  2PN8 A;  3FR6 A;  4ML6 A;  2YWM A;  5ECR B;  2AB6 A;  1TU7 A;  5ECL B;  3A5I A;  19GS A;  2MMA A;  2VIM A;  2IME A;  1F37 A;  4PXO A;  4F2I A;  1PX6 A;  1XFL A;  2P31 A;  4GQC A;  4ULX A;  4G9H A;  1BX9 A;  4XHM A;  4NAX A;  2IFQ B;  3L9S A;  5E59 A;  1SKS B;  2C0D A;  4MZC A;  3HY2 A;  3LXT A;  3LFL A;  1B4Q A;  5BMU A;  2CAQ A;  5DAK B;  3VI7 A;  1Y25 A;  3VPQ A;  1FB6 A;  5ECP B;  3P8W A;  2NDO A;  4DSQ A;  1AIU A;  2G2Q A;  5HR1 A;  3H4K A;  4IQA A;  4TRX A;  4AJ7 A;  2DJ1 A;  4O5R A;  1SL0 B;  3BJ5 A;  5LCZ A;  4HEA 2;  5B8A A;  2H73 A;  4PQH A;  5B6N A;  2LQQ A;  4ILF A;  4HDE A;  1PKZ A;  5ID2 B;  1URM A;  2JU5 A;  2DML A;  3IAM 2;  4MDC A;  5J41 A;  2BJX A;  4BL7 B;  2IPA A;  1RQM A;  3F3Q A;  2Z9S A;  2YP6 A;  3RPN A;  3ZFL A;  2K9F A;  3KCM A;  1U6T A;  3KXO A;  2FA8 A;  2PER A;  1QQ2 A;  2WCI A;  1WRY A;  5GST A;  1GSF A;  4XRA A;  3EE2 A;  10GS A;  1GTU A;  2WFC A;  2NPB A;  2YN1 A;  5H5R A;  4MPF A;  4ID0 A;  3LW9 A;  2HRK A;  5HR0 A;  5L71 A;  3RHC A;  1Z6N A;  3FKF A;  3ZMK A;  2H6Z A;  4AF2 A;  1M9A A;  3WYW A;  3IR4 A;  2CT6 A;  3GKN A;  1XWG A;  2H66 A;  3PPU A;  3CRT A;  4YQM A;  1AQX A;  1EGO A;  4BVY A;  2LTK A;  2LQO A;  1YY7 A;  3CSH A;  2KOK A;  2VL9 A;  3KM6 A;  3GMF A;  3LEF A;  4G0I A;  1TI3 A;  2LRC A;  2WGR A;  4BVX B;  2CX3 A;  3WT1 A;  2R37 A;  1V58 A;  5DVB A;  2PPT A;  2HRA A;  1FHE A;  2EIO A;  2YZU A;  4N0V A;  2FCH A;  4EE0 A;  4EXJ A;  1K0C A;  3DML A;  5D9W A;  5IMZ A;  5COH A;  2O85 A;  3MAK A;  2REM A;  3WGE A;  4HS1 A;  3D4T A;  3ZML A;  1GNE A;  2H0G A;  4PUR A;  3O3T A;  2C1Y A;  3ZIT A;  5ECQ B;  1X5C A;  4N11 A;  2HSM A;  5J4U A;  1UC7 A;  2AAW A;  1SU9 A;  5INY A;  3H79 A;  1I5G A;  1A2M A;  1XIY A;  3IA1 A;  4ICY A;  1Q98 A;  5JWO B;  2X8H A;  1PX7 A;  4DVC A;  1A0R P;  4N0Z A;  3IDV A;  4X1U A;  4I6X A;  5EVO A;  2VLV A;  3UVH A;  3MYD A;  1EGR A;  3V1W A;  4ZL8 A;  1HNC A;  2I4A A;  5ELA A;  1BQ7 A;  1TDI A;  2IFQ A;  4MH2 A;  1ST9 A;  2L59 A;  3DWV A;  3SWL A;  1BG5 A;  5JCU A;  1JFU A;  5D9X A;  5DAK A;  4GST A;  1XW5 A;  4OO4 A;  3F9U A;  4WET A;  5A4W A;  2H1B A;  2YJ7 A;  1TW9 A;  2O87 A;  1OVN A;  4NWY A;  4RQX A;  1A2L A;  3IHQ A;  4TKY A;  3P7X A;  1GSQ A;  3KTL A;  4NHW A;  2YAN A;  1OC3 A;  3D6I A;  4OCE A;  4BL7 A;  2H76 A;  1PL1 A;  2JZS A;  4IJI A;  1R26 A;  2MBS A;  4WBR D;  1NHO A;  3EVI A;  4EIP A;  2MZC A;  1R5A A;  1W89 A;  1DE1 A;  1TRS A;  4TR0 A;  2XBQ A;  1ZMA A;  1JLW A;  2J23 A;  2PU9 C;  2C0E A;  5CAX A;  2LNS A;  4HJM A;  3A2W A;  4HUA A;  2OBI A;  2L5L A;  1TK0 B;  3L0H A;  4MP4 A;  2KUC A;  2GQM A;  3UEM A;  2B6M A;  2AYT A;  2FWG A;  4CW9 A;  1O81 A;  3HVX A;  4N10 A;  5D8I A;  2H74 A;  4ZXG A;  4X43 A;  3RAZ A;  1SJI A;  1HD2 A;  5LNK e;  1V98 A;  1EWX A;  2FNO A;  4J2F A;  5CRG A;  1XPV A;  1PRX A;  1YQ1 A;  4Q5F A;  5HFK A;  2DLX A;  1VRS D;  2LV3 A;  3GUR A;  5AGY A;  3UAP A;  3A2V A;  2IMK A;  2XPE A;  1ZZY A;  6GSX A;  3PR8 A;  1Z5Y E;  5EY6 A;  1SK2 A;  2YPM A;  2M80 A;  2R6K A;  4OMV A;  3L78 A;  4IBP A;  4BVX A;  1OAZ A;  2GT5 A;  2WS2 A;  4TR4 A;  3KTB A;  1EEJ A;  2E7P A;  4WR5 A;  1Q4J A;  1FOH A;  2OE0 A;  5J9B A;  4IJ3 A;  3VK9 A;  2P5R A;  5HQP A;  1BYE A;  3FMW A;  2HRN A;  2ALB A;  3N9J A;  3VWV A;  4Z7X A;  5J5N A;  2A2R A;  2VUP A;  4IEL A;  1GSD A;  2VL2 C;  5GZZ B;  2IMF A;  1PGT A;  2IJY A;  4HI7 A;  4WBJ A;  1JLV A;  3TKS A;  1X5E A;  4FIW A;  2ON5 A;  5IMC A;  1M2D A;  2H6Y A;  5F07 A;  4TXV A;  3DYR A;  3A5W A;  1BAY A;  1JZR A;  2JSZ A;  2YWO A;  3QOU A;  4G0L A;  4I5Q A;  1JZD A;  2IMI A;  3TRX A;  4NHZ A;  7GSS A;  4KDY A;  1SK0 A;  4ISD A;  3I9V 2;  2RLI A;  3NZN A;  2VD1 A;  5ECN B;  20GS A;  4MJE A;  2GSR A;  2VCQ A;  5AIX A;  5F8B A;  4K0N A;  5GAN D;  3GKM A;  1ON4 A;  1OYJ A;  1W4V A;  5ECM B;  2ES7 A;  3EU4 A;  2QA2 A;  4PNF A;  3VWX A;  3EUR A;  2V6O A;  4HU9 A;  2B3S A;  3C71 A;  1PD2 1;  1OE8 A;  5AN1 A;  2MMN A;  2YWN A;  3GL3 A;  2H75 A;  3WGD A;  1THX A;  2LRT A;  4YQU A;  1E6B A;  4HSC X;  4PGT A;  3GKK A;  2HXK A;  2OAD A;  4GLT A;  5EPF A;  1UN2 A;  4KDX A;  4RI7 A;  4IP6 A;  4KSM A;  4EKZ A;  3GTU B;  2X8G A;  2ZNM A;  1OKT A;  4HZ2 A;  5CP1 A;  1YZX A;  3ZLP A;  4CY6 A;  1QMV A;  1NM3 A;  5IM9 A;  4QL7 A;  4JZQ A;  4IN0 A;  1YF1 A;  1SD8 A;  3EMX A;  4POL A;  3G9B A;  4TXO A;  5DQS A;  4XTS A;  5J9C A;  1K0N A;  2HNL A;  1USB A;  2RUE A;  3DEX A;  4POM A;  1K3Y A;  4FH8 A;  5IPG A;  3O76 A;  4K2X A;  5G31 A;  2GSS A;  1K0O A;  2DSA A;  1IYI A;  4X0X A;  3GNJ A;  3CQF A;  3HJO A;  2HZE B;  1ZYQ B;  4BPY A;  1ZL9 A;  2A2S A;  1V2A A;  3W8J A;  3IE3 A;  3TJJ A;  3Q19 A;  1FO5 A;  1F3B A;  2IN3 A;  1KEB A;  1F2E A;  2DJ3 A;  1PFO A;  1B48 A;  3HJP A;  2VCX A;  2IMD A;  2HRF A;  2LJA A;  1FB0 A;  3IPZ A;  5AIS A;  2GQL A;  2QA1 A;  4IW9 A;  3KZQ A;  1HNA A;  3WT2 A;  5CRD A;  1BJX A;  3MSZ A;  1O8W A;  3GSS A;  2GLR A;  4PX1 A;  1Z3E A;  4BWS A;  3EPT A;  1QUW A;  4YQV A;  5G5E A;  2YV9 A;  14GS A;  5F06 A;  4F0B A;  3GN3 A;  2V2G A;  1ILO A;  1LU4 A;  3H1N A;  2O8V B;  3F8U A;  3FZ4 A;  1NW2 A;  3KH7 A;  3P90 A;  1XG8 A;  1XOA A;  2OE1 A;  4XCS A;  2WZ9 A;  5D93 A;  3QFB C;  2YJH A;  4HZ4 A;  3KMN A;  3D4M A;  1MDK A;  3GST A;  5F05 A;  3KGK A;  4XIH A;  2X64 A;  1O85 A;  5ECO B;  1LJR A;  1XWA A;  4IP1 A;  4E8E A;  1GNW A;  4EIQ A;  3KP8 A;  5ECH B;  4ZB8 A;  3H8Q A;  3UJ1 A;  2BMX A;  4MZW A;  3MWH A;  4K2D A;  2VLU A;  3HVS A;  4IQ1 A;  4MJA A;  2H1A A;  3GYK A;  2B7J A;  2L4Q A;  5A5K A;  4ACS A;  2GTU A;  2DC5 A;  5DDL A;  2JAC A;  2P0G A;  2P5Q A;  1GP1 A;  2KP1 A;  3UOM A;  4PUA A;  2N5A A;  4KB3 A;  3G7Y A;  2MYG A;  5IOW A;  3C8E A;  2GST A;  4CDO A;  3L9U A;  3UBK A;  2E0Q A;  2N5B A;  3CRU A;  5D96 A;  4AGS A;  1ACV A;  1MTC A;  1EV4 A;  1V57 A;  3IK9 A;  3FZA A;  3GTU A;  3TJF A;  3VLN A;  2I81 A;  3IHG A;  5D73 A;  2HSY A;  5A4V A;  1T1V A;  1TP9 A;  1XOB A;  2WRT A;  4Q5Q A;  1ZYE A;  3FHK A;  3APS A;  3TRQ A;  2K8V A;  3HVN A;  2E2G A;  3R3E A;  1J0F A;  3CSI A;  2R3X A;  1F9M A;  1SD9 A;  4PUF C;  2R4V A;  4MJC A;  3I69 A;  2C0F A;  2NTO A;  3C73 A;  3LSZ A;  4MNN A;  2YCD A;  2H30 A;  5KN3 A;  5IMD A;  2PMT A;  3IXR A;  2B5Y A;  5HR2 A;  5IIZ A;  5KN2 A;  2B5X A;  4KE3 A;  1EEM A;  4PNG A;  1TOF A;  2B5E A;  3I6A A;  1NHY A;  1U3I A;  5DQY A;  3GX0 A;  3TRP A;  4JU5 A;  4Q5R A;  1GLQ A;  2HT9 A;  2HZE A;  1VF4 A;  5J3R A;  2DJK A;  3C7M A;  3TKQ A;  1MDI A;  2X8C A;  4USS A;  2OE3 A;  4K0G A;  3TOU A;  1AUC A;  3CTG A;  2WJU A;  2E2M A;  4RI6 A;  1S3D A;  4K1F A;  3LG6 A;  5IMA A;  4I8B A;  4K6X A;  3R2Q A;  4FYU A;  12GS A;  4FO5 A;  3LXZ A;  3RBT A;  4BWQ A;  1WWJ A;  1YJ6 A;  2CX4 A;  1QXH A;  5AIV A;  4PTS A;  1ABA A;  5KEJ A;  4DEJ A;  2L5O A;  4Z2R A;  5F0G A;  1S3A A;  4KSO A;  3ERG A;  3GIX A;  3KP9 A;  2H0H A;  2LUS A;  3OR5 A;  2VLT A;  3HDC A;  3D22 A;  3P2A A;  4MJB A;  1XWB A;  1A2J A;  4LMV A;  2F51 A;  2L6C A;  1AW9 A;  3ZTL A;  1GSE A;  2B1K A;  3Q74 A;  5CO3 A;  3HHV A;  1XBS A;  2HYX A;  5KN1 A;  4BA7 A;  5IO2 A;  4V1A g;  3LQ7 A;  2VCV A;  5HFI A;  4ZB6 A;  2GS3 A;  5EL8 A;  4FYB A;  4KND A;  3NOF A;  2AHE A;  4EF0 A;  4GSN A;  5ID2 A;  4OFN A;  1JZO A;  1VF3 A;  1WOU A;  1M3I A;  3AY8 A;  4TN8 A;  1ZOF A;  3QAG A;  1GTB A;  2X49 A;  3IC8 A;  1A23 A;  4KCA A;  4F0C A;  2IWT A;  1B9X C;  1ZYP A;  4XS6 A;  2C4J A;  5IMF A;  1GUH A;  2HZF A;  3E3E A;  3UMA A;  1PKW A;  2DJJ A;  4KAE A;  4CY8 A;  16GS A;  3NIV A;  4O7H A;  2R0P A;  22GS A;  2ZUP A;  1YEP A;  4O5Q A;  1UVZ A;  2G0F A;  3TOT A;  1SK1 A;  2TIR A;  2DJ2 A;  2OAC A;  2TRX A;  1O8X A;  1A0F A;  6GSV A;  5GAP D;  1UA5 A;  1PSQ A;  1OKD A;  3APQ A;  2GZY A;  5B8B A;  2B7K A;  2KHP A;  4V2L A;  1YDK A;  3EWL A;  3TKS C;  4G19 A;  3KH9 A;  5A4U A;  2C0G A;  4GWR A;  2PBJ A;  2QKE A;  3APO A;  2RUF A;  4TW5 A;  4YKF A;  5DAL B;  2HLS A;  1TKD B;  5BRT A;  4GCI A;  6GSU A;  4X4J A;  3TJB A;  3CYN A;  4K7I A;  2LEG A;  4LL4 B;  3CTF A;  2YOI A;  1TRW A;  3UVT A;  3FK8 A;  3J7Y b;  1H4O A;  3WD6 A;  2JL4 A;  4MA9 A;  2O89 A;  3A2X A;  2PUK C;  4V2M A;  1SJZ A;  3ZRE A;  4FYC A;  1G0T A;  3F4S A;  1ERU A;  1FOV A;  4EC0 A;  4TR1 B;  1TRV A;  3ZVJ A;  2DKH A;  4ECB A;  3VI5 A;  1G7E A;  4YAP A;  4GF0 A;  2QC7 A;  5IPH A;  3IRA A;  2DMM A;  3TGZ A;  3QD9 A;  3W6G A;  4NV5 A;  2DJ0 A;  2DBC A;  4RQR A;  3MNG A;  2F3M A;  4ECJ A;  2LJK A;  4JR4 A;  3QFA C;  1WE0 A;  4Z2U A;  1KBN A;  5HFG A;  3IBH A;  1PL2 A;  3SBC A;  4MCU A;  1VF2 A;  3QAW A;  2I1U A;  1GRX A;  3HJM A;  1FAA A;  3EIN A;  2H72 A;  3ZL5 A;  1V9W A;  1JZW A;  3TKR A;  1ZYN A;  1Y6E A;  4O32 A;  2CQ9 A;  1A24 A;  4GSS A;  3L9V A;  4L0U A;  4ZIL A;  4EO3 A;  1H75 A;  1T4Y A;  4POB A;  1PA3 A;  3MIX A;  2XHF A;  1EZK A;  3HYP A;  4ZL7 A;  1Z7R A;  2R0G A;  3EMP A;  4L8E A;  5ABR A;  2JSY A;  3FY7 A;  2FY6 A;  4TR3 A;  3ZIJ A;  4OD7 A;  2C3T A;  1WMJ A;  2XPD A;  4KW6 A;  4JRR A;  4MPG A;  3VFI A;  5DJL A;  1SL1 B;  6GSW A;  3GHA A;  3TUE A;  2F9S A;  2TRC P;  1KNG A;  3W8S A;  4I2T A;  4AJ6 A;  5D9V A;  3TKS E;  4YKG A;  4WXT A;  5IQY A;  1U87 A;  3CMI A;  3ME8 A;  1TXX A;  3CSJ A;  3HZ8 A;  3IC4 A;  3QDN A;  4QL9 A;  2DIY A;  5CRW A;  5G5F A;  3FYG A;  5JCW A;  1T00 A;  5DCH A;  5G1L A;  1QK8 A;  2DKI A;  3TJG A;  1XVQ A;  1PQN A;  3G7I A;  4V1A p;  11GS A;  1GTI A;  1XWK A;  3M9J A;  1SEN A;  5ECI B;  2FWF A;  2ON7 A;  1F6M C;  4MAB A;  4YAV A;  5DAL A;  4ZBB A;  1EOH A;  3PIN A;  1SYR A;  1RK4 A;  5D9T A;  2LJR A;  1MDJ A;  1GLP A;  2WB9 A;  3GFK A;  3FEU A;  4GRF A;  5CRE A;  3PGT A;  1TRU A;  1EOG A;  3DIE A;  3BCI A;  3QR6 A;  4EDZ A;  1T8E B;  1DBY A;  2JZT A;  5FHI A;  5ELG A;  2WUL A;  5ECK B;  1U3A A;  2FWH A;  1CQG A;  1ZGN A;  3VUR A;  1B8X A;  2H8L A;  3TDG A;  3FRC A;  4EL1 A;  2BTO T;  4TR1 A;  1MD3 A;  2V1M A;  4WEY A;  1GH2 A;  2VCT A;  1VGL A;  3LGC A;  4BIK A;  3MDK A;  1XWC A;  3QAV A;  4P3Y B;  1T3B A;  2FD3 A;  1GUM A;  8GSS A;  2RM6 A;  4MK3 A;  3F0I A;  3LYK A;  3HCZ A;  3F4T A;  4MF6 A;  2M72 A;  5JWQ B;  2C3Q A;  3KIJ A;  2V6K A;  4KH7 A;  1X5D A;  2VD0 A;  4WF5 A;  4RUV A;  2X4A A;  2C8U A;  2RM5 A;  4GTU A;  4XS1 A;  1WP0 A;  4JBB A;  1AC1 A;  2HFD A;  4TOP A;  3RHB A;  1JHB A;  2KP2 A;  1U88 A;  4KF9 A;  4XRD A;  2YV7 A;  3F6F A;  4OFT A;  2FWE A;  3D0Z A;  1E2Y A;  4ECI A;  1Z7P A;  3ZRD A;  1S3R A;  2L6D A;  5DJM A;  2M46 A;  4V2N A;  3BBY A;  1TJD A;  3M9K A;  2PWJ A;  3ZZX A;  2B1L A;  4Q5N A;  2AUV A;  3IAS 2;  2XC2 A;  2GZZ A;  3DVX A;  2HI7 A;  4KX4 A;  6GSY A;  1MEK A;  1GSY A;  3CXG A;  2K6V A;  4TVE A;  3ZVJ D;  4F03 A;  2CA8 A;  2F8A A;  1O6J A;  3F63 A;  18GS A;  4POK A;  3S9F A;  3JCM L;  4L5L A;  5KN0 A;  4EDY A;  1XW6 A;  3HXS A;  1FG4 A;  3ME7 A;  1TK8 B;  2KLX A;  3ED3 A;  4NMU A;  4OFM A;  1F3A A;  3ERW A;  5IO0 A;  1TTZ A;  3C1R A;  3UAR A;  2LRN A;  3DD3 A;  1DE2 A;  1A8L A;  2RII A;  4J56 E;  1M2A A;  5G30 A;  4K9Z A;  2MMO A;  2K18 A;  2JZR A;  1SJ6 A;  2EIQ A;  4K5S A;  2O7K A;  3GA4 A;  5B6M A;  2L4C A;  1QGV A;  4LMW A;  3TJK A;  4IS0 A;  4F9Z A;  1X9W B;  1HQO A;  3LWA A;  1FW1 A;  2R0C A;  3GX8 A;  4WF4 A;  5GSS A;  3LJR A;  1FVK A;  2CVB A;  3HD5 A;  2X99 A;  2PGT A;  4MF7 A;  1EP7 A;  3ZFB A;  1SL2 B;  1B4P A;  2FHE A;  1QFN A;  2H0I A;  3WGX A;  1TK5 B;  2N5F A;  2EIR A;  3FR3 A;  5FWG A;  1G6Y A;  2H1G A;  3DXB A;  1MD4 A;  3FZ5 A;  3HVV A;  2GT6 A;  2H19 A;  4OWY A;  1K0D A;  5CRH A;  1I9D A;  2VOC A;  1XW9 A;  4QQ7 A;  1T4Z A;  2FLS A;  2C80 A;  4PQI A;  4HU7 A;  2C3N A;  1N8J A;  3K8N A;  1RW1 A;  4Z2T A;  4HOJ A;  4IKH A;  4KA0 A;  4OO5 A;  4NXI A;  2D2Z A;  4ML1 A;  3E9J B;  1SKR B;  3IOS A;  1M0U A;  2FUG 2;  1SYX A;  4MMM A;  9GSS A;  5LD0 A;  2CVK A;  3FR9 A;  2K8S A;  3Q6O A;  2OBK A;  2AV4 A;  4GQF A;  1DSB A;  3I43 A;  2NVL A;  3GKX A;  3HA9 A;  3KJY A;  1AAZ A;  5JCG A;  3Q18 A;  2QSI A;  1OC8 A;  4H86 A;  5ECS A;  5JWR B;  2NBS A;  6GST A;  2A4V A;  5E4W A;  3DRN A;  2V41 A;  3F4R A;  4OCF A;  1G7O A;  2MMZ A;  3O6T A;  2QGV A;  1T7P B;  2LST A;  4ZIJ A;  3LOR A;  2F8F A;  4DSS B;  3VWU A;  4L0W A;  4XS4 B;  1Z9H A;  3DKS A;  3M0F A;  3GRX A;  2ZCT A;  1R7H A;  2CVD A;  4D73 B;  2I9H A;  2VAF A;  3DVW A;  3GH9 A;  4O92 A;  4LL1 B;  4YH2 A;  1V40 A;  3QCP A;  4ZL9 A;  4NV2 A;  4DSR A;  2DIZ A;  1BED A;  4HQZ A;  2FA4 A;  2OJL A;  1GL8 A;  2JAD A;  2WDU A;  4MF5 A;  4LLR A;  2CZ2 A;  2VCZ A;  3M3M A;  2EC4 A;  2H1D A;  2A4H A;  3QMX A;  5FT3 A;  4TXO B;  4ZB9 A;  3QPM A;  1R4W A;  2UZ8 A;  1S3C A;  1HNB A;  2OKA A;  4I97 A;  3TB2 A;  3DGQ A;  4PQ1 A;  4CHS A;  4ECC A;  1X9S B;  3EC3 A;  3GL5 A;  4K5R A;  3J7Y k;  5H5S A;  1EP8 A;  4L5O A;  1M2B A;  1AQW A;  2LNT A;  1OE7 A;  1K0M A;  4LA1 A;  1YKC A;  1X9M B;  4O5U A;  3F6D A;  3IV4 A;  4K7N A;  1TU8 A;  1C72 A;  5B7C A;  4JE1 A; 
#chains in the Genus database with same CATH homology
 1K0B A;  3RPP A;  3M8N A;  1XCC A;  6GSS A;  5G2Z A;  3GV1 A;  3D21 A;  2L57 A;  3GH6 A;  2I3Y A;  1THO A;  2AJQ B;  1PN9 A;  1OC9 B;  1M9B A;  3LYP A;  1B9Y C;  1GTA A;  2VCW A;  5ENU A;  3CBU A;  5KOX A;  1K3L A;  3D5J A;  2OA7 A;  3UL3 A;  1GUL A;  4MZB A;  4HJ2 A;  1M7T A;  4E8H A;  3UBL A;  2R5G A;  3HZ4 A;  1Z6M A;  1AQV A;  1CQH A;  1EV9 A;  3PH9 A;  2VL3 A;  4FQU A;  2H71 A;  4N30 A;  3IK7 A;  4MH3 A;  3TKP A;  4ZBA A;  1ERT A;  1YF0 A;  1NSW A;  3UIW A;  3U5R E;  1M99 A;  4GXZ A;  3TCO A;  1GWC A;  4ZBD A;  2CV4 A;  2YZH A;  3VWW A;  4KUN A;  2IIY A;  17GS A;  4IVF A;  3C1S A;  4J57 E;  2VM2 A;  1N2A A;  5CYY A;  2IL3 A;  3KMO A;  1IYH A;  5IMV A;  4KGI A;  2H01 A;  1J08 A;  3ERF A;  1XVW A;  1WJK A;  5DBQ A;  4G2E A;  5IOX A;  2VL2 A;  4EVM A;  1K3O A;  3H93 A;  3ZYW A;  2LKU A;  2GGT A;  4F82 A;  3KD0 A;  4HQS A;  2MBT A;  3FZ9 A;  4EUY A;  1YEX A;  1AXD A;  2HE3 A;  2XBI A;  4A5P A;  4DSS A;  4G0K A;  1G6W A;  5C00 A;  4KDU A;  1ERV A;  1FVJ A;  4MLY A;  4XS4 A;  2VM1 A;  2H6X A;  1VF1 A;  3L4N A;  4D73 A;  4JED A;  5DCG A;  3ZIV A;  1GSS A;  5CNW A;  3GUS A;  3N5O A;  5HR3 A;  1O7U A;  3U6V A;  2FGX A;  1K0A A;  2VO4 A;  1LBK A;  3E0U A;  2YNX A;  2PVO C;  2GZP A;  2R2J A;  1YKA A;  1KTE A;  3EU3 A;  1PMT A;  1J9B A;  2V32 A;  1R5P A;  4BVY B;  4KCE A;  3A3T A;  2J9H A;  2CZ3 A;  2GVP A;  3VPT A;  1SKW B;  2HSH A;  3M1G A;  3EYT A;  1XZO A;  2PVQ A;  3FW2 A;  5C04 A;  4IHU A;  2H70 A;  4K8M A;  1WPI A;  4NPB A;  1A8Y A;  3ISO A;  4WKW A;  4WR4 A;  2LS5 A;  2YWI A;  1TI1 A;  2GDR A;  4G10 A;  1O73 A;  1HYU A;  3BOA A;  1XXU A;  3RDW A;  1WIK A;  4JR6 A;  5G1K A;  1X0R A;  3BD2 A;  1ML6 A;  3F3R A;  3HKR A;  2A2P A;  4AJ8 A;  3BCK A;  2GQK A;  3US3 A;  4IGJ A;  1ERW A;  5KOW A;  3G7J A;  1PN0 A;  1DUG A;  1GUK A;  2CAI A;  1ZCP A;  4I2U A;  1GSU A;  3KEB A;  4K7O A;  13GS A;  1OC9 A;  2GSQ A;  5H5Q A;  2PN8 A;  3FR6 A;  4ML6 A;  2YWM A;  5ECR B;  2AB6 A;  1TU7 A;  5ECL B;  3A5I A;  19GS A;  2MMA A;  2VIM A;  2IME A;  1F37 A;  4PXO A;  4F2I A;  1PX6 A;  1XFL A;  2P31 A;  4GQC A;  4ULX A;  4G9H A;  1BX9 A;  4XHM A;  4NAX A;  2IFQ B;  3L9S A;  5E59 A;  1SKS B;  2C0D A;  4MZC A;  3HY2 A;  3LXT A;  3LFL A;  1B4Q A;  5BMU A;  2CAQ A;  5DAK B;  3VI7 A;  1Y25 A;  3VPQ A;  1FB6 A;  5ECP B;  3P8W A;  2NDO A;  4DSQ A;  1AIU A;  2G2Q A;  5HR1 A;  3H4K A;  4IQA A;  4TRX A;  4AJ7 A;  2DJ1 A;  4O5R A;  1SL0 B;  3BJ5 A;  5LCZ A;  4HEA 2;  5B8A A;  2H73 A;  4PQH A;  5B6N A;  2LQQ A;  4ILF A;  4HDE A;  1PKZ A;  5ID2 B;  1URM A;  2JU5 A;  2DML A;  3IAM 2;  4MDC A;  5J41 A;  2BJX A;  4BL7 B;  2IPA A;  1RQM A;  3F3Q A;  2Z9S A;  2YP6 A;  3RPN A;  3ZFL A;  2K9F A;  3KCM A;  1U6T A;  3KXO A;  2FA8 A;  2PER A;  1QQ2 A;  2WCI A;  1WRY A;  5GST A;  1GSF A;  4XRA A;  3EE2 A;  10GS A;  1GTU A;  2WFC A;  2NPB A;  2YN1 A;  5H5R A;  4MPF A;  4ID0 A;  3LW9 A;  2HRK A;  5HR0 A;  5L71 A;  3RHC A;  1Z6N A;  3FKF A;  3ZMK A;  2H6Z A;  4AF2 A;  1M9A A;  3WYW A;  3IR4 A;  2CT6 A;  3GKN A;  1XWG A;  2H66 A;  3PPU A;  3CRT A;  4YQM A;  1AQX A;  1EGO A;  4BVY A;  2LTK A;  2LQO A;  1YY7 A;  3CSH A;  2KOK A;  2VL9 A;  3KM6 A;  3GMF A;  3LEF A;  4G0I A;  1TI3 A;  2LRC A;  2WGR A;  4BVX B;  2CX3 A;  3WT1 A;  2R37 A;  1V58 A;  5DVB A;  2PPT A;  2HRA A;  1FHE A;  2EIO A;  2YZU A;  4N0V A;  2FCH A;  4EE0 A;  4EXJ A;  1K0C A;  3DML A;  5D9W A;  5IMZ A;  5COH A;  2O85 A;  3MAK A;  2REM A;  3WGE A;  4HS1 A;  3D4T A;  3ZML A;  1GNE A;  2H0G A;  4PUR A;  3O3T A;  2C1Y A;  3ZIT A;  5ECQ B;  1X5C A;  4N11 A;  2HSM A;  5J4U A;  1UC7 A;  2AAW A;  1SU9 A;  5INY A;  3H79 A;  1I5G A;  1A2M A;  1XIY A;  3IA1 A;  4ICY A;  1Q98 A;  5JWO B;  2X8H A;  1PX7 A;  4DVC A;  1A0R P;  4N0Z A;  3IDV A;  4X1U A;  4I6X A;  5EVO A;  2VLV A;  3UVH A;  3MYD A;  1EGR A;  3V1W A;  4ZL8 A;  1HNC A;  2I4A A;  5ELA A;  1BQ7 A;  1TDI A;  2IFQ A;  4MH2 A;  1ST9 A;  2L59 A;  3DWV A;  3SWL A;  1BG5 A;  5JCU A;  1JFU A;  5D9X A;  5DAK A;  4GST A;  1XW5 A;  4OO4 A;  3F9U A;  4WET A;  5A4W A;  2H1B A;  2YJ7 A;  1TW9 A;  2O87 A;  1OVN A;  4NWY A;  4RQX A;  1A2L A;  3IHQ A;  4TKY A;  3P7X A;  1GSQ A;  3KTL A;  4NHW A;  2YAN A;  1OC3 A;  3D6I A;  4OCE A;  4BL7 A;  2H76 A;  1PL1 A;  2JZS A;  4IJI A;  1R26 A;  2MBS A;  4WBR D;  1NHO A;  3EVI A;  4EIP A;  2MZC A;  1R5A A;  1W89 A;  1DE1 A;  1TRS A;  4TR0 A;  2XBQ A;  1ZMA A;  1JLW A;  2J23 A;  2PU9 C;  2C0E A;  5CAX A;  2LNS A;  4HJM A;  3A2W A;  4HUA A;  2OBI A;  2L5L A;  1TK0 B;  3L0H A;  4MP4 A;  2KUC A;  2GQM A;  3UEM A;  2B6M A;  2AYT A;  2FWG A;  4CW9 A;  1O81 A;  3HVX A;  4N10 A;  5D8I A;  2H74 A;  4ZXG A;  4X43 A;  3RAZ A;  1SJI A;  1HD2 A;  5LNK e;  1V98 A;  1EWX A;  2FNO A;  4J2F A;  5CRG A;  1XPV A;  1PRX A;  1YQ1 A;  4Q5F A;  5HFK A;  2DLX A;  1VRS D;  2LV3 A;  3GUR A;  5AGY A;  3UAP A;  3A2V A;  2IMK A;  2XPE A;  1ZZY A;  6GSX A;  3PR8 A;  1Z5Y E;  5EY6 A;  1SK2 A;  2YPM A;  2M80 A;  2R6K A;  4OMV A;  3L78 A;  4IBP A;  4BVX A;  1OAZ A;  2GT5 A;  2WS2 A;  4TR4 A;  3KTB A;  1EEJ A;  2E7P A;  4WR5 A;  1Q4J A;  1FOH A;  2OE0 A;  5J9B A;  4IJ3 A;  3VK9 A;  2P5R A;  5HQP A;  1BYE A;  3FMW A;  2HRN A;  2ALB A;  3N9J A;  3VWV A;  4Z7X A;  5J5N A;  2A2R A;  2VUP A;  4IEL A;  1GSD A;  2VL2 C;  5GZZ B;  2IMF A;  1PGT A;  2IJY A;  4HI7 A;  4WBJ A;  1JLV A;  3TKS A;  1X5E A;  4FIW A;  2ON5 A;  5IMC A;  1M2D A;  2H6Y A;  5F07 A;  4TXV A;  3DYR A;  1BAY A;  2JSZ A;  1JZR A;  2YWO A;  3A5W A;  3QOU A;  4G0L A;  4I5Q A;  1JZD A;  2IMI A;  3TRX A;  4NHZ A;  7GSS A;  4KDY A;  1SK0 A;  4ISD A;  3I9V 2;  2RLI A;  3NZN A;  2VD1 A;  5ECN B;  20GS A;  4MJE A;  2GSR A;  2VCQ A;  5AIX A;  5F8B A;  4K0N A;  5GAN D;  3GKM A;  1ON4 A;  1OYJ A;  1W4V A;  5ECM B;  2ES7 A;  3EU4 A;  2QA2 A;  4PNF A;  3VWX A;  3EUR A;  2V6O A;  4HU9 A;  2B3S A;  3C71 A;  1PD2 1;  1OE8 A;  5AN1 A;  2MMN A;  2YWN A;  3GL3 A;  2H75 A;  3WGD A;  1THX A;  2LRT A;  4YQU A;  1E6B A;  4PGT A;  3GKK A;  2HXK A;  2OAD A;  4GLT A;  5EPF A;  1UN2 A;  4KDX A;  4RI7 A;  4IP6 A;  4KSM A;  4EKZ A;  3GTU B;  2X8G A;  2ZNM A;  1OKT A;  4HZ2 A;  5CP1 A;  1YZX A;  3ZLP A;  4CY6 A;  1QMV A;  1NM3 A;  5IM9 A;  4QL7 A;  4JZQ A;  4IN0 A;  1YF1 A;  1SD8 A;  3EMX A;  4POL A;  3G9B A;  4TXO A;  5DQS A;  4XTS A;  5J9C A;  1K0N A;  2HNL A;  1USB A;  2RUE A;  3DEX A;  4POM A;  1K3Y A;  4FH8 A;  5IPG A;  3O76 A;  4K2X A;  5G31 A;  2GSS A;  1K0O A;  2DSA A;  1IYI A;  4X0X A;  3GNJ A;  3HJO A;  2HZE B;  1ZYQ B;  4BPY A;  1ZL9 A;  2A2S A;  1V2A A;  3W8J A;  3IE3 A;  3TJJ A;  3Q19 A;  1FO5 A;  1F3B A;  2IN3 A;  1KEB A;  1F2E A;  2DJ3 A;  3HJP A;  1B48 A;  2VCX A;  2IMD A;  2HRF A;  2LJA A;  1FB0 A;  3IPZ A;  5AIS A;  2GQL A;  2QA1 A;  4IW9 A;  3KZQ A;  1HNA A;  3WT2 A;  5CRD A;  1BJX A;  3MSZ A;  1O8W A;  3GSS A;  2GLR A;  4PX1 A;  1Z3E A;  4BWS A;  3EPT A;  1QUW A;  4YQV A;  5G5E A;  2YV9 A;  14GS A;  5F06 A;  4F0B A;  3GN3 A;  2V2G A;  1ILO A;  1LU4 A;  3H1N A;  2O8V B;  3F8U A;  3FZ4 A;  1NW2 A;  3KH7 A;  3P90 A;  1XOA A;  2OE1 A;  4XCS A;  2WZ9 A;  5D93 A;  3QFB C;  2YJH A;  4HZ4 A;  3KMN A;  3D4M A;  1MDK A;  3GST A;  5F05 A;  3KGK A;  4XIH A;  2X64 A;  1O85 A;  5ECO B;  1LJR A;  1XWA A;  4IP1 A;  4E8E A;  1GNW A;  4EIQ A;  3KP8 A;  5ECH B;  4ZB8 A;  3H8Q A;  3UJ1 A;  2BMX A;  4MZW A;  3MWH A;  4K2D A;  2VLU A;  3HVS A;  4IQ1 A;  4MJA A;  2H1A A;  3GYK A;  2B7J A;  2L4Q A;  5A5K A;  4ACS A;  2GTU A;  2DC5 A;  5DDL A;  2JAC A;  2P0G A;  2P5Q A;  1GP1 A;  2KP1 A;  3UOM A;  4PUA A;  2N5A A;  4KB3 A;  3G7Y A;  2MYG A;  5IOW A;  3C8E A;  2GST A;  4CDO A;  3L9U A;  3UBK A;  2E0Q A;  2N5B A;  3CRU A;  5D96 A;  4AGS A;  1ACV A;  1MTC A;  1EV4 A;  1V57 A;  3IK9 A;  3FZA A;  3GTU A;  3TJF A;  3VLN A;  2I81 A;  3IHG A;  5D73 A;  2HSY A;  5A4V A;  1T1V A;  1TP9 A;  1XOB A;  2WRT A;  4Q5Q A;  1ZYE A;  3FHK A;  3APS A;  3TRQ A;  2K8V A;  2E2G A;  3R3E A;  1J0F A;  3CSI A;  2R3X A;  1F9M A;  1SD9 A;  4PUF C;  2R4V A;  4MJC A;  3I69 A;  2C0F A;  2NTO A;  3C73 A;  3LSZ A;  4MNN A;  2YCD A;  2H30 A;  5KN3 A;  5IMD A;  2PMT A;  3IXR A;  2B5Y A;  5HR2 A;  5IIZ A;  5KN2 A;  2B5X A;  4KE3 A;  1EEM A;  4PNG A;  1TOF A;  2B5E A;  3I6A A;  1NHY A;  1U3I A;  5DQY A;  3GX0 A;  3TRP A;  4JU5 A;  4Q5R A;  1GLQ A;  2HT9 A;  2HZE A;  1VF4 A;  5J3R A;  2DJK A;  3C7M A;  3TKQ A;  1MDI A;  2X8C A;  4USS A;  2OE3 A;  4K0G A;  3TOU A;  1AUC A;  3CTG A;  2WJU A;  2E2M A;  4RI6 A;  1S3D A;  4K1F A;  3LG6 A;  5IMA A;  4I8B A;  4K6X A;  3R2Q A;  4FYU A;  12GS A;  4FO5 A;  3LXZ A;  3RBT A;  4BWQ A;  1WWJ A;  1YJ6 A;  2CX4 A;  1QXH A;  5AIV A;  4PTS A;  1ABA A;  5KEJ A;  4DEJ A;  2L5O A;  4Z2R A;  5F0G A;  1S3A A;  4KSO A;  3ERG A;  3GIX A;  3KP9 A;  2H0H A;  2LUS A;  3OR5 A;  2VLT A;  3HDC A;  3D22 A;  3P2A A;  4MJB A;  1XWB A;  1A2J A;  4LMV A;  2F51 A;  2L6C A;  1AW9 A;  3ZTL A;  1GSE A;  2B1K A;  3Q74 A;  5CO3 A;  3HHV A;  1XBS A;  2HYX A;  5KN1 A;  4BA7 A;  5IO2 A;  4V1A g;  3LQ7 A;  2VCV A;  5HFI A;  4ZB6 A;  2GS3 A;  5EL8 A;  4FYB A;  4KND A;  3NOF A;  2AHE A;  4EF0 A;  4GSN A;  5ID2 A;  4OFN A;  1JZO A;  1VF3 A;  1WOU A;  3AY8 A;  4TN8 A;  1ZOF A;  3QAG A;  1GTB A;  2X49 A;  3IC8 A;  1A23 A;  4KCA A;  4F0C A;  2IWT A;  1B9X C;  1ZYP A;  4XS6 A;  2C4J A;  5IMF A;  1GUH A;  2HZF A;  3E3E A;  3UMA A;  1PKW A;  2DJJ A;  4KAE A;  4CY8 A;  16GS A;  3NIV A;  4O7H A;  2R0P A;  22GS A;  2ZUP A;  1YEP A;  4O5Q A;  1UVZ A;  2G0F A;  3TOT A;  1SK1 A;  2TIR A;  2DJ2 A;  2OAC A;  2TRX A;  1O8X A;  1A0F A;  6GSV A;  5GAP D;  1UA5 A;  1PSQ A;  1OKD A;  3APQ A;  2GZY A;  5B8B A;  2B7K A;  2KHP A;  4V2L A;  1YDK A;  3EWL A;  3TKS C;  4G19 A;  3KH9 A;  5A4U A;  2C0G A;  4GWR A;  2PBJ A;  2QKE A;  3APO A;  2RUF A;  4TW5 A;  4YKF A;  5DAL B;  2HLS A;  1TKD B;  5BRT A;  4GCI A;  6GSU A;  4X4J A;  3TJB A;  3CYN A;  4K7I A;  2LEG A;  4LL4 B;  3CTF A;  2YOI A;  1TRW A;  3UVT A;  3FK8 A;  3J7Y b;  1H4O A;  3WD6 A;  2JL4 A;  4MA9 A;  2O89 A;  3A2X A;  2PUK C;  4V2M A;  1SJZ A;  3ZRE A;  4FYC A;  1G0T A;  3F4S A;  1ERU A;  1FOV A;  4EC0 A;  4TR1 B;  1TRV A;  3ZVJ A;  2DKH A;  4ECB A;  3VI5 A;  1G7E A;  4YAP A;  4GF0 A;  2QC7 A;  5IPH A;  3IRA A;  2DMM A;  3TGZ A;  3QD9 A;  3W6G A;  4NV5 A;  2DJ0 A;  2DBC A;  4RQR A;  3MNG A;  2F3M A;  4ECJ A;  2LJK A;  4JR4 A;  3QFA C;  1WE0 A;  4Z2U A;  1KBN A;  5HFG A;  3IBH A;  1PL2 A;  3SBC A;  4MCU A;  1VF2 A;  3QAW A;  2I1U A;  1GRX A;  3HJM A;  1FAA A;  3EIN A;  2H72 A;  3ZL5 A;  1V9W A;  1JZW A;  3TKR A;  1ZYN A;  1Y6E A;  4O32 A;  2CQ9 A;  1A24 A;  4GSS A;  3L9V A;  4L0U A;  4ZIL A;  4EO3 A;  1H75 A;  1T4Y A;  4POB A;  1PA3 A;  3MIX A;  2XHF A;  1EZK A;  3HYP A;  4ZL7 A;  1Z7R A;  2R0G A;  3EMP A;  4L8E A;  5ABR A;  2JSY A;  3FY7 A;  2FY6 A;  4TR3 A;  3ZIJ A;  4OD7 A;  2C3T A;  1WMJ A;  2XPD A;  4KW6 A;  4JRR A;  4MPG A;  3VFI A;  5DJL A;  1SL1 B;  6GSW A;  3GHA A;  3TUE A;  2F9S A;  2TRC P;  1KNG A;  3W8S A;  4I2T A;  4AJ6 A;  5D9V A;  3TKS E;  4YKG A;  4WXT A;  5IQY A;  1U87 A;  3CMI A;  3ME8 A;  1TXX A;  3CSJ A;  3HZ8 A;  3IC4 A;  3QDN A;  4QL9 A;  2DIY A;  5CRW A;  5G5F A;  3FYG A;  5JCW A;  1T00 A;  5DCH A;  5G1L A;  1QK8 A;  2DKI A;  3TJG A;  1XVQ A;  1PQN A;  3G7I A;  4V1A p;  11GS A;  1GTI A;  1XWK A;  3M9J A;  1SEN A;  5ECI B;  2FWF A;  2ON7 A;  1F6M C;  4MAB A;  4YAV A;  5DAL A;  4ZBB A;  1EOH A;  3PIN A;  1SYR A;  1RK4 A;  5D9T A;  2LJR A;  1MDJ A;  1GLP A;  2WB9 A;  3GFK A;  3FEU A;  4GRF A;  5CRE A;  3PGT A;  1TRU A;  1EOG A;  3DIE A;  3BCI A;  3QR6 A;  4EDZ A;  1T8E B;  1DBY A;  2JZT A;  5FHI A;  5ELG A;  2WUL A;  5ECK B;  1U3A A;  2FWH A;  1CQG A;  1ZGN A;  3VUR A;  1B8X A;  2H8L A;  3TDG A;  3FRC A;  4EL1 A;  2BTO T;  4TR1 A;  1MD3 A;  2V1M A;  4WEY A;  1GH2 A;  2VCT A;  1VGL A;  3LGC A;  3MDK A;  1XWC A;  3QAV A;  4P3Y B;  1T3B A;  2FD3 A;  1GUM A;  8GSS A;  2RM6 A;  4MK3 A;  3F0I A;  3LYK A;  3HCZ A;  3F4T A;  4MF6 A;  2M72 A;  5JWQ B;  2C3Q A;  3KIJ A;  2V6K A;  4KH7 A;  1X5D A;  2VD0 A;  4WF5 A;  4RUV A;  2X4A A;  2C8U A;  2RM5 A;  4GTU A;  4XS1 A;  1WP0 A;  4JBB A;  1AC1 A;  2HFD A;  4TOP A;  3RHB A;  1JHB A;  2KP2 A;  1U88 A;  4KF9 A;  4XRD A;  2YV7 A;  3F6F A;  4OFT A;  2FWE A;  3D0Z A;  1E2Y A;  4ECI A;  1Z7P A;  3ZRD A;  2L6D A;  5DJM A;  2M46 A;  4V2N A;  3BBY A;  1TJD A;  3M9K A;  2PWJ A;  3ZZX A;  2B1L A;  4Q5N A;  2AUV A;  3IAS 2;  2XC2 A;  2GZZ A;  3DVX A;  2HI7 A;  4KX4 A;  6GSY A;  1MEK A;  1GSY A;  3CXG A;  2K6V A;  4TVE A;  3ZVJ D;  4F03 A;  2CA8 A;  2F8A A;  1O6J A;  3F63 A;  18GS A;  4POK A;  3S9F A;  3JCM L;  4L5L A;  5KN0 A;  4EDY A;  1XW6 A;  3HXS A;  1FG4 A;  3ME7 A;  1TK8 B;  2KLX A;  3ED3 A;  4NMU A;  4OFM A;  1F3A A;  3ERW A;  5IO0 A;  1TTZ A;  3C1R A;  3UAR A;  2LRN A;  3DD3 A;  1DE2 A;  1A8L A;  2RII A;  4J56 E;  1M2A A;  5G30 A;  4K9Z A;  2MMO A;  2K18 A;  2JZR A;  1SJ6 A;  2EIQ A;  4K5S A;  2O7K A;  3GA4 A;  5B6M A;  2L4C A;  1QGV A;  4LMW A;  3TJK A;  4IS0 A;  4F9Z A;  1X9W B;  1HQO A;  3LWA A;  1FW1 A;  2R0C A;  3GX8 A;  4WF4 A;  5GSS A;  3LJR A;  1FVK A;  2CVB A;  3HD5 A;  2X99 A;  2PGT A;  4MF7 A;  1EP7 A;  3ZFB A;  1SL2 B;  1B4P A;  2FHE A;  1QFN A;  2H0I A;  3WGX A;  1TK5 B;  2N5F A;  2EIR A;  3FR3 A;  5FWG A;  1G6Y A;  2H1G A;  3DXB A;  1MD4 A;  3FZ5 A;  3HVV A;  2GT6 A;  2H19 A;  4OWY A;  1K0D A;  5CRH A;  1I9D A;  2VOC A;  1XW9 A;  4QQ7 A;  1T4Z A;  2FLS A;  2C80 A;  4PQI A;  4HU7 A;  2C3N A;  1N8J A;  3K8N A;  1RW1 A;  4Z2T A;  4HOJ A;  4IKH A;  4KA0 A;  4OO5 A;  4NXI A;  2D2Z A;  4ML1 A;  3E9J B;  1SKR B;  3IOS A;  1M0U A;  2FUG 2;  1SYX A;  4MMM A;  9GSS A;  5LD0 A;  2CVK A;  3FR9 A;  2K8S A;  3Q6O A;  2OBK A;  2AV4 A;  4GQF A;  1DSB A;  3I43 A;  2NVL A;  3GKX A;  3HA9 A;  3KJY A;  1AAZ A;  5JCG A;  3Q18 A;  2QSI A;  1OC8 A;  4H86 A;  5ECS A;  5JWR B;  2NBS A;  6GST A;  2A4V A;  5E4W A;  3DRN A;  2V41 A;  3F4R A;  4OCF A;  1G7O A;  2MMZ A;  3O6T A;  2QGV A;  1T7P B;  2LST A;  4ZIJ A;  3LOR A;  2F8F A;  4DSS B;  3VWU A;  4L0W A;  4XS4 B;  1Z9H A;  3DKS A;  3M0F A;  3GRX A;  2ZCT A;  1R7H A;  2CVD A;  4D73 B;  2I9H A;  2VAF A;  3DVW A;  3GH9 A;  4O92 A;  4LL1 B;  4YH2 A;  1V40 A;  3QCP A;  4ZL9 A;  4NV2 A;  4DSR A;  2DIZ A;  1BED A;  4HQZ A;  2FA4 A;  2OJL A;  1GL8 A;  2JAD A;  2WDU A;  4MF5 A;  4LLR A;  2CZ2 A;  2VCZ A;  3M3M A;  2EC4 A;  2H1D A;  2A4H A;  3QMX A;  5FT3 A;  4TXO B;  4ZB9 A;  3QPM A;  1R4W A;  2UZ8 A;  1S3C A;  1HNB A;  2OKA A;  4I97 A;  3TB2 A;  3DGQ A;  4PQ1 A;  4CHS A;  4ECC A;  1X9S B;  3EC3 A;  3GL5 A;  4K5R A;  3J7Y k;  5H5S A;  1EP8 A;  4L5O A;  1M2B A;  1AQW A;  2LNT A;  1OE7 A;  1K0M A;  4LA1 A;  1YKC A;  1X9M B;  4O5U A;  3F6D A;  3IV4 A;  4K7N A;  1TU8 A;  1C72 A;  5B7C A;  4JE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...