4ZIJA

Crystal structure of e.coli dsba in complex with 2-(4-iodophenylsulfonamido) benzoic acid
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
188
structure length
188
Chain Sequence
b'AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Determination of ligand binding modes in weak protein-ligand complexes using sparse NMR data.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 65
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zijA00
2H19A 2LQQA 3VWVA 1USBA 2O85A 2PVOC 5GAND 2YV9A 5KN2A 2B7JA 1Z6MA 5D9XA 1LU4A 3FR3A 2VM1A 1R5AA 5HFGA 1ZOFA 2F3MA 4LMWA 1LBKA 1ABAA 4L0UA 5HR2A 3QR6A 2P5QA 4CHSA 3ZVJA 4TXOB 5J9CA 4HEA2 3TOUA 22GSA 2K8VA 2I4AA 3NZNA 4PNFA 3GTUB 4DSSB 5F07A 2IIYA 2WDUA 1E6BA 3KXOA 2NDOA 1GSDA 1PMTA 2V32A 1M9AA 4J2FA 1ZYQB 1AQXA 19GSA 1X9MB 4ZBDA 2VL9A 5G31A 1H75A 2LRTA 1SKRB 1XXUA 4XHMA 3UVHA 1QXHA 4XCSA 1OE8A 2CV4A 1HNAA 2CAQA 4ZL7A 1AC1A 5ECIB 4POLA 4KE3A 5DALA 1Z5YE 4MP4A 2HFDA 3MSZA 2IFQB 1YEPA 5IMAA 5DVBA 1SJZA 2DJJA 2GDRA 2O7KA 1EOHA 4KNDA 4N0VA 4NMUA 1WPIA 3DYRA 1M2BA 3F9UA 5LNKe 2AUVA 1Z6NA 1WIKA 3H93A 1ERTA 1HYUA 4FYBA 1YKCA 3GRXA 4IKHA 3LQ7A 4GQFA 1X9WB 2MYGA 2R5GA 4JZQA 1SKWB 2JACA 2KLXA 4KSOA 1WJKA 2OBIA 1VF3A 4EL1A 1TOFA 5GAPD 2LUSA 1MTCA 1OYJA 1ML6A 2IPAA 3DVXA 1EGRA 1A0RP 3D4MA 4MZWA 4N0ZA 3GH6A 4K0NA 3CSHA 3P2AA 4EUYA 3WT1A 4HJ2A 2H71A 2V2GA 3HXSA 5COHA 1F2EA 4BWQA 5C04A 4JR6A 3ERGA 2KOKA 2WULA 2HNLA 4ISDA 5EVOA 3BBYA 3U5RE 3UIWA 4WBJA 3FKFA 5IIZA 1MDJA 1UC7A 1UN2A 3D22A 1JZRA 2MZCA 2AJQB 3F6FA 2WB9A 1FAAA 3R2QA 4TR4A 4WR5A 2DJ1A 4BWSA 1J9BA 2PVQA 4K9ZA 1Q4JA 3HVXA 4PUAA 1ZCPA 2DJ2A 2B1LA 1CQGA 3DVWA 1S3CA 4GRFA 2IJYA 3F0IA 1ON4A 3TJJA 4EO3A 2OBKA 4TR1A 14GSA 4TKYA 4O92A 3D21A 2I81A 2DBCA 2V6OA 4ACSA 3IC4A 6GSSA 4K2DA 1EEMA 3G7IA 3CTFA 1TK8B 3KMOA 2H30A 4GSTA 3HVVA 1O7UA 3L78A 5J41A 1Y25A 3DD3A 2FNOA 3VLNA 2GQMA 1F6MC 1G0TA 3C1SA 5CNWA 2JADA 3QFBC 3EC3A 3HHVA 3J7Yk 3C8EA 4V2LA 4FYCA 1GSFA 5G2ZA 1FO5A 1ST9A 1U3IA 2RM5A 2JZTA 2LJKA 1TRSA 2AAWA 3L9VA 1ZMAA 5JWQB 3RAZA 3N9JA 3HD5A 4DSRA 2E2GA 4OO4A 5A4UA 4WEYA 3PINA 3RHBA 5IMCA 4PQIA 4OO5A 1XWAA 3CSIA 1V9WA 2GSSA 4PURA 4EDYA 3TJGA 2DMLA 1VGLA 2JSZA 2O8VB 1K0DA 2VL2C 2AB6A 3V1WA 1OC9A 1JHBA 3UARA 1THOA 2IMFA 2BJXA 1JZOA 1K0AA 3RPPA 2VCWA 4HJMA 3PGTA 3HCZA 2WRTA 1VRSD 1KBNA 17GSA 1TU8A 3GX0A 1TI1A 1F3BA 1TI3A 3IE3A 1GWCA 3APSA 1SK0A 1T00A 3EU3A 3WT2A 1KTEA 3F63A 4N11A 1GLPA 3F6DA 1ACVA 1Z3EA 2GT6A 4MF7A 3I6AA 2CZ2A 5D9TA 2OJLA 4IJ3A 2HSYA 4PXOA 4I5QA 2HYXA 1GNEA 1FW1A 3EVIA 5G1KA 2HZEB 1GL8A 1PA3A 5IO0A 3DXBA 1PL2A 4PGTA 3ZMKA 4ID0A 2OE0A 2C0DA 4G19A 2ON5A 4HZ4A 6GSWA 1B9YC 4RUVA 5D9WA 4K7IA 2MMNA 3UAPA 5CRGA 3TGZA 3ZFLA 4EVMA 4ZL8A 18GSA 3LORA 3FZ9A 1SD8A 2H76A 2H1AA 1ZZYA 1A24A 4V2NA 1U6TA 2H75A 1WP0A 3D0ZA 4MDCA 1NM3A 1O81A 3HKRA 3NIVA 2KP2A 2C0FA 4ECIA 5GSSA 3HDCA 2OACA 2P5RA 1K3YA 1U88A 4EC0A 4Q5NA 4RQXA 1XW5A 3PR8A 5F06A 1F3AA 1X9SB 3IR4A 2GSQA 3FHKA 3ERWA 1TTZA 1KEBA 2K8SA 4XS6A 1UVZA 5ECLB 2BMXA 3G7JA 3C73A 1HNBA 1A2MA 3GH9A 2VLUA 3APQA 3QAWA 1A2LA 3BJ5A 4IJIA 2L59A 1FVJA 2F8FA 2KP1A 3ZRDA 5IOXA 1MD3A 3UVTA 3O3TA 4OCEA 5EY6A 1H4OA 3TKQA 2FCHA 5CP1A 3VI5A 3EU4A 5DDLA 2H1GA 2PMTA 2VIMA 1QGVA 3TJBA 3GSSA 3GMFA 11GSA 4BL7A 2LSTA 2LV3A 1XWBA 3LYPA 1C72A 1I5GA 5CREA 2O87A 3KIJA 4MABA 3AY8A 2X99A 3ZFBA 4FO5A 1G7EA 1TKDB 4BA7A 4F82A 4POBA 2YZUA 3A5WA 2V1MA 4IGJA 5L71A 2HZFA 1WRYA 1VF2A 2PUKC 3MDKA 4QL9A 4I8BA 3FW2A 2H66A 4JRRA 5JCGA 3BOAA 3GX8A 1OC3A 3TDGA 4NPBA 1Z7RA 2B5XA 1GSYA 3GFKA 4F2IA 1Z7PA 1R5PA 5J3RA 2F9SA 3GKXA 2H6ZA 3CSJA 5G5EA 1PD21 4MPGA 1OE7A 1HQOA 1GUMA 4KCEA 5CAXA 5ECHB 5D8IA 4KGIA 3K8NA 4Z7XA 1O85A 4XS4B 3RDWA 4J57E 5IM9A 2V41A 1O73A 5G30A 1NHYA 1SK1A 2FHEA 5IO2A 1T3BA 4HZ2A 2PBJA 5DBQA 4BVXA 5HR3A 5ELAA 2R6KA 2DLXA 2XBQA 4MK3A 4I2TA 1GSSA 3FYGA 4KX4A 1SL0B 4TR0A 2PWJA 1DUGA 1QK8A 5EPFA 2M72A 2OE1A 1GNWA 3GKMA 3HZ4A 4JEDA 1V40A 1B4PA 1JLWA 4F9ZA 4ZL9A 4RI7A 4MZCA 5J5NA 1AIUA 4KSMA 1GULA 2H70A 4GF0A 3M9JA 4IELA 3RBTA 3F8UA 4LL4B 1BJXA 3QPMA 6GSUA 5IMZA 2REMA 2GSTA 4KA0A 2DJ0A 2F51A 5JWOB 1GRXA 1JZWA 4IHUA 3EE2A 1GUKA 2BTOT 4ILFA 1LJRA 3TRQA 3IBHA 2XPEA 4WXTA 2L5LA 5AN1A 1S3AA 2H0GA 2L6DA 3F4RA 4GLTA 2RLIA 3GYKA 1PQNA 4HQSA 4G2EA 1X5CA 2HE3A 5DAKA 2WFCA 2GGTA 3DMLA 2YOIA 3HZ8A 4IVFA 2H8LA 1XVQA 4IS0A 16GSA 3QOUA 3FY7A 2ON7A 2C1YA 3US3A 2HT9A 4K6XA 1SL2B 1TDIA 2GZZA 1R4WA 4F0BA 3M8NA 5KN0A 1A2JA 3A2XA 2TIRA 3TUEA 2GQKA 1CQHA 3TRXA 2PERA 3C71A 3G9BA 3GA4A 1NHOA 2R3XA 4DSQA 1GUHA 4ZB9A 1PRXA 3DKSA 2PPTA 3ZVJD 2NVLA 1YF0A 2XPDA 4LMVA 2B6MA 1XVWA 8GSSA 4KH7A 4ZILA 3TOTA 1XWGA 3KJYA 3TKSE 4F0CA 3KD0A 1YKAA 1E2YA 3JCML 5AIXA 1SENA 2LS5A 2FLSA 4IP6A 4ZBBA 3M3MA 3Q19A 1TK5B 1XWCA 5DJMA 2VLVA 2L57A 3APOA 1ERUA 5HFKA 2OE3A 1PL1A 2Z9SA 3ED3A 2AV4A 2YCDA 5DJLA 4WETA 2V6KA 5KN1A 4L5LA 3ZYWA 4PX1A 2WCIA 5ECOB 3GL3A 1EWXA 5INYA 4IQ1A 3H1NA 4GWRA 1K0BA 1XW6A 3LXTA 5JCUA 4OFNA 2A2SA 3HJPA 5ECNB 4ZBAA 4MLYA 1BEDA 1B9XC 1G6YA 4LA1A 5J4UA 4D73A 4OFTA 2VCTA 4ECCA 2CX4A 2GLRA 4TVEA 5ECQB 2YJ7A 3HVSA 4KAEA 3ZREA 2LKUA 4NAXA 3TKPA 1MEKA 2XHFA 3M1GA 1G6WA 3LG6A 1J08A 1TW9A 3G7YA 4XRDA 3F4SA 1GTBA 4MF5A 2KUCA 2L5OA 1JZDA 3P7XA 2CZ3A 1WWJA 1TJDA 1T1VA 1WMJA 1PN9A 3WGXA 4NHWA 4ECBA 2FGXA 1Z9HA 4MF6A 3KEBA 2WGRA 5DALB 3CRUA 3FZAA 5JCWA 2G0FA 3GURA 1X0RA 3UBKA 5FHIA 3VFIA 3ME7A 1V57A 1V58A 4E8EA 3E0UA 4IQAA 5A4VA 2VL3A 2VCZA 3QAGA 1YJ6A 5CYYA 4TXOA 1PKZA 4K7NA 5B8BA 2DC5A 5IPHA 3A2WA 2CQ9A 1QMVA 3GTUA 3EWLA 1K0CA 2X8CA 3D6IA 2PU9C 4Q5QA 3HA9A 4QL7A 1TP9A 4MH3A 2YANA 1MDIA 4MMMA 4HOJA 1QFNA 3GHAA 4LL1B 1IYHA 4POKA 4TR3A 4KUNA 2R37A 1W4VA 1AAZA 1U3AA 2MMAA 2VL2A 3FR9A 2OADA 2NBSA 5ENUA 5AIVA 4DEJA 5ECKB 1OVNA 4MCUA 4FYUA 3I69A 1YY7A 3IRAA 1J0FA 2VCQA 4GSNA 1KNGA 3VWWA 1GSUA 5DAKB 2LQOA 2VCVA 3BCKA 4PQHA 3MAKA 2CVBA 4K0GA 3E9JB 2P0GA 2FA4A 4BPYA 3FZ5A 5IMDA 2IMIA 3QDNA 4X43A 2PN8A 4ULXA 2JSYA 4XRAA 3LYKA 2LTKA 6GSVA 4MJEA 6GSXA 2YWMA 3D5JA 2L6CA 3UL3A 1FHEA 4AJ8A 4F03A 2VLTA 4X1UA 3DEXA 4LLRA 3UBLA 1K3LA 3ME8A 2H74A 2AYTA 2DJ3A 1PSQA 3CBUA 4EKZA 1GTUA 2LRCA 1TRUA 2RIIA 1WOUA 2FUG2 2A2RA 5DQYA 2C8UA 2CT6A 1ZGNA 2IMDA 2JZRA 5CRDA 1XWKA 2VD1A 2LJAA 3UMAA 3TKSA 3GKNA 3QFAC 5DCHA 13GSA 2JU5A 1GTAA 4JU5A 5CO3A 1TRWA 3A2VA 1M0UA 2VO4A 3HY2A 2FA8A 4TR1B 3F4TA 4YH2A 3TJKA 2H01A 1RQMA 3ZIVA 1XIYA 2H73A 2WS2A 1OKDA 4ML1A 4ZIJA 4GTUA 5IPGA 3ZLPA 2FWGA 4TRXA 3L4NA 2GTUA 4E8HA 2HI7A 2EIOA 1JLVA 3ZL5A 2DSAA 3RPNA 2VAFA 1SJIA 4WF4A 5IOWA 4K7OA 3HYPA 4IW9A 1XW9A 2GT5A 4ZXGA 1ILOA 5J9BA 4G10A 1XZOA 3IK9A 1EZKA 4WKWA 3A3TA 4PQ1A 3EMPA 2HRNA 4NHZA 5F05A 5HR0A 3H8QA 3IDVA 9GSSA 4OFMA 4WR4A 4Q5RA 4NXIA 3ZTLA 1DE2A 1M99A 1M2DA 3BCIA 5D93A 2MMOA 1EV9A 2B5EA 4K1FA 1BAYA 2E7PA 1YDKA 2DJKA 2YWIA 4QQ7A 3KH9A 1A23A 2XBIA 4L8EA 1OC9B 4JBBA 3TJFA 4KW6A 3KTLA 2MBSA 4N30A 2FD3A 3LFLA 4KDUA 2TRCP 1A0FA 5IQYA 3Q18A 1BG5A 2HSHA 1A8LA 5B6NA 5H5RA 2NTOA 1QQ2A 2DIZA 3W8SA 1SKSB 2QC7A 2CX3A 3LSZA 1B48A 1URMA 1O8XA 5ECSA 3H4KA 1ZYEA 2B5YA 4X0XA 2OA7A 4HU7A 3ZMLA 5AISA 4MPFA 5ELGA 2I3YA 3RHCA 5HQPA 3QD9A 1K3OA 2GSRA 3FEUA 3EYTA 1HD2A 5ECRB 3IAM2 5HFIA 4YAVA 2I1UA 2C3TA 2ZUPA 1SU9A 4OMVA 2KHPA 2IN3A 1EOGA 2B1KA 2E0QA 4FH8A 4EE0A 2J9HA 3N5OA 2QGVA 3WD6A 3GIXA 3GL5A 3KGKA 4OD7A 2H6XA 3H79A 4GSSA 3M9KA 2GVPA 3TRPA 2JZSA 3KP9A 1FG4A 2J23A 4MZBA 3GN3A 1W89A 2WZ9A 4MJBA 1XOAA 3Q74A 2M80A 3UEMA 1EP8A 4PNGA 4TOPA 4NV2A 4WF5A 5H5SA 1MD4A 3KH7A 4P3YB 5IMFA 1N2AA 4CDOA 3IPZA 3GSTA 4K8MA 1AXDA 3FRCA 4V2MA 1BYEA 4PUFC 2CA8A 3IOSA 3E3EA 1OAZA 4O7HA 3CRTA 5CRWA 1GH2A 2HZEA 2ZCTA 2JL4A 1PX7A 4I6XA 12GSA 2C3QA 3EINA 3LWAA 5HR1A 1T7PB 1ERVA 1NW2A 2F8AA 1BQ7A 2YPMA 5CRHA 4XTSA 2IL3A 2H0HA 3GV1A 3LJRA 1XOBA 4OCFA 5ABRA 1T8EB 5EL8A 3FZ4A 4IBPA 5LD0A 4GQCA 2LRNA 1FOVA 3L9SA 4XS1A 2DMMA 4MJCA 2RUFA 2VCXA 1EP7A 3VPTA 2H1BA 4Q5FA 1YEXA 2LNTA 2H1DA 1AW9A 5B8AA 1B4QA 4IN0A 10GSA 1EEJA 2TRXA 1DSBA 1OC8A 4L5OA 4HUAA 2AHEA 1M2AA 1K0OA 2VUPA 4OWYA 3IK7A 1DBYA 1SYXA 3O76A 1T4YA 2VM2A 3CMIA 3TKRA 3QMXA 2LNSA 5D9VA 1JFUA 1FVKA 2EIRA 4AJ6A 1K0NA 3GKKA 3ERFA 4EF0A 3VI7A 1PX6A 5F0GA 2IMKA 3F3QA 4FIWA 1XFLA 3KM6A 5KEJA 5A4WA 1O8WA 3LXZA 3OR5A 1PKWA 3IHQA 2OKAA 1HNCA 2ES7A 1F37A 3VPQA 2GZYA 1SK2A 4TXVA 2K18A 2YP6A 2YZHA 4J56E 4RI6A 5D73A 2O89A 2N5FA 2YV7A 4L0WA 4O5RA 2YWNA 1R26A 2P31A 3CYNA 5E59A 3D4TA 3C7MA 3ZITA 3DIEA 2FWEA 4EXJA 4POMA 1Y6EA 4KB3A 4HU9A 2C0EA 3CTGA 1YQ1A 5ID2A 3BD2A 1T4ZA 2QSIA 3FR6A 3I9V2 2EIQA 2C80A 4HS1A 1M9BA 2MMZA 5KN3A 2HXKA 4ML6A 2CVKA 3ISOA 1A8YA 1EV4A 4RQRA 1TK0B 3GNJA 2C4JA 3I43A 5D96A 3NOFA 1FB0A 1FB6A 5F8BA 1TU7A 2E2MA 4KCAA 5E4WA 4CW9A 7GSSA 5ECMB 2A4VA 5H5QA 3SBCA 1X5EA 1MDKA 2IMEA 2WJUA 6GSTA 3ZZXA 3W8JA 1GTIA 3S9FA 5B7CA 2K6VA 2PGTA 4GCIA 2VOCA 3O6TA 1ERWA 3KP8A 1O6JA 1PGTA 4AF2A 3PH9A 4DSSA 3DWVA 1VF4A 2D2ZA 3LGCA 4AGSA 4XS4A 4YQVA 3VWXA 4HI7A 3QAVA 4MA9A 1SD9A 3P8WA 2FWFA 3WYWA 1S3DA 1AQVA 4YQUA 5A5KA 1AQWA 4ECJA 1GP1A 2LJRA 6GSYA 3SWLA 1V98A 2LEGA 2H0IA 4NV5A 4G9HA 4H86A 1OKTA 2N5AA 2QKEA 3VWUA 2C3NA 2R2JA 1V2AA 4EDZA 1Q98A 3IAS2 3UJ1A 2L4QA 2FWHA 1TXXA 4YAPA 3IXRA 3EMXA 5FWGA 3U6VA 3FK8A 3IV4A 3EURA 5GSTA 1THXA 4V1Ap 2N5BA 5DQSA 1NSWA 3P90A 4KDXA 4N10A 1SJ6A 2IFQA 3F3RA 1ZL9A 1UA5A 2X8HA 1BX9A 1EGOA 2RM6A 1XCCA 3MNGA 3GUSA 3UOMA 1B8XA 1DE1A 3HJMA 3L0HA 2ZNMA 4HQZA 2YNXA 4V1Ag 2EC4A 1SYRA 3LEFA 3VURA 3KTBA 2HLSA 2X8GA 1GSEA 3TKSC 2H6YA 2MBTA 2ALBA 3MWHA 5DCGA 1VF1A 4WBRD 4JR4A 2HRFA 1X5DA 1TRVA 2X64A 2C0GA 4O32A 5C00A 1K0MA 2R4VA 3IA1A 5FT3A 1SL1B 1M7TA 3DRNA 4I2UA 1F9MA 3J7Yb 20GSA 4I97A 4ZB6A 2K9FA 2GZPA 5B6MA 2M46A 3KMNA 2YWOA 1YF1A 1R7HA 1XBSA 4YQMA 4TW5A 3L9UA 3KZQA 2GS3A 3Q6OA 1RW1A 2FY6A 3VK9A 4IP1A 4ZB8A 4BVYA 2VD0A 3TB2A 3C1RA 5ECPB 4TN8A 4AJ7A 2G2QA 1GLQA 1U87A 4GXZA 1XPVA 2B3SA 2H72A 2NPBA 4HDEA 1RK4A 3DGQA 1I9DA 1YZXA 2GQLA 5G1LA 5JWRB 2YN1A 4XIHA 3M0FA 1G7OA 1AUCA 1N8JA 4MJAA 3ZIJA 4MH2A 4D73B 5IMVA 3KCMA 4KDYA 2IWTA 2YJHA 4JE1A 2I9HA 2DIYA 3WGDA 3CXGA 3QCPA 3HJOA 4NWYA 5G5FA 2RUEA 5AGYA 2XC2A 5ID2B 1IYIA 1GSQA 2L4CA 5LCZA 2CVDA 3W6GA 2CAIA 1WE0A 4DVCA 2B7KA 1QUWA 5GZZB 3TCOA 3WGEA
chains in the Genus database with same CATH superfamily
2H19A 2LQQA 3VWVA 1USBA 2A4HA 2O85A 2PVOC 5GAND 2YV9A 5KN2A 2B7JA 1Z6MA 5D9XA 1LU4A 3FR3A 2VM1A 1R5AA 5HFGA 1ZOFA 2F3MA 4LMWA 1LBKA 1ABAA 4L0UA 5HR2A 3QR6A 2P5QA 4CHSA 3ZVJA 4TXOB 5J9CA 4HEA2 3TOUA 22GSA 2K8VA 2I4AA 3NZNA 4PNFA 3GTUB 4DSSB 5F07A 2IIYA 2WDUA 1E6BA 3KXOA 2NDOA 1GSDA 1PMTA 2V32A 1M9AA 4J2FA 1ZYQB 1AQXA 19GSA 1X9MB 4ZBDA 2VL9A 5G31A 1H75A 2LRTA 1SKRB 1XXUA 4XHMA 3UVHA 1QXHA 4XCSA 1OE8A 3FMWA 2CV4A 1HNAA 2CAQA 4ZL7A 5KOWA 1AC1A 5ECIB 4POLA 4KE3A 5DALA 1Z5YE 4MP4A 2HFDA 3MSZA 2IFQB 1YEPA 5IMAA 5DVBA 1SJZA 2DJJA 2GDRA 2O7KA 1EOHA 4KNDA 4N0VA 4NMUA 1WPIA 3DYRA 1M2BA 3F9UA 5LNKe 2AUVA 1Z6NA 4K2XA 1WIKA 3H93A 4PTSA 1ERTA 1HYUA 4FYBA 1YKCA 3GRXA 4IKHA 3LQ7A 4GQFA 1X9WB 2MYGA 2R5GA 4JZQA 1SKWB 2JACA 2KLXA 4KSOA 1WJKA 2OBIA 1VF3A 4EL1A 1TOFA 5GAPD 2LUSA 1MTCA 1OYJA 1ML6A 2IPAA 3DVXA 1EGRA 1A0RP 3D4MA 4MZWA 4N0ZA 3GH6A 4K0NA 3CSHA 3P2AA 4EUYA 2DKIA 3WT1A 4HJ2A 2H71A 2V2GA 3HXSA 5COHA 1F2EA 4BWQA 5C04A 4JR6A 3ERGA 4USSA 2KOKA 2WULA 2HNLA 4ISDA 5EVOA 3BBYA 3U5RE 3UIWA 4WBJA 3FKFA 5IIZA 4ICYA 1MDJA 1UC7A 1UN2A 3D22A 1JZRA 2MZCA 2AJQB 3F6FA 2WB9A 1FAAA 3R2QA 4TR4A 4WR5A 2DJ1A 4BWSA 1J9BA 2PVQA 4K9ZA 1Q4JA 3HVXA 4PUAA 1ZCPA 2DJ2A 2B1LA 1CQGA 3DVWA 1S3CA 4GRFA 2IJYA 3F0IA 1ON4A 3TJJA 4EO3A 2OBKA 4TR1A 14GSA 4TKYA 4O92A 3D21A 2I81A 2DBCA 2V6OA 4ACSA 3IC4A 6GSSA 4K2DA 1EEMA 3G7IA 3CTFA 1TK8B 3KMOA 2H30A 2HSMA 4GSTA 3HVVA 1O7UA 3L78A 5J41A 1Y25A 3DD3A 2FNOA 2DKHA 3VLNA 2GQMA 1F6MC 1G0TA 3C1SA 5CNWA 2JADA 3QFBC 3EC3A 3HHVA 3J7Yk 3C8EA 4V2LA 4FYCA 1GSFA 5G2ZA 1FO5A 3A5IA 1ST9A 1U3IA 3IC8A 2RM5A 2JZTA 2LJKA 1TRSA 2AAWA 3L9VA 1ZMAA 5JWQB 3RAZA 3N9JA 3HD5A 4DSRA 2E2GA 4OO4A 5A4UA 4WEYA 3PINA 3RHBA 5IMCA 4PQIA 4OO5A 5BRTA 1XWAA 3CSIA 1V9WA 2GSSA 4PURA 4EDYA 3TJGA 2DMLA 1VGLA 2JSZA 2O8VB 1K0DA 2VL2C 2AB6A 3V1WA 1OC9A 1JHBA 3UARA 1THOA 2IMFA 2BJXA 1JZOA 1K0AA 3RPPA 2VCWA 4HJMA 3PGTA 3HCZA 2WRTA 1VRSD 1KBNA 17GSA 1ZYPA 1TU8A 3GX0A 1TI1A 1F3BA 1TI3A 3IE3A 1GWCA 3APSA 1SK0A 1T00A 3EU3A 3WT2A 1KTEA 3F63A 4N11A 1GLPA 4MNNA 3F6DA 1ACVA 1Z3EA 2GT6A 4MF7A 3I6AA 2CZ2A 5D9TA 2OJLA 4IJ3A 2HSYA 4PXOA 4I5QA 2HYXA 1GNEA 1FW1A 3EVIA 5G1KA 2HZEB 1GL8A 1PA3A 5IO0A 3DXBA 1PL2A 4PGTA 3ZMKA 4ID0A 2OE0A 2C0DA 4G19A 2ON5A 4HZ4A 6GSWA 1B9YC 4RUVA 5D9WA 4K7IA 2MMNA 3UAPA 5CRGA 3TGZA 3ZFLA 4EVMA 4ZL8A 18GSA 3EPTA 3LORA 3FZ9A 1SD8A 2H76A 2H1AA 1ZZYA 1A24A 4V2NA 1U6TA 2H75A 1WP0A 3D0ZA 4MDCA 1NM3A 1O81A 3HKRA 3NIVA 2X4AA 2KP2A 2C0FA 4ECIA 5GSSA 3HDCA 2OACA 2P5RA 1K3YA 1U88A 4EC0A 4Q5NA 4RQXA 1XW5A 3PR8A 5F06A 1F3AA 1X9SB 3IR4A 2GSQA 3FHKA 3LW9A 3ERWA 1TTZA 1KEBA 2K8SA 4XS6A 1UVZA 5ECLB 2BMXA 3G7JA 3C73A 1HNBA 1A2MA 3GH9A 2VLUA 3APQA 3QAWA 1A2LA 3BJ5A 4IJIA 2L59A 1FVJA 4EIPA 2F8FA 2KP1A 4CY6A 3ZRDA 5IOXA 1MD3A 3UVTA 3O3TA 4OCEA 5EY6A 1H4OA 3TKQA 2FCHA 5CP1A 3VI5A 3EU4A 5DDLA 2H1GA 2PMTA 2VIMA 1QGVA 3TJBA 3GSSA 3GMFA 11GSA 4BL7A 2LSTA 2LV3A 1XWBA 3LYPA 1C72A 1I5GA 5CREA 2O87A 3KIJA 4MABA 3AY8A 2X99A 3ZFBA 4FO5A 1G7EA 1TKDB 4BA7A 4F82A 4POBA 2YZUA 3A5WA 2V1MA 4IGJA 5L71A 2HZFA 1WRYA 1VF2A 2PUKC 3MDKA 4QL9A 2HRKA 4I8BA 3FW2A 2H66A 4JRRA 5JCGA 3BOAA 3GX8A 1OC3A 3TDGA 4NPBA 1Z7RA 2B5XA 1GSYA 3GFKA 4F2IA 1Z7PA 1R5PA 5J3RA 2F9SA 3GKXA 2H6ZA 3CSJA 5G5EA 1PD21 4MPGA 1OE7A 1HQOA 1GUMA 4KCEA 5CAXA 5ECHB 5D8IA 4KGIA 3K8NA 4Z7XA 1O85A 4XS4B 3RDWA 4J57E 5IM9A 2V41A 1O73A 2R0GA 5G30A 1NHYA 1SK1A 2FHEA 5IO2A 1T3BA 4HZ2A 2PBJA 5DBQA 4BVXA 1FOHA 5HR3A 5ELAA 2R6KA 2DLXA 2XBQA 4MK3A 4I2TA 2R0CA 1GSSA 3FYGA 4KX4A 1SL0B 4TR0A 2PWJA 1DUGA 1QK8A 5EPFA 2M72A 2OE1A 1GNWA 3GKMA 3HZ4A 4JEDA 1V40A 1B4PA 4X4JA 1JLWA 4F9ZA 4ZL9A 4RI7A 4MZCA 5J5NA 1AIUA 4KSMA 1GULA 2H70A 4GF0A 3M9JA 4IELA 3RBTA 3F8UA 4LL4B 1PFOA 1BJXA 3QPMA 6GSUA 2R0PA 5IMZA 2REMA 2GSTA 4KA0A 2DJ0A 4Z2UA 2F51A 5JWOB 1GRXA 1JZWA 4IHUA 3EE2A 1GUKA 2BTOT 4ILFA 1LJRA 3TRQA 3IBHA 2XPEA 4WXTA 2L5LA 5AN1A 1S3AA 2H0GA 2L6DA 3F4RA 4GLTA 2RLIA 2X49A 3GYKA 1PQNA 4HQSA 4G2EA 1X5CA 2HE3A 5DAKA 2WFCA 2GGTA 3DMLA 2YOIA 3HZ8A 4IVFA 2H8LA 4A5PA 1XVQA 4IS0A 4BVYB 16GSA 3QOUA 3FY7A 2ON7A 2C1YA 3US3A 2HT9A 4K6XA 1SL2B 1TDIA 2GZZA 1R4WA 4F0BA 3M8NA 5KN0A 1A2JA 3A2XA 2TIRA 3TUEA 2GQKA 1CQHA 3TRXA 2PERA 3C71A 3G9BA 3GA4A 1NHOA 2R3XA 4DSQA 1GUHA 4ZB9A 1PRXA 3DKSA 2PPTA 3ZVJD 2NVLA 1YF0A 2XPDA 4LMVA 2B6MA 1XVWA 8GSSA 4KH7A 4ZILA 3TOTA 1XWGA 3KJYA 3TKSE 4G0LA 4F0CA 3KD0A 1YKAA 1E2YA 3JCML 5AIXA 1SENA 2LS5A 2FLSA 4IP6A 4ZBBA 3M3MA 3Q19A 1TK5B 1XWCA 5DJMA 2VLVA 3PPUA 2L57A 3APOA 1ERUA 5HFKA 2OE3A 1PL1A 2Z9SA 3ED3A 2AV4A 2YCDA 5DJLA 4WETA 2V6KA 5KN1A 4L5LA 3ZYWA 4PX1A 2WCIA 5ECOB 3GL3A 1EWXA 3CQFA 5INYA 4IQ1A 3H1NA 4GWRA 1K0BA 1XW6A 3LXTA 5JCUA 4OFNA 2A2SA 3HJPA 5ECNB 4ZBAA 4MLYA 1BEDA 1B9XC 1G6YA 4LA1A 5J4UA 4D73A 4OFTA 2VCTA 4ECCA 2CX4A 2GLRA 4TVEA 5ECQB 2YJ7A 3HVSA 4KAEA 3ZREA 2LKUA 4NAXA 3TKPA 1MEKA 2XHFA 2QA2A 3M1GA 1G6WA 3LG6A 1J08A 1TW9A 3G7YA 4XRDA 3F4SA 1GTBA 4MF5A 2KUCA 2L5OA 1JZDA 3P7XA 3MIXA 2CZ3A 1WWJA 1TJDA 1T1VA 1ZYNA 1WMJA 1PN9A 3WGXA 4NHWA 4ECBA 2FGXA 1Z9HA 4MF6A 3KEBA 2WGRA 5DALB 3CRUA 3FZAA 5JCWA 2G0FA 3GURA 1X0RA 3UBKA 5FHIA 3VFIA 3ME7A 1V57A 1V58A 4E8EA 3E0UA 4IQAA 5A4VA 2VL3A 2VCZA 3QAGA 1YJ6A 5CYYA 4TXOA 1PKZA 4K7NA 5B8BA 2DC5A 5IPHA 3A2WA 2CQ9A 1QMVA 3GTUA 3EWLA 1K0CA 2X8CA 3D6IA 2PU9C 4Q5QA 3HA9A 4QL7A 1TP9A 4MH3A 2YANA 1MDIA 4MMMA 4HOJA 1QFNA 3GHAA 4LL1B 1IYHA 4POKA 4TR3A 4KUNA 2R37A 1W4VA 1AAZA 1U3AA 2MMAA 2VL2A 3FR9A 2OADA 2NBSA 5ENUA 5AIVA 4DEJA 5ECKB 1OVNA 4MCUA 4FYUA 3I69A 1YY7A 3IRAA 1J0FA 2VCQA 4GSNA 1KNGA 3VWWA 1GSUA 5DAKB 2LQOA 2VCVA 3BCKA 4PQHA 3MAKA 2CVBA 4K0GA 3E9JB 2P0GA 2FA4A 4BPYA 3FZ5A 5IMDA 2IMIA 3QDNA 4X43A 2PN8A 4ULXA 2JSYA 4XRAA 3LYKA 2LTKA 6GSVA 4MJEA 6GSXA 2YWMA 3D5JA 2L6CA 3UL3A 1FHEA 4AJ8A 4F03A 2VLTA 4X1UA 3DEXA 4LLRA 3UBLA 1K3LA 3ME8A 2H74A 2AYTA 2DJ3A 1PSQA 3CBUA 4EKZA 2HRAA 1GTUA 2LRCA 1TRUA 2RIIA 1WOUA 2FUG2 2A2RA 5DQYA 2C8UA 2CT6A 1ZGNA 2IMDA 2JZRA 5CRDA 1XWKA 2VD1A 2LJAA 3UMAA 3TKSA 3GKNA 3QFAC 5DCHA 13GSA 2JU5A 1GTAA 4JU5A 5CO3A 1TRWA 3A2VA 1M0UA 2VO4A 3HY2A 4Z2TA 2FA8A 5BMUA 4TR1B 3F4TA 4YH2A 3TJKA 2H01A 1RQMA 3ZIVA 1XIYA 2H73A 2WS2A 1OKDA 4ML1A 4ZIJA 4GTUA 5IPGA 3ZLPA 2FWGA 4TRXA 3L4NA 2GTUA 4E8HA 2HI7A 2EIOA 1JLVA 3ZL5A 2DSAA 1S3RA 3RPNA 2VAFA 1SJIA 4WF4A 5IOWA 4K7OA 3HYPA 4IW9A 1XW9A 2GT5A 4ZXGA 1ILOA 5J9BA 4G10A 1XZOA 3IK9A 1EZKA 4WKWA 3A3TA 4O5QA 4PQ1A 4KF9A 3EMPA 2HRNA 4NHZA 5F05A 5HR0A 3H8QA 3IDVA 9GSSA 4OFMA 4WR4A 4Q5RA 4NXIA 3ZTLA 1DE2A 1M99A 1M2DA 3BCIA 5D93A 2MMOA 1EV9A 2B5EA 4K1FA 1BAYA 2E7PA 1YDKA 4HSCX 2DJKA 2YWIA 4QQ7A 3KH9A 1A23A 2XBIA 4L8EA 1OC9B 4JBBA 3TJFA 5KOXA 4KW6A 3KTLA 2MBSA 4N30A 2FD3A 3LFLA 4KDUA 2TRCP 1A0FA 5IQYA 3Q18A 1BG5A 2HSHA 1A8LA 5B6NA 5H5RA 2NTOA 1QQ2A 2DIZA 3W8SA 1SKSB 2QC7A 2CX3A 3LSZA 1B48A 1URMA 1O8XA 5ECSA 3H4KA 1ZYEA 2B5YA 4X0XA 2OA7A 4HU7A 3ZMLA 5AISA 4MPFA 5ELGA 2I3YA 3RHCA 5HQPA 3QD9A 1K3OA 2GSRA 3FEUA 3EYTA 1HD2A 5ECRB 3IAM2 5HFIA 4YAVA 2I1UA 2C3TA 2ZUPA 1SU9A 4OMVA 2KHPA 2IN3A 1EOGA 2B1KA 2E0QA 4BIKA 4FH8A 4EE0A 2J9HA 3N5OA 2QGVA 3WD6A 3GIXA 3GL5A 3KGKA 4OD7A 2H6XA 3H79A 4GSSA 3M9KA 2GVPA 3TRPA 2JZSA 3KP9A 1FG4A 2J23A 4MZBA 3GN3A 1W89A 2WZ9A 4MJBA 1XOAA 3Q74A 4EIQA 2M80A 3UEMA 1EP8A 4PNGA 4TOPA 4NV2A 4WF5A 4G0KA 5H5SA 1MD4A 3KH7A 4P3YB 5IMFA 1N2AA 4CDOA 3IPZA 3GSTA 4K8MA 1AXDA 3FRCA 4V2MA 1BYEA 4PUFC 2CA8A 3IOSA 3E3EA 1OAZA 4O7HA 3CRTA 5CRWA 1GH2A 1M3JA 2HZEA 2ZCTA 2JL4A 1PX7A 4I6XA 12GSA 2C3QA 3EINA 3LWAA 5HR1A 1T7PB 1ERVA 1NW2A 2F8AA 1BQ7A 2YPMA 5CRHA 4XTSA 2IL3A 2H0HA 3GV1A 3LJRA 1XOBA 4OCFA 5ABRA 1T8EB 5EL8A 3FZ4A 4IBPA 5LD0A 4GQCA 2LRNA 1FOVA 3L9SA 4XS1A 2DMMA 4MJCA 2RUFA 2VCXA 1EP7A 3VPTA 2H1BA 4Q5FA 1YEXA 2LNTA 2H1DA 1AW9A 5B8AA 1B4QA 4IN0A 10GSA 1EEJA 2TRXA 3MYDA 4BL7B 1DSBA 1OC8A 4L5OA 4HUAA 2AHEA 1M2AA 1K0OA 2VUPA 4OWYA 3IK7A 1DBYA 1SYXA 3O76A 1T4YA 2VM2A 3CMIA 3TKRA 3QMXA 2LNSA 1XG8A 5D9VA 1JFUA 1FVKA 2EIRA 4AJ6A 1K0NA 3GKKA 3ERFA 4EF0A 3VI7A 1PX6A 5F0GA 2IMKA 3F3QA 4FIWA 1XFLA 3KM6A 5KEJA 5A4WA 4CY8A 1O8WA 3LXZA 3OR5A 1PKWA 3IHQA 2OKAA 1HNCA 2ES7A 1F37A 3VPQA 2GZYA 1SK2A 4TXVA 2K18A 2YP6A 2YZHA 4J56E 4RI6A 5D73A 2O89A 2N5FA 4K5RA 2YV7A 4L0WA 4O5RA 2YWNA 1R26A 2P31A 3CYNA 5E59A 3D4TA 3C7MA 3ZITA 3DIEA 2FWEA 4EXJA 4POMA 1Y6EA 4KB3A 4HU9A 4FQUA 2C0EA 2UZ8A 3CTGA 1YQ1A 5ID2A 3BD2A 1T4ZA 2QSIA 3FR6A 3I9V2 2EIQA 2C80A 4BVXB 4HS1A 1M9BA 2MMZA 5KN3A 2HXKA 4ML6A 2CVKA 4G0IA 3ISOA 1A8YA 1EV4A 4RQRA 1TK0B 3GNJA 4YKFA 2C4JA 3I43A 5D96A 3NOFA 1FB0A 1FB6A 5F8BA 1TU7A 2E2MA 4KCAA 5E4WA 4CW9A 7GSSA 2QA1A 5ECMB 2A4VA 5H5QA 3SBCA 1X5EA 1MDKA 2IMEA 2WJUA 6GSTA 3ZZXA 3W8JA 1GTIA 3S9FA 5B7CA 2K6VA 2PGTA 4GCIA 2VOCA 3O6TA 1ERWA 3KP8A 1O6JA 1PGTA 4Z2RA 4AF2A 3PH9A 4DSSA 3DWVA 1VF4A 2D2ZA 3LGCA 4AGSA 4XS4A 4YQVA 3VWXA 1PN0A 4HI7A 3QAVA 4MA9A 1SD9A 3P8WA 2FWFA 3WYWA 1S3DA 1AQVA 4YQUA 5A5KA 1AQWA 4ECJA 1M3IA 1GP1A 2LJRA 6GSYA 3SWLA 1V98A 2LEGA 2H0IA 4NV5A 4G9HA 4H86A 1OKTA 2N5AA 2QKEA 3VWUA 3IHGA 2C3NA 2R2JA 1V2AA 4EDZA 1Q98A 3IAS2 3UJ1A 2L4QA 2FWHA 1TXXA 4YAPA 3IXRA 3EMXA 5FWGA 3U6VA 3FK8A 3IV4A 3EURA 5GSTA 1THXA 4V1Ap 2N5BA 5DQSA 1NSWA 3P90A 4KDXA 4N10A 1SJ6A 2IFQA 2A2PA 3F3RA 1ZL9A 1UA5A 2X8HA 1BX9A 1EGOA 4K5SA 2RM6A 1XCCA 3MNGA 3GUSA 3UOMA 1B8XA 1DE1A 3HJMA 3L0HA 2ZNMA 4HQZA 2YNXA 4V1Ag 2EC4A 1SYRA 3LEFA 3VURA 3R3EA 3KTBA 2HLSA 2X8GA 1GSEA 3TKSC 2H6YA 2MBTA 2ALBA 3MWHA 5DCGA 1VF1A 4WBRD 4JR4A 2HRFA 1X5DA 1TRVA 2X64A 2C0GA 3HVNA 4O32A 5C00A 1K0MA 2R4VA 3IA1A 5FT3A 1SL1B 1M7TA 3DRNA 4I2UA 1F9MA 3J7Yb 20GSA 4I97A 4ZB6A 2K9FA 2GZPA 5B6MA 2M46A 3KMNA 2YWOA 1YF1A 1R7HA 1XBSA 4YQMA 4TW5A 3L9UA 3KZQA 2GS3A 3Q6OA 1RW1A 2FY6A 3VK9A 4IP1A 4ZB8A 4BVYA 2VD0A 3TB2A 3C1RA 5ECPB 4TN8A 4AJ7A 2G2QA 1GLQA 1U87A 4GXZA 1XPVA 2B3SA 2H72A 2NPBA 4HDEA 1RK4A 3DGQA 1I9DA 1YZXA 2GQLA 5G1LA 5JWRB 2YN1A 4YKGA 4O5UA 4XIHA 3M0FA 1G7OA 1AUCA 1N8JA 4MJAA 3ZIJA 4MH2A 4D73B 5IMVA 3KCMA 4KDYA 2IWTA 2YJHA 4JE1A 2I9HA 2DIYA 3WGDA 3CXGA 3QCPA 3HJOA 4NWYA 5G5FA 2RUEA 5AGYA 2XC2A 5ID2B 1IYIA 1GSQA 2L4CA 5LCZA 2CVDA 3W6GA 2CAIA 1WE0A 4DVCA 2B7KA 1QUWA 5GZZB 3TCOA 3WGEA
chains in the Genus database with same CATH topology
2H19A 2LQQA 3VWVA 1USBA 2A4HA 2O85A 2PVOC 5GAND 2YV9A 5KN2A 2B7JA 1Z6MA 5D9XA 1LU4A 3FR3A 2VM1A 1R5AA 5HFGA 1ZOFA 2F3MA 4LMWA 1LBKA 1ABAA 4L0UA 5HR2A 3QR6A 2P5QA 4CHSA 3ZVJA 4TXOB 5J9CA 4HEA2 3TOUA 22GSA 2K8VA 2I4AA 3NZNA 4PNFA 3GTUB 4DSSB 5F07A 2IIYA 2WDUA 1E6BA 3KXOA 2NDOA 1GSDA 1PMTA 2V32A 1M9AA 4J2FA 1ZYQB 1AQXA 19GSA 1X9MB 4ZBDA 2VL9A 5G31A 1H75A 2LRTA 1SKRB 1XXUA 4XHMA 3UVHA 1QXHA 4XCSA 1OE8A 3FMWA 2CV4A 1HNAA 2CAQA 4ZL7A 5KOWA 1AC1A 5ECIB 4POLA 4KE3A 5DALA 1Z5YE 4MP4A 2HFDA 3MSZA 2IFQB 1YEPA 5IMAA 5DVBA 1SJZA 2DJJA 2GDRA 2O7KA 1EOHA 4KNDA 4N0VA 4NMUA 1WPIA 3DYRA 1M2BA 3F9UA 5LNKe 2AUVA 1Z6NA 4K2XA 1WIKA 3H93A 4PTSA 1ERTA 1HYUA 4FYBA 1YKCA 3GRXA 4IKHA 3LQ7A 4GQFA 1X9WB 2MYGA 2R5GA 4JZQA 1SKWB 2JACA 2KLXA 4KSOA 1WJKA 2OBIA 1VF3A 4EL1A 1TOFA 5GAPD 2LUSA 1MTCA 1OYJA 1ML6A 2IPAA 3DVXA 1EGRA 1A0RP 3D4MA 4MZWA 4N0ZA 3GH6A 4K0NA 3CSHA 3P2AA 4EUYA 2DKIA 3WT1A 4HJ2A 2H71A 2V2GA 3HXSA 5COHA 1F2EA 4BWQA 5C04A 4JR6A 3ERGA 4USSA 2KOKA 2WULA 2HNLA 4ISDA 5EVOA 3BBYA 3U5RE 3UIWA 4WBJA 3FKFA 5IIZA 4ICYA 1MDJA 1UC7A 1UN2A 3D22A 1JZRA 2MZCA 2AJQB 3F6FA 2WB9A 1FAAA 3R2QA 4TR4A 4WR5A 2DJ1A 4BWSA 1J9BA 2PVQA 4K9ZA 1Q4JA 3HVXA 4PUAA 1ZCPA 2DJ2A 2B1LA 1CQGA 3DVWA 1S3CA 4GRFA 2IJYA 3F0IA 1ON4A 3TJJA 4EO3A 2OBKA 4TR1A 14GSA 4TKYA 4O92A 3D21A 2I81A 2DBCA 2V6OA 4ACSA 3IC4A 6GSSA 4K2DA 1EEMA 3G7IA 3CTFA 1TK8B 3KMOA 2H30A 2HSMA 4GSTA 3HVVA 1O7UA 3L78A 5J41A 1Y25A 3DD3A 2FNOA 2DKHA 3VLNA 2GQMA 1F6MC 1G0TA 3C1SA 5CNWA 2JADA 3QFBC 3EC3A 3HHVA 3J7Yk 3C8EA 4V2LA 4FYCA 1GSFA 5G2ZA 1FO5A 3A5IA 1ST9A 1U3IA 3IC8A 2RM5A 2JZTA 2LJKA 1TRSA 2AAWA 3L9VA 1ZMAA 5JWQB 3RAZA 3N9JA 3HD5A 4DSRA 2E2GA 4OO4A 5A4UA 4WEYA 3PINA 3RHBA 5IMCA 4PQIA 4OO5A 5BRTA 1XWAA 3CSIA 1V9WA 2GSSA 4PURA 4EDYA 3TJGA 2DMLA 1VGLA 2JSZA 2O8VB 1K0DA 2VL2C 2AB6A 3V1WA 1OC9A 1JHBA 3UARA 1THOA 2IMFA 2BJXA 1JZOA 1K0AA 3RPPA 2VCWA 4HJMA 3PGTA 3HCZA 2WRTA 1VRSD 1KBNA 17GSA 1ZYPA 1TU8A 3GX0A 1TI1A 1F3BA 1TI3A 3IE3A 1GWCA 3APSA 1SK0A 1T00A 3EU3A 3WT2A 1KTEA 3F63A 4N11A 1GLPA 4MNNA 3F6DA 1ACVA 1Z3EA 2GT6A 4MF7A 3I6AA 2CZ2A 5D9TA 2OJLA 4IJ3A 2HSYA 4PXOA 4I5QA 2HYXA 1GNEA 1FW1A 3EVIA 5G1KA 2HZEB 1GL8A 1PA3A 5IO0A 3DXBA 1PL2A 4PGTA 3ZMKA 4ID0A 2OE0A 2C0DA 4G19A 2ON5A 4HZ4A 6GSWA 1B9YC 4RUVA 5D9WA 4K7IA 2MMNA 3UAPA 5CRGA 3TGZA 3ZFLA 4EVMA 4ZL8A 18GSA 3EPTA 3LORA 3FZ9A 1SD8A 2H76A 2H1AA 1ZZYA 1A24A 4V2NA 1U6TA 2H75A 1WP0A 3D0ZA 4MDCA 1NM3A 1O81A 3HKRA 3NIVA 2X4AA 2KP2A 2C0FA 4ECIA 5GSSA 3HDCA 2OACA 2P5RA 1K3YA 1U88A 4EC0A 4Q5NA 4RQXA 1XW5A 3PR8A 5F06A 1F3AA 1X9SB 3IR4A 2GSQA 3FHKA 3LW9A 3ERWA 1TTZA 1KEBA 2K8SA 4XS6A 1UVZA 5ECLB 2BMXA 3G7JA 3C73A 1HNBA 1A2MA 3GH9A 2VLUA 3APQA 3QAWA 1A2LA 3BJ5A 4IJIA 2L59A 1FVJA 4EIPA 2F8FA 2KP1A 4CY6A 3ZRDA 5IOXA 1MD3A 3UVTA 3O3TA 4OCEA 5EY6A 1H4OA 3TKQA 2FCHA 5CP1A 3VI5A 3EU4A 5DDLA 2H1GA 2PMTA 2VIMA 1QGVA 3TJBA 3GSSA 3GMFA 11GSA 4BL7A 2LSTA 2LV3A 1XWBA 3LYPA 1C72A 1I5GA 5CREA 2O87A 3KIJA 4MABA 3AY8A 2X99A 3ZFBA 4FO5A 1G7EA 1TKDB 4BA7A 4F82A 4POBA 2YZUA 3A5WA 2V1MA 4IGJA 5L71A 2HZFA 1WRYA 1VF2A 2PUKC 3MDKA 4QL9A 2HRKA 4I8BA 3FW2A 2H66A 4JRRA 5JCGA 3BOAA 3GX8A 1OC3A 3TDGA 4NPBA 1Z7RA 2B5XA 1GSYA 3GFKA 4F2IA 1Z7PA 1R5PA 5J3RA 2F9SA 3GKXA 2H6ZA 3CSJA 5G5EA 1PD21 4MPGA 1OE7A 1HQOA 1GUMA 4KCEA 5CAXA 5ECHB 5D8IA 4KGIA 3K8NA 4Z7XA 1O85A 4XS4B 3RDWA 4J57E 5IM9A 2V41A 1O73A 2R0GA 5G30A 1NHYA 1SK1A 2FHEA 5IO2A 1T3BA 4HZ2A 2PBJA 5DBQA 4BVXA 1FOHA 5HR3A 5ELAA 2R6KA 2DLXA 2XBQA 4MK3A 4I2TA 2R0CA 1GSSA 3FYGA 4KX4A 1SL0B 4TR0A 2PWJA 1DUGA 1QK8A 5EPFA 2M72A 2OE1A 1GNWA 3GKMA 3HZ4A 4JEDA 1V40A 1B4PA 4X4JA 1JLWA 4F9ZA 4ZL9A 4RI7A 4MZCA 5J5NA 1AIUA 4KSMA 1GULA 2H70A 4GF0A 3M9JA 4IELA 3RBTA 3F8UA 4LL4B 1BJXA 3QPMA 6GSUA 2R0PA 5IMZA 2REMA 2GSTA 4KA0A 2DJ0A 4Z2UA 2F51A 5JWOB 1GRXA 1JZWA 4IHUA 3EE2A 1GUKA 2BTOT 4ILFA 1LJRA 3TRQA 3IBHA 2XPEA 4WXTA 2L5LA 5AN1A 1S3AA 2H0GA 2L6DA 3F4RA 4GLTA 2RLIA 2X49A 3GYKA 1PQNA 4HQSA 4G2EA 1X5CA 2HE3A 5DAKA 2WFCA 2GGTA 3DMLA 2YOIA 3HZ8A 4IVFA 2H8LA 4A5PA 1XVQA 4IS0A 4BVYB 16GSA 3QOUA 3FY7A 2ON7A 2C1YA 3US3A 2HT9A 4K6XA 1SL2B 1TDIA 2GZZA 1R4WA 4F0BA 3M8NA 5KN0A 1A2JA 3A2XA 2TIRA 3TUEA 2GQKA 1CQHA 3TRXA 2PERA 3C71A 3G9BA 3GA4A 1NHOA 2R3XA 4DSQA 1GUHA 4ZB9A 1PRXA 3DKSA 2PPTA 3ZVJD 2NVLA 1YF0A 2XPDA 4LMVA 2B6MA 1XVWA 8GSSA 4KH7A 4ZILA 3TOTA 1XWGA 3KJYA 3TKSE 4G0LA 4F0CA 3KD0A 1YKAA 1E2YA 3JCML 5AIXA 1SENA 2LS5A 2FLSA 4IP6A 4ZBBA 3M3MA 3Q19A 1TK5B 1XWCA 5DJMA 2VLVA 3PPUA 2L57A 3APOA 1ERUA 5HFKA 2OE3A 1PL1A 2Z9SA 3ED3A 2AV4A 2YCDA 5DJLA 4WETA 2V6KA 5KN1A 4L5LA 3ZYWA 4PX1A 2WCIA 5ECOB 3GL3A 1EWXA 5INYA 4IQ1A 3H1NA 4GWRA 1K0BA 1XW6A 3LXTA 5JCUA 4OFNA 2A2SA 3HJPA 5ECNB 4ZBAA 4MLYA 1BEDA 1B9XC 1G6YA 4LA1A 5J4UA 4D73A 4OFTA 2VCTA 4ECCA 2CX4A 2GLRA 4TVEA 5ECQB 2YJ7A 3HVSA 4KAEA 3ZREA 2LKUA 4NAXA 3TKPA 1MEKA 2XHFA 2QA2A 3M1GA 1G6WA 3LG6A 1J08A 1TW9A 3G7YA 4XRDA 3F4SA 1GTBA 4MF5A 2KUCA 2L5OA 1JZDA 3P7XA 3MIXA 2CZ3A 1WWJA 1TJDA 1T1VA 1ZYNA 1WMJA 1PN9A 3WGXA 4NHWA 4ECBA 2FGXA 1Z9HA 4MF6A 3KEBA 2WGRA 5DALB 3CRUA 3FZAA 5JCWA 2G0FA 3GURA 1X0RA 3UBKA 5FHIA 3VFIA 3ME7A 1V57A 1V58A 4E8EA 3E0UA 4IQAA 5A4VA 2VL3A 2VCZA 3QAGA 1YJ6A 5CYYA 4TXOA 1PKZA 4K7NA 5B8BA 2DC5A 5IPHA 3A2WA 2CQ9A 1QMVA 3GTUA 3EWLA 1K0CA 2X8CA 3D6IA 2PU9C 4Q5QA 3HA9A 4QL7A 1TP9A 4MH3A 2YANA 1MDIA 4MMMA 4HOJA 1QFNA 3GHAA 4LL1B 1IYHA 4POKA 4TR3A 4KUNA 2R37A 1W4VA 1AAZA 1U3AA 2MMAA 2VL2A 3FR9A 2OADA 2NBSA 5ENUA 5AIVA 4DEJA 5ECKB 1OVNA 4MCUA 4FYUA 3I69A 1YY7A 3IRAA 1J0FA 2VCQA 4GSNA 1KNGA 3VWWA 1GSUA 5DAKB 2LQOA 2VCVA 3BCKA 4PQHA 3MAKA 2CVBA 4K0GA 3E9JB 2P0GA 2FA4A 4BPYA 3FZ5A 5IMDA 2IMIA 3QDNA 4X43A 2PN8A 4ULXA 2JSYA 4XRAA 3LYKA 2LTKA 6GSVA 4MJEA 6GSXA 2YWMA 3D5JA 2L6CA 3UL3A 1FHEA 4AJ8A 4F03A 2VLTA 4X1UA 3DEXA 4LLRA 3UBLA 1K3LA 3ME8A 2H74A 2AYTA 2DJ3A 1PSQA 3CBUA 4EKZA 2HRAA 1GTUA 2LRCA 1TRUA 2RIIA 1WOUA 2FUG2 2A2RA 5DQYA 2C8UA 2CT6A 1ZGNA 2IMDA 2JZRA 5CRDA 1XWKA 2VD1A 2LJAA 3UMAA 3TKSA 3GKNA 3QFAC 5DCHA 13GSA 2JU5A 1GTAA 4JU5A 5CO3A 1TRWA 3A2VA 1M0UA 2VO4A 3HY2A 4Z2TA 2FA8A 5BMUA 4TR1B 3F4TA 4YH2A 3TJKA 2H01A 1RQMA 3ZIVA 1XIYA 2H73A 2WS2A 1OKDA 4ML1A 4ZIJA 4GTUA 5IPGA 3ZLPA 2FWGA 4TRXA 3L4NA 2GTUA 4E8HA 2HI7A 2EIOA 1JLVA 3ZL5A 2DSAA 3RPNA 2VAFA 1SJIA 4WF4A 5IOWA 4K7OA 3HYPA 4IW9A 1XW9A 2GT5A 4ZXGA 1ILOA 5J9BA 4G10A 1XZOA 3IK9A 1EZKA 4WKWA 3A3TA 4O5QA 4PQ1A 4KF9A 3EMPA 2HRNA 4NHZA 5F05A 5HR0A 3H8QA 3IDVA 9GSSA 4OFMA 4WR4A 4Q5RA 4NXIA 3ZTLA 1DE2A 1M99A 1M2DA 3BCIA 5D93A 2MMOA 1EV9A 2B5EA 4K1FA 1BAYA 2E7PA 1YDKA 2DJKA 2YWIA 4QQ7A 3KH9A 1A23A 2XBIA 4L8EA 1OC9B 4JBBA 3TJFA 5KOXA 4KW6A 3KTLA 2MBSA 4N30A 2FD3A 3LFLA 4KDUA 2TRCP 1A0FA 5IQYA 3Q18A 1BG5A 2HSHA 1A8LA 5B6NA 5H5RA 2NTOA 1QQ2A 2DIZA 3W8SA 1SKSB 2QC7A 2CX3A 3LSZA 1B48A 1URMA 1O8XA 5ECSA 3H4KA 1ZYEA 2B5YA 4X0XA 2OA7A 4HU7A 3ZMLA 5AISA 4MPFA 5ELGA 2I3YA 3RHCA 5HQPA 3QD9A 1K3OA 2GSRA 3FEUA 3EYTA 1HD2A 5ECRB 3IAM2 5HFIA 4YAVA 2I1UA 2C3TA 2ZUPA 1SU9A 4OMVA 2KHPA 2IN3A 1EOGA 2B1KA 2E0QA 4FH8A 4EE0A 2J9HA 3N5OA 2QGVA 3WD6A 3GIXA 3GL5A 3KGKA 4OD7A 2H6XA 3H79A 4GSSA 3M9KA 2GVPA 3TRPA 2JZSA 3KP9A 1FG4A 2J23A 4MZBA 3GN3A 1W89A 2WZ9A 4MJBA 1XOAA 3Q74A 4EIQA 2M80A 3UEMA 1EP8A 4PNGA 4TOPA 4NV2A 4WF5A 4G0KA 5H5SA 1MD4A 3KH7A 4P3YB 5IMFA 1N2AA 4CDOA 3IPZA 3GSTA 4K8MA 1AXDA 3FRCA 4V2MA 1BYEA 4PUFC 2CA8A 3IOSA 3E3EA 1OAZA 4O7HA 3CRTA 5CRWA 1GH2A 2HZEA 2ZCTA 2JL4A 1PX7A 4I6XA 12GSA 2C3QA 3EINA 3LWAA 5HR1A 1T7PB 1ERVA 1NW2A 2F8AA 1BQ7A 2YPMA 5CRHA 4XTSA 2IL3A 2H0HA 3GV1A 3LJRA 1XOBA 4OCFA 5ABRA 1T8EB 5EL8A 3FZ4A 4IBPA 5LD0A 4GQCA 2LRNA 1FOVA 3L9SA 4XS1A 2DMMA 4MJCA 2RUFA 2VCXA 1EP7A 3VPTA 2H1BA 4Q5FA 1YEXA 2LNTA 2H1DA 1AW9A 5B8AA 1B4QA 4IN0A 10GSA 1EEJA 2TRXA 3MYDA 4BL7B 1DSBA 1OC8A 4L5OA 4HUAA 2AHEA 1M2AA 1K0OA 2VUPA 4OWYA 3IK7A 1DBYA 1SYXA 3O76A 1T4YA 2VM2A 3CMIA 3TKRA 3QMXA 2LNSA 5D9VA 1JFUA 1FVKA 2EIRA 4AJ6A 1K0NA 3GKKA 3ERFA 4EF0A 3VI7A 1PX6A 5F0GA 2IMKA 3F3QA 4FIWA 1XFLA 3KM6A 5KEJA 5A4WA 4CY8A 1O8WA 3LXZA 3OR5A 1PKWA 3IHQA 2OKAA 1HNCA 2ES7A 1F37A 3VPQA 2GZYA 1SK2A 4TXVA 2K18A 2YP6A 2YZHA 4J56E 4RI6A 5D73A 2O89A 2N5FA 4K5RA 2YV7A 4L0WA 4O5RA 2YWNA 1R26A 2P31A 3CYNA 5E59A 3D4TA 3C7MA 3ZITA 3DIEA 2FWEA 4EXJA 4POMA 1Y6EA 4KB3A 4HU9A 4FQUA 2C0EA 2UZ8A 3CTGA 1YQ1A 5ID2A 3BD2A 1T4ZA 2QSIA 3FR6A 3I9V2 2EIQA 2C80A 4BVXB 4HS1A 1M9BA 2MMZA 5KN3A 2HXKA 4ML6A 2CVKA 4G0IA 3ISOA 1A8YA 1EV4A 4RQRA 1TK0B 3GNJA 4YKFA 2C4JA 3I43A 5D96A 3NOFA 1FB0A 1FB6A 5F8BA 1TU7A 2E2MA 4KCAA 5E4WA 4CW9A 7GSSA 2QA1A 5ECMB 2A4VA 5H5QA 3SBCA 1X5EA 1MDKA 2IMEA 2WJUA 6GSTA 3ZZXA 3W8JA 1GTIA 3S9FA 5B7CA 2K6VA 2PGTA 4GCIA 2VOCA 3O6TA 1ERWA 3KP8A 1O6JA 1PGTA 4Z2RA 4AF2A 3PH9A 4DSSA 3DWVA 1VF4A 2D2ZA 3LGCA 4AGSA 4XS4A 4YQVA 3VWXA 1PN0A 4HI7A 3QAVA 4MA9A 1SD9A 3P8WA 2FWFA 3WYWA 1S3DA 1AQVA 4YQUA 5A5KA 1AQWA 4ECJA 1GP1A 2LJRA 6GSYA 3SWLA 1V98A 2LEGA 2H0IA 4NV5A 4G9HA 4H86A 1OKTA 2N5AA 2QKEA 3VWUA 3IHGA 2C3NA 2R2JA 1V2AA 4EDZA 1Q98A 3IAS2 3UJ1A 2L4QA 2FWHA 1TXXA 4YAPA 3IXRA 3EMXA 5FWGA 3U6VA 3FK8A 3IV4A 3EURA 5GSTA 1THXA 4V1Ap 2N5BA 5DQSA 1NSWA 3P90A 4KDXA 4N10A 1SJ6A 2IFQA 2A2PA 3F3RA 1ZL9A 1UA5A 2X8HA 1BX9A 1EGOA 4K5SA 2RM6A 1XCCA 3MNGA 3GUSA 3UOMA 1B8XA 1DE1A 3HJMA 3L0HA 2ZNMA 4HQZA 2YNXA 4V1Ag 2EC4A 1SYRA 3LEFA 3VURA 3R3EA 3KTBA 2HLSA 2X8GA 1GSEA 3TKSC 2H6YA 2MBTA 2ALBA 3MWHA 5DCGA 1VF1A 4WBRD 4JR4A 2HRFA 1X5DA 1TRVA 2X64A 2C0GA 4O32A 5C00A 1K0MA 2R4VA 3IA1A 5FT3A 1SL1B 1M7TA 3DRNA 4I2UA 1F9MA 3J7Yb 20GSA 4I97A 4ZB6A 2K9FA 2GZPA 5B6MA 2M46A 3KMNA 2YWOA 1YF1A 1R7HA 1XBSA 4YQMA 4TW5A 3L9UA 3KZQA 2GS3A 3Q6OA 1RW1A 2FY6A 3VK9A 4IP1A 4ZB8A 4BVYA 2VD0A 3TB2A 3C1RA 5ECPB 4TN8A 4AJ7A 2G2QA 1GLQA 1U87A 4GXZA 1XPVA 2B3SA 2H72A 2NPBA 4HDEA 1RK4A 3DGQA 1I9DA 1YZXA 2GQLA 5G1LA 5JWRB 2YN1A 4YKGA 4O5UA 4XIHA 3M0FA 1G7OA 1AUCA 1N8JA 4MJAA 3ZIJA 4MH2A 4D73B 5IMVA 3KCMA 4KDYA 2IWTA 2YJHA 4JE1A 2I9HA 2DIYA 3WGDA 3CXGA 3QCPA 3HJOA 4NWYA 5G5FA 2RUEA 5AGYA 2XC2A 5ID2B 1IYIA 1GSQA 2L4CA 5LCZA 2CVDA 3W6GA 2CAIA 1WE0A 4DVCA 2B7KA 1QUWA 5GZZB 3TCOA 3WGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H19 A;  2LQQ A;  3VWV A;  1USB A;  2O85 A;  2PVO C;  5GAN D;  2YV9 A;  5KN2 A;  2B7J A;  1Z6M A;  5D9X A;  1LU4 A;  3FR3 A;  2VM1 A;  1R5A A;  5HFG A;  1ZOF A;  2F3M A;  4LMW A;  1LBK A;  1ABA A;  4L0U A;  5HR2 A;  3QR6 A;  2P5Q A;  4CHS A;  3ZVJ A;  4TXO B;  5J9C A;  4HEA 2;  3TOU A;  22GS A;  2K8V A;  2I4A A;  3NZN A;  4PNF A;  3GTU B;  4DSS B;  5F07 A;  2IIY A;  2WDU A;  1E6B A;  3KXO A;  2NDO A;  1GSD A;  1PMT A;  2V32 A;  1M9A A;  4J2F A;  1ZYQ B;  1AQX A;  19GS A;  1X9M B;  4ZBD A;  2VL9 A;  5G31 A;  1H75 A;  2LRT A;  1SKR B;  1XXU A;  4XHM A;  3UVH A;  1QXH A;  4XCS A;  1OE8 A;  2CV4 A;  1HNA A;  2CAQ A;  4ZL7 A;  1AC1 A;  5ECI B;  4POL A;  4KE3 A;  5DAL A;  1Z5Y E;  4MP4 A;  2HFD A;  3MSZ A;  2IFQ B;  1YEP A;  5IMA A;  5DVB A;  1SJZ A;  2DJJ A;  2GDR A;  2O7K A;  1EOH A;  4KND A;  4N0V A;  4NMU A;  1WPI A;  3DYR A;  1M2B A;  3F9U A;  5LNK e;  2AUV A;  1Z6N A;  1WIK A;  3H93 A;  1ERT A;  1HYU A;  4FYB A;  1YKC A;  3GRX A;  4IKH A;  3LQ7 A;  4GQF A;  1X9W B;  2MYG A;  2R5G A;  4JZQ A;  1SKW B;  2JAC A;  2KLX A;  4KSO A;  1WJK A;  2OBI A;  1VF3 A;  4EL1 A;  1TOF A;  5GAP D;  2LUS A;  1MTC A;  1OYJ A;  1ML6 A;  2IPA A;  3DVX A;  1EGR A;  1A0R P;  3D4M A;  4MZW A;  4N0Z A;  3GH6 A;  4K0N A;  3CSH A;  3P2A A;  4EUY A;  3WT1 A;  4HJ2 A;  2H71 A;  2V2G A;  3HXS A;  5COH A;  1F2E A;  4BWQ A;  5C04 A;  4JR6 A;  3ERG A;  2KOK A;  2WUL A;  2HNL A;  4ISD A;  5EVO A;  3BBY A;  3U5R E;  3UIW A;  4WBJ A;  3FKF A;  5IIZ A;  1MDJ A;  1UC7 A;  1UN2 A;  3D22 A;  1JZR A;  2MZC A;  2AJQ B;  3F6F A;  2WB9 A;  1FAA A;  3R2Q A;  4TR4 A;  4WR5 A;  2DJ1 A;  4BWS A;  1J9B A;  2PVQ A;  4K9Z A;  1Q4J A;  3HVX A;  4PUA A;  1ZCP A;  2DJ2 A;  2B1L A;  1CQG A;  3DVW A;  1S3C A;  4GRF A;  2IJY A;  3F0I A;  1ON4 A;  3TJJ A;  4EO3 A;  2OBK A;  4TR1 A;  14GS A;  4TKY A;  4O92 A;  3D21 A;  2I81 A;  2DBC A;  2V6O A;  4ACS A;  3IC4 A;  6GSS A;  4K2D A;  1EEM A;  3G7I A;  3CTF A;  1TK8 B;  3KMO A;  2H30 A;  4GST A;  3HVV A;  1O7U A;  3L78 A;  5J41 A;  1Y25 A;  3DD3 A;  2FNO A;  3VLN A;  2GQM A;  1F6M C;  1G0T A;  3C1S A;  5CNW A;  2JAD A;  3QFB C;  3EC3 A;  3HHV A;  3J7Y k;  3C8E A;  4V2L A;  4FYC A;  1GSF A;  5G2Z A;  1FO5 A;  1ST9 A;  1U3I A;  2RM5 A;  2JZT A;  2LJK A;  1TRS A;  2AAW A;  3L9V A;  1ZMA A;  5JWQ B;  3RAZ A;  3N9J A;  3HD5 A;  4DSR A;  2E2G A;  4OO4 A;  5A4U A;  4WEY A;  3PIN A;  3RHB A;  5IMC A;  4PQI A;  4OO5 A;  1XWA A;  3CSI A;  1V9W A;  2GSS A;  4PUR A;  4EDY A;  3TJG A;  2DML A;  1VGL A;  2JSZ A;  2O8V B;  1K0D A;  2VL2 C;  2AB6 A;  3V1W A;  1OC9 A;  1JHB A;  3UAR A;  1THO A;  2IMF A;  2BJX A;  1JZO A;  1K0A A;  3RPP A;  2VCW A;  4HJM A;  3PGT A;  3HCZ A;  2WRT A;  1VRS D;  1KBN A;  17GS A;  1TU8 A;  3GX0 A;  1TI1 A;  1F3B A;  1TI3 A;  3IE3 A;  1GWC A;  3APS A;  1SK0 A;  1T00 A;  3EU3 A;  3WT2 A;  1KTE A;  3F63 A;  4N11 A;  1GLP A;  3F6D A;  1ACV A;  1Z3E A;  2GT6 A;  4MF7 A;  3I6A A;  2CZ2 A;  5D9T A;  2OJL A;  4IJ3 A;  2HSY A;  4PXO A;  4I5Q A;  2HYX A;  1GNE A;  1FW1 A;  3EVI A;  5G1K A;  2HZE B;  1GL8 A;  1PA3 A;  5IO0 A;  3DXB A;  1PL2 A;  4PGT A;  3ZMK A;  4ID0 A;  2OE0 A;  2C0D A;  4G19 A;  2ON5 A;  4HZ4 A;  6GSW A;  1B9Y C;  4RUV A;  5D9W A;  4K7I A;  2MMN A;  3UAP A;  5CRG A;  3TGZ A;  3ZFL A;  4EVM A;  4ZL8 A;  18GS A;  3LOR A;  3FZ9 A;  1SD8 A;  2H76 A;  2H1A A;  1ZZY A;  1A24 A;  4V2N A;  1U6T A;  2H75 A;  1WP0 A;  3D0Z A;  4MDC A;  1NM3 A;  1O81 A;  3HKR A;  3NIV A;  2KP2 A;  2C0F A;  4ECI A;  5GSS A;  3HDC A;  2OAC A;  2P5R A;  1K3Y A;  1U88 A;  4EC0 A;  4Q5N A;  4RQX A;  1XW5 A;  3PR8 A;  5F06 A;  1F3A A;  1X9S B;  3IR4 A;  2GSQ A;  3FHK A;  3ERW A;  1TTZ A;  1KEB A;  2K8S A;  4XS6 A;  1UVZ A;  5ECL B;  2BMX A;  3G7J A;  3C73 A;  1HNB A;  1A2M A;  3GH9 A;  2VLU A;  3APQ A;  3QAW A;  1A2L A;  3BJ5 A;  4IJI A;  2L59 A;  1FVJ A;  2F8F A;  2KP1 A;  3ZRD A;  5IOX A;  1MD3 A;  3UVT A;  3O3T A;  4OCE A;  5EY6 A;  1H4O A;  3TKQ A;  2FCH A;  5CP1 A;  3VI5 A;  3EU4 A;  5DDL A;  2H1G A;  2PMT A;  2VIM A;  1QGV A;  3TJB A;  3GSS A;  3GMF A;  11GS A;  4BL7 A;  2LST A;  2LV3 A;  1XWB A;  3LYP A;  1C72 A;  1I5G A;  5CRE A;  2O87 A;  3KIJ A;  4MAB A;  3AY8 A;  2X99 A;  3ZFB A;  4FO5 A;  1G7E A;  1TKD B;  4BA7 A;  4F82 A;  4POB A;  2YZU A;  3A5W A;  2V1M A;  4IGJ A;  5L71 A;  2HZF A;  1WRY A;  1VF2 A;  2PUK C;  3MDK A;  4QL9 A;  4I8B A;  3FW2 A;  2H66 A;  4JRR A;  5JCG A;  3BOA A;  3GX8 A;  1OC3 A;  3TDG A;  4NPB A;  1Z7R A;  2B5X A;  1GSY A;  3GFK A;  4F2I A;  1Z7P A;  1R5P A;  5J3R A;  2F9S A;  3GKX A;  2H6Z A;  3CSJ A;  5G5E A;  1PD2 1;  4MPG A;  1OE7 A;  1HQO A;  1GUM A;  4KCE A;  5CAX A;  5ECH B;  5D8I A;  4KGI A;  3K8N A;  4Z7X A;  1O85 A;  4XS4 B;  3RDW A;  4J57 E;  5IM9 A;  2V41 A;  1O73 A;  5G30 A;  1NHY A;  1SK1 A;  2FHE A;  5IO2 A;  1T3B A;  4HZ2 A;  2PBJ A;  5DBQ A;  4BVX A;  5HR3 A;  5ELA A;  2R6K A;  2DLX A;  2XBQ A;  4MK3 A;  4I2T A;  1GSS A;  3FYG A;  4KX4 A;  1SL0 B;  4TR0 A;  2PWJ A;  1DUG A;  1QK8 A;  5EPF A;  2M72 A;  2OE1 A;  1GNW A;  3GKM A;  3HZ4 A;  4JED A;  1V40 A;  1B4P A;  1JLW A;  4F9Z A;  4ZL9 A;  4RI7 A;  4MZC A;  5J5N A;  1AIU A;  4KSM A;  1GUL A;  2H70 A;  4GF0 A;  3M9J A;  4IEL A;  3RBT A;  3F8U A;  4LL4 B;  1BJX A;  3QPM A;  6GSU A;  5IMZ A;  2REM A;  2GST A;  4KA0 A;  2DJ0 A;  2F51 A;  5JWO B;  1GRX A;  1JZW A;  4IHU A;  3EE2 A;  1GUK A;  2BTO T;  4ILF A;  1LJR A;  3TRQ A;  3IBH A;  2XPE A;  4WXT A;  2L5L A;  5AN1 A;  1S3A A;  2H0G A;  2L6D A;  3F4R A;  4GLT A;  2RLI A;  3GYK A;  1PQN A;  4HQS A;  4G2E A;  1X5C A;  2HE3 A;  5DAK A;  2WFC A;  2GGT A;  3DML A;  2YOI A;  3HZ8 A;  4IVF A;  2H8L A;  1XVQ A;  4IS0 A;  16GS A;  3QOU A;  3FY7 A;  2ON7 A;  2C1Y A;  3US3 A;  2HT9 A;  4K6X A;  1SL2 B;  1TDI A;  2GZZ A;  1R4W A;  4F0B A;  3M8N A;  5KN0 A;  1A2J A;  3A2X A;  2TIR A;  3TUE A;  2GQK A;  1CQH A;  3TRX A;  2PER A;  3C71 A;  3G9B A;  3GA4 A;  1NHO A;  2R3X A;  4DSQ A;  1GUH A;  4ZB9 A;  1PRX A;  3DKS A;  2PPT A;  3ZVJ D;  2NVL A;  1YF0 A;  2XPD A;  4LMV A;  2B6M A;  1XVW A;  8GSS A;  4KH7 A;  4ZIL A;  3TOT A;  1XWG A;  3KJY A;  3TKS E;  4F0C A;  3KD0 A;  1YKA A;  1E2Y A;  3JCM L;  5AIX A;  1SEN A;  2LS5 A;  2FLS A;  4IP6 A;  4ZBB A;  3M3M A;  3Q19 A;  1TK5 B;  1XWC A;  5DJM A;  2VLV A;  2L57 A;  3APO A;  1ERU A;  5HFK A;  2OE3 A;  1PL1 A;  2Z9S A;  3ED3 A;  2AV4 A;  2YCD A;  5DJL A;  4WET A;  2V6K A;  5KN1 A;  4L5L A;  3ZYW A;  4PX1 A;  2WCI A;  5ECO B;  3GL3 A;  1EWX A;  5INY A;  4IQ1 A;  3H1N A;  4GWR A;  1K0B A;  1XW6 A;  3LXT A;  5JCU A;  4OFN A;  2A2S A;  3HJP A;  5ECN B;  4ZBA A;  4MLY A;  1BED A;  1B9X C;  1G6Y A;  4LA1 A;  5J4U A;  4D73 A;  4OFT A;  2VCT A;  4ECC A;  2CX4 A;  2GLR A;  4TVE A;  5ECQ B;  2YJ7 A;  3HVS A;  4KAE A;  3ZRE A;  2LKU A;  4NAX A;  3TKP A;  1MEK A;  2XHF A;  3M1G A;  1G6W A;  3LG6 A;  1J08 A;  1TW9 A;  3G7Y A;  4XRD A;  3F4S A;  1GTB A;  4MF5 A;  2KUC A;  2L5O A;  1JZD A;  3P7X A;  2CZ3 A;  1WWJ A;  1TJD A;  1T1V A;  1WMJ A;  1PN9 A;  3WGX A;  4NHW A;  4ECB A;  2FGX A;  1Z9H A;  4MF6 A;  3KEB A;  2WGR A;  5DAL B;  3CRU A;  3FZA A;  5JCW A;  2G0F A;  3GUR A;  1X0R A;  3UBK A;  5FHI A;  3VFI A;  3ME7 A;  1V57 A;  1V58 A;  4E8E A;  3E0U A;  4IQA A;  5A4V A;  2VL3 A;  2VCZ A;  3QAG A;  1YJ6 A;  5CYY A;  4TXO A;  1PKZ A;  4K7N A;  5B8B A;  2DC5 A;  5IPH A;  3A2W A;  2CQ9 A;  1QMV A;  3GTU A;  3EWL A;  1K0C A;  2X8C A;  3D6I A;  2PU9 C;  4Q5Q A;  3HA9 A;  4QL7 A;  1TP9 A;  4MH3 A;  2YAN A;  1MDI A;  4MMM A;  4HOJ A;  1QFN A;  3GHA A;  4LL1 B;  1IYH A;  4POK A;  4TR3 A;  4KUN A;  2R37 A;  1W4V A;  1AAZ A;  1U3A A;  2MMA A;  2VL2 A;  3FR9 A;  2OAD A;  2NBS A;  5ENU A;  5AIV A;  4DEJ A;  5ECK B;  1OVN A;  4MCU A;  4FYU A;  3I69 A;  1YY7 A;  3IRA A;  1J0F A;  2VCQ A;  4GSN A;  1KNG A;  3VWW A;  1GSU A;  5DAK B;  2LQO A;  2VCV A;  3BCK A;  4PQH A;  3MAK A;  2CVB A;  4K0G A;  3E9J B;  2P0G A;  2FA4 A;  4BPY A;  3FZ5 A;  5IMD A;  2IMI A;  3QDN A;  4X43 A;  2PN8 A;  4ULX A;  2JSY A;  4XRA A;  3LYK A;  2LTK A;  6GSV A;  4MJE A;  6GSX A;  2YWM A;  3D5J A;  2L6C A;  3UL3 A;  1FHE A;  4AJ8 A;  4F03 A;  2VLT A;  4X1U A;  3DEX A;  4LLR A;  3UBL A;  1K3L A;  3ME8 A;  2H74 A;  2AYT A;  2DJ3 A;  1PSQ A;  3CBU A;  4EKZ A;  1GTU A;  2LRC A;  1TRU A;  2RII A;  1WOU A;  2FUG 2;  2A2R A;  5DQY A;  2C8U A;  2CT6 A;  1ZGN A;  2IMD A;  2JZR A;  5CRD A;  1XWK A;  2VD1 A;  2LJA A;  3UMA A;  3TKS A;  3GKN A;  3QFA C;  5DCH A;  13GS A;  2JU5 A;  1GTA A;  4JU5 A;  5CO3 A;  1TRW A;  3A2V A;  1M0U A;  2VO4 A;  3HY2 A;  2FA8 A;  4TR1 B;  3F4T A;  4YH2 A;  3TJK A;  2H01 A;  1RQM A;  3ZIV A;  1XIY A;  2H73 A;  2WS2 A;  1OKD A;  4ML1 A;  4ZIJ A;  4GTU A;  5IPG A;  3ZLP A;  2FWG A;  4TRX A;  3L4N A;  2GTU A;  4E8H A;  2HI7 A;  2EIO A;  1JLV A;  3ZL5 A;  2DSA A;  3RPN A;  2VAF A;  1SJI A;  4WF4 A;  5IOW A;  4K7O A;  3HYP A;  4IW9 A;  1XW9 A;  2GT5 A;  4ZXG A;  1ILO A;  5J9B A;  4G10 A;  1XZO A;  3IK9 A;  1EZK A;  4WKW A;  3A3T A;  4PQ1 A;  3EMP A;  2HRN A;  4NHZ A;  5F05 A;  5HR0 A;  3H8Q A;  3IDV A;  9GSS A;  4OFM A;  4WR4 A;  4Q5R A;  4NXI A;  3ZTL A;  1DE2 A;  1M99 A;  1M2D A;  3BCI A;  5D93 A;  2MMO A;  1EV9 A;  2B5E A;  4K1F A;  1BAY A;  2E7P A;  1YDK A;  2DJK A;  2YWI A;  4QQ7 A;  3KH9 A;  1A23 A;  2XBI A;  4L8E A;  1OC9 B;  4JBB A;  3TJF A;  4KW6 A;  3KTL A;  2MBS A;  4N30 A;  2FD3 A;  3LFL A;  4KDU A;  2TRC P;  1A0F A;  5IQY A;  3Q18 A;  1BG5 A;  2HSH A;  1A8L A;  5B6N A;  5H5R A;  2NTO A;  1QQ2 A;  2DIZ A;  3W8S A;  1SKS B;  2QC7 A;  2CX3 A;  3LSZ A;  1B48 A;  1URM A;  1O8X A;  5ECS A;  3H4K A;  1ZYE A;  2B5Y A;  4X0X A;  2OA7 A;  4HU7 A;  3ZML A;  5AIS A;  4MPF A;  5ELG A;  2I3Y A;  3RHC A;  5HQP A;  3QD9 A;  1K3O A;  2GSR A;  3FEU A;  3EYT A;  1HD2 A;  5ECR B;  3IAM 2;  5HFI A;  4YAV A;  2I1U A;  2C3T A;  2ZUP A;  1SU9 A;  4OMV A;  2KHP A;  2IN3 A;  1EOG A;  2B1K A;  2E0Q A;  4FH8 A;  4EE0 A;  2J9H A;  3N5O A;  2QGV A;  3WD6 A;  3GIX A;  3GL5 A;  3KGK A;  4OD7 A;  2H6X A;  3H79 A;  4GSS A;  3M9K A;  2GVP A;  3TRP A;  2JZS A;  3KP9 A;  1FG4 A;  2J23 A;  4MZB A;  3GN3 A;  1W89 A;  2WZ9 A;  4MJB A;  1XOA A;  3Q74 A;  2M80 A;  3UEM A;  1EP8 A;  4PNG A;  4TOP A;  4NV2 A;  4WF5 A;  5H5S A;  1MD4 A;  3KH7 A;  4P3Y B;  5IMF A;  1N2A A;  4CDO A;  3IPZ A;  3GST A;  4K8M A;  1AXD A;  3FRC A;  4V2M A;  1BYE A;  4PUF C;  2CA8 A;  3IOS A;  3E3E A;  1OAZ A;  4O7H A;  3CRT A;  5CRW A;  1GH2 A;  2HZE A;  2ZCT A;  2JL4 A;  1PX7 A;  4I6X A;  12GS A;  2C3Q A;  3EIN A;  3LWA A;  5HR1 A;  1T7P B;  1ERV A;  1NW2 A;  2F8A A;  1BQ7 A;  2YPM A;  5CRH A;  4XTS A;  2IL3 A;  2H0H A;  3GV1 A;  3LJR A;  1XOB A;  4OCF A;  5ABR A;  1T8E B;  5EL8 A;  3FZ4 A;  4IBP A;  5LD0 A;  4GQC A;  2LRN A;  1FOV A;  3L9S A;  4XS1 A;  2DMM A;  4MJC A;  2RUF A;  2VCX A;  1EP7 A;  3VPT A;  2H1B A;  4Q5F A;  1YEX A;  2LNT A;  2H1D A;  1AW9 A;  5B8A A;  1B4Q A;  4IN0 A;  10GS A;  1EEJ A;  2TRX A;  1DSB A;  1OC8 A;  4L5O A;  4HUA A;  2AHE A;  1M2A A;  1K0O A;  2VUP A;  4OWY A;  3IK7 A;  1DBY A;  1SYX A;  3O76 A;  1T4Y A;  2VM2 A;  3CMI A;  3TKR A;  3QMX A;  2LNS A;  5D9V A;  1JFU A;  1FVK A;  2EIR A;  4AJ6 A;  1K0N A;  3GKK A;  3ERF A;  4EF0 A;  3VI7 A;  1PX6 A;  5F0G A;  2IMK A;  3F3Q A;  4FIW A;  1XFL A;  3KM6 A;  5KEJ A;  5A4W A;  1O8W A;  3LXZ A;  3OR5 A;  1PKW A;  3IHQ A;  2OKA A;  1HNC A;  2ES7 A;  1F37 A;  3VPQ A;  2GZY A;  1SK2 A;  4TXV A;  2K18 A;  2YP6 A;  2YZH A;  4J56 E;  4RI6 A;  5D73 A;  2O89 A;  2N5F A;  2YV7 A;  4L0W A;  4O5R A;  2YWN A;  1R26 A;  2P31 A;  3CYN A;  5E59 A;  3D4T A;  3C7M A;  3ZIT A;  3DIE A;  2FWE A;  4EXJ A;  4POM A;  1Y6E A;  4KB3 A;  4HU9 A;  2C0E A;  3CTG A;  1YQ1 A;  5ID2 A;  3BD2 A;  1T4Z A;  2QSI A;  3FR6 A;  3I9V 2;  2EIQ A;  2C80 A;  4HS1 A;  1M9B A;  2MMZ A;  5KN3 A;  2HXK A;  4ML6 A;  2CVK A;  3ISO A;  1A8Y A;  1EV4 A;  4RQR A;  1TK0 B;  3GNJ A;  2C4J A;  3I43 A;  5D96 A;  3NOF A;  1FB0 A;  1FB6 A;  5F8B A;  1TU7 A;  2E2M A;  4KCA A;  5E4W A;  4CW9 A;  7GSS A;  5ECM B;  2A4V A;  5H5Q A;  3SBC A;  1X5E A;  1MDK A;  2IME A;  2WJU A;  6GST A;  3ZZX A;  3W8J A;  1GTI A;  3S9F A;  5B7C A;  2K6V A;  2PGT A;  4GCI A;  2VOC A;  3O6T A;  1ERW A;  3KP8 A;  1O6J A;  1PGT A;  4AF2 A;  3PH9 A;  4DSS A;  3DWV A;  1VF4 A;  2D2Z A;  3LGC A;  4AGS A;  4XS4 A;  4YQV A;  3VWX A;  4HI7 A;  3QAV A;  4MA9 A;  1SD9 A;  3P8W A;  2FWF A;  3WYW A;  1S3D A;  1AQV A;  4YQU A;  5A5K A;  1AQW A;  4ECJ A;  1GP1 A;  2LJR A;  6GSY A;  3SWL A;  1V98 A;  2LEG A;  2H0I A;  4NV5 A;  4G9H A;  4H86 A;  1OKT A;  2N5A A;  2QKE A;  3VWU A;  2C3N A;  2R2J A;  1V2A A;  4EDZ A;  1Q98 A;  3IAS 2;  3UJ1 A;  2L4Q A;  2FWH A;  1TXX A;  4YAP A;  3IXR A;  3EMX A;  5FWG A;  3U6V A;  3FK8 A;  3IV4 A;  3EUR A;  5GST A;  1THX A;  4V1A p;  2N5B A;  5DQS A;  1NSW A;  3P90 A;  4KDX A;  4N10 A;  1SJ6 A;  2IFQ A;  3F3R A;  1ZL9 A;  1UA5 A;  2X8H A;  1BX9 A;  1EGO A;  2RM6 A;  1XCC A;  3MNG A;  3GUS A;  3UOM A;  1B8X A;  1DE1 A;  3HJM A;  3L0H A;  2ZNM A;  4HQZ A;  2YNX A;  4V1A g;  2EC4 A;  1SYR A;  3LEF A;  3VUR A;  3KTB A;  2HLS A;  2X8G A;  1GSE A;  3TKS C;  2H6Y A;  2MBT A;  2ALB A;  3MWH A;  5DCG A;  1VF1 A;  4WBR D;  4JR4 A;  2HRF A;  1X5D A;  1TRV A;  2X64 A;  2C0G A;  4O32 A;  5C00 A;  1K0M A;  2R4V A;  3IA1 A;  5FT3 A;  1SL1 B;  1M7T A;  3DRN A;  4I2U A;  1F9M A;  3J7Y b;  20GS A;  4I97 A;  4ZB6 A;  2K9F A;  2GZP A;  5B6M A;  2M46 A;  3KMN A;  2YWO A;  1YF1 A;  1R7H A;  1XBS A;  4YQM A;  4TW5 A;  3L9U A;  3KZQ A;  2GS3 A;  3Q6O A;  1RW1 A;  2FY6 A;  3VK9 A;  4IP1 A;  4ZB8 A;  4BVY A;  2VD0 A;  3TB2 A;  3C1R A;  5ECP B;  4TN8 A;  4AJ7 A;  2G2Q A;  1GLQ A;  1U87 A;  4GXZ A;  1XPV A;  2B3S A;  2H72 A;  2NPB A;  4HDE A;  1RK4 A;  3DGQ A;  1I9D A;  1YZX A;  2GQL A;  5G1L A;  5JWR B;  2YN1 A;  4XIH A;  3M0F A;  1G7O A;  1AUC A;  1N8J A;  4MJA A;  3ZIJ A;  4MH2 A;  4D73 B;  5IMV A;  3KCM A;  4KDY A;  2IWT A;  2YJH A;  4JE1 A;  2I9H A;  2DIY A;  3WGD A;  3CXG A;  3QCP A;  3HJO A;  4NWY A;  5G5F A;  2RUE A;  5AGY A;  2XC2 A;  5ID2 B;  1IYI A;  1GSQ A;  2L4C A;  5LCZ A;  2CVD A;  3W6G A;  2CAI A;  1WE0 A;  4DVC A;  2B7K A;  1QUW A;  5GZZ B;  3TCO A;  3WGE A; 
#chains in the Genus database with same CATH topology
 2H19 A;  2LQQ A;  3VWV A;  1USB A;  2A4H A;  2O85 A;  2PVO C;  5GAN D;  2YV9 A;  5KN2 A;  2B7J A;  1Z6M A;  5D9X A;  1LU4 A;  3FR3 A;  2VM1 A;  1R5A A;  5HFG A;  1ZOF A;  2F3M A;  4LMW A;  1LBK A;  1ABA A;  4L0U A;  5HR2 A;  3QR6 A;  2P5Q A;  4CHS A;  3ZVJ A;  4TXO B;  5J9C A;  4HEA 2;  3TOU A;  22GS A;  2K8V A;  2I4A A;  3NZN A;  4PNF A;  3GTU B;  4DSS B;  5F07 A;  2IIY A;  2WDU A;  1E6B A;  3KXO A;  2NDO A;  1GSD A;  1PMT A;  2V32 A;  1M9A A;  4J2F A;  1ZYQ B;  1AQX A;  19GS A;  1X9M B;  4ZBD A;  2VL9 A;  5G31 A;  1H75 A;  2LRT A;  1SKR B;  1XXU A;  4XHM A;  3UVH A;  1QXH A;  4XCS A;  1OE8 A;  3FMW A;  2CV4 A;  1HNA A;  2CAQ A;  4ZL7 A;  5KOW A;  1AC1 A;  5ECI B;  4POL A;  4KE3 A;  5DAL A;  1Z5Y E;  4MP4 A;  2HFD A;  3MSZ A;  2IFQ B;  1YEP A;  5IMA A;  5DVB A;  1SJZ A;  2DJJ A;  2GDR A;  2O7K A;  1EOH A;  4KND A;  4N0V A;  4NMU A;  1WPI A;  3DYR A;  1M2B A;  3F9U A;  5LNK e;  2AUV A;  1Z6N A;  4K2X A;  1WIK A;  3H93 A;  4PTS A;  1ERT A;  1HYU A;  4FYB A;  1YKC A;  3GRX A;  4IKH A;  3LQ7 A;  4GQF A;  1X9W B;  2MYG A;  2R5G A;  4JZQ A;  1SKW B;  2JAC A;  2KLX A;  4KSO A;  1WJK A;  2OBI A;  1VF3 A;  4EL1 A;  1TOF A;  5GAP D;  2LUS A;  1MTC A;  1OYJ A;  1ML6 A;  2IPA A;  3DVX A;  1EGR A;  1A0R P;  3D4M A;  4MZW A;  4N0Z A;  3GH6 A;  4K0N A;  3CSH A;  3P2A A;  4EUY A;  2DKI A;  3WT1 A;  4HJ2 A;  2H71 A;  2V2G A;  3HXS A;  5COH A;  1F2E A;  4BWQ A;  5C04 A;  4JR6 A;  3ERG A;  4USS A;  2KOK A;  2WUL A;  2HNL A;  4ISD A;  5EVO A;  3BBY A;  3U5R E;  3UIW A;  4WBJ A;  3FKF A;  5IIZ A;  4ICY A;  1MDJ A;  1UC7 A;  1UN2 A;  3D22 A;  1JZR A;  2MZC A;  2AJQ B;  3F6F A;  2WB9 A;  1FAA A;  3R2Q A;  4TR4 A;  4WR5 A;  2DJ1 A;  4BWS A;  1J9B A;  2PVQ A;  4K9Z A;  1Q4J A;  3HVX A;  4PUA A;  1ZCP A;  2DJ2 A;  2B1L A;  1CQG A;  3DVW A;  1S3C A;  4GRF A;  2IJY A;  3F0I A;  1ON4 A;  3TJJ A;  4EO3 A;  2OBK A;  4TR1 A;  14GS A;  4TKY A;  4O92 A;  3D21 A;  2I81 A;  2DBC A;  2V6O A;  4ACS A;  3IC4 A;  6GSS A;  4K2D A;  1EEM A;  3G7I A;  3CTF A;  1TK8 B;  3KMO A;  2H30 A;  2HSM A;  4GST A;  3HVV A;  1O7U A;  3L78 A;  5J41 A;  1Y25 A;  3DD3 A;  2FNO A;  2DKH A;  3VLN A;  2GQM A;  1F6M C;  1G0T A;  3C1S A;  5CNW A;  2JAD A;  3QFB C;  3EC3 A;  3HHV A;  3J7Y k;  3C8E A;  4V2L A;  4FYC A;  1GSF A;  5G2Z A;  1FO5 A;  3A5I A;  1ST9 A;  1U3I A;  3IC8 A;  2RM5 A;  2JZT A;  2LJK A;  1TRS A;  2AAW A;  3L9V A;  1ZMA A;  5JWQ B;  3RAZ A;  3N9J A;  3HD5 A;  4DSR A;  2E2G A;  4OO4 A;  5A4U A;  4WEY A;  3PIN A;  3RHB A;  5IMC A;  4PQI A;  4OO5 A;  5BRT A;  1XWA A;  3CSI A;  1V9W A;  2GSS A;  4PUR A;  4EDY A;  3TJG A;  2DML A;  1VGL A;  2JSZ A;  2O8V B;  1K0D A;  2VL2 C;  2AB6 A;  3V1W A;  1OC9 A;  1JHB A;  3UAR A;  1THO A;  2IMF A;  2BJX A;  1JZO A;  1K0A A;  3RPP A;  2VCW A;  4HJM A;  3PGT A;  3HCZ A;  2WRT A;  1VRS D;  1KBN A;  17GS A;  1ZYP A;  1TU8 A;  3GX0 A;  1TI1 A;  1F3B A;  1TI3 A;  3IE3 A;  1GWC A;  3APS A;  1SK0 A;  1T00 A;  3EU3 A;  3WT2 A;  1KTE A;  3F63 A;  4N11 A;  1GLP A;  4MNN A;  3F6D A;  1ACV A;  1Z3E A;  2GT6 A;  4MF7 A;  3I6A A;  2CZ2 A;  5D9T A;  2OJL A;  4IJ3 A;  2HSY A;  4PXO A;  4I5Q A;  2HYX A;  1GNE A;  1FW1 A;  3EVI A;  5G1K A;  2HZE B;  1GL8 A;  1PA3 A;  5IO0 A;  3DXB A;  1PL2 A;  4PGT A;  3ZMK A;  4ID0 A;  2OE0 A;  2C0D A;  4G19 A;  2ON5 A;  4HZ4 A;  6GSW A;  1B9Y C;  4RUV A;  5D9W A;  4K7I A;  2MMN A;  3UAP A;  5CRG A;  3TGZ A;  3ZFL A;  4EVM A;  4ZL8 A;  18GS A;  3EPT A;  3LOR A;  3FZ9 A;  1SD8 A;  2H76 A;  2H1A A;  1ZZY A;  1A24 A;  4V2N A;  1U6T A;  2H75 A;  1WP0 A;  3D0Z A;  4MDC A;  1NM3 A;  1O81 A;  3HKR A;  3NIV A;  2X4A A;  2KP2 A;  2C0F A;  4ECI A;  5GSS A;  3HDC A;  2OAC A;  2P5R A;  1K3Y A;  1U88 A;  4EC0 A;  4Q5N A;  4RQX A;  1XW5 A;  3PR8 A;  5F06 A;  1F3A A;  1X9S B;  3IR4 A;  2GSQ A;  3FHK A;  3LW9 A;  3ERW A;  1TTZ A;  1KEB A;  2K8S A;  4XS6 A;  1UVZ A;  5ECL B;  2BMX A;  3G7J A;  3C73 A;  1HNB A;  1A2M A;  3GH9 A;  2VLU A;  3APQ A;  3QAW A;  1A2L A;  3BJ5 A;  4IJI A;  2L59 A;  1FVJ A;  4EIP A;  2F8F A;  2KP1 A;  4CY6 A;  3ZRD A;  5IOX A;  1MD3 A;  3UVT A;  3O3T A;  4OCE A;  5EY6 A;  1H4O A;  3TKQ A;  2FCH A;  5CP1 A;  3VI5 A;  3EU4 A;  5DDL A;  2H1G A;  2PMT A;  2VIM A;  1QGV A;  3TJB A;  3GSS A;  3GMF A;  11GS A;  4BL7 A;  2LST A;  2LV3 A;  1XWB A;  3LYP A;  1C72 A;  1I5G A;  5CRE A;  2O87 A;  3KIJ A;  4MAB A;  3AY8 A;  2X99 A;  3ZFB A;  4FO5 A;  1G7E A;  1TKD B;  4BA7 A;  4F82 A;  4POB A;  2YZU A;  3A5W A;  2V1M A;  4IGJ A;  5L71 A;  2HZF A;  1WRY A;  1VF2 A;  2PUK C;  3MDK A;  4QL9 A;  2HRK A;  4I8B A;  3FW2 A;  2H66 A;  4JRR A;  5JCG A;  3BOA A;  3GX8 A;  1OC3 A;  3TDG A;  4NPB A;  1Z7R A;  2B5X A;  1GSY A;  3GFK A;  4F2I A;  1Z7P A;  1R5P A;  5J3R A;  2F9S A;  3GKX A;  2H6Z A;  3CSJ A;  5G5E A;  1PD2 1;  4MPG A;  1OE7 A;  1HQO A;  1GUM A;  4KCE A;  5CAX A;  5ECH B;  5D8I A;  4KGI A;  3K8N A;  4Z7X A;  1O85 A;  4XS4 B;  3RDW A;  4J57 E;  5IM9 A;  2V41 A;  1O73 A;  2R0G A;  5G30 A;  1NHY A;  1SK1 A;  2FHE A;  5IO2 A;  1T3B A;  4HZ2 A;  2PBJ A;  5DBQ A;  4BVX A;  1FOH A;  5HR3 A;  5ELA A;  2R6K A;  2DLX A;  2XBQ A;  4MK3 A;  4I2T A;  2R0C A;  1GSS A;  3FYG A;  4KX4 A;  1SL0 B;  4TR0 A;  2PWJ A;  1DUG A;  1QK8 A;  5EPF A;  2M72 A;  2OE1 A;  1GNW A;  3GKM A;  3HZ4 A;  4JED A;  1V40 A;  1B4P A;  4X4J A;  1JLW A;  4F9Z A;  4ZL9 A;  4RI7 A;  4MZC A;  5J5N A;  1AIU A;  4KSM A;  1GUL A;  2H70 A;  4GF0 A;  3M9J A;  4IEL A;  3RBT A;  3F8U A;  4LL4 B;  1PFO A;  1BJX A;  3QPM A;  6GSU A;  2R0P A;  5IMZ A;  2REM A;  2GST A;  4KA0 A;  2DJ0 A;  4Z2U A;  2F51 A;  5JWO B;  1GRX A;  1JZW A;  4IHU A;  3EE2 A;  1GUK A;  2BTO T;  4ILF A;  1LJR A;  3TRQ A;  3IBH A;  2XPE A;  4WXT A;  2L5L A;  5AN1 A;  1S3A A;  2H0G A;  2L6D A;  3F4R A;  4GLT A;  2RLI A;  2X49 A;  3GYK A;  1PQN A;  4HQS A;  4G2E A;  1X5C A;  2HE3 A;  5DAK A;  2WFC A;  2GGT A;  3DML A;  2YOI A;  3HZ8 A;  4IVF A;  2H8L A;  4A5P A;  1XVQ A;  4IS0 A;  4BVY B;  16GS A;  3QOU A;  3FY7 A;  2ON7 A;  2C1Y A;  3US3 A;  2HT9 A;  4K6X A;  1SL2 B;  1TDI A;  2GZZ A;  1R4W A;  4F0B A;  3M8N A;  5KN0 A;  1A2J A;  3A2X A;  2TIR A;  3TUE A;  2GQK A;  1CQH A;  3TRX A;  2PER A;  3C71 A;  3G9B A;  3GA4 A;  1NHO A;  2R3X A;  4DSQ A;  1GUH A;  4ZB9 A;  1PRX A;  3DKS A;  2PPT A;  3ZVJ D;  2NVL A;  1YF0 A;  2XPD A;  4LMV A;  2B6M A;  1XVW A;  8GSS A;  4KH7 A;  4ZIL A;  3TOT A;  1XWG A;  3KJY A;  3TKS E;  4G0L A;  4F0C A;  3KD0 A;  1YKA A;  1E2Y A;  3JCM L;  5AIX A;  1SEN A;  2LS5 A;  2FLS A;  4IP6 A;  4ZBB A;  3M3M A;  3Q19 A;  1TK5 B;  1XWC A;  5DJM A;  2VLV A;  3PPU A;  2L57 A;  3APO A;  1ERU A;  5HFK A;  2OE3 A;  1PL1 A;  2Z9S A;  3ED3 A;  2AV4 A;  2YCD A;  5DJL A;  4WET A;  2V6K A;  5KN1 A;  4L5L A;  3ZYW A;  4PX1 A;  2WCI A;  5ECO B;  3GL3 A;  1EWX A;  3CQF A;  5INY A;  4IQ1 A;  3H1N A;  4GWR A;  1K0B A;  1XW6 A;  3LXT A;  5JCU A;  4OFN A;  2A2S A;  3HJP A;  5ECN B;  4ZBA A;  4MLY A;  1BED A;  1B9X C;  1G6Y A;  4LA1 A;  5J4U A;  4D73 A;  4OFT A;  2VCT A;  4ECC A;  2CX4 A;  2GLR A;  4TVE A;  5ECQ B;  2YJ7 A;  3HVS A;  4KAE A;  3ZRE A;  2LKU A;  4NAX A;  3TKP A;  1MEK A;  2XHF A;  2QA2 A;  3M1G A;  1G6W A;  3LG6 A;  1J08 A;  1TW9 A;  3G7Y A;  4XRD A;  3F4S A;  1GTB A;  4MF5 A;  2KUC A;  2L5O A;  1JZD A;  3P7X A;  3MIX A;  2CZ3 A;  1WWJ A;  1TJD A;  1T1V A;  1ZYN A;  1WMJ A;  1PN9 A;  3WGX A;  4NHW A;  4ECB A;  2FGX A;  1Z9H A;  4MF6 A;  3KEB A;  2WGR A;  5DAL B;  3CRU A;  3FZA A;  5JCW A;  2G0F A;  3GUR A;  1X0R A;  3UBK A;  5FHI A;  3VFI A;  3ME7 A;  1V57 A;  1V58 A;  4E8E A;  3E0U A;  4IQA A;  5A4V A;  2VL3 A;  2VCZ A;  3QAG A;  1YJ6 A;  5CYY A;  4TXO A;  1PKZ A;  4K7N A;  5B8B A;  2DC5 A;  5IPH A;  3A2W A;  2CQ9 A;  1QMV A;  3GTU A;  3EWL A;  1K0C A;  2X8C A;  3D6I A;  2PU9 C;  4Q5Q A;  3HA9 A;  4QL7 A;  1TP9 A;  4MH3 A;  2YAN A;  1MDI A;  4MMM A;  4HOJ A;  1QFN A;  3GHA A;  4LL1 B;  1IYH A;  4POK A;  4TR3 A;  4KUN A;  2R37 A;  1W4V A;  1AAZ A;  1U3A A;  2MMA A;  2VL2 A;  3FR9 A;  2OAD A;  2NBS A;  5ENU A;  5AIV A;  4DEJ A;  5ECK B;  1OVN A;  4MCU A;  4FYU A;  3I69 A;  1YY7 A;  3IRA A;  1J0F A;  2VCQ A;  4GSN A;  1KNG A;  3VWW A;  1GSU A;  5DAK B;  2LQO A;  2VCV A;  3BCK A;  4PQH A;  3MAK A;  2CVB A;  4K0G A;  3E9J B;  2P0G A;  2FA4 A;  4BPY A;  3FZ5 A;  5IMD A;  2IMI A;  3QDN A;  4X43 A;  2PN8 A;  4ULX A;  2JSY A;  4XRA A;  3LYK A;  2LTK A;  6GSV A;  4MJE A;  6GSX A;  2YWM A;  3D5J A;  2L6C A;  3UL3 A;  1FHE A;  4AJ8 A;  4F03 A;  2VLT A;  4X1U A;  3DEX A;  4LLR A;  3UBL A;  1K3L A;  3ME8 A;  2H74 A;  2AYT A;  2DJ3 A;  1PSQ A;  3CBU A;  4EKZ A;  2HRA A;  1GTU A;  2LRC A;  1TRU A;  2RII A;  1WOU A;  2FUG 2;  2A2R A;  5DQY A;  2C8U A;  2CT6 A;  1ZGN A;  2IMD A;  2JZR A;  5CRD A;  1XWK A;  2VD1 A;  2LJA A;  3UMA A;  3TKS A;  3GKN A;  3QFA C;  5DCH A;  13GS A;  2JU5 A;  1GTA A;  4JU5 A;  5CO3 A;  1TRW A;  3A2V A;  1M0U A;  2VO4 A;  3HY2 A;  4Z2T A;  2FA8 A;  5BMU A;  4TR1 B;  3F4T A;  4YH2 A;  3TJK A;  2H01 A;  1RQM A;  3ZIV A;  1XIY A;  2H73 A;  2WS2 A;  1OKD A;  4ML1 A;  4ZIJ A;  4GTU A;  5IPG A;  3ZLP A;  2FWG A;  4TRX A;  3L4N A;  2GTU A;  4E8H A;  2HI7 A;  2EIO A;  1JLV A;  3ZL5 A;  2DSA A;  1S3R A;  3RPN A;  2VAF A;  1SJI A;  4WF4 A;  5IOW A;  4K7O A;  3HYP A;  4IW9 A;  1XW9 A;  2GT5 A;  4ZXG A;  1ILO A;  5J9B A;  4G10 A;  1XZO A;  3IK9 A;  1EZK A;  4WKW A;  3A3T A;  4O5Q A;  4PQ1 A;  4KF9 A;  3EMP A;  2HRN A;  4NHZ A;  5F05 A;  5HR0 A;  3H8Q A;  3IDV A;  9GSS A;  4OFM A;  4WR4 A;  4Q5R A;  4NXI A;  3ZTL A;  1DE2 A;  1M99 A;  1M2D A;  3BCI A;  5D93 A;  2MMO A;  1EV9 A;  2B5E A;  4K1F A;  1BAY A;  2E7P A;  1YDK A;  4HSC X;  2DJK A;  2YWI A;  4QQ7 A;  3KH9 A;  1A23 A;  2XBI A;  4L8E A;  1OC9 B;  4JBB A;  3TJF A;  5KOX A;  4KW6 A;  3KTL A;  2MBS A;  4N30 A;  2FD3 A;  3LFL A;  4KDU A;  2TRC P;  1A0F A;  5IQY A;  3Q18 A;  1BG5 A;  2HSH A;  1A8L A;  5B6N A;  5H5R A;  2NTO A;  1QQ2 A;  2DIZ A;  3W8S A;  1SKS B;  2QC7 A;  2CX3 A;  3LSZ A;  1B48 A;  1URM A;  1O8X A;  5ECS A;  3H4K A;  1ZYE A;  2B5Y A;  4X0X A;  2OA7 A;  4HU7 A;  3ZML A;  5AIS A;  4MPF A;  5ELG A;  2I3Y A;  3RHC A;  5HQP A;  3QD9 A;  1K3O A;  2GSR A;  3FEU A;  3EYT A;  1HD2 A;  5ECR B;  3IAM 2;  5HFI A;  4YAV A;  2I1U A;  2C3T A;  2ZUP A;  1SU9 A;  4OMV A;  2KHP A;  2IN3 A;  1EOG A;  2B1K A;  2E0Q A;  4BIK A;  4FH8 A;  4EE0 A;  2J9H A;  3N5O A;  2QGV A;  3WD6 A;  3GIX A;  3GL5 A;  3KGK A;  4OD7 A;  2H6X A;  3H79 A;  4GSS A;  3M9K A;  2GVP A;  3TRP A;  2JZS A;  3KP9 A;  1FG4 A;  2J23 A;  4MZB A;  3GN3 A;  1W89 A;  2WZ9 A;  4MJB A;  1XOA A;  3Q74 A;  4EIQ A;  2M80 A;  3UEM A;  1EP8 A;  4PNG A;  4TOP A;  4NV2 A;  4WF5 A;  4G0K A;  5H5S A;  1MD4 A;  3KH7 A;  4P3Y B;  5IMF A;  1N2A A;  4CDO A;  3IPZ A;  3GST A;  4K8M A;  1AXD A;  3FRC A;  4V2M A;  1BYE A;  4PUF C;  2CA8 A;  3IOS A;  3E3E A;  1OAZ A;  4O7H A;  3CRT A;  5CRW A;  1GH2 A;  1M3J A;  2HZE A;  2ZCT A;  2JL4 A;  1PX7 A;  4I6X A;  12GS A;  2C3Q A;  3EIN A;  3LWA A;  5HR1 A;  1T7P B;  1ERV A;  1NW2 A;  2F8A A;  1BQ7 A;  2YPM A;  5CRH A;  4XTS A;  2IL3 A;  2H0H A;  3GV1 A;  3LJR A;  1XOB A;  4OCF A;  5ABR A;  1T8E B;  5EL8 A;  3FZ4 A;  4IBP A;  5LD0 A;  4GQC A;  2LRN A;  1FOV A;  3L9S A;  4XS1 A;  2DMM A;  4MJC A;  2RUF A;  2VCX A;  1EP7 A;  3VPT A;  2H1B A;  4Q5F A;  1YEX A;  2LNT A;  2H1D A;  1AW9 A;  5B8A A;  1B4Q A;  4IN0 A;  10GS A;  1EEJ A;  2TRX A;  3MYD A;  4BL7 B;  1DSB A;  1OC8 A;  4L5O A;  4HUA A;  2AHE A;  1M2A A;  1K0O A;  2VUP A;  4OWY A;  3IK7 A;  1DBY A;  1SYX A;  3O76 A;  1T4Y A;  2VM2 A;  3CMI A;  3TKR A;  3QMX A;  2LNS A;  1XG8 A;  5D9V A;  1JFU A;  1FVK A;  2EIR A;  4AJ6 A;  1K0N A;  3GKK A;  3ERF A;  4EF0 A;  3VI7 A;  1PX6 A;  5F0G A;  2IMK A;  3F3Q A;  4FIW A;  1XFL A;  3KM6 A;  5KEJ A;  5A4W A;  4CY8 A;  1O8W A;  3LXZ A;  3OR5 A;  1PKW A;  3IHQ A;  2OKA A;  1HNC A;  2ES7 A;  1F37 A;  3VPQ A;  2GZY A;  1SK2 A;  4TXV A;  2K18 A;  2YP6 A;  2YZH A;  4J56 E;  4RI6 A;  5D73 A;  2O89 A;  2N5F A;  4K5R A;  2YV7 A;  4L0W A;  4O5R A;  2YWN A;  1R26 A;  2P31 A;  3CYN A;  5E59 A;  3D4T A;  3C7M A;  3ZIT A;  3DIE A;  2FWE A;  4EXJ A;  4POM A;  1Y6E A;  4KB3 A;  4HU9 A;  4FQU A;  2C0E A;  2UZ8 A;  3CTG A;  1YQ1 A;  5ID2 A;  3BD2 A;  1T4Z A;  2QSI A;  3FR6 A;  3I9V 2;  2EIQ A;  2C80 A;  4BVX B;  4HS1 A;  1M9B A;  2MMZ A;  5KN3 A;  2HXK A;  4ML6 A;  2CVK A;  4G0I A;  3ISO A;  1A8Y A;  1EV4 A;  4RQR A;  1TK0 B;  3GNJ A;  4YKF A;  2C4J A;  3I43 A;  5D96 A;  3NOF A;  1FB0 A;  1FB6 A;  5F8B A;  1TU7 A;  2E2M A;  4KCA A;  5E4W A;  4CW9 A;  7GSS A;  2QA1 A;  5ECM B;  2A4V A;  5H5Q A;  3SBC A;  1X5E A;  1MDK A;  2IME A;  2WJU A;  6GST A;  3ZZX A;  3W8J A;  1GTI A;  3S9F A;  5B7C A;  2K6V A;  2PGT A;  4GCI A;  2VOC A;  3O6T A;  1ERW A;  3KP8 A;  1O6J A;  1PGT A;  4Z2R A;  4AF2 A;  3PH9 A;  4DSS A;  3DWV A;  1VF4 A;  2D2Z A;  3LGC A;  4AGS A;  4XS4 A;  4YQV A;  3VWX A;  1PN0 A;  4HI7 A;  3QAV A;  4MA9 A;  1SD9 A;  3P8W A;  2FWF A;  3WYW A;  1S3D A;  1AQV A;  4YQU A;  5A5K A;  1AQW A;  4ECJ A;  1M3I A;  1GP1 A;  2LJR A;  6GSY A;  3SWL A;  1V98 A;  2LEG A;  2H0I A;  4NV5 A;  4G9H A;  4H86 A;  1OKT A;  2N5A A;  2QKE A;  3VWU A;  3IHG A;  2C3N A;  2R2J A;  1V2A A;  4EDZ A;  1Q98 A;  3IAS 2;  3UJ1 A;  2L4Q A;  2FWH A;  1TXX A;  4YAP A;  3IXR A;  3EMX A;  5FWG A;  3U6V A;  3FK8 A;  3IV4 A;  3EUR A;  5GST A;  1THX A;  4V1A p;  2N5B A;  5DQS A;  1NSW A;  3P90 A;  4KDX A;  4N10 A;  1SJ6 A;  2IFQ A;  2A2P A;  3F3R A;  1ZL9 A;  1UA5 A;  2X8H A;  1BX9 A;  1EGO A;  4K5S A;  2RM6 A;  1XCC A;  3MNG A;  3GUS A;  3UOM A;  1B8X A;  1DE1 A;  3HJM A;  3L0H A;  2ZNM A;  4HQZ A;  2YNX A;  4V1A g;  2EC4 A;  1SYR A;  3LEF A;  3VUR A;  3R3E A;  3KTB A;  2HLS A;  2X8G A;  1GSE A;  3TKS C;  2H6Y A;  2MBT A;  2ALB A;  3MWH A;  5DCG A;  1VF1 A;  4WBR D;  4JR4 A;  2HRF A;  1X5D A;  1TRV A;  2X64 A;  2C0G A;  3HVN A;  4O32 A;  5C00 A;  1K0M A;  2R4V A;  3IA1 A;  5FT3 A;  1SL1 B;  1M7T A;  3DRN A;  4I2U A;  1F9M A;  3J7Y b;  20GS A;  4I97 A;  4ZB6 A;  2K9F A;  2GZP A;  5B6M A;  2M46 A;  3KMN A;  2YWO A;  1YF1 A;  1R7H A;  1XBS A;  4YQM A;  4TW5 A;  3L9U A;  3KZQ A;  2GS3 A;  3Q6O A;  1RW1 A;  2FY6 A;  3VK9 A;  4IP1 A;  4ZB8 A;  4BVY A;  2VD0 A;  3TB2 A;  3C1R A;  5ECP B;  4TN8 A;  4AJ7 A;  2G2Q A;  1GLQ A;  1U87 A;  4GXZ A;  1XPV A;  2B3S A;  2H72 A;  2NPB A;  4HDE A;  1RK4 A;  3DGQ A;  1I9D A;  1YZX A;  2GQL A;  5G1L A;  5JWR B;  2YN1 A;  4YKG A;  4O5U A;  4XIH A;  3M0F A;  1G7O A;  1AUC A;  1N8J A;  4MJA A;  3ZIJ A;  4MH2 A;  4D73 B;  5IMV A;  3KCM A;  4KDY A;  2IWT A;  2YJH A;  4JE1 A;  2I9H A;  2DIY A;  3WGD A;  3CXG A;  3QCP A;  3HJO A;  4NWY A;  5G5F A;  2RUE A;  5AGY A;  2XC2 A;  5ID2 B;  1IYI A;  1GSQ A;  2L4C A;  5LCZ A;  2CVD A;  3W6G A;  2CAI A;  1WE0 A;  4DVC A;  2B7K A;  1QUW A;  5GZZ B;  3TCO A;  3WGE A; 
#chains in the Genus database with same CATH homology
 2H19 A;  2LQQ A;  3VWV A;  1USB A;  2A4H A;  2O85 A;  2PVO C;  5GAN D;  2YV9 A;  5KN2 A;  2B7J A;  1Z6M A;  5D9X A;  1LU4 A;  3FR3 A;  2VM1 A;  1R5A A;  5HFG A;  1ZOF A;  2F3M A;  4LMW A;  1LBK A;  1ABA A;  4L0U A;  5HR2 A;  3QR6 A;  2P5Q A;  4CHS A;  3ZVJ A;  4TXO B;  5J9C A;  4HEA 2;  3TOU A;  22GS A;  2K8V A;  2I4A A;  3NZN A;  4PNF A;  3GTU B;  4DSS B;  5F07 A;  2IIY A;  2WDU A;  1E6B A;  3KXO A;  2NDO A;  1GSD A;  1PMT A;  2V32 A;  1M9A A;  4J2F A;  1ZYQ B;  1AQX A;  19GS A;  1X9M B;  4ZBD A;  2VL9 A;  5G31 A;  1H75 A;  2LRT A;  1SKR B;  1XXU A;  4XHM A;  3UVH A;  1QXH A;  4XCS A;  1OE8 A;  3FMW A;  2CV4 A;  1HNA A;  2CAQ A;  4ZL7 A;  5KOW A;  1AC1 A;  5ECI B;  4POL A;  4KE3 A;  5DAL A;  1Z5Y E;  4MP4 A;  2HFD A;  3MSZ A;  2IFQ B;  1YEP A;  5IMA A;  5DVB A;  1SJZ A;  2DJJ A;  2GDR A;  2O7K A;  1EOH A;  4KND A;  4N0V A;  4NMU A;  1WPI A;  3DYR A;  1M2B A;  3F9U A;  5LNK e;  2AUV A;  1Z6N A;  4K2X A;  1WIK A;  3H93 A;  4PTS A;  1ERT A;  1HYU A;  4FYB A;  1YKC A;  3GRX A;  4IKH A;  3LQ7 A;  4GQF A;  1X9W B;  2MYG A;  2R5G A;  4JZQ A;  1SKW B;  2JAC A;  2KLX A;  4KSO A;  1WJK A;  2OBI A;  1VF3 A;  4EL1 A;  1TOF A;  5GAP D;  2LUS A;  1MTC A;  1OYJ A;  1ML6 A;  2IPA A;  3DVX A;  1EGR A;  1A0R P;  3D4M A;  4MZW A;  4N0Z A;  3GH6 A;  4K0N A;  3CSH A;  3P2A A;  4EUY A;  2DKI A;  3WT1 A;  4HJ2 A;  2H71 A;  2V2G A;  3HXS A;  5COH A;  1F2E A;  4BWQ A;  5C04 A;  4JR6 A;  3ERG A;  4USS A;  2KOK A;  2WUL A;  2HNL A;  4ISD A;  5EVO A;  3BBY A;  3U5R E;  3UIW A;  4WBJ A;  3FKF A;  5IIZ A;  4ICY A;  1MDJ A;  1UC7 A;  1UN2 A;  3D22 A;  1JZR A;  2MZC A;  2AJQ B;  3F6F A;  2WB9 A;  1FAA A;  3R2Q A;  4TR4 A;  4WR5 A;  2DJ1 A;  4BWS A;  1J9B A;  2PVQ A;  4K9Z A;  1Q4J A;  3HVX A;  4PUA A;  1ZCP A;  2DJ2 A;  2B1L A;  1CQG A;  3DVW A;  1S3C A;  4GRF A;  2IJY A;  3F0I A;  1ON4 A;  3TJJ A;  4EO3 A;  2OBK A;  4TR1 A;  14GS A;  4TKY A;  4O92 A;  3D21 A;  2I81 A;  2DBC A;  2V6O A;  4ACS A;  3IC4 A;  6GSS A;  4K2D A;  1EEM A;  3G7I A;  3CTF A;  1TK8 B;  3KMO A;  2H30 A;  2HSM A;  4GST A;  3HVV A;  1O7U A;  3L78 A;  5J41 A;  1Y25 A;  3DD3 A;  2FNO A;  2DKH A;  3VLN A;  2GQM A;  1F6M C;  1G0T A;  3C1S A;  5CNW A;  2JAD A;  3QFB C;  3EC3 A;  3HHV A;  3J7Y k;  3C8E A;  4V2L A;  4FYC A;  1GSF A;  5G2Z A;  1FO5 A;  3A5I A;  1ST9 A;  1U3I A;  3IC8 A;  2RM5 A;  2JZT A;  2LJK A;  1TRS A;  2AAW A;  3L9V A;  1ZMA A;  5JWQ B;  3RAZ A;  3N9J A;  3HD5 A;  4DSR A;  2E2G A;  4OO4 A;  5A4U A;  4WEY A;  3PIN A;  3RHB A;  5IMC A;  4PQI A;  4OO5 A;  5BRT A;  1XWA A;  3CSI A;  1V9W A;  2GSS A;  4PUR A;  4EDY A;  3TJG A;  2DML A;  1VGL A;  2JSZ A;  2O8V B;  1K0D A;  2VL2 C;  2AB6 A;  3V1W A;  1OC9 A;  1JHB A;  3UAR A;  1THO A;  2IMF A;  2BJX A;  1JZO A;  1K0A A;  3RPP A;  2VCW A;  4HJM A;  3PGT A;  3HCZ A;  2WRT A;  1VRS D;  1KBN A;  17GS A;  1ZYP A;  1TU8 A;  3GX0 A;  1TI1 A;  1F3B A;  1TI3 A;  3IE3 A;  1GWC A;  3APS A;  1SK0 A;  1T00 A;  3EU3 A;  3WT2 A;  1KTE A;  3F63 A;  4N11 A;  1GLP A;  4MNN A;  3F6D A;  1ACV A;  1Z3E A;  2GT6 A;  4MF7 A;  3I6A A;  2CZ2 A;  5D9T A;  2OJL A;  4IJ3 A;  2HSY A;  4PXO A;  4I5Q A;  2HYX A;  1GNE A;  1FW1 A;  3EVI A;  5G1K A;  2HZE B;  1GL8 A;  1PA3 A;  5IO0 A;  3DXB A;  1PL2 A;  4PGT A;  3ZMK A;  4ID0 A;  2OE0 A;  2C0D A;  4G19 A;  2ON5 A;  4HZ4 A;  6GSW A;  1B9Y C;  4RUV A;  5D9W A;  4K7I A;  2MMN A;  3UAP A;  5CRG A;  3TGZ A;  3ZFL A;  4EVM A;  4ZL8 A;  18GS A;  3EPT A;  3LOR A;  3FZ9 A;  1SD8 A;  2H76 A;  2H1A A;  1ZZY A;  1A24 A;  4V2N A;  1U6T A;  2H75 A;  1WP0 A;  3D0Z A;  4MDC A;  1NM3 A;  1O81 A;  3HKR A;  3NIV A;  2X4A A;  2KP2 A;  2C0F A;  4ECI A;  5GSS A;  3HDC A;  2OAC A;  2P5R A;  1K3Y A;  1U88 A;  4EC0 A;  4Q5N A;  4RQX A;  1XW5 A;  3PR8 A;  5F06 A;  1F3A A;  1X9S B;  3IR4 A;  2GSQ A;  3FHK A;  3LW9 A;  3ERW A;  1TTZ A;  1KEB A;  2K8S A;  4XS6 A;  1UVZ A;  5ECL B;  2BMX A;  3G7J A;  3C73 A;  1HNB A;  1A2M A;  3GH9 A;  2VLU A;  3APQ A;  3QAW A;  1A2L A;  3BJ5 A;  4IJI A;  2L59 A;  1FVJ A;  4EIP A;  2F8F A;  2KP1 A;  4CY6 A;  3ZRD A;  5IOX A;  1MD3 A;  3UVT A;  3O3T A;  4OCE A;  5EY6 A;  1H4O A;  3TKQ A;  2FCH A;  5CP1 A;  3VI5 A;  3EU4 A;  5DDL A;  2H1G A;  2PMT A;  2VIM A;  1QGV A;  3TJB A;  3GSS A;  3GMF A;  11GS A;  4BL7 A;  2LST A;  2LV3 A;  1XWB A;  3LYP A;  1C72 A;  1I5G A;  5CRE A;  2O87 A;  3KIJ A;  4MAB A;  3AY8 A;  2X99 A;  3ZFB A;  4FO5 A;  1G7E A;  1TKD B;  4BA7 A;  4F82 A;  4POB A;  2YZU A;  3A5W A;  2V1M A;  4IGJ A;  5L71 A;  2HZF A;  1WRY A;  1VF2 A;  2PUK C;  3MDK A;  4QL9 A;  2HRK A;  4I8B A;  3FW2 A;  2H66 A;  4JRR A;  5JCG A;  3BOA A;  3GX8 A;  1OC3 A;  3TDG A;  4NPB A;  1Z7R A;  2B5X A;  1GSY A;  3GFK A;  4F2I A;  1Z7P A;  1R5P A;  5J3R A;  2F9S A;  3GKX A;  2H6Z A;  3CSJ A;  5G5E A;  1PD2 1;  4MPG A;  1OE7 A;  1HQO A;  1GUM A;  4KCE A;  5CAX A;  5ECH B;  5D8I A;  4KGI A;  3K8N A;  4Z7X A;  1O85 A;  4XS4 B;  3RDW A;  4J57 E;  5IM9 A;  2V41 A;  1O73 A;  2R0G A;  5G30 A;  1NHY A;  1SK1 A;  2FHE A;  5IO2 A;  1T3B A;  4HZ2 A;  2PBJ A;  5DBQ A;  4BVX A;  1FOH A;  5HR3 A;  5ELA A;  2R6K A;  2DLX A;  2XBQ A;  4MK3 A;  4I2T A;  2R0C A;  1GSS A;  3FYG A;  4KX4 A;  1SL0 B;  4TR0 A;  2PWJ A;  1DUG A;  1QK8 A;  5EPF A;  2M72 A;  2OE1 A;  1GNW A;  3GKM A;  3HZ4 A;  4JED A;  1V40 A;  1B4P A;  4X4J A;  1JLW A;  4F9Z A;  4ZL9 A;  4RI7 A;  4MZC A;  5J5N A;  1AIU A;  4KSM A;  1GUL A;  2H70 A;  4GF0 A;  3M9J A;  4IEL A;  3RBT A;  3F8U A;  4LL4 B;  1BJX A;  3QPM A;  6GSU A;  2R0P A;  5IMZ A;  2REM A;  2GST A;  4KA0 A;  2DJ0 A;  4Z2U A;  2F51 A;  5JWO B;  1GRX A;  1JZW A;  4IHU A;  3EE2 A;  1GUK A;  2BTO T;  4ILF A;  1LJR A;  3TRQ A;  3IBH A;  2XPE A;  4WXT A;  2L5L A;  5AN1 A;  1S3A A;  2H0G A;  2L6D A;  3F4R A;  4GLT A;  2RLI A;  2X49 A;  3GYK A;  1PQN A;  4HQS A;  4G2E A;  1X5C A;  2HE3 A;  5DAK A;  2WFC A;  2GGT A;  3DML A;  2YOI A;  3HZ8 A;  4IVF A;  2H8L A;  4A5P A;  1XVQ A;  4IS0 A;  4BVY B;  16GS A;  3QOU A;  3FY7 A;  2ON7 A;  2C1Y A;  3US3 A;  2HT9 A;  4K6X A;  1SL2 B;  1TDI A;  2GZZ A;  1R4W A;  4F0B A;  3M8N A;  5KN0 A;  1A2J A;  3A2X A;  2TIR A;  3TUE A;  2GQK A;  1CQH A;  3TRX A;  2PER A;  3C71 A;  3G9B A;  3GA4 A;  1NHO A;  2R3X A;  4DSQ A;  1GUH A;  4ZB9 A;  1PRX A;  3DKS A;  2PPT A;  3ZVJ D;  2NVL A;  1YF0 A;  2XPD A;  4LMV A;  2B6M A;  1XVW A;  8GSS A;  4KH7 A;  4ZIL A;  3TOT A;  1XWG A;  3KJY A;  3TKS E;  4G0L A;  4F0C A;  3KD0 A;  1YKA A;  1E2Y A;  3JCM L;  5AIX A;  1SEN A;  2LS5 A;  2FLS A;  4IP6 A;  4ZBB A;  3M3M A;  3Q19 A;  1TK5 B;  1XWC A;  5DJM A;  2VLV A;  3PPU A;  2L57 A;  3APO A;  1ERU A;  5HFK A;  2OE3 A;  1PL1 A;  2Z9S A;  3ED3 A;  2AV4 A;  2YCD A;  5DJL A;  4WET A;  2V6K A;  5KN1 A;  4L5L A;  3ZYW A;  4PX1 A;  2WCI A;  5ECO B;  3GL3 A;  1EWX A;  5INY A;  4IQ1 A;  3H1N A;  4GWR A;  1K0B A;  1XW6 A;  3LXT A;  5JCU A;  4OFN A;  2A2S A;  3HJP A;  5ECN B;  4ZBA A;  4MLY A;  1BED A;  1B9X C;  1G6Y A;  4LA1 A;  5J4U A;  4D73 A;  4OFT A;  2VCT A;  4ECC A;  2CX4 A;  2GLR A;  4TVE A;  5ECQ B;  2YJ7 A;  3HVS A;  4KAE A;  3ZRE A;  2LKU A;  4NAX A;  3TKP A;  1MEK A;  2XHF A;  2QA2 A;  3M1G A;  1G6W A;  3LG6 A;  1J08 A;  1TW9 A;  3G7Y A;  4XRD A;  3F4S A;  1GTB A;  4MF5 A;  2KUC A;  2L5O A;  1JZD A;  3P7X A;  3MIX A;  2CZ3 A;  1WWJ A;  1TJD A;  1T1V A;  1ZYN A;  1WMJ A;  1PN9 A;  3WGX A;  4NHW A;  4ECB A;  2FGX A;  1Z9H A;  4MF6 A;  3KEB A;  2WGR A;  5DAL B;  3CRU A;  3FZA A;  5JCW A;  2G0F A;  3GUR A;  1X0R A;  3UBK A;  5FHI A;  3VFI A;  3ME7 A;  1V57 A;  1V58 A;  4E8E A;  3E0U A;  4IQA A;  5A4V A;  2VL3 A;  2VCZ A;  3QAG A;  1YJ6 A;  5CYY A;  4TXO A;  1PKZ A;  4K7N A;  5B8B A;  2DC5 A;  5IPH A;  3A2W A;  2CQ9 A;  1QMV A;  3GTU A;  3EWL A;  1K0C A;  2X8C A;  3D6I A;  2PU9 C;  4Q5Q A;  3HA9 A;  4QL7 A;  1TP9 A;  4MH3 A;  2YAN A;  1MDI A;  4MMM A;  4HOJ A;  1QFN A;  3GHA A;  4LL1 B;  1IYH A;  4POK A;  4TR3 A;  4KUN A;  2R37 A;  1W4V A;  1AAZ A;  1U3A A;  2MMA A;  2VL2 A;  3FR9 A;  2OAD A;  2NBS A;  5ENU A;  5AIV A;  4DEJ A;  5ECK B;  1OVN A;  4MCU A;  4FYU A;  3I69 A;  1YY7 A;  3IRA A;  1J0F A;  2VCQ A;  4GSN A;  1KNG A;  3VWW A;  1GSU A;  5DAK B;  2LQO A;  2VCV A;  3BCK A;  4PQH A;  3MAK A;  2CVB A;  4K0G A;  3E9J B;  2P0G A;  2FA4 A;  4BPY A;  3FZ5 A;  5IMD A;  2IMI A;  3QDN A;  4X43 A;  2PN8 A;  4ULX A;  2JSY A;  4XRA A;  3LYK A;  2LTK A;  6GSV A;  4MJE A;  6GSX A;  2YWM A;  3D5J A;  2L6C A;  3UL3 A;  1FHE A;  4AJ8 A;  4F03 A;  2VLT A;  4X1U A;  3DEX A;  4LLR A;  3UBL A;  1K3L A;  3ME8 A;  2H74 A;  2AYT A;  2DJ3 A;  1PSQ A;  3CBU A;  4EKZ A;  2HRA A;  1GTU A;  2LRC A;  1TRU A;  2RII A;  1WOU A;  2FUG 2;  2A2R A;  5DQY A;  2C8U A;  2CT6 A;  1ZGN A;  2IMD A;  2JZR A;  5CRD A;  1XWK A;  2VD1 A;  2LJA A;  3UMA A;  3TKS A;  3GKN A;  3QFA C;  5DCH A;  13GS A;  2JU5 A;  1GTA A;  4JU5 A;  5CO3 A;  1TRW A;  3A2V A;  1M0U A;  2VO4 A;  3HY2 A;  4Z2T A;  2FA8 A;  5BMU A;  4TR1 B;  3F4T A;  4YH2 A;  3TJK A;  2H01 A;  1RQM A;  3ZIV A;  1XIY A;  2H73 A;  2WS2 A;  1OKD A;  4ML1 A;  4ZIJ A;  4GTU A;  5IPG A;  3ZLP A;  2FWG A;  4TRX A;  3L4N A;  2GTU A;  4E8H A;  2HI7 A;  2EIO A;  1JLV A;  3ZL5 A;  2DSA A;  3RPN A;  2VAF A;  1SJI A;  4WF4 A;  5IOW A;  4K7O A;  3HYP A;  4IW9 A;  1XW9 A;  2GT5 A;  4ZXG A;  1ILO A;  5J9B A;  4G10 A;  1XZO A;  3IK9 A;  1EZK A;  4WKW A;  3A3T A;  4O5Q A;  4PQ1 A;  4KF9 A;  3EMP A;  2HRN A;  4NHZ A;  5F05 A;  5HR0 A;  3H8Q A;  3IDV A;  9GSS A;  4OFM A;  4WR4 A;  4Q5R A;  4NXI A;  3ZTL A;  1DE2 A;  1M99 A;  1M2D A;  3BCI A;  5D93 A;  2MMO A;  1EV9 A;  2B5E A;  4K1F A;  1BAY A;  2E7P A;  1YDK A;  2DJK A;  2YWI A;  4QQ7 A;  3KH9 A;  1A23 A;  2XBI A;  4L8E A;  1OC9 B;  4JBB A;  3TJF A;  5KOX A;  4KW6 A;  3KTL A;  2MBS A;  4N30 A;  2FD3 A;  3LFL A;  4KDU A;  2TRC P;  1A0F A;  5IQY A;  3Q18 A;  1BG5 A;  2HSH A;  1A8L A;  5B6N A;  5H5R A;  2NTO A;  1QQ2 A;  2DIZ A;  3W8S A;  1SKS B;  2QC7 A;  2CX3 A;  3LSZ A;  1B48 A;  1URM A;  1O8X A;  5ECS A;  3H4K A;  1ZYE A;  2B5Y A;  4X0X A;  2OA7 A;  4HU7 A;  3ZML A;  5AIS A;  4MPF A;  5ELG A;  2I3Y A;  3RHC A;  5HQP A;  3QD9 A;  1K3O A;  2GSR A;  3FEU A;  3EYT A;  1HD2 A;  5ECR B;  3IAM 2;  5HFI A;  4YAV A;  2I1U A;  2C3T A;  2ZUP A;  1SU9 A;  4OMV A;  2KHP A;  2IN3 A;  1EOG A;  2B1K A;  2E0Q A;  4FH8 A;  4EE0 A;  2J9H A;  3N5O A;  2QGV A;  3WD6 A;  3GIX A;  3GL5 A;  3KGK A;  4OD7 A;  2H6X A;  3H79 A;  4GSS A;  3M9K A;  2GVP A;  3TRP A;  2JZS A;  3KP9 A;  1FG4 A;  2J23 A;  4MZB A;  3GN3 A;  1W89 A;  2WZ9 A;  4MJB A;  1XOA A;  3Q74 A;  4EIQ A;  2M80 A;  3UEM A;  1EP8 A;  4PNG A;  4TOP A;  4NV2 A;  4WF5 A;  4G0K A;  5H5S A;  1MD4 A;  3KH7 A;  4P3Y B;  5IMF A;  1N2A A;  4CDO A;  3IPZ A;  3GST A;  4K8M A;  1AXD A;  3FRC A;  4V2M A;  1BYE A;  4PUF C;  2CA8 A;  3IOS A;  3E3E A;  1OAZ A;  4O7H A;  3CRT A;  5CRW A;  1GH2 A;  2HZE A;  2ZCT A;  2JL4 A;  1PX7 A;  4I6X A;  12GS A;  2C3Q A;  3EIN A;  3LWA A;  5HR1 A;  1T7P B;  1ERV A;  1NW2 A;  2F8A A;  1BQ7 A;  2YPM A;  5CRH A;  4XTS A;  2IL3 A;  2H0H A;  3GV1 A;  3LJR A;  1XOB A;  4OCF A;  5ABR A;  1T8E B;  5EL8 A;  3FZ4 A;  4IBP A;  5LD0 A;  4GQC A;  2LRN A;  1FOV A;  3L9S A;  4XS1 A;  2DMM A;  4MJC A;  2RUF A;  2VCX A;  1EP7 A;  3VPT A;  2H1B A;  4Q5F A;  1YEX A;  2LNT A;  2H1D A;  1AW9 A;  5B8A A;  1B4Q A;  4IN0 A;  10GS A;  1EEJ A;  2TRX A;  3MYD A;  4BL7 B;  1DSB A;  1OC8 A;  4L5O A;  4HUA A;  2AHE A;  1M2A A;  1K0O A;  2VUP A;  4OWY A;  3IK7 A;  1DBY A;  1SYX A;  3O76 A;  1T4Y A;  2VM2 A;  3CMI A;  3TKR A;  3QMX A;  2LNS A;  5D9V A;  1JFU A;  1FVK A;  2EIR A;  4AJ6 A;  1K0N A;  3GKK A;  3ERF A;  4EF0 A;  3VI7 A;  1PX6 A;  5F0G A;  2IMK A;  3F3Q A;  4FIW A;  1XFL A;  3KM6 A;  5KEJ A;  5A4W A;  4CY8 A;  1O8W A;  3LXZ A;  3OR5 A;  1PKW A;  3IHQ A;  2OKA A;  1HNC A;  2ES7 A;  1F37 A;  3VPQ A;  2GZY A;  1SK2 A;  4TXV A;  2K18 A;  2YP6 A;  2YZH A;  4J56 E;  4RI6 A;  5D73 A;  2O89 A;  2N5F A;  4K5R A;  2YV7 A;  4L0W A;  4O5R A;  2YWN A;  1R26 A;  2P31 A;  3CYN A;  5E59 A;  3D4T A;  3C7M A;  3ZIT A;  3DIE A;  2FWE A;  4EXJ A;  4POM A;  1Y6E A;  4KB3 A;  4HU9 A;  4FQU A;  2C0E A;  2UZ8 A;  3CTG A;  1YQ1 A;  5ID2 A;  3BD2 A;  1T4Z A;  2QSI A;  3FR6 A;  3I9V 2;  2EIQ A;  2C80 A;  4BVX B;  4HS1 A;  1M9B A;  2MMZ A;  5KN3 A;  2HXK A;  4ML6 A;  2CVK A;  4G0I A;  3ISO A;  1A8Y A;  1EV4 A;  4RQR A;  1TK0 B;  3GNJ A;  4YKF A;  2C4J A;  3I43 A;  5D96 A;  3NOF A;  1FB0 A;  1FB6 A;  5F8B A;  1TU7 A;  2E2M A;  4KCA A;  5E4W A;  4CW9 A;  7GSS A;  2QA1 A;  5ECM B;  2A4V A;  5H5Q A;  3SBC A;  1X5E A;  1MDK A;  2IME A;  2WJU A;  6GST A;  3ZZX A;  3W8J A;  1GTI A;  3S9F A;  5B7C A;  2K6V A;  2PGT A;  4GCI A;  2VOC A;  3O6T A;  1ERW A;  3KP8 A;  1O6J A;  1PGT A;  4Z2R A;  4AF2 A;  3PH9 A;  4DSS A;  3DWV A;  1VF4 A;  2D2Z A;  3LGC A;  4AGS A;  4XS4 A;  4YQV A;  3VWX A;  1PN0 A;  4HI7 A;  3QAV A;  4MA9 A;  1SD9 A;  3P8W A;  2FWF A;  3WYW A;  1S3D A;  1AQV A;  4YQU A;  5A5K A;  1AQW A;  4ECJ A;  1GP1 A;  2LJR A;  6GSY A;  3SWL A;  1V98 A;  2LEG A;  2H0I A;  4NV5 A;  4G9H A;  4H86 A;  1OKT A;  2N5A A;  2QKE A;  3VWU A;  3IHG A;  2C3N A;  2R2J A;  1V2A A;  4EDZ A;  1Q98 A;  3IAS 2;  3UJ1 A;  2L4Q A;  2FWH A;  1TXX A;  4YAP A;  3IXR A;  3EMX A;  5FWG A;  3U6V A;  3FK8 A;  3IV4 A;  3EUR A;  5GST A;  1THX A;  4V1A p;  2N5B A;  5DQS A;  1NSW A;  3P90 A;  4KDX A;  4N10 A;  1SJ6 A;  2IFQ A;  2A2P A;  3F3R A;  1ZL9 A;  1UA5 A;  2X8H A;  1BX9 A;  1EGO A;  4K5S A;  2RM6 A;  1XCC A;  3MNG A;  3GUS A;  3UOM A;  1B8X A;  1DE1 A;  3HJM A;  3L0H A;  2ZNM A;  4HQZ A;  2YNX A;  4V1A g;  2EC4 A;  1SYR A;  3LEF A;  3VUR A;  3R3E A;  3KTB A;  2HLS A;  2X8G A;  1GSE A;  3TKS C;  2H6Y A;  2MBT A;  2ALB A;  3MWH A;  5DCG A;  1VF1 A;  4WBR D;  4JR4 A;  2HRF A;  1X5D A;  1TRV A;  2X64 A;  2C0G A;  4O32 A;  5C00 A;  1K0M A;  2R4V A;  3IA1 A;  5FT3 A;  1SL1 B;  1M7T A;  3DRN A;  4I2U A;  1F9M A;  3J7Y b;  20GS A;  4I97 A;  4ZB6 A;  2K9F A;  2GZP A;  5B6M A;  2M46 A;  3KMN A;  2YWO A;  1YF1 A;  1R7H A;  1XBS A;  4YQM A;  4TW5 A;  3L9U A;  3KZQ A;  2GS3 A;  3Q6O A;  1RW1 A;  2FY6 A;  3VK9 A;  4IP1 A;  4ZB8 A;  4BVY A;  2VD0 A;  3TB2 A;  3C1R A;  5ECP B;  4TN8 A;  4AJ7 A;  2G2Q A;  1GLQ A;  1U87 A;  4GXZ A;  1XPV A;  2B3S A;  2H72 A;  2NPB A;  4HDE A;  1RK4 A;  3DGQ A;  1I9D A;  1YZX A;  2GQL A;  5G1L A;  5JWR B;  2YN1 A;  4YKG A;  4O5U A;  4XIH A;  3M0F A;  1G7O A;  1AUC A;  1N8J A;  4MJA A;  3ZIJ A;  4MH2 A;  4D73 B;  5IMV A;  3KCM A;  4KDY A;  2IWT A;  2YJH A;  4JE1 A;  2I9H A;  2DIY A;  3WGD A;  3CXG A;  3QCP A;  3HJO A;  4NWY A;  5G5F A;  2RUE A;  5AGY A;  2XC2 A;  5ID2 B;  1IYI A;  1GSQ A;  2L4C A;  5LCZ A;  2CVD A;  3W6G A;  2CAI A;  1WE0 A;  4DVC A;  2B7K A;  1QUW A;  5GZZ B;  3TCO A;  3WGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...