4ZIJA

Crystal structure of e.coli dsba in complex with 2-(4-iodophenylsulfonamido) benzoic acid
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
188
structure length
188
Chain Sequence
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Thiol:disulfide interchange protein DsbA
publication title Determination of ligand binding modes in weak protein-ligand complexes using sparse NMR data.
pubmed doi rcsb
source organism Escherichia coli
total genus 65
structure length 188
sequence length 188
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4zijA00
2P5QA 2IFQB 4MH2A 3RHCA 2CAQA 1GSEA 3A2VA 4ML6A 2C0DA 1GSSA 3EU4A 5H5QA 2LJRA 3HJOA 1Q98A 2VOCA 4MDCA 3DIEA 1EGRA 1K0BA 2AUVA 3TKSA 2E2MA 1UA5A 2O7KA 17GSA 4HJ2A 2TRXA 2L4CA 2P0GA 3IPZA 1PN9A 4X0XA 2GT5A 1TRSA 2FLSA 3L78A 5GSSA 2H66A 3HZ8A 1EEJA 4GF0A 3UJ1A 3TKSC 3TKPA 1KBNA 2PUKC 1X5EA 4DSSA 6GSVA 1EGOA 2I4AA 3LEFA 5F05A 2MBTA 2FUG2 3GH6A 2JU5A 5HQPA 5B8AA 1QQ2A 4IQAA 5ABRA 1E6BA 4MJCA 1LBKA 3EVIA 4I2TA 2M80A 5CYYA 2V32A 5A4VA 2IFQA 1SYRA 4ZXGA 4ZBDA 3UARA 3CBUA 2CVBA 3N9JA 4L5LA 4Z7XA 2PVQA 4MP4A 3IXRA 3RBTA 4GLTA 5E4WA 4IJ3A 1OC9B 4MCUA 2PERA 2P5RA 5DBQA 3FZAA 1O85A 4QL9A 2XBQA 3AY8A 4I2UA 4DVCA 1J9BA 3LYPA 1XWAA 3TCOA 3WGEA 1TI1A 4FH8A 3FEUA 5ECHB 3QCPA 3GHAA 5HR2A 4BWQA 1M2BA 4POMA 3GH9A 2LQOA 3J7Yk 2I1UA 3O3TA 2GS3A 3HD5A 1FVJA 1A23A 2DMMA 5IPGA 2HI7A 4JU5A 4ECJA 5ECPB 3P90A 5INYA 4Q5QA 1OE7A 1EV9A 4PQ1A 8GSSA 1M9BA 1LJRA 2JADA 2H72A 3ZL5A 2LNTA 4N0VA 2DJ2A 1TTZA 2QKEA 2HLSA 1OC9A 6GSUA 1ZCPA 5IMFA 3D21A 3HVXA 3IV4A 1ZYEA 1NM3A 3GFKA 2IPAA 2FA8A 2HFDA 3IAM2 22GSA 3O76A 3WT1A 1T3BA 14GSA 1AW9A 1TP9A 5IMAA 3CRTA 1Q4JA 2LQQA 3KMNA 2VL2A 4TKYA 3LWAA 2GSQA 1G6YA 5B6NA 2H0IA 2A4VA 3D22A 2H6XA 3Q74A 3C7MA 3MDKA 4L0UA 5HFGA 2R3XA 2VL2C 5EL8A 2WULA 1SD8A 2DJKA 6GSTA 2YV7A 2CQ9A 3CMIA 3DMLA 1MEKA 5KN0A 2L4QA 2H30A 1PL2A 1T8EB 3ZZXA 3UEMA 5EVOA 5A4WA 3PGTA 4KGIA 4I8BA 2YWOA 1T1VA 3ME7A 2C0FA 1N8JA 1GRXA 2N5BA 1TW9A 2R6KA 3KH9A 4MJBA 3ZFLA 1URMA 2IMFA 3EURA 1N2AA 3E0UA 1QGVA 4POLA 4HU9A 3FY7A 1XOBA 2TIRA 3NIVA 3IAS2 4DEJA 2FHEA 3DD3A 2F9SA 2KLXA 4LMVA 4HQSA 1G0TA 1H75A 2NPBA 4KDXA 1X0RA 1GUHA 4NAXA 1R4WA 4KB3A 2TRCP 13GSA 3H79A 1SU9A 3ZVJD 2I81A 3RPPA 2LUSA 2MBSA 1OE8A 3VPTA 1GULA 2H0GA 1PX6A 4ECIA 4TR1A 3KTLA 3DXBA 1WIKA 5D9WA 4KX4A 1SL1B 4YAVA 2DMLA 3W6GA 3FR9A 4BVYA 1V2AA 3LORA 4ULXA 4ZL8A 4HS1A 4JR4A 1HYUA 5J41A 5IQYA 5CP1A 4O92A 1WJKA 5D9VA 1DSBA 4E8HA 2VM1A 4F82A 4WR5A 3QDNA 2EIQA 1XW6A 4N0ZA 4JR6A 4OO4A 2RM6A 2OBKA 1YDKA 3TOUA 1TU7A 2QGVA 1M2AA 2AAWA 2GSTA 3LFLA 4N10A 5G2ZA 3H93A 3M9KA 10GSA 4TRXA 3C71A 1ZMAA 4TR3A 4GSNA 4HEA2 4PQIA 5CRHA 5ECMB 4EO3A 1GNWA 4XS1A 1FB6A 4GCIA 4J57E 3QMXA 4HU7A 5G5EA 2L59A 1GSQA 3EU3A 4NHZA 3ERFA 4BVXA 5AN1A 1ACVA 1BX9A 1JZRA 2E7PA 4F9ZA 4X1UA 3C8EA 4MK3A 3C73A 1K0CA 4N30A 3QFBC 2I9HA 2VD0A 3F4TA 4QL7A 1AC1A 1GNEA 1VF4A 3TKQA 4EF0A 1EV4A 1OAZA 2M72A 4JEDA 2JSYA 3FZ4A 4ZB9A 2WZ9A 2V6KA 3J7Yb 1GWCA 5IMVA 3ZLPA 1KEBA 4WBRD 3S9FA 1B4QA 2VIMA 5DAKA 1GLQA 1TRVA 2FA4A 4WXTA 3VPQA 1VGLA 3TJBA 2MMAA 1XIYA 3IK9A 4MABA 4YQUA 4ILFA 1T7PB 3PINA 2CAIA 1ERTA 1ILOA 5EY6A 4HJMA 2BTOT 4KSOA 1SENA 1TK5B 1WE0A 5ECLB 2L6DA 1XBSA 3LGCA 5AIXA 1TRWA 3G7JA 1K0AA 1ZGNA 20GSA 5DCGA 3GKNA 3ZFBA 5J5NA 2L5OA 2KUCA 3GA4A 4LA1A 1YEPA 5L71A 2JZRA 3A3TA 3DVXA 5F07A 1XVQA 5LD0A 3RPNA 1LU4A 2EIOA 2REMA 3KEBA 1J0FA 1X5DA 1OKDA 5CRGA 1VF2A 2HSYA 1K0OA 2L57A 3HXSA 2VAFA 4IP1A 3GNJA 4HZ2A 3VI7A 3QAVA 5CNWA 2AJQB 1OYJA 2B1LA 4EC0A 2VD1A 1ST9A 3G7YA 6GSXA 2LTKA 4I5QA 1YKCA 1T4ZA 3BJ5A 4PXOA 1GUKA 1TRUA 1ERVA 1A2MA 3VK9A 5EPFA 4HDEA 4K7NA 1ON4A 4FO5A 3QD9A 3HY2A 1AQXA 1HNCA 3TB2A 2H19A 4O32A 2H70A 4ECBA 1DUGA 5GAND 4KSMA 2VCZA 3M0FA 4TOPA 2H76A 1A2LA 2GTUA 2XC2A 1VF3A 2YCDA 1R26A 3M8NA 5ENUA 2PVOC 3GURA 3K8NA 4XS4B 3BBYA 3ZYWA 1B9XC 2YZHA 1SL2B 3DKSA 1GUMA 5ECKB 2FWHA 2HXKA 1S3AA 5IO0A 5HFKA 3ME8A 4MPGA 4AJ6A 3QOUA 1XPVA 4LL4B 3WGXA 3H8QA 2MMOA 4EDZA 3E9JB 3KP9A 5C04A 5A4UA 5C00A 1VRSD 3BCIA 3EMXA 5IOWA 2C1YA 5CREA 3HCZA 3WGDA 3GL5A 1NSWA 3US3A 1O6JA 4MPFA 1JZOA 1BG5A 1FO5A 1B8XA 2XPDA 2B7KA 3ZIVA 3VLNA 2KOKA 3DVWA 1DBYA 3VI5A 4O5RA 3FZ9A 4AGSA 3G9BA 1FAAA 2IMEA 1BQ7A 2H1GA 2C3TA 4YQMA 5AGYA 3F4RA 3PH9A 3KP8A 3VURA 2L6CA 5FHIA 5ECIB 4K0GA 4RUVA 1E2YA 4MLYA 1X9SB 1X5CA 2KHPA 3VFIA 2RUFA 19GSA 2GZYA 3F0IA 4QQ7A 4JE1A 4KAEA 4WKWA 3HZ4A 4V1Ap 1OC3A 4RQXA 3ERGA 1HNBA 1S3DA 3IHQA 1GSFA 4PUAA 1Z5YE 3FRCA 3APQA 5D9TA 4I97A 1BYEA 2O85A 3WT2A 4IGJA 3TJGA 3EYTA 2KP2A 3QFAC 5DCHA 2DSAA 1QK8A 3EWLA 1JZDA 5D93A 1M9AA 1O81A 4KCAA 4EL1A 1I9DA 1THOA 4AJ8A 2A2SA 3EMPA 2YN1A 4EKZA 1UVZA 2PGTA 1EZKA 1SK0A 4PURA 2EIRA 3GKMA 3GTUB 5IPHA 2B5YA 3GN3A 4L8EA 3QAGA 1CQHA 5ELAA 3TJFA 3L9SA 4MJAA 3UL3A 5JCWA 1BJXA 4P3YB 3KH7A 2K9FA 3KMOA 3UOMA 2YWMA 1J08A 1I5GA 4WF4A 1A24A 5E59A 4POKA 2DLXA 3TGZA 3D4TA 3W8JA 1FHEA 3IRAA 3HVVA 1XZOA 1TDIA 5COHA 3HA9A 1T00A 4O7HA 2B6MA 4KA0A 5HR3A 2LNSA 3ZMKA 4OFTA 3VWUA 2C80A 3IR4A 5KEJA 3F8UA 3D6IA 2FGXA 2YNXA 2C3NA 4F2IA 1YF1A 2X8GA 3TKSE 2OE0A 2HE3A 3DWVA 2ON7A 3FYGA 4GQCA 5J9CA 1EOGA 2GQKA 5AISA 1EEMA 1TKDB 1C72A 4ZL9A 4BWSA 2DJJA 1V9WA 1BEDA 2C3QA 2M46A 2PU9C 3GTUA 1ZL9A 1X9MB 3I9V2 4GSTA 2PMTA 4HOJA 1SK1A 2CZ3A 2P31A 2GGTA 2K8VA 2B1KA 5H5RA 1B48A 3QR6A 2C8UA 3MAKA 2LKUA 6GSWA 3MWHA 2K8SA 1HD2A 4F03A 5IM9A 1M2DA 2H1DA 4ISDA 2HRNA 2B5XA 3UIWA 1WMJA 1JFUA 1MTCA 5HR0A 4ML1A 2XBIA 1V98A 1UN2A 4ZBBA 2PPTA 5F0GA 2H0HA 1R5PA 2MZCA 1YEXA 4N11A 2WFCA 3FW2A 1XWGA 3VWWA 3Q19A 4PNGA 2VCXA 5JWQB 5CAXA 3APOA 1FG4A 2JZTA 2LJAA 5CRDA 1CQGA 2FWGA 1F9MA 4TXVA 2WGRA 2C0EA 1F3AA 3Q18A 2WS2A 2F51A 2ZUPA 2LS5A 3MSZA 3DEXA 2WDUA 5G31A 3GX8A 4IELA 5IIZA 3D4MA 3IC4A 1THXA 2YV9A 4RQRA 2LRNA 2V41A 3QPMA 5DALB 2JZSA 1O73A 3ZITA 2VCWA 4MJEA 2HZFA 2CVDA 2YWIA 1MDIA 3TRXA 3TKRA 1A0RP 3HVSA 2X8HA 1OVNA 1V58A 4ZILA 4PX1A 4F0CA 4TN8A 4OCEA 1R5AA 3CSHA 4V2LA 2L5LA 2FD3A 4K9ZA 2PN8A 1JLWA 1K0DA 1HQOA 1M0UA 5FWGA 1ZZYA 4X43A 1FB0A 3EE2A 2PWJA 3C1SA 3TRPA 1A0FA 4KNDA 4WBJA 3HJPA 4ECCA 1K3OA 3W8SA 1M7TA 2YOIA 2YP6A 3CRUA 1JHBA 18GSA 1DE2A 4KE3A 5D8IA 5DDLA 2AHEA 2F8AA 3UBLA 3L4NA 1PMTA 3GMFA 4XRAA 3F63A 5DALA 4G2EA 4DSRA 2JACA 2LSTA 3RAZA 1B9YC 1RQMA 3ZVJA 3LXZA 4KUNA 4DSQA 4LL1B 2B3SA 1XWCA 4TR0A 1GTAA 4IJIA 2CT6A 4NMUA 2XPEA 1TI3A 2X99A 5J3RA 2V6OA 3JCML 3KM6A 3L0HA 2HT9A 2FNOA 2DJ3A 1PRXA 4G10A 4HQZA 4GQFA 2I3YA 3F9UA 2O89A 2A2RA 4G9HA 5GSTA 4NHWA 4KW6A 5F06A 2QC7A 5KN2A 1AXDA 1PKZA 4IKHA 2OACA 4D73B 3HHVA 1PQNA 5KN3A 1U3IA 4K1FA 3RDWA 5KN1A 3LSZA 3TRQA 2IWTA 4FIWA 1AQVA 4YQVA 5IO2A 2OADA 4TW5A 1GSUA 1QFNA 6GSSA 2CX4A 4GTUA 4K7IA 4GSSA 2ZCTA 1V40A 1O8WA 4K2DA 2G0FA 5AIVA 1K3LA 3ERWA 3PR8A 2VCQA 3G7IA 4EXJA 3UVTA 5B8BA 1AIUA 5ECQB 3Q6OA 1Z7PA 4BPYA 1U3AA 3P2AA 4ZBAA 5ECRB 1T4YA 3I6AA 3I69A 1VF1A 3H4KA 4MF7A 3L9UA 4V2NA 1EP7A 5D96A 3CXGA 3LJRA 4D73A 5ECOB 3WYWA 1B4PA 3CSIA 3IBHA 3GIXA 3C1RA 2H8LA 3IOSA 1JLVA 5JWOB 4IS0A 1DE1A 2WRTA 3CSJA 3KZQA 1OC8A 4HI7A 1TU8A 2C4JA 2GLRA 5B7CA 2X64A 5F8BA 3GSTA 3M9JA 2R37A 4CW9A 1EOHA 1F3BA 2RLIA 4HUAA 1XW9A 4LLRA 2K18A 1Z6NA 2IMIA 4MF5A 4Q5NA 2OE3A 2VL3A 4IHUA 1AUCA 3WD6A 1QUWA 5A5KA 4OMVA 2YZUA 2B5EA 2NBSA 5D9XA 3KCMA 1M99A 2HNLA 4V2MA 2V1MA 4XRDA 1NHOA 2FWFA 1AAZA 4RI6A 2DIYA 1PL1A 2YWNA 3R2QA 1GTBA 2H71A 7GSSA 1XVWA 1GSYA 4PNFA 3GL3A 4MH3A 4OCFA 4XIHA 5ECNB 3ZMLA 4OWYA 1SJZA 2YPMA 2BMXA 1PKWA 1YQ1A 3V1WA 1SJ6A 4H86A 4WETA 4XS4A 2VL9A 4JRRA 1K0NA 1WWJA 1GTIA 2F8FA 2FWEA 2VLUA 1EWXA 3ZIJA 1XWKA 3KTBA 2AYTA 2ON5A 2H01A 1G7EA 4XS6A 3KD0A 2DIZA 2VCTA 4JZQA 4ZB6A 1WP0A 1U6TA 3KGKA 4NXIA 2ZNMA 4HZ4A 4GXZA 1A8LA 2WB9A 4K7OA 4F0BA 1SL0B 1U88A 4JBBA 3F3QA 3UMAA 1O8XA 5DQSA 2LRCA 2C0GA 2GZZA 3TOTA 4GWRA 2GZPA 1UC7A 4OFNA 2RM5A 2CVKA 3OR5A 2GQLA 1SD9A 3UBKA 3H1NA 16GSA 2R2JA 4KDYA 2JSZA 2VLVA 2R5GA 1R7HA 3SWLA 2NDOA 4IP6A 5ECSA 2LV3A 3DRNA 4TVEA 2RUEA 3LXTA 4EUYA 2ES7A 2F3MA 4YAPA 3D5JA 2BJXA 1ABAA 3BCKA 2G2QA 1WPIA 4PQHA 2GVPA 2HSHA 3CTGA 2YJ7A 5DVBA 2O8VB 3A2WA 4YH2A 1V57A 3GRXA 3FHKA 2JL4A 3TDGA 1IYIA 3QAWA 4ACSA 4XTSA 5D73A 3U5RE 3M3MA 1FW1A 4AF2A 3GUSA 1GL8A 3ZREA 1HNAA 3SBCA 4LMWA 2V2GA 3DYRA 4MF6A 2H73A 1SK2A 4CHSA 4IN0A 1MDKA 4J2FA 5LCZA 2GSRA 3ZRDA 2H6ZA 4TR1B 2H1BA 4V1Ag 1TK8B 12GSA 1G6WA 3F6DA 1SYXA 6GSYA 3IA1A 3VWVA 1Z3EA 1TOFA 4OO5A 2MMNA 4FYCA 2IMKA 3UVHA 2VM2A 1PD21 1USBA 2FY6A 5FT3A 2IJYA 1U87A 5CO3A 3O6TA 3KJYA 3U6VA 3GX0A 4NV2A 1XOAA 3BD2A 3GKKA 1YZXA 2WJUA 1TXXA 4ID0A 2O87A 3P8WA 4K0NA 2OBIA 3KIJA 2H1AA 2XHFA 3GV1A 4KDUA 3D0ZA 3HKRA 3CTFA 2NVLA 5JWRB 4E8EA 1MDJA 2KP1A 2X8CA 3HJMA 1ZOFA 1K0MA 3EINA 4IQ1A 4KCEA 5IMCA 3UAPA 4K6XA 3GYKA 3E3EA 4NV5A 1KNGA 1NHYA 3L9VA 1SJIA 4MA9A 3TJJA 1F37A 2Z9SA 4ZB8A 1YKAA 1YF0A 4XCSA 4WR4A 2EC4A 5DJMA 4OFMA 2IL3A 2OKAA 4NWYA 2MYGA 4AJ7A 1FOVA 5ID2B 3HYPA 1IYHA 3TJKA 1F2EA 2YJHA 1ERUA 5GAPD 1XFLA 2OA7A 5G30A 4EE0A 2R4VA 4IVFA 2H74A 1SKSB 5JCUA 3M1GA 5DJLA 2HYXA 4MZCA 5G5FA 4RI7A 5DAKB 3ED3A 3NZNA 1QXHA 4L0WA 3IK7A 4PGTA 1NW2A 2CZ2A 3CYNA 3NOFA 1A8YA 4I6XA 4TXOB 3FR6A 1K3YA 3ISOA 4NPBA 4FYUA 4GRFA 1PA3A 5IMZA 2MMZA 1W89A 3IE3A 1S3CA 1XW5A 3LYKA 5JCGA 2GT6A 5HFIA 2YANA 1PX7A 3FK8A 3I43A 3LG6A 2PBJA 2H75A 2OJLA 5ID2A 2GDRA 3DGQA 2HZEB 2ALBA 1GLPA 1X9WB 2GSSA 1Y25A 2K6VA 3FR3A 5H5SA 4K8MA 1XXUA 2CA8A 4J56E 5J4UA 1MD3A 5ELGA 3A2XA 3F6FA 4BL7A 2H6YA 2B7JA 1Z7RA 3F3RA 4FYBA 2QSIA 3F4SA 3ZTLA 2IN3A 1RK4A 2LJKA 1A2JA 1FVKA 2LEGA 2WCIA 4TXOA 3APSA 2DC5A 2J23A 4BA7A 2DBCA 2FCHA 5HR1A 1Z9HA 2D2ZA 2GQMA 1PSQA 3RHBA 5LNKe 1TK0B 3KXOA 1O7UA 2N5FA 1F6MC 5IMDA 4CDOA 2E0QA 3FKFA 2VCVA 1SKWB 1H4OA 1ERWA 1JZWA 5IOXA 2NTOA 2IIYA 2HRFA 4Q5FA 2CX3A 1YY7A 5DQYA 4MZBA 4EDYA 3BOAA 3MNGA 2N5AA 1G7OA 4MZWA 3HDCA 2HZEA 2VUPA 1RW1A 1OKTA 5J9BA 1GP1A 3VWXA 4WEYA 2LRTA 1KTEA 5GZZB 3GKXA 2E2GA 3FZ5A 11GSA 2AB6A 4MMMA 4IW9A 1WOUA 2OE1A 4G19A 3LQ7A 5G1LA 2VLTA 4PUFC 9GSSA 4XHMA 2IMDA 4TR4A 3TUEA 1MD4A 1GTUA 1GSDA 1XWBA 1Y6EA 2VO4A 1ML6A 4WF5A 1PGTA 3IDVA 4OD7A 1GH2A 3N5OA 2AV4A 1AQWA 1YJ6A 1SKRB 1TJDA 1Z6MA 4ZL7A 3EC3A 1WRYA 3GSSA 4IBPA 5B6MA 1EP8A 4DSSB 1W4VA 2J9HA 4L5OA 4POBA 1BAYA 4KH7A 1ZYQB 5CRWA 1QMVA 1XCCA 2DJ1A 4ZIJA 4EVMA 2DJ0A 2CV4A 3P7XA 3A5WA 5G1KA 2RIIA 4Q5RA
chains in the Genus database with same CATH superfamily
2P5QA 2IFQB 4MH2A 3RHCA 2CAQA 1GSEA 3A2VA 4ML6A 2C0DA 1GSSA 3EU4A 5H5QA 2LJRA 3FMWA 3HJOA 1Q98A 2VOCA 4MDCA 3DIEA 1EGRA 1K0BA 2AUVA 3TKSA 2E2MA 3IHGA 1UA5A 2O7KA 17GSA 4HJ2A 2TRXA 2L4CA 2R0PA 2P0GA 3IPZA 1PN9A 4X0XA 2GT5A 1TRSA 2FLSA 3L78A 5GSSA 2H66A 3HZ8A 1EEJA 4GF0A 3UJ1A 3TKSC 3TKPA 1KBNA 2PUKC 1X5EA 4DSSA 6GSVA 1EGOA 4O5UA 2I4AA 3LEFA 5F05A 2MBTA 2FUG2 3GH6A 2JU5A 5HQPA 5B8AA 1QQ2A 4IQAA 5ABRA 1E6BA 4MJCA 1LBKA 3EVIA 4I2TA 4YKGA 2M80A 5CYYA 2V32A 5A4VA 2IFQA 1SYRA 4ZXGA 4ZBDA 3UARA 3CBUA 2CVBA 3N9JA 4L5LA 4Z7XA 2PVQA 4MP4A 3IXRA 3RBTA 4GLTA 5E4WA 4IJ3A 1OC9B 4MCUA 2PERA 2P5RA 5DBQA 3FZAA 1O85A 4QL9A 2XBQA 3AY8A 4I2UA 4DVCA 1J9BA 3LYPA 1XWAA 3TCOA 2QA2A 3WGEA 1TI1A 4FH8A 3FEUA 5ECHB 3QCPA 3GHAA 5HR2A 4BWQA 1M2BA 4POMA 3GH9A 2LQOA 3J7Yk 2I1UA 3O3TA 2GS3A 3HD5A 1FVJA 1A23A 2DMMA 5IPGA 2HI7A 4JU5A 4ECJA 5ECPB 3P90A 5INYA 4Q5QA 1OE7A 1EV9A 4PQ1A 8GSSA 1M9BA 1LJRA 2JADA 2H72A 3ZL5A 2LNTA 4N0VA 2DJ2A 1TTZA 2QKEA 2HLSA 1OC9A 6GSUA 1ZCPA 5IMFA 1ZYPA 3D21A 3HVXA 3IV4A 1ZYEA 1NM3A 3GFKA 2IPAA 2FA8A 2HFDA 3IAM2 22GSA 4CY6A 3O76A 3WT1A 1T3BA 14GSA 1AW9A 1TP9A 5IMAA 3CRTA 1Q4JA 2LQQA 3KMNA 2VL2A 4TKYA 3LWAA 2GSQA 1G6YA 5B6NA 2H0IA 2A4VA 3D22A 2H6XA 3Q74A 3C7MA 3MDKA 4L0UA 5HFGA 2R3XA 2VL2C 5EL8A 2WULA 1SD8A 2DJKA 6GSTA 2YV7A 2CQ9A 3CMIA 3DMLA 1MEKA 5KN0A 2L4QA 2H30A 1PL2A 1T8EB 3ZZXA 3UEMA 5EVOA 5A4WA 3PGTA 4KGIA 4BVYB 4I8BA 2YWOA 1T1VA 3ME7A 2C0FA 1N8JA 1GRXA 2N5BA 1TW9A 5KOWA 2R6KA 3KH9A 5BRTA 4MJBA 3ZFLA 1URMA 2IMFA 3EURA 1N2AA 3E0UA 1QGVA 4POLA 4HU9A 3FY7A 1XOBA 2TIRA 3NIVA 3IAS2 4DEJA 2R0CA 2FHEA 3DD3A 2F9SA 2KLXA 4LMVA 4HQSA 1G0TA 1H75A 2NPBA 4KDXA 1X0RA 1GUHA 4NAXA 1R4WA 4KB3A 2TRCP 13GSA 3H79A 1SU9A 3ZVJD 2I81A 3RPPA 2LUSA 3CQFA 2MBSA 1OE8A 3VPTA 1GULA 2H0GA 1PX6A 4ECIA 4TR1A 3KTLA 3DXBA 1WIKA 5D9WA 2HSMA 4KX4A 1SL1B 4YAVA 4BVXB 2DMLA 3W6GA 3FR9A 4BVYA 1V2AA 3LORA 4ULXA 4ZL8A 4HS1A 4JR4A 1HYUA 5J41A 5IQYA 5CP1A 4O92A 1WJKA 5D9VA 1DSBA 4E8HA 2VM1A 4F82A 4WR5A 3QDNA 2EIQA 1XW6A 4N0ZA 4JR6A 4OO4A 2RM6A 2OBKA 1YDKA 3TOUA 1TU7A 2QGVA 1M2AA 2AAWA 2GSTA 3LFLA 4N10A 5G2ZA 3H93A 3M9KA 10GSA 4TRXA 3C71A 1ZMAA 4TR3A 4GSNA 4HEA2 4PQIA 5CRHA 5ECMB 4EO3A 1GNWA 4XS1A 1FB6A 4GCIA 4J57E 3QMXA 4HU7A 5G5EA 1ZYNA 2L59A 4K5RA 1GSQA 3EU3A 4NHZA 3ERFA 4BVXA 5AN1A 1ACVA 1BX9A 1JZRA 2E7PA 4F9ZA 4X1UA 3C8EA 4MK3A 3C73A 1K0CA 4N30A 3QFBC 2I9HA 2VD0A 3F4TA 4QL7A 1AC1A 1GNEA 1VF4A 3TKQA 4EF0A 1EV4A 1OAZA 2M72A 4JEDA 2JSYA 2UZ8A 3FZ4A 4ZB9A 2WZ9A 2V6KA 3J7Yb 1GWCA 5KOXA 5IMVA 3ZLPA 1KEBA 4WBRD 3S9FA 1B4QA 2VIMA 5DAKA 1GLQA 1TRVA 2FA4A 4WXTA 3VPQA 1VGLA 3TJBA 2MMAA 1XIYA 3IK9A 4MABA 4YQUA 4ILFA 1T7PB 3PINA 2CAIA 1ERTA 1ILOA 5EY6A 4HJMA 2BTOT 4KSOA 1SENA 1TK5B 1WE0A 5ECLB 2L6DA 1XBSA 3LGCA 5AIXA 1TRWA 3G7JA 1K0AA 1ZGNA 20GSA 5DCGA 3GKNA 3ZFBA 5J5NA 2L5OA 2KUCA 3GA4A 4LA1A 1YEPA 5L71A 2JZRA 3A3TA 3DVXA 5F07A 1XVQA 5LD0A 3RPNA 1LU4A 2EIOA 2REMA 3KEBA 1J0FA 1X5DA 1OKDA 5CRGA 1VF2A 2HSYA 1K0OA 2L57A 3HXSA 2VAFA 4IP1A 3GNJA 4HZ2A 4K2XA 3VI7A 2DKHA 3QAVA 5CNWA 1OYJA 2AJQB 2B1LA 4EC0A 2VD1A 1ST9A 3G7YA 6GSXA 2LTKA 4I5QA 1YKCA 1T4ZA 3BJ5A 4PXOA 1GUKA 1TRUA 1ERVA 1A2MA 3VK9A 5EPFA 4HDEA 4K7NA 1ON4A 5BMUA 4FO5A 2DKIA 3QD9A 3HY2A 1AQXA 1HNCA 3TB2A 2H19A 4O32A 2H70A 4ECBA 1DUGA 5GAND 4HSCX 4KSMA 2VCZA 3M0FA 4TOPA 2H76A 1A2LA 2GTUA 2XC2A 1VF3A 2YCDA 1R26A 3M8NA 5ENUA 2PVOC 3GURA 3K8NA 4XS4B 3BBYA 3ZYWA 1B9XC 2YZHA 1SL2B 1PN0A 3DKSA 1GUMA 5ECKB 2FWHA 2HXKA 1S3AA 5IO0A 5HFKA 3ME8A 4MPGA 4AJ6A 3QOUA 1XPVA 4LL4B 3WGXA 3H8QA 2MMOA 4EDZA 3E9JB 3KP9A 5C04A 5A4UA 5C00A 1VRSD 3BCIA 3EMXA 5IOWA 2C1YA 5CREA 3HCZA 3WGDA 3GL5A 3A5IA 1NSWA 4KF9A 3US3A 1O6JA 4MPFA 1JZOA 1BG5A 1FO5A 1B8XA 2XPDA 2B7KA 3ZIVA 4G0KA 3VLNA 2KOKA 3DVWA 1DBYA 3VI5A 4O5RA 3FZ9A 4AGSA 3G9BA 1FAAA 2IMEA 1BQ7A 2H1GA 2X4AA 2C3TA 4YQMA 5AGYA 3F4RA 4A5PA 3PH9A 3KP8A 1PFOA 3VURA 2L6CA 5FHIA 5ECIB 2QA1A 4K0GA 4RUVA 1E2YA 4MLYA 1X9SB 1X5CA 2KHPA 3VFIA 2RUFA 19GSA 2GZYA 3F0IA 4QQ7A 4JE1A 4KAEA 4WKWA 3HZ4A 4V1Ap 1OC3A 4RQXA 3ERGA 1HNBA 1S3DA 3IHQA 1GSFA 4PUAA 1Z5YE 3FRCA 3APQA 5D9TA 4I97A 1BYEA 2O85A 3WT2A 4IGJA 3TJGA 3EYTA 2KP2A 3QFAC 2DSAA 5DCHA 1QK8A 3EWLA 1JZDA 5D93A 1M9AA 1O81A 4KCAA 4EL1A 1I9DA 1THOA 4AJ8A 2A2SA 3EMPA 2YN1A 4EKZA 1UVZA 1XG8A 2PGTA 1EZKA 1SK0A 4PURA 3PPUA 2EIRA 4CY8A 3GKMA 3GTUB 5IPHA 2B5YA 3GN3A 4L8EA 3QAGA 1CQHA 5ELAA 3TJFA 3L9SA 4MJAA 3UL3A 5JCWA 1BJXA 4P3YB 3KH7A 2K9FA 3KMOA 3UOMA 2YWMA 1J08A 1I5GA 4WF4A 1A24A 5E59A 4POKA 2DLXA 3TGZA 3D4TA 3W8JA 1FHEA 3IRAA 3HVVA 1XZOA 1TDIA 5COHA 3HA9A 1T00A 4O7HA 2B6MA 4KA0A 5HR3A 2LNSA 3ZMKA 4OFTA 3VWUA 2C80A 3IR4A 5KEJA 3F8UA 3D6IA 2FGXA 2YNXA 2C3NA 4F2IA 1YF1A 2X8GA 3TKSE 2OE0A 2HE3A 3DWVA 2ON7A 3FYGA 4GQCA 5J9CA 1EOGA 2GQKA 5AISA 1EEMA 1TKDB 1C72A 4ZL9A 4BWSA 2DJJA 1V9WA 1BEDA 2C3QA 4K5SA 2M46A 2PU9C 3GTUA 1ZL9A 1X9MB 3I9V2 4GSTA 2PMTA 4HOJA 1SK1A 2CZ3A 2P31A 2GGTA 2K8VA 2B1KA 5H5RA 1B48A 3QR6A 2C8UA 3MAKA 4YKFA 2LKUA 6GSWA 3MWHA 2K8SA 1HD2A 4F03A 5IM9A 1M2DA 2H1DA 4ISDA 2HRNA 2B5XA 3UIWA 1WMJA 1JFUA 1MTCA 5HR0A 4ML1A 2XBIA 1V98A 1UN2A 4ZBBA 2PPTA 5F0GA 2H0HA 1R5PA 2MZCA 1YEXA 4N11A 4EIQA 2WFCA 3FW2A 1XWGA 3VWWA 3Q19A 4PNGA 2VCXA 5JWQB 5CAXA 3APOA 1FG4A 2JZTA 2LJAA 5CRDA 1CQGA 2FWGA 1F9MA 4TXVA 2WGRA 2C0EA 1F3AA 3Q18A 2WS2A 2F51A 2ZUPA 4PTSA 2LS5A 3MSZA 3DEXA 2WDUA 5G31A 3GX8A 4IELA 5IIZA 3D4MA 3IC4A 1THXA 2YV9A 4RQRA 2LRNA 2V41A 3QPMA 5DALB 2JZSA 1O73A 3ZITA 2VCWA 4MJEA 2HZFA 2CVDA 2YWIA 1MDIA 3TRXA 3TKRA 2A4HA 1A0RP 3LW9A 3HVSA 2X8HA 1OVNA 1V58A 4ZILA 4PX1A 4F0CA 4BL7B 4TN8A 4OCEA 1R5AA 3CSHA 4V2LA 2L5LA 2FD3A 4K9ZA 2PN8A 1JLWA 1K0DA 1HQOA 1M0UA 5FWGA 1ZZYA 1M3JA 4X43A 1FB0A 3EE2A 2PWJA 3C1SA 3TRPA 1A0FA 4KNDA 4WBJA 3HJPA 4ECCA 1K3OA 3W8SA 1M7TA 2YOIA 2YP6A 3CRUA 1JHBA 18GSA 1DE2A 4KE3A 5D8IA 5DDLA 2AHEA 2F8AA 3UBLA 3L4NA 1PMTA 3GMFA 4XRAA 3F63A 5DALA 4G2EA 4DSRA 2JACA 2LSTA 3RAZA 1B9YC 1RQMA 3ZVJA 3LXZA 4KUNA 4DSQA 4LL1B 2B3SA 1XWCA 4TR0A 1GTAA 4IJIA 2CT6A 4NMUA 2XPEA 1TI3A 2X99A 5J3RA 2V6OA 3JCML 3KM6A 3L0HA 2HT9A 4Z2TA 2FNOA 2DJ3A 1PRXA 4G10A 4HQZA 4GQFA 2I3YA 3F9UA 2O89A 2A2RA 4G9HA 5GSTA 4NHWA 4KW6A 5F06A 2QC7A 5KN2A 1AXDA 1PKZA 4IKHA 2OACA 4D73B 3HHVA 1PQNA 5KN3A 1U3IA 4K1FA 3RDWA 5KN1A 3LSZA 3TRQA 2IWTA 4FIWA 1AQVA 4YQVA 5IO2A 2OADA 4TW5A 1GSUA 1QFNA 6GSSA 2CX4A 4GTUA 4K7IA 4GSSA 2ZCTA 1V40A 1O8WA 4K2DA 2G0FA 5AIVA 1K3LA 3ERWA 3PR8A 2VCQA 2HRAA 3G7IA 4EXJA 3UVTA 5B8BA 1AIUA 5ECQB 3Q6OA 1Z7PA 4BPYA 1U3AA 3P2AA 4ZBAA 5ECRB 1T4YA 3I6AA 2HRKA 3I69A 1VF1A 3H4KA 4MF7A 3L9UA 4V2NA 1EP7A 5D96A 3CXGA 3LJRA 4D73A 5ECOB 3WYWA 1B4PA 3CSIA 3IBHA 3GIXA 3C1RA 2H8LA 3IOSA 1JLVA 5JWOB 4IS0A 3MYDA 1DE1A 2WRTA 3CSJA 3KZQA 1OC8A 4HI7A 1TU8A 2C4JA 2GLRA 5B7CA 2X64A 5F8BA 3GSTA 3M9JA 2R37A 4ICYA 4CW9A 1EOHA 1F3BA 2RLIA 4HUAA 1XW9A 4LLRA 2K18A 1Z6NA 2IMIA 4MF5A 4Q5NA 2OE3A 2VL3A 2X49A 4IHUA 1AUCA 3WD6A 1QUWA 5A5KA 4OMVA 2YZUA 2B5EA 2NBSA 5D9XA 3KCMA 1M99A 2HNLA 4V2MA 3MIXA 2V1MA 4XRDA 1NHOA 2FWFA 1AAZA 4RI6A 4O5QA 2DIYA 1PL1A 2YWNA 3R2QA 1GTBA 2H71A 3HVNA 7GSSA 1XVWA 1GSYA 4PNFA 3GL3A 4MH3A 4OCFA 4XIHA 5ECNB 3ZMLA 4OWYA 1SJZA 2YPMA 2BMXA 1PKWA 1YQ1A 3V1WA 1SJ6A 4H86A 4WETA 4XS4A 2VL9A 4JRRA 1K0NA 1WWJA 1GTIA 4MNNA 2F8FA 2FWEA 2VLUA 1EWXA 3ZIJA 1XWKA 3KTBA 2AYTA 2ON5A 2H01A 1G7EA 4XS6A 3KD0A 2DIZA 2VCTA 4JZQA 4ZB6A 4BIKA 1WP0A 1U6TA 3KGKA 4NXIA 2ZNMA 4HZ4A 4GXZA 1A8LA 2WB9A 4K7OA 4USSA 4F0BA 1SL0B 1U88A 4JBBA 3F3QA 3UMAA 1O8XA 5DQSA 2LRCA 2C0GA 2GZZA 3TOTA 4GWRA 2GZPA 1UC7A 4OFNA 2RM5A 2CVKA 3OR5A 2GQLA 1SD9A 3UBKA 3H1NA 16GSA 2R2JA 4KDYA 2JSZA 2VLVA 2R5GA 1R7HA 3SWLA 2NDOA 4IP6A 5ECSA 2LV3A 3DRNA 4TVEA 2RUEA 3LXTA 4EUYA 2ES7A 2F3MA 4YAPA 3D5JA 2BJXA 1ABAA 3BCKA 2G2QA 1WPIA 4PQHA 2GVPA 2HSHA 3CTGA 2YJ7A 5DVBA 2O8VB 3A2WA 4YH2A 1V57A 3GRXA 3FHKA 2JL4A 3TDGA 1IYIA 3QAWA 4ACSA 4XTSA 5D73A 3U5RE 3M3MA 1FW1A 4AF2A 3GUSA 1GL8A 3ZREA 1HNAA 3SBCA 4LMWA 2V2GA 1FOHA 3DYRA 4MF6A 2H73A 1SK2A 4CHSA 4IN0A 1MDKA 4J2FA 5LCZA 2GSRA 3ZRDA 2H6ZA 4TR1B 2H1BA 4V1Ag 1TK8B 12GSA 1G6WA 3F6DA 1SYXA 6GSYA 3IA1A 3VWVA 1Z3EA 1TOFA 4OO5A 2MMNA 4FYCA 2IMKA 3UVHA 2VM2A 1PD21 1USBA 2FY6A 3R3EA 5FT3A 2IJYA 1U87A 5CO3A 3O6TA 3KJYA 3U6VA 3GX0A 4NV2A 1XOAA 3BD2A 3GKKA 1YZXA 2WJUA 1TXXA 4ID0A 2O87A 3P8WA 4K0NA 2OBIA 3KIJA 2H1AA 2XHFA 3GV1A 4KDUA 3D0ZA 3HKRA 3CTFA 2NVLA 5JWRB 4E8EA 1MDJA 2KP1A 2X8CA 3HJMA 1ZOFA 1K0MA 3EINA 4IQ1A 4G0IA 4KCEA 5IMCA 3UAPA 4K6XA 3GYKA 2R0GA 3E3EA 4NV5A 1KNGA 1NHYA 3L9VA 1SJIA 4Z2RA 4MA9A 3TJJA 1F37A 2Z9SA 4ZB8A 1YKAA 2A2PA 1YF0A 4XCSA 4WR4A 2EC4A 5DJMA 4OFMA 2IL3A 2OKAA 4NWYA 2MYGA 4AJ7A 1FOVA 5ID2B 3HYPA 1IYHA 3TJKA 1F2EA 2YJHA 4G0LA 1ERUA 5GAPD 1XFLA 2OA7A 5G30A 4EE0A 2R4VA 4IVFA 2H74A 1SKSB 5JCUA 3M1GA 5DJLA 2HYXA 4MZCA 5G5FA 4RI7A 5DAKB 3ED3A 3NZNA 1QXHA 4L0WA 3IK7A 4PGTA 1NW2A 2CZ2A 3CYNA 3NOFA 1A8YA 4I6XA 3EPTA 4TXOB 3FR6A 1K3YA 3ISOA 4NPBA 4FYUA 4GRFA 1PA3A 5IMZA 2MMZA 1W89A 3IE3A 1S3CA 1XW5A 3LYKA 5JCGA 2GT6A 5HFIA 2YANA 1PX7A 3FK8A 3I43A 3LG6A 2PBJA 2H75A 2OJLA 5ID2A 2GDRA 3DGQA 2HZEB 2ALBA 1GLPA 1X9WB 4Z2UA 2GSSA 1Y25A 2K6VA 3FR3A 5H5SA 4K8MA 1XXUA 2CA8A 4J56E 5J4UA 1MD3A 5ELGA 4EIPA 3A2XA 3F6FA 4BL7A 2H6YA 2B7JA 1Z7RA 3F3RA 4FYBA 2QSIA 3F4SA 3ZTLA 2IN3A 1RK4A 2LJKA 1A2JA 1FVKA 2LEGA 2WCIA 4TXOA 3APSA 2DC5A 2J23A 4X4JA 4BA7A 2DBCA 2FCHA 5HR1A 1Z9HA 2D2ZA 2GQMA 1PSQA 3RHBA 5LNKe 1TK0B 3KXOA 1O7UA 2N5FA 1F6MC 5IMDA 4CDOA 2E0QA 3FKFA 2VCVA 1SKWB 1H4OA 1ERWA 1JZWA 5IOXA 2NTOA 2IIYA 2HRFA 4Q5FA 2CX3A 1YY7A 5DQYA 4MZBA 4EDYA 3BOAA 3MNGA 2N5AA 1G7OA 4MZWA 3HDCA 2HZEA 2VUPA 1RW1A 1OKTA 5J9BA 1GP1A 3VWXA 4WEYA 2LRTA 1KTEA 5GZZB 3GKXA 2E2GA 3FZ5A 11GSA 2AB6A 4MMMA 4IW9A 1WOUA 2OE1A 4G19A 3LQ7A 5G1LA 2VLTA 4PUFC 9GSSA 4XHMA 2IMDA 4TR4A 3TUEA 1MD4A 1S3RA 1GTUA 1GSDA 1XWBA 1Y6EA 2VO4A 1ML6A 4WF5A 1PGTA 3IDVA 4OD7A 1GH2A 3N5OA 2AV4A 4FQUA 1AQWA 1YJ6A 3IC8A 1SKRB 1TJDA 1Z6MA 4ZL7A 3EC3A 1WRYA 3GSSA 4IBPA 5B6MA 1EP8A 4DSSB 1W4VA 2J9HA 4L5OA 4POBA 1BAYA 4KH7A 1M3IA 1ZYQB 5CRWA 1QMVA 1XCCA 2DJ1A 4ZIJA 4EVMA 2DJ0A 2CV4A 3P7XA 3A5WA 5G1KA 2RIIA 4Q5RA
chains in the Genus database with same CATH topology
2P5QA 2IFQB 4MH2A 3RHCA 2CAQA 1GSEA 3A2VA 4ML6A 2C0DA 1GSSA 3EU4A 5H5QA 2LJRA 3FMWA 3HJOA 1Q98A 2VOCA 4MDCA 3DIEA 1EGRA 1K0BA 2AUVA 3TKSA 2E2MA 3IHGA 1UA5A 2O7KA 17GSA 4HJ2A 2TRXA 2L4CA 2R0PA 2P0GA 3IPZA 1PN9A 4X0XA 2GT5A 1TRSA 2FLSA 3L78A 5GSSA 2H66A 3HZ8A 1EEJA 4GF0A 3UJ1A 3TKSC 3TKPA 1KBNA 2PUKC 1X5EA 4DSSA 6GSVA 1EGOA 4O5UA 2I4AA 3LEFA 5F05A 2MBTA 2FUG2 3GH6A 2JU5A 5HQPA 5B8AA 1QQ2A 4IQAA 5ABRA 1E6BA 4MJCA 1LBKA 3EVIA 4I2TA 4YKGA 2M80A 5CYYA 2V32A 5A4VA 2IFQA 1SYRA 4ZXGA 4ZBDA 3UARA 3CBUA 2CVBA 3N9JA 4L5LA 4Z7XA 2PVQA 4MP4A 3IXRA 3RBTA 4GLTA 5E4WA 4IJ3A 1OC9B 4MCUA 2PERA 2P5RA 5DBQA 3FZAA 1O85A 4QL9A 2XBQA 3AY8A 4I2UA 4DVCA 1J9BA 3LYPA 1XWAA 3TCOA 2QA2A 3WGEA 1TI1A 4FH8A 3FEUA 5ECHB 3QCPA 3GHAA 5HR2A 4BWQA 1M2BA 4POMA 3GH9A 2LQOA 3J7Yk 2I1UA 3O3TA 2GS3A 3HD5A 1FVJA 1A23A 2DMMA 5IPGA 2HI7A 4JU5A 4ECJA 5ECPB 3P90A 5INYA 4Q5QA 1OE7A 1EV9A 4PQ1A 8GSSA 1M9BA 1LJRA 2JADA 2H72A 3ZL5A 2LNTA 4N0VA 2DJ2A 1TTZA 2QKEA 2HLSA 1OC9A 6GSUA 1ZCPA 5IMFA 1ZYPA 3D21A 3HVXA 3IV4A 1ZYEA 1NM3A 3GFKA 2IPAA 2FA8A 2HFDA 3IAM2 22GSA 4CY6A 3O76A 3WT1A 1T3BA 14GSA 1AW9A 1TP9A 5IMAA 3CRTA 1Q4JA 2LQQA 3KMNA 2VL2A 4TKYA 3LWAA 2GSQA 1G6YA 5B6NA 2H0IA 2A4VA 3D22A 2H6XA 3Q74A 3C7MA 3MDKA 4L0UA 5HFGA 2R3XA 2VL2C 5EL8A 2WULA 1SD8A 2DJKA 6GSTA 2YV7A 2CQ9A 3CMIA 3DMLA 1MEKA 5KN0A 2L4QA 2H30A 1PL2A 1T8EB 3ZZXA 3UEMA 5EVOA 5A4WA 3PGTA 4KGIA 4BVYB 4I8BA 2YWOA 1T1VA 3ME7A 2C0FA 1N8JA 1GRXA 2N5BA 1TW9A 5KOWA 2R6KA 3KH9A 5BRTA 4MJBA 3ZFLA 1URMA 2IMFA 3EURA 1N2AA 3E0UA 1QGVA 4POLA 4HU9A 3FY7A 1XOBA 2TIRA 3NIVA 3IAS2 4DEJA 2R0CA 2FHEA 3DD3A 2F9SA 2KLXA 4LMVA 4HQSA 1G0TA 1H75A 2NPBA 4KDXA 1X0RA 1GUHA 4NAXA 1R4WA 4KB3A 2TRCP 13GSA 3H79A 1SU9A 3ZVJD 2I81A 3RPPA 2LUSA 2MBSA 1OE8A 3VPTA 1GULA 2H0GA 1PX6A 4ECIA 4TR1A 3KTLA 3DXBA 1WIKA 5D9WA 2HSMA 4KX4A 1SL1B 4YAVA 4BVXB 2DMLA 3W6GA 3FR9A 4BVYA 1V2AA 3LORA 4ULXA 4ZL8A 4HS1A 4JR4A 1HYUA 5J41A 5IQYA 5CP1A 4O92A 1WJKA 5D9VA 1DSBA 4E8HA 2VM1A 4F82A 4WR5A 3QDNA 2EIQA 1XW6A 4N0ZA 4JR6A 4OO4A 2RM6A 2OBKA 1YDKA 3TOUA 1TU7A 2QGVA 1M2AA 2AAWA 2GSTA 3LFLA 4N10A 5G2ZA 3H93A 3M9KA 10GSA 4TRXA 3C71A 1ZMAA 4TR3A 4GSNA 4HEA2 4PQIA 5CRHA 5ECMB 4EO3A 1GNWA 4XS1A 1FB6A 4GCIA 4J57E 3QMXA 4HU7A 5G5EA 1ZYNA 2L59A 4K5RA 1GSQA 3EU3A 4NHZA 3ERFA 4BVXA 5AN1A 1ACVA 1BX9A 1JZRA 2E7PA 4F9ZA 4X1UA 3C8EA 4MK3A 3C73A 1K0CA 4N30A 3QFBC 2I9HA 2VD0A 3F4TA 4QL7A 1AC1A 1GNEA 1VF4A 3TKQA 4EF0A 1EV4A 1OAZA 2M72A 4JEDA 2JSYA 2UZ8A 3FZ4A 4ZB9A 2WZ9A 2V6KA 3J7Yb 1GWCA 5KOXA 5IMVA 3ZLPA 1KEBA 4WBRD 3S9FA 1B4QA 2VIMA 5DAKA 1GLQA 1TRVA 2FA4A 4WXTA 3VPQA 1VGLA 3TJBA 2MMAA 1XIYA 3IK9A 4MABA 4YQUA 4ILFA 1T7PB 3PINA 2CAIA 1ERTA 1ILOA 5EY6A 4HJMA 2BTOT 4KSOA 1SENA 1TK5B 1WE0A 5ECLB 2L6DA 1XBSA 3LGCA 5AIXA 1TRWA 3G7JA 1K0AA 1ZGNA 20GSA 5DCGA 3GKNA 3ZFBA 5J5NA 2L5OA 2KUCA 3GA4A 4LA1A 1YEPA 5L71A 2JZRA 3A3TA 3DVXA 5F07A 1XVQA 5LD0A 3RPNA 1LU4A 2EIOA 2REMA 3KEBA 1J0FA 1X5DA 1OKDA 5CRGA 1VF2A 2HSYA 1K0OA 2L57A 3HXSA 2VAFA 4IP1A 3GNJA 4HZ2A 4K2XA 3VI7A 2DKHA 3QAVA 5CNWA 1OYJA 2AJQB 2B1LA 4EC0A 2VD1A 1ST9A 3G7YA 6GSXA 2LTKA 4I5QA 1YKCA 1T4ZA 3BJ5A 4PXOA 1GUKA 1TRUA 1ERVA 1A2MA 3VK9A 5EPFA 4HDEA 4K7NA 1ON4A 5BMUA 4FO5A 2DKIA 3QD9A 3HY2A 1AQXA 1HNCA 3TB2A 2H19A 4O32A 2H70A 4ECBA 1DUGA 5GAND 4KSMA 2VCZA 3M0FA 4TOPA 2H76A 1A2LA 2GTUA 2XC2A 1VF3A 2YCDA 1R26A 3M8NA 5ENUA 2PVOC 3GURA 3K8NA 4XS4B 3BBYA 3ZYWA 1B9XC 2YZHA 1SL2B 1PN0A 3DKSA 1GUMA 5ECKB 2FWHA 2HXKA 1S3AA 5IO0A 5HFKA 3ME8A 4MPGA 4AJ6A 3QOUA 1XPVA 4LL4B 3WGXA 3H8QA 2MMOA 4EDZA 3E9JB 3KP9A 5C04A 5A4UA 5C00A 1VRSD 3BCIA 3EMXA 5IOWA 2C1YA 5CREA 3HCZA 3WGDA 3GL5A 3A5IA 1NSWA 4KF9A 3US3A 1O6JA 4MPFA 1JZOA 1BG5A 1FO5A 1B8XA 2XPDA 2B7KA 3ZIVA 4G0KA 3VLNA 2KOKA 3DVWA 1DBYA 3VI5A 4O5RA 3FZ9A 4AGSA 3G9BA 1FAAA 2IMEA 1BQ7A 2H1GA 2X4AA 2C3TA 4YQMA 5AGYA 3F4RA 4A5PA 3PH9A 3KP8A 3VURA 2L6CA 5FHIA 5ECIB 2QA1A 4K0GA 4RUVA 1E2YA 4MLYA 1X9SB 1X5CA 2KHPA 3VFIA 2RUFA 19GSA 2GZYA 3F0IA 4QQ7A 4JE1A 4KAEA 4WKWA 3HZ4A 4V1Ap 1OC3A 4RQXA 3ERGA 1HNBA 1S3DA 3IHQA 1GSFA 4PUAA 1Z5YE 3FRCA 3APQA 5D9TA 4I97A 1BYEA 2O85A 3WT2A 4IGJA 3TJGA 3EYTA 2KP2A 3QFAC 2DSAA 5DCHA 1QK8A 3EWLA 1JZDA 5D93A 1M9AA 1O81A 4KCAA 4EL1A 1I9DA 1THOA 4AJ8A 2A2SA 3EMPA 2YN1A 4EKZA 1UVZA 2PGTA 1EZKA 1SK0A 4PURA 3PPUA 2EIRA 4CY8A 3GKMA 3GTUB 5IPHA 2B5YA 3GN3A 4L8EA 3QAGA 1CQHA 5ELAA 3TJFA 3L9SA 4MJAA 3UL3A 5JCWA 1BJXA 4P3YB 3KH7A 2K9FA 3KMOA 3UOMA 2YWMA 1J08A 1I5GA 4WF4A 1A24A 5E59A 4POKA 2DLXA 3TGZA 3D4TA 3W8JA 1FHEA 3IRAA 3HVVA 1XZOA 1TDIA 5COHA 3HA9A 1T00A 4O7HA 2B6MA 4KA0A 5HR3A 2LNSA 3ZMKA 4OFTA 3VWUA 2C80A 3IR4A 5KEJA 3F8UA 3D6IA 2FGXA 2YNXA 2C3NA 4F2IA 1YF1A 2X8GA 3TKSE 2OE0A 2HE3A 3DWVA 2ON7A 3FYGA 4GQCA 5J9CA 1EOGA 2GQKA 5AISA 1EEMA 1TKDB 1C72A 4ZL9A 4BWSA 2DJJA 1V9WA 1BEDA 2C3QA 4K5SA 2M46A 2PU9C 3GTUA 1ZL9A 1X9MB 3I9V2 4GSTA 2PMTA 4HOJA 1SK1A 2CZ3A 2P31A 2GGTA 2K8VA 2B1KA 5H5RA 1B48A 3QR6A 2C8UA 3MAKA 4YKFA 2LKUA 6GSWA 3MWHA 2K8SA 1HD2A 4F03A 5IM9A 1M2DA 2H1DA 4ISDA 2HRNA 2B5XA 3UIWA 1WMJA 1JFUA 1MTCA 5HR0A 4ML1A 2XBIA 1V98A 1UN2A 4ZBBA 2PPTA 5F0GA 2H0HA 1R5PA 2MZCA 1YEXA 4N11A 4EIQA 2WFCA 3FW2A 1XWGA 3VWWA 3Q19A 4PNGA 2VCXA 5JWQB 5CAXA 3APOA 1FG4A 2JZTA 2LJAA 5CRDA 1CQGA 2FWGA 1F9MA 4TXVA 2WGRA 2C0EA 1F3AA 3Q18A 2WS2A 2F51A 2ZUPA 4PTSA 2LS5A 3MSZA 3DEXA 2WDUA 5G31A 3GX8A 4IELA 5IIZA 3D4MA 3IC4A 1THXA 2YV9A 4RQRA 2LRNA 2V41A 3QPMA 5DALB 2JZSA 1O73A 3ZITA 2VCWA 4MJEA 2HZFA 2CVDA 2YWIA 1MDIA 3TRXA 3TKRA 2A4HA 1A0RP 3LW9A 3HVSA 2X8HA 1OVNA 1V58A 4ZILA 4PX1A 4F0CA 4BL7B 4TN8A 4OCEA 1R5AA 3CSHA 4V2LA 2L5LA 2FD3A 4K9ZA 2PN8A 1JLWA 1K0DA 1HQOA 1M0UA 5FWGA 1ZZYA 4X43A 1FB0A 3EE2A 2PWJA 3C1SA 3TRPA 1A0FA 4KNDA 4WBJA 3HJPA 4ECCA 1K3OA 3W8SA 1M7TA 2YOIA 2YP6A 3CRUA 1JHBA 18GSA 1DE2A 4KE3A 5D8IA 5DDLA 2AHEA 2F8AA 3UBLA 3L4NA 1PMTA 3GMFA 4XRAA 3F63A 5DALA 4G2EA 4DSRA 2JACA 2LSTA 3RAZA 1B9YC 1RQMA 3ZVJA 3LXZA 4KUNA 4DSQA 4LL1B 2B3SA 1XWCA 4TR0A 1GTAA 4IJIA 2CT6A 4NMUA 2XPEA 1TI3A 2X99A 5J3RA 2V6OA 3JCML 3KM6A 3L0HA 2HT9A 4Z2TA 2FNOA 2DJ3A 1PRXA 4G10A 4HQZA 4GQFA 2I3YA 3F9UA 2O89A 2A2RA 4G9HA 5GSTA 4NHWA 4KW6A 5F06A 2QC7A 5KN2A 1AXDA 1PKZA 4IKHA 2OACA 4D73B 3HHVA 1PQNA 5KN3A 1U3IA 4K1FA 3RDWA 5KN1A 3LSZA 3TRQA 2IWTA 4FIWA 1AQVA 4YQVA 5IO2A 2OADA 4TW5A 1GSUA 1QFNA 6GSSA 2CX4A 4GTUA 4K7IA 4GSSA 2ZCTA 1V40A 1O8WA 4K2DA 2G0FA 5AIVA 1K3LA 3ERWA 3PR8A 2VCQA 2HRAA 3G7IA 4EXJA 3UVTA 5B8BA 1AIUA 5ECQB 3Q6OA 1Z7PA 4BPYA 1U3AA 3P2AA 4ZBAA 5ECRB 1T4YA 3I6AA 2HRKA 3I69A 1VF1A 3H4KA 4MF7A 3L9UA 4V2NA 1EP7A 5D96A 3CXGA 3LJRA 4D73A 5ECOB 3WYWA 1B4PA 3CSIA 3IBHA 3GIXA 3C1RA 2H8LA 3IOSA 1JLVA 5JWOB 4IS0A 3MYDA 1DE1A 2WRTA 3CSJA 3KZQA 1OC8A 4HI7A 1TU8A 2C4JA 2GLRA 5B7CA 2X64A 5F8BA 3GSTA 3M9JA 2R37A 4ICYA 4CW9A 1EOHA 1F3BA 2RLIA 4HUAA 1XW9A 4LLRA 2K18A 1Z6NA 2IMIA 4MF5A 4Q5NA 2OE3A 2VL3A 2X49A 4IHUA 1AUCA 3WD6A 1QUWA 5A5KA 4OMVA 2YZUA 2B5EA 2NBSA 5D9XA 3KCMA 1M99A 2HNLA 4V2MA 3MIXA 2V1MA 4XRDA 1NHOA 2FWFA 1AAZA 4RI6A 4O5QA 2DIYA 1PL1A 2YWNA 3R2QA 1GTBA 2H71A 7GSSA 1XVWA 1GSYA 4PNFA 3GL3A 4MH3A 4OCFA 4XIHA 5ECNB 3ZMLA 4OWYA 1SJZA 2YPMA 2BMXA 1PKWA 1YQ1A 3V1WA 1SJ6A 4H86A 4WETA 4XS4A 2VL9A 4JRRA 1K0NA 1WWJA 1GTIA 4MNNA 2F8FA 2FWEA 2VLUA 1EWXA 3ZIJA 1XWKA 3KTBA 2AYTA 2ON5A 2H01A 1G7EA 4XS6A 3KD0A 2DIZA 2VCTA 4JZQA 4ZB6A 1WP0A 1U6TA 3KGKA 4NXIA 2ZNMA 4HZ4A 4GXZA 1A8LA 2WB9A 4K7OA 4USSA 4F0BA 1SL0B 1U88A 4JBBA 3F3QA 3UMAA 1O8XA 5DQSA 2LRCA 2C0GA 2GZZA 3TOTA 4GWRA 2GZPA 1UC7A 4OFNA 2RM5A 2CVKA 3OR5A 2GQLA 1SD9A 3UBKA 3H1NA 16GSA 2R2JA 4KDYA 2JSZA 2VLVA 2R5GA 1R7HA 3SWLA 2NDOA 4IP6A 5ECSA 2LV3A 3DRNA 4TVEA 2RUEA 3LXTA 4EUYA 2ES7A 2F3MA 4YAPA 3D5JA 2BJXA 1ABAA 3BCKA 2G2QA 1WPIA 4PQHA 2GVPA 2HSHA 3CTGA 2YJ7A 5DVBA 2O8VB 3A2WA 4YH2A 1V57A 3GRXA 3FHKA 2JL4A 3TDGA 1IYIA 3QAWA 4ACSA 4XTSA 5D73A 3U5RE 3M3MA 1FW1A 4AF2A 3GUSA 1GL8A 3ZREA 1HNAA 3SBCA 4LMWA 2V2GA 1FOHA 3DYRA 4MF6A 2H73A 1SK2A 4CHSA 4IN0A 1MDKA 4J2FA 5LCZA 2GSRA 3ZRDA 2H6ZA 4TR1B 2H1BA 4V1Ag 1TK8B 12GSA 1G6WA 3F6DA 1SYXA 6GSYA 3IA1A 3VWVA 1Z3EA 1TOFA 4OO5A 2MMNA 4FYCA 2IMKA 3UVHA 2VM2A 1PD21 1USBA 2FY6A 3R3EA 5FT3A 2IJYA 1U87A 5CO3A 3O6TA 3KJYA 3U6VA 3GX0A 4NV2A 1XOAA 3BD2A 3GKKA 1YZXA 2WJUA 1TXXA 4ID0A 2O87A 3P8WA 4K0NA 2OBIA 3KIJA 2H1AA 2XHFA 3GV1A 4KDUA 3D0ZA 3HKRA 3CTFA 2NVLA 5JWRB 4E8EA 1MDJA 2KP1A 2X8CA 3HJMA 1ZOFA 1K0MA 3EINA 4IQ1A 4G0IA 4KCEA 5IMCA 3UAPA 4K6XA 3GYKA 2R0GA 3E3EA 4NV5A 1KNGA 1NHYA 3L9VA 1SJIA 4Z2RA 4MA9A 3TJJA 1F37A 2Z9SA 4ZB8A 1YKAA 2A2PA 1YF0A 4XCSA 4WR4A 2EC4A 5DJMA 4OFMA 2IL3A 2OKAA 4NWYA 2MYGA 4AJ7A 1FOVA 5ID2B 3HYPA 1IYHA 3TJKA 1F2EA 2YJHA 4G0LA 1ERUA 5GAPD 1XFLA 2OA7A 5G30A 4EE0A 2R4VA 4IVFA 2H74A 1SKSB 5JCUA 3M1GA 5DJLA 2HYXA 4MZCA 5G5FA 4RI7A 5DAKB 3ED3A 3NZNA 1QXHA 4L0WA 3IK7A 4PGTA 1NW2A 2CZ2A 3CYNA 3NOFA 1A8YA 4I6XA 3EPTA 4TXOB 3FR6A 1K3YA 3ISOA 4NPBA 4FYUA 4GRFA 1PA3A 5IMZA 2MMZA 1W89A 3IE3A 1S3CA 1XW5A 3LYKA 5JCGA 2GT6A 5HFIA 2YANA 1PX7A 3FK8A 3I43A 3LG6A 2PBJA 2H75A 2OJLA 5ID2A 2GDRA 3DGQA 2HZEB 2ALBA 1GLPA 1X9WB 4Z2UA 2GSSA 1Y25A 2K6VA 3FR3A 5H5SA 4K8MA 1XXUA 2CA8A 4J56E 5J4UA 1MD3A 5ELGA 4EIPA 3A2XA 3F6FA 4BL7A 2H6YA 2B7JA 1Z7RA 3F3RA 4FYBA 2QSIA 3F4SA 3ZTLA 2IN3A 1RK4A 2LJKA 1A2JA 1FVKA 2LEGA 2WCIA 4TXOA 3APSA 2DC5A 2J23A 4X4JA 4BA7A 2DBCA 2FCHA 5HR1A 1Z9HA 2D2ZA 2GQMA 1PSQA 3RHBA 5LNKe 1TK0B 3KXOA 1O7UA 2N5FA 1F6MC 5IMDA 4CDOA 2E0QA 3FKFA 2VCVA 1SKWB 1H4OA 1ERWA 1JZWA 5IOXA 2NTOA 2IIYA 2HRFA 4Q5FA 2CX3A 1YY7A 5DQYA 4MZBA 4EDYA 3BOAA 3MNGA 2N5AA 1G7OA 4MZWA 3HDCA 2HZEA 2VUPA 1RW1A 1OKTA 5J9BA 1GP1A 3VWXA 4WEYA 2LRTA 1KTEA 5GZZB 3GKXA 2E2GA 3FZ5A 11GSA 2AB6A 4MMMA 4IW9A 1WOUA 2OE1A 4G19A 3LQ7A 5G1LA 2VLTA 4PUFC 9GSSA 4XHMA 2IMDA 4TR4A 3TUEA 1MD4A 1GTUA 1GSDA 1XWBA 1Y6EA 2VO4A 1ML6A 4WF5A 1PGTA 3IDVA 4OD7A 1GH2A 3N5OA 2AV4A 4FQUA 1AQWA 1YJ6A 3IC8A 1SKRB 1TJDA 1Z6MA 4ZL7A 3EC3A 1WRYA 3GSSA 4IBPA 5B6MA 1EP8A 4DSSB 1W4VA 2J9HA 4L5OA 4POBA 1BAYA 4KH7A 1ZYQB 5CRWA 1QMVA 1XCCA 2DJ1A 4ZIJA 4EVMA 2DJ0A 2CV4A 3P7XA 3A5WA 5G1KA 2RIIA 4Q5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P5Q A;  2IFQ B;  4MH2 A;  3RHC A;  2CAQ A;  1GSE A;  3A2V A;  4ML6 A;  2C0D A;  1GSS A;  3EU4 A;  5H5Q A;  2LJR A;  3HJO A;  1Q98 A;  2VOC A;  4MDC A;  3DIE A;  1EGR A;  1K0B A;  2AUV A;  3TKS A;  2E2M A;  1UA5 A;  2O7K A;  17GS A;  4HJ2 A;  2TRX A;  2L4C A;  2P0G A;  3IPZ A;  1PN9 A;  4X0X A;  2GT5 A;  1TRS A;  2FLS A;  3L78 A;  5GSS A;  2H66 A;  3HZ8 A;  1EEJ A;  4GF0 A;  3UJ1 A;  3TKS C;  3TKP A;  1KBN A;  2PUK C;  1X5E A;  4DSS A;  6GSV A;  1EGO A;  2I4A A;  3LEF A;  5F05 A;  2MBT A;  2FUG 2;  3GH6 A;  2JU5 A;  5HQP A;  5B8A A;  1QQ2 A;  4IQA A;  5ABR A;  1E6B A;  4MJC A;  1LBK A;  3EVI A;  4I2T A;  2M80 A;  5CYY A;  2V32 A;  5A4V A;  2IFQ A;  1SYR A;  4ZXG A;  4ZBD A;  3UAR A;  3CBU A;  2CVB A;  3N9J A;  4L5L A;  4Z7X A;  2PVQ A;  4MP4 A;  3IXR A;  3RBT A;  4GLT A;  5E4W A;  4IJ3 A;  1OC9 B;  4MCU A;  2PER A;  2P5R A;  5DBQ A;  3FZA A;  1O85 A;  4QL9 A;  2XBQ A;  3AY8 A;  4I2U A;  4DVC A;  1J9B A;  3LYP A;  1XWA A;  3TCO A;  3WGE A;  1TI1 A;  4FH8 A;  3FEU A;  5ECH B;  3QCP A;  3GHA A;  5HR2 A;  4BWQ A;  1M2B A;  4POM A;  3GH9 A;  2LQO A;  3J7Y k;  2I1U A;  3O3T A;  2GS3 A;  3HD5 A;  1FVJ A;  1A23 A;  2DMM A;  5IPG A;  2HI7 A;  4JU5 A;  4ECJ A;  5ECP B;  3P90 A;  5INY A;  4Q5Q A;  1OE7 A;  1EV9 A;  4PQ1 A;  8GSS A;  1M9B A;  1LJR A;  2JAD A;  2H72 A;  3ZL5 A;  2LNT A;  4N0V A;  2DJ2 A;  1TTZ A;  2QKE A;  2HLS A;  1OC9 A;  6GSU A;  1ZCP A;  5IMF A;  3D21 A;  3HVX A;  3IV4 A;  1ZYE A;  1NM3 A;  3GFK A;  2IPA A;  2FA8 A;  2HFD A;  3IAM 2;  22GS A;  3O76 A;  3WT1 A;  1T3B A;  14GS A;  1AW9 A;  1TP9 A;  5IMA A;  3CRT A;  1Q4J A;  2LQQ A;  3KMN A;  2VL2 A;  4TKY A;  3LWA A;  2GSQ A;  1G6Y A;  5B6N A;  2H0I A;  2A4V A;  3D22 A;  2H6X A;  3Q74 A;  3C7M A;  3MDK A;  4L0U A;  5HFG A;  2R3X A;  2VL2 C;  5EL8 A;  2WUL A;  1SD8 A;  2DJK A;  6GST A;  2YV7 A;  2CQ9 A;  3CMI A;  3DML A;  1MEK A;  5KN0 A;  2L4Q A;  2H30 A;  1PL2 A;  1T8E B;  3ZZX A;  3UEM A;  5EVO A;  5A4W A;  3PGT A;  4KGI A;  4I8B A;  2YWO A;  1T1V A;  3ME7 A;  2C0F A;  1N8J A;  1GRX A;  2N5B A;  1TW9 A;  2R6K A;  3KH9 A;  4MJB A;  3ZFL A;  1URM A;  2IMF A;  3EUR A;  1N2A A;  3E0U A;  1QGV A;  4POL A;  4HU9 A;  3FY7 A;  1XOB A;  2TIR A;  3NIV A;  3IAS 2;  4DEJ A;  2FHE A;  3DD3 A;  2F9S A;  2KLX A;  4LMV A;  4HQS A;  1G0T A;  1H75 A;  2NPB A;  4KDX A;  1X0R A;  1GUH A;  4NAX A;  1R4W A;  4KB3 A;  2TRC P;  13GS A;  3H79 A;  1SU9 A;  3ZVJ D;  2I81 A;  3RPP A;  2LUS A;  2MBS A;  1OE8 A;  3VPT A;  1GUL A;  2H0G A;  1PX6 A;  4ECI A;  4TR1 A;  3KTL A;  3DXB A;  1WIK A;  5D9W A;  4KX4 A;  1SL1 B;  4YAV A;  2DML A;  3W6G A;  3FR9 A;  4BVY A;  1V2A A;  3LOR A;  4ULX A;  4ZL8 A;  4HS1 A;  4JR4 A;  1HYU A;  5J41 A;  5IQY A;  5CP1 A;  4O92 A;  1WJK A;  5D9V A;  1DSB A;  4E8H A;  2VM1 A;  4F82 A;  4WR5 A;  3QDN A;  2EIQ A;  1XW6 A;  4N0Z A;  4JR6 A;  4OO4 A;  2RM6 A;  2OBK A;  1YDK A;  3TOU A;  1TU7 A;  2QGV A;  1M2A A;  2AAW A;  2GST A;  3LFL A;  4N10 A;  5G2Z A;  3H93 A;  3M9K A;  10GS A;  4TRX A;  3C71 A;  1ZMA A;  4TR3 A;  4GSN A;  4HEA 2;  4PQI A;  5CRH A;  5ECM B;  4EO3 A;  1GNW A;  4XS1 A;  1FB6 A;  4GCI A;  4J57 E;  3QMX A;  4HU7 A;  5G5E A;  2L59 A;  1GSQ A;  3EU3 A;  4NHZ A;  3ERF A;  4BVX A;  5AN1 A;  1ACV A;  1BX9 A;  1JZR A;  2E7P A;  4F9Z A;  4X1U A;  3C8E A;  4MK3 A;  3C73 A;  1K0C A;  4N30 A;  3QFB C;  2I9H A;  2VD0 A;  3F4T A;  4QL7 A;  1AC1 A;  1GNE A;  1VF4 A;  3TKQ A;  4EF0 A;  1EV4 A;  1OAZ A;  2M72 A;  4JED A;  2JSY A;  3FZ4 A;  4ZB9 A;  2WZ9 A;  2V6K A;  3J7Y b;  1GWC A;  5IMV A;  3ZLP A;  1KEB A;  4WBR D;  3S9F A;  1B4Q A;  2VIM A;  5DAK A;  1GLQ A;  1TRV A;  2FA4 A;  4WXT A;  3VPQ A;  1VGL A;  3TJB A;  2MMA A;  1XIY A;  3IK9 A;  4MAB A;  4YQU A;  4ILF A;  1T7P B;  3PIN A;  2CAI A;  1ERT A;  1ILO A;  5EY6 A;  4HJM A;  2BTO T;  4KSO A;  1SEN A;  1TK5 B;  1WE0 A;  5ECL B;  2L6D A;  1XBS A;  3LGC A;  5AIX A;  1TRW A;  3G7J A;  1K0A A;  1ZGN A;  20GS A;  5DCG A;  3GKN A;  3ZFB A;  5J5N A;  2L5O A;  2KUC A;  3GA4 A;  4LA1 A;  1YEP A;  5L71 A;  2JZR A;  3A3T A;  3DVX A;  5F07 A;  1XVQ A;  5LD0 A;  3RPN A;  1LU4 A;  2EIO A;  2REM A;  3KEB A;  1J0F A;  1X5D A;  1OKD A;  5CRG A;  1VF2 A;  2HSY A;  1K0O A;  2L57 A;  3HXS A;  2VAF A;  4IP1 A;  3GNJ A;  4HZ2 A;  3VI7 A;  3QAV A;  5CNW A;  2AJQ B;  1OYJ A;  2B1L A;  4EC0 A;  2VD1 A;  1ST9 A;  3G7Y A;  6GSX A;  2LTK A;  4I5Q A;  1YKC A;  1T4Z A;  3BJ5 A;  4PXO A;  1GUK A;  1TRU A;  1ERV A;  1A2M A;  3VK9 A;  5EPF A;  4HDE A;  4K7N A;  1ON4 A;  4FO5 A;  3QD9 A;  3HY2 A;  1AQX A;  1HNC A;  3TB2 A;  2H19 A;  4O32 A;  2H70 A;  4ECB A;  1DUG A;  5GAN D;  4KSM A;  2VCZ A;  3M0F A;  4TOP A;  2H76 A;  1A2L A;  2GTU A;  2XC2 A;  1VF3 A;  2YCD A;  1R26 A;  3M8N A;  5ENU A;  2PVO C;  3GUR A;  3K8N A;  4XS4 B;  3BBY A;  3ZYW A;  1B9X C;  2YZH A;  1SL2 B;  3DKS A;  1GUM A;  5ECK B;  2FWH A;  2HXK A;  1S3A A;  5IO0 A;  5HFK A;  3ME8 A;  4MPG A;  4AJ6 A;  3QOU A;  1XPV A;  4LL4 B;  3WGX A;  3H8Q A;  2MMO A;  4EDZ A;  3E9J B;  3KP9 A;  5C04 A;  5A4U A;  5C00 A;  1VRS D;  3BCI A;  3EMX A;  5IOW A;  2C1Y A;  5CRE A;  3HCZ A;  3WGD A;  3GL5 A;  1NSW A;  3US3 A;  1O6J A;  4MPF A;  1JZO A;  1BG5 A;  1FO5 A;  1B8X A;  2XPD A;  2B7K A;  3ZIV A;  3VLN A;  2KOK A;  3DVW A;  1DBY A;  3VI5 A;  4O5R A;  3FZ9 A;  4AGS A;  3G9B A;  1FAA A;  2IME A;  1BQ7 A;  2H1G A;  2C3T A;  4YQM A;  5AGY A;  3F4R A;  3PH9 A;  3KP8 A;  3VUR A;  2L6C A;  5FHI A;  5ECI B;  4K0G A;  4RUV A;  1E2Y A;  4MLY A;  1X9S B;  1X5C A;  2KHP A;  3VFI A;  2RUF A;  19GS A;  2GZY A;  3F0I A;  4QQ7 A;  4JE1 A;  4KAE A;  4WKW A;  3HZ4 A;  4V1A p;  1OC3 A;  4RQX A;  3ERG A;  1HNB A;  1S3D A;  3IHQ A;  1GSF A;  4PUA A;  1Z5Y E;  3FRC A;  3APQ A;  5D9T A;  4I97 A;  1BYE A;  2O85 A;  3WT2 A;  4IGJ A;  3TJG A;  3EYT A;  2KP2 A;  3QFA C;  5DCH A;  2DSA A;  1QK8 A;  3EWL A;  1JZD A;  5D93 A;  1M9A A;  1O81 A;  4KCA A;  4EL1 A;  1I9D A;  1THO A;  4AJ8 A;  2A2S A;  3EMP A;  2YN1 A;  4EKZ A;  1UVZ A;  2PGT A;  1EZK A;  1SK0 A;  4PUR A;  2EIR A;  3GKM A;  3GTU B;  5IPH A;  2B5Y A;  3GN3 A;  4L8E A;  3QAG A;  1CQH A;  5ELA A;  3TJF A;  3L9S A;  4MJA A;  3UL3 A;  5JCW A;  1BJX A;  4P3Y B;  3KH7 A;  2K9F A;  3KMO A;  3UOM A;  2YWM A;  1J08 A;  1I5G A;  4WF4 A;  1A24 A;  5E59 A;  4POK A;  2DLX A;  3TGZ A;  3D4T A;  3W8J A;  1FHE A;  3IRA A;  3HVV A;  1XZO A;  1TDI A;  5COH A;  3HA9 A;  1T00 A;  4O7H A;  2B6M A;  4KA0 A;  5HR3 A;  2LNS A;  3ZMK A;  4OFT A;  3VWU A;  2C80 A;  3IR4 A;  5KEJ A;  3F8U A;  3D6I A;  2FGX A;  2YNX A;  2C3N A;  4F2I A;  1YF1 A;  2X8G A;  3TKS E;  2OE0 A;  2HE3 A;  3DWV A;  2ON7 A;  3FYG A;  4GQC A;  5J9C A;  1EOG A;  2GQK A;  5AIS A;  1EEM A;  1TKD B;  1C72 A;  4ZL9 A;  4BWS A;  2DJJ A;  1V9W A;  1BED A;  2C3Q A;  2M46 A;  2PU9 C;  3GTU A;  1ZL9 A;  1X9M B;  3I9V 2;  4GST A;  2PMT A;  4HOJ A;  1SK1 A;  2CZ3 A;  2P31 A;  2GGT A;  2K8V A;  2B1K A;  5H5R A;  1B48 A;  3QR6 A;  2C8U A;  3MAK A;  2LKU A;  6GSW A;  3MWH A;  2K8S A;  1HD2 A;  4F03 A;  5IM9 A;  1M2D A;  2H1D A;  4ISD A;  2HRN A;  2B5X A;  3UIW A;  1WMJ A;  1JFU A;  1MTC A;  5HR0 A;  4ML1 A;  2XBI A;  1V98 A;  1UN2 A;  4ZBB A;  2PPT A;  5F0G A;  2H0H A;  1R5P A;  2MZC A;  1YEX A;  4N11 A;  2WFC A;  3FW2 A;  1XWG A;  3VWW A;  3Q19 A;  4PNG A;  2VCX A;  5JWQ B;  5CAX A;  3APO A;  1FG4 A;  2JZT A;  2LJA A;  5CRD A;  1CQG A;  2FWG A;  1F9M A;  4TXV A;  2WGR A;  2C0E A;  1F3A A;  3Q18 A;  2WS2 A;  2F51 A;  2ZUP A;  2LS5 A;  3MSZ A;  3DEX A;  2WDU A;  5G31 A;  3GX8 A;  4IEL A;  5IIZ A;  3D4M A;  3IC4 A;  1THX A;  2YV9 A;  4RQR A;  2LRN A;  2V41 A;  3QPM A;  5DAL B;  2JZS A;  1O73 A;  3ZIT A;  2VCW A;  4MJE A;  2HZF A;  2CVD A;  2YWI A;  1MDI A;  3TRX A;  3TKR A;  1A0R P;  3HVS A;  2X8H A;  1OVN A;  1V58 A;  4ZIL A;  4PX1 A;  4F0C A;  4TN8 A;  4OCE A;  1R5A A;  3CSH A;  4V2L A;  2L5L A;  2FD3 A;  4K9Z A;  2PN8 A;  1JLW A;  1K0D A;  1HQO A;  1M0U A;  5FWG A;  1ZZY A;  4X43 A;  1FB0 A;  3EE2 A;  2PWJ A;  3C1S A;  3TRP A;  1A0F A;  4KND A;  4WBJ A;  3HJP A;  4ECC A;  1K3O A;  3W8S A;  1M7T A;  2YOI A;  2YP6 A;  3CRU A;  1JHB A;  18GS A;  1DE2 A;  4KE3 A;  5D8I A;  5DDL A;  2AHE A;  2F8A A;  3UBL A;  3L4N A;  1PMT A;  3GMF A;  4XRA A;  3F63 A;  5DAL A;  4G2E A;  4DSR A;  2JAC A;  2LST A;  3RAZ A;  1B9Y C;  1RQM A;  3ZVJ A;  3LXZ A;  4KUN A;  4DSQ A;  4LL1 B;  2B3S A;  1XWC A;  4TR0 A;  1GTA A;  4IJI A;  2CT6 A;  4NMU A;  2XPE A;  1TI3 A;  2X99 A;  5J3R A;  2V6O A;  3JCM L;  3KM6 A;  3L0H A;  2HT9 A;  2FNO A;  2DJ3 A;  1PRX A;  4G10 A;  4HQZ A;  4GQF A;  2I3Y A;  3F9U A;  2O89 A;  2A2R A;  4G9H A;  5GST A;  4NHW A;  4KW6 A;  5F06 A;  2QC7 A;  5KN2 A;  1AXD A;  1PKZ A;  4IKH A;  2OAC A;  4D73 B;  3HHV A;  1PQN A;  5KN3 A;  1U3I A;  4K1F A;  3RDW A;  5KN1 A;  3LSZ A;  3TRQ A;  2IWT A;  4FIW A;  1AQV A;  4YQV A;  5IO2 A;  2OAD A;  4TW5 A;  1GSU A;  1QFN A;  6GSS A;  2CX4 A;  4GTU A;  4K7I A;  4GSS A;  2ZCT A;  1V40 A;  1O8W A;  4K2D A;  2G0F A;  5AIV A;  1K3L A;  3ERW A;  3PR8 A;  2VCQ A;  3G7I A;  4EXJ A;  3UVT A;  5B8B A;  1AIU A;  5ECQ B;  3Q6O A;  1Z7P A;  4BPY A;  1U3A A;  3P2A A;  4ZBA A;  5ECR B;  1T4Y A;  3I6A A;  3I69 A;  1VF1 A;  3H4K A;  4MF7 A;  3L9U A;  4V2N A;  1EP7 A;  5D96 A;  3CXG A;  3LJR A;  4D73 A;  5ECO B;  3WYW A;  1B4P A;  3CSI A;  3IBH A;  3GIX A;  3C1R A;  2H8L A;  3IOS A;  1JLV A;  5JWO B;  4IS0 A;  1DE1 A;  2WRT A;  3CSJ A;  3KZQ A;  1OC8 A;  4HI7 A;  1TU8 A;  2C4J A;  2GLR A;  5B7C A;  2X64 A;  5F8B A;  3GST A;  3M9J A;  2R37 A;  4CW9 A;  1EOH A;  1F3B A;  2RLI A;  4HUA A;  1XW9 A;  4LLR A;  2K18 A;  1Z6N A;  2IMI A;  4MF5 A;  4Q5N A;  2OE3 A;  2VL3 A;  4IHU A;  1AUC A;  3WD6 A;  1QUW A;  5A5K A;  4OMV A;  2YZU A;  2B5E A;  2NBS A;  5D9X A;  3KCM A;  1M99 A;  2HNL A;  4V2M A;  2V1M A;  4XRD A;  1NHO A;  2FWF A;  1AAZ A;  4RI6 A;  2DIY A;  1PL1 A;  2YWN A;  3R2Q A;  1GTB A;  2H71 A;  7GSS A;  1XVW A;  1GSY A;  4PNF A;  3GL3 A;  4MH3 A;  4OCF A;  4XIH A;  5ECN B;  3ZML A;  4OWY A;  1SJZ A;  2YPM A;  2BMX A;  1PKW A;  1YQ1 A;  3V1W A;  1SJ6 A;  4H86 A;  4WET A;  4XS4 A;  2VL9 A;  4JRR A;  1K0N A;  1WWJ A;  1GTI A;  2F8F A;  2FWE A;  2VLU A;  1EWX A;  3ZIJ A;  1XWK A;  3KTB A;  2AYT A;  2ON5 A;  2H01 A;  1G7E A;  4XS6 A;  3KD0 A;  2DIZ A;  2VCT A;  4JZQ A;  4ZB6 A;  1WP0 A;  1U6T A;  3KGK A;  4NXI A;  2ZNM A;  4HZ4 A;  4GXZ A;  1A8L A;  2WB9 A;  4K7O A;  4F0B A;  1SL0 B;  1U88 A;  4JBB A;  3F3Q A;  3UMA A;  1O8X A;  5DQS A;  2LRC A;  2C0G A;  2GZZ A;  3TOT A;  4GWR A;  2GZP A;  1UC7 A;  4OFN A;  2RM5 A;  2CVK A;  3OR5 A;  2GQL A;  1SD9 A;  3UBK A;  3H1N A;  16GS A;  2R2J A;  4KDY A;  2JSZ A;  2VLV A;  2R5G A;  1R7H A;  3SWL A;  2NDO A;  4IP6 A;  5ECS A;  2LV3 A;  3DRN A;  4TVE A;  2RUE A;  3LXT A;  4EUY A;  2ES7 A;  2F3M A;  4YAP A;  3D5J A;  2BJX A;  1ABA A;  3BCK A;  2G2Q A;  1WPI A;  4PQH A;  2GVP A;  2HSH A;  3CTG A;  2YJ7 A;  5DVB A;  2O8V B;  3A2W A;  4YH2 A;  1V57 A;  3GRX A;  3FHK A;  2JL4 A;  3TDG A;  1IYI A;  3QAW A;  4ACS A;  4XTS A;  5D73 A;  3U5R E;  3M3M A;  1FW1 A;  4AF2 A;  3GUS A;  1GL8 A;  3ZRE A;  1HNA A;  3SBC A;  4LMW A;  2V2G A;  3DYR A;  4MF6 A;  2H73 A;  1SK2 A;  4CHS A;  4IN0 A;  1MDK A;  4J2F A;  5LCZ A;  2GSR A;  3ZRD A;  2H6Z A;  4TR1 B;  2H1B A;  4V1A g;  1TK8 B;  12GS A;  1G6W A;  3F6D A;  1SYX A;  6GSY A;  3IA1 A;  3VWV A;  1Z3E A;  1TOF A;  4OO5 A;  2MMN A;  4FYC A;  2IMK A;  3UVH A;  2VM2 A;  1PD2 1;  1USB A;  2FY6 A;  5FT3 A;  2IJY A;  1U87 A;  5CO3 A;  3O6T A;  3KJY A;  3U6V A;  3GX0 A;  4NV2 A;  1XOA A;  3BD2 A;  3GKK A;  1YZX A;  2WJU A;  1TXX A;  4ID0 A;  2O87 A;  3P8W A;  4K0N A;  2OBI A;  3KIJ A;  2H1A A;  2XHF A;  3GV1 A;  4KDU A;  3D0Z A;  3HKR A;  3CTF A;  2NVL A;  5JWR B;  4E8E A;  1MDJ A;  2KP1 A;  2X8C A;  3HJM A;  1ZOF A;  1K0M A;  3EIN A;  4IQ1 A;  4KCE A;  5IMC A;  3UAP A;  4K6X A;  3GYK A;  3E3E A;  4NV5 A;  1KNG A;  1NHY A;  3L9V A;  1SJI A;  4MA9 A;  3TJJ A;  1F37 A;  2Z9S A;  4ZB8 A;  1YKA A;  1YF0 A;  4XCS A;  4WR4 A;  2EC4 A;  5DJM A;  4OFM A;  2IL3 A;  2OKA A;  4NWY A;  2MYG A;  4AJ7 A;  1FOV A;  5ID2 B;  3HYP A;  1IYH A;  3TJK A;  1F2E A;  2YJH A;  1ERU A;  5GAP D;  1XFL A;  2OA7 A;  5G30 A;  4EE0 A;  2R4V A;  4IVF A;  2H74 A;  1SKS B;  5JCU A;  3M1G A;  5DJL A;  2HYX A;  4MZC A;  5G5F A;  4RI7 A;  5DAK B;  3ED3 A;  3NZN A;  1QXH A;  4L0W A;  3IK7 A;  4PGT A;  1NW2 A;  2CZ2 A;  3CYN A;  3NOF A;  1A8Y A;  4I6X A;  4TXO B;  3FR6 A;  1K3Y A;  3ISO A;  4NPB A;  4FYU A;  4GRF A;  1PA3 A;  5IMZ A;  2MMZ A;  1W89 A;  3IE3 A;  1S3C A;  1XW5 A;  3LYK A;  5JCG A;  2GT6 A;  5HFI A;  2YAN A;  1PX7 A;  3FK8 A;  3I43 A;  3LG6 A;  2PBJ A;  2H75 A;  2OJL A;  5ID2 A;  2GDR A;  3DGQ A;  2HZE B;  2ALB A;  1GLP A;  1X9W B;  2GSS A;  1Y25 A;  2K6V A;  3FR3 A;  5H5S A;  4K8M A;  1XXU A;  2CA8 A;  4J56 E;  5J4U A;  1MD3 A;  5ELG A;  3A2X A;  3F6F A;  4BL7 A;  2H6Y A;  2B7J A;  1Z7R A;  3F3R A;  4FYB A;  2QSI A;  3F4S A;  3ZTL A;  2IN3 A;  1RK4 A;  2LJK A;  1A2J A;  1FVK A;  2LEG A;  2WCI A;  4TXO A;  3APS A;  2DC5 A;  2J23 A;  4BA7 A;  2DBC A;  2FCH A;  5HR1 A;  1Z9H A;  2D2Z A;  2GQM A;  1PSQ A;  3RHB A;  5LNK e;  1TK0 B;  3KXO A;  1O7U A;  2N5F A;  1F6M C;  5IMD A;  4CDO A;  2E0Q A;  3FKF A;  2VCV A;  1SKW B;  1H4O A;  1ERW A;  1JZW A;  5IOX A;  2NTO A;  2IIY A;  2HRF A;  4Q5F A;  2CX3 A;  1YY7 A;  5DQY A;  4MZB A;  4EDY A;  3BOA A;  3MNG A;  2N5A A;  1G7O A;  4MZW A;  3HDC A;  2HZE A;  2VUP A;  1RW1 A;  1OKT A;  5J9B A;  1GP1 A;  3VWX A;  4WEY A;  2LRT A;  1KTE A;  5GZZ B;  3GKX A;  2E2G A;  3FZ5 A;  11GS A;  2AB6 A;  4MMM A;  4IW9 A;  1WOU A;  2OE1 A;  4G19 A;  3LQ7 A;  5G1L A;  2VLT A;  4PUF C;  9GSS A;  4XHM A;  2IMD A;  4TR4 A;  3TUE A;  1MD4 A;  1GTU A;  1GSD A;  1XWB A;  1Y6E A;  2VO4 A;  1ML6 A;  4WF5 A;  1PGT A;  3IDV A;  4OD7 A;  1GH2 A;  3N5O A;  2AV4 A;  1AQW A;  1YJ6 A;  1SKR B;  1TJD A;  1Z6M A;  4ZL7 A;  3EC3 A;  1WRY A;  3GSS A;  4IBP A;  5B6M A;  1EP8 A;  4DSS B;  1W4V A;  2J9H A;  4L5O A;  4POB A;  1BAY A;  4KH7 A;  1ZYQ B;  5CRW A;  1QMV A;  1XCC A;  2DJ1 A;  4ZIJ A;  4EVM A;  2DJ0 A;  2CV4 A;  3P7X A;  3A5W A;  5G1K A;  2RII A;  4Q5R A; 
#chains in the Genus database with same CATH topology
 2P5Q A;  2IFQ B;  4MH2 A;  3RHC A;  2CAQ A;  1GSE A;  3A2V A;  4ML6 A;  2C0D A;  1GSS A;  3EU4 A;  5H5Q A;  2LJR A;  3FMW A;  3HJO A;  1Q98 A;  2VOC A;  4MDC A;  3DIE A;  1EGR A;  1K0B A;  2AUV A;  3TKS A;  2E2M A;  3IHG A;  1UA5 A;  2O7K A;  17GS A;  4HJ2 A;  2TRX A;  2L4C A;  2R0P A;  2P0G A;  3IPZ A;  1PN9 A;  4X0X A;  2GT5 A;  1TRS A;  2FLS A;  3L78 A;  5GSS A;  2H66 A;  3HZ8 A;  1EEJ A;  4GF0 A;  3UJ1 A;  3TKS C;  3TKP A;  1KBN A;  2PUK C;  1X5E A;  4DSS A;  6GSV A;  1EGO A;  4O5U A;  2I4A A;  3LEF A;  5F05 A;  2MBT A;  2FUG 2;  3GH6 A;  2JU5 A;  5HQP A;  5B8A A;  1QQ2 A;  4IQA A;  5ABR A;  1E6B A;  4MJC A;  1LBK A;  3EVI A;  4I2T A;  4YKG A;  2M80 A;  5CYY A;  2V32 A;  5A4V A;  2IFQ A;  1SYR A;  4ZXG A;  4ZBD A;  3UAR A;  3CBU A;  2CVB A;  3N9J A;  4L5L A;  4Z7X A;  2PVQ A;  4MP4 A;  3IXR A;  3RBT A;  4GLT A;  5E4W A;  4IJ3 A;  1OC9 B;  4MCU A;  2PER A;  2P5R A;  5DBQ A;  3FZA A;  1O85 A;  4QL9 A;  2XBQ A;  3AY8 A;  4I2U A;  4DVC A;  1J9B A;  3LYP A;  1XWA A;  3TCO A;  2QA2 A;  3WGE A;  1TI1 A;  4FH8 A;  3FEU A;  5ECH B;  3QCP A;  3GHA A;  5HR2 A;  4BWQ A;  1M2B A;  4POM A;  3GH9 A;  2LQO A;  3J7Y k;  2I1U A;  3O3T A;  2GS3 A;  3HD5 A;  1FVJ A;  1A23 A;  2DMM A;  5IPG A;  2HI7 A;  4JU5 A;  4ECJ A;  5ECP B;  3P90 A;  5INY A;  4Q5Q A;  1OE7 A;  1EV9 A;  4PQ1 A;  8GSS A;  1M9B A;  1LJR A;  2JAD A;  2H72 A;  3ZL5 A;  2LNT A;  4N0V A;  2DJ2 A;  1TTZ A;  2QKE A;  2HLS A;  1OC9 A;  6GSU A;  1ZCP A;  5IMF A;  1ZYP A;  3D21 A;  3HVX A;  3IV4 A;  1ZYE A;  1NM3 A;  3GFK A;  2IPA A;  2FA8 A;  2HFD A;  3IAM 2;  22GS A;  4CY6 A;  3O76 A;  3WT1 A;  1T3B A;  14GS A;  1AW9 A;  1TP9 A;  5IMA A;  3CRT A;  1Q4J A;  2LQQ A;  3KMN A;  2VL2 A;  4TKY A;  3LWA A;  2GSQ A;  1G6Y A;  5B6N A;  2H0I A;  2A4V A;  3D22 A;  2H6X A;  3Q74 A;  3C7M A;  3MDK A;  4L0U A;  5HFG A;  2R3X A;  2VL2 C;  5EL8 A;  2WUL A;  1SD8 A;  2DJK A;  6GST A;  2YV7 A;  2CQ9 A;  3CMI A;  3DML A;  1MEK A;  5KN0 A;  2L4Q A;  2H30 A;  1PL2 A;  1T8E B;  3ZZX A;  3UEM A;  5EVO A;  5A4W A;  3PGT A;  4KGI A;  4BVY B;  4I8B A;  2YWO A;  1T1V A;  3ME7 A;  2C0F A;  1N8J A;  1GRX A;  2N5B A;  1TW9 A;  5KOW A;  2R6K A;  3KH9 A;  5BRT A;  4MJB A;  3ZFL A;  1URM A;  2IMF A;  3EUR A;  1N2A A;  3E0U A;  1QGV A;  4POL A;  4HU9 A;  3FY7 A;  1XOB A;  2TIR A;  3NIV A;  3IAS 2;  4DEJ A;  2R0C A;  2FHE A;  3DD3 A;  2F9S A;  2KLX A;  4LMV A;  4HQS A;  1G0T A;  1H75 A;  2NPB A;  4KDX A;  1X0R A;  1GUH A;  4NAX A;  1R4W A;  4KB3 A;  2TRC P;  13GS A;  3H79 A;  1SU9 A;  3ZVJ D;  2I81 A;  3RPP A;  2LUS A;  3CQF A;  2MBS A;  1OE8 A;  3VPT A;  1GUL A;  2H0G A;  1PX6 A;  4ECI A;  4TR1 A;  3KTL A;  3DXB A;  1WIK A;  5D9W A;  2HSM A;  4KX4 A;  1SL1 B;  4YAV A;  4BVX B;  2DML A;  3W6G A;  3FR9 A;  4BVY A;  1V2A A;  3LOR A;  4ULX A;  4ZL8 A;  4HS1 A;  4JR4 A;  1HYU A;  5J41 A;  5IQY A;  5CP1 A;  4O92 A;  1WJK A;  5D9V A;  1DSB A;  4E8H A;  2VM1 A;  4F82 A;  4WR5 A;  3QDN A;  2EIQ A;  1XW6 A;  4N0Z A;  4JR6 A;  4OO4 A;  2RM6 A;  2OBK A;  1YDK A;  3TOU A;  1TU7 A;  2QGV A;  1M2A A;  2AAW A;  2GST A;  3LFL A;  4N10 A;  5G2Z A;  3H93 A;  3M9K A;  10GS A;  4TRX A;  3C71 A;  1ZMA A;  4TR3 A;  4GSN A;  4HEA 2;  4PQI A;  5CRH A;  5ECM B;  4EO3 A;  1GNW A;  4XS1 A;  1FB6 A;  4GCI A;  4J57 E;  3QMX A;  4HU7 A;  5G5E A;  1ZYN A;  2L59 A;  4K5R A;  1GSQ A;  3EU3 A;  4NHZ A;  3ERF A;  4BVX A;  5AN1 A;  1ACV A;  1BX9 A;  1JZR A;  2E7P A;  4F9Z A;  4X1U A;  3C8E A;  4MK3 A;  3C73 A;  1K0C A;  4N30 A;  3QFB C;  2I9H A;  2VD0 A;  3F4T A;  4QL7 A;  1AC1 A;  1GNE A;  1VF4 A;  3TKQ A;  4EF0 A;  1EV4 A;  1OAZ A;  2M72 A;  4JED A;  2JSY A;  2UZ8 A;  3FZ4 A;  4ZB9 A;  2WZ9 A;  2V6K A;  3J7Y b;  1GWC A;  5KOX A;  5IMV A;  3ZLP A;  1KEB A;  4WBR D;  3S9F A;  1B4Q A;  2VIM A;  5DAK A;  1GLQ A;  1TRV A;  2FA4 A;  4WXT A;  3VPQ A;  1VGL A;  3TJB A;  2MMA A;  1XIY A;  3IK9 A;  4MAB A;  4YQU A;  4ILF A;  1T7P B;  3PIN A;  2CAI A;  1ERT A;  1ILO A;  5EY6 A;  4HJM A;  2BTO T;  4KSO A;  1SEN A;  1TK5 B;  1WE0 A;  5ECL B;  2L6D A;  1XBS A;  3LGC A;  5AIX A;  1TRW A;  3G7J A;  1K0A A;  1ZGN A;  20GS A;  5DCG A;  3GKN A;  3ZFB A;  5J5N A;  2L5O A;  2KUC A;  3GA4 A;  4LA1 A;  1YEP A;  5L71 A;  2JZR A;  3A3T A;  3DVX A;  5F07 A;  1XVQ A;  5LD0 A;  3RPN A;  1LU4 A;  2EIO A;  2REM A;  3KEB A;  1J0F A;  1X5D A;  1OKD A;  5CRG A;  1VF2 A;  2HSY A;  1K0O A;  2L57 A;  3HXS A;  2VAF A;  4IP1 A;  3GNJ A;  4HZ2 A;  4K2X A;  3VI7 A;  2DKH A;  3QAV A;  5CNW A;  1OYJ A;  2AJQ B;  2B1L A;  4EC0 A;  2VD1 A;  1ST9 A;  3G7Y A;  6GSX A;  2LTK A;  4I5Q A;  1YKC A;  1T4Z A;  3BJ5 A;  4PXO A;  1GUK A;  1TRU A;  1ERV A;  1A2M A;  3VK9 A;  5EPF A;  4HDE A;  4K7N A;  1ON4 A;  5BMU A;  4FO5 A;  2DKI A;  3QD9 A;  3HY2 A;  1AQX A;  1HNC A;  3TB2 A;  2H19 A;  4O32 A;  2H70 A;  4ECB A;  1DUG A;  5GAN D;  4HSC X;  4KSM A;  2VCZ A;  3M0F A;  4TOP A;  2H76 A;  1A2L A;  2GTU A;  2XC2 A;  1VF3 A;  2YCD A;  1R26 A;  3M8N A;  5ENU A;  2PVO C;  3GUR A;  3K8N A;  4XS4 B;  3BBY A;  3ZYW A;  1B9X C;  2YZH A;  1SL2 B;  1PN0 A;  3DKS A;  1GUM A;  5ECK B;  2FWH A;  2HXK A;  1S3A A;  5IO0 A;  5HFK A;  3ME8 A;  4MPG A;  4AJ6 A;  3QOU A;  1XPV A;  4LL4 B;  3WGX A;  3H8Q A;  2MMO A;  4EDZ A;  3E9J B;  3KP9 A;  5C04 A;  5A4U A;  5C00 A;  1VRS D;  3BCI A;  3EMX A;  5IOW A;  2C1Y A;  5CRE A;  3HCZ A;  3WGD A;  3GL5 A;  3A5I A;  1NSW A;  4KF9 A;  3US3 A;  1O6J A;  4MPF A;  1JZO A;  1BG5 A;  1FO5 A;  1B8X A;  2XPD A;  2B7K A;  3ZIV A;  4G0K A;  3VLN A;  2KOK A;  3DVW A;  1DBY A;  3VI5 A;  4O5R A;  3FZ9 A;  4AGS A;  3G9B A;  1FAA A;  2IME A;  1BQ7 A;  2H1G A;  2X4A A;  2C3T A;  4YQM A;  5AGY A;  3F4R A;  4A5P A;  3PH9 A;  3KP8 A;  1PFO A;  3VUR A;  2L6C A;  5FHI A;  5ECI B;  2QA1 A;  4K0G A;  4RUV A;  1E2Y A;  4MLY A;  1X9S B;  1X5C A;  2KHP A;  3VFI A;  2RUF A;  19GS A;  2GZY A;  3F0I A;  4QQ7 A;  4JE1 A;  4KAE A;  4WKW A;  3HZ4 A;  4V1A p;  1OC3 A;  4RQX A;  3ERG A;  1HNB A;  1S3D A;  3IHQ A;  1GSF A;  4PUA A;  1Z5Y E;  3FRC A;  3APQ A;  5D9T A;  4I97 A;  1BYE A;  2O85 A;  3WT2 A;  4IGJ A;  3TJG A;  3EYT A;  2KP2 A;  3QFA C;  2DSA A;  5DCH A;  1QK8 A;  3EWL A;  1JZD A;  5D93 A;  1M9A A;  1O81 A;  4KCA A;  4EL1 A;  1I9D A;  1THO A;  4AJ8 A;  2A2S A;  3EMP A;  2YN1 A;  4EKZ A;  1UVZ A;  1XG8 A;  2PGT A;  1EZK A;  1SK0 A;  4PUR A;  3PPU A;  2EIR A;  4CY8 A;  3GKM A;  3GTU B;  5IPH A;  2B5Y A;  3GN3 A;  4L8E A;  3QAG A;  1CQH A;  5ELA A;  3TJF A;  3L9S A;  4MJA A;  3UL3 A;  5JCW A;  1BJX A;  4P3Y B;  3KH7 A;  2K9F A;  3KMO A;  3UOM A;  2YWM A;  1J08 A;  1I5G A;  4WF4 A;  1A24 A;  5E59 A;  4POK A;  2DLX A;  3TGZ A;  3D4T A;  3W8J A;  1FHE A;  3IRA A;  3HVV A;  1XZO A;  1TDI A;  5COH A;  3HA9 A;  1T00 A;  4O7H A;  2B6M A;  4KA0 A;  5HR3 A;  2LNS A;  3ZMK A;  4OFT A;  3VWU A;  2C80 A;  3IR4 A;  5KEJ A;  3F8U A;  3D6I A;  2FGX A;  2YNX A;  2C3N A;  4F2I A;  1YF1 A;  2X8G A;  3TKS E;  2OE0 A;  2HE3 A;  3DWV A;  2ON7 A;  3FYG A;  4GQC A;  5J9C A;  1EOG A;  2GQK A;  5AIS A;  1EEM A;  1TKD B;  1C72 A;  4ZL9 A;  4BWS A;  2DJJ A;  1V9W A;  1BED A;  2C3Q A;  4K5S A;  2M46 A;  2PU9 C;  3GTU A;  1ZL9 A;  1X9M B;  3I9V 2;  4GST A;  2PMT A;  4HOJ A;  1SK1 A;  2CZ3 A;  2P31 A;  2GGT A;  2K8V A;  2B1K A;  5H5R A;  1B48 A;  3QR6 A;  2C8U A;  3MAK A;  4YKF A;  2LKU A;  6GSW A;  3MWH A;  2K8S A;  1HD2 A;  4F03 A;  5IM9 A;  1M2D A;  2H1D A;  4ISD A;  2HRN A;  2B5X A;  3UIW A;  1WMJ A;  1JFU A;  1MTC A;  5HR0 A;  4ML1 A;  2XBI A;  1V98 A;  1UN2 A;  4ZBB A;  2PPT A;  5F0G A;  2H0H A;  1R5P A;  2MZC A;  1YEX A;  4N11 A;  4EIQ A;  2WFC A;  3FW2 A;  1XWG A;  3VWW A;  3Q19 A;  4PNG A;  2VCX A;  5JWQ B;  5CAX A;  3APO A;  1FG4 A;  2JZT A;  2LJA A;  5CRD A;  1CQG A;  2FWG A;  1F9M A;  4TXV A;  2WGR A;  2C0E A;  1F3A A;  3Q18 A;  2WS2 A;  2F51 A;  2ZUP A;  4PTS A;  2LS5 A;  3MSZ A;  3DEX A;  2WDU A;  5G31 A;  3GX8 A;  4IEL A;  5IIZ A;  3D4M A;  3IC4 A;  1THX A;  2YV9 A;  4RQR A;  2LRN A;  2V41 A;  3QPM A;  5DAL B;  2JZS A;  1O73 A;  3ZIT A;  2VCW A;  4MJE A;  2HZF A;  2CVD A;  2YWI A;  1MDI A;  3TRX A;  3TKR A;  2A4H A;  1A0R P;  3LW9 A;  3HVS A;  2X8H A;  1OVN A;  1V58 A;  4ZIL A;  4PX1 A;  4F0C A;  4BL7 B;  4TN8 A;  4OCE A;  1R5A A;  3CSH A;  4V2L A;  2L5L A;  2FD3 A;  4K9Z A;  2PN8 A;  1JLW A;  1K0D A;  1HQO A;  1M0U A;  5FWG A;  1ZZY A;  1M3J A;  4X43 A;  1FB0 A;  3EE2 A;  2PWJ A;  3C1S A;  3TRP A;  1A0F A;  4KND A;  4WBJ A;  3HJP A;  4ECC A;  1K3O A;  3W8S A;  1M7T A;  2YOI A;  2YP6 A;  3CRU A;  1JHB A;  18GS A;  1DE2 A;  4KE3 A;  5D8I A;  5DDL A;  2AHE A;  2F8A A;  3UBL A;  3L4N A;  1PMT A;  3GMF A;  4XRA A;  3F63 A;  5DAL A;  4G2E A;  4DSR A;  2JAC A;  2LST A;  3RAZ A;  1B9Y C;  1RQM A;  3ZVJ A;  3LXZ A;  4KUN A;  4DSQ A;  4LL1 B;  2B3S A;  1XWC A;  4TR0 A;  1GTA A;  4IJI A;  2CT6 A;  4NMU A;  2XPE A;  1TI3 A;  2X99 A;  5J3R A;  2V6O A;  3JCM L;  3KM6 A;  3L0H A;  2HT9 A;  4Z2T A;  2FNO A;  2DJ3 A;  1PRX A;  4G10 A;  4HQZ A;  4GQF A;  2I3Y A;  3F9U A;  2O89 A;  2A2R A;  4G9H A;  5GST A;  4NHW A;  4KW6 A;  5F06 A;  2QC7 A;  5KN2 A;  1AXD A;  1PKZ A;  4IKH A;  2OAC A;  4D73 B;  3HHV A;  1PQN A;  5KN3 A;  1U3I A;  4K1F A;  3RDW A;  5KN1 A;  3LSZ A;  3TRQ A;  2IWT A;  4FIW A;  1AQV A;  4YQV A;  5IO2 A;  2OAD A;  4TW5 A;  1GSU A;  1QFN A;  6GSS A;  2CX4 A;  4GTU A;  4K7I A;  4GSS A;  2ZCT A;  1V40 A;  1O8W A;  4K2D A;  2G0F A;  5AIV A;  1K3L A;  3ERW A;  3PR8 A;  2VCQ A;  2HRA A;  3G7I A;  4EXJ A;  3UVT A;  5B8B A;  1AIU A;  5ECQ B;  3Q6O A;  1Z7P A;  4BPY A;  1U3A A;  3P2A A;  4ZBA A;  5ECR B;  1T4Y A;  3I6A A;  2HRK A;  3I69 A;  1VF1 A;  3H4K A;  4MF7 A;  3L9U A;  4V2N A;  1EP7 A;  5D96 A;  3CXG A;  3LJR A;  4D73 A;  5ECO B;  3WYW A;  1B4P A;  3CSI A;  3IBH A;  3GIX A;  3C1R A;  2H8L A;  3IOS A;  1JLV A;  5JWO B;  4IS0 A;  3MYD A;  1DE1 A;  2WRT A;  3CSJ A;  3KZQ A;  1OC8 A;  4HI7 A;  1TU8 A;  2C4J A;  2GLR A;  5B7C A;  2X64 A;  5F8B A;  3GST A;  3M9J A;  2R37 A;  4ICY A;  4CW9 A;  1EOH A;  1F3B A;  2RLI A;  4HUA A;  1XW9 A;  4LLR A;  2K18 A;  1Z6N A;  2IMI A;  4MF5 A;  4Q5N A;  2OE3 A;  2VL3 A;  2X49 A;  4IHU A;  1AUC A;  3WD6 A;  1QUW A;  5A5K A;  4OMV A;  2YZU A;  2B5E A;  2NBS A;  5D9X A;  3KCM A;  1M99 A;  2HNL A;  4V2M A;  3MIX A;  2V1M A;  4XRD A;  1NHO A;  2FWF A;  1AAZ A;  4RI6 A;  4O5Q A;  2DIY A;  1PL1 A;  2YWN A;  3R2Q A;  1GTB A;  2H71 A;  3HVN A;  7GSS A;  1XVW A;  1GSY A;  4PNF A;  3GL3 A;  4MH3 A;  4OCF A;  4XIH A;  5ECN B;  3ZML A;  4OWY A;  1SJZ A;  2YPM A;  2BMX A;  1PKW A;  1YQ1 A;  3V1W A;  1SJ6 A;  4H86 A;  4WET A;  4XS4 A;  2VL9 A;  4JRR A;  1K0N A;  1WWJ A;  1GTI A;  4MNN A;  2F8F A;  2FWE A;  2VLU A;  1EWX A;  3ZIJ A;  1XWK A;  3KTB A;  2AYT A;  2ON5 A;  2H01 A;  1G7E A;  4XS6 A;  3KD0 A;  2DIZ A;  2VCT A;  4JZQ A;  4ZB6 A;  4BIK A;  1WP0 A;  1U6T A;  3KGK A;  4NXI A;  2ZNM A;  4HZ4 A;  4GXZ A;  1A8L A;  2WB9 A;  4K7O A;  4USS A;  4F0B A;  1SL0 B;  1U88 A;  4JBB A;  3F3Q A;  3UMA A;  1O8X A;  5DQS A;  2LRC A;  2C0G A;  2GZZ A;  3TOT A;  4GWR A;  2GZP A;  1UC7 A;  4OFN A;  2RM5 A;  2CVK A;  3OR5 A;  2GQL A;  1SD9 A;  3UBK A;  3H1N A;  16GS A;  2R2J A;  4KDY A;  2JSZ A;  2VLV A;  2R5G A;  1R7H A;  3SWL A;  2NDO A;  4IP6 A;  5ECS A;  2LV3 A;  3DRN A;  4TVE A;  2RUE A;  3LXT A;  4EUY A;  2ES7 A;  2F3M A;  4YAP A;  3D5J A;  2BJX A;  1ABA A;  3BCK A;  2G2Q A;  1WPI A;  4PQH A;  2GVP A;  2HSH A;  3CTG A;  2YJ7 A;  5DVB A;  2O8V B;  3A2W A;  4YH2 A;  1V57 A;  3GRX A;  3FHK A;  2JL4 A;  3TDG A;  1IYI A;  3QAW A;  4ACS A;  4XTS A;  5D73 A;  3U5R E;  3M3M A;  1FW1 A;  4AF2 A;  3GUS A;  1GL8 A;  3ZRE A;  1HNA A;  3SBC A;  4LMW A;  2V2G A;  1FOH A;  3DYR A;  4MF6 A;  2H73 A;  1SK2 A;  4CHS A;  4IN0 A;  1MDK A;  4J2F A;  5LCZ A;  2GSR A;  3ZRD A;  2H6Z A;  4TR1 B;  2H1B A;  4V1A g;  1TK8 B;  12GS A;  1G6W A;  3F6D A;  1SYX A;  6GSY A;  3IA1 A;  3VWV A;  1Z3E A;  1TOF A;  4OO5 A;  2MMN A;  4FYC A;  2IMK A;  3UVH A;  2VM2 A;  1PD2 1;  1USB A;  2FY6 A;  3R3E A;  5FT3 A;  2IJY A;  1U87 A;  5CO3 A;  3O6T A;  3KJY A;  3U6V A;  3GX0 A;  4NV2 A;  1XOA A;  3BD2 A;  3GKK A;  1YZX A;  2WJU A;  1TXX A;  4ID0 A;  2O87 A;  3P8W A;  4K0N A;  2OBI A;  3KIJ A;  2H1A A;  2XHF A;  3GV1 A;  4KDU A;  3D0Z A;  3HKR A;  3CTF A;  2NVL A;  5JWR B;  4E8E A;  1MDJ A;  2KP1 A;  2X8C A;  3HJM A;  1ZOF A;  1K0M A;  3EIN A;  4IQ1 A;  4G0I A;  4KCE A;  5IMC A;  3UAP A;  4K6X A;  3GYK A;  2R0G A;  3E3E A;  4NV5 A;  1KNG A;  1NHY A;  3L9V A;  1SJI A;  4Z2R A;  4MA9 A;  3TJJ A;  1F37 A;  2Z9S A;  4ZB8 A;  1YKA A;  2A2P A;  1YF0 A;  4XCS A;  4WR4 A;  2EC4 A;  5DJM A;  4OFM A;  2IL3 A;  2OKA A;  4NWY A;  2MYG A;  4AJ7 A;  1FOV A;  5ID2 B;  3HYP A;  1IYH A;  3TJK A;  1F2E A;  2YJH A;  4G0L A;  1ERU A;  5GAP D;  1XFL A;  2OA7 A;  5G30 A;  4EE0 A;  2R4V A;  4IVF A;  2H74 A;  1SKS B;  5JCU A;  3M1G A;  5DJL A;  2HYX A;  4MZC A;  5G5F A;  4RI7 A;  5DAK B;  3ED3 A;  3NZN A;  1QXH A;  4L0W A;  3IK7 A;  4PGT A;  1NW2 A;  2CZ2 A;  3CYN A;  3NOF A;  1A8Y A;  4I6X A;  3EPT A;  4TXO B;  3FR6 A;  1K3Y A;  3ISO A;  4NPB A;  4FYU A;  4GRF A;  1PA3 A;  5IMZ A;  2MMZ A;  1W89 A;  3IE3 A;  1S3C A;  1XW5 A;  3LYK A;  5JCG A;  2GT6 A;  5HFI A;  2YAN A;  1PX7 A;  3FK8 A;  3I43 A;  3LG6 A;  2PBJ A;  2H75 A;  2OJL A;  5ID2 A;  2GDR A;  3DGQ A;  2HZE B;  2ALB A;  1GLP A;  1X9W B;  4Z2U A;  2GSS A;  1Y25 A;  2K6V A;  3FR3 A;  5H5S A;  4K8M A;  1XXU A;  2CA8 A;  4J56 E;  5J4U A;  1MD3 A;  5ELG A;  4EIP A;  3A2X A;  3F6F A;  4BL7 A;  2H6Y A;  2B7J A;  1Z7R A;  3F3R A;  4FYB A;  2QSI A;  3F4S A;  3ZTL A;  2IN3 A;  1RK4 A;  2LJK A;  1A2J A;  1FVK A;  2LEG A;  2WCI A;  4TXO A;  3APS A;  2DC5 A;  2J23 A;  4X4J A;  4BA7 A;  2DBC A;  2FCH A;  5HR1 A;  1Z9H A;  2D2Z A;  2GQM A;  1PSQ A;  3RHB A;  5LNK e;  1TK0 B;  3KXO A;  1O7U A;  2N5F A;  1F6M C;  5IMD A;  4CDO A;  2E0Q A;  3FKF A;  2VCV A;  1SKW B;  1H4O A;  1ERW A;  1JZW A;  5IOX A;  2NTO A;  2IIY A;  2HRF A;  4Q5F A;  2CX3 A;  1YY7 A;  5DQY A;  4MZB A;  4EDY A;  3BOA A;  3MNG A;  2N5A A;  1G7O A;  4MZW A;  3HDC A;  2HZE A;  2VUP A;  1RW1 A;  1OKT A;  5J9B A;  1GP1 A;  3VWX A;  4WEY A;  2LRT A;  1KTE A;  5GZZ B;  3GKX A;  2E2G A;  3FZ5 A;  11GS A;  2AB6 A;  4MMM A;  4IW9 A;  1WOU A;  2OE1 A;  4G19 A;  3LQ7 A;  5G1L A;  2VLT A;  4PUF C;  9GSS A;  4XHM A;  2IMD A;  4TR4 A;  3TUE A;  1MD4 A;  1S3R A;  1GTU A;  1GSD A;  1XWB A;  1Y6E A;  2VO4 A;  1ML6 A;  4WF5 A;  1PGT A;  3IDV A;  4OD7 A;  1GH2 A;  3N5O A;  2AV4 A;  4FQU A;  1AQW A;  1YJ6 A;  3IC8 A;  1SKR B;  1TJD A;  1Z6M A;  4ZL7 A;  3EC3 A;  1WRY A;  3GSS A;  4IBP A;  5B6M A;  1EP8 A;  4DSS B;  1W4V A;  2J9H A;  4L5O A;  4POB A;  1BAY A;  4KH7 A;  1M3I A;  1ZYQ B;  5CRW A;  1QMV A;  1XCC A;  2DJ1 A;  4ZIJ A;  4EVM A;  2DJ0 A;  2CV4 A;  3P7X A;  3A5W A;  5G1K A;  2RII A;  4Q5R A; 
#chains in the Genus database with same CATH homology
 2P5Q A;  2IFQ B;  4MH2 A;  3RHC A;  2CAQ A;  1GSE A;  3A2V A;  4ML6 A;  2C0D A;  1GSS A;  3EU4 A;  5H5Q A;  2LJR A;  3FMW A;  3HJO A;  1Q98 A;  2VOC A;  4MDC A;  3DIE A;  1EGR A;  1K0B A;  2AUV A;  3TKS A;  2E2M A;  3IHG A;  1UA5 A;  2O7K A;  17GS A;  4HJ2 A;  2TRX A;  2L4C A;  2R0P A;  2P0G A;  3IPZ A;  1PN9 A;  4X0X A;  2GT5 A;  1TRS A;  2FLS A;  3L78 A;  5GSS A;  2H66 A;  3HZ8 A;  1EEJ A;  4GF0 A;  3UJ1 A;  3TKS C;  3TKP A;  1KBN A;  2PUK C;  1X5E A;  4DSS A;  6GSV A;  1EGO A;  4O5U A;  2I4A A;  3LEF A;  5F05 A;  2MBT A;  2FUG 2;  3GH6 A;  2JU5 A;  5HQP A;  5B8A A;  1QQ2 A;  4IQA A;  5ABR A;  1E6B A;  4MJC A;  1LBK A;  3EVI A;  4I2T A;  4YKG A;  2M80 A;  5CYY A;  2V32 A;  5A4V A;  2IFQ A;  1SYR A;  4ZXG A;  4ZBD A;  3UAR A;  3CBU A;  2CVB A;  3N9J A;  4L5L A;  4Z7X A;  2PVQ A;  4MP4 A;  3IXR A;  3RBT A;  4GLT A;  5E4W A;  4IJ3 A;  1OC9 B;  4MCU A;  2PER A;  2P5R A;  5DBQ A;  3FZA A;  1O85 A;  4QL9 A;  2XBQ A;  3AY8 A;  4I2U A;  4DVC A;  1J9B A;  3LYP A;  1XWA A;  3TCO A;  2QA2 A;  3WGE A;  1TI1 A;  4FH8 A;  3FEU A;  5ECH B;  3QCP A;  3GHA A;  5HR2 A;  4BWQ A;  1M2B A;  4POM A;  3GH9 A;  2LQO A;  3J7Y k;  2I1U A;  3O3T A;  2GS3 A;  3HD5 A;  1FVJ A;  1A23 A;  2DMM A;  5IPG A;  2HI7 A;  4JU5 A;  4ECJ A;  5ECP B;  3P90 A;  5INY A;  4Q5Q A;  1OE7 A;  1EV9 A;  4PQ1 A;  8GSS A;  1M9B A;  1LJR A;  2JAD A;  2H72 A;  3ZL5 A;  2LNT A;  4N0V A;  2DJ2 A;  1TTZ A;  2QKE A;  2HLS A;  1OC9 A;  6GSU A;  1ZCP A;  5IMF A;  1ZYP A;  3D21 A;  3HVX A;  3IV4 A;  1ZYE A;  1NM3 A;  3GFK A;  2IPA A;  2FA8 A;  2HFD A;  3IAM 2;  22GS A;  4CY6 A;  3O76 A;  3WT1 A;  1T3B A;  14GS A;  1AW9 A;  1TP9 A;  5IMA A;  3CRT A;  1Q4J A;  2LQQ A;  3KMN A;  2VL2 A;  4TKY A;  3LWA A;  2GSQ A;  1G6Y A;  5B6N A;  2H0I A;  2A4V A;  3D22 A;  2H6X A;  3Q74 A;  3C7M A;  3MDK A;  4L0U A;  5HFG A;  2R3X A;  2VL2 C;  5EL8 A;  2WUL A;  1SD8 A;  2DJK A;  6GST A;  2YV7 A;  2CQ9 A;  3CMI A;  3DML A;  1MEK A;  5KN0 A;  2L4Q A;  2H30 A;  1PL2 A;  1T8E B;  3ZZX A;  3UEM A;  5EVO A;  5A4W A;  3PGT A;  4KGI A;  4BVY B;  4I8B A;  2YWO A;  1T1V A;  3ME7 A;  2C0F A;  1N8J A;  1GRX A;  2N5B A;  1TW9 A;  5KOW A;  2R6K A;  3KH9 A;  5BRT A;  4MJB A;  3ZFL A;  1URM A;  2IMF A;  3EUR A;  1N2A A;  3E0U A;  1QGV A;  4POL A;  4HU9 A;  3FY7 A;  1XOB A;  2TIR A;  3NIV A;  3IAS 2;  4DEJ A;  2R0C A;  2FHE A;  3DD3 A;  2F9S A;  2KLX A;  4LMV A;  4HQS A;  1G0T A;  1H75 A;  2NPB A;  4KDX A;  1X0R A;  1GUH A;  4NAX A;  1R4W A;  4KB3 A;  2TRC P;  13GS A;  3H79 A;  1SU9 A;  3ZVJ D;  2I81 A;  3RPP A;  2LUS A;  2MBS A;  1OE8 A;  3VPT A;  1GUL A;  2H0G A;  1PX6 A;  4ECI A;  4TR1 A;  3KTL A;  3DXB A;  1WIK A;  5D9W A;  2HSM A;  4KX4 A;  1SL1 B;  4YAV A;  4BVX B;  2DML A;  3W6G A;  3FR9 A;  4BVY A;  1V2A A;  3LOR A;  4ULX A;  4ZL8 A;  4HS1 A;  4JR4 A;  1HYU A;  5J41 A;  5IQY A;  5CP1 A;  4O92 A;  1WJK A;  5D9V A;  1DSB A;  4E8H A;  2VM1 A;  4F82 A;  4WR5 A;  3QDN A;  2EIQ A;  1XW6 A;  4N0Z A;  4JR6 A;  4OO4 A;  2RM6 A;  2OBK A;  1YDK A;  3TOU A;  1TU7 A;  2QGV A;  1M2A A;  2AAW A;  2GST A;  3LFL A;  4N10 A;  5G2Z A;  3H93 A;  3M9K A;  10GS A;  4TRX A;  3C71 A;  1ZMA A;  4TR3 A;  4GSN A;  4HEA 2;  4PQI A;  5CRH A;  5ECM B;  4EO3 A;  1GNW A;  4XS1 A;  1FB6 A;  4GCI A;  4J57 E;  3QMX A;  4HU7 A;  5G5E A;  1ZYN A;  2L59 A;  4K5R A;  1GSQ A;  3EU3 A;  4NHZ A;  3ERF A;  4BVX A;  5AN1 A;  1ACV A;  1BX9 A;  1JZR A;  2E7P A;  4F9Z A;  4X1U A;  3C8E A;  4MK3 A;  3C73 A;  1K0C A;  4N30 A;  3QFB C;  2I9H A;  2VD0 A;  3F4T A;  4QL7 A;  1AC1 A;  1GNE A;  1VF4 A;  3TKQ A;  4EF0 A;  1EV4 A;  1OAZ A;  2M72 A;  4JED A;  2JSY A;  2UZ8 A;  3FZ4 A;  4ZB9 A;  2WZ9 A;  2V6K A;  3J7Y b;  1GWC A;  5KOX A;  5IMV A;  3ZLP A;  1KEB A;  4WBR D;  3S9F A;  1B4Q A;  2VIM A;  5DAK A;  1GLQ A;  1TRV A;  2FA4 A;  4WXT A;  3VPQ A;  1VGL A;  3TJB A;  2MMA A;  1XIY A;  3IK9 A;  4MAB A;  4YQU A;  4ILF A;  1T7P B;  3PIN A;  2CAI A;  1ERT A;  1ILO A;  5EY6 A;  4HJM A;  2BTO T;  4KSO A;  1SEN A;  1TK5 B;  1WE0 A;  5ECL B;  2L6D A;  1XBS A;  3LGC A;  5AIX A;  1TRW A;  3G7J A;  1K0A A;  1ZGN A;  20GS A;  5DCG A;  3GKN A;  3ZFB A;  5J5N A;  2L5O A;  2KUC A;  3GA4 A;  4LA1 A;  1YEP A;  5L71 A;  2JZR A;  3A3T A;  3DVX A;  5F07 A;  1XVQ A;  5LD0 A;  3RPN A;  1LU4 A;  2EIO A;  2REM A;  3KEB A;  1J0F A;  1X5D A;  1OKD A;  5CRG A;  1VF2 A;  2HSY A;  1K0O A;  2L57 A;  3HXS A;  2VAF A;  4IP1 A;  3GNJ A;  4HZ2 A;  4K2X A;  3VI7 A;  2DKH A;  3QAV A;  5CNW A;  1OYJ A;  2AJQ B;  2B1L A;  4EC0 A;  2VD1 A;  1ST9 A;  3G7Y A;  6GSX A;  2LTK A;  4I5Q A;  1YKC A;  1T4Z A;  3BJ5 A;  4PXO A;  1GUK A;  1TRU A;  1ERV A;  1A2M A;  3VK9 A;  5EPF A;  4HDE A;  4K7N A;  1ON4 A;  5BMU A;  4FO5 A;  2DKI A;  3QD9 A;  3HY2 A;  1AQX A;  1HNC A;  3TB2 A;  2H19 A;  4O32 A;  2H70 A;  4ECB A;  1DUG A;  5GAN D;  4KSM A;  2VCZ A;  3M0F A;  4TOP A;  2H76 A;  1A2L A;  2GTU A;  2XC2 A;  1VF3 A;  2YCD A;  1R26 A;  3M8N A;  5ENU A;  2PVO C;  3GUR A;  3K8N A;  4XS4 B;  3BBY A;  3ZYW A;  1B9X C;  2YZH A;  1SL2 B;  1PN0 A;  3DKS A;  1GUM A;  5ECK B;  2FWH A;  2HXK A;  1S3A A;  5IO0 A;  5HFK A;  3ME8 A;  4MPG A;  4AJ6 A;  3QOU A;  1XPV A;  4LL4 B;  3WGX A;  3H8Q A;  2MMO A;  4EDZ A;  3E9J B;  3KP9 A;  5C04 A;  5A4U A;  5C00 A;  1VRS D;  3BCI A;  3EMX A;  5IOW A;  2C1Y A;  5CRE A;  3HCZ A;  3WGD A;  3GL5 A;  3A5I A;  1NSW A;  4KF9 A;  3US3 A;  1O6J A;  4MPF A;  1JZO A;  1BG5 A;  1FO5 A;  1B8X A;  2XPD A;  2B7K A;  3ZIV A;  4G0K A;  3VLN A;  2KOK A;  3DVW A;  1DBY A;  3VI5 A;  4O5R A;  3FZ9 A;  4AGS A;  3G9B A;  1FAA A;  2IME A;  1BQ7 A;  2H1G A;  2X4A A;  2C3T A;  4YQM A;  5AGY A;  3F4R A;  4A5P A;  3PH9 A;  3KP8 A;  3VUR A;  2L6C A;  5FHI A;  5ECI B;  2QA1 A;  4K0G A;  4RUV A;  1E2Y A;  4MLY A;  1X9S B;  1X5C A;  2KHP A;  3VFI A;  2RUF A;  19GS A;  2GZY A;  3F0I A;  4QQ7 A;  4JE1 A;  4KAE A;  4WKW A;  3HZ4 A;  4V1A p;  1OC3 A;  4RQX A;  3ERG A;  1HNB A;  1S3D A;  3IHQ A;  1GSF A;  4PUA A;  1Z5Y E;  3FRC A;  3APQ A;  5D9T A;  4I97 A;  1BYE A;  2O85 A;  3WT2 A;  4IGJ A;  3TJG A;  3EYT A;  2KP2 A;  3QFA C;  2DSA A;  5DCH A;  1QK8 A;  3EWL A;  1JZD A;  5D93 A;  1M9A A;  1O81 A;  4KCA A;  4EL1 A;  1I9D A;  1THO A;  4AJ8 A;  2A2S A;  3EMP A;  2YN1 A;  4EKZ A;  1UVZ A;  2PGT A;  1EZK A;  1SK0 A;  4PUR A;  3PPU A;  2EIR A;  4CY8 A;  3GKM A;  3GTU B;  5IPH A;  2B5Y A;  3GN3 A;  4L8E A;  3QAG A;  1CQH A;  5ELA A;  3TJF A;  3L9S A;  4MJA A;  3UL3 A;  5JCW A;  1BJX A;  4P3Y B;  3KH7 A;  2K9F A;  3KMO A;  3UOM A;  2YWM A;  1J08 A;  1I5G A;  4WF4 A;  1A24 A;  5E59 A;  4POK A;  2DLX A;  3TGZ A;  3D4T A;  3W8J A;  1FHE A;  3IRA A;  3HVV A;  1XZO A;  1TDI A;  5COH A;  3HA9 A;  1T00 A;  4O7H A;  2B6M A;  4KA0 A;  5HR3 A;  2LNS A;  3ZMK A;  4OFT A;  3VWU A;  2C80 A;  3IR4 A;  5KEJ A;  3F8U A;  3D6I A;  2FGX A;  2YNX A;  2C3N A;  4F2I A;  1YF1 A;  2X8G A;  3TKS E;  2OE0 A;  2HE3 A;  3DWV A;  2ON7 A;  3FYG A;  4GQC A;  5J9C A;  1EOG A;  2GQK A;  5AIS A;  1EEM A;  1TKD B;  1C72 A;  4ZL9 A;  4BWS A;  2DJJ A;  1V9W A;  1BED A;  2C3Q A;  4K5S A;  2M46 A;  2PU9 C;  3GTU A;  1ZL9 A;  1X9M B;  3I9V 2;  4GST A;  2PMT A;  4HOJ A;  1SK1 A;  2CZ3 A;  2P31 A;  2GGT A;  2K8V A;  2B1K A;  5H5R A;  1B48 A;  3QR6 A;  2C8U A;  3MAK A;  4YKF A;  2LKU A;  6GSW A;  3MWH A;  2K8S A;  1HD2 A;  4F03 A;  5IM9 A;  1M2D A;  2H1D A;  4ISD A;  2HRN A;  2B5X A;  3UIW A;  1WMJ A;  1JFU A;  1MTC A;  5HR0 A;  4ML1 A;  2XBI A;  1V98 A;  1UN2 A;  4ZBB A;  2PPT A;  5F0G A;  2H0H A;  1R5P A;  2MZC A;  1YEX A;  4N11 A;  4EIQ A;  2WFC A;  3FW2 A;  1XWG A;  3VWW A;  3Q19 A;  4PNG A;  2VCX A;  5JWQ B;  5CAX A;  3APO A;  1FG4 A;  2JZT A;  2LJA A;  5CRD A;  1CQG A;  2FWG A;  1F9M A;  4TXV A;  2WGR A;  2C0E A;  1F3A A;  3Q18 A;  2WS2 A;  2F51 A;  2ZUP A;  4PTS A;  2LS5 A;  3MSZ A;  3DEX A;  2WDU A;  5G31 A;  3GX8 A;  4IEL A;  5IIZ A;  3D4M A;  3IC4 A;  1THX A;  2YV9 A;  4RQR A;  2LRN A;  2V41 A;  3QPM A;  5DAL B;  2JZS A;  1O73 A;  3ZIT A;  2VCW A;  4MJE A;  2HZF A;  2CVD A;  2YWI A;  1MDI A;  3TRX A;  3TKR A;  2A4H A;  1A0R P;  3LW9 A;  3HVS A;  2X8H A;  1OVN A;  1V58 A;  4ZIL A;  4PX1 A;  4F0C A;  4BL7 B;  4TN8 A;  4OCE A;  1R5A A;  3CSH A;  4V2L A;  2L5L A;  2FD3 A;  4K9Z A;  2PN8 A;  1JLW A;  1K0D A;  1HQO A;  1M0U A;  5FWG A;  1ZZY A;  4X43 A;  1FB0 A;  3EE2 A;  2PWJ A;  3C1S A;  3TRP A;  1A0F A;  4KND A;  4WBJ A;  3HJP A;  4ECC A;  1K3O A;  3W8S A;  1M7T A;  2YOI A;  2YP6 A;  3CRU A;  1JHB A;  18GS A;  1DE2 A;  4KE3 A;  5D8I A;  5DDL A;  2AHE A;  2F8A A;  3UBL A;  3L4N A;  1PMT A;  3GMF A;  4XRA A;  3F63 A;  5DAL A;  4G2E A;  4DSR A;  2JAC A;  2LST A;  3RAZ A;  1B9Y C;  1RQM A;  3ZVJ A;  3LXZ A;  4KUN A;  4DSQ A;  4LL1 B;  2B3S A;  1XWC A;  4TR0 A;  1GTA A;  4IJI A;  2CT6 A;  4NMU A;  2XPE A;  1TI3 A;  2X99 A;  5J3R A;  2V6O A;  3JCM L;  3KM6 A;  3L0H A;  2HT9 A;  4Z2T A;  2FNO A;  2DJ3 A;  1PRX A;  4G10 A;  4HQZ A;  4GQF A;  2I3Y A;  3F9U A;  2O89 A;  2A2R A;  4G9H A;  5GST A;  4NHW A;  4KW6 A;  5F06 A;  2QC7 A;  5KN2 A;  1AXD A;  1PKZ A;  4IKH A;  2OAC A;  4D73 B;  3HHV A;  1PQN A;  5KN3 A;  1U3I A;  4K1F A;  3RDW A;  5KN1 A;  3LSZ A;  3TRQ A;  2IWT A;  4FIW A;  1AQV A;  4YQV A;  5IO2 A;  2OAD A;  4TW5 A;  1GSU A;  1QFN A;  6GSS A;  2CX4 A;  4GTU A;  4K7I A;  4GSS A;  2ZCT A;  1V40 A;  1O8W A;  4K2D A;  2G0F A;  5AIV A;  1K3L A;  3ERW A;  3PR8 A;  2VCQ A;  2HRA A;  3G7I A;  4EXJ A;  3UVT A;  5B8B A;  1AIU A;  5ECQ B;  3Q6O A;  1Z7P A;  4BPY A;  1U3A A;  3P2A A;  4ZBA A;  5ECR B;  1T4Y A;  3I6A A;  2HRK A;  3I69 A;  1VF1 A;  3H4K A;  4MF7 A;  3L9U A;  4V2N A;  1EP7 A;  5D96 A;  3CXG A;  3LJR A;  4D73 A;  5ECO B;  3WYW A;  1B4P A;  3CSI A;  3IBH A;  3GIX A;  3C1R A;  2H8L A;  3IOS A;  1JLV A;  5JWO B;  4IS0 A;  3MYD A;  1DE1 A;  2WRT A;  3CSJ A;  3KZQ A;  1OC8 A;  4HI7 A;  1TU8 A;  2C4J A;  2GLR A;  5B7C A;  2X64 A;  5F8B A;  3GST A;  3M9J A;  2R37 A;  4ICY A;  4CW9 A;  1EOH A;  1F3B A;  2RLI A;  4HUA A;  1XW9 A;  4LLR A;  2K18 A;  1Z6N A;  2IMI A;  4MF5 A;  4Q5N A;  2OE3 A;  2VL3 A;  2X49 A;  4IHU A;  1AUC A;  3WD6 A;  1QUW A;  5A5K A;  4OMV A;  2YZU A;  2B5E A;  2NBS A;  5D9X A;  3KCM A;  1M99 A;  2HNL A;  4V2M A;  3MIX A;  2V1M A;  4XRD A;  1NHO A;  2FWF A;  1AAZ A;  4RI6 A;  4O5Q A;  2DIY A;  1PL1 A;  2YWN A;  3R2Q A;  1GTB A;  2H71 A;  7GSS A;  1XVW A;  1GSY A;  4PNF A;  3GL3 A;  4MH3 A;  4OCF A;  4XIH A;  5ECN B;  3ZML A;  4OWY A;  1SJZ A;  2YPM A;  2BMX A;  1PKW A;  1YQ1 A;  3V1W A;  1SJ6 A;  4H86 A;  4WET A;  4XS4 A;  2VL9 A;  4JRR A;  1K0N A;  1WWJ A;  1GTI A;  4MNN A;  2F8F A;  2FWE A;  2VLU A;  1EWX A;  3ZIJ A;  1XWK A;  3KTB A;  2AYT A;  2ON5 A;  2H01 A;  1G7E A;  4XS6 A;  3KD0 A;  2DIZ A;  2VCT A;  4JZQ A;  4ZB6 A;  1WP0 A;  1U6T A;  3KGK A;  4NXI A;  2ZNM A;  4HZ4 A;  4GXZ A;  1A8L A;  2WB9 A;  4K7O A;  4USS A;  4F0B A;  1SL0 B;  1U88 A;  4JBB A;  3F3Q A;  3UMA A;  1O8X A;  5DQS A;  2LRC A;  2C0G A;  2GZZ A;  3TOT A;  4GWR A;  2GZP A;  1UC7 A;  4OFN A;  2RM5 A;  2CVK A;  3OR5 A;  2GQL A;  1SD9 A;  3UBK A;  3H1N A;  16GS A;  2R2J A;  4KDY A;  2JSZ A;  2VLV A;  2R5G A;  1R7H A;  3SWL A;  2NDO A;  4IP6 A;  5ECS A;  2LV3 A;  3DRN A;  4TVE A;  2RUE A;  3LXT A;  4EUY A;  2ES7 A;  2F3M A;  4YAP A;  3D5J A;  2BJX A;  1ABA A;  3BCK A;  2G2Q A;  1WPI A;  4PQH A;  2GVP A;  2HSH A;  3CTG A;  2YJ7 A;  5DVB A;  2O8V B;  3A2W A;  4YH2 A;  1V57 A;  3GRX A;  3FHK A;  2JL4 A;  3TDG A;  1IYI A;  3QAW A;  4ACS A;  4XTS A;  5D73 A;  3U5R E;  3M3M A;  1FW1 A;  4AF2 A;  3GUS A;  1GL8 A;  3ZRE A;  1HNA A;  3SBC A;  4LMW A;  2V2G A;  1FOH A;  3DYR A;  4MF6 A;  2H73 A;  1SK2 A;  4CHS A;  4IN0 A;  1MDK A;  4J2F A;  5LCZ A;  2GSR A;  3ZRD A;  2H6Z A;  4TR1 B;  2H1B A;  4V1A g;  1TK8 B;  12GS A;  1G6W A;  3F6D A;  1SYX A;  6GSY A;  3IA1 A;  3VWV A;  1Z3E A;  1TOF A;  4OO5 A;  2MMN A;  4FYC A;  2IMK A;  3UVH A;  2VM2 A;  1PD2 1;  1USB A;  2FY6 A;  3R3E A;  5FT3 A;  2IJY A;  1U87 A;  5CO3 A;  3O6T A;  3KJY A;  3U6V A;  3GX0 A;  4NV2 A;  1XOA A;  3BD2 A;  3GKK A;  1YZX A;  2WJU A;  1TXX A;  4ID0 A;  2O87 A;  3P8W A;  4K0N A;  2OBI A;  3KIJ A;  2H1A A;  2XHF A;  3GV1 A;  4KDU A;  3D0Z A;  3HKR A;  3CTF A;  2NVL A;  5JWR B;  4E8E A;  1MDJ A;  2KP1 A;  2X8C A;  3HJM A;  1ZOF A;  1K0M A;  3EIN A;  4IQ1 A;  4G0I A;  4KCE A;  5IMC A;  3UAP A;  4K6X A;  3GYK A;  2R0G A;  3E3E A;  4NV5 A;  1KNG A;  1NHY A;  3L9V A;  1SJI A;  4Z2R A;  4MA9 A;  3TJJ A;  1F37 A;  2Z9S A;  4ZB8 A;  1YKA A;  2A2P A;  1YF0 A;  4XCS A;  4WR4 A;  2EC4 A;  5DJM A;  4OFM A;  2IL3 A;  2OKA A;  4NWY A;  2MYG A;  4AJ7 A;  1FOV A;  5ID2 B;  3HYP A;  1IYH A;  3TJK A;  1F2E A;  2YJH A;  4G0L A;  1ERU A;  5GAP D;  1XFL A;  2OA7 A;  5G30 A;  4EE0 A;  2R4V A;  4IVF A;  2H74 A;  1SKS B;  5JCU A;  3M1G A;  5DJL A;  2HYX A;  4MZC A;  5G5F A;  4RI7 A;  5DAK B;  3ED3 A;  3NZN A;  1QXH A;  4L0W A;  3IK7 A;  4PGT A;  1NW2 A;  2CZ2 A;  3CYN A;  3NOF A;  1A8Y A;  4I6X A;  3EPT A;  4TXO B;  3FR6 A;  1K3Y A;  3ISO A;  4NPB A;  4FYU A;  4GRF A;  1PA3 A;  5IMZ A;  2MMZ A;  1W89 A;  3IE3 A;  1S3C A;  1XW5 A;  3LYK A;  5JCG A;  2GT6 A;  5HFI A;  2YAN A;  1PX7 A;  3FK8 A;  3I43 A;  3LG6 A;  2PBJ A;  2H75 A;  2OJL A;  5ID2 A;  2GDR A;  3DGQ A;  2HZE B;  2ALB A;  1GLP A;  1X9W B;  4Z2U A;  2GSS A;  1Y25 A;  2K6V A;  3FR3 A;  5H5S A;  4K8M A;  1XXU A;  2CA8 A;  4J56 E;  5J4U A;  1MD3 A;  5ELG A;  4EIP A;  3A2X A;  3F6F A;  4BL7 A;  2H6Y A;  2B7J A;  1Z7R A;  3F3R A;  4FYB A;  2QSI A;  3F4S A;  3ZTL A;  2IN3 A;  1RK4 A;  2LJK A;  1A2J A;  1FVK A;  2LEG A;  2WCI A;  4TXO A;  3APS A;  2DC5 A;  2J23 A;  4X4J A;  4BA7 A;  2DBC A;  2FCH A;  5HR1 A;  1Z9H A;  2D2Z A;  2GQM A;  1PSQ A;  3RHB A;  5LNK e;  1TK0 B;  3KXO A;  1O7U A;  2N5F A;  1F6M C;  5IMD A;  4CDO A;  2E0Q A;  3FKF A;  2VCV A;  1SKW B;  1H4O A;  1ERW A;  1JZW A;  5IOX A;  2NTO A;  2IIY A;  2HRF A;  4Q5F A;  2CX3 A;  1YY7 A;  5DQY A;  4MZB A;  4EDY A;  3BOA A;  3MNG A;  2N5A A;  1G7O A;  4MZW A;  3HDC A;  2HZE A;  2VUP A;  1RW1 A;  1OKT A;  5J9B A;  1GP1 A;  3VWX A;  4WEY A;  2LRT A;  1KTE A;  5GZZ B;  3GKX A;  2E2G A;  3FZ5 A;  11GS A;  2AB6 A;  4MMM A;  4IW9 A;  1WOU A;  2OE1 A;  4G19 A;  3LQ7 A;  5G1L A;  2VLT A;  4PUF C;  9GSS A;  4XHM A;  2IMD A;  4TR4 A;  3TUE A;  1MD4 A;  1GTU A;  1GSD A;  1XWB A;  1Y6E A;  2VO4 A;  1ML6 A;  4WF5 A;  1PGT A;  3IDV A;  4OD7 A;  1GH2 A;  3N5O A;  2AV4 A;  4FQU A;  1AQW A;  1YJ6 A;  3IC8 A;  1SKR B;  1TJD A;  1Z6M A;  4ZL7 A;  3EC3 A;  1WRY A;  3GSS A;  4IBP A;  5B6M A;  1EP8 A;  4DSS B;  1W4V A;  2J9H A;  4L5O A;  4POB A;  1BAY A;  4KH7 A;  1ZYQ B;  5CRW A;  1QMV A;  1XCC A;  2DJ1 A;  4ZIJ A;  4EVM A;  2DJ0 A;  2CV4 A;  3P7X A;  3A5W A;  5G1K A;  2RII A;  4Q5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...