2WGRA

Combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
163
structure length
163
Chain Sequence
SWNSIYEFTVKDINGVDVSLEKYRGHVCLIVNVACKSGATDKNYRQLQEMHTRLVGKGLRILAFPCNQFGGQEPWAEAEIKKFVTEKYGVQFDMFSKIKVNGSDADDLYKFLKSRQHGTLTNNIKWNFSKFLVDRQGQPVKRYSPTTAPYDIEGDIMELLEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords GLUTATHIONE PEROXIDASE
publication title Combining Crystallography and Molecular Dynamics: The Case of Schistosoma Mansoni Phospholipid Glutathione Peroxidase.
pubmed doi rcsb
source organism Schistosoma mansoni
total genus 65
structure length 163
sequence length 163
ec nomenclature ec 1.11.1.9: Glutathione peroxidase.
pdb deposition date 2009-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2wgrA00
5DBQA 2B5YA 3NZNA 3QAGA 1WWJA 1OE7A 3QOUA 4OCEA 2CVKA 1IYHA 4V1Ag 2VL2A 4Q5RA 1XOAA 2RM5A 3GKKA 4RQXA 5ECIB 4CHSA 3BBYA 4NMUA 4X43A 2FUG2 1SKRB 2X8CA 1AQVA 2R3XA 5DAKB 1ZYQB 4D73A 2PUKC 3QAVA 4JR4A 3PINA 1TRWA 3DVWA 3ZZXA 4GCIA 3GUSA 2C80A 2AJQB 1G6WA 1JLVA 1YKAA 4BA7A 2H66A 3DWVA 2H76A 1MD4A 3IAS2 3M9JA 2V41A 4NPBA 1DSBA 2VCQA 1FVJA 3EVIA 4ILFA 1TI3A 2C1YA 3HXSA 3NOFA 3F4SA 2J9HA 17GSA 3GV1A 2LRTA 1TU8A 4WBRD 2VCVA 5LD0A 4JRRA 1V9WA 3HD5A 1ERTA 4I2TA 2PVOC 5ENUA 1F37A 5HFKA 1XVQA 1EOGA 1UVZA 3VWWA 1SK2A 2GQKA 3W8SA 1SK1A 4OO5A 3EU3A 4Q5FA 4WETA 4DSSB 3KH7A 1MDKA 1NHYA 3LJRA 3APQA 4TR0A 3DEXA 1VRSD 1OAZA 3VFIA 2GLRA 5B6MA 3VI7A 4G9HA 1T1VA 1RW1A 4KH7A 3GX8A 1HNAA 3W6GA 4MDCA 2R5GA 4K7OA 4XTSA 3DMLA 4IW9A 1F2EA 3UL3A 2WZ9A 2H19A 2IMEA 1SL2B 1XZOA 2WCIA 4O92A 3ZLPA 19GSA 2TIRA 3ZRDA 3WYWA 3TCOA 2GS3A 1EP7A 13GSA 2K8SA 3CYNA 4HJMA 3FEUA 4OFMA 3DGQA 1TI1A 1HYUA 2LNSA 2VIMA 3GRXA 1AQWA 4KCEA 3WGDA 3KXOA 2JU5A 1YDKA 1M7TA 2L5LA 3FZ5A 3F9UA 3FW2A 3RDWA 2DBCA 4HOJA 1KEBA 2OKAA 1T3BA 3QCPA 3KIJA 1ILOA 2B1LA 4G2EA 1WOUA 5ID2A 1PL1A 1YQ1A 3CSHA 4EC0A 2QC7A 2GSSA 3O76A 2H72A 2H0HA 3CRTA 11GSA 1ML6A 3EYTA 4KNDA 4JEDA 3G9BA 3A2VA 2GT5A 2O85A 2VLTA 3IHQA 5KEJA 1S3CA 3L78A 4ZB9A 2G0FA 2XPDA 2J23A 4NHZA 2R2JA 1ZYEA 4PQ1A 4BL7A 2XBIA 5CRDA 1TK0B 3ZVJD 3D0ZA 2DMMA 4DSQA 1OC9B 5EL8A 3LXTA 4GRFA 1K0MA 3M8NA 1VGLA 2LQOA 5B6NA 2F3MA 1GSEA 4IKHA 3DVXA 3HVXA 3VK9A 2VLUA 4IS0A 2WRTA 2OE1A 2VOCA 1EP8A 4YH2A 1U6TA 1TP9A 2OA7A 1OE8A 3GMFA 3LEFA 1HNCA 1SK0A 4PGTA 2CA8A 5IOXA 2MZCA 2YJHA 20GSA 4XS4A 4IQ1A 1N2AA 3IK9A 2NBSA 2YZHA 2F8AA 3M1GA 1WJKA 1ZMAA 1PQNA 3IA1A 4YQVA 16GSA 5LNKe 2E7PA 3LORA 5J4UA 2EC4A 5IMAA 3TKSA 2CV4A 3D4TA 3KP9A 1B9YC 4TW5A 3R2QA 2ZCTA 1QUWA 2JZTA 2YPMA 1GUHA 1NSWA 4NV2A 6GSVA 5KN1A 1K0OA 3KM6A 2REMA 4XS6A 1GSQA 2LEGA 2ON7A 5H5RA 3ZMKA 1PL2A 1A8YA 3HZ8A 4GWRA 4I6XA 1OC3A 4OO4A 1LU4A 1QGVA 2ALBA 1T00A 5FWGA 3EMPA 6GSUA 1E2YA 1JZRA 2JZRA 2V6KA 2KP2A 4KW6A 2LNTA 5F0GA 2VL2C 4BVYA 5C04A 2H1BA 4ZBDA 5DJMA 2OADA 2KUCA 4PQIA 4ECCA 1LBKA 5ECNB 3ZITA 2P31A 3QDNA 2DJ2A 2FWEA 1XXUA 6GSSA 2O8VB 4WR4A 4AGSA 2DSAA 3BCKA 4XS4B 3TOTA 1G7EA 2IPAA 4WEYA 2MMZA 2HNLA 4GTUA 1NHOA 3GH6A 1SL0B 1GSFA 1O6JA 4KA0A 3ERFA 3N5OA 1UA5A 1SD8A 2H71A 4ZBBA 4GQFA 2CT6A 1K0DA 3M3MA 4XS1A 4PXOA 2X8HA 1SL1B 1PMTA 4TR4A 1FOVA 5IMZA 1JZDA 2VD1A 3QPMA 1A8LA 1R26A 2PGTA 4NHWA 4KAEA 1ERUA 1DBYA 3UJ1A 3ZREA 5D8IA 3Q6OA 1KNGA 1J08A 2C0DA 2AHEA 3WGEA 2WULA 1U3AA 5J5NA 4ISDA 4N0ZA 2K8VA 4ECJA 1IYIA 1GP1A 1ACVA 3E0UA 1T8EB 3BD2A 3FYGA 5GSTA 4KB3A 3TKRA 3C1SA 2PPTA 1SU9A 2LJRA 3PH9A 3ZMLA 4I8BA 2HZFA 4MF5A 3EU4A 1K3OA 1TJDA 3UVTA 3HVVA 1MTCA 3K8NA 5HR0A 4F0BA 5ELAA 1EGRA 1Z7PA 1SENA 4F2IA 1QFNA 4LL4B 4V2NA 2PVQA 1R5AA 4WR5A 2DIYA 3MAKA 2TRXA 2M46A 1MEKA 2HYXA 4MLYA 1B4QA 2YJ7A 1XWCA 1XIYA 5CP1A 3GKMA 5ECOB 4LLRA 3MNGA 3UOMA 4BWQA 1V57A 1VF1A 1XOBA 1KTEA 4Q5NA 1T4ZA 1XVWA 2L4CA 5DAKA 2P5RA 2P5QA 3CRUA 4FH8A 2LKUA 1SD9A 1GULA 1F6MC 3C7MA 2MMAA 3KJYA 4NWYA 1N8JA 4X0XA 4MF7A 1HD2A 4ZILA 4F03A 1XW9A 1EV4A 3S9FA 5DQYA 2AV4A 4ZB6A 4IGJA 5G30A 3ZIVA 3KP8A 3E9JB 2YV7A 1ZZYA 2C0FA 2K6VA 1A2LA 3HZ4A 2GSQA 2ZUPA 3RHBA 3TRPA 4DSSA 4MMMA 1YF1A 2R6KA 3F6DA 18GSA 3DYRA 1PX6A 4PUFC 1W4VA 3DXBA 1GH2A 1K0NA 4K7NA 3TOUA 1TXXA 2LV3A 1X0RA 4HQZA 1PKWA 2H1AA 3MSZA 4LA1A 3IK7A 2GSRA 2XPEA 2IMFA 1WPIA 1UN2A 3TKSC 4Z7XA 3RPPA 5FHIA 2GSTA 5A4UA 3IRAA 3H1NA 5EY6A 4HJ2A 4L5LA 2WDUA 2DMLA 4ZL7A 2Z9SA 1XWKA 5B7CA 5H5QA 4HZ2A 4I2UA 2I1UA 3HYPA 3P2AA 4RUVA 1O73A 4F9ZA 5D9VA 4GLTA 3TB2A 2HSYA 4MJEA 2NPBA 4EE0A 5IIZA 4QL9A 1OKDA 2PMTA 2CVDA 2RIIA 4EO3A 2NVLA 1AIUA 3ZVJA 3PGTA 5CNWA 2LUSA 1URMA 2FGXA 3CXGA 1M0UA 1FHEA 3EURA 1EZKA 1J0FA 3H8QA 3ERGA 4MZWA 2I81A 4K2DA 1FW1A 1M9AA 4GF0A 5CRWA 4FIWA 1X9MB 3HKRA 2HFDA 5G5EA 4PX1A 2CVBA 5AGYA 3OR5A 3ERWA 5KN3A 1PN9A 1LJRA 2PN8A 1JHBA 3C71A 1OC9A 4JR6A 1XBSA 5ECLB 3BOAA 3GL5A 3GTUA 1G7OA 1GLPA 3C73A 3Q18A 2FNOA 2RUFA 5HFIA 1BJXA 2XHFA 2VO4A 4ULXA 2DJKA 3GN3A 3F0IA 2JSZA 5JCUA 5IO0A 3E3EA 2L57A 2GZPA 4NXIA 4MABA 2OJLA 5F06A 3UBKA 4XIHA 3D4MA 2V32A 2L59A 4IP6A 2NTOA 4TR3A 2LJAA 4KCAA 2DJ1A 1M2AA 1DUGA 4O7HA 4HU7A 1W89A 1Z9HA 4EKZA 2VL3A 3L4NA 3FHKA 2V6OA 2AB6A 4IN0A 3IOSA 3EWLA 2L6DA 5J41A 1BAYA 2DLXA 4RQRA 4K0NA 4ZIJA 4KUNA 3KTLA 5GZZB 10GSA 1ST9A 3GTUB 3GYKA 3W8JA 4O5RA 1B48A 4JE1A 4K7IA 2PBJA 3UEMA 3IC4A 2CAQA 5L71A 5FT3A 2H73A 5E4WA 3KCMA 1USBA 2QKEA 2MMOA 2WB9A 1TRVA 1YJ6A 5DVBA 1T7PB 1TK5B 2BTOT 2HSHA 4ZL9A 3P90A 4CDOA 5DCHA 5JCWA 3CTGA 3J7Yb 2BJXA 3N9JA 2KLXA 1GUKA 2G2QA 1GTUA 3L9VA 5HR1A 5F07A 1XFLA 4K8MA 1GL8A 3G7YA 1SYXA 3I43A 3VWXA 2JADA 2C3TA 3WT1A 2H0IA 4MK3A 1XWGA 1O8WA 2HRFA 4K1FA 3WT2A 3TKPA 8GSSA 1GTIA 3F3RA 3ZFLA 4N30A 2PU9C 4F0CA 2I3YA 3U5RE 3LSZA 2H70A 5CYYA 5E59A 3I6AA 5IMFA 2PERA 6GSWA 3IR4A 3ZIJA 3LGCA 1HNBA 4WXTA 1U87A 5AIVA 4IP1A 1PKZA 1V2AA 2VCZA 9GSSA 12GSA 1F9MA 4K6XA 4HEA2 3VWVA 4XRAA 1Z7RA 2JACA 5D93A 5DALB 3DKSA 3V1WA 4X1UA 1GRXA 2IMIA 5IQYA 4KE3A 6GSTA 4XCSA 3EMXA 3L0HA 4QL7A 4POLA 4NAXA 5INYA 4L0UA 4OCFA 2H6YA 5DCGA 2HXKA 2VL9A 3LYPA 5F05A 4TRXA 4IELA 3CTFA 2NDOA 5JWQB 2IN3A 1SKSB 1BG5A 1PA3A 5IPHA 1TRSA 2L6CA 2WJUA 2YCDA 1FG4A 4LL1B 3FZ4A 5JCGA 5HQPA 2C8UA 3GHAA 2YN1A 2DC5A 5EVOA 2B1KA 3TJKA 2O7KA 2LSTA 3DD3A 5LCZA 2YWMA 1M2BA 4EUYA 4RI6A 4YAPA 4I5QA 1PGTA 1ZOFA 4OFTA 1OYJA 4ZL8A 1YY7A 2VD0A 3UIWA 3FZ9A 5GAND 2M80A 1R4WA 4TOPA 5GSSA 4POKA 2HZEB 1EOHA 2H75A 2H6XA 4Q5QA 4CW9A 2OE3A 4DVCA 1G0TA 2VUPA 1TW9A 1RK4A 4IBPA 3UAPA 2RLIA 4PNFA 4BPYA 5KN0A 4IJIA 2GQMA 2YNXA 1SKWB 4HI7A 2ES7A 2JSYA 2IJYA 5C00A 2WFCA 4J2FA 2FA8A 3RBTA 4TXOA 5D9TA 1O81A 1PSQA 1KBNA 1A2MA 3GSSA 3LWAA 3F4TA 4PQHA 2GGTA 2HE3A 2CZ2A 2K9FA 4NV5A 2X64A 3VI5A 2YOIA 3ZTLA 1XW5A 2AUVA 1B9XC 4KDUA 1I5GA 1M2DA 3FY7A 2R4VA 4XHMA 3SWLA 4GSNA 1GNWA 4TR1B 2IMKA 2EIQA 3US3A 5B8AA 2OACA 5ECQB 4GXZA 5DDLA 5DQSA 5ELGA 4MJAA 5EPFA 1AW9A 4IQAA 3O3TA 3KGKA 2MMNA 3M0FA 3F8UA 3Q19A 1VF4A 2OE0A 2VCXA 2FWFA 3VLNA 6GSYA 2F8FA 1ON4A 1H75A 5A5KA 4KDXA 5J9CA 4E8EA 1TRUA 1QXHA 3KH9A 3LG6A 2F51A 2PWJA 4O32A 4KDYA 4KSMA 2WGRA 1Q98A 1MDJA 1V58A 1GSYA 4EVMA 2KHPA 2FA4A 3IBHA 4TXOB 3I9V2 1BEDA 5D73A 4OWYA 2RM6A 4TVEA 1K3YA 1AAZA 3GA4A 3GKXA 5IMCA 5IMVA 2C0GA 3TGZA 3QFAC 1XW6A 1GTAA 3HVSA 4MJBA 1YEXA 2DJJA 2C4JA 4MCUA 1Z6NA 1FB6A 4L5OA 2MBSA 4N11A 3GIXA 2GT6A 1DE1A 4YQMA 2WS2A 4EL1A 1U3IA 1SYRA 2HI7A 3TJBA 4KX4A 2YWOA 2C3QA 2VAFA 3FK8A 2YWIA 4KSOA 5ECRB 4FYBA 3U6VA 4IHUA 4DEJA 4HQSA 7GSSA 2D2ZA 3P7XA 1NW2A 5HR2A 2ON5A 5D9XA 1F3BA 4POMA 2KP1A 2YZUA 2YWNA 4PNGA 1M99A 3WD6A 5G1KA 2B7JA 3RPNA 2FCHA 3UARA 4MA9A 3KMOA 1PD21 4POBA 2MYGA 2ZNMA 4P3YB 3GL3A 2VCWA 1H4OA 2IWTA 4TN8A 4XRDA 3DRNA 1X5EA 3Q74A 3KTBA 3VPTA 1YEPA 3VPQA 1CQHA 1A0FA 3P8WA 1WIKA 4G10A 4GQCA 3WGXA 1O7UA 4IJ3A 4N10A 4LMWA 3PR8A 3ZYWA 3UMAA 1X5CA 5IM9A 1K3LA 2H8LA 2IFQA 4H86A 3L9UA 3IE3A 1YZXA 4ID0A 4G19A 2GZZA 4ECBA 4YAVA 1JFUA 5F8BA 2QGVA 4PUAA 2DJ0A 3HHVA 5CRHA 2AAWA 3ZFBA 2VM2A 3IPZA 3J7Yk 2A2RA 2LS5A 3GKNA 4ML6A 1ZL9A 2E0QA 4JU5A 4WF5A 3C8EA 3DIEA 1F3AA 4I97A 4V2LA 2HT9A 3H4KA 4AJ6A 1K0BA 4OMVA 2H74A 1MD3A 2N5FA 3H93A 1FB0A 2FHEA 2GZYA 4BWSA 1AXDA 1A24A 5GAPD 6GSXA 1AQXA 4MP4A 5IPGA 2LRCA 4ACSA 5A4WA 3FR6A 3F3QA 5HFGA 5DJLA 1TU7A 3M9KA 2C3NA 4ECIA 1ABAA 3VURA 1GNEA 5IMDA 2CX4A 4EF0A 1HQOA 2V1MA 2VCTA 2IMDA 4D73B 1ERWA 4MZBA 3F4RA 4MF6A 5AN1A 4OD7A 2FY6A 3FR3A 1XCCA 2B3SA 4WF4A 2LTKA 2IFQB 1MDIA 5AISA 3FKFA 2LQQA 4EDYA 1VF3A 1YKCA 4HUAA 3O6TA 2YANA 4EXJA 1R7HA 3HJPA 4FYUA 2FWHA 5JWRB 1TOFA 3CBUA 4ZXGA 2O87A 4HZ4A 1JZOA 1ERVA 3IXRA 5D9WA 2A2SA 4JZQA 1THXA 2CX3A 4DSRA 2C0EA 3VWUA 1FVKA 14GSA 3TKQA 4V1Ap 4TXVA 2DJ3A 5ECMB 3HJOA 3CSIA 4YQUA 1AUCA 2N5AA 1T4YA 3ME7A 5DALA 3A5WA 3IAM2 2MBTA 5IO2A 3KEBA 1TTZA 2GVPA 1GWCA 1THOA 3D6IA 1A2JA 3EE2A 2RUEA 3RAZA 3IV4A 3AY8A 1QQ2A 1RQMA 3TRQA 1BYEA 3FR9A 1EGOA 4BVXA 3GFKA 5J9BA 1UC7A 5G2ZA 5JWOB 3A3TA 1GLQA 1K0AA 2I4AA 2EIRA 3JCML 1U88A 2BMXA 1WE0A 2K18A 3D5JA 1GTBA 2XBQA 3TUEA 1C72A 3TJFA 2H1GA 4MPGA 1BQ7A 5ID2B 1AC1A 3LXZA 1S3DA 1EV9A 1SJIA 4AJ8A 1VF2A 2HZEA 1X5DA 1GSDA 2R37A 1Y6EA 4KGIA 3LYKA 3KMNA 3KD0A 3MDKA 3FZAA 4JBBA 2V2GA 1A23A 2X8GA 4LMVA 2B6MA 4FO5A 5CAXA 3I69A 1R5PA 2LRNA 4ZBAA 1JZWA 1EEJA 2HRNA 3QD9A 2E2MA 1O85A 3TDGA 3A2XA 2O89A 2YP6A 3TJGA 2GDRA 1PX7A 1WRYA 4QQ7A 2FLSA 3D22A 2CZ3A 4L0WA 5CRGA 4L8EA 3CMIA 2HLSA 3KZQA 3UVHA 1PRXA 3F6FA 4HS1A 1V40A 2IIYA 2JZSA 3QMXA 2YV9A 2P0GA 2GQLA 5IOWA 1JLWA 1BX9A 2H1DA 1S3AA 22GSA 3IDVA 1OVNA 1Z3EA 2EIOA 5COHA 2M72A 3ME8A 4TR1A 1X9WB 1B8XA 3SBCA 2B7KA 4TKYA 4GSTA 5H5SA 3ISOA 3UBLA 1SJZA 2B5EA 4V2MA 1WMJA 2B5XA 1ZCPA 1GSSA 4HDEA 3LQ7A 3NIVA 4F82A 2X99A 1B4PA 4K0GA 1Q4JA 2QSIA 2F9SA 2N5BA 3TJJA 1E6BA 2OBIA 3HDCA 3GSTA 1CQGA 4GSSA 5G5FA 2H30A 4MZCA 3APOA 3HCZA 1SJ6A 2OBKA 1G6YA 2XC2A 1A0RP 2AYTA 3G7IA 3H79A 3APSA 3G7JA 1Z6MA 2FD3A 5KN2A 3L9SA 2L5OA 1Y25A 1EEMA 4HU9A 1X9SB 1FAAA 4AF2A 2VM1A 3ED3A 2H0GA 4K9ZA 4ZB8A 1I9DA 3CSJA 2KOKA 4MJCA 5G1LA 3C1RA 1FO5A 2IL3A 3FRCA 5D96A 3ZL5A 1ZGNA 2A4VA 4MPFA 1YF0A 5CO3A 3QFBC 2CQ9A 1DE2A 3A2WA 3LFLA 3D21A 5A4VA 4MH2A 3EINA 1TKDB 1WP0A 3GX0A 5ECHB 4FYCA 1EWXA 1Z5YE 1NM3A 2TRCP 4J56E 3GNJA 5ECSA 1J9BA 5ECKB 4OFNA 4WBJA 3RHCA 4ML1A 2LJKA 3HA9A 3HY2A 5AIXA 3TKSE 4J57E 4PURA 5ECPB 2I9HA 1XPVA 4E8HA 4RI7A 1V98A 3QR6A 2FWGA 2CAIA 4AJ7A 2JL4A 1GSUA 1O8XA 2VLVA 2E2GA 2GTUA 3EC3A 1OKTA 3F63A 4IVFA 4MH3A 1QMVA 2L4QA 3MWHA 3TRXA 5ABRA 5G31A 1TK8B 3BCIA 2H6ZA 5CREA 1XWBA 3GURA 2DIZA 2H01A 4EDZA 1OC8A 4WKWA 1XWAA 1TDIA 5B8BA 1QK8A 5HR3A 4N0VA 5J3RA 3BJ5A 3QAWA 3GH9A 1M9BA 1GUMA 1K0CA 3HJMA
chains in the Genus database with same CATH superfamily
5DBQA 2B5YA 3NZNA 3QAGA 1WWJA 1OE7A 3QOUA 4OCEA 2CVKA 1IYHA 4V1Ag 2VL2A 4Q5RA 1XOAA 2RM5A 3GKKA 4O5QA 4RQXA 5ECIB 4CHSA 3BBYA 4NMUA 4X43A 2FUG2 1SKRB 2X8CA 1AQVA 2R3XA 5DAKB 1ZYQB 4D73A 2PUKC 3QAVA 4JR4A 3PINA 1TRWA 3DVWA 3ZZXA 4GCIA 3GUSA 2C80A 3PPUA 2AJQB 1G6WA 1JLVA 1YKAA 4BA7A 2H66A 3DWVA 2H76A 1MD4A 3IAS2 3M9JA 2V41A 4NPBA 1DSBA 2VCQA 1FVJA 3EVIA 4ILFA 1TI3A 2C1YA 3HXSA 3NOFA 3F4SA 2J9HA 17GSA 3GV1A 2LRTA 1TU8A 4WBRD 4YKGA 2VCVA 5LD0A 4JRRA 1V9WA 3HD5A 1ERTA 4I2TA 2PVOC 5ENUA 1F37A 5HFKA 1XVQA 1EOGA 1UVZA 3VWWA 1SK2A 2GQKA 3W8SA 1SK1A 4OO5A 3EU3A 4Q5FA 4WETA 4G0LA 4DSSB 3KH7A 1MDKA 1NHYA 3LJRA 3APQA 4TR0A 3DEXA 1VRSD 1OAZA 3VFIA 2GLRA 5B6MA 2HSMA 3VI7A 4G9HA 1T1VA 1RW1A 4KH7A 3GX8A 1HNAA 3W6GA 4MDCA 2R5GA 4K7OA 4XTSA 3DMLA 4IW9A 1F2EA 3UL3A 2WZ9A 2H19A 2IMEA 1SL2B 1XZOA 2WCIA 3R3EA 4O92A 3ZLPA 2X49A 19GSA 2TIRA 3ZRDA 3WYWA 3TCOA 2GS3A 1EP7A 13GSA 2K8SA 3CYNA 4HJMA 3FEUA 4OFMA 3DGQA 1TI1A 1HYUA 2LNSA 2VIMA 3GRXA 1AQWA 4KCEA 3WGDA 3KXOA 2JU5A 1YDKA 1M7TA 2L5LA 3FZ5A 3F9UA 3FW2A 3RDWA 2DBCA 4HOJA 4FQUA 1KEBA 2OKAA 1T3BA 3QCPA 3KIJA 1ILOA 2B1LA 4G2EA 1WOUA 5ID2A 1PL1A 1YQ1A 3CSHA 4EC0A 2QC7A 2GSSA 3O76A 2H72A 2H0HA 3CRTA 11GSA 1ML6A 3EYTA 4KNDA 4JEDA 3G9BA 3A2VA 2GT5A 2O85A 2VLTA 3IHQA 5KEJA 1S3CA 3L78A 4ZB9A 2G0FA 2XPDA 2J23A 4NHZA 2R2JA 1ZYEA 4PQ1A 4BL7A 2XBIA 5CRDA 1TK0B 4BIKA 3ZVJD 3D0ZA 2DMMA 4DSQA 1OC9B 5EL8A 3LXTA 4GRFA 1K0MA 3M8NA 1VGLA 2LQOA 5B6NA 2F3MA 1GSEA 4IKHA 3DVXA 3HVXA 3VK9A 2VLUA 4IS0A 2WRTA 2OE1A 2VOCA 1EP8A 4YH2A 1U6TA 1TP9A 2OA7A 1OE8A 3GMFA 3LEFA 1HNCA 1SK0A 3MYDA 4PGTA 2CA8A 5IOXA 5BRTA 4K2XA 2MZCA 2YJHA 20GSA 4XS4A 4IQ1A 1N2AA 3IK9A 2NBSA 2YZHA 2F8AA 3M1GA 1WJKA 1ZMAA 1PQNA 3IA1A 4YQVA 16GSA 5LNKe 2E7PA 3LORA 5J4UA 2EC4A 5IMAA 3TKSA 2CV4A 3D4TA 3KP9A 1B9YC 4TW5A 3R2QA 2ZCTA 1QUWA 2JZTA 2YPMA 1GUHA 1NSWA 4NV2A 6GSVA 5KN1A 1K0OA 3KM6A 4YKFA 2REMA 4BL7B 4XS6A 1GSQA 2LEGA 2ON7A 5H5RA 3ZMKA 1PL2A 1A8YA 3HZ8A 4GWRA 4I6XA 1OC3A 4OO4A 1LU4A 1QGVA 2ALBA 1T00A 5FWGA 3EMPA 6GSUA 1E2YA 1JZRA 2JZRA 2V6KA 2KP2A 4KW6A 2LNTA 5F0GA 2VL2C 1S3RA 3CQFA 4BVYA 5C04A 3EPTA 2H1BA 4ZBDA 5DJMA 2OADA 2KUCA 4PQIA 4Z2RA 4ECCA 1LBKA 5ECNB 3ZITA 2P31A 3QDNA 2DJ2A 2FWEA 1XXUA 6GSSA 2O8VB 4WR4A 4AGSA 2DSAA 3BCKA 4XS4B 3TOTA 1G7EA 2IPAA 4WEYA 2MMZA 2HNLA 4GTUA 1NHOA 3GH6A 1SL0B 1GSFA 1O6JA 4KA0A 3ERFA 3N5OA 1UA5A 1SD8A 2H71A 4ZBBA 4GQFA 2CT6A 1K0DA 3M3MA 4XS1A 4PXOA 2X8HA 1SL1B 1PMTA 4TR4A 1FOVA 5IMZA 1JZDA 2VD1A 3QPMA 1A8LA 1R26A 2PGTA 4NHWA 4KAEA 1ERUA 1DBYA 3UJ1A 2DKHA 3ZREA 5D8IA 3Q6OA 1KNGA 1J08A 2C0DA 2AHEA 3WGEA 2WULA 1U3AA 5J5NA 4ISDA 4N0ZA 2K8VA 4ECJA 1IYIA 1GP1A 1ACVA 3E0UA 1T8EB 3BD2A 3FYGA 5GSTA 4KB3A 3TKRA 3C1SA 2PPTA 1SU9A 2LJRA 3PH9A 3ZMLA 4I8BA 2HZFA 4MF5A 4USSA 3EU4A 1K3OA 1TJDA 3UVTA 3HVVA 1MTCA 3K8NA 5HR0A 4F0BA 5ELAA 1EGRA 1Z7PA 1SENA 4F2IA 1QFNA 4LL4B 4V2NA 2PVQA 1R5AA 4WR5A 2DIYA 3MAKA 2TRXA 2M46A 2UZ8A 1MEKA 2HYXA 4MLYA 1B4QA 2YJ7A 1XWCA 1XIYA 5CP1A 3GKMA 5ECOB 4LLRA 3MNGA 3UOMA 4BWQA 1V57A 1VF1A 1XOBA 1KTEA 4Q5NA 1T4ZA 1XVWA 2L4CA 5DAKA 2P5RA 2P5QA 3CRUA 4FH8A 2LKUA 1SD9A 1GULA 1M3JA 1F6MC 3C7MA 2MMAA 3KJYA 4NWYA 1N8JA 4X0XA 1FOHA 4MF7A 1HD2A 4MNNA 4ZILA 4F03A 1XW9A 1EV4A 3S9FA 5DQYA 2AV4A 4ZB6A 4IGJA 5G30A 3ZIVA 3KP8A 3E9JB 2YV7A 1ZZYA 2C0FA 2K6VA 1A2LA 3HZ4A 2GSQA 2ZUPA 3RHBA 3TRPA 4DSSA 4MMMA 1YF1A 2R6KA 3F6DA 18GSA 3DYRA 1PX6A 4PUFC 1W4VA 3DXBA 1GH2A 1K0NA 4K7NA 3TOUA 1TXXA 4A5PA 2LV3A 1X0RA 4HQZA 1PKWA 2H1AA 3MSZA 4LA1A 3IK7A 2GSRA 4Z2TA 2XPEA 2IMFA 1WPIA 1UN2A 3TKSC 2QA1A 4Z7XA 3RPPA 5FHIA 2GSTA 1M3IA 5A4UA 3IRAA 3H1NA 5EY6A 4HJ2A 4G0IA 4L5LA 2WDUA 2DMLA 4ZL7A 2Z9SA 1XWKA 5B7CA 5H5QA 4HZ2A 4I2UA 2I1UA 3HYPA 3P2AA 4RUVA 1O73A 2R0GA 4F9ZA 5D9VA 2X4AA 4GLTA 3TB2A 2HSYA 4MJEA 2NPBA 4EE0A 5IIZA 4QL9A 1OKDA 2PMTA 2CVDA 2RIIA 4EO3A 2NVLA 1AIUA 3ZVJA 3PGTA 5CNWA 2HRKA 2LUSA 1URMA 2FGXA 3CXGA 1M0UA 1FHEA 3EURA 1EZKA 1J0FA 3H8QA 3ERGA 4MZWA 2I81A 4K2DA 1FW1A 1M9AA 4GF0A 5CRWA 4FIWA 1X9MB 3HKRA 2HFDA 5G5EA 4PX1A 2CVBA 5AGYA 4K5SA 3OR5A 3ERWA 5KOXA 5KN3A 1PN9A 1LJRA 2PN8A 1ZYPA 1JHBA 3C71A 1OC9A 4JR6A 1XBSA 5ECLB 3BOAA 3GL5A 3GTUA 1G7OA 1GLPA 3C73A 3Q18A 2FNOA 2RUFA 5HFIA 1BJXA 2XHFA 2VO4A 4ULXA 2DJKA 3GN3A 3F0IA 2JSZA 5JCUA 5IO0A 3E3EA 2L57A 2GZPA 4NXIA 4MABA 2OJLA 5F06A 3UBKA 4XIHA 2HRAA 3D4MA 2V32A 2L59A 4IP6A 2NTOA 4TR3A 2LJAA 4KCAA 2DJ1A 1PN0A 1M2AA 1DUGA 4O7HA 4HU7A 1W89A 1Z9HA 4EKZA 2VL3A 3L4NA 3FHKA 2V6OA 2AB6A 4IN0A 3IOSA 3EWLA 2L6DA 5J41A 1BAYA 2DLXA 4RQRA 4K0NA 4ZIJA 4KUNA 3KTLA 5GZZB 10GSA 1ST9A 3GTUB 3GYKA 3W8JA 4O5RA 1B48A 4JE1A 4K7IA 2PBJA 3UEMA 3IC4A 2CAQA 5L71A 5FT3A 2H73A 5E4WA 3KCMA 1USBA 2QKEA 2MMOA 2WB9A 1TRVA 1YJ6A 5DVBA 1T7PB 1TK5B 2BTOT 2HSHA 4ZL9A 3P90A 4CDOA 5DCHA 5JCWA 3CTGA 3J7Yb 2BJXA 3N9JA 2KLXA 1GUKA 2G2QA 2R0PA 1GTUA 3L9VA 5HR1A 5F07A 1XFLA 4K8MA 1GL8A 3G7YA 1SYXA 4HSCX 3I43A 3VWXA 2JADA 2C3TA 3WT1A 2H0IA 4MK3A 1XWGA 1O8WA 2HRFA 4K1FA 3WT2A 3TKPA 8GSSA 1GTIA 3F3RA 3ZFLA 4N30A 2PU9C 3A5IA 4F0CA 2I3YA 3U5RE 3LSZA 2H70A 5CYYA 5E59A 3I6AA 5IMFA 2PERA 6GSWA 3IR4A 3ZIJA 3LGCA 1HNBA 4WXTA 1U87A 5AIVA 4IP1A 4Z2UA 1PKZA 1V2AA 2VCZA 4X4JA 9GSSA 12GSA 1F9MA 4K6XA 4HEA2 3VWVA 4XRAA 1Z7RA 2JACA 5D93A 5DALB 3DKSA 3V1WA 4X1UA 1GRXA 2IMIA 5IQYA 4KE3A 6GSTA 4XCSA 3EMXA 3L0HA 4QL7A 4POLA 4NAXA 5INYA 4L0UA 4OCFA 2H6YA 5DCGA 2HXKA 2VL9A 3LYPA 5F05A 4TRXA 4IELA 3CTFA 2NDOA 4BVXB 5JWQB 2IN3A 1SKSB 1BG5A 1PA3A 5IPHA 1TRSA 2L6CA 2WJUA 2YCDA 1FG4A 4LL1B 3FZ4A 5JCGA 5HQPA 2C8UA 3GHAA 2YN1A 2DC5A 5EVOA 2B1KA 3TJKA 2O7KA 2LSTA 4O5UA 3DD3A 5LCZA 2YWMA 1M2BA 4EUYA 4RI6A 4YAPA 4I5QA 1PGTA 1ZOFA 4OFTA 1OYJA 4ZL8A 1YY7A 2VD0A 3UIWA 3FZ9A 5GAND 2M80A 1R4WA 4TOPA 5GSSA 4POKA 2HZEB 1EOHA 2H75A 2H6XA 4Q5QA 4CW9A 2OE3A 4DVCA 1G0TA 2VUPA 1TW9A 1RK4A 4IBPA 3UAPA 2RLIA 4PNFA 4BPYA 5KN0A 4IJIA 2GQMA 2YNXA 1SKWB 4HI7A 2ES7A 2JSYA 2IJYA 5C00A 2WFCA 4J2FA 2FA8A 1ZYNA 3RBTA 4TXOA 5D9TA 1O81A 1PSQA 1KBNA 1A2MA 3GSSA 3LWAA 3F4TA 4PQHA 2GGTA 2HE3A 2CZ2A 2K9FA 3IHGA 4NV5A 2X64A 3VI5A 2YOIA 3ZTLA 1XW5A 2AUVA 1B9XC 4KDUA 1I5GA 1M2DA 3FY7A 2R4VA 4XHMA 3SWLA 4GSNA 1GNWA 4TR1B 2IMKA 2EIQA 3US3A 5B8AA 2OACA 5ECQB 4GXZA 5DDLA 5DQSA 5ELGA 4MJAA 5EPFA 1AW9A 4IQAA 3O3TA 3KGKA 2MMNA 3M0FA 3F8UA 3Q19A 1VF4A 2OE0A 2VCXA 2FWFA 3VLNA 6GSYA 2F8FA 1ON4A 1H75A 5A5KA 4KDXA 5J9CA 4E8EA 1TRUA 1QXHA 3KH9A 3LG6A 2F51A 2PWJA 4O32A 4KDYA 3FMWA 4KSMA 2WGRA 1Q98A 1MDJA 1V58A 1GSYA 4EVMA 2KHPA 2FA4A 3IBHA 4TXOB 3I9V2 1BEDA 5D73A 4OWYA 2RM6A 4TVEA 1K3YA 1AAZA 3GA4A 3GKXA 5IMCA 5IMVA 2C0GA 4KF9A 1XG8A 3TGZA 3QFAC 1XW6A 1GTAA 3HVSA 4MJBA 1YEXA 2DJJA 2C4JA 4MCUA 1Z6NA 1FB6A 4L5OA 2MBSA 4N11A 3GIXA 2GT6A 1DE1A 4YQMA 2WS2A 4EL1A 1U3IA 1SYRA 2HI7A 3TJBA 4KX4A 2YWOA 2C3QA 2VAFA 3FK8A 2YWIA 4KSOA 5ECRB 4FYBA 3U6VA 4IHUA 4DEJA 4HQSA 7GSSA 3HVNA 2D2ZA 3P7XA 4CY6A 1NW2A 5HR2A 2ON5A 5D9XA 1F3BA 4POMA 2KP1A 2YZUA 2YWNA 4PNGA 1M99A 3WD6A 5G1KA 2B7JA 3RPNA 2FCHA 3UARA 4MA9A 3KMOA 1PD21 4POBA 2MYGA 2ZNMA 4P3YB 3GL3A 2VCWA 1H4OA 2IWTA 4TN8A 4XRDA 3DRNA 1X5EA 3Q74A 3KTBA 3VPTA 1YEPA 3VPQA 1CQHA 1A0FA 3P8WA 1WIKA 4G10A 4GQCA 3WGXA 1O7UA 4IJ3A 3LW9A 4N10A 4LMWA 3PR8A 3ZYWA 3UMAA 1X5CA 5IM9A 1K3LA 2H8LA 2IFQA 4H86A 3L9UA 3IE3A 1YZXA 4ID0A 4G19A 2GZZA 4ECBA 4YAVA 4CY8A 1JFUA 5F8BA 2QGVA 4PUAA 2DJ0A 3HHVA 5CRHA 2AAWA 3ZFBA 2VM2A 3IPZA 3J7Yk 2A2RA 2LS5A 3GKNA 4ML6A 1ZL9A 2E0QA 4JU5A 4WF5A 3C8EA 3DIEA 1F3AA 4I97A 4V2LA 2HT9A 3H4KA 4AJ6A 1K0BA 4OMVA 2H74A 1MD3A 2N5FA 3H93A 1FB0A 2FHEA 2GZYA 4BWSA 1AXDA 1A24A 5GAPD 6GSXA 1AQXA 4MP4A 5IPGA 2LRCA 4ACSA 5A4WA 3FR6A 3F3QA 5HFGA 5DJLA 1TU7A 3M9KA 2C3NA 4ECIA 1ABAA 3VURA 1GNEA 3MIXA 5IMDA 2CX4A 4EF0A 1HQOA 2V1MA 2VCTA 2IMDA 4D73B 1ERWA 4MZBA 3F4RA 4MF6A 5AN1A 4OD7A 2FY6A 3FR3A 1XCCA 2B3SA 4WF4A 2LTKA 4PTSA 2IFQB 1MDIA 5AISA 3FKFA 2LQQA 4EDYA 1VF3A 1YKCA 4HUAA 3O6TA 2YANA 4EXJA 1R7HA 3HJPA 4FYUA 2FWHA 5JWRB 1TOFA 3CBUA 4ZXGA 2O87A 4HZ4A 5KOWA 1JZOA 1ERVA 3IXRA 5D9WA 2A2SA 4JZQA 1THXA 2CX3A 4DSRA 2C0EA 3VWUA 1FVKA 14GSA 3TKQA 4V1Ap 4TXVA 4EIPA 2DJ3A 5ECMB 3HJOA 3CSIA 4YQUA 1AUCA 2N5AA 1T4YA 3ME7A 5DALA 3A5WA 3IAM2 2MBTA 5IO2A 3KEBA 1TTZA 2GVPA 1GWCA 1THOA 3D6IA 1A2JA 3EE2A 2RUEA 3RAZA 3IV4A 3AY8A 1QQ2A 1RQMA 3TRQA 1BYEA 3FR9A 1EGOA 4BVXA 3GFKA 5J9BA 1UC7A 5G2ZA 5JWOB 3A3TA 1GLQA 1K0AA 2I4AA 2EIRA 3JCML 1U88A 2BMXA 1WE0A 2K18A 3D5JA 1GTBA 2XBQA 3TUEA 1C72A 3TJFA 2H1GA 4MPGA 1BQ7A 2A4HA 5ID2B 1AC1A 3LXZA 1S3DA 1EV9A 1SJIA 4AJ8A 1VF2A 2HZEA 1X5DA 1GSDA 2R37A 1Y6EA 4KGIA 3LYKA 3KMNA 3KD0A 3MDKA 3FZAA 4JBBA 2V2GA 1A23A 2X8GA 4LMVA 2B6MA 4FO5A 5CAXA 3I69A 1R5PA 2LRNA 4ZBAA 1JZWA 1EEJA 2HRNA 3QD9A 2E2MA 1O85A 3TDGA 3A2XA 2O89A 2YP6A 3TJGA 2GDRA 1PX7A 1WRYA 4QQ7A 2FLSA 3D22A 2CZ3A 4L0WA 5CRGA 4L8EA 3CMIA 2HLSA 3KZQA 3UVHA 1PRXA 3F6FA 4HS1A 1V40A 2IIYA 2JZSA 3QMXA 2YV9A 2P0GA 2GQLA 5IOWA 1JLWA 1BX9A 2H1DA 1S3AA 22GSA 3IDVA 1OVNA 1Z3EA 2EIOA 5COHA 2A2PA 2M72A 3ME8A 4TR1A 1X9WB 1B8XA 4EIQA 3SBCA 2B7KA 4TKYA 4GSTA 5H5SA 3ISOA 3UBLA 1SJZA 2B5EA 4V2MA 1WMJA 2B5XA 2DKIA 1ZCPA 1GSSA 4HDEA 3LQ7A 3NIVA 4F82A 2X99A 1B4PA 4K0GA 1Q4JA 2QSIA 2F9SA 2N5BA 3TJJA 4G0KA 1E6BA 3IC8A 2OBIA 3HDCA 3GSTA 1CQGA 4GSSA 5G5FA 2H30A 4MZCA 3APOA 3HCZA 1SJ6A 2OBKA 1G6YA 2XC2A 1A0RP 2AYTA 3G7IA 3H79A 3APSA 3G7JA 4BVYB 1Z6MA 2FD3A 5KN2A 3L9SA 2L5OA 1Y25A 1EEMA 4HU9A 1X9SB 1FAAA 4AF2A 2VM1A 3ED3A 2H0GA 4K9ZA 4ZB8A 1I9DA 3CSJA 2KOKA 4MJCA 5G1LA 3C1RA 1FO5A 2IL3A 3FRCA 5D96A 3ZL5A 1ZGNA 2A4VA 4MPFA 1YF0A 5CO3A 3QFBC 2CQ9A 1DE2A 1PFOA 3A2WA 3LFLA 3D21A 5A4VA 4MH2A 3EINA 1TKDB 1WP0A 3GX0A 2R0CA 5ECHB 4FYCA 1EWXA 1Z5YE 1NM3A 2TRCP 4J56E 3GNJA 4ICYA 5ECSA 1J9BA 5ECKB 4OFNA 4WBJA 3RHCA 4ML1A 2LJKA 3HA9A 3HY2A 5AIXA 3TKSE 4J57E 2QA2A 4PURA 5BMUA 5ECPB 2I9HA 1XPVA 4E8HA 4RI7A 1V98A 3QR6A 2FWGA 2CAIA 4K5RA 4AJ7A 2JL4A 1GSUA 1O8XA 2VLVA 2E2GA 2GTUA 3EC3A 1OKTA 3F63A 4IVFA 4MH3A 1QMVA 2L4QA 3MWHA 3TRXA 5ABRA 5G31A 1TK8B 3BCIA 2H6ZA 5CREA 1XWBA 3GURA 2DIZA 2H01A 4EDZA 1OC8A 4WKWA 1XWAA 1TDIA 5B8BA 1QK8A 5HR3A 4N0VA 5J3RA 3BJ5A 3QAWA 3GH9A 1M9BA 1GUMA 1K0CA 3HJMA
chains in the Genus database with same CATH topology
5DBQA 2B5YA 3NZNA 3QAGA 1WWJA 1OE7A 3QOUA 4OCEA 2CVKA 1IYHA 4V1Ag 2VL2A 4Q5RA 1XOAA 2RM5A 3GKKA 4O5QA 4RQXA 5ECIB 4CHSA 3BBYA 4NMUA 4X43A 2FUG2 1SKRB 2X8CA 1AQVA 2R3XA 5DAKB 1ZYQB 4D73A 2PUKC 3QAVA 4JR4A 3PINA 1TRWA 3DVWA 3ZZXA 4GCIA 3GUSA 2C80A 3PPUA 2AJQB 1G6WA 1JLVA 1YKAA 4BA7A 2H66A 3DWVA 2H76A 1MD4A 3IAS2 3M9JA 2V41A 4NPBA 1DSBA 2VCQA 1FVJA 3EVIA 4ILFA 1TI3A 2C1YA 3HXSA 3NOFA 3F4SA 2J9HA 17GSA 3GV1A 2LRTA 1TU8A 4WBRD 4YKGA 2VCVA 5LD0A 4JRRA 1V9WA 3HD5A 1ERTA 4I2TA 2PVOC 5ENUA 1F37A 5HFKA 1XVQA 1EOGA 1UVZA 3VWWA 1SK2A 2GQKA 3W8SA 1SK1A 4OO5A 3EU3A 4Q5FA 4WETA 4G0LA 4DSSB 3KH7A 1MDKA 1NHYA 3LJRA 3APQA 4TR0A 3DEXA 1VRSD 1OAZA 3VFIA 2GLRA 5B6MA 2HSMA 3VI7A 4G9HA 1T1VA 1RW1A 4KH7A 3GX8A 1HNAA 3W6GA 4MDCA 2R5GA 4K7OA 4XTSA 3DMLA 4IW9A 1F2EA 3UL3A 2WZ9A 2H19A 2IMEA 1SL2B 1XZOA 2WCIA 3R3EA 4O92A 3ZLPA 2X49A 19GSA 2TIRA 3ZRDA 3WYWA 3TCOA 2GS3A 1EP7A 13GSA 2K8SA 3CYNA 4HJMA 3FEUA 4OFMA 3DGQA 1TI1A 1HYUA 2LNSA 2VIMA 3GRXA 1AQWA 4KCEA 3WGDA 3KXOA 2JU5A 1YDKA 1M7TA 2L5LA 3FZ5A 3F9UA 3FW2A 3RDWA 2DBCA 4HOJA 4FQUA 1KEBA 2OKAA 1T3BA 3QCPA 3KIJA 1ILOA 2B1LA 4G2EA 1WOUA 5ID2A 1PL1A 1YQ1A 3CSHA 4EC0A 2QC7A 2GSSA 3O76A 2H72A 2H0HA 3CRTA 11GSA 1ML6A 3EYTA 4KNDA 4JEDA 3G9BA 3A2VA 2GT5A 2O85A 2VLTA 3IHQA 5KEJA 1S3CA 3L78A 4ZB9A 2G0FA 2XPDA 2J23A 4NHZA 2R2JA 1ZYEA 4PQ1A 4BL7A 2XBIA 5CRDA 1TK0B 3ZVJD 3D0ZA 2DMMA 4DSQA 1OC9B 5EL8A 3LXTA 4GRFA 1K0MA 3M8NA 1VGLA 2LQOA 5B6NA 2F3MA 1GSEA 4IKHA 3DVXA 3HVXA 3VK9A 2VLUA 4IS0A 2WRTA 2OE1A 2VOCA 1EP8A 4YH2A 1U6TA 1TP9A 2OA7A 1OE8A 3GMFA 3LEFA 1HNCA 1SK0A 3MYDA 4PGTA 2CA8A 5IOXA 5BRTA 4K2XA 2MZCA 2YJHA 20GSA 4XS4A 4IQ1A 1N2AA 3IK9A 2NBSA 2YZHA 2F8AA 3M1GA 1WJKA 1ZMAA 1PQNA 3IA1A 4YQVA 16GSA 5LNKe 2E7PA 3LORA 5J4UA 2EC4A 5IMAA 3TKSA 2CV4A 3D4TA 3KP9A 1B9YC 4TW5A 3R2QA 2ZCTA 1QUWA 2JZTA 2YPMA 1GUHA 1NSWA 4NV2A 6GSVA 5KN1A 1K0OA 3KM6A 4YKFA 2REMA 4BL7B 4XS6A 1GSQA 2LEGA 2ON7A 5H5RA 3ZMKA 1PL2A 1A8YA 3HZ8A 4GWRA 4I6XA 1OC3A 4OO4A 1LU4A 1QGVA 2ALBA 1T00A 5FWGA 3EMPA 6GSUA 1E2YA 1JZRA 2JZRA 2V6KA 2KP2A 4KW6A 2LNTA 5F0GA 2VL2C 4BVYA 5C04A 3EPTA 2H1BA 4ZBDA 5DJMA 2OADA 2KUCA 4PQIA 4Z2RA 4ECCA 1LBKA 5ECNB 3ZITA 2P31A 3QDNA 2DJ2A 2FWEA 1XXUA 6GSSA 2O8VB 4WR4A 4AGSA 2DSAA 3BCKA 4XS4B 3TOTA 1G7EA 2IPAA 4WEYA 2MMZA 2HNLA 4GTUA 1NHOA 3GH6A 1SL0B 1GSFA 1O6JA 4KA0A 3ERFA 3N5OA 1UA5A 1SD8A 2H71A 4ZBBA 4GQFA 2CT6A 1K0DA 3M3MA 4XS1A 4PXOA 2X8HA 1SL1B 1PMTA 4TR4A 1FOVA 5IMZA 1JZDA 2VD1A 3QPMA 1A8LA 1R26A 2PGTA 4NHWA 4KAEA 1ERUA 1DBYA 3UJ1A 2DKHA 3ZREA 5D8IA 3Q6OA 1KNGA 1J08A 2C0DA 2AHEA 3WGEA 2WULA 1U3AA 5J5NA 4ISDA 4N0ZA 2K8VA 4ECJA 1IYIA 1GP1A 1ACVA 3E0UA 1T8EB 3BD2A 3FYGA 5GSTA 4KB3A 3TKRA 3C1SA 2PPTA 1SU9A 2LJRA 3PH9A 3ZMLA 4I8BA 2HZFA 4MF5A 4USSA 3EU4A 1K3OA 1TJDA 3UVTA 3HVVA 1MTCA 3K8NA 5HR0A 4F0BA 5ELAA 1EGRA 1Z7PA 1SENA 4F2IA 1QFNA 4LL4B 4V2NA 2PVQA 1R5AA 4WR5A 2DIYA 3MAKA 2TRXA 2M46A 2UZ8A 1MEKA 2HYXA 4MLYA 1B4QA 2YJ7A 1XWCA 1XIYA 5CP1A 3GKMA 5ECOB 4LLRA 3MNGA 3UOMA 4BWQA 1V57A 1VF1A 1XOBA 1KTEA 4Q5NA 1T4ZA 1XVWA 2L4CA 5DAKA 2P5RA 2P5QA 3CRUA 4FH8A 2LKUA 1SD9A 1GULA 1F6MC 3C7MA 2MMAA 3KJYA 4NWYA 1N8JA 4X0XA 1FOHA 4MF7A 1HD2A 4MNNA 4ZILA 4F03A 1XW9A 1EV4A 3S9FA 5DQYA 2AV4A 4ZB6A 4IGJA 5G30A 3ZIVA 3KP8A 3E9JB 2YV7A 1ZZYA 2C0FA 2K6VA 1A2LA 3HZ4A 2GSQA 2ZUPA 3RHBA 3TRPA 4DSSA 4MMMA 1YF1A 2R6KA 3F6DA 18GSA 3DYRA 1PX6A 4PUFC 1W4VA 3DXBA 1GH2A 1K0NA 4K7NA 3TOUA 1TXXA 4A5PA 2LV3A 1X0RA 4HQZA 1PKWA 2H1AA 3MSZA 4LA1A 3IK7A 2GSRA 4Z2TA 2XPEA 2IMFA 1WPIA 1UN2A 3TKSC 2QA1A 4Z7XA 3RPPA 5FHIA 2GSTA 5A4UA 3IRAA 3H1NA 5EY6A 4HJ2A 4G0IA 4L5LA 2WDUA 2DMLA 4ZL7A 2Z9SA 1XWKA 5B7CA 5H5QA 4HZ2A 4I2UA 2I1UA 3HYPA 3P2AA 4RUVA 1O73A 2R0GA 4F9ZA 5D9VA 2X4AA 4GLTA 3TB2A 2HSYA 4MJEA 2NPBA 4EE0A 5IIZA 4QL9A 1OKDA 2PMTA 2CVDA 2RIIA 4EO3A 2NVLA 1AIUA 3ZVJA 3PGTA 5CNWA 2HRKA 2LUSA 1URMA 2FGXA 3CXGA 1M0UA 1FHEA 3EURA 1EZKA 1J0FA 3H8QA 3ERGA 4MZWA 2I81A 4K2DA 1FW1A 1M9AA 4GF0A 5CRWA 4FIWA 1X9MB 3HKRA 2HFDA 5G5EA 4PX1A 2CVBA 5AGYA 4K5SA 3OR5A 3ERWA 5KOXA 5KN3A 1PN9A 1LJRA 2PN8A 1ZYPA 1JHBA 3C71A 1OC9A 4JR6A 1XBSA 5ECLB 3BOAA 3GL5A 3GTUA 1G7OA 1GLPA 3C73A 3Q18A 2FNOA 2RUFA 5HFIA 1BJXA 2XHFA 2VO4A 4ULXA 2DJKA 3GN3A 3F0IA 2JSZA 5JCUA 5IO0A 3E3EA 2L57A 2GZPA 4NXIA 4MABA 2OJLA 5F06A 3UBKA 4XIHA 2HRAA 3D4MA 2V32A 2L59A 4IP6A 2NTOA 4TR3A 2LJAA 4KCAA 2DJ1A 1PN0A 1M2AA 1DUGA 4O7HA 4HU7A 1W89A 1Z9HA 4EKZA 2VL3A 3L4NA 3FHKA 2V6OA 2AB6A 4IN0A 3IOSA 3EWLA 2L6DA 5J41A 1BAYA 2DLXA 4RQRA 4K0NA 4ZIJA 4KUNA 3KTLA 5GZZB 10GSA 1ST9A 3GTUB 3GYKA 3W8JA 4O5RA 1B48A 4JE1A 4K7IA 2PBJA 3UEMA 3IC4A 2CAQA 5L71A 5FT3A 2H73A 5E4WA 3KCMA 1USBA 2QKEA 2MMOA 2WB9A 1TRVA 1YJ6A 5DVBA 1T7PB 1TK5B 2BTOT 2HSHA 4ZL9A 3P90A 4CDOA 5DCHA 5JCWA 3CTGA 3J7Yb 2BJXA 3N9JA 2KLXA 1GUKA 2G2QA 2R0PA 1GTUA 3L9VA 5HR1A 5F07A 1XFLA 4K8MA 1GL8A 3G7YA 1SYXA 3I43A 3VWXA 2JADA 2C3TA 3WT1A 2H0IA 4MK3A 1XWGA 1O8WA 2HRFA 4K1FA 3WT2A 3TKPA 8GSSA 1GTIA 3F3RA 3ZFLA 4N30A 2PU9C 3A5IA 4F0CA 2I3YA 3U5RE 3LSZA 2H70A 5CYYA 5E59A 3I6AA 5IMFA 2PERA 6GSWA 3IR4A 3ZIJA 3LGCA 1HNBA 4WXTA 1U87A 5AIVA 4IP1A 4Z2UA 1PKZA 1V2AA 2VCZA 4X4JA 9GSSA 12GSA 1F9MA 4K6XA 4HEA2 3VWVA 4XRAA 1Z7RA 2JACA 5D93A 5DALB 3DKSA 3V1WA 4X1UA 1GRXA 2IMIA 5IQYA 4KE3A 6GSTA 4XCSA 3EMXA 3L0HA 4QL7A 4POLA 4NAXA 5INYA 4L0UA 4OCFA 2H6YA 5DCGA 2HXKA 2VL9A 3LYPA 5F05A 4TRXA 4IELA 3CTFA 2NDOA 4BVXB 5JWQB 2IN3A 1SKSB 1BG5A 1PA3A 5IPHA 1TRSA 2L6CA 2WJUA 2YCDA 1FG4A 4LL1B 3FZ4A 5JCGA 5HQPA 2C8UA 3GHAA 2YN1A 2DC5A 5EVOA 2B1KA 3TJKA 2O7KA 2LSTA 4O5UA 3DD3A 5LCZA 2YWMA 1M2BA 4EUYA 4RI6A 4YAPA 4I5QA 1PGTA 1ZOFA 4OFTA 1OYJA 4ZL8A 1YY7A 2VD0A 3UIWA 3FZ9A 5GAND 2M80A 1R4WA 4TOPA 5GSSA 4POKA 2HZEB 1EOHA 2H75A 2H6XA 4Q5QA 4CW9A 2OE3A 4DVCA 1G0TA 2VUPA 1TW9A 1RK4A 4IBPA 3UAPA 2RLIA 4PNFA 4BPYA 5KN0A 4IJIA 2GQMA 2YNXA 1SKWB 4HI7A 2ES7A 2JSYA 2IJYA 5C00A 2WFCA 4J2FA 2FA8A 1ZYNA 3RBTA 4TXOA 5D9TA 1O81A 1PSQA 1KBNA 1A2MA 3GSSA 3LWAA 3F4TA 4PQHA 2GGTA 2HE3A 2CZ2A 2K9FA 3IHGA 4NV5A 2X64A 3VI5A 2YOIA 3ZTLA 1XW5A 2AUVA 1B9XC 4KDUA 1I5GA 1M2DA 3FY7A 2R4VA 4XHMA 3SWLA 4GSNA 1GNWA 4TR1B 2IMKA 2EIQA 3US3A 5B8AA 2OACA 5ECQB 4GXZA 5DDLA 5DQSA 5ELGA 4MJAA 5EPFA 1AW9A 4IQAA 3O3TA 3KGKA 2MMNA 3M0FA 3F8UA 3Q19A 1VF4A 2OE0A 2VCXA 2FWFA 3VLNA 6GSYA 2F8FA 1ON4A 1H75A 5A5KA 4KDXA 5J9CA 4E8EA 1TRUA 1QXHA 3KH9A 3LG6A 2F51A 2PWJA 4O32A 4KDYA 3FMWA 4KSMA 2WGRA 1Q98A 1MDJA 1V58A 1GSYA 4EVMA 2KHPA 2FA4A 3IBHA 4TXOB 3I9V2 1BEDA 5D73A 4OWYA 2RM6A 4TVEA 1K3YA 1AAZA 3GA4A 3GKXA 5IMCA 5IMVA 2C0GA 4KF9A 3TGZA 3QFAC 1XW6A 1GTAA 3HVSA 4MJBA 1YEXA 2DJJA 2C4JA 4MCUA 1Z6NA 1FB6A 4L5OA 2MBSA 4N11A 3GIXA 2GT6A 1DE1A 4YQMA 2WS2A 4EL1A 1U3IA 1SYRA 2HI7A 3TJBA 4KX4A 2YWOA 2C3QA 2VAFA 3FK8A 2YWIA 4KSOA 5ECRB 4FYBA 3U6VA 4IHUA 4DEJA 4HQSA 7GSSA 2D2ZA 3P7XA 4CY6A 1NW2A 5HR2A 2ON5A 5D9XA 1F3BA 4POMA 2KP1A 2YZUA 2YWNA 4PNGA 1M99A 3WD6A 5G1KA 2B7JA 3RPNA 2FCHA 3UARA 4MA9A 3KMOA 1PD21 4POBA 2MYGA 2ZNMA 4P3YB 3GL3A 2VCWA 1H4OA 2IWTA 4TN8A 4XRDA 3DRNA 1X5EA 3Q74A 3KTBA 3VPTA 1YEPA 3VPQA 1CQHA 1A0FA 3P8WA 1WIKA 4G10A 4GQCA 3WGXA 1O7UA 4IJ3A 3LW9A 4N10A 4LMWA 3PR8A 3ZYWA 3UMAA 1X5CA 5IM9A 1K3LA 2H8LA 2IFQA 4H86A 3L9UA 3IE3A 1YZXA 4ID0A 4G19A 2GZZA 4ECBA 4YAVA 4CY8A 1JFUA 5F8BA 2QGVA 4PUAA 2DJ0A 3HHVA 5CRHA 2AAWA 3ZFBA 2VM2A 3IPZA 3J7Yk 2A2RA 2LS5A 3GKNA 4ML6A 1ZL9A 2E0QA 4JU5A 4WF5A 3C8EA 3DIEA 1F3AA 4I97A 4V2LA 2HT9A 3H4KA 4AJ6A 1K0BA 4OMVA 2H74A 1MD3A 2N5FA 3H93A 1FB0A 2FHEA 2GZYA 4BWSA 1AXDA 1A24A 5GAPD 6GSXA 1AQXA 4MP4A 5IPGA 2LRCA 4ACSA 5A4WA 3FR6A 3F3QA 5HFGA 5DJLA 1TU7A 3M9KA 2C3NA 4ECIA 1ABAA 3VURA 1GNEA 3MIXA 5IMDA 2CX4A 4EF0A 1HQOA 2V1MA 2VCTA 2IMDA 4D73B 1ERWA 4MZBA 3F4RA 4MF6A 5AN1A 4OD7A 2FY6A 3FR3A 1XCCA 2B3SA 4WF4A 2LTKA 4PTSA 2IFQB 1MDIA 5AISA 3FKFA 2LQQA 4EDYA 1VF3A 1YKCA 4HUAA 3O6TA 2YANA 4EXJA 1R7HA 3HJPA 4FYUA 2FWHA 5JWRB 1TOFA 3CBUA 4ZXGA 2O87A 4HZ4A 5KOWA 1JZOA 1ERVA 3IXRA 5D9WA 2A2SA 4JZQA 1THXA 2CX3A 4DSRA 2C0EA 3VWUA 1FVKA 14GSA 3TKQA 4V1Ap 4TXVA 4EIPA 2DJ3A 5ECMB 3HJOA 3CSIA 4YQUA 1AUCA 2N5AA 1T4YA 3ME7A 5DALA 3A5WA 3IAM2 2MBTA 5IO2A 3KEBA 1TTZA 2GVPA 1GWCA 1THOA 3D6IA 1A2JA 3EE2A 2RUEA 3RAZA 3IV4A 3AY8A 1QQ2A 1RQMA 3TRQA 1BYEA 3FR9A 1EGOA 4BVXA 3GFKA 5J9BA 1UC7A 5G2ZA 5JWOB 3A3TA 1GLQA 1K0AA 2I4AA 2EIRA 3JCML 1U88A 2BMXA 1WE0A 2K18A 3D5JA 1GTBA 2XBQA 3TUEA 1C72A 3TJFA 2H1GA 4MPGA 1BQ7A 2A4HA 5ID2B 1AC1A 3LXZA 1S3DA 1EV9A 1SJIA 4AJ8A 1VF2A 2HZEA 1X5DA 1GSDA 2R37A 1Y6EA 4KGIA 3LYKA 3KMNA 3KD0A 3MDKA 3FZAA 4JBBA 2V2GA 1A23A 2X8GA 4LMVA 2B6MA 4FO5A 5CAXA 3I69A 1R5PA 2LRNA 4ZBAA 1JZWA 1EEJA 2HRNA 3QD9A 2E2MA 1O85A 3TDGA 3A2XA 2O89A 2YP6A 3TJGA 2GDRA 1PX7A 1WRYA 4QQ7A 2FLSA 3D22A 2CZ3A 4L0WA 5CRGA 4L8EA 3CMIA 2HLSA 3KZQA 3UVHA 1PRXA 3F6FA 4HS1A 1V40A 2IIYA 2JZSA 3QMXA 2YV9A 2P0GA 2GQLA 5IOWA 1JLWA 1BX9A 2H1DA 1S3AA 22GSA 3IDVA 1OVNA 1Z3EA 2EIOA 5COHA 2A2PA 2M72A 3ME8A 4TR1A 1X9WB 1B8XA 4EIQA 3SBCA 2B7KA 4TKYA 4GSTA 5H5SA 3ISOA 3UBLA 1SJZA 2B5EA 4V2MA 1WMJA 2B5XA 2DKIA 1ZCPA 1GSSA 4HDEA 3LQ7A 3NIVA 4F82A 2X99A 1B4PA 4K0GA 1Q4JA 2QSIA 2F9SA 2N5BA 3TJJA 4G0KA 1E6BA 3IC8A 2OBIA 3HDCA 3GSTA 1CQGA 4GSSA 5G5FA 2H30A 4MZCA 3APOA 3HCZA 1SJ6A 2OBKA 1G6YA 2XC2A 1A0RP 2AYTA 3G7IA 3H79A 3APSA 3G7JA 4BVYB 1Z6MA 2FD3A 5KN2A 3L9SA 2L5OA 1Y25A 1EEMA 4HU9A 1X9SB 1FAAA 4AF2A 2VM1A 3ED3A 2H0GA 4K9ZA 4ZB8A 1I9DA 3CSJA 2KOKA 4MJCA 5G1LA 3C1RA 1FO5A 2IL3A 3FRCA 5D96A 3ZL5A 1ZGNA 2A4VA 4MPFA 1YF0A 5CO3A 3QFBC 2CQ9A 1DE2A 3A2WA 3LFLA 3D21A 5A4VA 4MH2A 3EINA 1TKDB 1WP0A 3GX0A 2R0CA 5ECHB 4FYCA 1EWXA 1Z5YE 1NM3A 2TRCP 4J56E 3GNJA 4ICYA 5ECSA 1J9BA 5ECKB 4OFNA 4WBJA 3RHCA 4ML1A 2LJKA 3HA9A 3HY2A 5AIXA 3TKSE 4J57E 2QA2A 4PURA 5BMUA 5ECPB 2I9HA 1XPVA 4E8HA 4RI7A 1V98A 3QR6A 2FWGA 2CAIA 4K5RA 4AJ7A 2JL4A 1GSUA 1O8XA 2VLVA 2E2GA 2GTUA 3EC3A 1OKTA 3F63A 4IVFA 4MH3A 1QMVA 2L4QA 3MWHA 3TRXA 5ABRA 5G31A 1TK8B 3BCIA 2H6ZA 5CREA 1XWBA 3GURA 2DIZA 2H01A 4EDZA 1OC8A 4WKWA 1XWAA 1TDIA 5B8BA 1QK8A 5HR3A 4N0VA 5J3RA 3BJ5A 3QAWA 3GH9A 1M9BA 1GUMA 1K0CA 3HJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DBQ A;  2B5Y A;  3NZN A;  3QAG A;  1WWJ A;  1OE7 A;  3QOU A;  4OCE A;  2CVK A;  1IYH A;  4V1A g;  2VL2 A;  4Q5R A;  1XOA A;  2RM5 A;  3GKK A;  4RQX A;  5ECI B;  4CHS A;  3BBY A;  4NMU A;  4X43 A;  2FUG 2;  1SKR B;  2X8C A;  1AQV A;  2R3X A;  5DAK B;  1ZYQ B;  4D73 A;  2PUK C;  3QAV A;  4JR4 A;  3PIN A;  1TRW A;  3DVW A;  3ZZX A;  4GCI A;  3GUS A;  2C80 A;  2AJQ B;  1G6W A;  1JLV A;  1YKA A;  4BA7 A;  2H66 A;  3DWV A;  2H76 A;  1MD4 A;  3IAS 2;  3M9J A;  2V41 A;  4NPB A;  1DSB A;  2VCQ A;  1FVJ A;  3EVI A;  4ILF A;  1TI3 A;  2C1Y A;  3HXS A;  3NOF A;  3F4S A;  2J9H A;  17GS A;  3GV1 A;  2LRT A;  1TU8 A;  4WBR D;  2VCV A;  5LD0 A;  4JRR A;  1V9W A;  3HD5 A;  1ERT A;  4I2T A;  2PVO C;  5ENU A;  1F37 A;  5HFK A;  1XVQ A;  1EOG A;  1UVZ A;  3VWW A;  1SK2 A;  2GQK A;  3W8S A;  1SK1 A;  4OO5 A;  3EU3 A;  4Q5F A;  4WET A;  4DSS B;  3KH7 A;  1MDK A;  1NHY A;  3LJR A;  3APQ A;  4TR0 A;  3DEX A;  1VRS D;  1OAZ A;  3VFI A;  2GLR A;  5B6M A;  3VI7 A;  4G9H A;  1T1V A;  1RW1 A;  4KH7 A;  3GX8 A;  1HNA A;  3W6G A;  4MDC A;  2R5G A;  4K7O A;  4XTS A;  3DML A;  4IW9 A;  1F2E A;  3UL3 A;  2WZ9 A;  2H19 A;  2IME A;  1SL2 B;  1XZO A;  2WCI A;  4O92 A;  3ZLP A;  19GS A;  2TIR A;  3ZRD A;  3WYW A;  3TCO A;  2GS3 A;  1EP7 A;  13GS A;  2K8S A;  3CYN A;  4HJM A;  3FEU A;  4OFM A;  3DGQ A;  1TI1 A;  1HYU A;  2LNS A;  2VIM A;  3GRX A;  1AQW A;  4KCE A;  3WGD A;  3KXO A;  2JU5 A;  1YDK A;  1M7T A;  2L5L A;  3FZ5 A;  3F9U A;  3FW2 A;  3RDW A;  2DBC A;  4HOJ A;  1KEB A;  2OKA A;  1T3B A;  3QCP A;  3KIJ A;  1ILO A;  2B1L A;  4G2E A;  1WOU A;  5ID2 A;  1PL1 A;  1YQ1 A;  3CSH A;  4EC0 A;  2QC7 A;  2GSS A;  3O76 A;  2H72 A;  2H0H A;  3CRT A;  11GS A;  1ML6 A;  3EYT A;  4KND A;  4JED A;  3G9B A;  3A2V A;  2GT5 A;  2O85 A;  2VLT A;  3IHQ A;  5KEJ A;  1S3C A;  3L78 A;  4ZB9 A;  2G0F A;  2XPD A;  2J23 A;  4NHZ A;  2R2J A;  1ZYE A;  4PQ1 A;  4BL7 A;  2XBI A;  5CRD A;  1TK0 B;  3ZVJ D;  3D0Z A;  2DMM A;  4DSQ A;  1OC9 B;  5EL8 A;  3LXT A;  4GRF A;  1K0M A;  3M8N A;  1VGL A;  2LQO A;  5B6N A;  2F3M A;  1GSE A;  4IKH A;  3DVX A;  3HVX A;  3VK9 A;  2VLU A;  4IS0 A;  2WRT A;  2OE1 A;  2VOC A;  1EP8 A;  4YH2 A;  1U6T A;  1TP9 A;  2OA7 A;  1OE8 A;  3GMF A;  3LEF A;  1HNC A;  1SK0 A;  4PGT A;  2CA8 A;  5IOX A;  2MZC A;  2YJH A;  20GS A;  4XS4 A;  4IQ1 A;  1N2A A;  3IK9 A;  2NBS A;  2YZH A;  2F8A A;  3M1G A;  1WJK A;  1ZMA A;  1PQN A;  3IA1 A;  4YQV A;  16GS A;  5LNK e;  2E7P A;  3LOR A;  5J4U A;  2EC4 A;  5IMA A;  3TKS A;  2CV4 A;  3D4T A;  3KP9 A;  1B9Y C;  4TW5 A;  3R2Q A;  2ZCT A;  1QUW A;  2JZT A;  2YPM A;  1GUH A;  1NSW A;  4NV2 A;  6GSV A;  5KN1 A;  1K0O A;  3KM6 A;  2REM A;  4XS6 A;  1GSQ A;  2LEG A;  2ON7 A;  5H5R A;  3ZMK A;  1PL2 A;  1A8Y A;  3HZ8 A;  4GWR A;  4I6X A;  1OC3 A;  4OO4 A;  1LU4 A;  1QGV A;  2ALB A;  1T00 A;  5FWG A;  3EMP A;  6GSU A;  1E2Y A;  1JZR A;  2JZR A;  2V6K A;  2KP2 A;  4KW6 A;  2LNT A;  5F0G A;  2VL2 C;  4BVY A;  5C04 A;  2H1B A;  4ZBD A;  5DJM A;  2OAD A;  2KUC A;  4PQI A;  4ECC A;  1LBK A;  5ECN B;  3ZIT A;  2P31 A;  3QDN A;  2DJ2 A;  2FWE A;  1XXU A;  6GSS A;  2O8V B;  4WR4 A;  4AGS A;  2DSA A;  3BCK A;  4XS4 B;  3TOT A;  1G7E A;  2IPA A;  4WEY A;  2MMZ A;  2HNL A;  4GTU A;  1NHO A;  3GH6 A;  1SL0 B;  1GSF A;  1O6J A;  4KA0 A;  3ERF A;  3N5O A;  1UA5 A;  1SD8 A;  2H71 A;  4ZBB A;  4GQF A;  2CT6 A;  1K0D A;  3M3M A;  4XS1 A;  4PXO A;  2X8H A;  1SL1 B;  1PMT A;  4TR4 A;  1FOV A;  5IMZ A;  1JZD A;  2VD1 A;  3QPM A;  1A8L A;  1R26 A;  2PGT A;  4NHW A;  4KAE A;  1ERU A;  1DBY A;  3UJ1 A;  3ZRE A;  5D8I A;  3Q6O A;  1KNG A;  1J08 A;  2C0D A;  2AHE A;  3WGE A;  2WUL A;  1U3A A;  5J5N A;  4ISD A;  4N0Z A;  2K8V A;  4ECJ A;  1IYI A;  1GP1 A;  1ACV A;  3E0U A;  1T8E B;  3BD2 A;  3FYG A;  5GST A;  4KB3 A;  3TKR A;  3C1S A;  2PPT A;  1SU9 A;  2LJR A;  3PH9 A;  3ZML A;  4I8B A;  2HZF A;  4MF5 A;  3EU4 A;  1K3O A;  1TJD A;  3UVT A;  3HVV A;  1MTC A;  3K8N A;  5HR0 A;  4F0B A;  5ELA A;  1EGR A;  1Z7P A;  1SEN A;  4F2I A;  1QFN A;  4LL4 B;  4V2N A;  2PVQ A;  1R5A A;  4WR5 A;  2DIY A;  3MAK A;  2TRX A;  2M46 A;  1MEK A;  2HYX A;  4MLY A;  1B4Q A;  2YJ7 A;  1XWC A;  1XIY A;  5CP1 A;  3GKM A;  5ECO B;  4LLR A;  3MNG A;  3UOM A;  4BWQ A;  1V57 A;  1VF1 A;  1XOB A;  1KTE A;  4Q5N A;  1T4Z A;  1XVW A;  2L4C A;  5DAK A;  2P5R A;  2P5Q A;  3CRU A;  4FH8 A;  2LKU A;  1SD9 A;  1GUL A;  1F6M C;  3C7M A;  2MMA A;  3KJY A;  4NWY A;  1N8J A;  4X0X A;  4MF7 A;  1HD2 A;  4ZIL A;  4F03 A;  1XW9 A;  1EV4 A;  3S9F A;  5DQY A;  2AV4 A;  4ZB6 A;  4IGJ A;  5G30 A;  3ZIV A;  3KP8 A;  3E9J B;  2YV7 A;  1ZZY A;  2C0F A;  2K6V A;  1A2L A;  3HZ4 A;  2GSQ A;  2ZUP A;  3RHB A;  3TRP A;  4DSS A;  4MMM A;  1YF1 A;  2R6K A;  3F6D A;  18GS A;  3DYR A;  1PX6 A;  4PUF C;  1W4V A;  3DXB A;  1GH2 A;  1K0N A;  4K7N A;  3TOU A;  1TXX A;  2LV3 A;  1X0R A;  4HQZ A;  1PKW A;  2H1A A;  3MSZ A;  4LA1 A;  3IK7 A;  2GSR A;  2XPE A;  2IMF A;  1WPI A;  1UN2 A;  3TKS C;  4Z7X A;  3RPP A;  5FHI A;  2GST A;  5A4U A;  3IRA A;  3H1N A;  5EY6 A;  4HJ2 A;  4L5L A;  2WDU A;  2DML A;  4ZL7 A;  2Z9S A;  1XWK A;  5B7C A;  5H5Q A;  4HZ2 A;  4I2U A;  2I1U A;  3HYP A;  3P2A A;  4RUV A;  1O73 A;  4F9Z A;  5D9V A;  4GLT A;  3TB2 A;  2HSY A;  4MJE A;  2NPB A;  4EE0 A;  5IIZ A;  4QL9 A;  1OKD A;  2PMT A;  2CVD A;  2RII A;  4EO3 A;  2NVL A;  1AIU A;  3ZVJ A;  3PGT A;  5CNW A;  2LUS A;  1URM A;  2FGX A;  3CXG A;  1M0U A;  1FHE A;  3EUR A;  1EZK A;  1J0F A;  3H8Q A;  3ERG A;  4MZW A;  2I81 A;  4K2D A;  1FW1 A;  1M9A A;  4GF0 A;  5CRW A;  4FIW A;  1X9M B;  3HKR A;  2HFD A;  5G5E A;  4PX1 A;  2CVB A;  5AGY A;  3OR5 A;  3ERW A;  5KN3 A;  1PN9 A;  1LJR A;  2PN8 A;  1JHB A;  3C71 A;  1OC9 A;  4JR6 A;  1XBS A;  5ECL B;  3BOA A;  3GL5 A;  3GTU A;  1G7O A;  1GLP A;  3C73 A;  3Q18 A;  2FNO A;  2RUF A;  5HFI A;  1BJX A;  2XHF A;  2VO4 A;  4ULX A;  2DJK A;  3GN3 A;  3F0I A;  2JSZ A;  5JCU A;  5IO0 A;  3E3E A;  2L57 A;  2GZP A;  4NXI A;  4MAB A;  2OJL A;  5F06 A;  3UBK A;  4XIH A;  3D4M A;  2V32 A;  2L59 A;  4IP6 A;  2NTO A;  4TR3 A;  2LJA A;  4KCA A;  2DJ1 A;  1M2A A;  1DUG A;  4O7H A;  4HU7 A;  1W89 A;  1Z9H A;  4EKZ A;  2VL3 A;  3L4N A;  3FHK A;  2V6O A;  2AB6 A;  4IN0 A;  3IOS A;  3EWL A;  2L6D A;  5J41 A;  1BAY A;  2DLX A;  4RQR A;  4K0N A;  4ZIJ A;  4KUN A;  3KTL A;  5GZZ B;  10GS A;  1ST9 A;  3GTU B;  3GYK A;  3W8J A;  4O5R A;  1B48 A;  4JE1 A;  4K7I A;  2PBJ A;  3UEM A;  3IC4 A;  2CAQ A;  5L71 A;  5FT3 A;  2H73 A;  5E4W A;  3KCM A;  1USB A;  2QKE A;  2MMO A;  2WB9 A;  1TRV A;  1YJ6 A;  5DVB A;  1T7P B;  1TK5 B;  2BTO T;  2HSH A;  4ZL9 A;  3P90 A;  4CDO A;  5DCH A;  5JCW A;  3CTG A;  3J7Y b;  2BJX A;  3N9J A;  2KLX A;  1GUK A;  2G2Q A;  1GTU A;  3L9V A;  5HR1 A;  5F07 A;  1XFL A;  4K8M A;  1GL8 A;  3G7Y A;  1SYX A;  3I43 A;  3VWX A;  2JAD A;  2C3T A;  3WT1 A;  2H0I A;  4MK3 A;  1XWG A;  1O8W A;  2HRF A;  4K1F A;  3WT2 A;  3TKP A;  8GSS A;  1GTI A;  3F3R A;  3ZFL A;  4N30 A;  2PU9 C;  4F0C A;  2I3Y A;  3U5R E;  3LSZ A;  2H70 A;  5CYY A;  5E59 A;  3I6A A;  5IMF A;  2PER A;  6GSW A;  3IR4 A;  3ZIJ A;  3LGC A;  1HNB A;  4WXT A;  1U87 A;  5AIV A;  4IP1 A;  1PKZ A;  1V2A A;  2VCZ A;  9GSS A;  12GS A;  1F9M A;  4K6X A;  4HEA 2;  3VWV A;  4XRA A;  1Z7R A;  2JAC A;  5D93 A;  5DAL B;  3DKS A;  3V1W A;  4X1U A;  1GRX A;  2IMI A;  5IQY A;  4KE3 A;  6GST A;  4XCS A;  3EMX A;  3L0H A;  4QL7 A;  4POL A;  4NAX A;  5INY A;  4L0U A;  4OCF A;  2H6Y A;  5DCG A;  2HXK A;  2VL9 A;  3LYP A;  5F05 A;  4TRX A;  4IEL A;  3CTF A;  2NDO A;  5JWQ B;  2IN3 A;  1SKS B;  1BG5 A;  1PA3 A;  5IPH A;  1TRS A;  2L6C A;  2WJU A;  2YCD A;  1FG4 A;  4LL1 B;  3FZ4 A;  5JCG A;  5HQP A;  2C8U A;  3GHA A;  2YN1 A;  2DC5 A;  5EVO A;  2B1K A;  3TJK A;  2O7K A;  2LST A;  3DD3 A;  5LCZ A;  2YWM A;  1M2B A;  4EUY A;  4RI6 A;  4YAP A;  4I5Q A;  1PGT A;  1ZOF A;  4OFT A;  1OYJ A;  4ZL8 A;  1YY7 A;  2VD0 A;  3UIW A;  3FZ9 A;  5GAN D;  2M80 A;  1R4W A;  4TOP A;  5GSS A;  4POK A;  2HZE B;  1EOH A;  2H75 A;  2H6X A;  4Q5Q A;  4CW9 A;  2OE3 A;  4DVC A;  1G0T A;  2VUP A;  1TW9 A;  1RK4 A;  4IBP A;  3UAP A;  2RLI A;  4PNF A;  4BPY A;  5KN0 A;  4IJI A;  2GQM A;  2YNX A;  1SKW B;  4HI7 A;  2ES7 A;  2JSY A;  2IJY A;  5C00 A;  2WFC A;  4J2F A;  2FA8 A;  3RBT A;  4TXO A;  5D9T A;  1O81 A;  1PSQ A;  1KBN A;  1A2M A;  3GSS A;  3LWA A;  3F4T A;  4PQH A;  2GGT A;  2HE3 A;  2CZ2 A;  2K9F A;  4NV5 A;  2X64 A;  3VI5 A;  2YOI A;  3ZTL A;  1XW5 A;  2AUV A;  1B9X C;  4KDU A;  1I5G A;  1M2D A;  3FY7 A;  2R4V A;  4XHM A;  3SWL A;  4GSN A;  1GNW A;  4TR1 B;  2IMK A;  2EIQ A;  3US3 A;  5B8A A;  2OAC A;  5ECQ B;  4GXZ A;  5DDL A;  5DQS A;  5ELG A;  4MJA A;  5EPF A;  1AW9 A;  4IQA A;  3O3T A;  3KGK A;  2MMN A;  3M0F A;  3F8U A;  3Q19 A;  1VF4 A;  2OE0 A;  2VCX A;  2FWF A;  3VLN A;  6GSY A;  2F8F A;  1ON4 A;  1H75 A;  5A5K A;  4KDX A;  5J9C A;  4E8E A;  1TRU A;  1QXH A;  3KH9 A;  3LG6 A;  2F51 A;  2PWJ A;  4O32 A;  4KDY A;  4KSM A;  2WGR A;  1Q98 A;  1MDJ A;  1V58 A;  1GSY A;  4EVM A;  2KHP A;  2FA4 A;  3IBH A;  4TXO B;  3I9V 2;  1BED A;  5D73 A;  4OWY A;  2RM6 A;  4TVE A;  1K3Y A;  1AAZ A;  3GA4 A;  3GKX A;  5IMC A;  5IMV A;  2C0G A;  3TGZ A;  3QFA C;  1XW6 A;  1GTA A;  3HVS A;  4MJB A;  1YEX A;  2DJJ A;  2C4J A;  4MCU A;  1Z6N A;  1FB6 A;  4L5O A;  2MBS A;  4N11 A;  3GIX A;  2GT6 A;  1DE1 A;  4YQM A;  2WS2 A;  4EL1 A;  1U3I A;  1SYR A;  2HI7 A;  3TJB A;  4KX4 A;  2YWO A;  2C3Q A;  2VAF A;  3FK8 A;  2YWI A;  4KSO A;  5ECR B;  4FYB A;  3U6V A;  4IHU A;  4DEJ A;  4HQS A;  7GSS A;  2D2Z A;  3P7X A;  1NW2 A;  5HR2 A;  2ON5 A;  5D9X A;  1F3B A;  4POM A;  2KP1 A;  2YZU A;  2YWN A;  4PNG A;  1M99 A;  3WD6 A;  5G1K A;  2B7J A;  3RPN A;  2FCH A;  3UAR A;  4MA9 A;  3KMO A;  1PD2 1;  4POB A;  2MYG A;  2ZNM A;  4P3Y B;  3GL3 A;  2VCW A;  1H4O A;  2IWT A;  4TN8 A;  4XRD A;  3DRN A;  1X5E A;  3Q74 A;  3KTB A;  3VPT A;  1YEP A;  3VPQ A;  1CQH A;  1A0F A;  3P8W A;  1WIK A;  4G10 A;  4GQC A;  3WGX A;  1O7U A;  4IJ3 A;  4N10 A;  4LMW A;  3PR8 A;  3ZYW A;  3UMA A;  1X5C A;  5IM9 A;  1K3L A;  2H8L A;  2IFQ A;  4H86 A;  3L9U A;  3IE3 A;  1YZX A;  4ID0 A;  4G19 A;  2GZZ A;  4ECB A;  4YAV A;  1JFU A;  5F8B A;  2QGV A;  4PUA A;  2DJ0 A;  3HHV A;  5CRH A;  2AAW A;  3ZFB A;  2VM2 A;  3IPZ A;  3J7Y k;  2A2R A;  2LS5 A;  3GKN A;  4ML6 A;  1ZL9 A;  2E0Q A;  4JU5 A;  4WF5 A;  3C8E A;  3DIE A;  1F3A A;  4I97 A;  4V2L A;  2HT9 A;  3H4K A;  4AJ6 A;  1K0B A;  4OMV A;  2H74 A;  1MD3 A;  2N5F A;  3H93 A;  1FB0 A;  2FHE A;  2GZY A;  4BWS A;  1AXD A;  1A24 A;  5GAP D;  6GSX A;  1AQX A;  4MP4 A;  5IPG A;  2LRC A;  4ACS A;  5A4W A;  3FR6 A;  3F3Q A;  5HFG A;  5DJL A;  1TU7 A;  3M9K A;  2C3N A;  4ECI A;  1ABA A;  3VUR A;  1GNE A;  5IMD A;  2CX4 A;  4EF0 A;  1HQO A;  2V1M A;  2VCT A;  2IMD A;  4D73 B;  1ERW A;  4MZB A;  3F4R A;  4MF6 A;  5AN1 A;  4OD7 A;  2FY6 A;  3FR3 A;  1XCC A;  2B3S A;  4WF4 A;  2LTK A;  2IFQ B;  1MDI A;  5AIS A;  3FKF A;  2LQQ A;  4EDY A;  1VF3 A;  1YKC A;  4HUA A;  3O6T A;  2YAN A;  4EXJ A;  1R7H A;  3HJP A;  4FYU A;  2FWH A;  5JWR B;  1TOF A;  3CBU A;  4ZXG A;  2O87 A;  4HZ4 A;  1JZO A;  1ERV A;  3IXR A;  5D9W A;  2A2S A;  4JZQ A;  1THX A;  2CX3 A;  4DSR A;  2C0E A;  3VWU A;  1FVK A;  14GS A;  3TKQ A;  4V1A p;  4TXV A;  2DJ3 A;  5ECM B;  3HJO A;  3CSI A;  4YQU A;  1AUC A;  2N5A A;  1T4Y A;  3ME7 A;  5DAL A;  3A5W A;  3IAM 2;  2MBT A;  5IO2 A;  3KEB A;  1TTZ A;  2GVP A;  1GWC A;  1THO A;  3D6I A;  1A2J A;  3EE2 A;  2RUE A;  3RAZ A;  3IV4 A;  3AY8 A;  1QQ2 A;  1RQM A;  3TRQ A;  1BYE A;  3FR9 A;  1EGO A;  4BVX A;  3GFK A;  5J9B A;  1UC7 A;  5G2Z A;  5JWO B;  3A3T A;  1GLQ A;  1K0A A;  2I4A A;  2EIR A;  3JCM L;  1U88 A;  2BMX A;  1WE0 A;  2K18 A;  3D5J A;  1GTB A;  2XBQ A;  3TUE A;  1C72 A;  3TJF A;  2H1G A;  4MPG A;  1BQ7 A;  5ID2 B;  1AC1 A;  3LXZ A;  1S3D A;  1EV9 A;  1SJI A;  4AJ8 A;  1VF2 A;  2HZE A;  1X5D A;  1GSD A;  2R37 A;  1Y6E A;  4KGI A;  3LYK A;  3KMN A;  3KD0 A;  3MDK A;  3FZA A;  4JBB A;  2V2G A;  1A23 A;  2X8G A;  4LMV A;  2B6M A;  4FO5 A;  5CAX A;  3I69 A;  1R5P A;  2LRN A;  4ZBA A;  1JZW A;  1EEJ A;  2HRN A;  3QD9 A;  2E2M A;  1O85 A;  3TDG A;  3A2X A;  2O89 A;  2YP6 A;  3TJG A;  2GDR A;  1PX7 A;  1WRY A;  4QQ7 A;  2FLS A;  3D22 A;  2CZ3 A;  4L0W A;  5CRG A;  4L8E A;  3CMI A;  2HLS A;  3KZQ A;  3UVH A;  1PRX A;  3F6F A;  4HS1 A;  1V40 A;  2IIY A;  2JZS A;  3QMX A;  2YV9 A;  2P0G A;  2GQL A;  5IOW A;  1JLW A;  1BX9 A;  2H1D A;  1S3A A;  22GS A;  3IDV A;  1OVN A;  1Z3E A;  2EIO A;  5COH A;  2M72 A;  3ME8 A;  4TR1 A;  1X9W B;  1B8X A;  3SBC A;  2B7K A;  4TKY A;  4GST A;  5H5S A;  3ISO A;  3UBL A;  1SJZ A;  2B5E A;  4V2M A;  1WMJ A;  2B5X A;  1ZCP A;  1GSS A;  4HDE A;  3LQ7 A;  3NIV A;  4F82 A;  2X99 A;  1B4P A;  4K0G A;  1Q4J A;  2QSI A;  2F9S A;  2N5B A;  3TJJ A;  1E6B A;  2OBI A;  3HDC A;  3GST A;  1CQG A;  4GSS A;  5G5F A;  2H30 A;  4MZC A;  3APO A;  3HCZ A;  1SJ6 A;  2OBK A;  1G6Y A;  2XC2 A;  1A0R P;  2AYT A;  3G7I A;  3H79 A;  3APS A;  3G7J A;  1Z6M A;  2FD3 A;  5KN2 A;  3L9S A;  2L5O A;  1Y25 A;  1EEM A;  4HU9 A;  1X9S B;  1FAA A;  4AF2 A;  2VM1 A;  3ED3 A;  2H0G A;  4K9Z A;  4ZB8 A;  1I9D A;  3CSJ A;  2KOK A;  4MJC A;  5G1L A;  3C1R A;  1FO5 A;  2IL3 A;  3FRC A;  5D96 A;  3ZL5 A;  1ZGN A;  2A4V A;  4MPF A;  1YF0 A;  5CO3 A;  3QFB C;  2CQ9 A;  1DE2 A;  3A2W A;  3LFL A;  3D21 A;  5A4V A;  4MH2 A;  3EIN A;  1TKD B;  1WP0 A;  3GX0 A;  5ECH B;  4FYC A;  1EWX A;  1Z5Y E;  1NM3 A;  2TRC P;  4J56 E;  3GNJ A;  5ECS A;  1J9B A;  5ECK B;  4OFN A;  4WBJ A;  3RHC A;  4ML1 A;  2LJK A;  3HA9 A;  3HY2 A;  5AIX A;  3TKS E;  4J57 E;  4PUR A;  5ECP B;  2I9H A;  1XPV A;  4E8H A;  4RI7 A;  1V98 A;  3QR6 A;  2FWG A;  2CAI A;  4AJ7 A;  2JL4 A;  1GSU A;  1O8X A;  2VLV A;  2E2G A;  2GTU A;  3EC3 A;  1OKT A;  3F63 A;  4IVF A;  4MH3 A;  1QMV A;  2L4Q A;  3MWH A;  3TRX A;  5ABR A;  5G31 A;  1TK8 B;  3BCI A;  2H6Z A;  5CRE A;  1XWB A;  3GUR A;  2DIZ A;  2H01 A;  4EDZ A;  1OC8 A;  4WKW A;  1XWA A;  1TDI A;  5B8B A;  1QK8 A;  5HR3 A;  4N0V A;  5J3R A;  3BJ5 A;  3QAW A;  3GH9 A;  1M9B A;  1GUM A;  1K0C A;  3HJM A; 
#chains in the Genus database with same CATH topology
 5DBQ A;  2B5Y A;  3NZN A;  3QAG A;  1WWJ A;  1OE7 A;  3QOU A;  4OCE A;  2CVK A;  1IYH A;  4V1A g;  2VL2 A;  4Q5R A;  1XOA A;  2RM5 A;  3GKK A;  4O5Q A;  4RQX A;  5ECI B;  4CHS A;  3BBY A;  4NMU A;  4X43 A;  2FUG 2;  1SKR B;  2X8C A;  1AQV A;  2R3X A;  5DAK B;  1ZYQ B;  4D73 A;  2PUK C;  3QAV A;  4JR4 A;  3PIN A;  1TRW A;  3DVW A;  3ZZX A;  4GCI A;  3GUS A;  2C80 A;  3PPU A;  2AJQ B;  1G6W A;  1JLV A;  1YKA A;  4BA7 A;  2H66 A;  3DWV A;  2H76 A;  1MD4 A;  3IAS 2;  3M9J A;  2V41 A;  4NPB A;  1DSB A;  2VCQ A;  1FVJ A;  3EVI A;  4ILF A;  1TI3 A;  2C1Y A;  3HXS A;  3NOF A;  3F4S A;  2J9H A;  17GS A;  3GV1 A;  2LRT A;  1TU8 A;  4WBR D;  4YKG A;  2VCV A;  5LD0 A;  4JRR A;  1V9W A;  3HD5 A;  1ERT A;  4I2T A;  2PVO C;  5ENU A;  1F37 A;  5HFK A;  1XVQ A;  1EOG A;  1UVZ A;  3VWW A;  1SK2 A;  2GQK A;  3W8S A;  1SK1 A;  4OO5 A;  3EU3 A;  4Q5F A;  4WET A;  4G0L A;  4DSS B;  3KH7 A;  1MDK A;  1NHY A;  3LJR A;  3APQ A;  4TR0 A;  3DEX A;  1VRS D;  1OAZ A;  3VFI A;  2GLR A;  5B6M A;  2HSM A;  3VI7 A;  4G9H A;  1T1V A;  1RW1 A;  4KH7 A;  3GX8 A;  1HNA A;  3W6G A;  4MDC A;  2R5G A;  4K7O A;  4XTS A;  3DML A;  4IW9 A;  1F2E A;  3UL3 A;  2WZ9 A;  2H19 A;  2IME A;  1SL2 B;  1XZO A;  2WCI A;  3R3E A;  4O92 A;  3ZLP A;  2X49 A;  19GS A;  2TIR A;  3ZRD A;  3WYW A;  3TCO A;  2GS3 A;  1EP7 A;  13GS A;  2K8S A;  3CYN A;  4HJM A;  3FEU A;  4OFM A;  3DGQ A;  1TI1 A;  1HYU A;  2LNS A;  2VIM A;  3GRX A;  1AQW A;  4KCE A;  3WGD A;  3KXO A;  2JU5 A;  1YDK A;  1M7T A;  2L5L A;  3FZ5 A;  3F9U A;  3FW2 A;  3RDW A;  2DBC A;  4HOJ A;  4FQU A;  1KEB A;  2OKA A;  1T3B A;  3QCP A;  3KIJ A;  1ILO A;  2B1L A;  4G2E A;  1WOU A;  5ID2 A;  1PL1 A;  1YQ1 A;  3CSH A;  4EC0 A;  2QC7 A;  2GSS A;  3O76 A;  2H72 A;  2H0H A;  3CRT A;  11GS A;  1ML6 A;  3EYT A;  4KND A;  4JED A;  3G9B A;  3A2V A;  2GT5 A;  2O85 A;  2VLT A;  3IHQ A;  5KEJ A;  1S3C A;  3L78 A;  4ZB9 A;  2G0F A;  2XPD A;  2J23 A;  4NHZ A;  2R2J A;  1ZYE A;  4PQ1 A;  4BL7 A;  2XBI A;  5CRD A;  1TK0 B;  4BIK A;  3ZVJ D;  3D0Z A;  2DMM A;  4DSQ A;  1OC9 B;  5EL8 A;  3LXT A;  4GRF A;  1K0M A;  3M8N A;  1VGL A;  2LQO A;  5B6N A;  2F3M A;  1GSE A;  4IKH A;  3DVX A;  3HVX A;  3VK9 A;  2VLU A;  4IS0 A;  2WRT A;  2OE1 A;  2VOC A;  1EP8 A;  4YH2 A;  1U6T A;  1TP9 A;  2OA7 A;  1OE8 A;  3GMF A;  3LEF A;  1HNC A;  1SK0 A;  3MYD A;  4PGT A;  2CA8 A;  5IOX A;  5BRT A;  4K2X A;  2MZC A;  2YJH A;  20GS A;  4XS4 A;  4IQ1 A;  1N2A A;  3IK9 A;  2NBS A;  2YZH A;  2F8A A;  3M1G A;  1WJK A;  1ZMA A;  1PQN A;  3IA1 A;  4YQV A;  16GS A;  5LNK e;  2E7P A;  3LOR A;  5J4U A;  2EC4 A;  5IMA A;  3TKS A;  2CV4 A;  3D4T A;  3KP9 A;  1B9Y C;  4TW5 A;  3R2Q A;  2ZCT A;  1QUW A;  2JZT A;  2YPM A;  1GUH A;  1NSW A;  4NV2 A;  6GSV A;  5KN1 A;  1K0O A;  3KM6 A;  4YKF A;  2REM A;  4BL7 B;  4XS6 A;  1GSQ A;  2LEG A;  2ON7 A;  5H5R A;  3ZMK A;  1PL2 A;  1A8Y A;  3HZ8 A;  4GWR A;  4I6X A;  1OC3 A;  4OO4 A;  1LU4 A;  1QGV A;  2ALB A;  1T00 A;  5FWG A;  3EMP A;  6GSU A;  1E2Y A;  1JZR A;  2JZR A;  2V6K A;  2KP2 A;  4KW6 A;  2LNT A;  5F0G A;  2VL2 C;  1S3R A;  3CQF A;  4BVY A;  5C04 A;  3EPT A;  2H1B A;  4ZBD A;  5DJM A;  2OAD A;  2KUC A;  4PQI A;  4Z2R A;  4ECC A;  1LBK A;  5ECN B;  3ZIT A;  2P31 A;  3QDN A;  2DJ2 A;  2FWE A;  1XXU A;  6GSS A;  2O8V B;  4WR4 A;  4AGS A;  2DSA A;  3BCK A;  4XS4 B;  3TOT A;  1G7E A;  2IPA A;  4WEY A;  2MMZ A;  2HNL A;  4GTU A;  1NHO A;  3GH6 A;  1SL0 B;  1GSF A;  1O6J A;  4KA0 A;  3ERF A;  3N5O A;  1UA5 A;  1SD8 A;  2H71 A;  4ZBB A;  4GQF A;  2CT6 A;  1K0D A;  3M3M A;  4XS1 A;  4PXO A;  2X8H A;  1SL1 B;  1PMT A;  4TR4 A;  1FOV A;  5IMZ A;  1JZD A;  2VD1 A;  3QPM A;  1A8L A;  1R26 A;  2PGT A;  4NHW A;  4KAE A;  1ERU A;  1DBY A;  3UJ1 A;  2DKH A;  3ZRE A;  5D8I A;  3Q6O A;  1KNG A;  1J08 A;  2C0D A;  2AHE A;  3WGE A;  2WUL A;  1U3A A;  5J5N A;  4ISD A;  4N0Z A;  2K8V A;  4ECJ A;  1IYI A;  1GP1 A;  1ACV A;  3E0U A;  1T8E B;  3BD2 A;  3FYG A;  5GST A;  4KB3 A;  3TKR A;  3C1S A;  2PPT A;  1SU9 A;  2LJR A;  3PH9 A;  3ZML A;  4I8B A;  2HZF A;  4MF5 A;  4USS A;  3EU4 A;  1K3O A;  1TJD A;  3UVT A;  3HVV A;  1MTC A;  3K8N A;  5HR0 A;  4F0B A;  5ELA A;  1EGR A;  1Z7P A;  1SEN A;  4F2I A;  1QFN A;  4LL4 B;  4V2N A;  2PVQ A;  1R5A A;  4WR5 A;  2DIY A;  3MAK A;  2TRX A;  2M46 A;  2UZ8 A;  1MEK A;  2HYX A;  4MLY A;  1B4Q A;  2YJ7 A;  1XWC A;  1XIY A;  5CP1 A;  3GKM A;  5ECO B;  4LLR A;  3MNG A;  3UOM A;  4BWQ A;  1V57 A;  1VF1 A;  1XOB A;  1KTE A;  4Q5N A;  1T4Z A;  1XVW A;  2L4C A;  5DAK A;  2P5R A;  2P5Q A;  3CRU A;  4FH8 A;  2LKU A;  1SD9 A;  1GUL A;  1M3J A;  1F6M C;  3C7M A;  2MMA A;  3KJY A;  4NWY A;  1N8J A;  4X0X A;  1FOH A;  4MF7 A;  1HD2 A;  4MNN A;  4ZIL A;  4F03 A;  1XW9 A;  1EV4 A;  3S9F A;  5DQY A;  2AV4 A;  4ZB6 A;  4IGJ A;  5G30 A;  3ZIV A;  3KP8 A;  3E9J B;  2YV7 A;  1ZZY A;  2C0F A;  2K6V A;  1A2L A;  3HZ4 A;  2GSQ A;  2ZUP A;  3RHB A;  3TRP A;  4DSS A;  4MMM A;  1YF1 A;  2R6K A;  3F6D A;  18GS A;  3DYR A;  1PX6 A;  4PUF C;  1W4V A;  3DXB A;  1GH2 A;  1K0N A;  4K7N A;  3TOU A;  1TXX A;  4A5P A;  2LV3 A;  1X0R A;  4HQZ A;  1PKW A;  2H1A A;  3MSZ A;  4LA1 A;  3IK7 A;  2GSR A;  4Z2T A;  2XPE A;  2IMF A;  1WPI A;  1UN2 A;  3TKS C;  2QA1 A;  4Z7X A;  3RPP A;  5FHI A;  2GST A;  1M3I A;  5A4U A;  3IRA A;  3H1N A;  5EY6 A;  4HJ2 A;  4G0I A;  4L5L A;  2WDU A;  2DML A;  4ZL7 A;  2Z9S A;  1XWK A;  5B7C A;  5H5Q A;  4HZ2 A;  4I2U A;  2I1U A;  3HYP A;  3P2A A;  4RUV A;  1O73 A;  2R0G A;  4F9Z A;  5D9V A;  2X4A A;  4GLT A;  3TB2 A;  2HSY A;  4MJE A;  2NPB A;  4EE0 A;  5IIZ A;  4QL9 A;  1OKD A;  2PMT A;  2CVD A;  2RII A;  4EO3 A;  2NVL A;  1AIU A;  3ZVJ A;  3PGT A;  5CNW A;  2HRK A;  2LUS A;  1URM A;  2FGX A;  3CXG A;  1M0U A;  1FHE A;  3EUR A;  1EZK A;  1J0F A;  3H8Q A;  3ERG A;  4MZW A;  2I81 A;  4K2D A;  1FW1 A;  1M9A A;  4GF0 A;  5CRW A;  4FIW A;  1X9M B;  3HKR A;  2HFD A;  5G5E A;  4PX1 A;  2CVB A;  5AGY A;  4K5S A;  3OR5 A;  3ERW A;  5KOX A;  5KN3 A;  1PN9 A;  1LJR A;  2PN8 A;  1ZYP A;  1JHB A;  3C71 A;  1OC9 A;  4JR6 A;  1XBS A;  5ECL B;  3BOA A;  3GL5 A;  3GTU A;  1G7O A;  1GLP A;  3C73 A;  3Q18 A;  2FNO A;  2RUF A;  5HFI A;  1BJX A;  2XHF A;  2VO4 A;  4ULX A;  2DJK A;  3GN3 A;  3F0I A;  2JSZ A;  5JCU A;  5IO0 A;  3E3E A;  2L57 A;  2GZP A;  4NXI A;  4MAB A;  2OJL A;  5F06 A;  3UBK A;  4XIH A;  2HRA A;  3D4M A;  2V32 A;  2L59 A;  4IP6 A;  2NTO A;  4TR3 A;  2LJA A;  4KCA A;  2DJ1 A;  1PN0 A;  1M2A A;  1DUG A;  4O7H A;  4HU7 A;  1W89 A;  1Z9H A;  4EKZ A;  2VL3 A;  3L4N A;  3FHK A;  2V6O A;  2AB6 A;  4IN0 A;  3IOS A;  3EWL A;  2L6D A;  5J41 A;  1BAY A;  2DLX A;  4RQR A;  4K0N A;  4ZIJ A;  4KUN A;  3KTL A;  5GZZ B;  10GS A;  1ST9 A;  3GTU B;  3GYK A;  3W8J A;  4O5R A;  1B48 A;  4JE1 A;  4K7I A;  2PBJ A;  3UEM A;  3IC4 A;  2CAQ A;  5L71 A;  5FT3 A;  2H73 A;  5E4W A;  3KCM A;  1USB A;  2QKE A;  2MMO A;  2WB9 A;  1TRV A;  1YJ6 A;  5DVB A;  1T7P B;  1TK5 B;  2BTO T;  2HSH A;  4ZL9 A;  3P90 A;  4CDO A;  5DCH A;  5JCW A;  3CTG A;  3J7Y b;  2BJX A;  3N9J A;  2KLX A;  1GUK A;  2G2Q A;  2R0P A;  1GTU A;  3L9V A;  5HR1 A;  5F07 A;  1XFL A;  4K8M A;  1GL8 A;  3G7Y A;  1SYX A;  4HSC X;  3I43 A;  3VWX A;  2JAD A;  2C3T A;  3WT1 A;  2H0I A;  4MK3 A;  1XWG A;  1O8W A;  2HRF A;  4K1F A;  3WT2 A;  3TKP A;  8GSS A;  1GTI A;  3F3R A;  3ZFL A;  4N30 A;  2PU9 C;  3A5I A;  4F0C A;  2I3Y A;  3U5R E;  3LSZ A;  2H70 A;  5CYY A;  5E59 A;  3I6A A;  5IMF A;  2PER A;  6GSW A;  3IR4 A;  3ZIJ A;  3LGC A;  1HNB A;  4WXT A;  1U87 A;  5AIV A;  4IP1 A;  4Z2U A;  1PKZ A;  1V2A A;  2VCZ A;  4X4J A;  9GSS A;  12GS A;  1F9M A;  4K6X A;  4HEA 2;  3VWV A;  4XRA A;  1Z7R A;  2JAC A;  5D93 A;  5DAL B;  3DKS A;  3V1W A;  4X1U A;  1GRX A;  2IMI A;  5IQY A;  4KE3 A;  6GST A;  4XCS A;  3EMX A;  3L0H A;  4QL7 A;  4POL A;  4NAX A;  5INY A;  4L0U A;  4OCF A;  2H6Y A;  5DCG A;  2HXK A;  2VL9 A;  3LYP A;  5F05 A;  4TRX A;  4IEL A;  3CTF A;  2NDO A;  4BVX B;  5JWQ B;  2IN3 A;  1SKS B;  1BG5 A;  1PA3 A;  5IPH A;  1TRS A;  2L6C A;  2WJU A;  2YCD A;  1FG4 A;  4LL1 B;  3FZ4 A;  5JCG A;  5HQP A;  2C8U A;  3GHA A;  2YN1 A;  2DC5 A;  5EVO A;  2B1K A;  3TJK A;  2O7K A;  2LST A;  4O5U A;  3DD3 A;  5LCZ A;  2YWM A;  1M2B A;  4EUY A;  4RI6 A;  4YAP A;  4I5Q A;  1PGT A;  1ZOF A;  4OFT A;  1OYJ A;  4ZL8 A;  1YY7 A;  2VD0 A;  3UIW A;  3FZ9 A;  5GAN D;  2M80 A;  1R4W A;  4TOP A;  5GSS A;  4POK A;  2HZE B;  1EOH A;  2H75 A;  2H6X A;  4Q5Q A;  4CW9 A;  2OE3 A;  4DVC A;  1G0T A;  2VUP A;  1TW9 A;  1RK4 A;  4IBP A;  3UAP A;  2RLI A;  4PNF A;  4BPY A;  5KN0 A;  4IJI A;  2GQM A;  2YNX A;  1SKW B;  4HI7 A;  2ES7 A;  2JSY A;  2IJY A;  5C00 A;  2WFC A;  4J2F A;  2FA8 A;  1ZYN A;  3RBT A;  4TXO A;  5D9T A;  1O81 A;  1PSQ A;  1KBN A;  1A2M A;  3GSS A;  3LWA A;  3F4T A;  4PQH A;  2GGT A;  2HE3 A;  2CZ2 A;  2K9F A;  3IHG A;  4NV5 A;  2X64 A;  3VI5 A;  2YOI A;  3ZTL A;  1XW5 A;  2AUV A;  1B9X C;  4KDU A;  1I5G A;  1M2D A;  3FY7 A;  2R4V A;  4XHM A;  3SWL A;  4GSN A;  1GNW A;  4TR1 B;  2IMK A;  2EIQ A;  3US3 A;  5B8A A;  2OAC A;  5ECQ B;  4GXZ A;  5DDL A;  5DQS A;  5ELG A;  4MJA A;  5EPF A;  1AW9 A;  4IQA A;  3O3T A;  3KGK A;  2MMN A;  3M0F A;  3F8U A;  3Q19 A;  1VF4 A;  2OE0 A;  2VCX A;  2FWF A;  3VLN A;  6GSY A;  2F8F A;  1ON4 A;  1H75 A;  5A5K A;  4KDX A;  5J9C A;  4E8E A;  1TRU A;  1QXH A;  3KH9 A;  3LG6 A;  2F51 A;  2PWJ A;  4O32 A;  4KDY A;  3FMW A;  4KSM A;  2WGR A;  1Q98 A;  1MDJ A;  1V58 A;  1GSY A;  4EVM A;  2KHP A;  2FA4 A;  3IBH A;  4TXO B;  3I9V 2;  1BED A;  5D73 A;  4OWY A;  2RM6 A;  4TVE A;  1K3Y A;  1AAZ A;  3GA4 A;  3GKX A;  5IMC A;  5IMV A;  2C0G A;  4KF9 A;  1XG8 A;  3TGZ A;  3QFA C;  1XW6 A;  1GTA A;  3HVS A;  4MJB A;  1YEX A;  2DJJ A;  2C4J A;  4MCU A;  1Z6N A;  1FB6 A;  4L5O A;  2MBS A;  4N11 A;  3GIX A;  2GT6 A;  1DE1 A;  4YQM A;  2WS2 A;  4EL1 A;  1U3I A;  1SYR A;  2HI7 A;  3TJB A;  4KX4 A;  2YWO A;  2C3Q A;  2VAF A;  3FK8 A;  2YWI A;  4KSO A;  5ECR B;  4FYB A;  3U6V A;  4IHU A;  4DEJ A;  4HQS A;  7GSS A;  3HVN A;  2D2Z A;  3P7X A;  4CY6 A;  1NW2 A;  5HR2 A;  2ON5 A;  5D9X A;  1F3B A;  4POM A;  2KP1 A;  2YZU A;  2YWN A;  4PNG A;  1M99 A;  3WD6 A;  5G1K A;  2B7J A;  3RPN A;  2FCH A;  3UAR A;  4MA9 A;  3KMO A;  1PD2 1;  4POB A;  2MYG A;  2ZNM A;  4P3Y B;  3GL3 A;  2VCW A;  1H4O A;  2IWT A;  4TN8 A;  4XRD A;  3DRN A;  1X5E A;  3Q74 A;  3KTB A;  3VPT A;  1YEP A;  3VPQ A;  1CQH A;  1A0F A;  3P8W A;  1WIK A;  4G10 A;  4GQC A;  3WGX A;  1O7U A;  4IJ3 A;  3LW9 A;  4N10 A;  4LMW A;  3PR8 A;  3ZYW A;  3UMA A;  1X5C A;  5IM9 A;  1K3L A;  2H8L A;  2IFQ A;  4H86 A;  3L9U A;  3IE3 A;  1YZX A;  4ID0 A;  4G19 A;  2GZZ A;  4ECB A;  4YAV A;  4CY8 A;  1JFU A;  5F8B A;  2QGV A;  4PUA A;  2DJ0 A;  3HHV A;  5CRH A;  2AAW A;  3ZFB A;  2VM2 A;  3IPZ A;  3J7Y k;  2A2R A;  2LS5 A;  3GKN A;  4ML6 A;  1ZL9 A;  2E0Q A;  4JU5 A;  4WF5 A;  3C8E A;  3DIE A;  1F3A A;  4I97 A;  4V2L A;  2HT9 A;  3H4K A;  4AJ6 A;  1K0B A;  4OMV A;  2H74 A;  1MD3 A;  2N5F A;  3H93 A;  1FB0 A;  2FHE A;  2GZY A;  4BWS A;  1AXD A;  1A24 A;  5GAP D;  6GSX A;  1AQX A;  4MP4 A;  5IPG A;  2LRC A;  4ACS A;  5A4W A;  3FR6 A;  3F3Q A;  5HFG A;  5DJL A;  1TU7 A;  3M9K A;  2C3N A;  4ECI A;  1ABA A;  3VUR A;  1GNE A;  3MIX A;  5IMD A;  2CX4 A;  4EF0 A;  1HQO A;  2V1M A;  2VCT A;  2IMD A;  4D73 B;  1ERW A;  4MZB A;  3F4R A;  4MF6 A;  5AN1 A;  4OD7 A;  2FY6 A;  3FR3 A;  1XCC A;  2B3S A;  4WF4 A;  2LTK A;  4PTS A;  2IFQ B;  1MDI A;  5AIS A;  3FKF A;  2LQQ A;  4EDY A;  1VF3 A;  1YKC A;  4HUA A;  3O6T A;  2YAN A;  4EXJ A;  1R7H A;  3HJP A;  4FYU A;  2FWH A;  5JWR B;  1TOF A;  3CBU A;  4ZXG A;  2O87 A;  4HZ4 A;  5KOW A;  1JZO A;  1ERV A;  3IXR A;  5D9W A;  2A2S A;  4JZQ A;  1THX A;  2CX3 A;  4DSR A;  2C0E A;  3VWU A;  1FVK A;  14GS A;  3TKQ A;  4V1A p;  4TXV A;  4EIP A;  2DJ3 A;  5ECM B;  3HJO A;  3CSI A;  4YQU A;  1AUC A;  2N5A A;  1T4Y A;  3ME7 A;  5DAL A;  3A5W A;  3IAM 2;  2MBT A;  5IO2 A;  3KEB A;  1TTZ A;  2GVP A;  1GWC A;  1THO A;  3D6I A;  1A2J A;  3EE2 A;  2RUE A;  3RAZ A;  3IV4 A;  3AY8 A;  1QQ2 A;  1RQM A;  3TRQ A;  1BYE A;  3FR9 A;  1EGO A;  4BVX A;  3GFK A;  5J9B A;  1UC7 A;  5G2Z A;  5JWO B;  3A3T A;  1GLQ A;  1K0A A;  2I4A A;  2EIR A;  3JCM L;  1U88 A;  2BMX A;  1WE0 A;  2K18 A;  3D5J A;  1GTB A;  2XBQ A;  3TUE A;  1C72 A;  3TJF A;  2H1G A;  4MPG A;  1BQ7 A;  2A4H A;  5ID2 B;  1AC1 A;  3LXZ A;  1S3D A;  1EV9 A;  1SJI A;  4AJ8 A;  1VF2 A;  2HZE A;  1X5D A;  1GSD A;  2R37 A;  1Y6E A;  4KGI A;  3LYK A;  3KMN A;  3KD0 A;  3MDK A;  3FZA A;  4JBB A;  2V2G A;  1A23 A;  2X8G A;  4LMV A;  2B6M A;  4FO5 A;  5CAX A;  3I69 A;  1R5P A;  2LRN A;  4ZBA A;  1JZW A;  1EEJ A;  2HRN A;  3QD9 A;  2E2M A;  1O85 A;  3TDG A;  3A2X A;  2O89 A;  2YP6 A;  3TJG A;  2GDR A;  1PX7 A;  1WRY A;  4QQ7 A;  2FLS A;  3D22 A;  2CZ3 A;  4L0W A;  5CRG A;  4L8E A;  3CMI A;  2HLS A;  3KZQ A;  3UVH A;  1PRX A;  3F6F A;  4HS1 A;  1V40 A;  2IIY A;  2JZS A;  3QMX A;  2YV9 A;  2P0G A;  2GQL A;  5IOW A;  1JLW A;  1BX9 A;  2H1D A;  1S3A A;  22GS A;  3IDV A;  1OVN A;  1Z3E A;  2EIO A;  5COH A;  2A2P A;  2M72 A;  3ME8 A;  4TR1 A;  1X9W B;  1B8X A;  4EIQ A;  3SBC A;  2B7K A;  4TKY A;  4GST A;  5H5S A;  3ISO A;  3UBL A;  1SJZ A;  2B5E A;  4V2M A;  1WMJ A;  2B5X A;  2DKI A;  1ZCP A;  1GSS A;  4HDE A;  3LQ7 A;  3NIV A;  4F82 A;  2X99 A;  1B4P A;  4K0G A;  1Q4J A;  2QSI A;  2F9S A;  2N5B A;  3TJJ A;  4G0K A;  1E6B A;  3IC8 A;  2OBI A;  3HDC A;  3GST A;  1CQG A;  4GSS A;  5G5F A;  2H30 A;  4MZC A;  3APO A;  3HCZ A;  1SJ6 A;  2OBK A;  1G6Y A;  2XC2 A;  1A0R P;  2AYT A;  3G7I A;  3H79 A;  3APS A;  3G7J A;  4BVY B;  1Z6M A;  2FD3 A;  5KN2 A;  3L9S A;  2L5O A;  1Y25 A;  1EEM A;  4HU9 A;  1X9S B;  1FAA A;  4AF2 A;  2VM1 A;  3ED3 A;  2H0G A;  4K9Z A;  4ZB8 A;  1I9D A;  3CSJ A;  2KOK A;  4MJC A;  5G1L A;  3C1R A;  1FO5 A;  2IL3 A;  3FRC A;  5D96 A;  3ZL5 A;  1ZGN A;  2A4V A;  4MPF A;  1YF0 A;  5CO3 A;  3QFB C;  2CQ9 A;  1DE2 A;  1PFO A;  3A2W A;  3LFL A;  3D21 A;  5A4V A;  4MH2 A;  3EIN A;  1TKD B;  1WP0 A;  3GX0 A;  2R0C A;  5ECH B;  4FYC A;  1EWX A;  1Z5Y E;  1NM3 A;  2TRC P;  4J56 E;  3GNJ A;  4ICY A;  5ECS A;  1J9B A;  5ECK B;  4OFN A;  4WBJ A;  3RHC A;  4ML1 A;  2LJK A;  3HA9 A;  3HY2 A;  5AIX A;  3TKS E;  4J57 E;  2QA2 A;  4PUR A;  5BMU A;  5ECP B;  2I9H A;  1XPV A;  4E8H A;  4RI7 A;  1V98 A;  3QR6 A;  2FWG A;  2CAI A;  4K5R A;  4AJ7 A;  2JL4 A;  1GSU A;  1O8X A;  2VLV A;  2E2G A;  2GTU A;  3EC3 A;  1OKT A;  3F63 A;  4IVF A;  4MH3 A;  1QMV A;  2L4Q A;  3MWH A;  3TRX A;  5ABR A;  5G31 A;  1TK8 B;  3BCI A;  2H6Z A;  5CRE A;  1XWB A;  3GUR A;  2DIZ A;  2H01 A;  4EDZ A;  1OC8 A;  4WKW A;  1XWA A;  1TDI A;  5B8B A;  1QK8 A;  5HR3 A;  4N0V A;  5J3R A;  3BJ5 A;  3QAW A;  3GH9 A;  1M9B A;  1GUM A;  1K0C A;  3HJM A; 
#chains in the Genus database with same CATH homology
 5DBQ A;  2B5Y A;  3NZN A;  3QAG A;  1WWJ A;  1OE7 A;  3QOU A;  4OCE A;  2CVK A;  1IYH A;  4V1A g;  2VL2 A;  4Q5R A;  1XOA A;  2RM5 A;  3GKK A;  4O5Q A;  4RQX A;  5ECI B;  4CHS A;  3BBY A;  4NMU A;  4X43 A;  2FUG 2;  1SKR B;  2X8C A;  1AQV A;  2R3X A;  5DAK B;  1ZYQ B;  4D73 A;  2PUK C;  3QAV A;  4JR4 A;  3PIN A;  1TRW A;  3DVW A;  3ZZX A;  4GCI A;  3GUS A;  2C80 A;  3PPU A;  2AJQ B;  1G6W A;  1JLV A;  1YKA A;  4BA7 A;  2H66 A;  3DWV A;  2H76 A;  1MD4 A;  3IAS 2;  3M9J A;  2V41 A;  4NPB A;  1DSB A;  2VCQ A;  1FVJ A;  3EVI A;  4ILF A;  1TI3 A;  2C1Y A;  3HXS A;  3NOF A;  3F4S A;  2J9H A;  17GS A;  3GV1 A;  2LRT A;  1TU8 A;  4WBR D;  4YKG A;  2VCV A;  5LD0 A;  4JRR A;  1V9W A;  3HD5 A;  1ERT A;  4I2T A;  2PVO C;  5ENU A;  1F37 A;  5HFK A;  1XVQ A;  1EOG A;  1UVZ A;  3VWW A;  1SK2 A;  2GQK A;  3W8S A;  1SK1 A;  4OO5 A;  3EU3 A;  4Q5F A;  4WET A;  4G0L A;  4DSS B;  3KH7 A;  1MDK A;  1NHY A;  3LJR A;  3APQ A;  4TR0 A;  3DEX A;  1VRS D;  1OAZ A;  3VFI A;  2GLR A;  5B6M A;  2HSM A;  3VI7 A;  4G9H A;  1T1V A;  1RW1 A;  4KH7 A;  3GX8 A;  1HNA A;  3W6G A;  4MDC A;  2R5G A;  4K7O A;  4XTS A;  3DML A;  4IW9 A;  1F2E A;  3UL3 A;  2WZ9 A;  2H19 A;  2IME A;  1SL2 B;  1XZO A;  2WCI A;  3R3E A;  4O92 A;  3ZLP A;  2X49 A;  19GS A;  2TIR A;  3ZRD A;  3WYW A;  3TCO A;  2GS3 A;  1EP7 A;  13GS A;  2K8S A;  3CYN A;  4HJM A;  3FEU A;  4OFM A;  3DGQ A;  1TI1 A;  1HYU A;  2LNS A;  2VIM A;  3GRX A;  1AQW A;  4KCE A;  3WGD A;  3KXO A;  2JU5 A;  1YDK A;  1M7T A;  2L5L A;  3FZ5 A;  3F9U A;  3FW2 A;  3RDW A;  2DBC A;  4HOJ A;  4FQU A;  1KEB A;  2OKA A;  1T3B A;  3QCP A;  3KIJ A;  1ILO A;  2B1L A;  4G2E A;  1WOU A;  5ID2 A;  1PL1 A;  1YQ1 A;  3CSH A;  4EC0 A;  2QC7 A;  2GSS A;  3O76 A;  2H72 A;  2H0H A;  3CRT A;  11GS A;  1ML6 A;  3EYT A;  4KND A;  4JED A;  3G9B A;  3A2V A;  2GT5 A;  2O85 A;  2VLT A;  3IHQ A;  5KEJ A;  1S3C A;  3L78 A;  4ZB9 A;  2G0F A;  2XPD A;  2J23 A;  4NHZ A;  2R2J A;  1ZYE A;  4PQ1 A;  4BL7 A;  2XBI A;  5CRD A;  1TK0 B;  3ZVJ D;  3D0Z A;  2DMM A;  4DSQ A;  1OC9 B;  5EL8 A;  3LXT A;  4GRF A;  1K0M A;  3M8N A;  1VGL A;  2LQO A;  5B6N A;  2F3M A;  1GSE A;  4IKH A;  3DVX A;  3HVX A;  3VK9 A;  2VLU A;  4IS0 A;  2WRT A;  2OE1 A;  2VOC A;  1EP8 A;  4YH2 A;  1U6T A;  1TP9 A;  2OA7 A;  1OE8 A;  3GMF A;  3LEF A;  1HNC A;  1SK0 A;  3MYD A;  4PGT A;  2CA8 A;  5IOX A;  5BRT A;  4K2X A;  2MZC A;  2YJH A;  20GS A;  4XS4 A;  4IQ1 A;  1N2A A;  3IK9 A;  2NBS A;  2YZH A;  2F8A A;  3M1G A;  1WJK A;  1ZMA A;  1PQN A;  3IA1 A;  4YQV A;  16GS A;  5LNK e;  2E7P A;  3LOR A;  5J4U A;  2EC4 A;  5IMA A;  3TKS A;  2CV4 A;  3D4T A;  3KP9 A;  1B9Y C;  4TW5 A;  3R2Q A;  2ZCT A;  1QUW A;  2JZT A;  2YPM A;  1GUH A;  1NSW A;  4NV2 A;  6GSV A;  5KN1 A;  1K0O A;  3KM6 A;  4YKF A;  2REM A;  4BL7 B;  4XS6 A;  1GSQ A;  2LEG A;  2ON7 A;  5H5R A;  3ZMK A;  1PL2 A;  1A8Y A;  3HZ8 A;  4GWR A;  4I6X A;  1OC3 A;  4OO4 A;  1LU4 A;  1QGV A;  2ALB A;  1T00 A;  5FWG A;  3EMP A;  6GSU A;  1E2Y A;  1JZR A;  2JZR A;  2V6K A;  2KP2 A;  4KW6 A;  2LNT A;  5F0G A;  2VL2 C;  4BVY A;  5C04 A;  3EPT A;  2H1B A;  4ZBD A;  5DJM A;  2OAD A;  2KUC A;  4PQI A;  4Z2R A;  4ECC A;  1LBK A;  5ECN B;  3ZIT A;  2P31 A;  3QDN A;  2DJ2 A;  2FWE A;  1XXU A;  6GSS A;  2O8V B;  4WR4 A;  4AGS A;  2DSA A;  3BCK A;  4XS4 B;  3TOT A;  1G7E A;  2IPA A;  4WEY A;  2MMZ A;  2HNL A;  4GTU A;  1NHO A;  3GH6 A;  1SL0 B;  1GSF A;  1O6J A;  4KA0 A;  3ERF A;  3N5O A;  1UA5 A;  1SD8 A;  2H71 A;  4ZBB A;  4GQF A;  2CT6 A;  1K0D A;  3M3M A;  4XS1 A;  4PXO A;  2X8H A;  1SL1 B;  1PMT A;  4TR4 A;  1FOV A;  5IMZ A;  1JZD A;  2VD1 A;  3QPM A;  1A8L A;  1R26 A;  2PGT A;  4NHW A;  4KAE A;  1ERU A;  1DBY A;  3UJ1 A;  2DKH A;  3ZRE A;  5D8I A;  3Q6O A;  1KNG A;  1J08 A;  2C0D A;  2AHE A;  3WGE A;  2WUL A;  1U3A A;  5J5N A;  4ISD A;  4N0Z A;  2K8V A;  4ECJ A;  1IYI A;  1GP1 A;  1ACV A;  3E0U A;  1T8E B;  3BD2 A;  3FYG A;  5GST A;  4KB3 A;  3TKR A;  3C1S A;  2PPT A;  1SU9 A;  2LJR A;  3PH9 A;  3ZML A;  4I8B A;  2HZF A;  4MF5 A;  4USS A;  3EU4 A;  1K3O A;  1TJD A;  3UVT A;  3HVV A;  1MTC A;  3K8N A;  5HR0 A;  4F0B A;  5ELA A;  1EGR A;  1Z7P A;  1SEN A;  4F2I A;  1QFN A;  4LL4 B;  4V2N A;  2PVQ A;  1R5A A;  4WR5 A;  2DIY A;  3MAK A;  2TRX A;  2M46 A;  2UZ8 A;  1MEK A;  2HYX A;  4MLY A;  1B4Q A;  2YJ7 A;  1XWC A;  1XIY A;  5CP1 A;  3GKM A;  5ECO B;  4LLR A;  3MNG A;  3UOM A;  4BWQ A;  1V57 A;  1VF1 A;  1XOB A;  1KTE A;  4Q5N A;  1T4Z A;  1XVW A;  2L4C A;  5DAK A;  2P5R A;  2P5Q A;  3CRU A;  4FH8 A;  2LKU A;  1SD9 A;  1GUL A;  1F6M C;  3C7M A;  2MMA A;  3KJY A;  4NWY A;  1N8J A;  4X0X A;  1FOH A;  4MF7 A;  1HD2 A;  4MNN A;  4ZIL A;  4F03 A;  1XW9 A;  1EV4 A;  3S9F A;  5DQY A;  2AV4 A;  4ZB6 A;  4IGJ A;  5G30 A;  3ZIV A;  3KP8 A;  3E9J B;  2YV7 A;  1ZZY A;  2C0F A;  2K6V A;  1A2L A;  3HZ4 A;  2GSQ A;  2ZUP A;  3RHB A;  3TRP A;  4DSS A;  4MMM A;  1YF1 A;  2R6K A;  3F6D A;  18GS A;  3DYR A;  1PX6 A;  4PUF C;  1W4V A;  3DXB A;  1GH2 A;  1K0N A;  4K7N A;  3TOU A;  1TXX A;  4A5P A;  2LV3 A;  1X0R A;  4HQZ A;  1PKW A;  2H1A A;  3MSZ A;  4LA1 A;  3IK7 A;  2GSR A;  4Z2T A;  2XPE A;  2IMF A;  1WPI A;  1UN2 A;  3TKS C;  2QA1 A;  4Z7X A;  3RPP A;  5FHI A;  2GST A;  5A4U A;  3IRA A;  3H1N A;  5EY6 A;  4HJ2 A;  4G0I A;  4L5L A;  2WDU A;  2DML A;  4ZL7 A;  2Z9S A;  1XWK A;  5B7C A;  5H5Q A;  4HZ2 A;  4I2U A;  2I1U A;  3HYP A;  3P2A A;  4RUV A;  1O73 A;  2R0G A;  4F9Z A;  5D9V A;  2X4A A;  4GLT A;  3TB2 A;  2HSY A;  4MJE A;  2NPB A;  4EE0 A;  5IIZ A;  4QL9 A;  1OKD A;  2PMT A;  2CVD A;  2RII A;  4EO3 A;  2NVL A;  1AIU A;  3ZVJ A;  3PGT A;  5CNW A;  2HRK A;  2LUS A;  1URM A;  2FGX A;  3CXG A;  1M0U A;  1FHE A;  3EUR A;  1EZK A;  1J0F A;  3H8Q A;  3ERG A;  4MZW A;  2I81 A;  4K2D A;  1FW1 A;  1M9A A;  4GF0 A;  5CRW A;  4FIW A;  1X9M B;  3HKR A;  2HFD A;  5G5E A;  4PX1 A;  2CVB A;  5AGY A;  4K5S A;  3OR5 A;  3ERW A;  5KOX A;  5KN3 A;  1PN9 A;  1LJR A;  2PN8 A;  1ZYP A;  1JHB A;  3C71 A;  1OC9 A;  4JR6 A;  1XBS A;  5ECL B;  3BOA A;  3GL5 A;  3GTU A;  1G7O A;  1GLP A;  3C73 A;  3Q18 A;  2FNO A;  2RUF A;  5HFI A;  1BJX A;  2XHF A;  2VO4 A;  4ULX A;  2DJK A;  3GN3 A;  3F0I A;  2JSZ A;  5JCU A;  5IO0 A;  3E3E A;  2L57 A;  2GZP A;  4NXI A;  4MAB A;  2OJL A;  5F06 A;  3UBK A;  4XIH A;  2HRA A;  3D4M A;  2V32 A;  2L59 A;  4IP6 A;  2NTO A;  4TR3 A;  2LJA A;  4KCA A;  2DJ1 A;  1PN0 A;  1M2A A;  1DUG A;  4O7H A;  4HU7 A;  1W89 A;  1Z9H A;  4EKZ A;  2VL3 A;  3L4N A;  3FHK A;  2V6O A;  2AB6 A;  4IN0 A;  3IOS A;  3EWL A;  2L6D A;  5J41 A;  1BAY A;  2DLX A;  4RQR A;  4K0N A;  4ZIJ A;  4KUN A;  3KTL A;  5GZZ B;  10GS A;  1ST9 A;  3GTU B;  3GYK A;  3W8J A;  4O5R A;  1B48 A;  4JE1 A;  4K7I A;  2PBJ A;  3UEM A;  3IC4 A;  2CAQ A;  5L71 A;  5FT3 A;  2H73 A;  5E4W A;  3KCM A;  1USB A;  2QKE A;  2MMO A;  2WB9 A;  1TRV A;  1YJ6 A;  5DVB A;  1T7P B;  1TK5 B;  2BTO T;  2HSH A;  4ZL9 A;  3P90 A;  4CDO A;  5DCH A;  5JCW A;  3CTG A;  3J7Y b;  2BJX A;  3N9J A;  2KLX A;  1GUK A;  2G2Q A;  2R0P A;  1GTU A;  3L9V A;  5HR1 A;  5F07 A;  1XFL A;  4K8M A;  1GL8 A;  3G7Y A;  1SYX A;  3I43 A;  3VWX A;  2JAD A;  2C3T A;  3WT1 A;  2H0I A;  4MK3 A;  1XWG A;  1O8W A;  2HRF A;  4K1F A;  3WT2 A;  3TKP A;  8GSS A;  1GTI A;  3F3R A;  3ZFL A;  4N30 A;  2PU9 C;  3A5I A;  4F0C A;  2I3Y A;  3U5R E;  3LSZ A;  2H70 A;  5CYY A;  5E59 A;  3I6A A;  5IMF A;  2PER A;  6GSW A;  3IR4 A;  3ZIJ A;  3LGC A;  1HNB A;  4WXT A;  1U87 A;  5AIV A;  4IP1 A;  4Z2U A;  1PKZ A;  1V2A A;  2VCZ A;  4X4J A;  9GSS A;  12GS A;  1F9M A;  4K6X A;  4HEA 2;  3VWV A;  4XRA A;  1Z7R A;  2JAC A;  5D93 A;  5DAL B;  3DKS A;  3V1W A;  4X1U A;  1GRX A;  2IMI A;  5IQY A;  4KE3 A;  6GST A;  4XCS A;  3EMX A;  3L0H A;  4QL7 A;  4POL A;  4NAX A;  5INY A;  4L0U A;  4OCF A;  2H6Y A;  5DCG A;  2HXK A;  2VL9 A;  3LYP A;  5F05 A;  4TRX A;  4IEL A;  3CTF A;  2NDO A;  4BVX B;  5JWQ B;  2IN3 A;  1SKS B;  1BG5 A;  1PA3 A;  5IPH A;  1TRS A;  2L6C A;  2WJU A;  2YCD A;  1FG4 A;  4LL1 B;  3FZ4 A;  5JCG A;  5HQP A;  2C8U A;  3GHA A;  2YN1 A;  2DC5 A;  5EVO A;  2B1K A;  3TJK A;  2O7K A;  2LST A;  4O5U A;  3DD3 A;  5LCZ A;  2YWM A;  1M2B A;  4EUY A;  4RI6 A;  4YAP A;  4I5Q A;  1PGT A;  1ZOF A;  4OFT A;  1OYJ A;  4ZL8 A;  1YY7 A;  2VD0 A;  3UIW A;  3FZ9 A;  5GAN D;  2M80 A;  1R4W A;  4TOP A;  5GSS A;  4POK A;  2HZE B;  1EOH A;  2H75 A;  2H6X A;  4Q5Q A;  4CW9 A;  2OE3 A;  4DVC A;  1G0T A;  2VUP A;  1TW9 A;  1RK4 A;  4IBP A;  3UAP A;  2RLI A;  4PNF A;  4BPY A;  5KN0 A;  4IJI A;  2GQM A;  2YNX A;  1SKW B;  4HI7 A;  2ES7 A;  2JSY A;  2IJY A;  5C00 A;  2WFC A;  4J2F A;  2FA8 A;  1ZYN A;  3RBT A;  4TXO A;  5D9T A;  1O81 A;  1PSQ A;  1KBN A;  1A2M A;  3GSS A;  3LWA A;  3F4T A;  4PQH A;  2GGT A;  2HE3 A;  2CZ2 A;  2K9F A;  3IHG A;  4NV5 A;  2X64 A;  3VI5 A;  2YOI A;  3ZTL A;  1XW5 A;  2AUV A;  1B9X C;  4KDU A;  1I5G A;  1M2D A;  3FY7 A;  2R4V A;  4XHM A;  3SWL A;  4GSN A;  1GNW A;  4TR1 B;  2IMK A;  2EIQ A;  3US3 A;  5B8A A;  2OAC A;  5ECQ B;  4GXZ A;  5DDL A;  5DQS A;  5ELG A;  4MJA A;  5EPF A;  1AW9 A;  4IQA A;  3O3T A;  3KGK A;  2MMN A;  3M0F A;  3F8U A;  3Q19 A;  1VF4 A;  2OE0 A;  2VCX A;  2FWF A;  3VLN A;  6GSY A;  2F8F A;  1ON4 A;  1H75 A;  5A5K A;  4KDX A;  5J9C A;  4E8E A;  1TRU A;  1QXH A;  3KH9 A;  3LG6 A;  2F51 A;  2PWJ A;  4O32 A;  4KDY A;  3FMW A;  4KSM A;  2WGR A;  1Q98 A;  1MDJ A;  1V58 A;  1GSY A;  4EVM A;  2KHP A;  2FA4 A;  3IBH A;  4TXO B;  3I9V 2;  1BED A;  5D73 A;  4OWY A;  2RM6 A;  4TVE A;  1K3Y A;  1AAZ A;  3GA4 A;  3GKX A;  5IMC A;  5IMV A;  2C0G A;  4KF9 A;  3TGZ A;  3QFA C;  1XW6 A;  1GTA A;  3HVS A;  4MJB A;  1YEX A;  2DJJ A;  2C4J A;  4MCU A;  1Z6N A;  1FB6 A;  4L5O A;  2MBS A;  4N11 A;  3GIX A;  2GT6 A;  1DE1 A;  4YQM A;  2WS2 A;  4EL1 A;  1U3I A;  1SYR A;  2HI7 A;  3TJB A;  4KX4 A;  2YWO A;  2C3Q A;  2VAF A;  3FK8 A;  2YWI A;  4KSO A;  5ECR B;  4FYB A;  3U6V A;  4IHU A;  4DEJ A;  4HQS A;  7GSS A;  2D2Z A;  3P7X A;  4CY6 A;  1NW2 A;  5HR2 A;  2ON5 A;  5D9X A;  1F3B A;  4POM A;  2KP1 A;  2YZU A;  2YWN A;  4PNG A;  1M99 A;  3WD6 A;  5G1K A;  2B7J A;  3RPN A;  2FCH A;  3UAR A;  4MA9 A;  3KMO A;  1PD2 1;  4POB A;  2MYG A;  2ZNM A;  4P3Y B;  3GL3 A;  2VCW A;  1H4O A;  2IWT A;  4TN8 A;  4XRD A;  3DRN A;  1X5E A;  3Q74 A;  3KTB A;  3VPT A;  1YEP A;  3VPQ A;  1CQH A;  1A0F A;  3P8W A;  1WIK A;  4G10 A;  4GQC A;  3WGX A;  1O7U A;  4IJ3 A;  3LW9 A;  4N10 A;  4LMW A;  3PR8 A;  3ZYW A;  3UMA A;  1X5C A;  5IM9 A;  1K3L A;  2H8L A;  2IFQ A;  4H86 A;  3L9U A;  3IE3 A;  1YZX A;  4ID0 A;  4G19 A;  2GZZ A;  4ECB A;  4YAV A;  4CY8 A;  1JFU A;  5F8B A;  2QGV A;  4PUA A;  2DJ0 A;  3HHV A;  5CRH A;  2AAW A;  3ZFB A;  2VM2 A;  3IPZ A;  3J7Y k;  2A2R A;  2LS5 A;  3GKN A;  4ML6 A;  1ZL9 A;  2E0Q A;  4JU5 A;  4WF5 A;  3C8E A;  3DIE A;  1F3A A;  4I97 A;  4V2L A;  2HT9 A;  3H4K A;  4AJ6 A;  1K0B A;  4OMV A;  2H74 A;  1MD3 A;  2N5F A;  3H93 A;  1FB0 A;  2FHE A;  2GZY A;  4BWS A;  1AXD A;  1A24 A;  5GAP D;  6GSX A;  1AQX A;  4MP4 A;  5IPG A;  2LRC A;  4ACS A;  5A4W A;  3FR6 A;  3F3Q A;  5HFG A;  5DJL A;  1TU7 A;  3M9K A;  2C3N A;  4ECI A;  1ABA A;  3VUR A;  1GNE A;  3MIX A;  5IMD A;  2CX4 A;  4EF0 A;  1HQO A;  2V1M A;  2VCT A;  2IMD A;  4D73 B;  1ERW A;  4MZB A;  3F4R A;  4MF6 A;  5AN1 A;  4OD7 A;  2FY6 A;  3FR3 A;  1XCC A;  2B3S A;  4WF4 A;  2LTK A;  4PTS A;  2IFQ B;  1MDI A;  5AIS A;  3FKF A;  2LQQ A;  4EDY A;  1VF3 A;  1YKC A;  4HUA A;  3O6T A;  2YAN A;  4EXJ A;  1R7H A;  3HJP A;  4FYU A;  2FWH A;  5JWR B;  1TOF A;  3CBU A;  4ZXG A;  2O87 A;  4HZ4 A;  5KOW A;  1JZO A;  1ERV A;  3IXR A;  5D9W A;  2A2S A;  4JZQ A;  1THX A;  2CX3 A;  4DSR A;  2C0E A;  3VWU A;  1FVK A;  14GS A;  3TKQ A;  4V1A p;  4TXV A;  4EIP A;  2DJ3 A;  5ECM B;  3HJO A;  3CSI A;  4YQU A;  1AUC A;  2N5A A;  1T4Y A;  3ME7 A;  5DAL A;  3A5W A;  3IAM 2;  2MBT A;  5IO2 A;  3KEB A;  1TTZ A;  2GVP A;  1GWC A;  1THO A;  3D6I A;  1A2J A;  3EE2 A;  2RUE A;  3RAZ A;  3IV4 A;  3AY8 A;  1QQ2 A;  1RQM A;  3TRQ A;  1BYE A;  3FR9 A;  1EGO A;  4BVX A;  3GFK A;  5J9B A;  1UC7 A;  5G2Z A;  5JWO B;  3A3T A;  1GLQ A;  1K0A A;  2I4A A;  2EIR A;  3JCM L;  1U88 A;  2BMX A;  1WE0 A;  2K18 A;  3D5J A;  1GTB A;  2XBQ A;  3TUE A;  1C72 A;  3TJF A;  2H1G A;  4MPG A;  1BQ7 A;  2A4H A;  5ID2 B;  1AC1 A;  3LXZ A;  1S3D A;  1EV9 A;  1SJI A;  4AJ8 A;  1VF2 A;  2HZE A;  1X5D A;  1GSD A;  2R37 A;  1Y6E A;  4KGI A;  3LYK A;  3KMN A;  3KD0 A;  3MDK A;  3FZA A;  4JBB A;  2V2G A;  1A23 A;  2X8G A;  4LMV A;  2B6M A;  4FO5 A;  5CAX A;  3I69 A;  1R5P A;  2LRN A;  4ZBA A;  1JZW A;  1EEJ A;  2HRN A;  3QD9 A;  2E2M A;  1O85 A;  3TDG A;  3A2X A;  2O89 A;  2YP6 A;  3TJG A;  2GDR A;  1PX7 A;  1WRY A;  4QQ7 A;  2FLS A;  3D22 A;  2CZ3 A;  4L0W A;  5CRG A;  4L8E A;  3CMI A;  2HLS A;  3KZQ A;  3UVH A;  1PRX A;  3F6F A;  4HS1 A;  1V40 A;  2IIY A;  2JZS A;  3QMX A;  2YV9 A;  2P0G A;  2GQL A;  5IOW A;  1JLW A;  1BX9 A;  2H1D A;  1S3A A;  22GS A;  3IDV A;  1OVN A;  1Z3E A;  2EIO A;  5COH A;  2A2P A;  2M72 A;  3ME8 A;  4TR1 A;  1X9W B;  1B8X A;  4EIQ A;  3SBC A;  2B7K A;  4TKY A;  4GST A;  5H5S A;  3ISO A;  3UBL A;  1SJZ A;  2B5E A;  4V2M A;  1WMJ A;  2B5X A;  2DKI A;  1ZCP A;  1GSS A;  4HDE A;  3LQ7 A;  3NIV A;  4F82 A;  2X99 A;  1B4P A;  4K0G A;  1Q4J A;  2QSI A;  2F9S A;  2N5B A;  3TJJ A;  4G0K A;  1E6B A;  3IC8 A;  2OBI A;  3HDC A;  3GST A;  1CQG A;  4GSS A;  5G5F A;  2H30 A;  4MZC A;  3APO A;  3HCZ A;  1SJ6 A;  2OBK A;  1G6Y A;  2XC2 A;  1A0R P;  2AYT A;  3G7I A;  3H79 A;  3APS A;  3G7J A;  4BVY B;  1Z6M A;  2FD3 A;  5KN2 A;  3L9S A;  2L5O A;  1Y25 A;  1EEM A;  4HU9 A;  1X9S B;  1FAA A;  4AF2 A;  2VM1 A;  3ED3 A;  2H0G A;  4K9Z A;  4ZB8 A;  1I9D A;  3CSJ A;  2KOK A;  4MJC A;  5G1L A;  3C1R A;  1FO5 A;  2IL3 A;  3FRC A;  5D96 A;  3ZL5 A;  1ZGN A;  2A4V A;  4MPF A;  1YF0 A;  5CO3 A;  3QFB C;  2CQ9 A;  1DE2 A;  3A2W A;  3LFL A;  3D21 A;  5A4V A;  4MH2 A;  3EIN A;  1TKD B;  1WP0 A;  3GX0 A;  2R0C A;  5ECH B;  4FYC A;  1EWX A;  1Z5Y E;  1NM3 A;  2TRC P;  4J56 E;  3GNJ A;  4ICY A;  5ECS A;  1J9B A;  5ECK B;  4OFN A;  4WBJ A;  3RHC A;  4ML1 A;  2LJK A;  3HA9 A;  3HY2 A;  5AIX A;  3TKS E;  4J57 E;  2QA2 A;  4PUR A;  5BMU A;  5ECP B;  2I9H A;  1XPV A;  4E8H A;  4RI7 A;  1V98 A;  3QR6 A;  2FWG A;  2CAI A;  4K5R A;  4AJ7 A;  2JL4 A;  1GSU A;  1O8X A;  2VLV A;  2E2G A;  2GTU A;  3EC3 A;  1OKT A;  3F63 A;  4IVF A;  4MH3 A;  1QMV A;  2L4Q A;  3MWH A;  3TRX A;  5ABR A;  5G31 A;  1TK8 B;  3BCI A;  2H6Z A;  5CRE A;  1XWB A;  3GUR A;  2DIZ A;  2H01 A;  4EDZ A;  1OC8 A;  4WKW A;  1XWA A;  1TDI A;  5B8B A;  1QK8 A;  5HR3 A;  4N0V A;  5J3R A;  3BJ5 A;  3QAW A;  3GH9 A;  1M9B A;  1GUM A;  1K0C A;  3HJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...