2WGRA

Combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
163
structure length
163
Chain Sequence
SWNSIYEFTVKDINGVDVSLEKYRGHVCLIVNVACKSGATDKNYRQLQEMHTRLVGKGLRILAFPCNQFGGQEPWAEAEIKKFVTEKYGVQFDMFSKIKVNGSDADDLYKFLKSRQHGTLTNNIKWNFSKFLVDRQGQPVKRYSPTTAPYDIEGDIMELLEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE PEROXIDASE
publication title Combining Crystallography and Molecular Dynamics: The Case of Schistosoma Mansoni Phospholipid Glutathione Peroxidase.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Oxidoreductase
total genus 65
structure length 163
sequence length 163
ec nomenclature ec 1.11.1.9: Glutathione peroxidase.
pdb deposition date 2009-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00255 GSHPx Glutathione peroxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2wgrA00
1DE2A 3TRPA 4TVEA 2JL4A 4BPYA 4I2TA 5F05A 2B1LA 1FAAA 4PNGA 4ML1A 2HSHA 1XWKA 2F8AA 4FH8A 5A5KA 1X5CA 6GSXA 2JZTA 4GTUA 5F8BA 4QQ7A 3WT2A 3Q6OA 22GSA 3LEFA 3UEMA 5AIVA 2IWTA 1VF4A 4AJ6A 3MSZA 1R4WA 2DJ0A 3KH7A 4G9HA 2JZRA 5GZZB 2KP1A 3RAZA 5KN1A 3ZLPA 1OKTA 4J56E 4PUFC 3CMIA 3DXBA 3IAS2 4ZBAA 4MF7A 1A2MA 4K8MA 1GH2A 1HNAA 3I9V2 2C0EA 3L78A 2O7KA 2CAQA 1WPIA 5DJMA 1FB6A 3MDKA 3WT1A 3OR5A 4JBBA 3H8QA 3G9BA 2DIYA 2K9FA 4WR5A 5LD0A 1PRXA 4CW9A 4IW9A 3FR9A 5CP1A 3ZVJD 5KN2A 3CYNA 3GFKA 2GLRA 2PUKC 1T00A 1DUGA 2ES7A 2CVKA 1TU8A 2CX4A 3A5WA 5FWGA 4V1Ap 3LJRA 1YF0A 4YH2A 2TRXA 1HD2A 2E2MA 3H4KA 4PXOA 1MTCA 4I6XA 1EGOA 2CAIA 5JWOB 1E6BA 1XVWA 4AJ8A 2XBQA 4HJMA 2FNOA 3DVWA 1MD4A 5B8BA 2RM6A 3H79A 3GYKA 2CV4A 1M2BA 2GSSA 1GTAA 3SBCA 4D73A 1JFUA 2D2ZA 1ERVA 4KDYA 1Z6MA 3M8NA 4KDUA 2DJKA 2B5XA 2DBCA 2E2GA 2GQLA 3BJ5A 4I8BA 3ZMKA 1EWXA 1GTUA 2YWIA 2CT6A 4KDXA 3FW2A 1TRVA 2FD3A 2VOCA 4GRFA 1XIYA 1GTIA 2GT5A 3DYRA 4HZ2A 4TR1B 1SKSB 1TI3A 4RI7A 1TU7A 1RK4A 4OCEA 5JCUA 2H6YA 2KUCA 2OBIA 1VF2A 5H5QA 4V2MA 1A2JA 3ZVJA 2JZSA 2PVQA 5ECPB 16GSA 2AHEA 3M1GA 4IVFA 1V98A 3M9KA 4D73B 4F0BA 3HA9A 2EC4A 4BL7A 1ZL9A 2VCVA 1XBSA 2K8SA 4WXTA 1BX9A 4IP6A 4L0WA 6GSWA 4RQRA 1JLWA 2PPTA 2GZYA 4IP1A 5ENUA 2OACA 1OVNA 2FUG2 5G2ZA 2ON7A 2PMTA 1R5AA 3APSA 4EO3A 1GWCA 3GUSA 3F6DA 5FT3A 5E59A 1FOVA 3KH9A 4HZ4A 4K2DA 3UBKA 1SD9A 3D0ZA 3IBHA 4XS4A 2H0IA 4TR0A 1U88A 2LJRA 4GSTA 3GKXA 4MDCA 4XRAA 2XHFA 4NHWA 1QQ2A 2X64A 1QUWA 2L6CA 4EL1A 3KMNA 5AISA 4MZWA 1SU9A 1GUHA 2DJJA 2JU5A 1QK8A 2XPEA 2O89A 1JZRA 3F4TA 1Z7RA 1K0DA 4RQXA 2MMNA 1A23A 3ISOA 1SYXA 2I4AA 5HR2A 2YV9A 4MCUA 1XCCA 3KD0A 3Q18A 3DEXA 2YOIA 1A0FA 4BA7A 4CHSA 5IO2A 3K8NA 5CRDA 5DALA 3W8SA 3IHQA 4JEDA 2NDOA 3EURA 1GUMA 1XWBA 1LU4A 3CTGA 5HR1A 1ZCPA 3FKFA 5AIXA 2IPAA 4KA0A 1T4ZA 3UMAA 3KTLA 4KE3A 6GSSA 2L5OA 1MDJA 4XS4B 4K0NA 5INYA 2HT9A 2GT6A 1G0TA 3GN3A 5E4WA 1EEMA 1Z9HA 1GSFA 3S9FA 1SJZA 1LBKA 1KTEA 1JZWA 3LXTA 2MMAA 2B5EA 3E0UA 3FR6A 4EE0A 3TJBA 3C1RA 4HQZA 2C3TA 2KP2A 1TK0B 4F03A 4F82A 4NXIA 3F8UA 2JSYA 3KJYA 4DEJA 5C00A 4YQUA 3GURA 1QMVA 2QSIA 4IJIA 2PVOC 4QL9A 3ZFLA 18GSA 5DALB 3KCMA 1SK0A 3MAKA 2GTUA 4L0UA 1ILOA 2YN1A 2DIZA 2EIRA 2LRCA 1PD21 3GX8A 1W89A 5ELGA 1EEJA 3HZ4A 3A2XA 3BCKA 3H1NA 2V1MA 2IN3A 3HJMA 4OCFA 2DSAA 5CO3A 3PINA 2WZ9A 1SYRA 2H1GA 4WR4A 2A4VA 4EVMA 2GQKA 5DQYA 1PN9A 4AF2A 1Y6EA 3G7IA 1R5PA 1ERWA 2LSTA 2L57A 3GKNA 4K7NA 1XW9A 3EINA 4RUVA 4PUAA 1JHBA 3GNJA 2V6OA 1Q98A 4BVYA 4JR4A 3GA4A 1GSUA 3LQ7A 3G7JA 2V6KA 2DMMA 4V2LA 5CRGA 3ZIJA 3L0HA 2VAFA 4KSMA 3ERWA 1LJRA 1WMJA 1K0BA 2VCXA 4MJBA 1GUKA 3ZREA 2I81A 4POLA 5ECIB 1A0RP 2FY6A 2Z9SA 2CZ2A 3FHKA 4EKZA 3KGKA 2VLTA 2G0FA 3RDWA 3HZ8A 1OKDA 1PX6A 2X99A 1GNEA 3EE2A 1X9SB 2FA8A 3F6FA 2OA7A 1IYIA 2BMXA 4POMA 2LRTA 2L6DA 2DJ2A 5J9CA 1MDKA 3KZQA 3TRXA 2HLSA 1E2YA 5B7CA 4E8EA 2DMLA 3VWVA 3DD3A 1M2DA 1WE0A 5DCHA 4HS1A 2MMZA 3ZMLA 4LL4B 1PL1A 1X5EA 4TXOA 7GSSA 2IMEA 4EUYA 1THXA 1BYEA 4L5LA 2MZCA 3GKMA 3SWLA 1TP9A 2VL2A 2GS3A 5F07A 1DBYA 4EC0A 2WB9A 3R2QA 3GL3A 4KSOA 2K8VA 1A8YA 5ECQB 4XRDA 2OADA 3QFBC 1NM3A 5J5NA 19GSA 3A3TA 3DKSA 4MH2A 4BVXA 4O5RA 4PGTA 4OO4A 4TN8A 5CRHA 5D73A 3CSIA 2MBSA 1GTBA 2OE3A 2E7PA 2FWFA 1ERUA 3VURA 2HRNA 1OAZA 3VPTA 4FO5A 1GL8A 2H30A 2OE0A 4TXOB 3EYTA 17GSA 4HJ2A 2C80A 3UOMA 1SKRB 5L71A 4ZILA 1YDKA 4H86A 3DGQA 4TKYA 4OO5A 8GSSA 2N5AA 3TKRA 1BG5A 4MA9A 2WULA 3EU4A 2KOKA 3ED3A 1DE1A 1YJ6A 1K0CA 4EXJA 4OFNA 3ERGA 4FYUA 1PKWA 2H19A 4NAXA 1OYJA 3V1WA 1XW6A 3D22A 1GSDA 2WRTA 2C0DA 5D9XA 2IFQA 13GSA 3RBTA 5IM9A 4TR1A 2ZNMA 2H74A 1F37A 3FYGA 2YWOA 1Y25A 1GSEA 1YQ1A 2GZPA 1ZGNA 3KEBA 1BJXA 2HI7A 1TI1A 1I9DA 3DIEA 3I43A 1DSBA 3NZNA 2LEGA 1T8EB 2AAWA 1EV4A 2FWGA 4WKWA 2B7KA 3FZ4A 4TOPA 4G19A 4HU7A 2L5LA 3GMFA 2LNSA 3UL3A 1XOBA 3EU3A 2ON5A 5HR3A 1B4QA 1YKCA 5IMCA 5HFKA 3EMPA 1ZYQB 1G6WA 3IK7A 2FA4A 4O32A 4KH7A 20GSA 3LFLA 4P3YB 1TTZA 1K0AA 3DWVA 1PA3A 4WBJA 5D93A 2F9SA 3E3EA 3Q19A 3ZIVA 2IJYA 2GSQA 1EOHA 1AUCA 1M2AA 5DAKA 2R6KA 2IFQB 5ID2A 3GX0A 4DSQA 3WGDA 2JADA 2VCZA 3GSSA 2WCIA 2B7JA 3P8WA 1TDIA 1PL2A 5GAPD 1OC9A 2AYTA 2HXKA 5DDLA 2LKUA 1M7TA 5J4UA 2LJKA 4Q5NA 3VPQA 3LORA 3D21A 2P5RA 3L4NA 1O73A 3RHBA 1XXUA 1TOFA 4MJEA 1X5DA 3APQA 3TRQA 1WRYA 5G5EA 3TJKA 2VD0A 4FYBA 4I97A 2H8LA 3D5JA 2VM1A 1BQ7A 2H73A 2FWHA 1MEKA 3GH9A 3KIJA 1GSYA 2LQOA 4EF0A 1ACVA 1Z6NA 2WS2A 4OD7A 3BOAA 4GQFA 3J7Yb 5LNKe 2IIYA 2NVLA 3CRUA 4ZL8A 2YNXA 2AJQB 4WEYA 2C1YA 2N5BA 1X9WB 1AC1A 1ERTA 5DAKB 4WETA 3W6GA 5ID2B 2YPMA 4O7HA 2H01A 1GNWA 3C1SA 3TUEA 3IA1A 4F2IA 5COHA 5DCGA 4HOJA 5CYYA 2EIOA 1PSQA 1QFNA 4JR6A 1SKWB 2O87A 5DBQA 1OC9B 1FW1A 3FEUA 4K1FA 4ACSA 1TRSA 4KUNA 3PR8A 2NBSA 1ZZYA 2HFDA 3ZZXA 4ZL7A 1JLVA 2AUVA 3IK9A 3P2AA 1AAZA 1U3AA 1XOAA 2F3MA 3KMOA 3D4TA 1QGVA 2R4VA 4K7IA 2VM2A 3HJPA 3F3QA 3EVIA 3IV4A 1HYUA 5FHIA 2WDUA 2YANA 5IMVA 4GSNA 3WGEA 3J7Yk 2C0GA 4K0GA 4WBRD 2K6VA 5ECRB 5A4VA 5ECNB 2O85A 1B8XA 4ZBDA 3VI7A 1K0NA 4Z7XA 3CRTA 2QGVA 3QD9A 3EC3A 3DMLA 4MP4A 3AY8A 2OBKA 3HD5A 4MF5A 4JU5A 4L5OA 1N2AA 1J08A 1UC7A 2H6XA 2IMKA 1TRUA 1WP0A 3UJ1A 3GTUA 1SK2A 4GLTA 2JSZA 2TRCP 3KP9A 5HFIA 2M80A 4HQSA 5LCZA 1SL0B 3IAM2 3D6IA 2AB6A 3G7YA 2RUFA 4DVCA 2WFCA 2N5FA 4O92A 4GWRA 4LL1B 2OE1A 3C7MA 3TKSA 4N11A 2FHEA 2PU9C 9GSSA 1FB0A 1OC3A 5HR0A 2L4CA 4YAPA 3EWLA 2GQMA 1TRWA 4ZB6A 12GSA 1T7PB 4LMWA 3E9JB 1PGTA 4KB3A 4DSRA 4ECCA 3HVVA 3CXGA 4G10A 2HSYA 4V2NA 1KEBA 1V58A 4V1Ag 1PX7A 3ZRDA 4XTSA 3TKQA 4ZBBA 1YEPA 2MBTA 2C0FA 3IDVA 3PGTA 3O76A 4E8HA 4J2FA 3KP8A 14GSA 1A8LA 4KCEA 1B48A 4XS1A 2M72A 2VLVA 3GTUB 2B3SA 1GLQA 3N9JA 2HZFA 3QPMA 1XWGA 4PX1A 6GSUA 3ZFBA 4MMMA 1ZOFA 4OFTA 2NTOA 1G7OA 1VRSD 2YV7A 3MNGA 3UARA 3M3MA 2DC5A 1K3OA 2F8FA 1AW9A 4MF6A 1XVQA 2FWEA 2IL3A 1B4PA 4AGSA 2R5GA 4PNFA 4N0ZA 2V32A 1T1VA 4ECJA 3L9UA 1YY7A 5EPFA 1F3AA 1AXDA 4KCAA 2LTKA 3M0FA 2YWNA 2R3XA 2J23A 2GDRA 3US3A 2RIIA 3A2WA 4IN0A 1XWAA 3TJFA 5ECSA 3UVHA 1MDIA 4N30A 3F4RA 4YQMA 4GCIA 1J0FA 3F9UA 1V9WA 6GSVA 3W8JA 5H5RA 4MZCA 1EP7A 4NV2A 2KHPA 4ILFA 1V2AA 3TKPA 1X0RA 2X8HA 4ID0A 4Q5RA 2GVPA 1AQVA 2LRNA 4JRRA 5IMZA 2O8VB 2MMOA 2CX3A 5C04A 1T3BA 3HY2A 2KLXA 2LV3A 3JCML 1CQGA 4FIWA 3CSHA 3LWAA 1NW2A 4XCSA 3QDNA 1K3YA 5CREA 2H76A 3KTBA 2PBJA 2C3NA 3IE3A 2TIRA 3TOUA 4IHUA 1B9XC 1H75A 3QCPA 4TRXA 1RQMA 3GH6A 3N5OA 4YAVA 3F63A 3FZ5A 2MYGA 4GSSA 1SJ6A 3GL5A 4DSSA 4TR3A 4GXZA 3HHVA 3QAGA 2LQQA 5B6NA 3LYPA 2CA8A 3QAVA 4ZL9A 3HVSA 1Z5YE 5H5SA 3ZYWA 3UBLA 3NIVA 4MPFA 5JCGA 1O85A 2A2RA 4MJCA 2I9HA 3GSTA 2FCHA 1KBNA 1V40A 1FVKA 2VUPA 1VF1A 3O6TA 2YJHA 3ZL5A 4RI6A 1BEDA 2VL2C 4MPGA 1ZYEA 1Z7PA 1OC8A 4X1UA 3P7XA 1UA5A 3TJGA 3GIXA 5DQSA 4OWYA 5CAXA 1XPVA 1F6MC 3HVXA 2LS5A 2C4JA 2LUSA 1YEXA 5DJLA 1XZOA 4DSSB 1WWJA 4IJ3A 2H1AA 1GP1A 3EMXA 4WF4A 2XPDA 3LSZA 2JACA 3VK9A 4ECBA 1S3CA 3IR4A 3HCZA 4PURA 5F0GA 1ABAA 1UVZA 1TXXA 1S3AA 4K9ZA 1O6JA 3TGZA 4K6XA 2H6ZA 1SD8A 2ZCTA 3TKSE 1EV9A 4MLYA 4HUAA 1G6YA 5A4WA 3O3TA 3CTFA 2P5QA 2LNTA 2H75A 1I5GA 4PQIA 1SL1B 3LGCA 1O8WA 3F4SA 5EL8A 4POBA 2X8CA 4N0VA 2FGXA 1YKAA 5KN3A 2P31A 5IMDA 4MJAA 1THOA 3QOUA 4ZB9A 5GSTA 4F0CA 5KEJA 2YZUA 2CQ9A 4I5QA 2YZHA 2HNLA 4Q5FA 4K7OA 3TCOA 2CVDA 3CSJA 2WJUA 5AGYA 1MD3A 4ZIJA 1GLPA 2RUEA 4OFMA 1F3BA 2YJ7A 2E0QA 3C8EA 3IC4A 1X9MB 1W4VA 2REMA 3HYPA 4EDZA 4CDOA 1USBA 3VLNA 1M99A 1AIUA 1VGLA 4IGJA 2IMIA 5F06A 3ZTLA 5IMFA 3BBYA 4ML6A 1TK5B 1ML6A 4HDEA 1XW5A 4HEA2 4IBPA 3C73A 1JZDA 2IMDA 2H1DA 2J9HA 5ECOB 5IPHA 1J9BA 2DJ3A 1AQXA 1ST9A 1A2LA 1Q4JA 3FR3A 3HJOA 1WJKA 1K0OA 3VWUA 1F2EA 4BWQA 3UVTA 1EOGA 1C72A 4YQVA 1NHYA 1GSQA 1TKDB 3QFAC 3ME7A 5ECKB 4LA1A 2AV4A 5G1LA 5B6MA 4ECIA 3RHCA 1T4YA 3BD2A 2R37A 1URMA 3VWWA 5HQPA 1B9YC 2ALBA 3ERFA 1O8XA 5AN1A 2P0GA 4X0XA 5IOWA 2HE3A 4XS6A 3QMXA 3UAPA 4IELA 3IXRA 4PQ1A 1HNBA 5ECMB 4N10A 4WF5A 1SL2B 2VCTA 1K0MA 1PKZA 4G2EA 1FG4A 4MZBA 2B5YA 1SJIA 5D9WA 4OMVA 3F3RA 1F9MA 2R2JA 2NPBA 1HNCA 1K3LA 5KN0A 1TW9A 4BWSA 2IMFA 2PERA 1VF3A 1U87A 1A24A 4NPBA 5JWQB 2B1KA 2OJLA 2VD1A 4ULXA 2VL3A 1M9BA 4NHZA 2GZZA 3GRXA 1OE7A 3P90A 1UN2A 4IKHA 3L9SA 6GSTA 5D9VA 4IS0A 1IYHA 2HZEA 4F9ZA 1GULA 3F0IA 1ON4A 2YP6A 4I2UA 2L59A 1WOUA 5J3RA 4IQ1A 3I69A 2GSTA 5JCWA 2VLUA 5D9TA 3VWXA 2M46A 3NOFA 3TJJA 5ECHB 2WGRA 2HYXA 2PGTA 2QKEA 3IRAA 3TB2A 4IQAA 3D4MA 5A4UA 2V41A 3FZ9A 5CRWA 5B8AA 3HXSA 4KAEA 3M9JA 3UIWA 2DLXA 1EGRA 4AJ7A 3U5RE 2B6MA 5HFGA 2VIMA 1H4OA 2XBIA 5IPGA 1Z3EA 1EZKA 3DVXA 4X43A 3QAWA 3BCIA 2H1BA 1BAYA 4NWYA 4TW5A 4XIHA 3GV1A 5ABRA 5EY6A 4ZXGA 2CZ3A 2OKAA 1TJDA 3I6AA 1GSSA 5D8IA 1CQHA 2VCQA 4Q5QA 3WGXA 2HZEB 2YWMA 5ELAA 1G7EA 1O81A 3GKKA 1KNGA 1RW1A 3HKRA 3A2VA 1U6TA 3FY7A 4HI7A 4JZQA 2C8UA 2EIQA 5GAND 10GSA 1OE8A 3HDCA 1EP8A 3WYWA 3QR6A 3C71A 5G5FA 2RLIA 2XC2A 3CBUA 4LMVA 2PN8A 1YZXA 5IQYA 3VI5A 3TKSC 11GSA 2HRFA 3PH9A 2LJAA 1SENA 3VFIA 4KX4A 2DJ1A 4KGIA 5ECLB 3APOA 3WD6A 4MK3A 2FLSA 4ZB8A 2H72A 1PMTA 3GHAA 3KM6A 4J57E 5IOXA 1YF1A 3FRCA 3ME8A 1ZMAA 1TK8B 2GSRA 2H71A 4KW6A 3TOTA 1FO5A 2I3YA 1WIKA 2VL9A 2K18A 3MWHA 1FVJA 5JWRB 1R7HA 3FZAA 3TDGA 4ISDA 1FHEA 5J41A 1M9AA 4KNDA 4NMUA 4EDYA 5GSSA 5G30A 5IIZA 1S3DA 4MABA 3IOSA 2H0HA 1R26A 2L4QA 2VO4A 2X8GA 2QC7A 5IO0A 5J9BA 2YCDA 3ZITA 2V2GA 1M0UA 1O7UA 1XFLA 2F51A 1JZOA 4L8EA 1AQWA 2G2QA 4HU9A 1NHOA 1SK1A 2PWJA 4TXVA 5D96A 4JE1A 2BJXA 3LG6A 3DRNA 2VCWA 1XWCA 4GF0A 3FK8A 3IPZA 6GSYA 3Q74A 2C3QA 2H0GA 4XHMA 1QXHA 3LXZA 5G31A 5IMAA 2H70A 1NSWA 4GQCA 3L9VA 2RM5A 2GGTA 3RPNA 2BTOT 3RPPA 3U6VA 5EVOA 2A2SA 4PQHA 2H66A 4LLRA 4FYCA 2I1UA 4NV5A 2ZUPA 3H93A 3KXOA 5DVBA 2CVBA 1HQOA 1GRXA 1U3IA 1PQNA 4TR4A 1V57A 5G1KA 4MH3A 4QL7A 4POKA 1N8JA 5CNWA 3LYKA
chains in the Genus database with same CATH superfamily
1DE2A 3TRPA 4TVEA 2JL4A 4BPYA 4I2TA 5F05A 2B1LA 1FAAA 4PNGA 4ML1A 2HSHA 1XWKA 2F8AA 4FH8A 5A5KA 1X5CA 6GSXA 2JZTA 4GTUA 5F8BA 4QQ7A 3WT2A 3Q6OA 22GSA 3LEFA 3UEMA 5AIVA 2IWTA 1VF4A 4AJ6A 3MSZA 1R4WA 2DJ0A 3KH7A 4G9HA 2JZRA 5GZZB 4BIKA 2KP1A 3RAZA 5KN1A 3ZLPA 1OKTA 4J56E 4PUFC 3CMIA 4CY6A 3DXBA 3IAS2 4ZBAA 4MF7A 1A2MA 4K8MA 1GH2A 1HNAA 3I9V2 4K5RA 2C0EA 3L78A 2O7KA 2CAQA 1WPIA 5DJMA 1FB6A 3MDKA 3WT1A 3OR5A 4JBBA 3H8QA 3G9BA 2DIYA 2K9FA 4WR5A 5LD0A 1PRXA 2R0GA 4CW9A 4IW9A 3FR9A 5CP1A 3ZVJD 5KN2A 3CYNA 3GFKA 2GLRA 2PUKC 3MIXA 1T00A 1DUGA 2ES7A 2CVKA 1TU8A 2CX4A 3A5WA 5FWGA 4V1Ap 3LJRA 4O5UA 1YF0A 3R3EA 4YH2A 2TRXA 1HD2A 2E2MA 3H4KA 4PXOA 1MTCA 4I6XA 1EGOA 2CAIA 5JWOB 1E6BA 1XVWA 4AJ8A 2XBQA 4HJMA 2FNOA 3DVWA 1MD4A 5B8BA 3LW9A 2RM6A 3H79A 3GYKA 2CV4A 1M2BA 2GSSA 1GTAA 3SBCA 4D73A 1JFUA 2D2ZA 1ERVA 4KDYA 1Z6MA 2R0PA 3M8NA 4KDUA 2DJKA 2B5XA 4CY8A 2DBCA 2E2GA 2GQLA 3BJ5A 4I8BA 3ZMKA 1EWXA 3CQFA 1GTUA 2YWIA 2CT6A 4KDXA 3FW2A 1TRVA 2FD3A 2VOCA 4GRFA 1XIYA 1GTIA 2GT5A 3DYRA 4HZ2A 4TR1B 4YKFA 1SKSB 1TI3A 4RI7A 1TU7A 2HSMA 1RK4A 4OCEA 5JCUA 2H6YA 2KUCA 2OBIA 1VF2A 5H5QA 4V2MA 1A2JA 3ZVJA 2JZSA 2PVQA 5ECPB 16GSA 2AHEA 3M1GA 4IVFA 1V98A 3M9KA 4D73B 4F0BA 3HA9A 2DKHA 2EC4A 4BL7A 1ZL9A 2VCVA 1XBSA 2K8SA 4WXTA 1BX9A 4IP6A 4L0WA 6GSWA 4RQRA 1JLWA 2PPTA 2GZYA 4IP1A 5ENUA 2OACA 1OVNA 2FUG2 2UZ8A 5G2ZA 2ON7A 2PMTA 1R5AA 3APSA 4EO3A 1GWCA 3GUSA 3F6DA 5FT3A 5E59A 1FOVA 3KH9A 4HZ4A 4K2DA 3UBKA 1SD9A 3D0ZA 3IBHA 4XS4A 2H0IA 4TR0A 1U88A 2LJRA 4GSTA 3GKXA 4MDCA 4XRAA 2XHFA 4NHWA 1QQ2A 2X64A 1QUWA 2L6CA 4EL1A 3KMNA 5AISA 4MZWA 1SU9A 1GUHA 2DJJA 2JU5A 1QK8A 2XPEA 2O89A 1JZRA 4G0IA 3F4TA 1Z7RA 1K0DA 4RQXA 2MMNA 1A23A 3ISOA 1SYXA 4BL7B 2I4AA 4A5PA 5HR2A 2YV9A 4MCUA 1XCCA 3KD0A 3Q18A 3DEXA 2YOIA 1A0FA 4O5QA 4BA7A 4CHSA 5IO2A 3K8NA 5CRDA 5DALA 3W8SA 3IHQA 4JEDA 2NDOA 3EURA 1GUMA 1XWBA 1LU4A 3CTGA 5HR1A 1ZCPA 3FKFA 5AIXA 2IPAA 4KA0A 1T4ZA 3UMAA 3KTLA 4KE3A 6GSSA 2L5OA 1MDJA 4XS4B 4K0NA 5INYA 2HT9A 2GT6A 1G0TA 3GN3A 5E4WA 1EEMA 1Z9HA 1GSFA 3S9FA 1SJZA 1LBKA 1KTEA 1JZWA 3LXTA 2MMAA 2B5EA 3E0UA 3FR6A 4EE0A 3TJBA 3IC8A 2X49A 3C1RA 4HQZA 2C3TA 2KP2A 1TK0B 4F03A 4F82A 4NXIA 3F8UA 2JSYA 3KJYA 4DEJA 5C00A 4YQUA 3GURA 1QMVA 2QSIA 1S3RA 4IJIA 2PVOC 1XG8A 4QL9A 3ZFLA 18GSA 5DALB 3KCMA 1SK0A 3MAKA 2GTUA 4L0UA 1ILOA 2YN1A 4PTSA 2DIZA 2EIRA 2LRCA 1PD21 3GX8A 4MNNA 1W89A 5ELGA 1EEJA 3HZ4A 3A2XA 3BCKA 3H1NA 2V1MA 2IN3A 3HJMA 4OCFA 2DSAA 5CO3A 3PINA 2WZ9A 1SYRA 2H1GA 4WR4A 4G0LA 2A4VA 4KF9A 4EVMA 2GQKA 5DQYA 1PN9A 4AF2A 1Y6EA 3G7IA 1R5PA 1ERWA 2LSTA 2L57A 3GKNA 4K7NA 1XW9A 3EINA 4RUVA 4PUAA 1JHBA 3GNJA 2V6OA 1Q98A 4BVYA 4JR4A 3GA4A 1GSUA 3LQ7A 3G7JA 4Z2RA 2V6KA 2DMMA 4V2LA 5CRGA 3ZIJA 3L0HA 2VAFA 4KSMA 3ERWA 1LJRA 1WMJA 1M3IA 1K0BA 2VCXA 4MJBA 1GUKA 3ZREA 1FOHA 2I81A 4POLA 5ECIB 1A0RP 2FY6A 2Z9SA 2CZ2A 3FHKA 4EKZA 3KGKA 2VLTA 2G0FA 3RDWA 3HZ8A 1OKDA 1PX6A 2X99A 1GNEA 4K5SA 3EE2A 1X9SB 2FA8A 3F6FA 2OA7A 1IYIA 2BMXA 4POMA 2LRTA 2L6DA 2DJ2A 5J9CA 1MDKA 3KZQA 3TRXA 2HLSA 1E2YA 5B7CA 4E8EA 2DMLA 3VWVA 3DD3A 1M2DA 1WE0A 5DCHA 4HS1A 2MMZA 3ZMLA 4LL4B 4BVYB 1PL1A 1X5EA 4TXOA 7GSSA 2IMEA 4EUYA 1THXA 1BYEA 4L5LA 2MZCA 3GKMA 3SWLA 1TP9A 2VL2A 2GS3A 5F07A 1DBYA 4EC0A 2WB9A 3R2QA 3GL3A 4KSOA 2K8VA 1A8YA 4XRDA 5ECQB 2OADA 3QFBC 1NM3A 5J5NA 19GSA 3A3TA 3DKSA 4MH2A 4BVXA 4O5RA 4PGTA 4OO4A 4TN8A 5CRHA 5D73A 3CSIA 2MBSA 1GTBA 2OE3A 2E7PA 2FWFA 1ERUA 3VURA 2HRNA 1OAZA 3VPTA 4FO5A 1GL8A 2H30A 2OE0A 4TXOB 3EYTA 17GSA 4HJ2A 2C80A 1PN0A 3UOMA 1SKRB 4HSCX 5L71A 4ZILA 1YDKA 4H86A 3DGQA 4TKYA 4OO5A 8GSSA 2N5AA 3TKRA 1BG5A 4MA9A 2WULA 3EU4A 2KOKA 3ED3A 1DE1A 1YJ6A 1K0CA 4EXJA 4OFNA 3ERGA 4FYUA 1PKWA 2H19A 4NAXA 1OYJA 3V1WA 5KOXA 1XW6A 3D22A 1GSDA 2WRTA 2C0DA 5D9XA 2IFQA 4BVXB 13GSA 3RBTA 5IM9A 4TR1A 2ZNMA 2H74A 1F37A 3FYGA 2YWOA 1Y25A 1GSEA 1YQ1A 2GZPA 1ZGNA 3KEBA 1BJXA 2HI7A 1TI1A 1I9DA 3DIEA 3I43A 1DSBA 3NZNA 2LEGA 1T8EB 2AAWA 1EV4A 2FWGA 4WKWA 2B7KA 3FZ4A 4TOPA 4G19A 4HU7A 2L5LA 3GMFA 2LNSA 3UL3A 1XOBA 3EU3A 2ON5A 5HR3A 1B4QA 1YKCA 5IMCA 5HFKA 3EMPA 1ZYQB 1G6WA 3IK7A 2FA4A 4O32A 4KH7A 20GSA 3LFLA 4P3YB 1TTZA 1K0AA 3DWVA 1PA3A 4WBJA 5D93A 2F9SA 3E3EA 3Q19A 3ZIVA 2IJYA 2GSQA 1EOHA 1AUCA 1M2AA 5DAKA 2R6KA 2IFQB 5ID2A 3GX0A 4DSQA 3WGDA 2JADA 2VCZA 3GSSA 2WCIA 2B7JA 3P8WA 1TDIA 1PL2A 5GAPD 1OC9A 2AYTA 2HXKA 5DDLA 2LKUA 1M7TA 5J4UA 4G0KA 2LJKA 4Q5NA 3VPQA 3LORA 3D21A 2P5RA 3L4NA 1O73A 3RHBA 1XXUA 1TOFA 4MJEA 1X5DA 3APQA 3TRQA 1WRYA 5G5EA 3TJKA 2VD0A 4FYBA 4I97A 2H8LA 3D5JA 2VM1A 1BQ7A 2H73A 2FWHA 1MEKA 3FMWA 3GH9A 3KIJA 1GSYA 2LQOA 4EF0A 1ACVA 1Z6NA 2WS2A 4OD7A 3BOAA 4GQFA 3J7Yb 5LNKe 2IIYA 2NVLA 1M3JA 3CRUA 4ZL8A 2YNXA 2AJQB 4WEYA 2A4HA 2C1YA 2N5BA 1X9WB 1AC1A 1ERTA 5DAKB 4WETA 2DKIA 3W6GA 5ID2B 2YPMA 4O7HA 2H01A 1GNWA 3C1SA 3TUEA 3IA1A 4F2IA 5COHA 5DCGA 4HOJA 5CYYA 2EIOA 1PSQA 1QFNA 4JR6A 1SKWB 2O87A 5DBQA 1OC9B 1FW1A 3FEUA 4K1FA 4ACSA 1TRSA 4KUNA 3PR8A 2NBSA 1ZZYA 2HFDA 3ZZXA 4ZL7A 1JLVA 2AUVA 3IK9A 3P2AA 1AAZA 3A5IA 1U3AA 1XOAA 2F3MA 3KMOA 3D4TA 4Z2TA 1QGVA 2R4VA 4K7IA 2VM2A 3HJPA 3F3QA 3EVIA 3IV4A 1HYUA 5FHIA 2WDUA 2YANA 5IMVA 4GSNA 3WGEA 3J7Yk 2C0GA 4K0GA 4WBRD 2K6VA 5ECRB 5A4VA 5ECNB 2O85A 1B8XA 4ZBDA 3VI7A 1K0NA 4Z7XA 3CRTA 2QGVA 3QD9A 3EC3A 3DMLA 4MP4A 3AY8A 2OBKA 3HD5A 4MF5A 4JU5A 4L5OA 1N2AA 5BMUA 1J08A 1UC7A 2H6XA 2IMKA 1TRUA 1WP0A 3UJ1A 3GTUA 1SK2A 4GLTA 2JSZA 2TRCP 3KP9A 5HFIA 2M80A 4HQSA 5LCZA 1SL0B 3IAM2 3D6IA 2AB6A 3G7YA 2RUFA 4DVCA 2WFCA 2N5FA 4O92A 4GWRA 4LL1B 2OE1A 3C7MA 3TKSA 4N11A 2FHEA 2PU9C 9GSSA 1FB0A 1OC3A 5HR0A 2L4CA 4YAPA 3EWLA 2GQMA 1TRWA 4EIPA 4ZB6A 12GSA 1T7PB 4LMWA 3E9JB 1PGTA 4KB3A 4DSRA 4ECCA 3HVVA 3CXGA 4G10A 2HSYA 4V2NA 1KEBA 1V58A 4V1Ag 1PX7A 3ZRDA 4XTSA 3TKQA 4ZBBA 1YEPA 2MBTA 2C0FA 3IDVA 3PGTA 3O76A 4E8HA 4J2FA 3KP8A 14GSA 1A8LA 4KCEA 1B48A 4XS1A 2M72A 2VLVA 3GTUB 2B3SA 1GLQA 3N9JA 2HZFA 3QPMA 1XWGA 4PX1A 6GSUA 3ZFBA 5KOWA 4MMMA 1ZOFA 4OFTA 2NTOA 1G7OA 1VRSD 2YV7A 3MNGA 3UARA 3M3MA 2DC5A 1K3OA 2F8FA 1AW9A 4MF6A 1XVQA 2FWEA 2IL3A 1B4PA 4AGSA 2R5GA 4PNFA 4N0ZA 2V32A 1T1VA 4ECJA 3L9UA 1YY7A 5EPFA 1F3AA 1AXDA 4KCAA 2LTKA 3M0FA 2YWNA 2R3XA 2J23A 2GDRA 3US3A 2RIIA 3A2WA 4IN0A 1XWAA 3TJFA 5ECSA 3UVHA 1MDIA 4N30A 3F4RA 4YQMA 4GCIA 1J0FA 5BRTA 3F9UA 1V9WA 6GSVA 3W8JA 5H5RA 4MZCA 1EP7A 4NV2A 2KHPA 4ILFA 1V2AA 3TKPA 1X0RA 2X8HA 4ID0A 4Q5RA 2GVPA 1AQVA 2LRNA 4JRRA 5IMZA 2O8VB 2MMOA 2CX3A 5C04A 1T3BA 3HY2A 2KLXA 2LV3A 3JCML 1CQGA 4FIWA 3CSHA 3LWAA 1NW2A 4XCSA 3QDNA 1K3YA 5CREA 2H76A 3KTBA 2PBJA 2C3NA 3IE3A 2TIRA 3TOUA 4IHUA 1B9XC 1H75A 3QCPA 4TRXA 4USSA 1RQMA 3GH6A 3N5OA 4YAVA 3F63A 3FZ5A 2MYGA 4GSSA 4X4JA 1SJ6A 3GL5A 4DSSA 4TR3A 4GXZA 3HHVA 3QAGA 2LQQA 1PFOA 5B6NA 3LYPA 2CA8A 3QAVA 4ZL9A 4YKGA 4K2XA 3HVSA 1Z5YE 5H5SA 3ZYWA 3UBLA 3NIVA 4MPFA 5JCGA 1O85A 2A2RA 4MJCA 2I9HA 3GSTA 2FCHA 1KBNA 1V40A 1FVKA 2VUPA 1VF1A 4ICYA 3O6TA 2YJHA 3ZL5A 4RI6A 1BEDA 2VL2C 4MPGA 1ZYEA 1Z7PA 1OC8A 4X1UA 3P7XA 1UA5A 3PPUA 3TJGA 3GIXA 5DQSA 4OWYA 5CAXA 1XPVA 1F6MC 3HVXA 2LS5A 2C4JA 2LUSA 1YEXA 5DJLA 1XZOA 4DSSB 1WWJA 4IJ3A 2H1AA 1GP1A 3EMXA 4WF4A 2XPDA 3LSZA 2JACA 3VK9A 4ECBA 1S3CA 2HRAA 3IR4A 3HCZA 4PURA 5F0GA 1ABAA 1UVZA 1TXXA 1S3AA 4K9ZA 1O6JA 3TGZA 4K6XA 2H6ZA 1SD8A 2ZCTA 3TKSE 1EV9A 4MLYA 4HUAA 1G6YA 5A4WA 3O3TA 3CTFA 2P5QA 2LNTA 2H75A 1I5GA 4PQIA 1SL1B 3LGCA 1O8WA 3F4SA 1ZYNA 5EL8A 4POBA 2X8CA 4N0VA 2FGXA 1YKAA 5KN3A 2P31A 5IMDA 4MJAA 1THOA 3QOUA 4ZB9A 5GSTA 4F0CA 5KEJA 2YZUA 2CQ9A 4I5QA 2YZHA 2HNLA 4Q5FA 4K7OA 3TCOA 2CVDA 3CSJA 2WJUA 5AGYA 1MD3A 4ZIJA 1GLPA 2RUEA 4OFMA 1F3BA 2YJ7A 2E0QA 3C8EA 3IC4A 1X9MB 1W4VA 2REMA 3HYPA 4EDZA 4CDOA 4FQUA 1USBA 3VLNA 1M99A 1AIUA 1VGLA 4IGJA 2IMIA 5F06A 3ZTLA 5IMFA 3BBYA 4ML6A 1TK5B 1ML6A 4HDEA 1XW5A 4HEA2 4IBPA 3C73A 1JZDA 2IMDA 2H1DA 2J9HA 5ECOB 5IPHA 3HVNA 1J9BA 2DJ3A 1AQXA 1ST9A 1A2LA 1Q4JA 3FR3A 3HJOA 1WJKA 1K0OA 3VWUA 1F2EA 1ZYPA 4BWQA 3UVTA 1EOGA 1C72A 4YQVA 1NHYA 1GSQA 1TKDB 3QFAC 3ME7A 5ECKB 4LA1A 2AV4A 5G1LA 5B6MA 4ECIA 3RHCA 1T4YA 3BD2A 2R37A 1URMA 3VWWA 5HQPA 1B9YC 2ALBA 3ERFA 1O8XA 5AN1A 2P0GA 4X0XA 5IOWA 2HE3A 4XS6A 3QMXA 4Z2UA 3UAPA 4IELA 3IXRA 4PQ1A 2X4AA 1HNBA 4EIQA 5ECMB 4N10A 4WF5A 1SL2B 2VCTA 1K0MA 1PKZA 4G2EA 1FG4A 4MZBA 2B5YA 1SJIA 5D9WA 4OMVA 3F3RA 1F9MA 2R2JA 2NPBA 1HNCA 1K3LA 5KN0A 1TW9A 4BWSA 2IMFA 2PERA 1VF3A 1U87A 1A24A 4NPBA 5JWQB 2B1KA 2OJLA 2VD1A 4ULXA 2VL3A 1M9BA 4NHZA 2GZZA 3GRXA 1OE7A 3P90A 1UN2A 4IKHA 3L9SA 6GSTA 5D9VA 4IS0A 1IYHA 2HZEA 4F9ZA 1GULA 3F0IA 1ON4A 2YP6A 4I2UA 2L59A 1WOUA 5J3RA 4IQ1A 3I69A 2GSTA 5JCWA 2VLUA 5D9TA 3VWXA 2M46A 3NOFA 3TJJA 5ECHB 2WGRA 2HYXA 2PGTA 2QKEA 3IRAA 2A2PA 3TB2A 4IQAA 3D4MA 5A4UA 2V41A 3FZ9A 5CRWA 5B8AA 3HXSA 4KAEA 3M9JA 3UIWA 2DLXA 1EGRA 4AJ7A 3U5RE 2B6MA 5HFGA 2VIMA 1H4OA 2XBIA 5IPGA 1Z3EA 2HRKA 1EZKA 3DVXA 4X43A 3QAWA 3BCIA 2H1BA 1BAYA 4NWYA 4TW5A 4XIHA 3GV1A 5ABRA 5EY6A 4ZXGA 2CZ3A 2OKAA 1TJDA 3I6AA 1GSSA 5D8IA 1CQHA 2VCQA 4Q5QA 3WGXA 2HZEB 2YWMA 5ELAA 1G7EA 1O81A 3GKKA 1KNGA 1RW1A 3HKRA 3A2VA 1U6TA 3FY7A 4HI7A 4JZQA 2C8UA 2EIQA 5GAND 10GSA 1OE8A 3HDCA 1EP8A 3WYWA 3QR6A 3C71A 5G5FA 2RLIA 2XC2A 3CBUA 4LMVA 2PN8A 1YZXA 5IQYA 3VI5A 3TKSC 11GSA 2HRFA 3PH9A 2LJAA 1SENA 3VFIA 4KX4A 2DJ1A 4KGIA 5ECLB 3APOA 3WD6A 4MK3A 2FLSA 4ZB8A 2H72A 1PMTA 3GHAA 3KM6A 4J57E 5IOXA 1YF1A 3FRCA 3ME8A 1ZMAA 1TK8B 2GSRA 2H71A 4KW6A 3TOTA 2QA1A 1FO5A 2I3YA 1WIKA 2VL9A 2K18A 3IHGA 3MWHA 1FVJA 5JWRB 1R7HA 3FZAA 3TDGA 4ISDA 1FHEA 5J41A 1M9AA 4KNDA 4NMUA 4EDYA 5GSSA 5G30A 5IIZA 1S3DA 4MABA 3IOSA 2H0HA 1R26A 2L4QA 2VO4A 2X8GA 2QC7A 5IO0A 5J9BA 2YCDA 3ZITA 2V2GA 1M0UA 1O7UA 1XFLA 2F51A 1JZOA 4L8EA 1AQWA 2G2QA 4HU9A 1NHOA 1SK1A 2PWJA 4TXVA 5D96A 4JE1A 2BJXA 3LG6A 3DRNA 2VCWA 1XWCA 4GF0A 3FK8A 3IPZA 6GSYA 3Q74A 2C3QA 2H0GA 4XHMA 1QXHA 3LXZA 5G31A 5IMAA 2H70A 1NSWA 4GQCA 3L9VA 2RM5A 2GGTA 3RPNA 2BTOT 3EPTA 3RPPA 3U6VA 5EVOA 2A2SA 4PQHA 2H66A 4LLRA 4FYCA 2I1UA 4NV5A 2ZUPA 3H93A 3KXOA 5DVBA 2QA2A 2CVBA 2R0CA 1HQOA 1GRXA 1U3IA 1PQNA 4TR4A 1V57A 5G1KA 4MH3A 4QL7A 3MYDA 4POKA 1N8JA 5CNWA 3LYKA
chains in the Genus database with same CATH topology
1DE2A 3TRPA 4TVEA 2JL4A 4BPYA 4I2TA 5F05A 2B1LA 1FAAA 4PNGA 4ML1A 2HSHA 1XWKA 2F8AA 4FH8A 5A5KA 1X5CA 6GSXA 2JZTA 4GTUA 5F8BA 4QQ7A 3WT2A 3Q6OA 22GSA 3LEFA 3UEMA 5AIVA 2IWTA 1VF4A 4AJ6A 3MSZA 1R4WA 2DJ0A 3KH7A 4G9HA 2JZRA 5GZZB 2KP1A 3RAZA 5KN1A 3ZLPA 1OKTA 4J56E 4PUFC 3CMIA 4CY6A 3DXBA 3IAS2 4ZBAA 4MF7A 1A2MA 4K8MA 1GH2A 1HNAA 3I9V2 4K5RA 2C0EA 3L78A 2O7KA 2CAQA 1WPIA 5DJMA 1FB6A 3MDKA 3WT1A 3OR5A 4JBBA 3H8QA 3G9BA 2DIYA 2K9FA 4WR5A 5LD0A 1PRXA 2R0GA 4CW9A 4IW9A 3FR9A 5CP1A 3ZVJD 5KN2A 3CYNA 3GFKA 2GLRA 2PUKC 3MIXA 1T00A 1DUGA 2ES7A 2CVKA 1TU8A 2CX4A 3A5WA 5FWGA 4V1Ap 3LJRA 4O5UA 1YF0A 3R3EA 4YH2A 2TRXA 1HD2A 2E2MA 3H4KA 4PXOA 1MTCA 4I6XA 1EGOA 2CAIA 5JWOB 1E6BA 1XVWA 4AJ8A 2XBQA 4HJMA 2FNOA 3DVWA 1MD4A 5B8BA 3LW9A 2RM6A 3H79A 3GYKA 2CV4A 1M2BA 2GSSA 1GTAA 3SBCA 4D73A 1JFUA 2D2ZA 1ERVA 4KDYA 1Z6MA 2R0PA 3M8NA 4KDUA 2DJKA 2B5XA 4CY8A 2DBCA 2E2GA 2GQLA 3BJ5A 4I8BA 3ZMKA 1EWXA 1GTUA 2YWIA 2CT6A 4KDXA 3FW2A 1TRVA 2FD3A 2VOCA 4GRFA 1XIYA 1GTIA 2GT5A 3DYRA 4HZ2A 4TR1B 4YKFA 1SKSB 1TI3A 4RI7A 1TU7A 2HSMA 1RK4A 4OCEA 5JCUA 2H6YA 2KUCA 2OBIA 1VF2A 5H5QA 4V2MA 1A2JA 3ZVJA 2JZSA 2PVQA 5ECPB 16GSA 2AHEA 3M1GA 4IVFA 1V98A 3M9KA 4D73B 4F0BA 3HA9A 2DKHA 2EC4A 4BL7A 1ZL9A 2VCVA 1XBSA 2K8SA 4WXTA 1BX9A 4IP6A 4L0WA 6GSWA 4RQRA 1JLWA 2PPTA 2GZYA 4IP1A 5ENUA 2OACA 1OVNA 2FUG2 2UZ8A 5G2ZA 2ON7A 2PMTA 1R5AA 3APSA 4EO3A 1GWCA 3GUSA 3F6DA 5FT3A 5E59A 1FOVA 3KH9A 4HZ4A 4K2DA 3UBKA 1SD9A 3D0ZA 3IBHA 4XS4A 2H0IA 4TR0A 1U88A 2LJRA 4GSTA 3GKXA 4MDCA 4XRAA 2XHFA 4NHWA 1QQ2A 2X64A 1QUWA 2L6CA 4EL1A 3KMNA 5AISA 4MZWA 1SU9A 1GUHA 2DJJA 2JU5A 1QK8A 2XPEA 2O89A 1JZRA 4G0IA 3F4TA 1Z7RA 1K0DA 4RQXA 2MMNA 1A23A 3ISOA 1SYXA 4BL7B 2I4AA 4A5PA 5HR2A 2YV9A 4MCUA 1XCCA 3KD0A 3Q18A 3DEXA 2YOIA 1A0FA 4O5QA 4BA7A 4CHSA 5IO2A 3K8NA 5CRDA 5DALA 3W8SA 3IHQA 4JEDA 2NDOA 3EURA 1GUMA 1XWBA 1LU4A 3CTGA 5HR1A 1ZCPA 3FKFA 5AIXA 2IPAA 4KA0A 1T4ZA 3UMAA 3KTLA 4KE3A 6GSSA 2L5OA 1MDJA 4XS4B 4K0NA 5INYA 2HT9A 2GT6A 1G0TA 3GN3A 5E4WA 1EEMA 1Z9HA 1GSFA 3S9FA 1SJZA 1LBKA 1KTEA 1JZWA 3LXTA 2MMAA 2B5EA 3E0UA 3FR6A 4EE0A 3TJBA 3IC8A 2X49A 3C1RA 4HQZA 2C3TA 2KP2A 1TK0B 4F03A 4F82A 4NXIA 3F8UA 2JSYA 3KJYA 4DEJA 5C00A 4YQUA 3GURA 1QMVA 2QSIA 4IJIA 2PVOC 4QL9A 3ZFLA 18GSA 5DALB 3KCMA 1SK0A 3MAKA 2GTUA 4L0UA 1ILOA 2YN1A 4PTSA 2DIZA 2EIRA 2LRCA 1PD21 3GX8A 4MNNA 1W89A 5ELGA 1EEJA 3HZ4A 3A2XA 3BCKA 3H1NA 2V1MA 2IN3A 3HJMA 4OCFA 2DSAA 5CO3A 3PINA 2WZ9A 1SYRA 2H1GA 4WR4A 4G0LA 2A4VA 4KF9A 4EVMA 2GQKA 5DQYA 1PN9A 4AF2A 1Y6EA 3G7IA 1R5PA 1ERWA 2LSTA 2L57A 3GKNA 4K7NA 1XW9A 3EINA 4RUVA 4PUAA 1JHBA 3GNJA 2V6OA 1Q98A 4BVYA 4JR4A 3GA4A 1GSUA 3LQ7A 3G7JA 4Z2RA 2V6KA 2DMMA 4V2LA 5CRGA 3ZIJA 3L0HA 2VAFA 4KSMA 3ERWA 1LJRA 1WMJA 1K0BA 2VCXA 4MJBA 1GUKA 3ZREA 1FOHA 2I81A 4POLA 5ECIB 1A0RP 2FY6A 2Z9SA 2CZ2A 3FHKA 4EKZA 3KGKA 2VLTA 2G0FA 3RDWA 3HZ8A 1OKDA 1PX6A 2X99A 1GNEA 4K5SA 3EE2A 1X9SB 2FA8A 3F6FA 2OA7A 1IYIA 2BMXA 4POMA 2LRTA 2L6DA 2DJ2A 5J9CA 1MDKA 3KZQA 3TRXA 2HLSA 1E2YA 5B7CA 4E8EA 2DMLA 3VWVA 3DD3A 1M2DA 1WE0A 5DCHA 4HS1A 2MMZA 3ZMLA 4LL4B 4BVYB 1PL1A 1X5EA 4TXOA 7GSSA 2IMEA 4EUYA 1THXA 1BYEA 4L5LA 2MZCA 3GKMA 3SWLA 1TP9A 2VL2A 2GS3A 5F07A 1DBYA 4EC0A 2WB9A 3R2QA 3GL3A 4KSOA 2K8VA 1A8YA 4XRDA 5ECQB 2OADA 3QFBC 1NM3A 5J5NA 19GSA 3A3TA 3DKSA 4MH2A 4BVXA 4O5RA 4PGTA 4OO4A 4TN8A 5CRHA 5D73A 3CSIA 2MBSA 1GTBA 2OE3A 2E7PA 2FWFA 1ERUA 3VURA 2HRNA 1OAZA 3VPTA 4FO5A 1GL8A 2H30A 2OE0A 4TXOB 3EYTA 17GSA 4HJ2A 2C80A 1PN0A 3UOMA 1SKRB 5L71A 4ZILA 1YDKA 4H86A 3DGQA 4TKYA 4OO5A 8GSSA 2N5AA 3TKRA 1BG5A 4MA9A 2WULA 3EU4A 2KOKA 3ED3A 1DE1A 1YJ6A 1K0CA 4EXJA 4OFNA 3ERGA 4FYUA 1PKWA 2H19A 4NAXA 1OYJA 3V1WA 5KOXA 1XW6A 3D22A 1GSDA 2WRTA 2C0DA 5D9XA 2IFQA 4BVXB 13GSA 3RBTA 5IM9A 4TR1A 2ZNMA 2H74A 1F37A 3FYGA 2YWOA 1Y25A 1GSEA 1YQ1A 2GZPA 1ZGNA 3KEBA 1BJXA 2HI7A 1TI1A 1I9DA 3DIEA 3I43A 1DSBA 3NZNA 2LEGA 1T8EB 2AAWA 1EV4A 2FWGA 4WKWA 2B7KA 3FZ4A 4TOPA 4G19A 4HU7A 2L5LA 3GMFA 2LNSA 3UL3A 1XOBA 3EU3A 2ON5A 5HR3A 1B4QA 1YKCA 5IMCA 5HFKA 3EMPA 1ZYQB 1G6WA 3IK7A 2FA4A 4O32A 4KH7A 20GSA 3LFLA 4P3YB 1TTZA 1K0AA 3DWVA 1PA3A 4WBJA 5D93A 2F9SA 3E3EA 3Q19A 3ZIVA 2IJYA 2GSQA 1EOHA 1AUCA 1M2AA 5DAKA 2R6KA 2IFQB 5ID2A 3GX0A 4DSQA 3WGDA 2JADA 2VCZA 3GSSA 2WCIA 2B7JA 3P8WA 1TDIA 1PL2A 5GAPD 1OC9A 2AYTA 2HXKA 5DDLA 2LKUA 1M7TA 5J4UA 4G0KA 2LJKA 4Q5NA 3VPQA 3LORA 3D21A 2P5RA 3L4NA 1O73A 3RHBA 1XXUA 1TOFA 4MJEA 1X5DA 3APQA 3TRQA 1WRYA 5G5EA 3TJKA 2VD0A 4FYBA 4I97A 2H8LA 3D5JA 2VM1A 1BQ7A 2H73A 2FWHA 1MEKA 3FMWA 3GH9A 3KIJA 1GSYA 2LQOA 4EF0A 1ACVA 1Z6NA 2WS2A 4OD7A 3BOAA 4GQFA 3J7Yb 5LNKe 2IIYA 2NVLA 3CRUA 4ZL8A 2YNXA 2AJQB 4WEYA 2A4HA 2C1YA 2N5BA 1X9WB 1AC1A 1ERTA 5DAKB 4WETA 2DKIA 3W6GA 5ID2B 2YPMA 4O7HA 2H01A 1GNWA 3C1SA 3TUEA 3IA1A 4F2IA 5COHA 5DCGA 4HOJA 5CYYA 2EIOA 1PSQA 1QFNA 4JR6A 1SKWB 2O87A 5DBQA 1OC9B 1FW1A 3FEUA 4K1FA 4ACSA 1TRSA 4KUNA 3PR8A 2NBSA 1ZZYA 2HFDA 3ZZXA 4ZL7A 1JLVA 2AUVA 3IK9A 3P2AA 1AAZA 3A5IA 1U3AA 1XOAA 2F3MA 3KMOA 3D4TA 4Z2TA 1QGVA 2R4VA 4K7IA 2VM2A 3HJPA 3F3QA 3EVIA 3IV4A 1HYUA 5FHIA 2WDUA 2YANA 5IMVA 4GSNA 3WGEA 3J7Yk 2C0GA 4K0GA 4WBRD 2K6VA 5ECRB 5A4VA 5ECNB 2O85A 1B8XA 4ZBDA 3VI7A 1K0NA 4Z7XA 3CRTA 2QGVA 3QD9A 3EC3A 3DMLA 4MP4A 3AY8A 2OBKA 3HD5A 4MF5A 4JU5A 4L5OA 1N2AA 5BMUA 1J08A 1UC7A 2H6XA 2IMKA 1TRUA 1WP0A 3UJ1A 3GTUA 1SK2A 4GLTA 2JSZA 2TRCP 3KP9A 5HFIA 2M80A 4HQSA 5LCZA 1SL0B 3IAM2 3D6IA 2AB6A 3G7YA 2RUFA 4DVCA 2WFCA 2N5FA 4O92A 4GWRA 4LL1B 2OE1A 3C7MA 3TKSA 4N11A 2FHEA 2PU9C 9GSSA 1FB0A 1OC3A 5HR0A 2L4CA 4YAPA 3EWLA 2GQMA 1TRWA 4EIPA 4ZB6A 12GSA 1T7PB 4LMWA 3E9JB 1PGTA 4KB3A 4DSRA 4ECCA 3HVVA 3CXGA 4G10A 2HSYA 4V2NA 1KEBA 1V58A 4V1Ag 1PX7A 3ZRDA 4XTSA 3TKQA 4ZBBA 1YEPA 2MBTA 2C0FA 3IDVA 3PGTA 3O76A 4E8HA 4J2FA 3KP8A 14GSA 1A8LA 4KCEA 1B48A 4XS1A 2M72A 2VLVA 3GTUB 2B3SA 1GLQA 3N9JA 2HZFA 3QPMA 1XWGA 4PX1A 6GSUA 3ZFBA 5KOWA 4MMMA 1ZOFA 4OFTA 2NTOA 1G7OA 1VRSD 2YV7A 3MNGA 3UARA 3M3MA 2DC5A 1K3OA 2F8FA 1AW9A 4MF6A 1XVQA 2FWEA 2IL3A 1B4PA 4AGSA 2R5GA 4PNFA 4N0ZA 2V32A 1T1VA 4ECJA 3L9UA 1YY7A 5EPFA 1F3AA 1AXDA 4KCAA 2LTKA 3M0FA 2YWNA 2R3XA 2J23A 2GDRA 3US3A 2RIIA 3A2WA 4IN0A 1XWAA 3TJFA 5ECSA 3UVHA 1MDIA 4N30A 3F4RA 4YQMA 4GCIA 1J0FA 5BRTA 3F9UA 1V9WA 6GSVA 3W8JA 5H5RA 4MZCA 1EP7A 4NV2A 2KHPA 4ILFA 1V2AA 3TKPA 1X0RA 2X8HA 4ID0A 4Q5RA 2GVPA 1AQVA 2LRNA 4JRRA 5IMZA 2O8VB 2MMOA 2CX3A 5C04A 1T3BA 3HY2A 2KLXA 2LV3A 3JCML 1CQGA 4FIWA 3CSHA 3LWAA 1NW2A 4XCSA 3QDNA 1K3YA 5CREA 2H76A 3KTBA 2PBJA 2C3NA 3IE3A 2TIRA 3TOUA 4IHUA 1B9XC 1H75A 3QCPA 4TRXA 4USSA 1RQMA 3GH6A 3N5OA 4YAVA 3F63A 3FZ5A 2MYGA 4GSSA 4X4JA 1SJ6A 3GL5A 4DSSA 4TR3A 4GXZA 3HHVA 3QAGA 2LQQA 5B6NA 3LYPA 2CA8A 3QAVA 4ZL9A 4YKGA 4K2XA 3HVSA 1Z5YE 5H5SA 3ZYWA 3UBLA 3NIVA 4MPFA 5JCGA 1O85A 2A2RA 4MJCA 2I9HA 3GSTA 2FCHA 1KBNA 1V40A 1FVKA 2VUPA 1VF1A 4ICYA 3O6TA 2YJHA 3ZL5A 4RI6A 1BEDA 2VL2C 4MPGA 1ZYEA 1Z7PA 1OC8A 4X1UA 3P7XA 1UA5A 3PPUA 3TJGA 3GIXA 5DQSA 4OWYA 5CAXA 1XPVA 1F6MC 3HVXA 2LS5A 2C4JA 2LUSA 1YEXA 5DJLA 1XZOA 4DSSB 1WWJA 4IJ3A 2H1AA 1GP1A 3EMXA 4WF4A 2XPDA 3LSZA 2JACA 3VK9A 4ECBA 1S3CA 2HRAA 3IR4A 3HCZA 4PURA 5F0GA 1ABAA 1UVZA 1TXXA 1S3AA 4K9ZA 1O6JA 3TGZA 4K6XA 2H6ZA 1SD8A 2ZCTA 3TKSE 1EV9A 4MLYA 4HUAA 1G6YA 5A4WA 3O3TA 3CTFA 2P5QA 2LNTA 2H75A 1I5GA 4PQIA 1SL1B 3LGCA 1O8WA 3F4SA 1ZYNA 5EL8A 4POBA 2X8CA 4N0VA 2FGXA 1YKAA 5KN3A 2P31A 5IMDA 4MJAA 1THOA 3QOUA 4ZB9A 5GSTA 4F0CA 5KEJA 2YZUA 2CQ9A 4I5QA 2YZHA 2HNLA 4Q5FA 4K7OA 3TCOA 2CVDA 3CSJA 2WJUA 5AGYA 1MD3A 4ZIJA 1GLPA 2RUEA 4OFMA 1F3BA 2YJ7A 2E0QA 3C8EA 3IC4A 1X9MB 1W4VA 2REMA 3HYPA 4EDZA 4CDOA 4FQUA 1USBA 3VLNA 1M99A 1AIUA 1VGLA 4IGJA 2IMIA 5F06A 3ZTLA 5IMFA 3BBYA 4ML6A 1TK5B 1ML6A 4HDEA 1XW5A 4HEA2 4IBPA 3C73A 1JZDA 2IMDA 2H1DA 2J9HA 5ECOB 5IPHA 1J9BA 2DJ3A 1AQXA 1ST9A 1A2LA 1Q4JA 3FR3A 3HJOA 1WJKA 1K0OA 3VWUA 1F2EA 1ZYPA 4BWQA 3UVTA 1EOGA 1C72A 4YQVA 1NHYA 1GSQA 1TKDB 3QFAC 3ME7A 5ECKB 4LA1A 2AV4A 5G1LA 5B6MA 4ECIA 3RHCA 1T4YA 3BD2A 2R37A 1URMA 3VWWA 5HQPA 1B9YC 2ALBA 3ERFA 1O8XA 5AN1A 2P0GA 4X0XA 5IOWA 2HE3A 4XS6A 3QMXA 4Z2UA 3UAPA 4IELA 3IXRA 4PQ1A 2X4AA 1HNBA 4EIQA 5ECMB 4N10A 4WF5A 1SL2B 2VCTA 1K0MA 1PKZA 4G2EA 1FG4A 4MZBA 2B5YA 1SJIA 5D9WA 4OMVA 3F3RA 1F9MA 2R2JA 2NPBA 1HNCA 1K3LA 5KN0A 1TW9A 4BWSA 2IMFA 2PERA 1VF3A 1U87A 1A24A 4NPBA 5JWQB 2B1KA 2OJLA 2VD1A 4ULXA 2VL3A 1M9BA 4NHZA 2GZZA 3GRXA 1OE7A 3P90A 1UN2A 4IKHA 3L9SA 6GSTA 5D9VA 4IS0A 1IYHA 2HZEA 4F9ZA 1GULA 3F0IA 1ON4A 2YP6A 4I2UA 2L59A 1WOUA 5J3RA 4IQ1A 3I69A 2GSTA 5JCWA 2VLUA 5D9TA 3VWXA 2M46A 3NOFA 3TJJA 5ECHB 2WGRA 2HYXA 2PGTA 2QKEA 3IRAA 2A2PA 3TB2A 4IQAA 3D4MA 5A4UA 2V41A 3FZ9A 5CRWA 5B8AA 3HXSA 4KAEA 3M9JA 3UIWA 2DLXA 1EGRA 4AJ7A 3U5RE 2B6MA 5HFGA 2VIMA 1H4OA 2XBIA 5IPGA 1Z3EA 2HRKA 1EZKA 3DVXA 4X43A 3QAWA 3BCIA 2H1BA 1BAYA 4NWYA 4TW5A 4XIHA 3GV1A 5ABRA 5EY6A 4ZXGA 2CZ3A 2OKAA 1TJDA 3I6AA 1GSSA 5D8IA 1CQHA 2VCQA 4Q5QA 3WGXA 2HZEB 2YWMA 5ELAA 1G7EA 1O81A 3GKKA 1KNGA 1RW1A 3HKRA 3A2VA 1U6TA 3FY7A 4HI7A 4JZQA 2C8UA 2EIQA 5GAND 10GSA 1OE8A 3HDCA 1EP8A 3WYWA 3QR6A 3C71A 5G5FA 2RLIA 2XC2A 3CBUA 4LMVA 2PN8A 1YZXA 5IQYA 3VI5A 3TKSC 11GSA 2HRFA 3PH9A 2LJAA 1SENA 3VFIA 4KX4A 2DJ1A 4KGIA 5ECLB 3APOA 3WD6A 4MK3A 2FLSA 4ZB8A 2H72A 1PMTA 3GHAA 3KM6A 4J57E 5IOXA 1YF1A 3FRCA 3ME8A 1ZMAA 1TK8B 2GSRA 2H71A 4KW6A 3TOTA 2QA1A 1FO5A 2I3YA 1WIKA 2VL9A 2K18A 3IHGA 3MWHA 1FVJA 5JWRB 1R7HA 3FZAA 3TDGA 4ISDA 1FHEA 5J41A 1M9AA 4KNDA 4NMUA 4EDYA 5GSSA 5G30A 5IIZA 1S3DA 4MABA 3IOSA 2H0HA 1R26A 2L4QA 2VO4A 2X8GA 2QC7A 5IO0A 5J9BA 2YCDA 3ZITA 2V2GA 1M0UA 1O7UA 1XFLA 2F51A 1JZOA 4L8EA 1AQWA 2G2QA 4HU9A 1NHOA 1SK1A 2PWJA 4TXVA 5D96A 4JE1A 2BJXA 3LG6A 3DRNA 2VCWA 1XWCA 4GF0A 3FK8A 3IPZA 6GSYA 3Q74A 2C3QA 2H0GA 4XHMA 1QXHA 3LXZA 5G31A 5IMAA 2H70A 1NSWA 4GQCA 3L9VA 2RM5A 2GGTA 3RPNA 2BTOT 3EPTA 3RPPA 3U6VA 5EVOA 2A2SA 4PQHA 2H66A 4LLRA 4FYCA 2I1UA 4NV5A 2ZUPA 3H93A 3KXOA 5DVBA 2QA2A 2CVBA 2R0CA 1HQOA 1GRXA 1U3IA 1PQNA 4TR4A 1V57A 5G1KA 4MH3A 4QL7A 3MYDA 4POKA 1N8JA 5CNWA 3LYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DE2 A;  3TRP A;  4TVE A;  2JL4 A;  4BPY A;  4I2T A;  5F05 A;  2B1L A;  1FAA A;  4PNG A;  4ML1 A;  2HSH A;  1XWK A;  2F8A A;  4FH8 A;  5A5K A;  1X5C A;  6GSX A;  2JZT A;  4GTU A;  5F8B A;  4QQ7 A;  3WT2 A;  3Q6O A;  22GS A;  3LEF A;  3UEM A;  5AIV A;  2IWT A;  1VF4 A;  4AJ6 A;  3MSZ A;  1R4W A;  2DJ0 A;  3KH7 A;  4G9H A;  2JZR A;  5GZZ B;  2KP1 A;  3RAZ A;  5KN1 A;  3ZLP A;  1OKT A;  4J56 E;  4PUF C;  3CMI A;  3DXB A;  3IAS 2;  4ZBA A;  4MF7 A;  1A2M A;  4K8M A;  1GH2 A;  1HNA A;  3I9V 2;  2C0E A;  3L78 A;  2O7K A;  2CAQ A;  1WPI A;  5DJM A;  1FB6 A;  3MDK A;  3WT1 A;  3OR5 A;  4JBB A;  3H8Q A;  3G9B A;  2DIY A;  2K9F A;  4WR5 A;  5LD0 A;  1PRX A;  4CW9 A;  4IW9 A;  3FR9 A;  5CP1 A;  3ZVJ D;  5KN2 A;  3CYN A;  3GFK A;  2GLR A;  2PUK C;  1T00 A;  1DUG A;  2ES7 A;  2CVK A;  1TU8 A;  2CX4 A;  3A5W A;  5FWG A;  4V1A p;  3LJR A;  1YF0 A;  4YH2 A;  2TRX A;  1HD2 A;  2E2M A;  3H4K A;  4PXO A;  1MTC A;  4I6X A;  1EGO A;  2CAI A;  5JWO B;  1E6B A;  1XVW A;  4AJ8 A;  2XBQ A;  4HJM A;  2FNO A;  3DVW A;  1MD4 A;  5B8B A;  2RM6 A;  3H79 A;  3GYK A;  2CV4 A;  1M2B A;  2GSS A;  1GTA A;  3SBC A;  4D73 A;  1JFU A;  2D2Z A;  1ERV A;  4KDY A;  1Z6M A;  3M8N A;  4KDU A;  2DJK A;  2B5X A;  2DBC A;  2E2G A;  2GQL A;  3BJ5 A;  4I8B A;  3ZMK A;  1EWX A;  1GTU A;  2YWI A;  2CT6 A;  4KDX A;  3FW2 A;  1TRV A;  2FD3 A;  2VOC A;  4GRF A;  1XIY A;  1GTI A;  2GT5 A;  3DYR A;  4HZ2 A;  4TR1 B;  1SKS B;  1TI3 A;  4RI7 A;  1TU7 A;  1RK4 A;  4OCE A;  5JCU A;  2H6Y A;  2KUC A;  2OBI A;  1VF2 A;  5H5Q A;  4V2M A;  1A2J A;  3ZVJ A;  2JZS A;  2PVQ A;  5ECP B;  16GS A;  2AHE A;  3M1G A;  4IVF A;  1V98 A;  3M9K A;  4D73 B;  4F0B A;  3HA9 A;  2EC4 A;  4BL7 A;  1ZL9 A;  2VCV A;  1XBS A;  2K8S A;  4WXT A;  1BX9 A;  4IP6 A;  4L0W A;  6GSW A;  4RQR A;  1JLW A;  2PPT A;  2GZY A;  4IP1 A;  5ENU A;  2OAC A;  1OVN A;  2FUG 2;  5G2Z A;  2ON7 A;  2PMT A;  1R5A A;  3APS A;  4EO3 A;  1GWC A;  3GUS A;  3F6D A;  5FT3 A;  5E59 A;  1FOV A;  3KH9 A;  4HZ4 A;  4K2D A;  3UBK A;  1SD9 A;  3D0Z A;  3IBH A;  4XS4 A;  2H0I A;  4TR0 A;  1U88 A;  2LJR A;  4GST A;  3GKX A;  4MDC A;  4XRA A;  2XHF A;  4NHW A;  1QQ2 A;  2X64 A;  1QUW A;  2L6C A;  4EL1 A;  3KMN A;  5AIS A;  4MZW A;  1SU9 A;  1GUH A;  2DJJ A;  2JU5 A;  1QK8 A;  2XPE A;  2O89 A;  1JZR A;  3F4T A;  1Z7R A;  1K0D A;  4RQX A;  2MMN A;  1A23 A;  3ISO A;  1SYX A;  2I4A A;  5HR2 A;  2YV9 A;  4MCU A;  1XCC A;  3KD0 A;  3Q18 A;  3DEX A;  2YOI A;  1A0F A;  4BA7 A;  4CHS A;  5IO2 A;  3K8N A;  5CRD A;  5DAL A;  3W8S A;  3IHQ A;  4JED A;  2NDO A;  3EUR A;  1GUM A;  1XWB A;  1LU4 A;  3CTG A;  5HR1 A;  1ZCP A;  3FKF A;  5AIX A;  2IPA A;  4KA0 A;  1T4Z A;  3UMA A;  3KTL A;  4KE3 A;  6GSS A;  2L5O A;  1MDJ A;  4XS4 B;  4K0N A;  5INY A;  2HT9 A;  2GT6 A;  1G0T A;  3GN3 A;  5E4W A;  1EEM A;  1Z9H A;  1GSF A;  3S9F A;  1SJZ A;  1LBK A;  1KTE A;  1JZW A;  3LXT A;  2MMA A;  2B5E A;  3E0U A;  3FR6 A;  4EE0 A;  3TJB A;  3C1R A;  4HQZ A;  2C3T A;  2KP2 A;  1TK0 B;  4F03 A;  4F82 A;  4NXI A;  3F8U A;  2JSY A;  3KJY A;  4DEJ A;  5C00 A;  4YQU A;  3GUR A;  1QMV A;  2QSI A;  4IJI A;  2PVO C;  4QL9 A;  3ZFL A;  18GS A;  5DAL B;  3KCM A;  1SK0 A;  3MAK A;  2GTU A;  4L0U A;  1ILO A;  2YN1 A;  2DIZ A;  2EIR A;  2LRC A;  1PD2 1;  3GX8 A;  1W89 A;  5ELG A;  1EEJ A;  3HZ4 A;  3A2X A;  3BCK A;  3H1N A;  2V1M A;  2IN3 A;  3HJM A;  4OCF A;  2DSA A;  5CO3 A;  3PIN A;  2WZ9 A;  1SYR A;  2H1G A;  4WR4 A;  2A4V A;  4EVM A;  2GQK A;  5DQY A;  1PN9 A;  4AF2 A;  1Y6E A;  3G7I A;  1R5P A;  1ERW A;  2LST A;  2L57 A;  3GKN A;  4K7N A;  1XW9 A;  3EIN A;  4RUV A;  4PUA A;  1JHB A;  3GNJ A;  2V6O A;  1Q98 A;  4BVY A;  4JR4 A;  3GA4 A;  1GSU A;  3LQ7 A;  3G7J A;  2V6K A;  2DMM A;  4V2L A;  5CRG A;  3ZIJ A;  3L0H A;  2VAF A;  4KSM A;  3ERW A;  1LJR A;  1WMJ A;  1K0B A;  2VCX A;  4MJB A;  1GUK A;  3ZRE A;  2I81 A;  4POL A;  5ECI B;  1A0R P;  2FY6 A;  2Z9S A;  2CZ2 A;  3FHK A;  4EKZ A;  3KGK A;  2VLT A;  2G0F A;  3RDW A;  3HZ8 A;  1OKD A;  1PX6 A;  2X99 A;  1GNE A;  3EE2 A;  1X9S B;  2FA8 A;  3F6F A;  2OA7 A;  1IYI A;  2BMX A;  4POM A;  2LRT A;  2L6D A;  2DJ2 A;  5J9C A;  1MDK A;  3KZQ A;  3TRX A;  2HLS A;  1E2Y A;  5B7C A;  4E8E A;  2DML A;  3VWV A;  3DD3 A;  1M2D A;  1WE0 A;  5DCH A;  4HS1 A;  2MMZ A;  3ZML A;  4LL4 B;  1PL1 A;  1X5E A;  4TXO A;  7GSS A;  2IME A;  4EUY A;  1THX A;  1BYE A;  4L5L A;  2MZC A;  3GKM A;  3SWL A;  1TP9 A;  2VL2 A;  2GS3 A;  5F07 A;  1DBY A;  4EC0 A;  2WB9 A;  3R2Q A;  3GL3 A;  4KSO A;  2K8V A;  1A8Y A;  5ECQ B;  4XRD A;  2OAD A;  3QFB C;  1NM3 A;  5J5N A;  19GS A;  3A3T A;  3DKS A;  4MH2 A;  4BVX A;  4O5R A;  4PGT A;  4OO4 A;  4TN8 A;  5CRH A;  5D73 A;  3CSI A;  2MBS A;  1GTB A;  2OE3 A;  2E7P A;  2FWF A;  1ERU A;  3VUR A;  2HRN A;  1OAZ A;  3VPT A;  4FO5 A;  1GL8 A;  2H30 A;  2OE0 A;  4TXO B;  3EYT A;  17GS A;  4HJ2 A;  2C80 A;  3UOM A;  1SKR B;  5L71 A;  4ZIL A;  1YDK A;  4H86 A;  3DGQ A;  4TKY A;  4OO5 A;  8GSS A;  2N5A A;  3TKR A;  1BG5 A;  4MA9 A;  2WUL A;  3EU4 A;  2KOK A;  3ED3 A;  1DE1 A;  1YJ6 A;  1K0C A;  4EXJ A;  4OFN A;  3ERG A;  4FYU A;  1PKW A;  2H19 A;  4NAX A;  1OYJ A;  3V1W A;  1XW6 A;  3D22 A;  1GSD A;  2WRT A;  2C0D A;  5D9X A;  2IFQ A;  13GS A;  3RBT A;  5IM9 A;  4TR1 A;  2ZNM A;  2H74 A;  1F37 A;  3FYG A;  2YWO A;  1Y25 A;  1GSE A;  1YQ1 A;  2GZP A;  1ZGN A;  3KEB A;  1BJX A;  2HI7 A;  1TI1 A;  1I9D A;  3DIE A;  3I43 A;  1DSB A;  3NZN A;  2LEG A;  1T8E B;  2AAW A;  1EV4 A;  2FWG A;  4WKW A;  2B7K A;  3FZ4 A;  4TOP A;  4G19 A;  4HU7 A;  2L5L A;  3GMF A;  2LNS A;  3UL3 A;  1XOB A;  3EU3 A;  2ON5 A;  5HR3 A;  1B4Q A;  1YKC A;  5IMC A;  5HFK A;  3EMP A;  1ZYQ B;  1G6W A;  3IK7 A;  2FA4 A;  4O32 A;  4KH7 A;  20GS A;  3LFL A;  4P3Y B;  1TTZ A;  1K0A A;  3DWV A;  1PA3 A;  4WBJ A;  5D93 A;  2F9S A;  3E3E A;  3Q19 A;  3ZIV A;  2IJY A;  2GSQ A;  1EOH A;  1AUC A;  1M2A A;  5DAK A;  2R6K A;  2IFQ B;  5ID2 A;  3GX0 A;  4DSQ A;  3WGD A;  2JAD A;  2VCZ A;  3GSS A;  2WCI A;  2B7J A;  3P8W A;  1TDI A;  1PL2 A;  5GAP D;  1OC9 A;  2AYT A;  2HXK A;  5DDL A;  2LKU A;  1M7T A;  5J4U A;  2LJK A;  4Q5N A;  3VPQ A;  3LOR A;  3D21 A;  2P5R A;  3L4N A;  1O73 A;  3RHB A;  1XXU A;  1TOF A;  4MJE A;  1X5D A;  3APQ A;  3TRQ A;  1WRY A;  5G5E A;  3TJK A;  2VD0 A;  4FYB A;  4I97 A;  2H8L A;  3D5J A;  2VM1 A;  1BQ7 A;  2H73 A;  2FWH A;  1MEK A;  3GH9 A;  3KIJ A;  1GSY A;  2LQO A;  4EF0 A;  1ACV A;  1Z6N A;  2WS2 A;  4OD7 A;  3BOA A;  4GQF A;  3J7Y b;  5LNK e;  2IIY A;  2NVL A;  3CRU A;  4ZL8 A;  2YNX A;  2AJQ B;  4WEY A;  2C1Y A;  2N5B A;  1X9W B;  1AC1 A;  1ERT A;  5DAK B;  4WET A;  3W6G A;  5ID2 B;  2YPM A;  4O7H A;  2H01 A;  1GNW A;  3C1S A;  3TUE A;  3IA1 A;  4F2I A;  5COH A;  5DCG A;  4HOJ A;  5CYY A;  2EIO A;  1PSQ A;  1QFN A;  4JR6 A;  1SKW B;  2O87 A;  5DBQ A;  1OC9 B;  1FW1 A;  3FEU A;  4K1F A;  4ACS A;  1TRS A;  4KUN A;  3PR8 A;  2NBS A;  1ZZY A;  2HFD A;  3ZZX A;  4ZL7 A;  1JLV A;  2AUV A;  3IK9 A;  3P2A A;  1AAZ A;  1U3A A;  1XOA A;  2F3M A;  3KMO A;  3D4T A;  1QGV A;  2R4V A;  4K7I A;  2VM2 A;  3HJP A;  3F3Q A;  3EVI A;  3IV4 A;  1HYU A;  5FHI A;  2WDU A;  2YAN A;  5IMV A;  4GSN A;  3WGE A;  3J7Y k;  2C0G A;  4K0G A;  4WBR D;  2K6V A;  5ECR B;  5A4V A;  5ECN B;  2O85 A;  1B8X A;  4ZBD A;  3VI7 A;  1K0N A;  4Z7X A;  3CRT A;  2QGV A;  3QD9 A;  3EC3 A;  3DML A;  4MP4 A;  3AY8 A;  2OBK A;  3HD5 A;  4MF5 A;  4JU5 A;  4L5O A;  1N2A A;  1J08 A;  1UC7 A;  2H6X A;  2IMK A;  1TRU A;  1WP0 A;  3UJ1 A;  3GTU A;  1SK2 A;  4GLT A;  2JSZ A;  2TRC P;  3KP9 A;  5HFI A;  2M80 A;  4HQS A;  5LCZ A;  1SL0 B;  3IAM 2;  3D6I A;  2AB6 A;  3G7Y A;  2RUF A;  4DVC A;  2WFC A;  2N5F A;  4O92 A;  4GWR A;  4LL1 B;  2OE1 A;  3C7M A;  3TKS A;  4N11 A;  2FHE A;  2PU9 C;  9GSS A;  1FB0 A;  1OC3 A;  5HR0 A;  2L4C A;  4YAP A;  3EWL A;  2GQM A;  1TRW A;  4ZB6 A;  12GS A;  1T7P B;  4LMW A;  3E9J B;  1PGT A;  4KB3 A;  4DSR A;  4ECC A;  3HVV A;  3CXG A;  4G10 A;  2HSY A;  4V2N A;  1KEB A;  1V58 A;  4V1A g;  1PX7 A;  3ZRD A;  4XTS A;  3TKQ A;  4ZBB A;  1YEP A;  2MBT A;  2C0F A;  3IDV A;  3PGT A;  3O76 A;  4E8H A;  4J2F A;  3KP8 A;  14GS A;  1A8L A;  4KCE A;  1B48 A;  4XS1 A;  2M72 A;  2VLV A;  3GTU B;  2B3S A;  1GLQ A;  3N9J A;  2HZF A;  3QPM A;  1XWG A;  4PX1 A;  6GSU A;  3ZFB A;  4MMM A;  1ZOF A;  4OFT A;  2NTO A;  1G7O A;  1VRS D;  2YV7 A;  3MNG A;  3UAR A;  3M3M A;  2DC5 A;  1K3O A;  2F8F A;  1AW9 A;  4MF6 A;  1XVQ A;  2FWE A;  2IL3 A;  1B4P A;  4AGS A;  2R5G A;  4PNF A;  4N0Z A;  2V32 A;  1T1V A;  4ECJ A;  3L9U A;  1YY7 A;  5EPF A;  1F3A A;  1AXD A;  4KCA A;  2LTK A;  3M0F A;  2YWN A;  2R3X A;  2J23 A;  2GDR A;  3US3 A;  2RII A;  3A2W A;  4IN0 A;  1XWA A;  3TJF A;  5ECS A;  3UVH A;  1MDI A;  4N30 A;  3F4R A;  4YQM A;  4GCI A;  1J0F A;  3F9U A;  1V9W A;  6GSV A;  3W8J A;  5H5R A;  4MZC A;  1EP7 A;  4NV2 A;  2KHP A;  4ILF A;  1V2A A;  3TKP A;  1X0R A;  2X8H A;  4ID0 A;  4Q5R A;  2GVP A;  1AQV A;  2LRN A;  4JRR A;  5IMZ A;  2O8V B;  2MMO A;  2CX3 A;  5C04 A;  1T3B A;  3HY2 A;  2KLX A;  2LV3 A;  3JCM L;  1CQG A;  4FIW A;  3CSH A;  3LWA A;  1NW2 A;  4XCS A;  3QDN A;  1K3Y A;  5CRE A;  2H76 A;  3KTB A;  2PBJ A;  2C3N A;  3IE3 A;  2TIR A;  3TOU A;  4IHU A;  1B9X C;  1H75 A;  3QCP A;  4TRX A;  1RQM A;  3GH6 A;  3N5O A;  4YAV A;  3F63 A;  3FZ5 A;  2MYG A;  4GSS A;  1SJ6 A;  3GL5 A;  4DSS A;  4TR3 A;  4GXZ A;  3HHV A;  3QAG A;  2LQQ A;  5B6N A;  3LYP A;  2CA8 A;  3QAV A;  4ZL9 A;  3HVS A;  1Z5Y E;  5H5S A;  3ZYW A;  3UBL A;  3NIV A;  4MPF A;  5JCG A;  1O85 A;  2A2R A;  4MJC A;  2I9H A;  3GST A;  2FCH A;  1KBN A;  1V40 A;  1FVK A;  2VUP A;  1VF1 A;  3O6T A;  2YJH A;  3ZL5 A;  4RI6 A;  1BED A;  2VL2 C;  4MPG A;  1ZYE A;  1Z7P A;  1OC8 A;  4X1U A;  3P7X A;  1UA5 A;  3TJG A;  3GIX A;  5DQS A;  4OWY A;  5CAX A;  1XPV A;  1F6M C;  3HVX A;  2LS5 A;  2C4J A;  2LUS A;  1YEX A;  5DJL A;  1XZO A;  4DSS B;  1WWJ A;  4IJ3 A;  2H1A A;  1GP1 A;  3EMX A;  4WF4 A;  2XPD A;  3LSZ A;  2JAC A;  3VK9 A;  4ECB A;  1S3C A;  3IR4 A;  3HCZ A;  4PUR A;  5F0G A;  1ABA A;  1UVZ A;  1TXX A;  1S3A A;  4K9Z A;  1O6J A;  3TGZ A;  4K6X A;  2H6Z A;  1SD8 A;  2ZCT A;  3TKS E;  1EV9 A;  4MLY A;  4HUA A;  1G6Y A;  5A4W A;  3O3T A;  3CTF A;  2P5Q A;  2LNT A;  2H75 A;  1I5G A;  4PQI A;  1SL1 B;  3LGC A;  1O8W A;  3F4S A;  5EL8 A;  4POB A;  2X8C A;  4N0V A;  2FGX A;  1YKA A;  5KN3 A;  2P31 A;  5IMD A;  4MJA A;  1THO A;  3QOU A;  4ZB9 A;  5GST A;  4F0C A;  5KEJ A;  2YZU A;  2CQ9 A;  4I5Q A;  2YZH A;  2HNL A;  4Q5F A;  4K7O A;  3TCO A;  2CVD A;  3CSJ A;  2WJU A;  5AGY A;  1MD3 A;  4ZIJ A;  1GLP A;  2RUE A;  4OFM A;  1F3B A;  2YJ7 A;  2E0Q A;  3C8E A;  3IC4 A;  1X9M B;  1W4V A;  2REM A;  3HYP A;  4EDZ A;  4CDO A;  1USB A;  3VLN A;  1M99 A;  1AIU A;  1VGL A;  4IGJ A;  2IMI A;  5F06 A;  3ZTL A;  5IMF A;  3BBY A;  4ML6 A;  1TK5 B;  1ML6 A;  4HDE A;  1XW5 A;  4HEA 2;  4IBP A;  3C73 A;  1JZD A;  2IMD A;  2H1D A;  2J9H A;  5ECO B;  5IPH A;  1J9B A;  2DJ3 A;  1AQX A;  1ST9 A;  1A2L A;  1Q4J A;  3FR3 A;  3HJO A;  1WJK A;  1K0O A;  3VWU A;  1F2E A;  4BWQ A;  3UVT A;  1EOG A;  1C72 A;  4YQV A;  1NHY A;  1GSQ A;  1TKD B;  3QFA C;  3ME7 A;  5ECK B;  4LA1 A;  2AV4 A;  5G1L A;  5B6M A;  4ECI A;  3RHC A;  1T4Y A;  3BD2 A;  2R37 A;  1URM A;  3VWW A;  5HQP A;  1B9Y C;  2ALB A;  3ERF A;  1O8X A;  5AN1 A;  2P0G A;  4X0X A;  5IOW A;  2HE3 A;  4XS6 A;  3QMX A;  3UAP A;  4IEL A;  3IXR A;  4PQ1 A;  1HNB A;  5ECM B;  4N10 A;  4WF5 A;  1SL2 B;  2VCT A;  1K0M A;  1PKZ A;  4G2E A;  1FG4 A;  4MZB A;  2B5Y A;  1SJI A;  5D9W A;  4OMV A;  3F3R A;  1F9M A;  2R2J A;  2NPB A;  1HNC A;  1K3L A;  5KN0 A;  1TW9 A;  4BWS A;  2IMF A;  2PER A;  1VF3 A;  1U87 A;  1A24 A;  4NPB A;  5JWQ B;  2B1K A;  2OJL A;  2VD1 A;  4ULX A;  2VL3 A;  1M9B A;  4NHZ A;  2GZZ A;  3GRX A;  1OE7 A;  3P90 A;  1UN2 A;  4IKH A;  3L9S A;  6GST A;  5D9V A;  4IS0 A;  1IYH A;  2HZE A;  4F9Z A;  1GUL A;  3F0I A;  1ON4 A;  2YP6 A;  4I2U A;  2L59 A;  1WOU A;  5J3R A;  4IQ1 A;  3I69 A;  2GST A;  5JCW A;  2VLU A;  5D9T A;  3VWX A;  2M46 A;  3NOF A;  3TJJ A;  5ECH B;  2WGR A;  2HYX A;  2PGT A;  2QKE A;  3IRA A;  3TB2 A;  4IQA A;  3D4M A;  5A4U A;  2V41 A;  3FZ9 A;  5CRW A;  5B8A A;  3HXS A;  4KAE A;  3M9J A;  3UIW A;  2DLX A;  1EGR A;  4AJ7 A;  3U5R E;  2B6M A;  5HFG A;  2VIM A;  1H4O A;  2XBI A;  5IPG A;  1Z3E A;  1EZK A;  3DVX A;  4X43 A;  3QAW A;  3BCI A;  2H1B A;  1BAY A;  4NWY A;  4TW5 A;  4XIH A;  3GV1 A;  5ABR A;  5EY6 A;  4ZXG A;  2CZ3 A;  2OKA A;  1TJD A;  3I6A A;  1GSS A;  5D8I A;  1CQH A;  2VCQ A;  4Q5Q A;  3WGX A;  2HZE B;  2YWM A;  5ELA A;  1G7E A;  1O81 A;  3GKK A;  1KNG A;  1RW1 A;  3HKR A;  3A2V A;  1U6T A;  3FY7 A;  4HI7 A;  4JZQ A;  2C8U A;  2EIQ A;  5GAN D;  10GS A;  1OE8 A;  3HDC A;  1EP8 A;  3WYW A;  3QR6 A;  3C71 A;  5G5F A;  2RLI A;  2XC2 A;  3CBU A;  4LMV A;  2PN8 A;  1YZX A;  5IQY A;  3VI5 A;  3TKS C;  11GS A;  2HRF A;  3PH9 A;  2LJA A;  1SEN A;  3VFI A;  4KX4 A;  2DJ1 A;  4KGI A;  5ECL B;  3APO A;  3WD6 A;  4MK3 A;  2FLS A;  4ZB8 A;  2H72 A;  1PMT A;  3GHA A;  3KM6 A;  4J57 E;  5IOX A;  1YF1 A;  3FRC A;  3ME8 A;  1ZMA A;  1TK8 B;  2GSR A;  2H71 A;  4KW6 A;  3TOT A;  1FO5 A;  2I3Y A;  1WIK A;  2VL9 A;  2K18 A;  3MWH A;  1FVJ A;  5JWR B;  1R7H A;  3FZA A;  3TDG A;  4ISD A;  1FHE A;  5J41 A;  1M9A A;  4KND A;  4NMU A;  4EDY A;  5GSS A;  5G30 A;  5IIZ A;  1S3D A;  4MAB A;  3IOS A;  2H0H A;  1R26 A;  2L4Q A;  2VO4 A;  2X8G A;  2QC7 A;  5IO0 A;  5J9B A;  2YCD A;  3ZIT A;  2V2G A;  1M0U A;  1O7U A;  1XFL A;  2F51 A;  1JZO A;  4L8E A;  1AQW A;  2G2Q A;  4HU9 A;  1NHO A;  1SK1 A;  2PWJ A;  4TXV A;  5D96 A;  4JE1 A;  2BJX A;  3LG6 A;  3DRN A;  2VCW A;  1XWC A;  4GF0 A;  3FK8 A;  3IPZ A;  6GSY A;  3Q74 A;  2C3Q A;  2H0G A;  4XHM A;  1QXH A;  3LXZ A;  5G31 A;  5IMA A;  2H70 A;  1NSW A;  4GQC A;  3L9V A;  2RM5 A;  2GGT A;  3RPN A;  2BTO T;  3RPP A;  3U6V A;  5EVO A;  2A2S A;  4PQH A;  2H66 A;  4LLR A;  4FYC A;  2I1U A;  4NV5 A;  2ZUP A;  3H93 A;  3KXO A;  5DVB A;  2CVB A;  1HQO A;  1GRX A;  1U3I A;  1PQN A;  4TR4 A;  1V57 A;  5G1K A;  4MH3 A;  4QL7 A;  4POK A;  1N8J A;  5CNW A;  3LYK A; 
#chains in the Genus database with same CATH topology
 1DE2 A;  3TRP A;  4TVE A;  2JL4 A;  4BPY A;  4I2T A;  5F05 A;  2B1L A;  1FAA A;  4PNG A;  4ML1 A;  2HSH A;  1XWK A;  2F8A A;  4FH8 A;  5A5K A;  1X5C A;  6GSX A;  2JZT A;  4GTU A;  5F8B A;  4QQ7 A;  3WT2 A;  3Q6O A;  22GS A;  3LEF A;  3UEM A;  5AIV A;  2IWT A;  1VF4 A;  4AJ6 A;  3MSZ A;  1R4W A;  2DJ0 A;  3KH7 A;  4G9H A;  2JZR A;  5GZZ B;  4BIK A;  2KP1 A;  3RAZ A;  5KN1 A;  3ZLP A;  1OKT A;  4J56 E;  4PUF C;  3CMI A;  4CY6 A;  3DXB A;  3IAS 2;  4ZBA A;  4MF7 A;  1A2M A;  4K8M A;  1GH2 A;  1HNA A;  3I9V 2;  4K5R A;  2C0E A;  3L78 A;  2O7K A;  2CAQ A;  1WPI A;  5DJM A;  1FB6 A;  3MDK A;  3WT1 A;  3OR5 A;  4JBB A;  3H8Q A;  3G9B A;  2DIY A;  2K9F A;  4WR5 A;  5LD0 A;  1PRX A;  2R0G A;  4CW9 A;  4IW9 A;  3FR9 A;  5CP1 A;  3ZVJ D;  5KN2 A;  3CYN A;  3GFK A;  2GLR A;  2PUK C;  3MIX A;  1T00 A;  1DUG A;  2ES7 A;  2CVK A;  1TU8 A;  2CX4 A;  3A5W A;  5FWG A;  4V1A p;  3LJR A;  4O5U A;  1YF0 A;  3R3E A;  4YH2 A;  2TRX A;  1HD2 A;  2E2M A;  3H4K A;  4PXO A;  1MTC A;  4I6X A;  1EGO A;  2CAI A;  5JWO B;  1E6B A;  1XVW A;  4AJ8 A;  2XBQ A;  4HJM A;  2FNO A;  3DVW A;  1MD4 A;  5B8B A;  3LW9 A;  2RM6 A;  3H79 A;  3GYK A;  2CV4 A;  1M2B A;  2GSS A;  1GTA A;  3SBC A;  4D73 A;  1JFU A;  2D2Z A;  1ERV A;  4KDY A;  1Z6M A;  2R0P A;  3M8N A;  4KDU A;  2DJK A;  2B5X A;  4CY8 A;  2DBC A;  2E2G A;  2GQL A;  3BJ5 A;  4I8B A;  3ZMK A;  1EWX A;  3CQF A;  1GTU A;  2YWI A;  2CT6 A;  4KDX A;  3FW2 A;  1TRV A;  2FD3 A;  2VOC A;  4GRF A;  1XIY A;  1GTI A;  2GT5 A;  3DYR A;  4HZ2 A;  4TR1 B;  4YKF A;  1SKS B;  1TI3 A;  4RI7 A;  1TU7 A;  2HSM A;  1RK4 A;  4OCE A;  5JCU A;  2H6Y A;  2KUC A;  2OBI A;  1VF2 A;  5H5Q A;  4V2M A;  1A2J A;  3ZVJ A;  2JZS A;  2PVQ A;  5ECP B;  16GS A;  2AHE A;  3M1G A;  4IVF A;  1V98 A;  3M9K A;  4D73 B;  4F0B A;  3HA9 A;  2DKH A;  2EC4 A;  4BL7 A;  1ZL9 A;  2VCV A;  1XBS A;  2K8S A;  4WXT A;  1BX9 A;  4IP6 A;  4L0W A;  6GSW A;  4RQR A;  1JLW A;  2PPT A;  2GZY A;  4IP1 A;  5ENU A;  2OAC A;  1OVN A;  2FUG 2;  2UZ8 A;  5G2Z A;  2ON7 A;  2PMT A;  1R5A A;  3APS A;  4EO3 A;  1GWC A;  3GUS A;  3F6D A;  5FT3 A;  5E59 A;  1FOV A;  3KH9 A;  4HZ4 A;  4K2D A;  3UBK A;  1SD9 A;  3D0Z A;  3IBH A;  4XS4 A;  2H0I A;  4TR0 A;  1U88 A;  2LJR A;  4GST A;  3GKX A;  4MDC A;  4XRA A;  2XHF A;  4NHW A;  1QQ2 A;  2X64 A;  1QUW A;  2L6C A;  4EL1 A;  3KMN A;  5AIS A;  4MZW A;  1SU9 A;  1GUH A;  2DJJ A;  2JU5 A;  1QK8 A;  2XPE A;  2O89 A;  1JZR A;  4G0I A;  3F4T A;  1Z7R A;  1K0D A;  4RQX A;  2MMN A;  1A23 A;  3ISO A;  1SYX A;  4BL7 B;  2I4A A;  4A5P A;  5HR2 A;  2YV9 A;  4MCU A;  1XCC A;  3KD0 A;  3Q18 A;  3DEX A;  2YOI A;  1A0F A;  4O5Q A;  4BA7 A;  4CHS A;  5IO2 A;  3K8N A;  5CRD A;  5DAL A;  3W8S A;  3IHQ A;  4JED A;  2NDO A;  3EUR A;  1GUM A;  1XWB A;  1LU4 A;  3CTG A;  5HR1 A;  1ZCP A;  3FKF A;  5AIX A;  2IPA A;  4KA0 A;  1T4Z A;  3UMA A;  3KTL A;  4KE3 A;  6GSS A;  2L5O A;  1MDJ A;  4XS4 B;  4K0N A;  5INY A;  2HT9 A;  2GT6 A;  1G0T A;  3GN3 A;  5E4W A;  1EEM A;  1Z9H A;  1GSF A;  3S9F A;  1SJZ A;  1LBK A;  1KTE A;  1JZW A;  3LXT A;  2MMA A;  2B5E A;  3E0U A;  3FR6 A;  4EE0 A;  3TJB A;  3IC8 A;  2X49 A;  3C1R A;  4HQZ A;  2C3T A;  2KP2 A;  1TK0 B;  4F03 A;  4F82 A;  4NXI A;  3F8U A;  2JSY A;  3KJY A;  4DEJ A;  5C00 A;  4YQU A;  3GUR A;  1QMV A;  2QSI A;  1S3R A;  4IJI A;  2PVO C;  1XG8 A;  4QL9 A;  3ZFL A;  18GS A;  5DAL B;  3KCM A;  1SK0 A;  3MAK A;  2GTU A;  4L0U A;  1ILO A;  2YN1 A;  4PTS A;  2DIZ A;  2EIR A;  2LRC A;  1PD2 1;  3GX8 A;  4MNN A;  1W89 A;  5ELG A;  1EEJ A;  3HZ4 A;  3A2X A;  3BCK A;  3H1N A;  2V1M A;  2IN3 A;  3HJM A;  4OCF A;  2DSA A;  5CO3 A;  3PIN A;  2WZ9 A;  1SYR A;  2H1G A;  4WR4 A;  4G0L A;  2A4V A;  4KF9 A;  4EVM A;  2GQK A;  5DQY A;  1PN9 A;  4AF2 A;  1Y6E A;  3G7I A;  1R5P A;  1ERW A;  2LST A;  2L57 A;  3GKN A;  4K7N A;  1XW9 A;  3EIN A;  4RUV A;  4PUA A;  1JHB A;  3GNJ A;  2V6O A;  1Q98 A;  4BVY A;  4JR4 A;  3GA4 A;  1GSU A;  3LQ7 A;  3G7J A;  4Z2R A;  2V6K A;  2DMM A;  4V2L A;  5CRG A;  3ZIJ A;  3L0H A;  2VAF A;  4KSM A;  3ERW A;  1LJR A;  1WMJ A;  1M3I A;  1K0B A;  2VCX A;  4MJB A;  1GUK A;  3ZRE A;  1FOH A;  2I81 A;  4POL A;  5ECI B;  1A0R P;  2FY6 A;  2Z9S A;  2CZ2 A;  3FHK A;  4EKZ A;  3KGK A;  2VLT A;  2G0F A;  3RDW A;  3HZ8 A;  1OKD A;  1PX6 A;  2X99 A;  1GNE A;  4K5S A;  3EE2 A;  1X9S B;  2FA8 A;  3F6F A;  2OA7 A;  1IYI A;  2BMX A;  4POM A;  2LRT A;  2L6D A;  2DJ2 A;  5J9C A;  1MDK A;  3KZQ A;  3TRX A;  2HLS A;  1E2Y A;  5B7C A;  4E8E A;  2DML A;  3VWV A;  3DD3 A;  1M2D A;  1WE0 A;  5DCH A;  4HS1 A;  2MMZ A;  3ZML A;  4LL4 B;  4BVY B;  1PL1 A;  1X5E A;  4TXO A;  7GSS A;  2IME A;  4EUY A;  1THX A;  1BYE A;  4L5L A;  2MZC A;  3GKM A;  3SWL A;  1TP9 A;  2VL2 A;  2GS3 A;  5F07 A;  1DBY A;  4EC0 A;  2WB9 A;  3R2Q A;  3GL3 A;  4KSO A;  2K8V A;  1A8Y A;  4XRD A;  5ECQ B;  2OAD A;  3QFB C;  1NM3 A;  5J5N A;  19GS A;  3A3T A;  3DKS A;  4MH2 A;  4BVX A;  4O5R A;  4PGT A;  4OO4 A;  4TN8 A;  5CRH A;  5D73 A;  3CSI A;  2MBS A;  1GTB A;  2OE3 A;  2E7P A;  2FWF A;  1ERU A;  3VUR A;  2HRN A;  1OAZ A;  3VPT A;  4FO5 A;  1GL8 A;  2H30 A;  2OE0 A;  4TXO B;  3EYT A;  17GS A;  4HJ2 A;  2C80 A;  1PN0 A;  3UOM A;  1SKR B;  4HSC X;  5L71 A;  4ZIL A;  1YDK A;  4H86 A;  3DGQ A;  4TKY A;  4OO5 A;  8GSS A;  2N5A A;  3TKR A;  1BG5 A;  4MA9 A;  2WUL A;  3EU4 A;  2KOK A;  3ED3 A;  1DE1 A;  1YJ6 A;  1K0C A;  4EXJ A;  4OFN A;  3ERG A;  4FYU A;  1PKW A;  2H19 A;  4NAX A;  1OYJ A;  3V1W A;  5KOX A;  1XW6 A;  3D22 A;  1GSD A;  2WRT A;  2C0D A;  5D9X A;  2IFQ A;  4BVX B;  13GS A;  3RBT A;  5IM9 A;  4TR1 A;  2ZNM A;  2H74 A;  1F37 A;  3FYG A;  2YWO A;  1Y25 A;  1GSE A;  1YQ1 A;  2GZP A;  1ZGN A;  3KEB A;  1BJX A;  2HI7 A;  1TI1 A;  1I9D A;  3DIE A;  3I43 A;  1DSB A;  3NZN A;  2LEG A;  1T8E B;  2AAW A;  1EV4 A;  2FWG A;  4WKW A;  2B7K A;  3FZ4 A;  4TOP A;  4G19 A;  4HU7 A;  2L5L A;  3GMF A;  2LNS A;  3UL3 A;  1XOB A;  3EU3 A;  2ON5 A;  5HR3 A;  1B4Q A;  1YKC A;  5IMC A;  5HFK A;  3EMP A;  1ZYQ B;  1G6W A;  3IK7 A;  2FA4 A;  4O32 A;  4KH7 A;  20GS A;  3LFL A;  4P3Y B;  1TTZ A;  1K0A A;  3DWV A;  1PA3 A;  4WBJ A;  5D93 A;  2F9S A;  3E3E A;  3Q19 A;  3ZIV A;  2IJY A;  2GSQ A;  1EOH A;  1AUC A;  1M2A A;  5DAK A;  2R6K A;  2IFQ B;  5ID2 A;  3GX0 A;  4DSQ A;  3WGD A;  2JAD A;  2VCZ A;  3GSS A;  2WCI A;  2B7J A;  3P8W A;  1TDI A;  1PL2 A;  5GAP D;  1OC9 A;  2AYT A;  2HXK A;  5DDL A;  2LKU A;  1M7T A;  5J4U A;  4G0K A;  2LJK A;  4Q5N A;  3VPQ A;  3LOR A;  3D21 A;  2P5R A;  3L4N A;  1O73 A;  3RHB A;  1XXU A;  1TOF A;  4MJE A;  1X5D A;  3APQ A;  3TRQ A;  1WRY A;  5G5E A;  3TJK A;  2VD0 A;  4FYB A;  4I97 A;  2H8L A;  3D5J A;  2VM1 A;  1BQ7 A;  2H73 A;  2FWH A;  1MEK A;  3FMW A;  3GH9 A;  3KIJ A;  1GSY A;  2LQO A;  4EF0 A;  1ACV A;  1Z6N A;  2WS2 A;  4OD7 A;  3BOA A;  4GQF A;  3J7Y b;  5LNK e;  2IIY A;  2NVL A;  1M3J A;  3CRU A;  4ZL8 A;  2YNX A;  2AJQ B;  4WEY A;  2A4H A;  2C1Y A;  2N5B A;  1X9W B;  1AC1 A;  1ERT A;  5DAK B;  4WET A;  2DKI A;  3W6G A;  5ID2 B;  2YPM A;  4O7H A;  2H01 A;  1GNW A;  3C1S A;  3TUE A;  3IA1 A;  4F2I A;  5COH A;  5DCG A;  4HOJ A;  5CYY A;  2EIO A;  1PSQ A;  1QFN A;  4JR6 A;  1SKW B;  2O87 A;  5DBQ A;  1OC9 B;  1FW1 A;  3FEU A;  4K1F A;  4ACS A;  1TRS A;  4KUN A;  3PR8 A;  2NBS A;  1ZZY A;  2HFD A;  3ZZX A;  4ZL7 A;  1JLV A;  2AUV A;  3IK9 A;  3P2A A;  1AAZ A;  3A5I A;  1U3A A;  1XOA A;  2F3M A;  3KMO A;  3D4T A;  4Z2T A;  1QGV A;  2R4V A;  4K7I A;  2VM2 A;  3HJP A;  3F3Q A;  3EVI A;  3IV4 A;  1HYU A;  5FHI A;  2WDU A;  2YAN A;  5IMV A;  4GSN A;  3WGE A;  3J7Y k;  2C0G A;  4K0G A;  4WBR D;  2K6V A;  5ECR B;  5A4V A;  5ECN B;  2O85 A;  1B8X A;  4ZBD A;  3VI7 A;  1K0N A;  4Z7X A;  3CRT A;  2QGV A;  3QD9 A;  3EC3 A;  3DML A;  4MP4 A;  3AY8 A;  2OBK A;  3HD5 A;  4MF5 A;  4JU5 A;  4L5O A;  1N2A A;  5BMU A;  1J08 A;  1UC7 A;  2H6X A;  2IMK A;  1TRU A;  1WP0 A;  3UJ1 A;  3GTU A;  1SK2 A;  4GLT A;  2JSZ A;  2TRC P;  3KP9 A;  5HFI A;  2M80 A;  4HQS A;  5LCZ A;  1SL0 B;  3IAM 2;  3D6I A;  2AB6 A;  3G7Y A;  2RUF A;  4DVC A;  2WFC A;  2N5F A;  4O92 A;  4GWR A;  4LL1 B;  2OE1 A;  3C7M A;  3TKS A;  4N11 A;  2FHE A;  2PU9 C;  9GSS A;  1FB0 A;  1OC3 A;  5HR0 A;  2L4C A;  4YAP A;  3EWL A;  2GQM A;  1TRW A;  4EIP A;  4ZB6 A;  12GS A;  1T7P B;  4LMW A;  3E9J B;  1PGT A;  4KB3 A;  4DSR A;  4ECC A;  3HVV A;  3CXG A;  4G10 A;  2HSY A;  4V2N A;  1KEB A;  1V58 A;  4V1A g;  1PX7 A;  3ZRD A;  4XTS A;  3TKQ A;  4ZBB A;  1YEP A;  2MBT A;  2C0F A;  3IDV A;  3PGT A;  3O76 A;  4E8H A;  4J2F A;  3KP8 A;  14GS A;  1A8L A;  4KCE A;  1B48 A;  4XS1 A;  2M72 A;  2VLV A;  3GTU B;  2B3S A;  1GLQ A;  3N9J A;  2HZF A;  3QPM A;  1XWG A;  4PX1 A;  6GSU A;  3ZFB A;  5KOW A;  4MMM A;  1ZOF A;  4OFT A;  2NTO A;  1G7O A;  1VRS D;  2YV7 A;  3MNG A;  3UAR A;  3M3M A;  2DC5 A;  1K3O A;  2F8F A;  1AW9 A;  4MF6 A;  1XVQ A;  2FWE A;  2IL3 A;  1B4P A;  4AGS A;  2R5G A;  4PNF A;  4N0Z A;  2V32 A;  1T1V A;  4ECJ A;  3L9U A;  1YY7 A;  5EPF A;  1F3A A;  1AXD A;  4KCA A;  2LTK A;  3M0F A;  2YWN A;  2R3X A;  2J23 A;  2GDR A;  3US3 A;  2RII A;  3A2W A;  4IN0 A;  1XWA A;  3TJF A;  5ECS A;  3UVH A;  1MDI A;  4N30 A;  3F4R A;  4YQM A;  4GCI A;  1J0F A;  5BRT A;  3F9U A;  1V9W A;  6GSV A;  3W8J A;  5H5R A;  4MZC A;  1EP7 A;  4NV2 A;  2KHP A;  4ILF A;  1V2A A;  3TKP A;  1X0R A;  2X8H A;  4ID0 A;  4Q5R A;  2GVP A;  1AQV A;  2LRN A;  4JRR A;  5IMZ A;  2O8V B;  2MMO A;  2CX3 A;  5C04 A;  1T3B A;  3HY2 A;  2KLX A;  2LV3 A;  3JCM L;  1CQG A;  4FIW A;  3CSH A;  3LWA A;  1NW2 A;  4XCS A;  3QDN A;  1K3Y A;  5CRE A;  2H76 A;  3KTB A;  2PBJ A;  2C3N A;  3IE3 A;  2TIR A;  3TOU A;  4IHU A;  1B9X C;  1H75 A;  3QCP A;  4TRX A;  4USS A;  1RQM A;  3GH6 A;  3N5O A;  4YAV A;  3F63 A;  3FZ5 A;  2MYG A;  4GSS A;  4X4J A;  1SJ6 A;  3GL5 A;  4DSS A;  4TR3 A;  4GXZ A;  3HHV A;  3QAG A;  2LQQ A;  1PFO A;  5B6N A;  3LYP A;  2CA8 A;  3QAV A;  4ZL9 A;  4YKG A;  4K2X A;  3HVS A;  1Z5Y E;  5H5S A;  3ZYW A;  3UBL A;  3NIV A;  4MPF A;  5JCG A;  1O85 A;  2A2R A;  4MJC A;  2I9H A;  3GST A;  2FCH A;  1KBN A;  1V40 A;  1FVK A;  2VUP A;  1VF1 A;  4ICY A;  3O6T A;  2YJH A;  3ZL5 A;  4RI6 A;  1BED A;  2VL2 C;  4MPG A;  1ZYE A;  1Z7P A;  1OC8 A;  4X1U A;  3P7X A;  1UA5 A;  3PPU A;  3TJG A;  3GIX A;  5DQS A;  4OWY A;  5CAX A;  1XPV A;  1F6M C;  3HVX A;  2LS5 A;  2C4J A;  2LUS A;  1YEX A;  5DJL A;  1XZO A;  4DSS B;  1WWJ A;  4IJ3 A;  2H1A A;  1GP1 A;  3EMX A;  4WF4 A;  2XPD A;  3LSZ A;  2JAC A;  3VK9 A;  4ECB A;  1S3C A;  2HRA A;  3IR4 A;  3HCZ A;  4PUR A;  5F0G A;  1ABA A;  1UVZ A;  1TXX A;  1S3A A;  4K9Z A;  1O6J A;  3TGZ A;  4K6X A;  2H6Z A;  1SD8 A;  2ZCT A;  3TKS E;  1EV9 A;  4MLY A;  4HUA A;  1G6Y A;  5A4W A;  3O3T A;  3CTF A;  2P5Q A;  2LNT A;  2H75 A;  1I5G A;  4PQI A;  1SL1 B;  3LGC A;  1O8W A;  3F4S A;  1ZYN A;  5EL8 A;  4POB A;  2X8C A;  4N0V A;  2FGX A;  1YKA A;  5KN3 A;  2P31 A;  5IMD A;  4MJA A;  1THO A;  3QOU A;  4ZB9 A;  5GST A;  4F0C A;  5KEJ A;  2YZU A;  2CQ9 A;  4I5Q A;  2YZH A;  2HNL A;  4Q5F A;  4K7O A;  3TCO A;  2CVD A;  3CSJ A;  2WJU A;  5AGY A;  1MD3 A;  4ZIJ A;  1GLP A;  2RUE A;  4OFM A;  1F3B A;  2YJ7 A;  2E0Q A;  3C8E A;  3IC4 A;  1X9M B;  1W4V A;  2REM A;  3HYP A;  4EDZ A;  4CDO A;  4FQU A;  1USB A;  3VLN A;  1M99 A;  1AIU A;  1VGL A;  4IGJ A;  2IMI A;  5F06 A;  3ZTL A;  5IMF A;  3BBY A;  4ML6 A;  1TK5 B;  1ML6 A;  4HDE A;  1XW5 A;  4HEA 2;  4IBP A;  3C73 A;  1JZD A;  2IMD A;  2H1D A;  2J9H A;  5ECO B;  5IPH A;  3HVN A;  1J9B A;  2DJ3 A;  1AQX A;  1ST9 A;  1A2L A;  1Q4J A;  3FR3 A;  3HJO A;  1WJK A;  1K0O A;  3VWU A;  1F2E A;  1ZYP A;  4BWQ A;  3UVT A;  1EOG A;  1C72 A;  4YQV A;  1NHY A;  1GSQ A;  1TKD B;  3QFA C;  3ME7 A;  5ECK B;  4LA1 A;  2AV4 A;  5G1L A;  5B6M A;  4ECI A;  3RHC A;  1T4Y A;  3BD2 A;  2R37 A;  1URM A;  3VWW A;  5HQP A;  1B9Y C;  2ALB A;  3ERF A;  1O8X A;  5AN1 A;  2P0G A;  4X0X A;  5IOW A;  2HE3 A;  4XS6 A;  3QMX A;  4Z2U A;  3UAP A;  4IEL A;  3IXR A;  4PQ1 A;  2X4A A;  1HNB A;  4EIQ A;  5ECM B;  4N10 A;  4WF5 A;  1SL2 B;  2VCT A;  1K0M A;  1PKZ A;  4G2E A;  1FG4 A;  4MZB A;  2B5Y A;  1SJI A;  5D9W A;  4OMV A;  3F3R A;  1F9M A;  2R2J A;  2NPB A;  1HNC A;  1K3L A;  5KN0 A;  1TW9 A;  4BWS A;  2IMF A;  2PER A;  1VF3 A;  1U87 A;  1A24 A;  4NPB A;  5JWQ B;  2B1K A;  2OJL A;  2VD1 A;  4ULX A;  2VL3 A;  1M9B A;  4NHZ A;  2GZZ A;  3GRX A;  1OE7 A;  3P90 A;  1UN2 A;  4IKH A;  3L9S A;  6GST A;  5D9V A;  4IS0 A;  1IYH A;  2HZE A;  4F9Z A;  1GUL A;  3F0I A;  1ON4 A;  2YP6 A;  4I2U A;  2L59 A;  1WOU A;  5J3R A;  4IQ1 A;  3I69 A;  2GST A;  5JCW A;  2VLU A;  5D9T A;  3VWX A;  2M46 A;  3NOF A;  3TJJ A;  5ECH B;  2WGR A;  2HYX A;  2PGT A;  2QKE A;  3IRA A;  2A2P A;  3TB2 A;  4IQA A;  3D4M A;  5A4U A;  2V41 A;  3FZ9 A;  5CRW A;  5B8A A;  3HXS A;  4KAE A;  3M9J A;  3UIW A;  2DLX A;  1EGR A;  4AJ7 A;  3U5R E;  2B6M A;  5HFG A;  2VIM A;  1H4O A;  2XBI A;  5IPG A;  1Z3E A;  2HRK A;  1EZK A;  3DVX A;  4X43 A;  3QAW A;  3BCI A;  2H1B A;  1BAY A;  4NWY A;  4TW5 A;  4XIH A;  3GV1 A;  5ABR A;  5EY6 A;  4ZXG A;  2CZ3 A;  2OKA A;  1TJD A;  3I6A A;  1GSS A;  5D8I A;  1CQH A;  2VCQ A;  4Q5Q A;  3WGX A;  2HZE B;  2YWM A;  5ELA A;  1G7E A;  1O81 A;  3GKK A;  1KNG A;  1RW1 A;  3HKR A;  3A2V A;  1U6T A;  3FY7 A;  4HI7 A;  4JZQ A;  2C8U A;  2EIQ A;  5GAN D;  10GS A;  1OE8 A;  3HDC A;  1EP8 A;  3WYW A;  3QR6 A;  3C71 A;  5G5F A;  2RLI A;  2XC2 A;  3CBU A;  4LMV A;  2PN8 A;  1YZX A;  5IQY A;  3VI5 A;  3TKS C;  11GS A;  2HRF A;  3PH9 A;  2LJA A;  1SEN A;  3VFI A;  4KX4 A;  2DJ1 A;  4KGI A;  5ECL B;  3APO A;  3WD6 A;  4MK3 A;  2FLS A;  4ZB8 A;  2H72 A;  1PMT A;  3GHA A;  3KM6 A;  4J57 E;  5IOX A;  1YF1 A;  3FRC A;  3ME8 A;  1ZMA A;  1TK8 B;  2GSR A;  2H71 A;  4KW6 A;  3TOT A;  2QA1 A;  1FO5 A;  2I3Y A;  1WIK A;  2VL9 A;  2K18 A;  3IHG A;  3MWH A;  1FVJ A;  5JWR B;  1R7H A;  3FZA A;  3TDG A;  4ISD A;  1FHE A;  5J41 A;  1M9A A;  4KND A;  4NMU A;  4EDY A;  5GSS A;  5G30 A;  5IIZ A;  1S3D A;  4MAB A;  3IOS A;  2H0H A;  1R26 A;  2L4Q A;  2VO4 A;  2X8G A;  2QC7 A;  5IO0 A;  5J9B A;  2YCD A;  3ZIT A;  2V2G A;  1M0U A;  1O7U A;  1XFL A;  2F51 A;  1JZO A;  4L8E A;  1AQW A;  2G2Q A;  4HU9 A;  1NHO A;  1SK1 A;  2PWJ A;  4TXV A;  5D96 A;  4JE1 A;  2BJX A;  3LG6 A;  3DRN A;  2VCW A;  1XWC A;  4GF0 A;  3FK8 A;  3IPZ A;  6GSY A;  3Q74 A;  2C3Q A;  2H0G A;  4XHM A;  1QXH A;  3LXZ A;  5G31 A;  5IMA A;  2H70 A;  1NSW A;  4GQC A;  3L9V A;  2RM5 A;  2GGT A;  3RPN A;  2BTO T;  3EPT A;  3RPP A;  3U6V A;  5EVO A;  2A2S A;  4PQH A;  2H66 A;  4LLR A;  4FYC A;  2I1U A;  4NV5 A;  2ZUP A;  3H93 A;  3KXO A;  5DVB A;  2QA2 A;  2CVB A;  2R0C A;  1HQO A;  1GRX A;  1U3I A;  1PQN A;  4TR4 A;  1V57 A;  5G1K A;  4MH3 A;  4QL7 A;  3MYD A;  4POK A;  1N8J A;  5CNW A;  3LYK A; 
#chains in the Genus database with same CATH homology
 1DE2 A;  3TRP A;  4TVE A;  2JL4 A;  4BPY A;  4I2T A;  5F05 A;  2B1L A;  1FAA A;  4PNG A;  4ML1 A;  2HSH A;  1XWK A;  2F8A A;  4FH8 A;  5A5K A;  1X5C A;  6GSX A;  2JZT A;  4GTU A;  5F8B A;  4QQ7 A;  3WT2 A;  3Q6O A;  22GS A;  3LEF A;  3UEM A;  5AIV A;  2IWT A;  1VF4 A;  4AJ6 A;  3MSZ A;  1R4W A;  2DJ0 A;  3KH7 A;  4G9H A;  2JZR A;  5GZZ B;  2KP1 A;  3RAZ A;  5KN1 A;  3ZLP A;  1OKT A;  4J56 E;  4PUF C;  3CMI A;  4CY6 A;  3DXB A;  3IAS 2;  4ZBA A;  4MF7 A;  1A2M A;  4K8M A;  1GH2 A;  1HNA A;  3I9V 2;  4K5R A;  2C0E A;  3L78 A;  2O7K A;  2CAQ A;  1WPI A;  5DJM A;  1FB6 A;  3MDK A;  3WT1 A;  3OR5 A;  4JBB A;  3H8Q A;  3G9B A;  2DIY A;  2K9F A;  4WR5 A;  5LD0 A;  1PRX A;  2R0G A;  4CW9 A;  4IW9 A;  3FR9 A;  5CP1 A;  3ZVJ D;  5KN2 A;  3CYN A;  3GFK A;  2GLR A;  2PUK C;  3MIX A;  1T00 A;  1DUG A;  2ES7 A;  2CVK A;  1TU8 A;  2CX4 A;  3A5W A;  5FWG A;  4V1A p;  3LJR A;  4O5U A;  1YF0 A;  3R3E A;  4YH2 A;  2TRX A;  1HD2 A;  2E2M A;  3H4K A;  4PXO A;  1MTC A;  4I6X A;  1EGO A;  2CAI A;  5JWO B;  1E6B A;  1XVW A;  4AJ8 A;  2XBQ A;  4HJM A;  2FNO A;  3DVW A;  1MD4 A;  5B8B A;  3LW9 A;  2RM6 A;  3H79 A;  3GYK A;  2CV4 A;  1M2B A;  2GSS A;  1GTA A;  3SBC A;  4D73 A;  1JFU A;  2D2Z A;  1ERV A;  4KDY A;  1Z6M A;  2R0P A;  3M8N A;  4KDU A;  2DJK A;  2B5X A;  4CY8 A;  2DBC A;  2E2G A;  2GQL A;  3BJ5 A;  4I8B A;  3ZMK A;  1EWX A;  1GTU A;  2YWI A;  2CT6 A;  4KDX A;  3FW2 A;  1TRV A;  2FD3 A;  2VOC A;  4GRF A;  1XIY A;  1GTI A;  2GT5 A;  3DYR A;  4HZ2 A;  4TR1 B;  4YKF A;  1SKS B;  1TI3 A;  4RI7 A;  1TU7 A;  2HSM A;  1RK4 A;  4OCE A;  5JCU A;  2H6Y A;  2KUC A;  2OBI A;  1VF2 A;  5H5Q A;  4V2M A;  1A2J A;  3ZVJ A;  2JZS A;  2PVQ A;  5ECP B;  16GS A;  2AHE A;  3M1G A;  4IVF A;  1V98 A;  3M9K A;  4D73 B;  4F0B A;  3HA9 A;  2DKH A;  2EC4 A;  4BL7 A;  1ZL9 A;  2VCV A;  1XBS A;  2K8S A;  4WXT A;  1BX9 A;  4IP6 A;  4L0W A;  6GSW A;  4RQR A;  1JLW A;  2PPT A;  2GZY A;  4IP1 A;  5ENU A;  2OAC A;  1OVN A;  2FUG 2;  2UZ8 A;  5G2Z A;  2ON7 A;  2PMT A;  1R5A A;  3APS A;  4EO3 A;  1GWC A;  3GUS A;  3F6D A;  5FT3 A;  5E59 A;  1FOV A;  3KH9 A;  4HZ4 A;  4K2D A;  3UBK A;  1SD9 A;  3D0Z A;  3IBH A;  4XS4 A;  2H0I A;  4TR0 A;  1U88 A;  2LJR A;  4GST A;  3GKX A;  4MDC A;  4XRA A;  2XHF A;  4NHW A;  1QQ2 A;  2X64 A;  1QUW A;  2L6C A;  4EL1 A;  3KMN A;  5AIS A;  4MZW A;  1SU9 A;  1GUH A;  2DJJ A;  2JU5 A;  1QK8 A;  2XPE A;  2O89 A;  1JZR A;  4G0I A;  3F4T A;  1Z7R A;  1K0D A;  4RQX A;  2MMN A;  1A23 A;  3ISO A;  1SYX A;  4BL7 B;  2I4A A;  4A5P A;  5HR2 A;  2YV9 A;  4MCU A;  1XCC A;  3KD0 A;  3Q18 A;  3DEX A;  2YOI A;  1A0F A;  4O5Q A;  4BA7 A;  4CHS A;  5IO2 A;  3K8N A;  5CRD A;  5DAL A;  3W8S A;  3IHQ A;  4JED A;  2NDO A;  3EUR A;  1GUM A;  1XWB A;  1LU4 A;  3CTG A;  5HR1 A;  1ZCP A;  3FKF A;  5AIX A;  2IPA A;  4KA0 A;  1T4Z A;  3UMA A;  3KTL A;  4KE3 A;  6GSS A;  2L5O A;  1MDJ A;  4XS4 B;  4K0N A;  5INY A;  2HT9 A;  2GT6 A;  1G0T A;  3GN3 A;  5E4W A;  1EEM A;  1Z9H A;  1GSF A;  3S9F A;  1SJZ A;  1LBK A;  1KTE A;  1JZW A;  3LXT A;  2MMA A;  2B5E A;  3E0U A;  3FR6 A;  4EE0 A;  3TJB A;  3IC8 A;  2X49 A;  3C1R A;  4HQZ A;  2C3T A;  2KP2 A;  1TK0 B;  4F03 A;  4F82 A;  4NXI A;  3F8U A;  2JSY A;  3KJY A;  4DEJ A;  5C00 A;  4YQU A;  3GUR A;  1QMV A;  2QSI A;  4IJI A;  2PVO C;  4QL9 A;  3ZFL A;  18GS A;  5DAL B;  3KCM A;  1SK0 A;  3MAK A;  2GTU A;  4L0U A;  1ILO A;  2YN1 A;  4PTS A;  2DIZ A;  2EIR A;  2LRC A;  1PD2 1;  3GX8 A;  4MNN A;  1W89 A;  5ELG A;  1EEJ A;  3HZ4 A;  3A2X A;  3BCK A;  3H1N A;  2V1M A;  2IN3 A;  3HJM A;  4OCF A;  2DSA A;  5CO3 A;  3PIN A;  2WZ9 A;  1SYR A;  2H1G A;  4WR4 A;  4G0L A;  2A4V A;  4KF9 A;  4EVM A;  2GQK A;  5DQY A;  1PN9 A;  4AF2 A;  1Y6E A;  3G7I A;  1R5P A;  1ERW A;  2LST A;  2L57 A;  3GKN A;  4K7N A;  1XW9 A;  3EIN A;  4RUV A;  4PUA A;  1JHB A;  3GNJ A;  2V6O A;  1Q98 A;  4BVY A;  4JR4 A;  3GA4 A;  1GSU A;  3LQ7 A;  3G7J A;  4Z2R A;  2V6K A;  2DMM A;  4V2L A;  5CRG A;  3ZIJ A;  3L0H A;  2VAF A;  4KSM A;  3ERW A;  1LJR A;  1WMJ A;  1K0B A;  2VCX A;  4MJB A;  1GUK A;  3ZRE A;  1FOH A;  2I81 A;  4POL A;  5ECI B;  1A0R P;  2FY6 A;  2Z9S A;  2CZ2 A;  3FHK A;  4EKZ A;  3KGK A;  2VLT A;  2G0F A;  3RDW A;  3HZ8 A;  1OKD A;  1PX6 A;  2X99 A;  1GNE A;  4K5S A;  3EE2 A;  1X9S B;  2FA8 A;  3F6F A;  2OA7 A;  1IYI A;  2BMX A;  4POM A;  2LRT A;  2L6D A;  2DJ2 A;  5J9C A;  1MDK A;  3KZQ A;  3TRX A;  2HLS A;  1E2Y A;  5B7C A;  4E8E A;  2DML A;  3VWV A;  3DD3 A;  1M2D A;  1WE0 A;  5DCH A;  4HS1 A;  2MMZ A;  3ZML A;  4LL4 B;  4BVY B;  1PL1 A;  1X5E A;  4TXO A;  7GSS A;  2IME A;  4EUY A;  1THX A;  1BYE A;  4L5L A;  2MZC A;  3GKM A;  3SWL A;  1TP9 A;  2VL2 A;  2GS3 A;  5F07 A;  1DBY A;  4EC0 A;  2WB9 A;  3R2Q A;  3GL3 A;  4KSO A;  2K8V A;  1A8Y A;  4XRD A;  5ECQ B;  2OAD A;  3QFB C;  1NM3 A;  5J5N A;  19GS A;  3A3T A;  3DKS A;  4MH2 A;  4BVX A;  4O5R A;  4PGT A;  4OO4 A;  4TN8 A;  5CRH A;  5D73 A;  3CSI A;  2MBS A;  1GTB A;  2OE3 A;  2E7P A;  2FWF A;  1ERU A;  3VUR A;  2HRN A;  1OAZ A;  3VPT A;  4FO5 A;  1GL8 A;  2H30 A;  2OE0 A;  4TXO B;  3EYT A;  17GS A;  4HJ2 A;  2C80 A;  1PN0 A;  3UOM A;  1SKR B;  5L71 A;  4ZIL A;  1YDK A;  4H86 A;  3DGQ A;  4TKY A;  4OO5 A;  8GSS A;  2N5A A;  3TKR A;  1BG5 A;  4MA9 A;  2WUL A;  3EU4 A;  2KOK A;  3ED3 A;  1DE1 A;  1YJ6 A;  1K0C A;  4EXJ A;  4OFN A;  3ERG A;  4FYU A;  1PKW A;  2H19 A;  4NAX A;  1OYJ A;  3V1W A;  5KOX A;  1XW6 A;  3D22 A;  1GSD A;  2WRT A;  2C0D A;  5D9X A;  2IFQ A;  4BVX B;  13GS A;  3RBT A;  5IM9 A;  4TR1 A;  2ZNM A;  2H74 A;  1F37 A;  3FYG A;  2YWO A;  1Y25 A;  1GSE A;  1YQ1 A;  2GZP A;  1ZGN A;  3KEB A;  1BJX A;  2HI7 A;  1TI1 A;  1I9D A;  3DIE A;  3I43 A;  1DSB A;  3NZN A;  2LEG A;  1T8E B;  2AAW A;  1EV4 A;  2FWG A;  4WKW A;  2B7K A;  3FZ4 A;  4TOP A;  4G19 A;  4HU7 A;  2L5L A;  3GMF A;  2LNS A;  3UL3 A;  1XOB A;  3EU3 A;  2ON5 A;  5HR3 A;  1B4Q A;  1YKC A;  5IMC A;  5HFK A;  3EMP A;  1ZYQ B;  1G6W A;  3IK7 A;  2FA4 A;  4O32 A;  4KH7 A;  20GS A;  3LFL A;  4P3Y B;  1TTZ A;  1K0A A;  3DWV A;  1PA3 A;  4WBJ A;  5D93 A;  2F9S A;  3E3E A;  3Q19 A;  3ZIV A;  2IJY A;  2GSQ A;  1EOH A;  1AUC A;  1M2A A;  5DAK A;  2R6K A;  2IFQ B;  5ID2 A;  3GX0 A;  4DSQ A;  3WGD A;  2JAD A;  2VCZ A;  3GSS A;  2WCI A;  2B7J A;  3P8W A;  1TDI A;  1PL2 A;  5GAP D;  1OC9 A;  2AYT A;  2HXK A;  5DDL A;  2LKU A;  1M7T A;  5J4U A;  4G0K A;  2LJK A;  4Q5N A;  3VPQ A;  3LOR A;  3D21 A;  2P5R A;  3L4N A;  1O73 A;  3RHB A;  1XXU A;  1TOF A;  4MJE A;  1X5D A;  3APQ A;  3TRQ A;  1WRY A;  5G5E A;  3TJK A;  2VD0 A;  4FYB A;  4I97 A;  2H8L A;  3D5J A;  2VM1 A;  1BQ7 A;  2H73 A;  2FWH A;  1MEK A;  3FMW A;  3GH9 A;  3KIJ A;  1GSY A;  2LQO A;  4EF0 A;  1ACV A;  1Z6N A;  2WS2 A;  4OD7 A;  3BOA A;  4GQF A;  3J7Y b;  5LNK e;  2IIY A;  2NVL A;  3CRU A;  4ZL8 A;  2YNX A;  2AJQ B;  4WEY A;  2A4H A;  2C1Y A;  2N5B A;  1X9W B;  1AC1 A;  1ERT A;  5DAK B;  4WET A;  2DKI A;  3W6G A;  5ID2 B;  2YPM A;  4O7H A;  2H01 A;  1GNW A;  3C1S A;  3TUE A;  3IA1 A;  4F2I A;  5COH A;  5DCG A;  4HOJ A;  5CYY A;  2EIO A;  1PSQ A;  1QFN A;  4JR6 A;  1SKW B;  2O87 A;  5DBQ A;  1OC9 B;  1FW1 A;  3FEU A;  4K1F A;  4ACS A;  1TRS A;  4KUN A;  3PR8 A;  2NBS A;  1ZZY A;  2HFD A;  3ZZX A;  4ZL7 A;  1JLV A;  2AUV A;  3IK9 A;  3P2A A;  1AAZ A;  3A5I A;  1U3A A;  1XOA A;  2F3M A;  3KMO A;  3D4T A;  4Z2T A;  1QGV A;  2R4V A;  4K7I A;  2VM2 A;  3HJP A;  3F3Q A;  3EVI A;  3IV4 A;  1HYU A;  5FHI A;  2WDU A;  2YAN A;  5IMV A;  4GSN A;  3WGE A;  3J7Y k;  2C0G A;  4K0G A;  4WBR D;  2K6V A;  5ECR B;  5A4V A;  5ECN B;  2O85 A;  1B8X A;  4ZBD A;  3VI7 A;  1K0N A;  4Z7X A;  3CRT A;  2QGV A;  3QD9 A;  3EC3 A;  3DML A;  4MP4 A;  3AY8 A;  2OBK A;  3HD5 A;  4MF5 A;  4JU5 A;  4L5O A;  1N2A A;  5BMU A;  1J08 A;  1UC7 A;  2H6X A;  2IMK A;  1TRU A;  1WP0 A;  3UJ1 A;  3GTU A;  1SK2 A;  4GLT A;  2JSZ A;  2TRC P;  3KP9 A;  5HFI A;  2M80 A;  4HQS A;  5LCZ A;  1SL0 B;  3IAM 2;  3D6I A;  2AB6 A;  3G7Y A;  2RUF A;  4DVC A;  2WFC A;  2N5F A;  4O92 A;  4GWR A;  4LL1 B;  2OE1 A;  3C7M A;  3TKS A;  4N11 A;  2FHE A;  2PU9 C;  9GSS A;  1FB0 A;  1OC3 A;  5HR0 A;  2L4C A;  4YAP A;  3EWL A;  2GQM A;  1TRW A;  4EIP A;  4ZB6 A;  12GS A;  1T7P B;  4LMW A;  3E9J B;  1PGT A;  4KB3 A;  4DSR A;  4ECC A;  3HVV A;  3CXG A;  4G10 A;  2HSY A;  4V2N A;  1KEB A;  1V58 A;  4V1A g;  1PX7 A;  3ZRD A;  4XTS A;  3TKQ A;  4ZBB A;  1YEP A;  2MBT A;  2C0F A;  3IDV A;  3PGT A;  3O76 A;  4E8H A;  4J2F A;  3KP8 A;  14GS A;  1A8L A;  4KCE A;  1B48 A;  4XS1 A;  2M72 A;  2VLV A;  3GTU B;  2B3S A;  1GLQ A;  3N9J A;  2HZF A;  3QPM A;  1XWG A;  4PX1 A;  6GSU A;  3ZFB A;  5KOW A;  4MMM A;  1ZOF A;  4OFT A;  2NTO A;  1G7O A;  1VRS D;  2YV7 A;  3MNG A;  3UAR A;  3M3M A;  2DC5 A;  1K3O A;  2F8F A;  1AW9 A;  4MF6 A;  1XVQ A;  2FWE A;  2IL3 A;  1B4P A;  4AGS A;  2R5G A;  4PNF A;  4N0Z A;  2V32 A;  1T1V A;  4ECJ A;  3L9U A;  1YY7 A;  5EPF A;  1F3A A;  1AXD A;  4KCA A;  2LTK A;  3M0F A;  2YWN A;  2R3X A;  2J23 A;  2GDR A;  3US3 A;  2RII A;  3A2W A;  4IN0 A;  1XWA A;  3TJF A;  5ECS A;  3UVH A;  1MDI A;  4N30 A;  3F4R A;  4YQM A;  4GCI A;  1J0F A;  5BRT A;  3F9U A;  1V9W A;  6GSV A;  3W8J A;  5H5R A;  4MZC A;  1EP7 A;  4NV2 A;  2KHP A;  4ILF A;  1V2A A;  3TKP A;  1X0R A;  2X8H A;  4ID0 A;  4Q5R A;  2GVP A;  1AQV A;  2LRN A;  4JRR A;  5IMZ A;  2O8V B;  2MMO A;  2CX3 A;  5C04 A;  1T3B A;  3HY2 A;  2KLX A;  2LV3 A;  3JCM L;  1CQG A;  4FIW A;  3CSH A;  3LWA A;  1NW2 A;  4XCS A;  3QDN A;  1K3Y A;  5CRE A;  2H76 A;  3KTB A;  2PBJ A;  2C3N A;  3IE3 A;  2TIR A;  3TOU A;  4IHU A;  1B9X C;  1H75 A;  3QCP A;  4TRX A;  4USS A;  1RQM A;  3GH6 A;  3N5O A;  4YAV A;  3F63 A;  3FZ5 A;  2MYG A;  4GSS A;  4X4J A;  1SJ6 A;  3GL5 A;  4DSS A;  4TR3 A;  4GXZ A;  3HHV A;  3QAG A;  2LQQ A;  5B6N A;  3LYP A;  2CA8 A;  3QAV A;  4ZL9 A;  4YKG A;  4K2X A;  3HVS A;  1Z5Y E;  5H5S A;  3ZYW A;  3UBL A;  3NIV A;  4MPF A;  5JCG A;  1O85 A;  2A2R A;  4MJC A;  2I9H A;  3GST A;  2FCH A;  1KBN A;  1V40 A;  1FVK A;  2VUP A;  1VF1 A;  4ICY A;  3O6T A;  2YJH A;  3ZL5 A;  4RI6 A;  1BED A;  2VL2 C;  4MPG A;  1ZYE A;  1Z7P A;  1OC8 A;  4X1U A;  3P7X A;  1UA5 A;  3PPU A;  3TJG A;  3GIX A;  5DQS A;  4OWY A;  5CAX A;  1XPV A;  1F6M C;  3HVX A;  2LS5 A;  2C4J A;  2LUS A;  1YEX A;  5DJL A;  1XZO A;  4DSS B;  1WWJ A;  4IJ3 A;  2H1A A;  1GP1 A;  3EMX A;  4WF4 A;  2XPD A;  3LSZ A;  2JAC A;  3VK9 A;  4ECB A;  1S3C A;  2HRA A;  3IR4 A;  3HCZ A;  4PUR A;  5F0G A;  1ABA A;  1UVZ A;  1TXX A;  1S3A A;  4K9Z A;  1O6J A;  3TGZ A;  4K6X A;  2H6Z A;  1SD8 A;  2ZCT A;  3TKS E;  1EV9 A;  4MLY A;  4HUA A;  1G6Y A;  5A4W A;  3O3T A;  3CTF A;  2P5Q A;  2LNT A;  2H75 A;  1I5G A;  4PQI A;  1SL1 B;  3LGC A;  1O8W A;  3F4S A;  1ZYN A;  5EL8 A;  4POB A;  2X8C A;  4N0V A;  2FGX A;  1YKA A;  5KN3 A;  2P31 A;  5IMD A;  4MJA A;  1THO A;  3QOU A;  4ZB9 A;  5GST A;  4F0C A;  5KEJ A;  2YZU A;  2CQ9 A;  4I5Q A;  2YZH A;  2HNL A;  4Q5F A;  4K7O A;  3TCO A;  2CVD A;  3CSJ A;  2WJU A;  5AGY A;  1MD3 A;  4ZIJ A;  1GLP A;  2RUE A;  4OFM A;  1F3B A;  2YJ7 A;  2E0Q A;  3C8E A;  3IC4 A;  1X9M B;  1W4V A;  2REM A;  3HYP A;  4EDZ A;  4CDO A;  4FQU A;  1USB A;  3VLN A;  1M99 A;  1AIU A;  1VGL A;  4IGJ A;  2IMI A;  5F06 A;  3ZTL A;  5IMF A;  3BBY A;  4ML6 A;  1TK5 B;  1ML6 A;  4HDE A;  1XW5 A;  4HEA 2;  4IBP A;  3C73 A;  1JZD A;  2IMD A;  2H1D A;  2J9H A;  5ECO B;  5IPH A;  1J9B A;  2DJ3 A;  1AQX A;  1ST9 A;  1A2L A;  1Q4J A;  3FR3 A;  3HJO A;  1WJK A;  1K0O A;  3VWU A;  1F2E A;  1ZYP A;  4BWQ A;  3UVT A;  1EOG A;  1C72 A;  4YQV A;  1NHY A;  1GSQ A;  1TKD B;  3QFA C;  3ME7 A;  5ECK B;  4LA1 A;  2AV4 A;  5G1L A;  5B6M A;  4ECI A;  3RHC A;  1T4Y A;  3BD2 A;  2R37 A;  1URM A;  3VWW A;  5HQP A;  1B9Y C;  2ALB A;  3ERF A;  1O8X A;  5AN1 A;  2P0G A;  4X0X A;  5IOW A;  2HE3 A;  4XS6 A;  3QMX A;  4Z2U A;  3UAP A;  4IEL A;  3IXR A;  4PQ1 A;  2X4A A;  1HNB A;  4EIQ A;  5ECM B;  4N10 A;  4WF5 A;  1SL2 B;  2VCT A;  1K0M A;  1PKZ A;  4G2E A;  1FG4 A;  4MZB A;  2B5Y A;  1SJI A;  5D9W A;  4OMV A;  3F3R A;  1F9M A;  2R2J A;  2NPB A;  1HNC A;  1K3L A;  5KN0 A;  1TW9 A;  4BWS A;  2IMF A;  2PER A;  1VF3 A;  1U87 A;  1A24 A;  4NPB A;  5JWQ B;  2B1K A;  2OJL A;  2VD1 A;  4ULX A;  2VL3 A;  1M9B A;  4NHZ A;  2GZZ A;  3GRX A;  1OE7 A;  3P90 A;  1UN2 A;  4IKH A;  3L9S A;  6GST A;  5D9V A;  4IS0 A;  1IYH A;  2HZE A;  4F9Z A;  1GUL A;  3F0I A;  1ON4 A;  2YP6 A;  4I2U A;  2L59 A;  1WOU A;  5J3R A;  4IQ1 A;  3I69 A;  2GST A;  5JCW A;  2VLU A;  5D9T A;  3VWX A;  2M46 A;  3NOF A;  3TJJ A;  5ECH B;  2WGR A;  2HYX A;  2PGT A;  2QKE A;  3IRA A;  2A2P A;  3TB2 A;  4IQA A;  3D4M A;  5A4U A;  2V41 A;  3FZ9 A;  5CRW A;  5B8A A;  3HXS A;  4KAE A;  3M9J A;  3UIW A;  2DLX A;  1EGR A;  4AJ7 A;  3U5R E;  2B6M A;  5HFG A;  2VIM A;  1H4O A;  2XBI A;  5IPG A;  1Z3E A;  2HRK A;  1EZK A;  3DVX A;  4X43 A;  3QAW A;  3BCI A;  2H1B A;  1BAY A;  4NWY A;  4TW5 A;  4XIH A;  3GV1 A;  5ABR A;  5EY6 A;  4ZXG A;  2CZ3 A;  2OKA A;  1TJD A;  3I6A A;  1GSS A;  5D8I A;  1CQH A;  2VCQ A;  4Q5Q A;  3WGX A;  2HZE B;  2YWM A;  5ELA A;  1G7E A;  1O81 A;  3GKK A;  1KNG A;  1RW1 A;  3HKR A;  3A2V A;  1U6T A;  3FY7 A;  4HI7 A;  4JZQ A;  2C8U A;  2EIQ A;  5GAN D;  10GS A;  1OE8 A;  3HDC A;  1EP8 A;  3WYW A;  3QR6 A;  3C71 A;  5G5F A;  2RLI A;  2XC2 A;  3CBU A;  4LMV A;  2PN8 A;  1YZX A;  5IQY A;  3VI5 A;  3TKS C;  11GS A;  2HRF A;  3PH9 A;  2LJA A;  1SEN A;  3VFI A;  4KX4 A;  2DJ1 A;  4KGI A;  5ECL B;  3APO A;  3WD6 A;  4MK3 A;  2FLS A;  4ZB8 A;  2H72 A;  1PMT A;  3GHA A;  3KM6 A;  4J57 E;  5IOX A;  1YF1 A;  3FRC A;  3ME8 A;  1ZMA A;  1TK8 B;  2GSR A;  2H71 A;  4KW6 A;  3TOT A;  2QA1 A;  1FO5 A;  2I3Y A;  1WIK A;  2VL9 A;  2K18 A;  3IHG A;  3MWH A;  1FVJ A;  5JWR B;  1R7H A;  3FZA A;  3TDG A;  4ISD A;  1FHE A;  5J41 A;  1M9A A;  4KND A;  4NMU A;  4EDY A;  5GSS A;  5G30 A;  5IIZ A;  1S3D A;  4MAB A;  3IOS A;  2H0H A;  1R26 A;  2L4Q A;  2VO4 A;  2X8G A;  2QC7 A;  5IO0 A;  5J9B A;  2YCD A;  3ZIT A;  2V2G A;  1M0U A;  1O7U A;  1XFL A;  2F51 A;  1JZO A;  4L8E A;  1AQW A;  2G2Q A;  4HU9 A;  1NHO A;  1SK1 A;  2PWJ A;  4TXV A;  5D96 A;  4JE1 A;  2BJX A;  3LG6 A;  3DRN A;  2VCW A;  1XWC A;  4GF0 A;  3FK8 A;  3IPZ A;  6GSY A;  3Q74 A;  2C3Q A;  2H0G A;  4XHM A;  1QXH A;  3LXZ A;  5G31 A;  5IMA A;  2H70 A;  1NSW A;  4GQC A;  3L9V A;  2RM5 A;  2GGT A;  3RPN A;  2BTO T;  3EPT A;  3RPP A;  3U6V A;  5EVO A;  2A2S A;  4PQH A;  2H66 A;  4LLR A;  4FYC A;  2I1U A;  4NV5 A;  2ZUP A;  3H93 A;  3KXO A;  5DVB A;  2QA2 A;  2CVB A;  2R0C A;  1HQO A;  1GRX A;  1U3I A;  1PQN A;  4TR4 A;  1V57 A;  5G1K A;  4MH3 A;  4QL7 A;  3MYD A;  4POK A;  1N8J A;  5CNW A;  3LYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...