5LNKe

Entire ovine respiratory complex i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
LGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQEKNVSLNNFSADQVTRALENVLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial complex I, 51 kDa subunit
publication title Atomic structure of the entire mammalian mitochondrial complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 19
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2016-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF05047 L51_S25_CI-B8 Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5lnke00
5DALB 5GAPD 4P3YB 4V2MA 2B1KA 3TOTA 1WIKA 1M7TA 3C7MA 2GDRA 1SKSB 4EKZA 3KP8A 5CRWA 2GSTA 3FR6A 4OCEA 1PSQA 2LKUA 5GAND 5JCGA 3WGXA 2NBSA 2RUEA 4N0ZA 3QDNA 1GWCA 1J9BA 2CZ2A 3JCML 1SK1A 2H70A 4DSSB 2LJKA 4MCUA 4LL4B 5IMAA 1GSQA 3KD0A 3LFLA 2GSRA 4KB3A 1Z7PA 5FT3A 1JLWA 3F6FA 2WGRA 3O76A 4H86A 2YOIA 2H75A 4I2UA 2GSSA 1M2BA 3G7YA 4L5OA 4GQFA 1R5PA 3O6TA 1KTEA 4NV5A 2VCXA 5DQSA 2V1MA 3UVTA 4K9ZA 18GSA 1LBKA 2JADA 4ZL7A 2LTKA 4D73A 1XVQA 2CA8A 2J9HA 3UL3A 4ULXA 2X8CA 2G0FA 3HDCA 3TDGA 4HI7A 3L9UA 6GSVA 5ECIB 2C1YA 2YANA 4HJ2A 3DYRA 2K18A 5ECMB 1XOAA 1G6WA 5DCGA 1TI3A 2YPMA 1OKDA 1EP8A 1O85A 2RM5A 2GT6A 4RQXA 3KIJA 5ECRB 4MABA 4GSTA 1F9MA 2FD3A 2PU9C 5ABRA 3WGEA 1GNEA 2IPAA 2N5BA 2YP6A 4ZL8A 2FWEA 3M8NA 1OKTA 1SU9A 5DDLA 3UEMA 3IC4A 3ZVJD 2B7KA 4V1Ap 3E9JB 4GLTA 5E59A 3QR6A 3DD3A 5DALA 5B6MA 2H8LA 3ZIJA 2G2QA 3TOUA 5EVOA 1UN2A 2OKAA 1GSDA 6GSTA 3EU4A 3L4NA 4KAEA 1T00A 3GFKA 4LA1A 4BWQA 3IK9A 5JWQB 4WF4A 5F0GA 3WD6A 4WR5A 5J4UA 1XOBA 2E7PA 1OE7A 2JZRA 4IKHA 4BVXA 2E2GA 1TDIA 2L4CA 5DQYA 2OBKA 4BWSA 5CRDA 5CRGA 3FZAA 2X99A 4DSSA 4HUAA 2PVOC 2X64A 6GSXA 2OJLA 3E3EA 1XW6A 3IA1A 2NDOA 4WKWA 2IJYA 2EIOA 2R3XA 2BJXA 3KJYA 3GA4A 4V1Ag 1TRUA 3F4RA 2JZTA 1BYEA 5CNWA 2OE3A 1A8LA 1FW1A 3GKMA 2H73A 1O81A 2FWHA 3ZREA 2HNLA 4DSRA 4V2LA 3U6VA 1K0OA 3H79A 4TR1B 3GTUA 3GX8A 5LCZA 2HXKA 3APSA 1ST9A 2H0GA 2P31A 4N10A 3HVXA 1RQMA 1XW9A 5C04A 2V41A 4G9HA 1X5EA 2WCIA 2JSYA 2ON7A 3WT2A 4OD7A 3RAZA 1TU8A 5FWGA 1WE0A 2BMXA 5ECKB 2CQ9A 4N0VA 4EO3A 1DE2A 1M0UA 1NHYA 4Z7XA 5KN1A 2DJJA 4ZB8A 1UA5A 5HR0A 2PMTA 1NM3A 5ECNB 2F3MA 2HRNA 2J23A 1Z5YE 1XWAA 2GVPA 2VCQA 3KTBA 2GS3A 2AUVA 2WB9A 3DMLA 3ZZXA 1K3LA 2VAFA 3ME7A 4WBJA 5H5QA 4AGSA 3TKRA 2JL4A 1PQNA 3HCZA 4MH2A 2FA4A 5DAKB 2KOKA 3MDKA 3UARA 3M9KA 2LV3A 5J41A 5DJMA 4IJ3A 2B7JA 4GRFA 5EL8A 4ML6A 1TXXA 2VD0A 3FW2A 4NV2A 1ON4A 2YWNA 3BCIA 1K0NA 4EL1A 2CVDA 2GLRA 3ZLPA 1NW2A 1ZYQB 3TB2A 3APOA 2RLIA 2I3YA 1GLQA 5J9CA 1TKDB 2VL2C 1J08A 2FHEA 5HFGA 5LD0A 1U3IA 5GZZB 1BJXA 5D9TA 5IOXA 4J56E 5ENUA 1ERWA 4E8HA 5LNKe 4MZBA 3GUSA 3CTGA 2M72A 1SD8A 3P8WA 4TR1A 4NMUA 4TVEA 1RK4A 1ERUA 4ZXGA 1YDKA 1PD21 3LYPA 1GRXA 4OFTA 1Y25A 1V58A 5F07A 2LSTA 3GN3A 4NAXA 4HU9A 1BEDA 5FHIA 4POKA 2IIYA 4MH3A 1A8YA 2C0DA 4AJ8A 1TRWA 2I9HA 5ECOB 3HVVA 5HQPA 3IE3A 1PL1A 4XRAA 2MMAA 4MZWA 4POBA 3M1GA 3ZMKA 5HFKA 2H1AA 3VWUA 4DEJA 2E0QA 3KGKA 1GTAA 3IAS2 3U5RE 3G7IA 1GLPA 1JZOA 4LMWA 2WRTA 5J9BA 4MDCA 1Z3EA 1OVNA 1OC8A 2H66A 4KSMA 3TKPA 3IAM2 1T1VA 4F0BA 4J57E 2YN1A 3TKSC 1TJDA 3DWVA 2JZSA 4FYCA 4N30A 3P7XA 4KGIA 4G19A 2P5RA 4EXJA 5B8BA 2B5XA 2VCVA 5F06A 3QFAC 3KEBA 3I9V2 3ZIVA 4YAVA 2M80A 1IYIA 2PWJA 4KUNA 1FG4A 3F0IA 5DAKA 2MMZA 1OC3A 3DVXA 5CRHA 5IPHA 2YJ7A 3IBHA 3HHVA 4ECJA 1R26A 2AHEA 1VGLA 2TIRA 2QC7A 5KEJA 2M46A 1SK0A 3VI7A 5ELGA 3ZMLA 5A5KA 1XWBA 3MSZA 2JSZA 4ECCA 2LJRA 4I8BA 2C0GA 4EDYA 1A0RP 5G5EA 4HU7A 2IN3A 1JLVA 4F82A 2DJ0A 2FA8A 3WGDA 2L6CA 1THOA 2HFDA 3I69A 3CRTA 2H6YA 3W6GA 1K0MA 4D73B 1O6JA 3CRUA 3ZTLA 3RHBA 1TK5B 4TR4A 2YNXA 3VURA 4OO5A 2LNTA 2F51A 3F4SA 3L9SA 3P90A 1V9WA 4K6XA 5J3RA 3QD9A 1X9SB 3WYWA 4PX1A 4AJ7A 2HZEA 2CVKA 2C8UA 2N5AA 1KEBA 1GH2A 1T8EB 1EV9A 4PQHA 3VFIA 1HD2A 3G9BA 4GF0A 12GSA 5IQYA 2R37A 1R5AA 1QXHA 3I6AA 3BD2A 2YZUA 2HSHA 3UBLA 3S9FA 1XWGA 1N2AA 1MDKA 5HR1A 3VPTA 4ACSA 1FVJA 5D8IA 2DBCA 4AJ6A 3V1WA 1OE8A 3N9JA 2VLUA 2WULA 1WP0A 1YKAA 2LS5A 3KP9A 1EGOA 1KNGA 2LNSA 1YEPA 4WR4A 3TKQA 4EVMA 4TW5A 1DSBA 5DCHA 5AGYA 4QL9A 4YH2A 1X0RA 3F3RA 1GSSA 3UBKA 4IP6A 4MZCA 3C1RA 5AN1A 5IO0A 1PN9A 1T4ZA 3QMXA 4IN0A 2B1LA 3HZ8A 2JU5A 4BA7A 1EGRA 3IK7A 3F3QA 1BG5A 2RM6A 4QQ7A 5ECPB 5A4VA 4KDUA 2KP1A 1K0CA 2YWIA 2GQMA 1ACVA 2YV9A 5A4WA 2VLVA 5IMCA 1ZOFA 3P2AA 3ZFLA 3HA9A 2QGVA 4IELA 3RHCA 4WETA 3GMFA 2IMKA 4ZB9A 5C00A 4PGTA 1SK2A 3Q18A 1GSYA 5CO3A 5ECLB 2MZCA 4PQIA 1TTZA 3D21A 3GTUB 2H76A 3BBYA 1G0TA 3HD5A 4X0XA 3H93A 5CREA 4IQAA 2N5FA 1DUGA 1E2YA 1IYHA 6GSWA 1B4QA 2K6VA 3D5JA 3FHKA 4RUVA 5D96A 4OCFA 2CV4A 1ILOA 1V40A 2F8FA 3TJJA 2HT9A 4ML1A 4F9ZA 2DMMA 22GSA 1TOFA 1F2EA 3C8EA 1YF1A 4MJCA 3GKKA 8GSSA 4XS6A 5IMVA 1AQWA 3QFBC 5IO2A 1EOHA 1M9BA 3DRNA 1MD4A 3IV4A 1XVWA 3HZ4A 3L0HA 3L9VA 4K1FA 2MBSA 2ALBA 4MJAA 3LQ7A 2GQLA 2CAQA 2DIZA 3GIXA 3FKFA 4I97A 1HNCA 3KM6A 1HNAA 2IMIA 2LQOA 4GSNA 4MF6A 2DJKA 3BCKA 2CAIA 1XXUA 5ID2B 1VF1A 2R2JA 5B6NA 4F03A 5G5FA 3EU3A 1NSWA 4YAPA 3GX0A 1QGVA 4LMVA 3EVIA 1X9WB 4QL7A 5ECHB 3C1SA 1RW1A 3APQA 2ON5A 2TRXA 1PRXA 2A2RA 1PKWA 2V32A 1Q4JA 2H1DA 3VWVA 2HZFA 5KN3A 2V6KA 1ABAA 4KCAA 2C3NA 2AAWA 4FYBA 4IP1A 1PX6A 1GTUA 2FWGA 2VM2A 2L5LA 3GHAA 1A23A 1AAZA 4WBRD 4XTSA 3H4KA 3M3MA 1XCCA 1XZOA 3EURA 4IJIA 4Q5QA 4WF5A 2GSQA 2IMDA 3KTLA 4MJBA 5IMZA 1YJ6A 1Z9HA 3FZ5A 4RQRA 4KW6A 4KCEA 2H1BA 1U87A 5HR2A 4BVYA 2LEGA 1G7EA 2RUFA 3ZL5A 1VF4A 3G7JA 4ZILA 3HYPA 3N5OA 4OFMA 2V2GA 2L59A 3GH9A 4XCSA 4XHMA 1LU4A 1W89A 1VF2A 4FH8A 3H8QA 9GSSA 4NPBA 4I6XA 1O8XA 1WOUA 3ME8A 4I2TA 3ERFA 2R4VA 5B8AA 2REMA 1S3CA 3SWLA 3IOSA 3US3A 2PGTA 3CXGA 1W4VA 4MLYA 1Z7RA 2AV4A 5IIZA 4KE3A 1B9XC 3ZITA 5F8BA 6GSUA 2ZCTA 4FO5A 4TKYA 4F2IA 5ECSA 3LXTA 3IDVA 2OE0A 4K0GA 2VCZA 1OC9A 3A2WA 1XPVA 3GURA 5ID2A 1ZL9A 1QFNA 4JEDA 3L78A 2PPTA 2JACA 3QAWA 1NHOA 3KMOA 2NPBA 1XBSA 2O8VB 5ECQB 2FWFA 3D4TA 1K0DA 4JR6A 4O7HA 2LJAA 2DMLA 1JZRA 2XHFA 2XBQA 1MDJA 2I4AA 3LEFA 4ISDA 2YWMA 3TRQA 4PUAA 1AQXA 2QKEA 4IGJA 2DC5A 3D0ZA 3A5WA 3ZYWA 2XBIA 3D4MA 4CHSA 1T4YA 2P5QA 3VPQA 13GSA 19GSA 2P0GA 3LWAA 4DVCA 5IOWA 2A2SA 4YQMA 4OFNA 2DIYA 2FCHA 2IFQB 1EZKA 4IVFA 2H72A 3FEUA 4YQVA 1ZCPA 2NVLA 1A2JA 1MTCA 4LL1B 1HQOA 1GNWA 3DXBA 1GL8A 1QQ2A 2HI7A 4Q5RA 4KH7A 4ECBA 2HZEB 10GSA 4DSQA 4Q5FA 3QCPA 5D73A 3W8SA 4MF7A 5JCWA 5KN2A 1SENA 2B6MA 2B5EA 4KDXA 2YZHA 5ELAA 3UAPA 1SJIA 3EC3A 3GV1A 5D93A 3BOAA 4FYUA 2HRFA 4PNFA 1GSEA 4I5QA 1PGTA 1KBNA 4TR3A 1HYUA 1N8JA 2GTUA 1TU7A 4CDOA 4NHWA 3HVSA 4EUYA 4HJMA 3FZ4A 1GTIA 3M0FA 1WWJA 2HYXA 3CSHA 3D22A 4MPFA 2F9SA 2VM1A 1GULA 3HKRA 3VWXA 1X9MB 2QSIA 2O7KA 3DIEA 1AC1A 2ES7A 1YZXA 17GSA 1URMA 4PNGA 2GZYA 1U88A 2LRCA 5GSSA 1THXA 1OYJA 1QUWA 4L0WA 3K8NA 1GSFA 2PVQA 3UVHA 3F6DA 3PR8A 2L5OA 2IMFA 4PXOA 1QMVA 4XRDA 4E8EA 4JU5A 5G1KA 1S3DA 4O92A 3Q74A 3MWHA 3UIWA 1HNBA 2OBIA 1WRYA 5G1LA 3IR4A 2PUKC 4K0NA 1TP9A 4JBBA 1V57A 2IFQA 1O7UA 4N11A 2PBJA 3I43A 2H71A 5DJLA 4EE0A 5JCUA 11GSA 1PMTA 3DGQA 2AJQB 3EMPA 3EMXA 4POMA 3KCMA 2FUG2 7GSSA 1B4PA 5JWRB 3FY7A 3LGCA 4GQCA 3F9UA 3FZ9A 3TKSE 4XS4A 5CP1A 3CTFA 6GSSA 3Q6OA 2OADA 3HY2A 3ZVJA 3LYKA 6GSYA 4EF0A 2WZ9A 1B9YC 1GSUA 2VOCA 1GP1A 1QK8A 4KX4A 3MNGA 1SL2B 1FB0A 3LORA 2C4JA 2IWTA 3C73A 4XS1A 1K0BA 1SYXA 4F0CA 4IBPA 3MAKA 2CVBA 3EWLA 2L4QA 1GUHA 1AXDA 2GZPA 3GRXA 5AIXA 1H75A 1YKCA 2VUPA 3HJPA 2O87A 4K7IA 1EEJA 1FO5A 3TJKA 1F6MC 2PN8A 4KA0A 1DBYA 3ED3A 3TJBA 5E4WA 1PA3A 4IW9A 3C71A 1YEXA 1FAAA 1M99A 1X5CA 2OE1A 2RIIA 3KZQA 3KH9A 1V2AA 1TRSA 2CX3A 2H1GA 1SL0B 1FB6A 2DJ1A 2WDUA 4K8MA 4ILFA 3A2XA 5CYYA 3SBCA 4KDYA 5G2ZA 2VLTA 2KP2A 4J2FA 5GSTA 1JHBA 1V98A 1PL2A 1ZGNA 2FGXA 2H0HA 4OMVA 5H5RA 3KXOA 3ERGA 4MJEA 3H1NA 1GUMA 4WXTA 2DLXA 1A24A 2BTOT 1XIYA 2GQKA 2VO4A 4POLA 2I81A 5G30A 3HJMA 5L71A 4KNDA 4PQ1A 2OACA 1K0AA 1A2LA 1EWXA 2C3TA 4PURA 5DBQA 2CT6A 5HFIA 4RI7A 1BX9A 1FVKA 2XPEA 3GSTA 4GWRA 2O85A 4JZQA 2IL3A 1TK8B 1GUKA 4OO4A 4TXOA 4IQ1A 4TXVA 1K3OA 3GL3A 1YF0A 4BL7A 3PH9A 3Q19A 4EDZA 5EPFA 2E2MA 4O32A 1BAYA 2Z9SA 4MP4A 2X8GA 4ID0A 2H0IA 1U3AA 2C3QA 1TW9A 3GKXA 1B48A 1FHEA 1AIUA 2LQQA 3J7Yk 2YJHA 4GTUA 3CYNA 3TRXA 1SJZA 2R6KA 1ERTA 1ZYEA 2VIMA 4ECIA 3J7Yb 3EYTA 1O73A 2ZNMA 1ZMAA 2A4VA 4ZBAA 2HLSA 5J5NA 1OC9B 3VK9A 3IHQA 3W8JA 3GNJA 2K8SA 3FR3A 4OWYA 5COHA 1EOGA 4JE1A 2XPDA 3QAVA 4L0UA 1J0FA 1EP7A 3D6IA 3ZFBA 5HR3A 5F05A 3NIVA 1G6YA 2B5YA 2L57A 4TRXA 3CBUA 3ZRDA 2YV7A 3GKNA 1FOVA 2X8HA 4TR0A 1X5DA 4Q5NA 3IXRA 4AF2A 1SL1B 2EC4A 3GH6A 4NWYA 5DVBA 3LG6A 2DJ3A 1TI1A 3RPNA 2NTOA 3VWWA 1Y6EA 2C80A 2K8VA 3CSIA 5IPGA 1XWKA 3TCOA 3HJOA 5D9XA 1M2AA 2DJ2A 3KMNA 4ZIJA 5AISA 2K9FA 5B7CA 1F3BA 5EY6A 1H4OA 3F63A 2YCDA 1SD9A 2VL2A 3NZNA 3NOFA 1DE1A 2YWOA 2HE3A 3QPMA 4JRRA 4MF5A 1E6BA 1F37A 2LRNA 2EIRA 5A4UA 2V6OA 3F4TA 1VRSD 1JZDA 1UC7A 1TK0B 1PKZA 5D9WA 1PX7A 4HS1A 1O8WA 2C0FA 3R2QA 1JFUA 3TUEA 1K3YA 2KLXA 1VF3A 1I5GA 1JZWA 3KH7A 2FY6A 3RDWA 2MMOA 1TRVA 2H6ZA 2H30A 2XC2A 1GTBA 5KN0A 2VL3A 4MMMA 3GL5A 1OAZA 1SYRA 3TJGA 3TKSA 2MMNA 2DSAA 2HSYA 1SJ6A 1WMJA 1S3AA 4O5RA 3VLNA 3QOUA 1U6TA 3PGTA 1EEMA 3A2VA 3TJFA 3ISOA 4ZBBA 1M2DA 1CQGA 2PERA 4GXZA 2MBTA 2FLSA 5AIVA 1ML6A 2C0EA 3AY8A 2CX4A 2LUSA 3PINA 3UJ1A 1T3BA 2IMEA 1ERVA 3IPZA 1YQ1A 3FR9A 1Z6MA 1R4WA 1AQVA 3ERWA 1MDIA 3VI5A 4XS4B 2B3SA 4IS0A 3EINA 4TN8A 4GCIA 3BJ5A 4KSOA 2OA7A 3LXZA 2GZZA 4HDEA 1XFLA 4L8EA 3DEXA 4GSSA 3A3TA 1AW9A 4ZL9A 1LJRA 5INYA 2H01A 3EE2A 3GSSA 3WT1A 5H5SA 1WJKA 1USBA 1A0FA 3E0UA 2VCTA 1YY7A 2CZ3A 4IHUA 4X1UA 4ZB6A 3FK8A 2MYGA 2KUCA 3HXSA 4V2NA 1BQ7A 4ZBDA 2O89A 4YQUA 4HQSA 2WJUA 3CSJA 5IMFA 2GT5A 2VL9A 3F8UA 3DKSA 2TRCP 1G7OA 4EC0A 4HQZA 2H6XA 4CW9A 1SKWB 2R5GA 2KHPA 1MD3A 4MPGA 2VD1A 2FNOA 2VCWA 4G2EA 5D9VA 20GSA 3FRCA 1EV4A 3CMIA 2WFCA 3DVWA 1XW5A 4PUFC 3UOMA 1M9AA 1C72A 1MEKA 1R7HA 4K7OA 3O3TA 2AB6A 5CAXA 2L6DA 4JR4A 1Q98A 3GYKA 2LRTA 2H19A 2I1UA 3M9JA 1I9DA 16GSA 1AUCA 4TOPA 5JWOB 4K2DA 5IM9A 4X43A 3FYGA 3QAGA 3LSZA 4NHZA 4RI6A 3TRPA 4K7NA 4HOJA 1SKRB 1F3AA 1Z6NA 3RPPA 4WEYA 4G10A 4HEA2 1B8XA 1ZZYA 4LLRA 4MA9A 4TXOB 5IMDA 3TGZA 2EIQA 1CQHA 4NXIA 2ZUPA 4BPYA 5G31A 3OR5A 4L5LA 1A2MA 4MK3A 4FIWA 3RBTA 4HZ4A 3IRAA 4HZ2A 3UMAA 4XIHA 1UVZA 2F8AA 2H74A 1T7PB 1XWCA 1WPIA 3LJRA 2WS2A 2GGTA 2AYTA 2D2ZA 14GSA
chains in the Genus database with same CATH superfamily
5DALB 5GAPD 4P3YB 4V2MA 2B1KA 3TOTA 1WIKA 1M7TA 3C7MA 2GDRA 1SKSB 4EKZA 3KP8A 5CRWA 2GSTA 3FR6A 4OCEA 1PSQA 2LKUA 5GAND 5JCGA 3WGXA 2NBSA 4G0IA 2RUEA 4N0ZA 3QDNA 1GWCA 1J9BA 2CZ2A 3JCML 1SK1A 2H70A 2R0GA 4DSSB 2LJKA 3A5IA 4MCUA 4LL4B 1ZYNA 5IMAA 3EPTA 1GSQA 3KD0A 3LFLA 2GSRA 4KB3A 1Z7PA 5FT3A 1JLWA 3F6FA 2WGRA 3O76A 4H86A 2YOIA 2H75A 4I2UA 2GSSA 1M2BA 3G7YA 1PFOA 4L5OA 4GQFA 1R5PA 3O6TA 1KTEA 4NV5A 2VCXA 5DQSA 2V1MA 3UVTA 4K9ZA 18GSA 1LBKA 2JADA 4ZL7A 2LTKA 4D73A 1XVQA 2CA8A 2J9HA 3UL3A 4ULXA 2X8CA 2G0FA 3HDCA 3TDGA 4HI7A 3L9UA 6GSVA 5ECIB 2C1YA 3MYDA 2YANA 4HJ2A 3DYRA 2K18A 5ECMB 1XOAA 1G6WA 5DCGA 1TI3A 2YPMA 1OKDA 1EP8A 1O85A 2RM5A 2GT6A 4RQXA 3KIJA 5ECRB 4MABA 4GSTA 1F9MA 2FD3A 2PU9C 4YKFA 3WGEA 5ABRA 1GNEA 2IPAA 2N5BA 2YP6A 4ZL8A 2R0CA 2FWEA 3M8NA 1OKTA 1SU9A 5DDLA 3UEMA 3IC4A 3ZVJD 2B7KA 4V1Ap 3E9JB 4GLTA 5E59A 3QR6A 3DD3A 5DALA 5B6MA 2H8LA 3ZIJA 2G2QA 3TOUA 5EVOA 1UN2A 2OKAA 1GSDA 6GSTA 3EU4A 3L4NA 4KAEA 1T00A 3GFKA 4LA1A 4BWQA 1M3IA 3IK9A 5JWQB 5BRTA 4WF4A 5F0GA 3WD6A 4WR5A 5J4UA 1XOBA 2E7PA 1OE7A 2JZRA 4IKHA 4BVXA 2E2GA 1TDIA 2L4CA 5DQYA 2OBKA 4BWSA 5CRDA 5CRGA 3FZAA 2X99A 4DSSA 4HUAA 2QA2A 2PVOC 2X64A 6GSXA 2OJLA 3E3EA 1XW6A 3IA1A 2NDOA 4WKWA 2IJYA 1S3RA 2EIOA 2R3XA 2BJXA 3KJYA 5KOXA 4Z2TA 3GA4A 4V1Ag 2DKIA 1TRUA 3F4RA 2JZTA 1BYEA 5CNWA 2OE3A 1A8LA 1FW1A 3GKMA 2H73A 3LW9A 1O81A 2FWHA 3ZREA 2HNLA 4DSRA 4V2LA 3U6VA 1K0OA 3H79A 4TR1B 3GTUA 3GX8A 5LCZA 2HXKA 3APSA 1ST9A 2H0GA 2P31A 4N10A 3HVXA 1RQMA 1XW9A 5C04A 2V41A 4G9HA 1X5EA 2WCIA 2JSYA 2ON7A 3WT2A 4OD7A 3RAZA 1TU8A 5FWGA 1WE0A 2BMXA 5ECKB 2CQ9A 4N0VA 4EO3A 1DE2A 1M0UA 1NHYA 4Z7XA 5KN1A 2DJJA 4ZB8A 1UA5A 5HR0A 2PMTA 1NM3A 5ECNB 2F3MA 2HRNA 2J23A 1Z5YE 1XWAA 2GVPA 2VCQA 3KTBA 2GS3A 2AUVA 2WB9A 3DMLA 3ZZXA 1K3LA 2VAFA 3ME7A 3MIXA 4WBJA 5H5QA 4AGSA 3TKRA 2JL4A 1PQNA 3HCZA 4MH2A 2FA4A 5DAKB 2KOKA 3MDKA 3UARA 3M9KA 2LV3A 5J41A 3IHGA 5DJMA 4IJ3A 2B7JA 4GRFA 5EL8A 4ML6A 1TXXA 2VD0A 3FW2A 4NV2A 1ON4A 2YWNA 2A4HA 1K0NA 3BCIA 4EL1A 1ZYPA 2CVDA 2GLRA 3ZLPA 1NW2A 1ZYQB 3TB2A 3APOA 2RLIA 2I3YA 1GLQA 5J9CA 1TKDB 4KF9A 2VL2C 1J08A 2FHEA 5HFGA 5LD0A 1U3IA 5GZZB 1BJXA 5D9TA 5IOXA 4J56E 5ENUA 1ERWA 4E8HA 5LNKe 4MZBA 3GUSA 3CTGA 2M72A 1SD8A 3P8WA 4TR1A 4NMUA 4HSCX 1RK4A 1ERUA 4TVEA 4ZXGA 1YDKA 1PD21 3LYPA 1GRXA 4OFTA 1Y25A 1V58A 5F07A 2LSTA 3GN3A 4NAXA 4HU9A 1BEDA 5FHIA 4POKA 2IIYA 4MH3A 1A8YA 2C0DA 4AJ8A 1TRWA 2I9HA 5ECOB 2HRAA 3HVVA 5HQPA 3IE3A 1PL1A 4XRAA 2MMAA 4MZWA 4POBA 3M1GA 3ZMKA 5HFKA 2H1AA 3VWUA 4DEJA 2E0QA 3KGKA 1GTAA 3IAS2 3U5RE 3HVNA 3G7IA 1GLPA 1JZOA 4LMWA 2WRTA 5J9BA 4MDCA 1Z3EA 1OVNA 1OC8A 2H66A 4KSMA 3TKPA 3IAM2 1T1VA 4F0BA 4J57E 2YN1A 3TKSC 1TJDA 3DWVA 4K5SA 2JZSA 4FYCA 4N30A 3P7XA 4KGIA 4G19A 2P5RA 4EXJA 5B8BA 2B5XA 2VCVA 5F06A 3QFAC 3KEBA 3I9V2 3ZIVA 4EIQA 4YAVA 2M80A 1IYIA 2PWJA 4KUNA 1FG4A 3F0IA 5DAKA 2MMZA 1OC3A 3DVXA 5CRHA 5IPHA 2YJ7A 3IBHA 3HHVA 4ECJA 1R26A 2AHEA 1VGLA 2TIRA 2QC7A 5KEJA 2M46A 1SK0A 3VI7A 5ELGA 3ZMLA 5A5KA 1XWBA 3MSZA 2JSZA 4ECCA 2LJRA 4I8BA 2C0GA 4EDYA 1A0RP 5G5EA 4HU7A 2IN3A 1JLVA 4F82A 2DJ0A 2FA8A 3WGDA 2L6CA 1THOA 2HFDA 3I69A 3CRTA 2H6YA 3W6GA 1K0MA 4D73B 1O6JA 3CRUA 3ZTLA 3RHBA 1TK5B 4TR4A 2YNXA 3VURA 4OO5A 2LNTA 2F51A 3F4SA 3L9SA 3P90A 1V9WA 4K6XA 5J3RA 3QD9A 1X9SB 3WYWA 4PX1A 4AJ7A 2HZEA 2CVKA 2C8UA 4EIPA 2N5AA 1KEBA 1GH2A 1T8EB 1EV9A 4PQHA 3VFIA 1HD2A 3G9BA 2HSMA 4GF0A 3IC8A 12GSA 5IQYA 2R37A 1R5AA 1QXHA 3I6AA 3BD2A 3R3EA 2YZUA 2HSHA 3UBLA 3S9FA 1XWGA 1N2AA 1MDKA 5HR1A 3VPTA 4ACSA 1FVJA 5D8IA 2DBCA 4AJ6A 3V1WA 1OE8A 3N9JA 2VLUA 2WULA 1WP0A 1YKAA 2LS5A 3KP9A 1EGOA 1KNGA 2LNSA 1YEPA 4WR4A 3TKQA 4K5RA 4EVMA 4TW5A 1DSBA 5DCHA 4BVXB 5AGYA 4QL9A 4YH2A 1X0RA 3F3RA 1GSSA 3UBKA 4IP6A 4MZCA 3C1RA 5AN1A 5IO0A 1PN9A 4O5QA 1T4ZA 4PTSA 3QMXA 4IN0A 2B1LA 3HZ8A 2JU5A 4BA7A 4MNNA 1EGRA 3IK7A 3F3QA 1BG5A 2RM6A 4QQ7A 5ECPB 5A4VA 4KDUA 2KP1A 1K0CA 2YWIA 2GQMA 1ACVA 2YV9A 5A4WA 2VLVA 5IMCA 1ZOFA 3P2AA 3ZFLA 3HA9A 2QGVA 4IELA 3RHCA 4WETA 3GMFA 2IMKA 4ZB9A 5C00A 4PGTA 1SK2A 3Q18A 1GSYA 5CO3A 5ECLB 2MZCA 4PQIA 1TTZA 3D21A 3GTUB 4YKGA 2H76A 3BBYA 1G0TA 3HD5A 4X0XA 3H93A 5CREA 4IQAA 2N5FA 1DUGA 1E2YA 1IYHA 6GSWA 1B4QA 2K6VA 3D5JA 3FHKA 4RUVA 5D96A 4OCFA 2CV4A 1ILOA 4BVYB 1V40A 2F8FA 3TJJA 2HT9A 4ML1A 4F9ZA 2DMMA 22GSA 1TOFA 1F2EA 3C8EA 1YF1A 2DKHA 4X4JA 4MJCA 3GKKA 8GSSA 4XS6A 5IMVA 1AQWA 3QFBC 5IO2A 1EOHA 1M9BA 3DRNA 1MD4A 3IV4A 1XVWA 3HZ4A 3L0HA 3L9VA 4K1FA 2MBSA 2ALBA 4CY6A 4MJAA 3LQ7A 2GQLA 2CAQA 2DIZA 3GIXA 3FKFA 4I97A 1HNCA 2QA1A 3KM6A 1HNAA 2IMIA 2LQOA 3CQFA 4GSNA 4MF6A 2DJKA 3BCKA 2CAIA 1XXUA 5ID2B 1VF1A 2R2JA 5B6NA 4F03A 5G5FA 3EU3A 1NSWA 4YAPA 3GX0A 1QGVA 4LMVA 3EVIA 1X9WB 4QL7A 5ECHB 3C1SA 1RW1A 3APQA 2ON5A 2TRXA 1PRXA 2A2RA 1PKWA 2V32A 1Q4JA 2H1DA 3VWVA 2HZFA 5KN3A 2V6KA 1ABAA 4KCAA 2C3NA 2AAWA 4FYBA 4IP1A 1PX6A 1GTUA 2FWGA 2VM2A 2L5LA 3GHAA 1A23A 1AAZA 4WBRD 4XTSA 3H4KA 3M3MA 1XCCA 1XZOA 3EURA 4IJIA 4Q5QA 4WF5A 2GSQA 2IMDA 3KTLA 4MJBA 5IMZA 1YJ6A 1Z9HA 3FZ5A 4RQRA 1FOHA 4KW6A 4KCEA 2H1BA 1U87A 5HR2A 4BVYA 2LEGA 1G7EA 2RUFA 3ZL5A 1VF4A 3G7JA 4ZILA 3HYPA 3N5OA 4OFMA 2V2GA 2L59A 3GH9A 4XCSA 4XHMA 1LU4A 1W89A 1VF2A 4FH8A 3H8QA 4O5UA 9GSSA 4NPBA 4I6XA 1O8XA 1WOUA 3ME8A 4I2TA 3ERFA 2R4VA 5B8AA 2REMA 1S3CA 3SWLA 3IOSA 3US3A 2PGTA 3CXGA 1W4VA 4MLYA 1Z7RA 2AV4A 5IIZA 4KE3A 1B9XC 3ZITA 5F8BA 6GSUA 2ZCTA 4FO5A 4TKYA 4F2IA 5ECSA 3LXTA 3IDVA 2OE0A 4K0GA 2VCZA 1OC9A 3A2WA 1XPVA 3GURA 5ID2A 1ZL9A 1QFNA 4JEDA 3L78A 2PPTA 2JACA 3QAWA 1NHOA 3KMOA 2NPBA 1XBSA 2O8VB 5ECQB 2FWFA 3D4TA 1K0DA 4JR6A 4O7HA 2LJAA 2DMLA 1JZRA 2XHFA 2XBQA 1MDJA 2I4AA 3LEFA 4ISDA 2YWMA 3TRQA 4PUAA 1AQXA 2QKEA 4IGJA 2DC5A 3D0ZA 3A5WA 3ZYWA 2XBIA 3D4MA 4CHSA 1T4YA 2P5QA 3VPQA 13GSA 19GSA 2P0GA 3LWAA 4DVCA 5IOWA 2A2SA 4YQMA 4OFNA 2DIYA 2FCHA 2IFQB 1EZKA 4IVFA 2H72A 3FEUA 4YQVA 1ZCPA 2NVLA 1A2JA 1MTCA 4LL1B 1HQOA 1GNWA 3DXBA 1GL8A 1QQ2A 2HI7A 4G0LA 4Q5RA 4KH7A 4ECBA 2HZEB 10GSA 4DSQA 4Q5FA 3QCPA 5D73A 3W8SA 4MF7A 5JCWA 5KN2A 1SENA 2B6MA 2B5EA 4KDXA 2YZHA 5ELAA 3UAPA 1SJIA 3EC3A 3GV1A 5D93A 3BOAA 4FYUA 2HRFA 4PNFA 1GSEA 4I5QA 1PGTA 1KBNA 4TR3A 1HYUA 1N8JA 2GTUA 1TU7A 4FQUA 4CDOA 4NHWA 3HVSA 4EUYA 4HJMA 3FZ4A 1GTIA 3M0FA 1WWJA 2HYXA 3CSHA 3D22A 4MPFA 2F9SA 2VM1A 1GULA 3HKRA 3VWXA 1X9MB 2QSIA 2O7KA 3DIEA 1AC1A 2ES7A 1YZXA 17GSA 1URMA 4PNGA 2GZYA 1U88A 2LRCA 5GSSA 4Z2UA 1THXA 1OYJA 1QUWA 4L0WA 3K8NA 1GSFA 2PVQA 3UVHA 3F6DA 3PR8A 2L5OA 2IMFA 4PXOA 1QMVA 4XRDA 4E8EA 4JU5A 5G1KA 1S3DA 4O92A 3Q74A 3MWHA 3UIWA 1HNBA 2OBIA 1WRYA 5G1LA 3IR4A 2PUKC 4K0NA 1TP9A 4JBBA 1V57A 2IFQA 1O7UA 4N11A 2PBJA 3I43A 2H71A 5DJLA 4EE0A 5JCUA 11GSA 1PMTA 3DGQA 2AJQB 3EMPA 3EMXA 4POMA 3KCMA 2FUG2 7GSSA 1B4PA 5JWRB 3FY7A 3LGCA 4GQCA 3F9UA 3FZ9A 3TKSE 4XS4A 5CP1A 3CTFA 6GSSA 3Q6OA 2OADA 3HY2A 3ZVJA 3LYKA 6GSYA 4EF0A 2WZ9A 1B9YC 1GSUA 2VOCA 1GP1A 1QK8A 4KX4A 3MNGA 1SL2B 1FB0A 3LORA 2C4JA 2IWTA 3C73A 4XS1A 1K0BA 1SYXA 4F0CA 4IBPA 3MAKA 2CVBA 3EWLA 2L4QA 1GUHA 1AXDA 2GZPA 3GRXA 5AIXA 1H75A 1YKCA 2VUPA 3HJPA 2O87A 4K7IA 1EEJA 1FO5A 3TJKA 1F6MC 2PN8A 4KA0A 1DBYA 3ED3A 3TJBA 5E4WA 1PA3A 4IW9A 3C71A 1YEXA 1FAAA 1M99A 1X5CA 2OE1A 2RIIA 3KZQA 3KH9A 1V2AA 1TRSA 2CX3A 2H1GA 1SL0B 1FB6A 2DJ1A 2WDUA 4K8MA 4ILFA 3A2XA 5CYYA 3SBCA 4KDYA 5G2ZA 2VLTA 2KP2A 4J2FA 5GSTA 1JHBA 1V98A 1PL2A 1ZGNA 2FGXA 4BIKA 2H0HA 4OMVA 5H5RA 1XG8A 3KXOA 3ERGA 4MJEA 3H1NA 1GUMA 4WXTA 2DLXA 1A24A 2BTOT 1XIYA 2GQKA 2VO4A 4POLA 2I81A 5G30A 3HJMA 5L71A 4KNDA 4PQ1A 2OACA 1K0AA 1A2LA 1EWXA 2C3TA 4PURA 5DBQA 2CT6A 5HFIA 4RI7A 1BX9A 1FVKA 2XPEA 3GSTA 4GWRA 2O85A 4JZQA 2IL3A 1TK8B 3FMWA 1GUKA 4OO4A 4TXOA 4IQ1A 4TXVA 1PN0A 1K3OA 3GL3A 1YF0A 4BL7A 3PH9A 3Q19A 4EDZA 5EPFA 2E2MA 4O32A 1BAYA 2Z9SA 4MP4A 2X8GA 4ID0A 2H0IA 1U3AA 2C3QA 1TW9A 3GKXA 1B48A 4G0KA 1FHEA 1AIUA 2LQQA 3J7Yk 2YJHA 4GTUA 3CYNA 3TRXA 1SJZA 2R6KA 1ERTA 1ZYEA 2VIMA 4ECIA 3J7Yb 3EYTA 1O73A 2ZNMA 4Z2RA 1ZMAA 2A4VA 4ICYA 4ZBAA 2HLSA 5J5NA 1OC9B 3VK9A 3IHQA 3W8JA 3GNJA 2K8SA 3FR3A 4OWYA 5COHA 1EOGA 4JE1A 2XPDA 3QAVA 4L0UA 1J0FA 1EP7A 3D6IA 3ZFBA 5HR3A 5F05A 3NIVA 1G6YA 2B5YA 2L57A 4TRXA 3CBUA 3ZRDA 2YV7A 3GKNA 1FOVA 2X8HA 4TR0A 1X5DA 4Q5NA 3IXRA 4AF2A 1SL1B 2EC4A 4USSA 3GH6A 4NWYA 5DVBA 3LG6A 2DJ3A 1TI1A 3RPNA 2NTOA 2X4AA 3VWWA 1Y6EA 2C80A 2K8VA 3CSIA 5IPGA 1XWKA 3TCOA 3HJOA 5D9XA 1M2AA 2DJ2A 3KMNA 4ZIJA 5AISA 2K9FA 5B7CA 1F3BA 5EY6A 1H4OA 3F63A 2YCDA 1SD9A 2VL2A 3NZNA 3NOFA 1DE1A 2YWOA 2HE3A 3QPMA 4JRRA 4MF5A 1E6BA 1F37A 2LRNA 2EIRA 5A4UA 2V6OA 3F4TA 1VRSD 1JZDA 1UC7A 1TK0B 1PKZA 5D9WA 1PX7A 4HS1A 1O8WA 2C0FA 3R2QA 1JFUA 3TUEA 1K3YA 2KLXA 1VF3A 1I5GA 1JZWA 3KH7A 2FY6A 2UZ8A 3RDWA 2MMOA 1TRVA 2H6ZA 2H30A 2XC2A 1GTBA 5KN0A 2VL3A 4MMMA 3GL5A 4CY8A 1OAZA 1SYRA 5KOWA 3TJGA 3TKSA 2MMNA 2DSAA 2R0PA 2HSYA 1SJ6A 1WMJA 5BMUA 1S3AA 4O5RA 3VLNA 3QOUA 1U6TA 3PGTA 1EEMA 3A2VA 3TJFA 3ISOA 4ZBBA 1M2DA 1CQGA 2PERA 4GXZA 2MBTA 2FLSA 5AIVA 1ML6A 2C0EA 3AY8A 2CX4A 2LUSA 3PINA 4K2XA 3UJ1A 1T3BA 2IMEA 1ERVA 3IPZA 1YQ1A 1M3JA 3FR9A 1Z6MA 1R4WA 1AQVA 3ERWA 2X49A 1MDIA 3VI5A 4XS4B 2B3SA 4IS0A 3EINA 4TN8A 4GCIA 3BJ5A 4KSOA 2OA7A 3LXZA 2HRKA 2GZZA 4HDEA 1XFLA 4L8EA 3DEXA 4GSSA 3A3TA 1AW9A 4ZL9A 1LJRA 5INYA 2H01A 3EE2A 3GSSA 3WT1A 5H5SA 1WJKA 1USBA 1A0FA 3E0UA 2VCTA 1YY7A 2CZ3A 4IHUA 4X1UA 4ZB6A 3FK8A 2MYGA 2KUCA 3HXSA 4V2NA 1BQ7A 4ZBDA 2O89A 4YQUA 4HQSA 2WJUA 3CSJA 5IMFA 2GT5A 2VL9A 3F8UA 3DKSA 2TRCP 1G7OA 4EC0A 4HQZA 2H6XA 4CW9A 1SKWB 2R5GA 2KHPA 1MD3A 4MPGA 2VD1A 2FNOA 2VCWA 4G2EA 5D9VA 20GSA 3FRCA 1EV4A 3CMIA 2WFCA 3DVWA 1XW5A 4PUFC 3UOMA 1M9AA 1C72A 1MEKA 1R7HA 4K7OA 3O3TA 2AB6A 5CAXA 2L6DA 4JR4A 1Q98A 3GYKA 2LRTA 2H19A 2I1UA 3M9JA 1I9DA 16GSA 1AUCA 4TOPA 5JWOB 4K2DA 5IM9A 4X43A 3FYGA 3QAGA 3LSZA 4NHZA 4RI6A 3TRPA 4K7NA 4HOJA 1SKRB 1F3AA 1Z6NA 3RPPA 4WEYA 4G10A 4HEA2 1B8XA 4A5PA 1ZZYA 4LLRA 4MA9A 4TXOB 5IMDA 3TGZA 2EIQA 1CQHA 4NXIA 2ZUPA 4BPYA 4BL7B 5G31A 3OR5A 4L5LA 1A2MA 4MK3A 4FIWA 3RBTA 4HZ4A 3IRAA 2A2PA 4HZ2A 3UMAA 3PPUA 4XIHA 1UVZA 2F8AA 2H74A 1T7PB 1XWCA 1WPIA 3LJRA 2WS2A 2GGTA 2AYTA 2D2ZA 14GSA
chains in the Genus database with same CATH topology
5DALB 5GAPD 4P3YB 4V2MA 2B1KA 3TOTA 1WIKA 1M7TA 3C7MA 2GDRA 1SKSB 4EKZA 3KP8A 5CRWA 2GSTA 3FR6A 4OCEA 1PSQA 2LKUA 5GAND 5JCGA 3WGXA 2NBSA 4G0IA 2RUEA 4N0ZA 3QDNA 1GWCA 1J9BA 2CZ2A 3JCML 1SK1A 2H70A 2R0GA 4DSSB 2LJKA 3A5IA 4MCUA 4LL4B 1ZYNA 5IMAA 3EPTA 1GSQA 3KD0A 3LFLA 2GSRA 4KB3A 1Z7PA 5FT3A 1JLWA 3F6FA 2WGRA 3O76A 4H86A 2YOIA 2H75A 4I2UA 2GSSA 1M2BA 3G7YA 4L5OA 4GQFA 1R5PA 3O6TA 1KTEA 4NV5A 2VCXA 5DQSA 2V1MA 3UVTA 4K9ZA 18GSA 1LBKA 2JADA 4ZL7A 2LTKA 4D73A 1XVQA 2CA8A 2J9HA 3UL3A 4ULXA 2X8CA 2G0FA 3HDCA 3TDGA 4HI7A 3L9UA 6GSVA 5ECIB 2C1YA 3MYDA 2YANA 4HJ2A 3DYRA 2K18A 5ECMB 1XOAA 1G6WA 5DCGA 1TI3A 2YPMA 1OKDA 1EP8A 1O85A 2RM5A 2GT6A 4RQXA 3KIJA 5ECRB 4MABA 4GSTA 1F9MA 2FD3A 2PU9C 4YKFA 3WGEA 5ABRA 1GNEA 2IPAA 2N5BA 2YP6A 4ZL8A 2R0CA 2FWEA 3M8NA 1OKTA 1SU9A 5DDLA 3UEMA 3IC4A 3ZVJD 2B7KA 4V1Ap 3E9JB 4GLTA 5E59A 3QR6A 3DD3A 5DALA 5B6MA 2H8LA 3ZIJA 2G2QA 3TOUA 5EVOA 1UN2A 2OKAA 1GSDA 6GSTA 3EU4A 3L4NA 4KAEA 1T00A 3GFKA 4LA1A 4BWQA 3IK9A 5JWQB 5BRTA 4WF4A 5F0GA 3WD6A 4WR5A 5J4UA 1XOBA 2E7PA 1OE7A 2JZRA 4IKHA 4BVXA 2E2GA 1TDIA 2L4CA 5DQYA 2OBKA 4BWSA 5CRDA 5CRGA 3FZAA 2X99A 4DSSA 4HUAA 2QA2A 2PVOC 2X64A 6GSXA 2OJLA 3E3EA 1XW6A 3IA1A 2NDOA 4WKWA 2IJYA 2EIOA 2R3XA 2BJXA 3KJYA 5KOXA 4Z2TA 3GA4A 4V1Ag 2DKIA 1TRUA 3F4RA 2JZTA 1BYEA 5CNWA 2OE3A 1A8LA 1FW1A 3GKMA 2H73A 3LW9A 1O81A 2FWHA 3ZREA 2HNLA 4DSRA 4V2LA 3U6VA 1K0OA 3H79A 4TR1B 3GTUA 3GX8A 5LCZA 2HXKA 3APSA 1ST9A 2H0GA 2P31A 4N10A 3HVXA 1RQMA 1XW9A 5C04A 2V41A 4G9HA 1X5EA 2WCIA 2JSYA 2ON7A 3WT2A 4OD7A 3RAZA 1TU8A 5FWGA 1WE0A 2BMXA 5ECKB 2CQ9A 4N0VA 4EO3A 1DE2A 1M0UA 1NHYA 4Z7XA 5KN1A 2DJJA 4ZB8A 1UA5A 5HR0A 2PMTA 1NM3A 5ECNB 2F3MA 2HRNA 2J23A 1Z5YE 1XWAA 2GVPA 2VCQA 3KTBA 2GS3A 2AUVA 2WB9A 3DMLA 3ZZXA 1K3LA 2VAFA 3ME7A 3MIXA 4WBJA 5H5QA 4AGSA 3TKRA 2JL4A 1PQNA 3HCZA 4MH2A 2FA4A 5DAKB 2KOKA 3MDKA 3UARA 3M9KA 2LV3A 5J41A 3IHGA 5DJMA 4IJ3A 2B7JA 4GRFA 5EL8A 4ML6A 1TXXA 2VD0A 3FW2A 4NV2A 1ON4A 2YWNA 2A4HA 1K0NA 3BCIA 4EL1A 1ZYPA 2CVDA 2GLRA 3ZLPA 1NW2A 1ZYQB 3TB2A 3APOA 2RLIA 2I3YA 1GLQA 5J9CA 1TKDB 4KF9A 2VL2C 1J08A 2FHEA 5HFGA 5LD0A 1U3IA 5GZZB 1BJXA 5D9TA 5IOXA 4J56E 5ENUA 1ERWA 4E8HA 5LNKe 4MZBA 3GUSA 3CTGA 2M72A 1SD8A 3P8WA 4TR1A 4NMUA 4TVEA 1RK4A 1ERUA 4ZXGA 1YDKA 1PD21 3LYPA 1GRXA 4OFTA 1Y25A 1V58A 5F07A 2LSTA 3GN3A 4NAXA 4HU9A 1BEDA 5FHIA 4POKA 2IIYA 4MH3A 1A8YA 2C0DA 4AJ8A 1TRWA 2I9HA 5ECOB 2HRAA 3HVVA 5HQPA 3IE3A 1PL1A 4XRAA 2MMAA 4MZWA 4POBA 3M1GA 3ZMKA 5HFKA 2H1AA 3VWUA 4DEJA 2E0QA 3KGKA 1GTAA 3IAS2 3U5RE 3G7IA 1GLPA 1JZOA 4LMWA 2WRTA 5J9BA 4MDCA 1Z3EA 1OVNA 1OC8A 2H66A 4KSMA 3TKPA 3IAM2 1T1VA 4F0BA 4J57E 2YN1A 3TKSC 1TJDA 3DWVA 4K5SA 2JZSA 4FYCA 4N30A 3P7XA 4KGIA 4G19A 2P5RA 4EXJA 5B8BA 2B5XA 2VCVA 5F06A 3QFAC 3KEBA 3I9V2 3ZIVA 4EIQA 4YAVA 2M80A 1IYIA 2PWJA 4KUNA 1FG4A 3F0IA 5DAKA 2MMZA 1OC3A 3DVXA 5CRHA 5IPHA 2YJ7A 3IBHA 3HHVA 4ECJA 1R26A 2AHEA 1VGLA 2TIRA 2QC7A 5KEJA 2M46A 1SK0A 3VI7A 5ELGA 3ZMLA 5A5KA 1XWBA 3MSZA 2JSZA 4ECCA 2LJRA 4I8BA 2C0GA 4EDYA 1A0RP 5G5EA 4HU7A 2IN3A 1JLVA 4F82A 2DJ0A 2FA8A 3WGDA 2L6CA 1THOA 2HFDA 3I69A 3CRTA 2H6YA 3W6GA 1K0MA 4D73B 1O6JA 3CRUA 3ZTLA 3RHBA 1TK5B 4TR4A 2YNXA 3VURA 4OO5A 2LNTA 2F51A 3F4SA 3L9SA 3P90A 1V9WA 4K6XA 5J3RA 3QD9A 1X9SB 3WYWA 4PX1A 4AJ7A 2HZEA 2CVKA 2C8UA 4EIPA 2N5AA 1KEBA 1GH2A 1T8EB 1EV9A 4PQHA 3VFIA 1HD2A 3G9BA 2HSMA 4GF0A 3IC8A 12GSA 5IQYA 2R37A 1R5AA 1QXHA 3I6AA 3BD2A 3R3EA 2YZUA 2HSHA 3UBLA 3S9FA 1XWGA 1N2AA 1MDKA 5HR1A 3VPTA 4ACSA 1FVJA 5D8IA 2DBCA 4AJ6A 3V1WA 1OE8A 3N9JA 2VLUA 2WULA 1WP0A 1YKAA 2LS5A 3KP9A 1EGOA 1KNGA 2LNSA 1YEPA 4WR4A 3TKQA 4K5RA 4EVMA 4TW5A 1DSBA 5DCHA 4BVXB 5AGYA 4QL9A 4YH2A 1X0RA 3F3RA 1GSSA 3UBKA 4IP6A 4MZCA 3C1RA 5AN1A 5IO0A 1PN9A 4O5QA 1T4ZA 4PTSA 3QMXA 4IN0A 2B1LA 3HZ8A 2JU5A 4BA7A 4MNNA 1EGRA 3IK7A 3F3QA 1BG5A 2RM6A 4QQ7A 5ECPB 5A4VA 4KDUA 2KP1A 1K0CA 2YWIA 2GQMA 1ACVA 2YV9A 5A4WA 2VLVA 5IMCA 1ZOFA 3P2AA 3ZFLA 3HA9A 2QGVA 4IELA 3RHCA 4WETA 3GMFA 2IMKA 4ZB9A 5C00A 4PGTA 1SK2A 3Q18A 1GSYA 5CO3A 5ECLB 2MZCA 4PQIA 1TTZA 3D21A 3GTUB 4YKGA 2H76A 3BBYA 1G0TA 3HD5A 4X0XA 3H93A 5CREA 4IQAA 2N5FA 1DUGA 1E2YA 1IYHA 6GSWA 1B4QA 2K6VA 3D5JA 3FHKA 4RUVA 5D96A 4OCFA 2CV4A 1ILOA 4BVYB 1V40A 2F8FA 3TJJA 2HT9A 4ML1A 4F9ZA 2DMMA 22GSA 1TOFA 1F2EA 3C8EA 1YF1A 2DKHA 4X4JA 4MJCA 3GKKA 8GSSA 4XS6A 5IMVA 1AQWA 3QFBC 5IO2A 1EOHA 1M9BA 3DRNA 1MD4A 3IV4A 1XVWA 3HZ4A 3L0HA 3L9VA 4K1FA 2MBSA 2ALBA 4CY6A 4MJAA 3LQ7A 2GQLA 2CAQA 2DIZA 3GIXA 3FKFA 4I97A 1HNCA 2QA1A 3KM6A 1HNAA 2IMIA 2LQOA 4GSNA 4MF6A 2DJKA 3BCKA 2CAIA 1XXUA 5ID2B 1VF1A 2R2JA 5B6NA 4F03A 5G5FA 3EU3A 1NSWA 4YAPA 3GX0A 1QGVA 4LMVA 3EVIA 1X9WB 4QL7A 5ECHB 3C1SA 1RW1A 3APQA 2ON5A 2TRXA 1PRXA 2A2RA 1PKWA 2V32A 1Q4JA 2H1DA 3VWVA 2HZFA 5KN3A 2V6KA 1ABAA 4KCAA 2C3NA 2AAWA 4FYBA 4IP1A 1PX6A 1GTUA 2FWGA 2VM2A 2L5LA 3GHAA 1A23A 1AAZA 4WBRD 4XTSA 3H4KA 3M3MA 1XCCA 1XZOA 3EURA 4IJIA 4Q5QA 4WF5A 2GSQA 2IMDA 3KTLA 4MJBA 5IMZA 1YJ6A 1Z9HA 3FZ5A 4RQRA 1FOHA 4KW6A 4KCEA 2H1BA 1U87A 5HR2A 4BVYA 2LEGA 1G7EA 2RUFA 3ZL5A 1VF4A 3G7JA 4ZILA 3HYPA 3N5OA 4OFMA 2V2GA 2L59A 3GH9A 4XCSA 4XHMA 1LU4A 1W89A 1VF2A 4FH8A 3H8QA 4O5UA 9GSSA 4NPBA 4I6XA 1O8XA 1WOUA 3ME8A 4I2TA 3ERFA 2R4VA 5B8AA 2REMA 1S3CA 3SWLA 3IOSA 3US3A 2PGTA 3CXGA 1W4VA 4MLYA 1Z7RA 2AV4A 5IIZA 4KE3A 1B9XC 3ZITA 5F8BA 6GSUA 2ZCTA 4FO5A 4TKYA 4F2IA 5ECSA 3LXTA 3IDVA 2OE0A 4K0GA 2VCZA 1OC9A 3A2WA 1XPVA 3GURA 5ID2A 1ZL9A 1QFNA 4JEDA 3L78A 2PPTA 2JACA 3QAWA 1NHOA 3KMOA 2NPBA 1XBSA 2O8VB 5ECQB 2FWFA 3D4TA 1K0DA 4JR6A 4O7HA 2LJAA 2DMLA 1JZRA 2XHFA 2XBQA 1MDJA 2I4AA 3LEFA 4ISDA 2YWMA 3TRQA 4PUAA 1AQXA 2QKEA 4IGJA 2DC5A 3D0ZA 3A5WA 3ZYWA 2XBIA 3D4MA 4CHSA 1T4YA 2P5QA 3VPQA 13GSA 19GSA 2P0GA 3LWAA 4DVCA 5IOWA 2A2SA 4YQMA 4OFNA 2DIYA 2FCHA 2IFQB 1EZKA 4IVFA 2H72A 3FEUA 4YQVA 1ZCPA 2NVLA 1A2JA 1MTCA 4LL1B 1HQOA 1GNWA 3DXBA 1GL8A 1QQ2A 2HI7A 4G0LA 4Q5RA 4KH7A 4ECBA 2HZEB 10GSA 4DSQA 4Q5FA 3QCPA 5D73A 3W8SA 4MF7A 5JCWA 5KN2A 1SENA 2B6MA 2B5EA 4KDXA 2YZHA 5ELAA 3UAPA 1SJIA 3EC3A 3GV1A 5D93A 3BOAA 4FYUA 2HRFA 4PNFA 1GSEA 4I5QA 1PGTA 1KBNA 4TR3A 1HYUA 1N8JA 2GTUA 1TU7A 4FQUA 4CDOA 4NHWA 3HVSA 4EUYA 4HJMA 3FZ4A 1GTIA 3M0FA 1WWJA 2HYXA 3CSHA 3D22A 4MPFA 2F9SA 2VM1A 1GULA 3HKRA 3VWXA 1X9MB 2QSIA 2O7KA 3DIEA 1AC1A 2ES7A 1YZXA 17GSA 1URMA 4PNGA 2GZYA 1U88A 2LRCA 5GSSA 4Z2UA 1THXA 1OYJA 1QUWA 4L0WA 3K8NA 1GSFA 2PVQA 3UVHA 3F6DA 3PR8A 2L5OA 2IMFA 4PXOA 1QMVA 4XRDA 4E8EA 4JU5A 5G1KA 1S3DA 4O92A 3Q74A 3MWHA 3UIWA 1HNBA 2OBIA 1WRYA 5G1LA 3IR4A 2PUKC 4K0NA 1TP9A 4JBBA 1V57A 2IFQA 1O7UA 4N11A 2PBJA 3I43A 2H71A 5DJLA 4EE0A 5JCUA 11GSA 1PMTA 3DGQA 2AJQB 3EMPA 3EMXA 4POMA 3KCMA 2FUG2 7GSSA 1B4PA 5JWRB 3FY7A 3LGCA 4GQCA 3F9UA 3FZ9A 3TKSE 4XS4A 5CP1A 3CTFA 6GSSA 3Q6OA 2OADA 3HY2A 3ZVJA 3LYKA 6GSYA 4EF0A 2WZ9A 1B9YC 1GSUA 2VOCA 1GP1A 1QK8A 4KX4A 3MNGA 1SL2B 1FB0A 3LORA 2C4JA 2IWTA 3C73A 4XS1A 1K0BA 1SYXA 4F0CA 4IBPA 3MAKA 2CVBA 3EWLA 2L4QA 1GUHA 1AXDA 2GZPA 3GRXA 5AIXA 1H75A 1YKCA 2VUPA 3HJPA 2O87A 4K7IA 1EEJA 1FO5A 3TJKA 1F6MC 2PN8A 4KA0A 1DBYA 3ED3A 3TJBA 5E4WA 1PA3A 4IW9A 3C71A 1YEXA 1FAAA 1M99A 1X5CA 2OE1A 2RIIA 3KZQA 3KH9A 1V2AA 1TRSA 2CX3A 2H1GA 1SL0B 1FB6A 2DJ1A 2WDUA 4K8MA 4ILFA 3A2XA 5CYYA 3SBCA 4KDYA 5G2ZA 2VLTA 2KP2A 4J2FA 5GSTA 1JHBA 1V98A 1PL2A 1ZGNA 2FGXA 2H0HA 4OMVA 5H5RA 3KXOA 3ERGA 4MJEA 3H1NA 1GUMA 4WXTA 2DLXA 1A24A 2BTOT 1XIYA 2GQKA 2VO4A 4POLA 2I81A 5G30A 3HJMA 5L71A 4KNDA 4PQ1A 2OACA 1K0AA 1A2LA 1EWXA 2C3TA 4PURA 5DBQA 2CT6A 5HFIA 4RI7A 1BX9A 1FVKA 2XPEA 3GSTA 4GWRA 2O85A 4JZQA 2IL3A 1TK8B 3FMWA 1GUKA 4OO4A 4TXOA 4IQ1A 4TXVA 1PN0A 1K3OA 3GL3A 1YF0A 4BL7A 3PH9A 3Q19A 4EDZA 5EPFA 2E2MA 4O32A 1BAYA 2Z9SA 4MP4A 2X8GA 4ID0A 2H0IA 1U3AA 2C3QA 1TW9A 3GKXA 1B48A 4G0KA 1FHEA 1AIUA 2LQQA 3J7Yk 2YJHA 4GTUA 3CYNA 3TRXA 1SJZA 2R6KA 1ERTA 1ZYEA 2VIMA 4ECIA 3J7Yb 3EYTA 1O73A 2ZNMA 4Z2RA 1ZMAA 2A4VA 4ICYA 4ZBAA 2HLSA 5J5NA 1OC9B 3VK9A 3IHQA 3W8JA 3GNJA 2K8SA 3FR3A 4OWYA 5COHA 1EOGA 4JE1A 2XPDA 3QAVA 4L0UA 1J0FA 1EP7A 3D6IA 3ZFBA 5HR3A 5F05A 3NIVA 1G6YA 2B5YA 2L57A 4TRXA 3CBUA 3ZRDA 2YV7A 3GKNA 1FOVA 2X8HA 4TR0A 1X5DA 4Q5NA 3IXRA 4AF2A 1SL1B 2EC4A 4USSA 3GH6A 4NWYA 5DVBA 3LG6A 2DJ3A 1TI1A 3RPNA 2NTOA 2X4AA 3VWWA 1Y6EA 2C80A 2K8VA 3CSIA 5IPGA 1XWKA 3TCOA 3HJOA 5D9XA 1M2AA 2DJ2A 3KMNA 4ZIJA 5AISA 2K9FA 5B7CA 1F3BA 5EY6A 1H4OA 3F63A 2YCDA 1SD9A 2VL2A 3NZNA 3NOFA 1DE1A 2YWOA 2HE3A 3QPMA 4JRRA 4MF5A 1E6BA 1F37A 2LRNA 2EIRA 5A4UA 2V6OA 3F4TA 1VRSD 1JZDA 1UC7A 1TK0B 1PKZA 5D9WA 1PX7A 4HS1A 1O8WA 2C0FA 3R2QA 1JFUA 3TUEA 1K3YA 2KLXA 1VF3A 1I5GA 1JZWA 3KH7A 2FY6A 2UZ8A 3RDWA 2MMOA 1TRVA 2H6ZA 2H30A 2XC2A 1GTBA 5KN0A 2VL3A 4MMMA 3GL5A 4CY8A 1OAZA 1SYRA 5KOWA 3TJGA 3TKSA 2MMNA 2DSAA 2R0PA 2HSYA 1SJ6A 1WMJA 5BMUA 1S3AA 4O5RA 3VLNA 3QOUA 1U6TA 3PGTA 1EEMA 3A2VA 3TJFA 3ISOA 4ZBBA 1M2DA 1CQGA 2PERA 4GXZA 2MBTA 2FLSA 5AIVA 1ML6A 2C0EA 3AY8A 2CX4A 2LUSA 3PINA 4K2XA 3UJ1A 1T3BA 2IMEA 1ERVA 3IPZA 1YQ1A 3FR9A 1Z6MA 1R4WA 1AQVA 3ERWA 2X49A 1MDIA 3VI5A 4XS4B 2B3SA 4IS0A 3EINA 4TN8A 4GCIA 3BJ5A 4KSOA 2OA7A 3LXZA 2HRKA 2GZZA 4HDEA 1XFLA 4L8EA 3DEXA 4GSSA 3A3TA 1AW9A 4ZL9A 1LJRA 5INYA 2H01A 3EE2A 3GSSA 3WT1A 5H5SA 1WJKA 1USBA 1A0FA 3E0UA 2VCTA 1YY7A 2CZ3A 4IHUA 4X1UA 4ZB6A 3FK8A 2MYGA 2KUCA 3HXSA 4V2NA 1BQ7A 4ZBDA 2O89A 4YQUA 4HQSA 2WJUA 3CSJA 5IMFA 2GT5A 2VL9A 3F8UA 3DKSA 2TRCP 1G7OA 4EC0A 4HQZA 2H6XA 4CW9A 1SKWB 2R5GA 2KHPA 1MD3A 4MPGA 2VD1A 2FNOA 2VCWA 4G2EA 5D9VA 20GSA 3FRCA 1EV4A 3CMIA 2WFCA 3DVWA 1XW5A 4PUFC 3UOMA 1M9AA 1C72A 1MEKA 1R7HA 4K7OA 3O3TA 2AB6A 5CAXA 2L6DA 4JR4A 1Q98A 3GYKA 2LRTA 2H19A 2I1UA 3M9JA 1I9DA 16GSA 1AUCA 4TOPA 5JWOB 4K2DA 5IM9A 4X43A 3FYGA 3QAGA 3LSZA 4NHZA 4RI6A 3TRPA 4K7NA 4HOJA 1SKRB 1F3AA 1Z6NA 3RPPA 4WEYA 4G10A 4HEA2 1B8XA 4A5PA 1ZZYA 4LLRA 4MA9A 4TXOB 5IMDA 3TGZA 2EIQA 1CQHA 4NXIA 2ZUPA 4BPYA 4BL7B 5G31A 3OR5A 4L5LA 1A2MA 4MK3A 4FIWA 3RBTA 4HZ4A 3IRAA 2A2PA 4HZ2A 3UMAA 3PPUA 4XIHA 1UVZA 2F8AA 2H74A 1T7PB 1XWCA 1WPIA 3LJRA 2WS2A 2GGTA 2AYTA 2D2ZA 14GSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DAL B;  5GAP D;  4P3Y B;  4V2M A;  2B1K A;  3TOT A;  1WIK A;  1M7T A;  3C7M A;  2GDR A;  1SKS B;  4EKZ A;  3KP8 A;  5CRW A;  2GST A;  3FR6 A;  4OCE A;  1PSQ A;  2LKU A;  5GAN D;  5JCG A;  3WGX A;  2NBS A;  2RUE A;  4N0Z A;  3QDN A;  1GWC A;  1J9B A;  2CZ2 A;  3JCM L;  1SK1 A;  2H70 A;  4DSS B;  2LJK A;  4MCU A;  4LL4 B;  5IMA A;  1GSQ A;  3KD0 A;  3LFL A;  2GSR A;  4KB3 A;  1Z7P A;  5FT3 A;  1JLW A;  3F6F A;  2WGR A;  3O76 A;  4H86 A;  2YOI A;  2H75 A;  4I2U A;  2GSS A;  1M2B A;  3G7Y A;  4L5O A;  4GQF A;  1R5P A;  3O6T A;  1KTE A;  4NV5 A;  2VCX A;  5DQS A;  2V1M A;  3UVT A;  4K9Z A;  18GS A;  1LBK A;  2JAD A;  4ZL7 A;  2LTK A;  4D73 A;  1XVQ A;  2CA8 A;  2J9H A;  3UL3 A;  4ULX A;  2X8C A;  2G0F A;  3HDC A;  3TDG A;  4HI7 A;  3L9U A;  6GSV A;  5ECI B;  2C1Y A;  2YAN A;  4HJ2 A;  3DYR A;  2K18 A;  5ECM B;  1XOA A;  1G6W A;  5DCG A;  1TI3 A;  2YPM A;  1OKD A;  1EP8 A;  1O85 A;  2RM5 A;  2GT6 A;  4RQX A;  3KIJ A;  5ECR B;  4MAB A;  4GST A;  1F9M A;  2FD3 A;  2PU9 C;  5ABR A;  3WGE A;  1GNE A;  2IPA A;  2N5B A;  2YP6 A;  4ZL8 A;  2FWE A;  3M8N A;  1OKT A;  1SU9 A;  5DDL A;  3UEM A;  3IC4 A;  3ZVJ D;  2B7K A;  4V1A p;  3E9J B;  4GLT A;  5E59 A;  3QR6 A;  3DD3 A;  5DAL A;  5B6M A;  2H8L A;  3ZIJ A;  2G2Q A;  3TOU A;  5EVO A;  1UN2 A;  2OKA A;  1GSD A;  6GST A;  3EU4 A;  3L4N A;  4KAE A;  1T00 A;  3GFK A;  4LA1 A;  4BWQ A;  3IK9 A;  5JWQ B;  4WF4 A;  5F0G A;  3WD6 A;  4WR5 A;  5J4U A;  1XOB A;  2E7P A;  1OE7 A;  2JZR A;  4IKH A;  4BVX A;  2E2G A;  1TDI A;  2L4C A;  5DQY A;  2OBK A;  4BWS A;  5CRD A;  5CRG A;  3FZA A;  2X99 A;  4DSS A;  4HUA A;  2PVO C;  2X64 A;  6GSX A;  2OJL A;  3E3E A;  1XW6 A;  3IA1 A;  2NDO A;  4WKW A;  2IJY A;  2EIO A;  2R3X A;  2BJX A;  3KJY A;  3GA4 A;  4V1A g;  1TRU A;  3F4R A;  2JZT A;  1BYE A;  5CNW A;  2OE3 A;  1A8L A;  1FW1 A;  3GKM A;  2H73 A;  1O81 A;  2FWH A;  3ZRE A;  2HNL A;  4DSR A;  4V2L A;  3U6V A;  1K0O A;  3H79 A;  4TR1 B;  3GTU A;  3GX8 A;  5LCZ A;  2HXK A;  3APS A;  1ST9 A;  2H0G A;  2P31 A;  4N10 A;  3HVX A;  1RQM A;  1XW9 A;  5C04 A;  2V41 A;  4G9H A;  1X5E A;  2WCI A;  2JSY A;  2ON7 A;  3WT2 A;  4OD7 A;  3RAZ A;  1TU8 A;  5FWG A;  1WE0 A;  2BMX A;  5ECK B;  2CQ9 A;  4N0V A;  4EO3 A;  1DE2 A;  1M0U A;  1NHY A;  4Z7X A;  5KN1 A;  2DJJ A;  4ZB8 A;  1UA5 A;  5HR0 A;  2PMT A;  1NM3 A;  5ECN B;  2F3M A;  2HRN A;  2J23 A;  1Z5Y E;  1XWA A;  2GVP A;  2VCQ A;  3KTB A;  2GS3 A;  2AUV A;  2WB9 A;  3DML A;  3ZZX A;  1K3L A;  2VAF A;  3ME7 A;  4WBJ A;  5H5Q A;  4AGS A;  3TKR A;  2JL4 A;  1PQN A;  3HCZ A;  4MH2 A;  2FA4 A;  5DAK B;  2KOK A;  3MDK A;  3UAR A;  3M9K A;  2LV3 A;  5J41 A;  5DJM A;  4IJ3 A;  2B7J A;  4GRF A;  5EL8 A;  4ML6 A;  1TXX A;  2VD0 A;  3FW2 A;  4NV2 A;  1ON4 A;  2YWN A;  3BCI A;  1K0N A;  4EL1 A;  2CVD A;  2GLR A;  3ZLP A;  1NW2 A;  1ZYQ B;  3TB2 A;  3APO A;  2RLI A;  2I3Y A;  1GLQ A;  5J9C A;  1TKD B;  2VL2 C;  1J08 A;  2FHE A;  5HFG A;  5LD0 A;  1U3I A;  5GZZ B;  1BJX A;  5D9T A;  5IOX A;  4J56 E;  5ENU A;  1ERW A;  4E8H A;  5LNK e;  4MZB A;  3GUS A;  3CTG A;  2M72 A;  1SD8 A;  3P8W A;  4TR1 A;  4NMU A;  4TVE A;  1RK4 A;  1ERU A;  4ZXG A;  1YDK A;  1PD2 1;  3LYP A;  1GRX A;  4OFT A;  1Y25 A;  1V58 A;  5F07 A;  2LST A;  3GN3 A;  4NAX A;  4HU9 A;  1BED A;  5FHI A;  4POK A;  2IIY A;  4MH3 A;  1A8Y A;  2C0D A;  4AJ8 A;  1TRW A;  2I9H A;  5ECO B;  3HVV A;  5HQP A;  3IE3 A;  1PL1 A;  4XRA A;  2MMA A;  4MZW A;  4POB A;  3M1G A;  3ZMK A;  5HFK A;  2H1A A;  3VWU A;  4DEJ A;  2E0Q A;  3KGK A;  1GTA A;  3IAS 2;  3U5R E;  3G7I A;  1GLP A;  1JZO A;  4LMW A;  2WRT A;  5J9B A;  4MDC A;  1Z3E A;  1OVN A;  1OC8 A;  2H66 A;  4KSM A;  3TKP A;  3IAM 2;  1T1V A;  4F0B A;  4J57 E;  2YN1 A;  3TKS C;  1TJD A;  3DWV A;  2JZS A;  4FYC A;  4N30 A;  3P7X A;  4KGI A;  4G19 A;  2P5R A;  4EXJ A;  5B8B A;  2B5X A;  2VCV A;  5F06 A;  3QFA C;  3KEB A;  3I9V 2;  3ZIV A;  4YAV A;  2M80 A;  1IYI A;  2PWJ A;  4KUN A;  1FG4 A;  3F0I A;  5DAK A;  2MMZ A;  1OC3 A;  3DVX A;  5CRH A;  5IPH A;  2YJ7 A;  3IBH A;  3HHV A;  4ECJ A;  1R26 A;  2AHE A;  1VGL A;  2TIR A;  2QC7 A;  5KEJ A;  2M46 A;  1SK0 A;  3VI7 A;  5ELG A;  3ZML A;  5A5K A;  1XWB A;  3MSZ A;  2JSZ A;  4ECC A;  2LJR A;  4I8B A;  2C0G A;  4EDY A;  1A0R P;  5G5E A;  4HU7 A;  2IN3 A;  1JLV A;  4F82 A;  2DJ0 A;  2FA8 A;  3WGD A;  2L6C A;  1THO A;  2HFD A;  3I69 A;  3CRT A;  2H6Y A;  3W6G A;  1K0M A;  4D73 B;  1O6J A;  3CRU A;  3ZTL A;  3RHB A;  1TK5 B;  4TR4 A;  2YNX A;  3VUR A;  4OO5 A;  2LNT A;  2F51 A;  3F4S A;  3L9S A;  3P90 A;  1V9W A;  4K6X A;  5J3R A;  3QD9 A;  1X9S B;  3WYW A;  4PX1 A;  4AJ7 A;  2HZE A;  2CVK A;  2C8U A;  2N5A A;  1KEB A;  1GH2 A;  1T8E B;  1EV9 A;  4PQH A;  3VFI A;  1HD2 A;  3G9B A;  4GF0 A;  12GS A;  5IQY A;  2R37 A;  1R5A A;  1QXH A;  3I6A A;  3BD2 A;  2YZU A;  2HSH A;  3UBL A;  3S9F A;  1XWG A;  1N2A A;  1MDK A;  5HR1 A;  3VPT A;  4ACS A;  1FVJ A;  5D8I A;  2DBC A;  4AJ6 A;  3V1W A;  1OE8 A;  3N9J A;  2VLU A;  2WUL A;  1WP0 A;  1YKA A;  2LS5 A;  3KP9 A;  1EGO A;  1KNG A;  2LNS A;  1YEP A;  4WR4 A;  3TKQ A;  4EVM A;  4TW5 A;  1DSB A;  5DCH A;  5AGY A;  4QL9 A;  4YH2 A;  1X0R A;  3F3R A;  1GSS A;  3UBK A;  4IP6 A;  4MZC A;  3C1R A;  5AN1 A;  5IO0 A;  1PN9 A;  1T4Z A;  3QMX A;  4IN0 A;  2B1L A;  3HZ8 A;  2JU5 A;  4BA7 A;  1EGR A;  3IK7 A;  3F3Q A;  1BG5 A;  2RM6 A;  4QQ7 A;  5ECP B;  5A4V A;  4KDU A;  2KP1 A;  1K0C A;  2YWI A;  2GQM A;  1ACV A;  2YV9 A;  5A4W A;  2VLV A;  5IMC A;  1ZOF A;  3P2A A;  3ZFL A;  3HA9 A;  2QGV A;  4IEL A;  3RHC A;  4WET A;  3GMF A;  2IMK A;  4ZB9 A;  5C00 A;  4PGT A;  1SK2 A;  3Q18 A;  1GSY A;  5CO3 A;  5ECL B;  2MZC A;  4PQI A;  1TTZ A;  3D21 A;  3GTU B;  2H76 A;  3BBY A;  1G0T A;  3HD5 A;  4X0X A;  3H93 A;  5CRE A;  4IQA A;  2N5F A;  1DUG A;  1E2Y A;  1IYH A;  6GSW A;  1B4Q A;  2K6V A;  3D5J A;  3FHK A;  4RUV A;  5D96 A;  4OCF A;  2CV4 A;  1ILO A;  1V40 A;  2F8F A;  3TJJ A;  2HT9 A;  4ML1 A;  4F9Z A;  2DMM A;  22GS A;  1TOF A;  1F2E A;  3C8E A;  1YF1 A;  4MJC A;  3GKK A;  8GSS A;  4XS6 A;  5IMV A;  1AQW A;  3QFB C;  5IO2 A;  1EOH A;  1M9B A;  3DRN A;  1MD4 A;  3IV4 A;  1XVW A;  3HZ4 A;  3L0H A;  3L9V A;  4K1F A;  2MBS A;  2ALB A;  4MJA A;  3LQ7 A;  2GQL A;  2CAQ A;  2DIZ A;  3GIX A;  3FKF A;  4I97 A;  1HNC A;  3KM6 A;  1HNA A;  2IMI A;  2LQO A;  4GSN A;  4MF6 A;  2DJK A;  3BCK A;  2CAI A;  1XXU A;  5ID2 B;  1VF1 A;  2R2J A;  5B6N A;  4F03 A;  5G5F A;  3EU3 A;  1NSW A;  4YAP A;  3GX0 A;  1QGV A;  4LMV A;  3EVI A;  1X9W B;  4QL7 A;  5ECH B;  3C1S A;  1RW1 A;  3APQ A;  2ON5 A;  2TRX A;  1PRX A;  2A2R A;  1PKW A;  2V32 A;  1Q4J A;  2H1D A;  3VWV A;  2HZF A;  5KN3 A;  2V6K A;  1ABA A;  4KCA A;  2C3N A;  2AAW A;  4FYB A;  4IP1 A;  1PX6 A;  1GTU A;  2FWG A;  2VM2 A;  2L5L A;  3GHA A;  1A23 A;  1AAZ A;  4WBR D;  4XTS A;  3H4K A;  3M3M A;  1XCC A;  1XZO A;  3EUR A;  4IJI A;  4Q5Q A;  4WF5 A;  2GSQ A;  2IMD A;  3KTL A;  4MJB A;  5IMZ A;  1YJ6 A;  1Z9H A;  3FZ5 A;  4RQR A;  4KW6 A;  4KCE A;  2H1B A;  1U87 A;  5HR2 A;  4BVY A;  2LEG A;  1G7E A;  2RUF A;  3ZL5 A;  1VF4 A;  3G7J A;  4ZIL A;  3HYP A;  3N5O A;  4OFM A;  2V2G A;  2L59 A;  3GH9 A;  4XCS A;  4XHM A;  1LU4 A;  1W89 A;  1VF2 A;  4FH8 A;  3H8Q A;  9GSS A;  4NPB A;  4I6X A;  1O8X A;  1WOU A;  3ME8 A;  4I2T A;  3ERF A;  2R4V A;  5B8A A;  2REM A;  1S3C A;  3SWL A;  3IOS A;  3US3 A;  2PGT A;  3CXG A;  1W4V A;  4MLY A;  1Z7R A;  2AV4 A;  5IIZ A;  4KE3 A;  1B9X C;  3ZIT A;  5F8B A;  6GSU A;  2ZCT A;  4FO5 A;  4TKY A;  4F2I A;  5ECS A;  3LXT A;  3IDV A;  2OE0 A;  4K0G A;  2VCZ A;  1OC9 A;  3A2W A;  1XPV A;  3GUR A;  5ID2 A;  1ZL9 A;  1QFN A;  4JED A;  3L78 A;  2PPT A;  2JAC A;  3QAW A;  1NHO A;  3KMO A;  2NPB A;  1XBS A;  2O8V B;  5ECQ B;  2FWF A;  3D4T A;  1K0D A;  4JR6 A;  4O7H A;  2LJA A;  2DML A;  1JZR A;  2XHF A;  2XBQ A;  1MDJ A;  2I4A A;  3LEF A;  4ISD A;  2YWM A;  3TRQ A;  4PUA A;  1AQX A;  2QKE A;  4IGJ A;  2DC5 A;  3D0Z A;  3A5W A;  3ZYW A;  2XBI A;  3D4M A;  4CHS A;  1T4Y A;  2P5Q A;  3VPQ A;  13GS A;  19GS A;  2P0G A;  3LWA A;  4DVC A;  5IOW A;  2A2S A;  4YQM A;  4OFN A;  2DIY A;  2FCH A;  2IFQ B;  1EZK A;  4IVF A;  2H72 A;  3FEU A;  4YQV A;  1ZCP A;  2NVL A;  1A2J A;  1MTC A;  4LL1 B;  1HQO A;  1GNW A;  3DXB A;  1GL8 A;  1QQ2 A;  2HI7 A;  4Q5R A;  4KH7 A;  4ECB A;  2HZE B;  10GS A;  4DSQ A;  4Q5F A;  3QCP A;  5D73 A;  3W8S A;  4MF7 A;  5JCW A;  5KN2 A;  1SEN A;  2B6M A;  2B5E A;  4KDX A;  2YZH A;  5ELA A;  3UAP A;  1SJI A;  3EC3 A;  3GV1 A;  5D93 A;  3BOA A;  4FYU A;  2HRF A;  4PNF A;  1GSE A;  4I5Q A;  1PGT A;  1KBN A;  4TR3 A;  1HYU A;  1N8J A;  2GTU A;  1TU7 A;  4CDO A;  4NHW A;  3HVS A;  4EUY A;  4HJM A;  3FZ4 A;  1GTI A;  3M0F A;  1WWJ A;  2HYX A;  3CSH A;  3D22 A;  4MPF A;  2F9S A;  2VM1 A;  1GUL A;  3HKR A;  3VWX A;  1X9M B;  2QSI A;  2O7K A;  3DIE A;  1AC1 A;  2ES7 A;  1YZX A;  17GS A;  1URM A;  4PNG A;  2GZY A;  1U88 A;  2LRC A;  5GSS A;  1THX A;  1OYJ A;  1QUW A;  4L0W A;  3K8N A;  1GSF A;  2PVQ A;  3UVH A;  3F6D A;  3PR8 A;  2L5O A;  2IMF A;  4PXO A;  1QMV A;  4XRD A;  4E8E A;  4JU5 A;  5G1K A;  1S3D A;  4O92 A;  3Q74 A;  3MWH A;  3UIW A;  1HNB A;  2OBI A;  1WRY A;  5G1L A;  3IR4 A;  2PUK C;  4K0N A;  1TP9 A;  4JBB A;  1V57 A;  2IFQ A;  1O7U A;  4N11 A;  2PBJ A;  3I43 A;  2H71 A;  5DJL A;  4EE0 A;  5JCU A;  11GS A;  1PMT A;  3DGQ A;  2AJQ B;  3EMP A;  3EMX A;  4POM A;  3KCM A;  2FUG 2;  7GSS A;  1B4P A;  5JWR B;  3FY7 A;  3LGC A;  4GQC A;  3F9U A;  3FZ9 A;  3TKS E;  4XS4 A;  5CP1 A;  3CTF A;  6GSS A;  3Q6O A;  2OAD A;  3HY2 A;  3ZVJ A;  3LYK A;  6GSY A;  4EF0 A;  2WZ9 A;  1B9Y C;  1GSU A;  2VOC A;  1GP1 A;  1QK8 A;  4KX4 A;  3MNG A;  1SL2 B;  1FB0 A;  3LOR A;  2C4J A;  2IWT A;  3C73 A;  4XS1 A;  1K0B A;  1SYX A;  4F0C A;  4IBP A;  3MAK A;  2CVB A;  3EWL A;  2L4Q A;  1GUH A;  1AXD A;  2GZP A;  3GRX A;  5AIX A;  1H75 A;  1YKC A;  2VUP A;  3HJP A;  2O87 A;  4K7I A;  1EEJ A;  1FO5 A;  3TJK A;  1F6M C;  2PN8 A;  4KA0 A;  1DBY A;  3ED3 A;  3TJB A;  5E4W A;  1PA3 A;  4IW9 A;  3C71 A;  1YEX A;  1FAA A;  1M99 A;  1X5C A;  2OE1 A;  2RII A;  3KZQ A;  3KH9 A;  1V2A A;  1TRS A;  2CX3 A;  2H1G A;  1SL0 B;  1FB6 A;  2DJ1 A;  2WDU A;  4K8M A;  4ILF A;  3A2X A;  5CYY A;  3SBC A;  4KDY A;  5G2Z A;  2VLT A;  2KP2 A;  4J2F A;  5GST A;  1JHB A;  1V98 A;  1PL2 A;  1ZGN A;  2FGX A;  2H0H A;  4OMV A;  5H5R A;  3KXO A;  3ERG A;  4MJE A;  3H1N A;  1GUM A;  4WXT A;  2DLX A;  1A24 A;  2BTO T;  1XIY A;  2GQK A;  2VO4 A;  4POL A;  2I81 A;  5G30 A;  3HJM A;  5L71 A;  4KND A;  4PQ1 A;  2OAC A;  1K0A A;  1A2L A;  1EWX A;  2C3T A;  4PUR A;  5DBQ A;  2CT6 A;  5HFI A;  4RI7 A;  1BX9 A;  1FVK A;  2XPE A;  3GST A;  4GWR A;  2O85 A;  4JZQ A;  2IL3 A;  1TK8 B;  1GUK A;  4OO4 A;  4TXO A;  4IQ1 A;  4TXV A;  1K3O A;  3GL3 A;  1YF0 A;  4BL7 A;  3PH9 A;  3Q19 A;  4EDZ A;  5EPF A;  2E2M A;  4O32 A;  1BAY A;  2Z9S A;  4MP4 A;  2X8G A;  4ID0 A;  2H0I A;  1U3A A;  2C3Q A;  1TW9 A;  3GKX A;  1B48 A;  1FHE A;  1AIU A;  2LQQ A;  3J7Y k;  2YJH A;  4GTU A;  3CYN A;  3TRX A;  1SJZ A;  2R6K A;  1ERT A;  1ZYE A;  2VIM A;  4ECI A;  3J7Y b;  3EYT A;  1O73 A;  2ZNM A;  1ZMA A;  2A4V A;  4ZBA A;  2HLS A;  5J5N A;  1OC9 B;  3VK9 A;  3IHQ A;  3W8J A;  3GNJ A;  2K8S A;  3FR3 A;  4OWY A;  5COH A;  1EOG A;  4JE1 A;  2XPD A;  3QAV A;  4L0U A;  1J0F A;  1EP7 A;  3D6I A;  3ZFB A;  5HR3 A;  5F05 A;  3NIV A;  1G6Y A;  2B5Y A;  2L57 A;  4TRX A;  3CBU A;  3ZRD A;  2YV7 A;  3GKN A;  1FOV A;  2X8H A;  4TR0 A;  1X5D A;  4Q5N A;  3IXR A;  4AF2 A;  1SL1 B;  2EC4 A;  3GH6 A;  4NWY A;  5DVB A;  3LG6 A;  2DJ3 A;  1TI1 A;  3RPN A;  2NTO A;  3VWW A;  1Y6E A;  2C80 A;  2K8V A;  3CSI A;  5IPG A;  1XWK A;  3TCO A;  3HJO A;  5D9X A;  1M2A A;  2DJ2 A;  3KMN A;  4ZIJ A;  5AIS A;  2K9F A;  5B7C A;  1F3B A;  5EY6 A;  1H4O A;  3F63 A;  2YCD A;  1SD9 A;  2VL2 A;  3NZN A;  3NOF A;  1DE1 A;  2YWO A;  2HE3 A;  3QPM A;  4JRR A;  4MF5 A;  1E6B A;  1F37 A;  2LRN A;  2EIR A;  5A4U A;  2V6O A;  3F4T A;  1VRS D;  1JZD A;  1UC7 A;  1TK0 B;  1PKZ A;  5D9W A;  1PX7 A;  4HS1 A;  1O8W A;  2C0F A;  3R2Q A;  1JFU A;  3TUE A;  1K3Y A;  2KLX A;  1VF3 A;  1I5G A;  1JZW A;  3KH7 A;  2FY6 A;  3RDW A;  2MMO A;  1TRV A;  2H6Z A;  2H30 A;  2XC2 A;  1GTB A;  5KN0 A;  2VL3 A;  4MMM A;  3GL5 A;  1OAZ A;  1SYR A;  3TJG A;  3TKS A;  2MMN A;  2DSA A;  2HSY A;  1SJ6 A;  1WMJ A;  1S3A A;  4O5R A;  3VLN A;  3QOU A;  1U6T A;  3PGT A;  1EEM A;  3A2V A;  3TJF A;  3ISO A;  4ZBB A;  1M2D A;  1CQG A;  2PER A;  4GXZ A;  2MBT A;  2FLS A;  5AIV A;  1ML6 A;  2C0E A;  3AY8 A;  2CX4 A;  2LUS A;  3PIN A;  3UJ1 A;  1T3B A;  2IME A;  1ERV A;  3IPZ A;  1YQ1 A;  3FR9 A;  1Z6M A;  1R4W A;  1AQV A;  3ERW A;  1MDI A;  3VI5 A;  4XS4 B;  2B3S A;  4IS0 A;  3EIN A;  4TN8 A;  4GCI A;  3BJ5 A;  4KSO A;  2OA7 A;  3LXZ A;  2GZZ A;  4HDE A;  1XFL A;  4L8E A;  3DEX A;  4GSS A;  3A3T A;  1AW9 A;  4ZL9 A;  1LJR A;  5INY A;  2H01 A;  3EE2 A;  3GSS A;  3WT1 A;  5H5S A;  1WJK A;  1USB A;  1A0F A;  3E0U A;  2VCT A;  1YY7 A;  2CZ3 A;  4IHU A;  4X1U A;  4ZB6 A;  3FK8 A;  2MYG A;  2KUC A;  3HXS A;  4V2N A;  1BQ7 A;  4ZBD A;  2O89 A;  4YQU A;  4HQS A;  2WJU A;  3CSJ A;  5IMF A;  2GT5 A;  2VL9 A;  3F8U A;  3DKS A;  2TRC P;  1G7O A;  4EC0 A;  4HQZ A;  2H6X A;  4CW9 A;  1SKW B;  2R5G A;  2KHP A;  1MD3 A;  4MPG A;  2VD1 A;  2FNO A;  2VCW A;  4G2E A;  5D9V A;  20GS A;  3FRC A;  1EV4 A;  3CMI A;  2WFC A;  3DVW A;  1XW5 A;  4PUF C;  3UOM A;  1M9A A;  1C72 A;  1MEK A;  1R7H A;  4K7O A;  3O3T A;  2AB6 A;  5CAX A;  2L6D A;  4JR4 A;  1Q98 A;  3GYK A;  2LRT A;  2H19 A;  2I1U A;  3M9J A;  1I9D A;  16GS A;  1AUC A;  4TOP A;  5JWO B;  4K2D A;  5IM9 A;  4X43 A;  3FYG A;  3QAG A;  3LSZ A;  4NHZ A;  4RI6 A;  3TRP A;  4K7N A;  4HOJ A;  1SKR B;  1F3A A;  1Z6N A;  3RPP A;  4WEY A;  4G10 A;  4HEA 2;  1B8X A;  1ZZY A;  4LLR A;  4MA9 A;  4TXO B;  5IMD A;  3TGZ A;  2EIQ A;  1CQH A;  4NXI A;  2ZUP A;  4BPY A;  5G31 A;  3OR5 A;  4L5L A;  1A2M A;  4MK3 A;  4FIW A;  3RBT A;  4HZ4 A;  3IRA A;  4HZ2 A;  3UMA A;  4XIH A;  1UVZ A;  2F8A A;  2H74 A;  1T7P B;  1XWC A;  1WPI A;  3LJR A;  2WS2 A;  2GGT A;  2AYT A;  2D2Z A;  14GS A; 
#chains in the Genus database with same CATH topology
 5DAL B;  5GAP D;  4P3Y B;  4V2M A;  2B1K A;  3TOT A;  1WIK A;  1M7T A;  3C7M A;  2GDR A;  1SKS B;  4EKZ A;  3KP8 A;  5CRW A;  2GST A;  3FR6 A;  4OCE A;  1PSQ A;  2LKU A;  5GAN D;  5JCG A;  3WGX A;  2NBS A;  4G0I A;  2RUE A;  4N0Z A;  3QDN A;  1GWC A;  1J9B A;  2CZ2 A;  3JCM L;  1SK1 A;  2H70 A;  2R0G A;  4DSS B;  2LJK A;  3A5I A;  4MCU A;  4LL4 B;  1ZYN A;  5IMA A;  3EPT A;  1GSQ A;  3KD0 A;  3LFL A;  2GSR A;  4KB3 A;  1Z7P A;  5FT3 A;  1JLW A;  3F6F A;  2WGR A;  3O76 A;  4H86 A;  2YOI A;  2H75 A;  4I2U A;  2GSS A;  1M2B A;  3G7Y A;  1PFO A;  4L5O A;  4GQF A;  1R5P A;  3O6T A;  1KTE A;  4NV5 A;  2VCX A;  5DQS A;  2V1M A;  3UVT A;  4K9Z A;  18GS A;  1LBK A;  2JAD A;  4ZL7 A;  2LTK A;  4D73 A;  1XVQ A;  2CA8 A;  2J9H A;  3UL3 A;  4ULX A;  2X8C A;  2G0F A;  3HDC A;  3TDG A;  4HI7 A;  3L9U A;  6GSV A;  5ECI B;  2C1Y A;  3MYD A;  2YAN A;  4HJ2 A;  3DYR A;  2K18 A;  5ECM B;  1XOA A;  1G6W A;  5DCG A;  1TI3 A;  2YPM A;  1OKD A;  1EP8 A;  1O85 A;  2RM5 A;  2GT6 A;  4RQX A;  3KIJ A;  5ECR B;  4MAB A;  4GST A;  1F9M A;  2FD3 A;  2PU9 C;  4YKF A;  3WGE A;  5ABR A;  1GNE A;  2IPA A;  2N5B A;  2YP6 A;  4ZL8 A;  2R0C A;  2FWE A;  3M8N A;  1OKT A;  1SU9 A;  5DDL A;  3UEM A;  3IC4 A;  3ZVJ D;  2B7K A;  4V1A p;  3E9J B;  4GLT A;  5E59 A;  3QR6 A;  3DD3 A;  5DAL A;  5B6M A;  2H8L A;  3ZIJ A;  2G2Q A;  3TOU A;  5EVO A;  1UN2 A;  2OKA A;  1GSD A;  6GST A;  3EU4 A;  3L4N A;  4KAE A;  1T00 A;  3GFK A;  4LA1 A;  4BWQ A;  1M3I A;  3IK9 A;  5JWQ B;  5BRT A;  4WF4 A;  5F0G A;  3WD6 A;  4WR5 A;  5J4U A;  1XOB A;  2E7P A;  1OE7 A;  2JZR A;  4IKH A;  4BVX A;  2E2G A;  1TDI A;  2L4C A;  5DQY A;  2OBK A;  4BWS A;  5CRD A;  5CRG A;  3FZA A;  2X99 A;  4DSS A;  4HUA A;  2QA2 A;  2PVO C;  2X64 A;  6GSX A;  2OJL A;  3E3E A;  1XW6 A;  3IA1 A;  2NDO A;  4WKW A;  2IJY A;  1S3R A;  2EIO A;  2R3X A;  2BJX A;  3KJY A;  5KOX A;  4Z2T A;  3GA4 A;  4V1A g;  2DKI A;  1TRU A;  3F4R A;  2JZT A;  1BYE A;  5CNW A;  2OE3 A;  1A8L A;  1FW1 A;  3GKM A;  2H73 A;  3LW9 A;  1O81 A;  2FWH A;  3ZRE A;  2HNL A;  4DSR A;  4V2L A;  3U6V A;  1K0O A;  3H79 A;  4TR1 B;  3GTU A;  3GX8 A;  5LCZ A;  2HXK A;  3APS A;  1ST9 A;  2H0G A;  2P31 A;  4N10 A;  3HVX A;  1RQM A;  1XW9 A;  5C04 A;  2V41 A;  4G9H A;  1X5E A;  2WCI A;  2JSY A;  2ON7 A;  3WT2 A;  4OD7 A;  3RAZ A;  1TU8 A;  5FWG A;  1WE0 A;  2BMX A;  5ECK B;  2CQ9 A;  4N0V A;  4EO3 A;  1DE2 A;  1M0U A;  1NHY A;  4Z7X A;  5KN1 A;  2DJJ A;  4ZB8 A;  1UA5 A;  5HR0 A;  2PMT A;  1NM3 A;  5ECN B;  2F3M A;  2HRN A;  2J23 A;  1Z5Y E;  1XWA A;  2GVP A;  2VCQ A;  3KTB A;  2GS3 A;  2AUV A;  2WB9 A;  3DML A;  3ZZX A;  1K3L A;  2VAF A;  3ME7 A;  3MIX A;  4WBJ A;  5H5Q A;  4AGS A;  3TKR A;  2JL4 A;  1PQN A;  3HCZ A;  4MH2 A;  2FA4 A;  5DAK B;  2KOK A;  3MDK A;  3UAR A;  3M9K A;  2LV3 A;  5J41 A;  3IHG A;  5DJM A;  4IJ3 A;  2B7J A;  4GRF A;  5EL8 A;  4ML6 A;  1TXX A;  2VD0 A;  3FW2 A;  4NV2 A;  1ON4 A;  2YWN A;  2A4H A;  1K0N A;  3BCI A;  4EL1 A;  1ZYP A;  2CVD A;  2GLR A;  3ZLP A;  1NW2 A;  1ZYQ B;  3TB2 A;  3APO A;  2RLI A;  2I3Y A;  1GLQ A;  5J9C A;  1TKD B;  4KF9 A;  2VL2 C;  1J08 A;  2FHE A;  5HFG A;  5LD0 A;  1U3I A;  5GZZ B;  1BJX A;  5D9T A;  5IOX A;  4J56 E;  5ENU A;  1ERW A;  4E8H A;  5LNK e;  4MZB A;  3GUS A;  3CTG A;  2M72 A;  1SD8 A;  3P8W A;  4TR1 A;  4NMU A;  4HSC X;  1RK4 A;  1ERU A;  4TVE A;  4ZXG A;  1YDK A;  1PD2 1;  3LYP A;  1GRX A;  4OFT A;  1Y25 A;  1V58 A;  5F07 A;  2LST A;  3GN3 A;  4NAX A;  4HU9 A;  1BED A;  5FHI A;  4POK A;  2IIY A;  4MH3 A;  1A8Y A;  2C0D A;  4AJ8 A;  1TRW A;  2I9H A;  5ECO B;  2HRA A;  3HVV A;  5HQP A;  3IE3 A;  1PL1 A;  4XRA A;  2MMA A;  4MZW A;  4POB A;  3M1G A;  3ZMK A;  5HFK A;  2H1A A;  3VWU A;  4DEJ A;  2E0Q A;  3KGK A;  1GTA A;  3IAS 2;  3U5R E;  3HVN A;  3G7I A;  1GLP A;  1JZO A;  4LMW A;  2WRT A;  5J9B A;  4MDC A;  1Z3E A;  1OVN A;  1OC8 A;  2H66 A;  4KSM A;  3TKP A;  3IAM 2;  1T1V A;  4F0B A;  4J57 E;  2YN1 A;  3TKS C;  1TJD A;  3DWV A;  4K5S A;  2JZS A;  4FYC A;  4N30 A;  3P7X A;  4KGI A;  4G19 A;  2P5R A;  4EXJ A;  5B8B A;  2B5X A;  2VCV A;  5F06 A;  3QFA C;  3KEB A;  3I9V 2;  3ZIV A;  4EIQ A;  4YAV A;  2M80 A;  1IYI A;  2PWJ A;  4KUN A;  1FG4 A;  3F0I A;  5DAK A;  2MMZ A;  1OC3 A;  3DVX A;  5CRH A;  5IPH A;  2YJ7 A;  3IBH A;  3HHV A;  4ECJ A;  1R26 A;  2AHE A;  1VGL A;  2TIR A;  2QC7 A;  5KEJ A;  2M46 A;  1SK0 A;  3VI7 A;  5ELG A;  3ZML A;  5A5K A;  1XWB A;  3MSZ A;  2JSZ A;  4ECC A;  2LJR A;  4I8B A;  2C0G A;  4EDY A;  1A0R P;  5G5E A;  4HU7 A;  2IN3 A;  1JLV A;  4F82 A;  2DJ0 A;  2FA8 A;  3WGD A;  2L6C A;  1THO A;  2HFD A;  3I69 A;  3CRT A;  2H6Y A;  3W6G A;  1K0M A;  4D73 B;  1O6J A;  3CRU A;  3ZTL A;  3RHB A;  1TK5 B;  4TR4 A;  2YNX A;  3VUR A;  4OO5 A;  2LNT A;  2F51 A;  3F4S A;  3L9S A;  3P90 A;  1V9W A;  4K6X A;  5J3R A;  3QD9 A;  1X9S B;  3WYW A;  4PX1 A;  4AJ7 A;  2HZE A;  2CVK A;  2C8U A;  4EIP A;  2N5A A;  1KEB A;  1GH2 A;  1T8E B;  1EV9 A;  4PQH A;  3VFI A;  1HD2 A;  3G9B A;  2HSM A;  4GF0 A;  3IC8 A;  12GS A;  5IQY A;  2R37 A;  1R5A A;  1QXH A;  3I6A A;  3BD2 A;  3R3E A;  2YZU A;  2HSH A;  3UBL A;  3S9F A;  1XWG A;  1N2A A;  1MDK A;  5HR1 A;  3VPT A;  4ACS A;  1FVJ A;  5D8I A;  2DBC A;  4AJ6 A;  3V1W A;  1OE8 A;  3N9J A;  2VLU A;  2WUL A;  1WP0 A;  1YKA A;  2LS5 A;  3KP9 A;  1EGO A;  1KNG A;  2LNS A;  1YEP A;  4WR4 A;  3TKQ A;  4K5R A;  4EVM A;  4TW5 A;  1DSB A;  5DCH A;  4BVX B;  5AGY A;  4QL9 A;  4YH2 A;  1X0R A;  3F3R A;  1GSS A;  3UBK A;  4IP6 A;  4MZC A;  3C1R A;  5AN1 A;  5IO0 A;  1PN9 A;  4O5Q A;  1T4Z A;  4PTS A;  3QMX A;  4IN0 A;  2B1L A;  3HZ8 A;  2JU5 A;  4BA7 A;  4MNN A;  1EGR A;  3IK7 A;  3F3Q A;  1BG5 A;  2RM6 A;  4QQ7 A;  5ECP B;  5A4V A;  4KDU A;  2KP1 A;  1K0C A;  2YWI A;  2GQM A;  1ACV A;  2YV9 A;  5A4W A;  2VLV A;  5IMC A;  1ZOF A;  3P2A A;  3ZFL A;  3HA9 A;  2QGV A;  4IEL A;  3RHC A;  4WET A;  3GMF A;  2IMK A;  4ZB9 A;  5C00 A;  4PGT A;  1SK2 A;  3Q18 A;  1GSY A;  5CO3 A;  5ECL B;  2MZC A;  4PQI A;  1TTZ A;  3D21 A;  3GTU B;  4YKG A;  2H76 A;  3BBY A;  1G0T A;  3HD5 A;  4X0X A;  3H93 A;  5CRE A;  4IQA A;  2N5F A;  1DUG A;  1E2Y A;  1IYH A;  6GSW A;  1B4Q A;  2K6V A;  3D5J A;  3FHK A;  4RUV A;  5D96 A;  4OCF A;  2CV4 A;  1ILO A;  4BVY B;  1V40 A;  2F8F A;  3TJJ A;  2HT9 A;  4ML1 A;  4F9Z A;  2DMM A;  22GS A;  1TOF A;  1F2E A;  3C8E A;  1YF1 A;  2DKH A;  4X4J A;  4MJC A;  3GKK A;  8GSS A;  4XS6 A;  5IMV A;  1AQW A;  3QFB C;  5IO2 A;  1EOH A;  1M9B A;  3DRN A;  1MD4 A;  3IV4 A;  1XVW A;  3HZ4 A;  3L0H A;  3L9V A;  4K1F A;  2MBS A;  2ALB A;  4CY6 A;  4MJA A;  3LQ7 A;  2GQL A;  2CAQ A;  2DIZ A;  3GIX A;  3FKF A;  4I97 A;  1HNC A;  2QA1 A;  3KM6 A;  1HNA A;  2IMI A;  2LQO A;  3CQF A;  4GSN A;  4MF6 A;  2DJK A;  3BCK A;  2CAI A;  1XXU A;  5ID2 B;  1VF1 A;  2R2J A;  5B6N A;  4F03 A;  5G5F A;  3EU3 A;  1NSW A;  4YAP A;  3GX0 A;  1QGV A;  4LMV A;  3EVI A;  1X9W B;  4QL7 A;  5ECH B;  3C1S A;  1RW1 A;  3APQ A;  2ON5 A;  2TRX A;  1PRX A;  2A2R A;  1PKW A;  2V32 A;  1Q4J A;  2H1D A;  3VWV A;  2HZF A;  5KN3 A;  2V6K A;  1ABA A;  4KCA A;  2C3N A;  2AAW A;  4FYB A;  4IP1 A;  1PX6 A;  1GTU A;  2FWG A;  2VM2 A;  2L5L A;  3GHA A;  1A23 A;  1AAZ A;  4WBR D;  4XTS A;  3H4K A;  3M3M A;  1XCC A;  1XZO A;  3EUR A;  4IJI A;  4Q5Q A;  4WF5 A;  2GSQ A;  2IMD A;  3KTL A;  4MJB A;  5IMZ A;  1YJ6 A;  1Z9H A;  3FZ5 A;  4RQR A;  1FOH A;  4KW6 A;  4KCE A;  2H1B A;  1U87 A;  5HR2 A;  4BVY A;  2LEG A;  1G7E A;  2RUF A;  3ZL5 A;  1VF4 A;  3G7J A;  4ZIL A;  3HYP A;  3N5O A;  4OFM A;  2V2G A;  2L59 A;  3GH9 A;  4XCS A;  4XHM A;  1LU4 A;  1W89 A;  1VF2 A;  4FH8 A;  3H8Q A;  4O5U A;  9GSS A;  4NPB A;  4I6X A;  1O8X A;  1WOU A;  3ME8 A;  4I2T A;  3ERF A;  2R4V A;  5B8A A;  2REM A;  1S3C A;  3SWL A;  3IOS A;  3US3 A;  2PGT A;  3CXG A;  1W4V A;  4MLY A;  1Z7R A;  2AV4 A;  5IIZ A;  4KE3 A;  1B9X C;  3ZIT A;  5F8B A;  6GSU A;  2ZCT A;  4FO5 A;  4TKY A;  4F2I A;  5ECS A;  3LXT A;  3IDV A;  2OE0 A;  4K0G A;  2VCZ A;  1OC9 A;  3A2W A;  1XPV A;  3GUR A;  5ID2 A;  1ZL9 A;  1QFN A;  4JED A;  3L78 A;  2PPT A;  2JAC A;  3QAW A;  1NHO A;  3KMO A;  2NPB A;  1XBS A;  2O8V B;  5ECQ B;  2FWF A;  3D4T A;  1K0D A;  4JR6 A;  4O7H A;  2LJA A;  2DML A;  1JZR A;  2XHF A;  2XBQ A;  1MDJ A;  2I4A A;  3LEF A;  4ISD A;  2YWM A;  3TRQ A;  4PUA A;  1AQX A;  2QKE A;  4IGJ A;  2DC5 A;  3D0Z A;  3A5W A;  3ZYW A;  2XBI A;  3D4M A;  4CHS A;  1T4Y A;  2P5Q A;  3VPQ A;  13GS A;  19GS A;  2P0G A;  3LWA A;  4DVC A;  5IOW A;  2A2S A;  4YQM A;  4OFN A;  2DIY A;  2FCH A;  2IFQ B;  1EZK A;  4IVF A;  2H72 A;  3FEU A;  4YQV A;  1ZCP A;  2NVL A;  1A2J A;  1MTC A;  4LL1 B;  1HQO A;  1GNW A;  3DXB A;  1GL8 A;  1QQ2 A;  2HI7 A;  4G0L A;  4Q5R A;  4KH7 A;  4ECB A;  2HZE B;  10GS A;  4DSQ A;  4Q5F A;  3QCP A;  5D73 A;  3W8S A;  4MF7 A;  5JCW A;  5KN2 A;  1SEN A;  2B6M A;  2B5E A;  4KDX A;  2YZH A;  5ELA A;  3UAP A;  1SJI A;  3EC3 A;  3GV1 A;  5D93 A;  3BOA A;  4FYU A;  2HRF A;  4PNF A;  1GSE A;  4I5Q A;  1PGT A;  1KBN A;  4TR3 A;  1HYU A;  1N8J A;  2GTU A;  1TU7 A;  4FQU A;  4CDO A;  4NHW A;  3HVS A;  4EUY A;  4HJM A;  3FZ4 A;  1GTI A;  3M0F A;  1WWJ A;  2HYX A;  3CSH A;  3D22 A;  4MPF A;  2F9S A;  2VM1 A;  1GUL A;  3HKR A;  3VWX A;  1X9M B;  2QSI A;  2O7K A;  3DIE A;  1AC1 A;  2ES7 A;  1YZX A;  17GS A;  1URM A;  4PNG A;  2GZY A;  1U88 A;  2LRC A;  5GSS A;  4Z2U A;  1THX A;  1OYJ A;  1QUW A;  4L0W A;  3K8N A;  1GSF A;  2PVQ A;  3UVH A;  3F6D A;  3PR8 A;  2L5O A;  2IMF A;  4PXO A;  1QMV A;  4XRD A;  4E8E A;  4JU5 A;  5G1K A;  1S3D A;  4O92 A;  3Q74 A;  3MWH A;  3UIW A;  1HNB A;  2OBI A;  1WRY A;  5G1L A;  3IR4 A;  2PUK C;  4K0N A;  1TP9 A;  4JBB A;  1V57 A;  2IFQ A;  1O7U A;  4N11 A;  2PBJ A;  3I43 A;  2H71 A;  5DJL A;  4EE0 A;  5JCU A;  11GS A;  1PMT A;  3DGQ A;  2AJQ B;  3EMP A;  3EMX A;  4POM A;  3KCM A;  2FUG 2;  7GSS A;  1B4P A;  5JWR B;  3FY7 A;  3LGC A;  4GQC A;  3F9U A;  3FZ9 A;  3TKS E;  4XS4 A;  5CP1 A;  3CTF A;  6GSS A;  3Q6O A;  2OAD A;  3HY2 A;  3ZVJ A;  3LYK A;  6GSY A;  4EF0 A;  2WZ9 A;  1B9Y C;  1GSU A;  2VOC A;  1GP1 A;  1QK8 A;  4KX4 A;  3MNG A;  1SL2 B;  1FB0 A;  3LOR A;  2C4J A;  2IWT A;  3C73 A;  4XS1 A;  1K0B A;  1SYX A;  4F0C A;  4IBP A;  3MAK A;  2CVB A;  3EWL A;  2L4Q A;  1GUH A;  1AXD A;  2GZP A;  3GRX A;  5AIX A;  1H75 A;  1YKC A;  2VUP A;  3HJP A;  2O87 A;  4K7I A;  1EEJ A;  1FO5 A;  3TJK A;  1F6M C;  2PN8 A;  4KA0 A;  1DBY A;  3ED3 A;  3TJB A;  5E4W A;  1PA3 A;  4IW9 A;  3C71 A;  1YEX A;  1FAA A;  1M99 A;  1X5C A;  2OE1 A;  2RII A;  3KZQ A;  3KH9 A;  1V2A A;  1TRS A;  2CX3 A;  2H1G A;  1SL0 B;  1FB6 A;  2DJ1 A;  2WDU A;  4K8M A;  4ILF A;  3A2X A;  5CYY A;  3SBC A;  4KDY A;  5G2Z A;  2VLT A;  2KP2 A;  4J2F A;  5GST A;  1JHB A;  1V98 A;  1PL2 A;  1ZGN A;  2FGX A;  4BIK A;  2H0H A;  4OMV A;  5H5R A;  1XG8 A;  3KXO A;  3ERG A;  4MJE A;  3H1N A;  1GUM A;  4WXT A;  2DLX A;  1A24 A;  2BTO T;  1XIY A;  2GQK A;  2VO4 A;  4POL A;  2I81 A;  5G30 A;  3HJM A;  5L71 A;  4KND A;  4PQ1 A;  2OAC A;  1K0A A;  1A2L A;  1EWX A;  2C3T A;  4PUR A;  5DBQ A;  2CT6 A;  5HFI A;  4RI7 A;  1BX9 A;  1FVK A;  2XPE A;  3GST A;  4GWR A;  2O85 A;  4JZQ A;  2IL3 A;  1TK8 B;  3FMW A;  1GUK A;  4OO4 A;  4TXO A;  4IQ1 A;  4TXV A;  1PN0 A;  1K3O A;  3GL3 A;  1YF0 A;  4BL7 A;  3PH9 A;  3Q19 A;  4EDZ A;  5EPF A;  2E2M A;  4O32 A;  1BAY A;  2Z9S A;  4MP4 A;  2X8G A;  4ID0 A;  2H0I A;  1U3A A;  2C3Q A;  1TW9 A;  3GKX A;  1B48 A;  4G0K A;  1FHE A;  1AIU A;  2LQQ A;  3J7Y k;  2YJH A;  4GTU A;  3CYN A;  3TRX A;  1SJZ A;  2R6K A;  1ERT A;  1ZYE A;  2VIM A;  4ECI A;  3J7Y b;  3EYT A;  1O73 A;  2ZNM A;  4Z2R A;  1ZMA A;  2A4V A;  4ICY A;  4ZBA A;  2HLS A;  5J5N A;  1OC9 B;  3VK9 A;  3IHQ A;  3W8J A;  3GNJ A;  2K8S A;  3FR3 A;  4OWY A;  5COH A;  1EOG A;  4JE1 A;  2XPD A;  3QAV A;  4L0U A;  1J0F A;  1EP7 A;  3D6I A;  3ZFB A;  5HR3 A;  5F05 A;  3NIV A;  1G6Y A;  2B5Y A;  2L57 A;  4TRX A;  3CBU A;  3ZRD A;  2YV7 A;  3GKN A;  1FOV A;  2X8H A;  4TR0 A;  1X5D A;  4Q5N A;  3IXR A;  4AF2 A;  1SL1 B;  2EC4 A;  4USS A;  3GH6 A;  4NWY A;  5DVB A;  3LG6 A;  2DJ3 A;  1TI1 A;  3RPN A;  2NTO A;  2X4A A;  3VWW A;  1Y6E A;  2C80 A;  2K8V A;  3CSI A;  5IPG A;  1XWK A;  3TCO A;  3HJO A;  5D9X A;  1M2A A;  2DJ2 A;  3KMN A;  4ZIJ A;  5AIS A;  2K9F A;  5B7C A;  1F3B A;  5EY6 A;  1H4O A;  3F63 A;  2YCD A;  1SD9 A;  2VL2 A;  3NZN A;  3NOF A;  1DE1 A;  2YWO A;  2HE3 A;  3QPM A;  4JRR A;  4MF5 A;  1E6B A;  1F37 A;  2LRN A;  2EIR A;  5A4U A;  2V6O A;  3F4T A;  1VRS D;  1JZD A;  1UC7 A;  1TK0 B;  1PKZ A;  5D9W A;  1PX7 A;  4HS1 A;  1O8W A;  2C0F A;  3R2Q A;  1JFU A;  3TUE A;  1K3Y A;  2KLX A;  1VF3 A;  1I5G A;  1JZW A;  3KH7 A;  2FY6 A;  2UZ8 A;  3RDW A;  2MMO A;  1TRV A;  2H6Z A;  2H30 A;  2XC2 A;  1GTB A;  5KN0 A;  2VL3 A;  4MMM A;  3GL5 A;  4CY8 A;  1OAZ A;  1SYR A;  5KOW A;  3TJG A;  3TKS A;  2MMN A;  2DSA A;  2R0P A;  2HSY A;  1SJ6 A;  1WMJ A;  5BMU A;  1S3A A;  4O5R A;  3VLN A;  3QOU A;  1U6T A;  3PGT A;  1EEM A;  3A2V A;  3TJF A;  3ISO A;  4ZBB A;  1M2D A;  1CQG A;  2PER A;  4GXZ A;  2MBT A;  2FLS A;  5AIV A;  1ML6 A;  2C0E A;  3AY8 A;  2CX4 A;  2LUS A;  3PIN A;  4K2X A;  3UJ1 A;  1T3B A;  2IME A;  1ERV A;  3IPZ A;  1YQ1 A;  1M3J A;  3FR9 A;  1Z6M A;  1R4W A;  1AQV A;  3ERW A;  2X49 A;  1MDI A;  3VI5 A;  4XS4 B;  2B3S A;  4IS0 A;  3EIN A;  4TN8 A;  4GCI A;  3BJ5 A;  4KSO A;  2OA7 A;  3LXZ A;  2HRK A;  2GZZ A;  4HDE A;  1XFL A;  4L8E A;  3DEX A;  4GSS A;  3A3T A;  1AW9 A;  4ZL9 A;  1LJR A;  5INY A;  2H01 A;  3EE2 A;  3GSS A;  3WT1 A;  5H5S A;  1WJK A;  1USB A;  1A0F A;  3E0U A;  2VCT A;  1YY7 A;  2CZ3 A;  4IHU A;  4X1U A;  4ZB6 A;  3FK8 A;  2MYG A;  2KUC A;  3HXS A;  4V2N A;  1BQ7 A;  4ZBD A;  2O89 A;  4YQU A;  4HQS A;  2WJU A;  3CSJ A;  5IMF A;  2GT5 A;  2VL9 A;  3F8U A;  3DKS A;  2TRC P;  1G7O A;  4EC0 A;  4HQZ A;  2H6X A;  4CW9 A;  1SKW B;  2R5G A;  2KHP A;  1MD3 A;  4MPG A;  2VD1 A;  2FNO A;  2VCW A;  4G2E A;  5D9V A;  20GS A;  3FRC A;  1EV4 A;  3CMI A;  2WFC A;  3DVW A;  1XW5 A;  4PUF C;  3UOM A;  1M9A A;  1C72 A;  1MEK A;  1R7H A;  4K7O A;  3O3T A;  2AB6 A;  5CAX A;  2L6D A;  4JR4 A;  1Q98 A;  3GYK A;  2LRT A;  2H19 A;  2I1U A;  3M9J A;  1I9D A;  16GS A;  1AUC A;  4TOP A;  5JWO B;  4K2D A;  5IM9 A;  4X43 A;  3FYG A;  3QAG A;  3LSZ A;  4NHZ A;  4RI6 A;  3TRP A;  4K7N A;  4HOJ A;  1SKR B;  1F3A A;  1Z6N A;  3RPP A;  4WEY A;  4G10 A;  4HEA 2;  1B8X A;  4A5P A;  1ZZY A;  4LLR A;  4MA9 A;  4TXO B;  5IMD A;  3TGZ A;  2EIQ A;  1CQH A;  4NXI A;  2ZUP A;  4BPY A;  4BL7 B;  5G31 A;  3OR5 A;  4L5L A;  1A2M A;  4MK3 A;  4FIW A;  3RBT A;  4HZ4 A;  3IRA A;  2A2P A;  4HZ2 A;  3UMA A;  3PPU A;  4XIH A;  1UVZ A;  2F8A A;  2H74 A;  1T7P B;  1XWC A;  1WPI A;  3LJR A;  2WS2 A;  2GGT A;  2AYT A;  2D2Z A;  14GS A; 
#chains in the Genus database with same CATH homology
 5DAL B;  5GAP D;  4P3Y B;  4V2M A;  2B1K A;  3TOT A;  1WIK A;  1M7T A;  3C7M A;  2GDR A;  1SKS B;  4EKZ A;  3KP8 A;  5CRW A;  2GST A;  3FR6 A;  4OCE A;  1PSQ A;  2LKU A;  5GAN D;  5JCG A;  3WGX A;  2NBS A;  4G0I A;  2RUE A;  4N0Z A;  3QDN A;  1GWC A;  1J9B A;  2CZ2 A;  3JCM L;  1SK1 A;  2H70 A;  2R0G A;  4DSS B;  2LJK A;  3A5I A;  4MCU A;  4LL4 B;  1ZYN A;  5IMA A;  3EPT A;  1GSQ A;  3KD0 A;  3LFL A;  2GSR A;  4KB3 A;  1Z7P A;  5FT3 A;  1JLW A;  3F6F A;  2WGR A;  3O76 A;  4H86 A;  2YOI A;  2H75 A;  4I2U A;  2GSS A;  1M2B A;  3G7Y A;  4L5O A;  4GQF A;  1R5P A;  3O6T A;  1KTE A;  4NV5 A;  2VCX A;  5DQS A;  2V1M A;  3UVT A;  4K9Z A;  18GS A;  1LBK A;  2JAD A;  4ZL7 A;  2LTK A;  4D73 A;  1XVQ A;  2CA8 A;  2J9H A;  3UL3 A;  4ULX A;  2X8C A;  2G0F A;  3HDC A;  3TDG A;  4HI7 A;  3L9U A;  6GSV A;  5ECI B;  2C1Y A;  3MYD A;  2YAN A;  4HJ2 A;  3DYR A;  2K18 A;  5ECM B;  1XOA A;  1G6W A;  5DCG A;  1TI3 A;  2YPM A;  1OKD A;  1EP8 A;  1O85 A;  2RM5 A;  2GT6 A;  4RQX A;  3KIJ A;  5ECR B;  4MAB A;  4GST A;  1F9M A;  2FD3 A;  2PU9 C;  4YKF A;  3WGE A;  5ABR A;  1GNE A;  2IPA A;  2N5B A;  2YP6 A;  4ZL8 A;  2R0C A;  2FWE A;  3M8N A;  1OKT A;  1SU9 A;  5DDL A;  3UEM A;  3IC4 A;  3ZVJ D;  2B7K A;  4V1A p;  3E9J B;  4GLT A;  5E59 A;  3QR6 A;  3DD3 A;  5DAL A;  5B6M A;  2H8L A;  3ZIJ A;  2G2Q A;  3TOU A;  5EVO A;  1UN2 A;  2OKA A;  1GSD A;  6GST A;  3EU4 A;  3L4N A;  4KAE A;  1T00 A;  3GFK A;  4LA1 A;  4BWQ A;  3IK9 A;  5JWQ B;  5BRT A;  4WF4 A;  5F0G A;  3WD6 A;  4WR5 A;  5J4U A;  1XOB A;  2E7P A;  1OE7 A;  2JZR A;  4IKH A;  4BVX A;  2E2G A;  1TDI A;  2L4C A;  5DQY A;  2OBK A;  4BWS A;  5CRD A;  5CRG A;  3FZA A;  2X99 A;  4DSS A;  4HUA A;  2QA2 A;  2PVO C;  2X64 A;  6GSX A;  2OJL A;  3E3E A;  1XW6 A;  3IA1 A;  2NDO A;  4WKW A;  2IJY A;  2EIO A;  2R3X A;  2BJX A;  3KJY A;  5KOX A;  4Z2T A;  3GA4 A;  4V1A g;  2DKI A;  1TRU A;  3F4R A;  2JZT A;  1BYE A;  5CNW A;  2OE3 A;  1A8L A;  1FW1 A;  3GKM A;  2H73 A;  3LW9 A;  1O81 A;  2FWH A;  3ZRE A;  2HNL A;  4DSR A;  4V2L A;  3U6V A;  1K0O A;  3H79 A;  4TR1 B;  3GTU A;  3GX8 A;  5LCZ A;  2HXK A;  3APS A;  1ST9 A;  2H0G A;  2P31 A;  4N10 A;  3HVX A;  1RQM A;  1XW9 A;  5C04 A;  2V41 A;  4G9H A;  1X5E A;  2WCI A;  2JSY A;  2ON7 A;  3WT2 A;  4OD7 A;  3RAZ A;  1TU8 A;  5FWG A;  1WE0 A;  2BMX A;  5ECK B;  2CQ9 A;  4N0V A;  4EO3 A;  1DE2 A;  1M0U A;  1NHY A;  4Z7X A;  5KN1 A;  2DJJ A;  4ZB8 A;  1UA5 A;  5HR0 A;  2PMT A;  1NM3 A;  5ECN B;  2F3M A;  2HRN A;  2J23 A;  1Z5Y E;  1XWA A;  2GVP A;  2VCQ A;  3KTB A;  2GS3 A;  2AUV A;  2WB9 A;  3DML A;  3ZZX A;  1K3L A;  2VAF A;  3ME7 A;  3MIX A;  4WBJ A;  5H5Q A;  4AGS A;  3TKR A;  2JL4 A;  1PQN A;  3HCZ A;  4MH2 A;  2FA4 A;  5DAK B;  2KOK A;  3MDK A;  3UAR A;  3M9K A;  2LV3 A;  5J41 A;  3IHG A;  5DJM A;  4IJ3 A;  2B7J A;  4GRF A;  5EL8 A;  4ML6 A;  1TXX A;  2VD0 A;  3FW2 A;  4NV2 A;  1ON4 A;  2YWN A;  2A4H A;  1K0N A;  3BCI A;  4EL1 A;  1ZYP A;  2CVD A;  2GLR A;  3ZLP A;  1NW2 A;  1ZYQ B;  3TB2 A;  3APO A;  2RLI A;  2I3Y A;  1GLQ A;  5J9C A;  1TKD B;  4KF9 A;  2VL2 C;  1J08 A;  2FHE A;  5HFG A;  5LD0 A;  1U3I A;  5GZZ B;  1BJX A;  5D9T A;  5IOX A;  4J56 E;  5ENU A;  1ERW A;  4E8H A;  5LNK e;  4MZB A;  3GUS A;  3CTG A;  2M72 A;  1SD8 A;  3P8W A;  4TR1 A;  4NMU A;  4TVE A;  1RK4 A;  1ERU A;  4ZXG A;  1YDK A;  1PD2 1;  3LYP A;  1GRX A;  4OFT A;  1Y25 A;  1V58 A;  5F07 A;  2LST A;  3GN3 A;  4NAX A;  4HU9 A;  1BED A;  5FHI A;  4POK A;  2IIY A;  4MH3 A;  1A8Y A;  2C0D A;  4AJ8 A;  1TRW A;  2I9H A;  5ECO B;  2HRA A;  3HVV A;  5HQP A;  3IE3 A;  1PL1 A;  4XRA A;  2MMA A;  4MZW A;  4POB A;  3M1G A;  3ZMK A;  5HFK A;  2H1A A;  3VWU A;  4DEJ A;  2E0Q A;  3KGK A;  1GTA A;  3IAS 2;  3U5R E;  3G7I A;  1GLP A;  1JZO A;  4LMW A;  2WRT A;  5J9B A;  4MDC A;  1Z3E A;  1OVN A;  1OC8 A;  2H66 A;  4KSM A;  3TKP A;  3IAM 2;  1T1V A;  4F0B A;  4J57 E;  2YN1 A;  3TKS C;  1TJD A;  3DWV A;  4K5S A;  2JZS A;  4FYC A;  4N30 A;  3P7X A;  4KGI A;  4G19 A;  2P5R A;  4EXJ A;  5B8B A;  2B5X A;  2VCV A;  5F06 A;  3QFA C;  3KEB A;  3I9V 2;  3ZIV A;  4EIQ A;  4YAV A;  2M80 A;  1IYI A;  2PWJ A;  4KUN A;  1FG4 A;  3F0I A;  5DAK A;  2MMZ A;  1OC3 A;  3DVX A;  5CRH A;  5IPH A;  2YJ7 A;  3IBH A;  3HHV A;  4ECJ A;  1R26 A;  2AHE A;  1VGL A;  2TIR A;  2QC7 A;  5KEJ A;  2M46 A;  1SK0 A;  3VI7 A;  5ELG A;  3ZML A;  5A5K A;  1XWB A;  3MSZ A;  2JSZ A;  4ECC A;  2LJR A;  4I8B A;  2C0G A;  4EDY A;  1A0R P;  5G5E A;  4HU7 A;  2IN3 A;  1JLV A;  4F82 A;  2DJ0 A;  2FA8 A;  3WGD A;  2L6C A;  1THO A;  2HFD A;  3I69 A;  3CRT A;  2H6Y A;  3W6G A;  1K0M A;  4D73 B;  1O6J A;  3CRU A;  3ZTL A;  3RHB A;  1TK5 B;  4TR4 A;  2YNX A;  3VUR A;  4OO5 A;  2LNT A;  2F51 A;  3F4S A;  3L9S A;  3P90 A;  1V9W A;  4K6X A;  5J3R A;  3QD9 A;  1X9S B;  3WYW A;  4PX1 A;  4AJ7 A;  2HZE A;  2CVK A;  2C8U A;  4EIP A;  2N5A A;  1KEB A;  1GH2 A;  1T8E B;  1EV9 A;  4PQH A;  3VFI A;  1HD2 A;  3G9B A;  2HSM A;  4GF0 A;  3IC8 A;  12GS A;  5IQY A;  2R37 A;  1R5A A;  1QXH A;  3I6A A;  3BD2 A;  3R3E A;  2YZU A;  2HSH A;  3UBL A;  3S9F A;  1XWG A;  1N2A A;  1MDK A;  5HR1 A;  3VPT A;  4ACS A;  1FVJ A;  5D8I A;  2DBC A;  4AJ6 A;  3V1W A;  1OE8 A;  3N9J A;  2VLU A;  2WUL A;  1WP0 A;  1YKA A;  2LS5 A;  3KP9 A;  1EGO A;  1KNG A;  2LNS A;  1YEP A;  4WR4 A;  3TKQ A;  4K5R A;  4EVM A;  4TW5 A;  1DSB A;  5DCH A;  4BVX B;  5AGY A;  4QL9 A;  4YH2 A;  1X0R A;  3F3R A;  1GSS A;  3UBK A;  4IP6 A;  4MZC A;  3C1R A;  5AN1 A;  5IO0 A;  1PN9 A;  4O5Q A;  1T4Z A;  4PTS A;  3QMX A;  4IN0 A;  2B1L A;  3HZ8 A;  2JU5 A;  4BA7 A;  4MNN A;  1EGR A;  3IK7 A;  3F3Q A;  1BG5 A;  2RM6 A;  4QQ7 A;  5ECP B;  5A4V A;  4KDU A;  2KP1 A;  1K0C A;  2YWI A;  2GQM A;  1ACV A;  2YV9 A;  5A4W A;  2VLV A;  5IMC A;  1ZOF A;  3P2A A;  3ZFL A;  3HA9 A;  2QGV A;  4IEL A;  3RHC A;  4WET A;  3GMF A;  2IMK A;  4ZB9 A;  5C00 A;  4PGT A;  1SK2 A;  3Q18 A;  1GSY A;  5CO3 A;  5ECL B;  2MZC A;  4PQI A;  1TTZ A;  3D21 A;  3GTU B;  4YKG A;  2H76 A;  3BBY A;  1G0T A;  3HD5 A;  4X0X A;  3H93 A;  5CRE A;  4IQA A;  2N5F A;  1DUG A;  1E2Y A;  1IYH A;  6GSW A;  1B4Q A;  2K6V A;  3D5J A;  3FHK A;  4RUV A;  5D96 A;  4OCF A;  2CV4 A;  1ILO A;  4BVY B;  1V40 A;  2F8F A;  3TJJ A;  2HT9 A;  4ML1 A;  4F9Z A;  2DMM A;  22GS A;  1TOF A;  1F2E A;  3C8E A;  1YF1 A;  2DKH A;  4X4J A;  4MJC A;  3GKK A;  8GSS A;  4XS6 A;  5IMV A;  1AQW A;  3QFB C;  5IO2 A;  1EOH A;  1M9B A;  3DRN A;  1MD4 A;  3IV4 A;  1XVW A;  3HZ4 A;  3L0H A;  3L9V A;  4K1F A;  2MBS A;  2ALB A;  4CY6 A;  4MJA A;  3LQ7 A;  2GQL A;  2CAQ A;  2DIZ A;  3GIX A;  3FKF A;  4I97 A;  1HNC A;  2QA1 A;  3KM6 A;  1HNA A;  2IMI A;  2LQO A;  4GSN A;  4MF6 A;  2DJK A;  3BCK A;  2CAI A;  1XXU A;  5ID2 B;  1VF1 A;  2R2J A;  5B6N A;  4F03 A;  5G5F A;  3EU3 A;  1NSW A;  4YAP A;  3GX0 A;  1QGV A;  4LMV A;  3EVI A;  1X9W B;  4QL7 A;  5ECH B;  3C1S A;  1RW1 A;  3APQ A;  2ON5 A;  2TRX A;  1PRX A;  2A2R A;  1PKW A;  2V32 A;  1Q4J A;  2H1D A;  3VWV A;  2HZF A;  5KN3 A;  2V6K A;  1ABA A;  4KCA A;  2C3N A;  2AAW A;  4FYB A;  4IP1 A;  1PX6 A;  1GTU A;  2FWG A;  2VM2 A;  2L5L A;  3GHA A;  1A23 A;  1AAZ A;  4WBR D;  4XTS A;  3H4K A;  3M3M A;  1XCC A;  1XZO A;  3EUR A;  4IJI A;  4Q5Q A;  4WF5 A;  2GSQ A;  2IMD A;  3KTL A;  4MJB A;  5IMZ A;  1YJ6 A;  1Z9H A;  3FZ5 A;  4RQR A;  1FOH A;  4KW6 A;  4KCE A;  2H1B A;  1U87 A;  5HR2 A;  4BVY A;  2LEG A;  1G7E A;  2RUF A;  3ZL5 A;  1VF4 A;  3G7J A;  4ZIL A;  3HYP A;  3N5O A;  4OFM A;  2V2G A;  2L59 A;  3GH9 A;  4XCS A;  4XHM A;  1LU4 A;  1W89 A;  1VF2 A;  4FH8 A;  3H8Q A;  4O5U A;  9GSS A;  4NPB A;  4I6X A;  1O8X A;  1WOU A;  3ME8 A;  4I2T A;  3ERF A;  2R4V A;  5B8A A;  2REM A;  1S3C A;  3SWL A;  3IOS A;  3US3 A;  2PGT A;  3CXG A;  1W4V A;  4MLY A;  1Z7R A;  2AV4 A;  5IIZ A;  4KE3 A;  1B9X C;  3ZIT A;  5F8B A;  6GSU A;  2ZCT A;  4FO5 A;  4TKY A;  4F2I A;  5ECS A;  3LXT A;  3IDV A;  2OE0 A;  4K0G A;  2VCZ A;  1OC9 A;  3A2W A;  1XPV A;  3GUR A;  5ID2 A;  1ZL9 A;  1QFN A;  4JED A;  3L78 A;  2PPT A;  2JAC A;  3QAW A;  1NHO A;  3KMO A;  2NPB A;  1XBS A;  2O8V B;  5ECQ B;  2FWF A;  3D4T A;  1K0D A;  4JR6 A;  4O7H A;  2LJA A;  2DML A;  1JZR A;  2XHF A;  2XBQ A;  1MDJ A;  2I4A A;  3LEF A;  4ISD A;  2YWM A;  3TRQ A;  4PUA A;  1AQX A;  2QKE A;  4IGJ A;  2DC5 A;  3D0Z A;  3A5W A;  3ZYW A;  2XBI A;  3D4M A;  4CHS A;  1T4Y A;  2P5Q A;  3VPQ A;  13GS A;  19GS A;  2P0G A;  3LWA A;  4DVC A;  5IOW A;  2A2S A;  4YQM A;  4OFN A;  2DIY A;  2FCH A;  2IFQ B;  1EZK A;  4IVF A;  2H72 A;  3FEU A;  4YQV A;  1ZCP A;  2NVL A;  1A2J A;  1MTC A;  4LL1 B;  1HQO A;  1GNW A;  3DXB A;  1GL8 A;  1QQ2 A;  2HI7 A;  4G0L A;  4Q5R A;  4KH7 A;  4ECB A;  2HZE B;  10GS A;  4DSQ A;  4Q5F A;  3QCP A;  5D73 A;  3W8S A;  4MF7 A;  5JCW A;  5KN2 A;  1SEN A;  2B6M A;  2B5E A;  4KDX A;  2YZH A;  5ELA A;  3UAP A;  1SJI A;  3EC3 A;  3GV1 A;  5D93 A;  3BOA A;  4FYU A;  2HRF A;  4PNF A;  1GSE A;  4I5Q A;  1PGT A;  1KBN A;  4TR3 A;  1HYU A;  1N8J A;  2GTU A;  1TU7 A;  4FQU A;  4CDO A;  4NHW A;  3HVS A;  4EUY A;  4HJM A;  3FZ4 A;  1GTI A;  3M0F A;  1WWJ A;  2HYX A;  3CSH A;  3D22 A;  4MPF A;  2F9S A;  2VM1 A;  1GUL A;  3HKR A;  3VWX A;  1X9M B;  2QSI A;  2O7K A;  3DIE A;  1AC1 A;  2ES7 A;  1YZX A;  17GS A;  1URM A;  4PNG A;  2GZY A;  1U88 A;  2LRC A;  5GSS A;  4Z2U A;  1THX A;  1OYJ A;  1QUW A;  4L0W A;  3K8N A;  1GSF A;  2PVQ A;  3UVH A;  3F6D A;  3PR8 A;  2L5O A;  2IMF A;  4PXO A;  1QMV A;  4XRD A;  4E8E A;  4JU5 A;  5G1K A;  1S3D A;  4O92 A;  3Q74 A;  3MWH A;  3UIW A;  1HNB A;  2OBI A;  1WRY A;  5G1L A;  3IR4 A;  2PUK C;  4K0N A;  1TP9 A;  4JBB A;  1V57 A;  2IFQ A;  1O7U A;  4N11 A;  2PBJ A;  3I43 A;  2H71 A;  5DJL A;  4EE0 A;  5JCU A;  11GS A;  1PMT A;  3DGQ A;  2AJQ B;  3EMP A;  3EMX A;  4POM A;  3KCM A;  2FUG 2;  7GSS A;  1B4P A;  5JWR B;  3FY7 A;  3LGC A;  4GQC A;  3F9U A;  3FZ9 A;  3TKS E;  4XS4 A;  5CP1 A;  3CTF A;  6GSS A;  3Q6O A;  2OAD A;  3HY2 A;  3ZVJ A;  3LYK A;  6GSY A;  4EF0 A;  2WZ9 A;  1B9Y C;  1GSU A;  2VOC A;  1GP1 A;  1QK8 A;  4KX4 A;  3MNG A;  1SL2 B;  1FB0 A;  3LOR A;  2C4J A;  2IWT A;  3C73 A;  4XS1 A;  1K0B A;  1SYX A;  4F0C A;  4IBP A;  3MAK A;  2CVB A;  3EWL A;  2L4Q A;  1GUH A;  1AXD A;  2GZP A;  3GRX A;  5AIX A;  1H75 A;  1YKC A;  2VUP A;  3HJP A;  2O87 A;  4K7I A;  1EEJ A;  1FO5 A;  3TJK A;  1F6M C;  2PN8 A;  4KA0 A;  1DBY A;  3ED3 A;  3TJB A;  5E4W A;  1PA3 A;  4IW9 A;  3C71 A;  1YEX A;  1FAA A;  1M99 A;  1X5C A;  2OE1 A;  2RII A;  3KZQ A;  3KH9 A;  1V2A A;  1TRS A;  2CX3 A;  2H1G A;  1SL0 B;  1FB6 A;  2DJ1 A;  2WDU A;  4K8M A;  4ILF A;  3A2X A;  5CYY A;  3SBC A;  4KDY A;  5G2Z A;  2VLT A;  2KP2 A;  4J2F A;  5GST A;  1JHB A;  1V98 A;  1PL2 A;  1ZGN A;  2FGX A;  2H0H A;  4OMV A;  5H5R A;  3KXO A;  3ERG A;  4MJE A;  3H1N A;  1GUM A;  4WXT A;  2DLX A;  1A24 A;  2BTO T;  1XIY A;  2GQK A;  2VO4 A;  4POL A;  2I81 A;  5G30 A;  3HJM A;  5L71 A;  4KND A;  4PQ1 A;  2OAC A;  1K0A A;  1A2L A;  1EWX A;  2C3T A;  4PUR A;  5DBQ A;  2CT6 A;  5HFI A;  4RI7 A;  1BX9 A;  1FVK A;  2XPE A;  3GST A;  4GWR A;  2O85 A;  4JZQ A;  2IL3 A;  1TK8 B;  3FMW A;  1GUK A;  4OO4 A;  4TXO A;  4IQ1 A;  4TXV A;  1PN0 A;  1K3O A;  3GL3 A;  1YF0 A;  4BL7 A;  3PH9 A;  3Q19 A;  4EDZ A;  5EPF A;  2E2M A;  4O32 A;  1BAY A;  2Z9S A;  4MP4 A;  2X8G A;  4ID0 A;  2H0I A;  1U3A A;  2C3Q A;  1TW9 A;  3GKX A;  1B48 A;  4G0K A;  1FHE A;  1AIU A;  2LQQ A;  3J7Y k;  2YJH A;  4GTU A;  3CYN A;  3TRX A;  1SJZ A;  2R6K A;  1ERT A;  1ZYE A;  2VIM A;  4ECI A;  3J7Y b;  3EYT A;  1O73 A;  2ZNM A;  4Z2R A;  1ZMA A;  2A4V A;  4ICY A;  4ZBA A;  2HLS A;  5J5N A;  1OC9 B;  3VK9 A;  3IHQ A;  3W8J A;  3GNJ A;  2K8S A;  3FR3 A;  4OWY A;  5COH A;  1EOG A;  4JE1 A;  2XPD A;  3QAV A;  4L0U A;  1J0F A;  1EP7 A;  3D6I A;  3ZFB A;  5HR3 A;  5F05 A;  3NIV A;  1G6Y A;  2B5Y A;  2L57 A;  4TRX A;  3CBU A;  3ZRD A;  2YV7 A;  3GKN A;  1FOV A;  2X8H A;  4TR0 A;  1X5D A;  4Q5N A;  3IXR A;  4AF2 A;  1SL1 B;  2EC4 A;  4USS A;  3GH6 A;  4NWY A;  5DVB A;  3LG6 A;  2DJ3 A;  1TI1 A;  3RPN A;  2NTO A;  2X4A A;  3VWW A;  1Y6E A;  2C80 A;  2K8V A;  3CSI A;  5IPG A;  1XWK A;  3TCO A;  3HJO A;  5D9X A;  1M2A A;  2DJ2 A;  3KMN A;  4ZIJ A;  5AIS A;  2K9F A;  5B7C A;  1F3B A;  5EY6 A;  1H4O A;  3F63 A;  2YCD A;  1SD9 A;  2VL2 A;  3NZN A;  3NOF A;  1DE1 A;  2YWO A;  2HE3 A;  3QPM A;  4JRR A;  4MF5 A;  1E6B A;  1F37 A;  2LRN A;  2EIR A;  5A4U A;  2V6O A;  3F4T A;  1VRS D;  1JZD A;  1UC7 A;  1TK0 B;  1PKZ A;  5D9W A;  1PX7 A;  4HS1 A;  1O8W A;  2C0F A;  3R2Q A;  1JFU A;  3TUE A;  1K3Y A;  2KLX A;  1VF3 A;  1I5G A;  1JZW A;  3KH7 A;  2FY6 A;  2UZ8 A;  3RDW A;  2MMO A;  1TRV A;  2H6Z A;  2H30 A;  2XC2 A;  1GTB A;  5KN0 A;  2VL3 A;  4MMM A;  3GL5 A;  4CY8 A;  1OAZ A;  1SYR A;  5KOW A;  3TJG A;  3TKS A;  2MMN A;  2DSA A;  2R0P A;  2HSY A;  1SJ6 A;  1WMJ A;  5BMU A;  1S3A A;  4O5R A;  3VLN A;  3QOU A;  1U6T A;  3PGT A;  1EEM A;  3A2V A;  3TJF A;  3ISO A;  4ZBB A;  1M2D A;  1CQG A;  2PER A;  4GXZ A;  2MBT A;  2FLS A;  5AIV A;  1ML6 A;  2C0E A;  3AY8 A;  2CX4 A;  2LUS A;  3PIN A;  4K2X A;  3UJ1 A;  1T3B A;  2IME A;  1ERV A;  3IPZ A;  1YQ1 A;  3FR9 A;  1Z6M A;  1R4W A;  1AQV A;  3ERW A;  2X49 A;  1MDI A;  3VI5 A;  4XS4 B;  2B3S A;  4IS0 A;  3EIN A;  4TN8 A;  4GCI A;  3BJ5 A;  4KSO A;  2OA7 A;  3LXZ A;  2HRK A;  2GZZ A;  4HDE A;  1XFL A;  4L8E A;  3DEX A;  4GSS A;  3A3T A;  1AW9 A;  4ZL9 A;  1LJR A;  5INY A;  2H01 A;  3EE2 A;  3GSS A;  3WT1 A;  5H5S A;  1WJK A;  1USB A;  1A0F A;  3E0U A;  2VCT A;  1YY7 A;  2CZ3 A;  4IHU A;  4X1U A;  4ZB6 A;  3FK8 A;  2MYG A;  2KUC A;  3HXS A;  4V2N A;  1BQ7 A;  4ZBD A;  2O89 A;  4YQU A;  4HQS A;  2WJU A;  3CSJ A;  5IMF A;  2GT5 A;  2VL9 A;  3F8U A;  3DKS A;  2TRC P;  1G7O A;  4EC0 A;  4HQZ A;  2H6X A;  4CW9 A;  1SKW B;  2R5G A;  2KHP A;  1MD3 A;  4MPG A;  2VD1 A;  2FNO A;  2VCW A;  4G2E A;  5D9V A;  20GS A;  3FRC A;  1EV4 A;  3CMI A;  2WFC A;  3DVW A;  1XW5 A;  4PUF C;  3UOM A;  1M9A A;  1C72 A;  1MEK A;  1R7H A;  4K7O A;  3O3T A;  2AB6 A;  5CAX A;  2L6D A;  4JR4 A;  1Q98 A;  3GYK A;  2LRT A;  2H19 A;  2I1U A;  3M9J A;  1I9D A;  16GS A;  1AUC A;  4TOP A;  5JWO B;  4K2D A;  5IM9 A;  4X43 A;  3FYG A;  3QAG A;  3LSZ A;  4NHZ A;  4RI6 A;  3TRP A;  4K7N A;  4HOJ A;  1SKR B;  1F3A A;  1Z6N A;  3RPP A;  4WEY A;  4G10 A;  4HEA 2;  1B8X A;  4A5P A;  1ZZY A;  4LLR A;  4MA9 A;  4TXO B;  5IMD A;  3TGZ A;  2EIQ A;  1CQH A;  4NXI A;  2ZUP A;  4BPY A;  4BL7 B;  5G31 A;  3OR5 A;  4L5L A;  1A2M A;  4MK3 A;  4FIW A;  3RBT A;  4HZ4 A;  3IRA A;  2A2P A;  4HZ2 A;  3UMA A;  3PPU A;  4XIH A;  1UVZ A;  2F8A A;  2H74 A;  1T7P B;  1XWC A;  1WPI A;  3LJR A;  2WS2 A;  2GGT A;  2AYT A;  2D2Z A;  14GS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...