5LNKe

Entire ovine respiratory complex i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
LGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQEKNVSLNNFSADQVTRALENVLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Mitochondrial complex I, 51 kDa subunit
publication title Atomic structure of the entire mammalian mitochondrial complex I.
pubmed doi rcsb
total genus 19
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2016-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF05047 L51_S25_CI-B8 Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5lnke00
4POLA 2I81A 4YQUA 2YWMA 4PNGA 4HQSA 3CBUA 3VWUA 3GKXA 2KHPA 4POBA 1R5AA 3KD0A 2H1GA 5ECMB 3RAZA 2H01A 2F3MA 3DMLA 4TR1B 2IMKA 4FYCA 4L0WA 5DALA 1TRUA 1Z9HA 1LBKA 1M9AA 4F2IA 3CYNA 4OWYA 2KP1A 1SKRB 3K8NA 2GSTA 4IJ3A 2L59A 1NSWA 4K7OA 1PA3A 2CX4A 3HDCA 3TDGA 3D4MA 4XS1A 1M99A 5FT3A 2MBTA 2GLRA 3D0ZA 1FG4A 2JL4A 5IOXA 2LKUA 1GL8A 2O87A 3A2XA 3F63A 4WBJA 2VL2C 2RM5A 2VOCA 4XS4A 1A24A 2CAIA 5CRGA 3ZVJA 1A8YA 4IQ1A 3GV1A 3DVWA 1ML6A 4I2TA 4EUYA 4X0XA 4EDZA 1EZKA 3TB2A 5HFGA 3FW2A 3ZL5A 3EC3A 5CYYA 1FAAA 4J2FA 3G9BA 1SL0B 1TRVA 4JE1A 5JCWA 5DQSA 2LRCA 2IL3A 1B8XA 4X43A 12GSA 3ME7A 4WEYA 2M46A 4MZCA 1YKAA 1BG5A 5IMFA 4POKA 1SK0A 2QC7A 1HNCA 2EIOA 2PWJA 4PQ1A 5LNKe 1XWBA 3RHCA 3W8SA 1GNEA 4HJMA 2ALBA 1TRWA 3UOMA 1GTAA 1BEDA 5IPHA 2N5BA 3QPMA 1EP7A 2YJ7A 4ECJA 3EE2A 2X99A 1AQVA 2LJRA 1TKDB 4GXZA 4DSSB 5D73A 3IA1A 3LGCA 4F0BA 2BTOT 5GSSA 1X9MB 4K2DA 1WJKA 4WF5A 2G0FA 1JZRA 4TR1A 5D9TA 2FWHA 2DIZA 3TUEA 1J9BA 1M2AA 4HU9A 2R4VA 3FK8A 3TJFA 3M8NA 6GSYA 3ZFLA 1GLQA 3TRQA 5HFIA 2E2MA 1GUKA 3S9FA 2WJUA 1ZL9A 2J9HA 5AIVA 1A8LA 4IKHA 1F37A 3C73A 2H74A 1YEPA 3KZQA 1T7PB 1X0RA 2RM6A 2HSYA 1JLVA 2I3YA 4D73A 4TXOB 1M2DA 5A4WA 2XPEA 1XZOA 5COHA 3W8JA 3VPTA 2VD0A 3HJMA 2X8HA 4AJ8A 4I8BA 2H1AA 5ECRB 4BA7A 1K0DA 3EVIA 1T4ZA 5CAXA 3BD2A 1T8EB 2YWOA 1TOFA 1DE1A 1M7TA 5JWOB 1OC8A 2YOIA 2C3QA 2VLVA 2X8CA 1WWJA 4MJEA 2IMIA 1ERUA 2CVKA 2DJ3A 1VF4A 1B9YC 1J0FA 3F4SA 2LSTA 1WIKA 3N5OA 1YY7A 1U88A 2GQMA 4XHMA 2IMEA 4KB3A 3D4TA 1Q4JA 5LCZA 1NW2A 2C0GA 2H66A 1THXA 3UIWA 3M0FA 2LRTA 2NDOA 3QAVA 1T00A 1TU8A 4POMA 3NIVA 2FA8A 3GH6A 4HZ4A 2V41A 2PVOC 4AJ6A 1XW5A 3E3EA 2VCTA 4O7HA 1RQMA 1K3YA 4MK3A 2VO4A 2WULA 3GUSA 2I4AA 1YDKA 1OC9B 2VM2A 1K3LA 2WRTA 4K0GA 4NWYA 4KE3A 2MYGA 3QFAC 3UEMA 5INYA 5DBQA 3ZREA 3KGKA 5A5KA 2N5AA 4KDXA 2LUSA 2QKEA 4CHSA 1IYIA 3MNGA 3UBKA 4OD7A 4G19A 1XBSA 1XFLA 3GIXA 4IHUA 2L57A 2LTKA 1Z6MA 1N2AA 3UVTA 2VCWA 3DRNA 1B48A 4JR4A 1XWAA 3VWXA 1F3AA 2P5QA 2DMMA 4KX4A 1AC1A 1XCCA 3PR8A 2BMXA 4ZILA 4TN8A 1JFUA 5CO3A 4YAPA 5HQPA 16GSA 4OFMA 3QDNA 1TXXA 4MF5A 5F07A 3GX8A 1Q98A 4ML1A 5J9BA 2PU9C 2KP2A 2G2QA 2C3NA 2GQKA 2D2ZA 1AUCA 4TR4A 4ULXA 5EL8A 4V2LA 4LMVA 3ZZXA 5A4UA 4JR6A 1BAYA 1Z7RA 4LA1A 2EIQA 2R6KA 1OE7A 4JU5A 5JCGA 1W89A 1AXDA 4JBBA 2ON7A 1EGOA 6GSSA 2DMLA 1A2JA 3GTUB 3IAS2 4NMUA 1UN2A 5J5NA 5DDLA 1MEKA 2C0EA 1S3CA 3P7XA 1GP1A 3ZRDA 4TR3A 3DKSA 4MJAA 4EO3A 1XVQA 3LQ7A 2VIMA 1TW9A 1N8JA 3LSZA 1YF1A 1G0TA 3F8UA 5ECHB 4JZQA 3F3RA 2DJKA 1UA5A 4MA9A 2FA4A 3APQA 5E59A 2YZHA 5F05A 3TKSC 4AJ7A 3DIEA 2OBIA 3HY2A 5KN3A 1ACVA 3HVSA 5HFKA 2O85A 2GVPA 1GSSA 3DEXA 2YV9A 1QXHA 5D96A 3Q6OA 2MMNA 4MF7A 1G7EA 3QMXA 2H8LA 1YZXA 2OKAA 5JCUA 1GULA 2YCDA 4NAXA 1PX6A 3VLNA 1F2EA 3APOA 3LYKA 1Y25A 1PKWA 3A5WA 4V1Ag 5ECSA 3KJYA 2P0GA 2XPDA 3CXGA 3GMFA 2GSRA 4YH2A 1PQNA 2F9SA 5DJLA 3ED3A 2MMAA 1M9BA 3U5RE 2GT6A 2E7PA 4N11A 3V1WA 3G7YA 2VL3A 3D21A 3F3QA 2FUG2 3AY8A 4LLRA 1DE2A 22GSA 3KCMA 3LFLA 5JWQB 3TJKA 5ELGA 1PN9A 2KUCA 1VRSD 4L5OA 2CT6A 3FHKA 2AAWA 4HZ2A 1GRXA 4OO4A 5C04A 2WCIA 1WPIA 14GSA 1QUWA 3I6AA 4ECBA 3FR6A 4J57E 3QAWA 3KMOA 3QAGA 3GTUA 3FEUA 3IAM2 2AYTA 3HD5A 5CNWA 4FYBA 2B1LA 1A0FA 4Q5QA 5J3RA 4Z7XA 4MJCA 2JZSA 2XC2A 3ZLPA 2HZEA 5AGYA 3I69A 4FIWA 1FB0A 3HA9A 1VF1A 3IK7A 2VCXA 5ECOB 1XOBA 4GWRA 2HXKA 2C0DA 4MH2A 4RI7A 4OMVA 2H71A 1K0OA 4PXOA 2VAFA 1B9XC 1Z7PA 1K0CA 1XW9A 1SU9A 2F8FA 2GDRA 7GSSA 1T3BA 2FWFA 3UMAA 1GSQA 1XVWA 2LJKA 1E6BA 2RUFA 3WGDA 3MDKA 1WE0A 2FD3A 1NHYA 2P5RA 1KTEA 3A2WA 4OFTA 1X5CA 2LNSA 3ZTLA 3TKSE 2R5GA 4EL1A 3UL3A 2A2SA 18GSA 3VPQA 4MJBA 1BQ7A 1X5EA 2JADA 2HZFA 1GLPA 4KSMA 2H0GA 2I1UA 2RIIA 1O6JA 3HXSA 5GZZB 4XCSA 1V57A 2CA8A 1FOVA 4ACSA 4D73B 1IYHA 2OE0A 1R7HA 1DBYA 4IS0A 1AQXA 3C1SA 4F9ZA 2GSSA 5A4VA 3BCIA 1GUHA 5D93A 3ZIJA 3F4RA 4HJ2A 2VM1A 2CV4A 2B1KA 4LL4B 4PUAA 4ZL8A 3VK9A 5ECIB 3Q74A 1TU7A 5G5EA 5IMZA 3UAPA 2TRXA 1HD2A 1GNWA 2TIRA 2H1DA 3HZ8A 4G9HA 3WT2A 3WT1A 5H5QA 4MABA 4KGIA 4GRFA 3BBYA 2E2GA 1EEJA 4O32A 3ME8A 2H0HA 2C1YA 1I5GA 2VCVA 3WGEA 2X64A 3F0IA 3UVHA 2F51A 1M2BA 1PL1A 19GSA 2NBSA 1ABAA 2PN8A 3ZVJD 4HUAA 1ZGNA 2H1BA 4L0UA 4XIHA 5DCHA 1VF3A 4E8EA 3BCKA 3O76A 1KEBA 4K7NA 3GHAA 1W4VA 3P8WA 2CAQA 5DQYA 2H6ZA 3I43A 3CTGA 3HKRA 3IDVA 4N0VA 2YWIA 3ERFA 3GL3A 3GRXA 2H30A 4PURA 2CVBA 1C72A 4IELA 5EPFA 5CREA 3KM6A 2B5YA 4FYUA 2ZCTA 1QFNA 4V2NA 3TOTA 2DC5A 2H72A 1Z6NA 2IIYA 4IGJA 1VF2A 5G2ZA 1UC7A 1XXUA 2IPAA 4GQCA 1PX7A 3LWAA 4I5QA 3HJPA 3FZAA 5FWGA 2IFQA 2FNOA 3TKQA 5DJMA 4PUFC 4PQHA 5D9VA 2E0QA 5GAND 3SBCA 5D8IA 2X8GA 3TOUA 1AIUA 2GZPA 1I9DA 1O81A 1TTZA 1O8WA 1FW1A 2NTOA 3EURA 1WRYA 1SK1A 17GSA 5KN2A 3ZYWA 2F8AA 2H75A 3VWVA 5EVOA 4IN0A 4NHZA 4ZIJA 1B4QA 2GZYA 2YNXA 3IK9A 3L9VA 1O7UA 2K8SA 3P2AA 1EP8A 3IV4A 4OCFA 2H70A 1Y6EA 2OBKA 1DSBA 4PX1A 3TKSA 3FZ4A 4TKYA 2DJ2A 1HYUA 3EMXA 1R5PA 2L4QA 1AQWA 4G2EA 1EOGA 1X9SB 3PGTA 1EEMA 3L0HA 4O5RA 1TK0B 4Q5NA 1GSDA 2AB6A 3EYTA 3GKMA 2DBCA 1J08A 3IC4A 1XPVA 3M9JA 3F9UA 1ZCPA 2PPTA 5ECQB 5JWRB 3KMNA 3E9JB 1TP9A 2GQLA 3UARA 2ZUPA 1PGTA 2WFCA 1MD4A 4I6XA 3H8QA 5DAKB 4HS1A 1QQ2A 5L71A 1GH2A 5IO0A 2GTUA 5B8BA 3GKNA 2B7JA 1TI1A 2L4CA 2AJQB 5D9XA 3GNJA 1M0UA 2VCZA 2HE3A 2EIRA 4DSRA 5B6NA 2LEGA 2H73A 2V6OA 4KCAA 2JACA 2FWGA 4NHWA 3TRXA 3US3A 5F8BA 2B5XA 5F06A 3EWLA 4QQ7A 4TR0A 1S3AA 4NV2A 3P90A 1ERTA 5ELAA 5ECPB 2O7KA 1XWGA 6GSUA 3PH9A 2KOKA 3H4KA 4KAEA 3EU4A 1G6YA 1NHOA 4CW9A 4NPBA 3EINA 1U3IA 2A2RA 4XRDA 3MAKA 5B7CA 3TJJA 3LORA 4MZWA 1A2MA 3IR4A 5HR3A 13GSA 4K8MA 5KN0A 2JZRA 3ERWA 1AW9A 4L5LA 1THOA 3W6GA 4ZBDA 1KNGA 1EOHA 1LU4A 3ERGA 1MD3A 4N30A 2HZEB 3MSZA 2FLSA 2WS2A 1TK8B 4KH7A 2FCHA 2GZZA 4RQRA 4PNFA 1XWKA 4P3YB 4WR4A 2V2GA 4RUVA 4IP1A 4I2UA 8GSSA 1NM3A 2AV4A 2O89A 4N10A 2V6KA 1CQHA 4TXVA 3CSJA 4ISDA 4XS6A 3CRUA 2YPMA 1FB6A 4K9ZA 4LL1B 3CSHA 1V40A 3LXZA 4K6XA 3GSTA 4Q5FA 1XIYA 2B3SA 5G31A 2YANA 2VL2A 1ZMAA 2IMFA 3U6VA 2QSIA 3R2QA 1SYXA 3FZ9A 4J56E 4TOPA 3D5JA 1V58A 2DSAA 4IBPA 5ABRA 1AAZA 1JHBA 4XTSA 4GLTA 3VWWA 1EWXA 3M1GA 2PVQA 5DAKA 2B5EA 3L9SA 4ML6A 5FHIA 2R3XA 4YAVA 2RUEA 2XHFA 1OYJA 4HEA2 3TCOA 2VL9A 3H1NA 5H5RA 2DLXA 2QGVA 4KUNA 3M3MA 3GKKA 3IBHA 2KLXA 2YP6A 1O85A 3F4TA 1TRSA 2L5LA 1RW1A 2LS5A 4WETA 1A0RP 1OVNA 2AHEA 3Q19A 5IMCA 2O8VB 1A2LA 1HNAA 2M80A 5B8AA 1PRXA 4GF0A 3C1RA 2PGTA 1OKDA 3VI5A 3F6DA 1K0NA 4FH8A 5CP1A 4OCEA 2YV7A 2Z9SA 1Z5YE 5IO2A 4V1Ap 2HRFA 5D9WA 2YWNA 1E2YA 1JZWA 4EKZA 1GSEA 2B7KA 1YF0A 20GSA 1PL2A 4ZL7A 5CRDA 3IHQA 4WXTA 1OAZA 3RBTA 3GN3A 1URMA 4NXIA 2WZ9A 4MPGA 4ZXGA 1T1VA 4IJIA 3KTLA 4RI6A 3PINA 1BYEA 4IP6A 1FVKA 3M9KA 1GSYA 4BVXA 1BX9A 2BJXA 3L9UA 3CMIA 1S3DA 2R37A 6GSWA 1CQGA 2K9FA 2PUKC 3IPZA 3RPNA 1HQOA 1K0BA 3A2VA 4MDCA 3F6FA 2LQQA 5KEJA 5ENUA 3FY7A 4MLYA 2HI7A 3L78A 4L8EA 3L4NA 3WD6A 11GSA 1Z3EA 2PBJA 4DEJA 2ZNMA 2IFQB 2CQ9A 3DD3A 3HZ4A 3J7Yb 2A4VA 2I9HA 1H4OA 2HT9A 2YN1A 4NV5A 3OR5A 1GSFA 3D22A 1QK8A 1HNBA 5ECLB 3TJGA 1JLWA 1PSQA 1B4PA 1V2AA 4TVEA 4FO5A 4MMMA 5IMAA 2H6XA 3BJ5A 2IN3A 4HU7A 2TRCP 1X9WB 4KDYA 1GTIA 3VI7A 3O6TA 3ZFBA 4G10A 3GX0A 3RPPA 4O92A 4F03A 1OC3A 6GSVA 5HR0A 2C0FA 3ZIVA 3MWHA 1WOUA 2RLIA 5IMVA 5IMDA 1UVZA 4DSQA 3TJBA 4MF6A 2HLSA 1ZYEA 5GSTA 3DXBA 1ILOA 1F9MA 2L5OA 2EC4A 5C00A 3JCML 5E4WA 3LJRA 5ECNB 5G1LA 2JU5A 3J7Yk 4V2MA 1ZZYA 2V32A 5GAPD 2HYXA 3A3TA 3FR9A 5IQYA 2FY6A 1SJ6A 4QL7A 2MBSA 1GTBA 2N5FA 1U6TA 4HQZA 2XBQA 3GA4A 1SD8A 5J4UA 1DUGA 2MMZA 3QOUA 4ZB8A 3FKFA 3SWLA 1TDIA 1F6MC 3I9V2 3FZ5A 3IE3A 3RHBA 4MCUA 2C4JA 2CVDA 2HSHA 1SENA 4BPYA 5HR1A 1X5DA 4HDEA 2LRNA 3EU3A 4TW5A 2OJLA 4KNDA 1G7OA 1MDJA 4ZB6A 3WGXA 3GH9A 4GTUA 4E8HA 4JEDA 2K8VA 1EV9A 2VUPA 4LMWA 4ID0A 1F3BA 4F0CA 4BWSA 4ECCA 5DCGA 4KCEA 2JSZA 4Q5RA 4KA0A 4WKWA 3KIJA 4EVMA 1SL2B 3LEFA 1XOAA 1MTCA 4XRAA 2OADA 2C8UA 2VLTA 4HOJA 1K0AA 1YEXA 3KXOA 4MPFA 3ISOA 3UJ1A 2FHEA 6GSXA 3N9JA 3GSSA 1MDKA 3TRPA 1GSUA 3C7MA 3KP9A 4ECIA 1SL1B 1WMJA 2IJYA 1U3AA 4BVYA 5G5FA 2H19A 3HVXA 1R26A 4YQMA 4IW9A 3H93A 3ZMLA 3FYGA 4X1UA 3G7IA 4EC0A 3KH7A 1ZOFA 2C80A 1U87A 3VURA 2VLUA 3ZMKA 1ERVA 5ECKB 3TKRA 2LQOA 3GYKA 5AIXA 3KP8A 1G6WA 5IM9A 1TJDA 1TI3A 1YJ6A 5J9CA 3VFIA 4DSSA 1EGRA 3HJOA 6GSTA 4AF2A 2CZ3A 1GTUA 3DGQA 4CDOA 4AGSA 3APSA 3DVXA 3HCZA 1LJRA 1GWCA 1K3OA 4K1FA 1XW6A 4EXJA 3FR3A 4QL9A 5LD0A 1QGVA 1MDIA 2OE3A 3E0UA 3Q18A 1PKZA 3O3TA 4F82A 2FWEA 3KH9A 3QD9A 5ID2B 4N0ZA 1XWCA 5AISA 1R4WA 2OA7A 2WGRA 4IVFA 3D6IA 2IMDA 2ES7A 2LV3A 4ZB9A 4ZBBA 1O73A 2M72A 1RK4A 5G1KA 4PQIA 3CRTA 5CRHA 3WYWA 1ERWA 2WB9A 3DYRA 1SK2A 1O8XA 2LJAA 3ZITA 2JZTA 2CZ2A 1V9WA 2OE1A 3LYPA 3QFBC 4KDUA 5G30A 5DVBA 1SKSB 4PGTA 2R2JA 5J41A 1SJZA 1PD21 4TXOA 3LG6A 2HRNA 10GSA 2LNTA 2HNLA 1VGLA 5AN1A 3NOFA 2V1MA 2MMOA 2C3TA 1GUMA 2XBIA 5IIZA 2H0IA 2H6YA 1A23A 2GT5A 3C8EA 2GSQA 1ON4A 5EY6A 4KW6A 3GURA 1JZDA 2YJHA 2FGXA 3HVVA 3NZNA 4OO5A 1FHEA 3G7JA 5F0GA 1SJIA 4I97A 1TK5B 2HFDA 5B6MA 3H79A 1FO5A 5KN1A 4BL7A 4HI7A 1BJXA 2PMTA 3IXRA 4GSNA 4JRRA 2DJ1A 2GGTA 2OACA 5DALB 1K0MA 4MZBA 3TGZA 4OFNA 2DJ0A 1FVJA 3C71A 2P31A 4EE0A 4TRXA 1QMVA 4GSTA 1ZYQB 3DWVA 3GFKA 4BWQA 2L6CA 4RQXA 5H5SA 3UBLA 4WBRD 3KEBA 3HHVA 4DVCA 1OC9A 3QCPA 2B6MA 1V98A 1SD9A 2REMA 5IPGA 3IOSA 1T4YA 3CSIA 4ILFA 2PERA 5ID2A 3QR6A 1PMTA 3HYPA 3BOAA 2J23A 1SKWB 2VCQA 1USBA 4ZL9A 5IOWA 1OKTA 1JZOA 1ST9A 4MH3A 2K18A 4WR5A 5CRWA 4EDYA 4XS4B 2DIYA 2MZCA 9GSSA 4YQVA 2AUVA 2WDUA 3RDWA 1H75A 3GL5A 2CX3A 1EV4A 4K0NA 3CTFA 3IRAA 2IWTA 4MP4A 4IQAA 1SYRA 1OE8A 4GQFA 4ZBAA 1KBNA 3TKPA 4K7IA 2K6VA 2YZUA 1YQ1A 4GSSA 3KTBA 1WP0A 2ON5A 2H76A 2NVLA 2NPBA 2JSYA 2DJJA 4KSOA 4WF4A 3EMPA 3LXTA 2GS3A 4GCIA 1YKCA 4H86A 3FRCA 4EF0A 2VD1A 5HR2A 2L6DA
chains in the Genus database with same CATH superfamily
4POLA 2I81A 4YQUA 2YWMA 4PNGA 4HQSA 3CBUA 3VWUA 3GKXA 2KHPA 4POBA 1R5AA 3KD0A 2H1GA 5ECMB 3RAZA 2H01A 2F3MA 3DMLA 4TR1B 2IMKA 4FYCA 4L0WA 5DALA 1TRUA 1Z9HA 1LBKA 1M9AA 4F2IA 3CYNA 4OWYA 2KP1A 1SKRB 3K8NA 2GSTA 4IJ3A 2L59A 1NSWA 4K7OA 1PA3A 2CX4A 3HDCA 3TDGA 4K5RA 3D4MA 4XS1A 1M99A 5FT3A 2MBTA 2GLRA 3D0ZA 1FG4A 2JL4A 5IOXA 2LKUA 1GL8A 2O87A 3A2XA 3F63A 4WBJA 2VL2C 2RM5A 2VOCA 4XS4A 1A24A 2CAIA 5CRGA 3ZVJA 1A8YA 2A2PA 4IQ1A 3GV1A 3DVWA 1ML6A 4I2TA 4EUYA 4X0XA 4EDZA 1EZKA 3TB2A 5HFGA 3FW2A 3ZL5A 3EC3A 5CYYA 1FAAA 4J2FA 3G9BA 1SL0B 4CY8A 1TRVA 4JE1A 4KF9A 5JCWA 5DQSA 3MIXA 2LRCA 2IL3A 1B8XA 4X43A 12GSA 2HSMA 3ME7A 4WEYA 2M46A 4MZCA 1YKAA 1BG5A 4EIQA 5IMFA 4POKA 1SK0A 2QC7A 1HNCA 2EIOA 2PWJA 4PQ1A 5LNKe 1XWBA 3RHCA 3W8SA 1GNEA 4HJMA 2ALBA 1TRWA 3UOMA 1GTAA 1BEDA 5IPHA 2N5BA 3QPMA 1EP7A 2YJ7A 4ECJA 3EE2A 2X99A 1AQVA 2LJRA 1TKDB 1S3RA 4GXZA 4DSSB 5D73A 3IA1A 3LGCA 4F0BA 2BTOT 5GSSA 1X9MB 4K2DA 1WJKA 4WF5A 2G0FA 1JZRA 4TR1A 5D9TA 2FWHA 2DIZA 3TUEA 1J9BA 1M2AA 4HU9A 2R4VA 3FK8A 3TJFA 3M8NA 6GSYA 3ZFLA 1GLQA 3TRQA 5HFIA 2E2MA 1GUKA 3S9FA 2WJUA 1ZL9A 2J9HA 5AIVA 1A8LA 4IKHA 1F37A 2X4AA 3C73A 2H74A 1YEPA 3KZQA 1T7PB 1X0RA 2RM6A 2HSYA 1JLVA 2I3YA 4D73A 4TXOB 1M2DA 5A4WA 2XPEA 1XZOA 5COHA 3W8JA 3VPTA 2VD0A 3HJMA 2X8HA 4AJ8A 4I8BA 2H1AA 5ECRB 4BA7A 1K0DA 3EVIA 1T4ZA 5CAXA 3BD2A 1T8EB 2YWOA 1TOFA 1DE1A 1M7TA 5JWOB 1OC8A 2YOIA 2C3QA 2VLVA 2X8CA 1WWJA 4MJEA 2IMIA 1ERUA 2CVKA 2DJ3A 1VF4A 1B9YC 1J0FA 3F4SA 2LSTA 1WIKA 3N5OA 1YY7A 1U88A 2GQMA 4XHMA 2IMEA 4KB3A 3D4TA 1Q4JA 5LCZA 1NW2A 2C0GA 5BMUA 2H66A 1THXA 3UIWA 3M0FA 2LRTA 2NDOA 3QAVA 1T00A 1TU8A 4POMA 3NIVA 4PTSA 2FA8A 3GH6A 4HZ4A 2V41A 2PVOC 4AJ6A 1XW5A 3E3EA 2VCTA 4O7HA 1RQMA 1K3YA 4MK3A 2VO4A 2WULA 3GUSA 2I4AA 1YDKA 1OC9B 2VM2A 1K3LA 2WRTA 4K0GA 4NWYA 3CQFA 4KE3A 2MYGA 3QFAC 3UEMA 5INYA 5DBQA 3ZREA 3KGKA 5A5KA 2N5AA 4KDXA 2LUSA 2QKEA 4CHSA 1IYIA 3MNGA 3UBKA 4OD7A 4G19A 1XBSA 1XFLA 3GIXA 4IHUA 2L57A 2LTKA 4X4JA 1Z6MA 2QA1A 1N2AA 3UVTA 2VCWA 3DRNA 1B48A 4JR4A 1XWAA 3PPUA 3VWXA 1F3AA 2P5QA 2DMMA 4KX4A 1AC1A 1M3IA 1XCCA 3PR8A 2BMXA 4ZILA 4TN8A 1JFUA 5CO3A 4YAPA 5HQPA 16GSA 4OFMA 3QDNA 1TXXA 4MF5A 3LW9A 5F07A 3GX8A 1Q98A 4ML1A 5J9BA 2PU9C 2KP2A 2G2QA 2C3NA 2GQKA 2D2ZA 1AUCA 4TR4A 4ULXA 5EL8A 4V2LA 4LMVA 3ZZXA 5A4UA 4JR6A 1BAYA 1Z7RA 4LA1A 2EIQA 2R6KA 1OE7A 4JU5A 5JCGA 1W89A 1AXDA 4JBBA 2ON7A 1EGOA 6GSSA 2DMLA 1A2JA 3GTUB 3IAS2 4NMUA 1UN2A 5J5NA 5DDLA 1MEKA 2C0EA 1S3CA 3P7XA 1GP1A 3ZRDA 4TR3A 3DKSA 4MJAA 4EO3A 1XVQA 3LQ7A 2VIMA 1TW9A 1N8JA 3LSZA 1YF1A 1G0TA 3F8UA 5ECHB 4JZQA 3F3RA 2DJKA 1UA5A 4MA9A 2FA4A 3APQA 5E59A 2YZHA 5F05A 3TKSC 4AJ7A 3DIEA 2OBIA 3HY2A 5KN3A 1ACVA 3HVSA 5HFKA 2O85A 2GVPA 1GSSA 3DEXA 2YV9A 1QXHA 5D96A 3Q6OA 2MMNA 4MF7A 1G7EA 3QMXA 2H8LA 1YZXA 2OKAA 5JCUA 1GULA 2YCDA 4NAXA 1PX6A 3VLNA 1F2EA 3APOA 3LYKA 1Y25A 1PKWA 3A5WA 4V1Ag 5ECSA 3KJYA 2P0GA 2XPDA 3CXGA 3GMFA 2GSRA 4YH2A 1PQNA 2F9SA 5DJLA 3ED3A 2MMAA 1M9BA 3U5RE 2GT6A 2E7PA 4N11A 3V1WA 3G7YA 2VL3A 3D21A 3F3QA 2FUG2 3AY8A 4LLRA 4ICYA 1DE2A 22GSA 3KCMA 3LFLA 5JWQB 5BRTA 3TJKA 5ELGA 1PN9A 2KUCA 1VRSD 4L5OA 2CT6A 3FHKA 2AAWA 4HZ2A 1GRXA 4OO4A 5C04A 2WCIA 1WPIA 14GSA 1QUWA 3I6AA 4ECBA 3FR6A 4J57E 3QAWA 3KMOA 3QAGA 3GTUA 3FEUA 2QA2A 3IAM2 2AYTA 3HD5A 5CNWA 4FYBA 2B1LA 1A0FA 4Q5QA 5J3RA 4Z7XA 4MJCA 2JZSA 2XC2A 3ZLPA 2HZEA 5AGYA 3I69A 4FIWA 1FB0A 3HA9A 1VF1A 3IK7A 2VCXA 5ECOB 1XOBA 4GWRA 2HXKA 2C0DA 4MH2A 4RI7A 4OMVA 2H71A 1K0OA 4PXOA 2VAFA 1B9XC 1Z7PA 1K0CA 1XW9A 1SU9A 2F8FA 2GDRA 7GSSA 1T3BA 2FWFA 3UMAA 1GSQA 1XVWA 2LJKA 1E6BA 2RUFA 3WGDA 3MDKA 1WE0A 2FD3A 1NHYA 2P5RA 1KTEA 3A2WA 4OFTA 1X5CA 2LNSA 3ZTLA 3TKSE 2R5GA 4EL1A 3UL3A 2A2SA 18GSA 3VPQA 4MJBA 3EPTA 1BQ7A 1X5EA 2JADA 2HZFA 1GLPA 4KSMA 2H0GA 2I1UA 2RIIA 1O6JA 3HXSA 5GZZB 4HSCX 4XCSA 1V57A 2CA8A 2R0GA 1FOVA 4ACSA 4D73B 1IYHA 2OE0A 1R7HA 1DBYA 4IS0A 1AQXA 3C1SA 4F9ZA 2GSSA 5A4VA 3BCIA 1GUHA 5D93A 3ZIJA 3F4RA 4HJ2A 2VM1A 2CV4A 2B1KA 4LL4B 4PUAA 4ZL8A 3VK9A 5ECIB 3Q74A 1TU7A 5G5EA 5IMZA 3UAPA 2TRXA 1HD2A 1GNWA 2TIRA 2H1DA 3HZ8A 4G9HA 3WT2A 3WT1A 5H5QA 4MABA 4KGIA 4G0KA 4GRFA 3BBYA 2E2GA 1EEJA 3R3EA 4O32A 3ME8A 2H0HA 2C1YA 1I5GA 2VCVA 3WGEA 2X64A 3F0IA 3IHGA 3UVHA 2F51A 1M2BA 1PL1A 19GSA 2NBSA 1ABAA 2PN8A 3ZVJD 4HUAA 1ZGNA 2H1BA 4L0UA 4XIHA 5DCHA 1VF3A 4E8EA 4YKFA 2HRKA 3BCKA 3O76A 1KEBA 4K7NA 3GHAA 1W4VA 3P8WA 2CAQA 5DQYA 2H6ZA 2UZ8A 3I43A 3CTGA 3HKRA 3IDVA 4N0VA 2YWIA 3ERFA 3GL3A 3GRXA 2H30A 4PURA 2CVBA 1C72A 4IELA 5EPFA 5CREA 3KM6A 2B5YA 4FYUA 2ZCTA 1QFNA 4V2NA 3TOTA 2DC5A 2H72A 1Z6NA 4MNNA 2IIYA 4IGJA 1VF2A 5G2ZA 1UC7A 1XXUA 2IPAA 4FQUA 4GQCA 1PX7A 3LWAA 4I5QA 3HJPA 3FZAA 5FWGA 2IFQA 4K2XA 2FNOA 3TKQA 4EIPA 5DJMA 4PUFC 4PQHA 5D9VA 2E0QA 5GAND 4G0IA 3SBCA 5D8IA 2X8GA 3TOUA 1AIUA 2GZPA 1I9DA 1O81A 1TTZA 1O8WA 1FW1A 2NTOA 3EURA 1WRYA 1SK1A 17GSA 5KN2A 3ZYWA 2F8AA 2H75A 3VWVA 5EVOA 4IN0A 4NHZA 4ZIJA 1B4QA 2GZYA 2YNXA 3IK9A 3L9VA 1O7UA 2K8SA 3P2AA 1EP8A 3IV4A 4OCFA 2H70A 1Y6EA 2OBKA 1DSBA 4PX1A 3TKSA 3FZ4A 4TKYA 2DJ2A 1HYUA 3EMXA 1R5PA 2L4QA 1AQWA 4G2EA 1EOGA 1X9SB 3PGTA 1EEMA 3L0HA 4O5RA 1TK0B 4Q5NA 1GSDA 2AB6A 3EYTA 3GKMA 2DBCA 1J08A 3IC4A 1XPVA 3M9JA 3F9UA 1ZCPA 2PPTA 5ECQB 5JWRB 3KMNA 3E9JB 1TP9A 2GQLA 3UARA 2ZUPA 1PGTA 2WFCA 1MD4A 4I6XA 3H8QA 5DAKB 4HS1A 1QQ2A 5L71A 1GH2A 5IO0A 2GTUA 5B8BA 3GKNA 2B7JA 1TI1A 2L4CA 2AJQB 5D9XA 3GNJA 1M0UA 2VCZA 2HE3A 2EIRA 4DSRA 5B6NA 2LEGA 2H73A 2V6OA 4KCAA 2JACA 2FWGA 4NHWA 3TRXA 3US3A 5F8BA 2B5XA 5F06A 3EWLA 4QQ7A 4TR0A 1S3AA 4NV2A 3P90A 1ERTA 5ELAA 5ECPB 2O7KA 1XWGA 6GSUA 3PH9A 2KOKA 3H4KA 4KAEA 3EU4A 1G6YA 1NHOA 4CW9A 4NPBA 3EINA 1U3IA 2A2RA 4XRDA 3MAKA 5B7CA 3TJJA 3LORA 4MZWA 1A2MA 3IR4A 5HR3A 13GSA 4K8MA 4CY6A 5KN0A 2JZRA 3ERWA 4Z2TA 1AW9A 4L5LA 1THOA 3W6GA 4ZBDA 1KNGA 1EOHA 1LU4A 3ERGA 1MD3A 4N30A 2HZEB 3MSZA 2FLSA 2WS2A 1TK8B 4KH7A 2FCHA 2GZZA 4RQRA 4PNFA 1XWKA 4P3YB 4WR4A 2V2GA 4RUVA 4IP1A 4I2UA 8GSSA 1NM3A 2AV4A 2O89A 4N10A 2V6KA 1CQHA 4TXVA 3CSJA 4ISDA 4XS6A 3CRUA 2YPMA 1FB6A 4K9ZA 4LL1B 3CSHA 1V40A 3LXZA 4K6XA 3GSTA 4Q5FA 1XIYA 2B3SA 5G31A 2YANA 2VL2A 1ZMAA 2IMFA 3U6VA 1ZYNA 2QSIA 3R2QA 1SYXA 3FZ9A 4J56E 4TOPA 3D5JA 1V58A 2DSAA 4IBPA 5ABRA 1AAZA 1JHBA 4XTSA 4A5PA 4GLTA 3VWWA 1EWXA 3M1GA 2PVQA 5DAKA 2B5EA 1PFOA 3L9SA 4ML6A 5FHIA 1ZYPA 2R3XA 4YAVA 2RUEA 2XHFA 1OYJA 4HEA2 3TCOA 2VL9A 3H1NA 5H5RA 2DLXA 2QGVA 4KUNA 3M3MA 3GKKA 3IBHA 2KLXA 2YP6A 1O85A 3F4TA 1TRSA 2L5LA 1RW1A 2LS5A 4WETA 1A0RP 1OVNA 2AHEA 3Q19A 5IMCA 2O8VB 1A2LA 1HNAA 2M80A 5B8AA 1PRXA 4GF0A 3C1RA 2PGTA 1OKDA 3VI5A 3F6DA 1K0NA 4FH8A 5CP1A 4OCEA 2YV7A 2Z9SA 1Z5YE 5IO2A 4V1Ap 2HRFA 5D9WA 2YWNA 1E2YA 1JZWA 4EKZA 1GSEA 2B7KA 1YF0A 20GSA 1PL2A 4ZL7A 5CRDA 3IHQA 4WXTA 1OAZA 3RBTA 3GN3A 1URMA 4NXIA 2WZ9A 3FMWA 4MPGA 4ZXGA 1T1VA 4IJIA 3KTLA 2DKIA 4RI6A 3PINA 1BYEA 4IP6A 1FVKA 3M9KA 1GSYA 4BVXA 1BX9A 4USSA 2BJXA 3L9UA 3CMIA 1S3DA 2R37A 6GSWA 1CQGA 2K9FA 2PUKC 3IPZA 3RPNA 1HQOA 2R0PA 1K0BA 3A2VA 4MDCA 3F6FA 2LQQA 5KEJA 5ENUA 3FY7A 4MLYA 2HI7A 3L78A 4L8EA 3L4NA 3WD6A 11GSA 1Z3EA 2PBJA 4DEJA 2ZNMA 2IFQB 2CQ9A 3DD3A 3HZ4A 2A4HA 3J7Yb 2A4VA 2I9HA 1H4OA 2HT9A 2YN1A 4NV5A 3OR5A 1GSFA 3D22A 1QK8A 1HNBA 5ECLB 3TJGA 1JLWA 1PSQA 1B4PA 1V2AA 4TVEA 4FO5A 4MMMA 5IMAA 2H6XA 3BJ5A 2IN3A 4HU7A 2TRCP 1X9WB 4KDYA 1GTIA 3VI7A 3O6TA 3ZFBA 4G10A 3GX0A 3RPPA 4O92A 4F03A 1OC3A 6GSVA 5HR0A 2C0FA 3ZIVA 3MWHA 1WOUA 2RLIA 5IMVA 5IMDA 1UVZA 4DSQA 3TJBA 2HRAA 4MF6A 2HLSA 1ZYEA 5GSTA 3DXBA 1ILOA 1F9MA 2L5OA 4BVYB 2EC4A 5C00A 3JCML 5E4WA 3LJRA 5ECNB 5G1LA 2JU5A 3J7Yk 4V2MA 1ZZYA 2V32A 5GAPD 2HYXA 3A3TA 3FR9A 5IQYA 2FY6A 1SJ6A 4QL7A 2MBSA 1GTBA 2N5FA 1U6TA 4HQZA 2XBQA 3GA4A 1SD8A 2DKHA 5J4UA 1DUGA 2MMZA 3QOUA 4ZB8A 3FKFA 3SWLA 1TDIA 1F6MC 3I9V2 3FZ5A 3IE3A 3RHBA 4MCUA 2C4JA 2CVDA 2HSHA 1SENA 4BPYA 5HR1A 1X5DA 4HDEA 2LRNA 3EU3A 4TW5A 2OJLA 4KNDA 1G7OA 1MDJA 4ZB6A 3WGXA 3GH9A 4GTUA 4E8HA 4JEDA 2K8VA 1EV9A 2VUPA 4LMWA 4ID0A 1F3BA 4F0CA 4BWSA 4ECCA 5KOXA 5DCGA 4KCEA 2JSZA 4Q5RA 4K5SA 4KA0A 4WKWA 3KIJA 1PN0A 4EVMA 1SL2B 3LEFA 1XOAA 1MTCA 4XRAA 2OADA 2C8UA 2VLTA 4HOJA 1K0AA 1YEXA 3KXOA 4MPFA 3ISOA 3UJ1A 2FHEA 6GSXA 3N9JA 3GSSA 1MDKA 3TRPA 1GSUA 3C7MA 3KP9A 4ECIA 1SL1B 1WMJA 2IJYA 1U3AA 4BVYA 5G5FA 2H19A 3HVXA 1R26A 4YQMA 4BL7B 4IW9A 3H93A 3ZMLA 3FYGA 4X1UA 3G7IA 4EC0A 3KH7A 1ZOFA 2C80A 1U87A 3VURA 2VLUA 3ZMKA 1ERVA 5ECKB 3TKRA 2LQOA 3GYKA 5AIXA 3KP8A 1G6WA 5IM9A 4G0LA 1TJDA 1TI3A 1YJ6A 5J9CA 3VFIA 4DSSA 4O5QA 1EGRA 3HJOA 6GSTA 4AF2A 2CZ3A 1GTUA 3DGQA 4CDOA 4AGSA 3APSA 3DVXA 3HCZA 1LJRA 1GWCA 1K3OA 4K1FA 1XW6A 4EXJA 3FR3A 4QL9A 5LD0A 1QGVA 1MDIA 2OE3A 3E0UA 3Q18A 1PKZA 3O3TA 4F82A 3HVNA 2FWEA 3KH9A 3QD9A 5ID2B 4N0ZA 1XWCA 5AISA 1R4WA 2OA7A 2WGRA 4IVFA 3D6IA 2IMDA 2ES7A 2LV3A 4ZB9A 4ZBBA 1O73A 1XG8A 1RK4A 2M72A 5G1KA 4PQIA 3CRTA 5CRHA 3WYWA 1ERWA 2WB9A 3DYRA 1SK2A 1O8XA 2LJAA 3ZITA 2JZTA 2CZ2A 1V9WA 2OE1A 3LYPA 3QFBC 4KDUA 3MYDA 5G30A 5DVBA 2R0CA 1SKSB 4PGTA 2R2JA 5J41A 1SJZA 1PD21 5KOWA 4TXOA 3LG6A 2HRNA 10GSA 2LNTA 2HNLA 1VGLA 5AN1A 3NOFA 2V1MA 2MMOA 4Z2RA 2C3TA 1GUMA 2XBIA 5IIZA 2H0IA 4BIKA 2H6YA 1A23A 2GT5A 3C8EA 2GSQA 1M3JA 1ON4A 5EY6A 2X49A 4KW6A 3GURA 1JZDA 2YJHA 2FGXA 3HVVA 3NZNA 4OO5A 1FHEA 3G7JA 5F0GA 1SJIA 4I97A 1TK5B 2HFDA 5B6MA 3H79A 1FO5A 4BVXB 5KN1A 4BL7A 4HI7A 1BJXA 1FOHA 2PMTA 3IXRA 4GSNA 4JRRA 2DJ1A 2GGTA 2OACA 5DALB 1K0MA 4MZBA 3TGZA 4YKGA 4OFNA 2DJ0A 1FVJA 3C71A 2P31A 4EE0A 4TRXA 1QMVA 4GSTA 1ZYQB 3DWVA 3GFKA 4BWQA 2L6CA 4RQXA 5H5SA 3UBLA 4WBRD 3KEBA 3HHVA 4DVCA 1OC9A 3QCPA 2B6MA 1V98A 1SD9A 2REMA 5IPGA 3IOSA 1T4YA 3CSIA 4ILFA 2PERA 5ID2A 3QR6A 1PMTA 3HYPA 3BOAA 2J23A 1SKWB 2VCQA 1USBA 4ZL9A 5IOWA 1OKTA 1JZOA 1ST9A 4MH3A 2K18A 5CRWA 4WR5A 4EDYA 4XS4B 2DIYA 2MZCA 9GSSA 4YQVA 2AUVA 2WDUA 3A5IA 3RDWA 1H75A 3GL5A 2CX3A 1EV4A 4K0NA 3CTFA 3IRAA 2IWTA 4MP4A 4IQAA 4Z2UA 1SYRA 1OE8A 3IC8A 4GQFA 4ZBAA 1KBNA 3TKPA 4K7IA 2K6VA 2YZUA 1YQ1A 4GSSA 3KTBA 1WP0A 2ON5A 2H76A 2NVLA 2NPBA 2JSYA 2DJJA 4KSOA 4WF4A 3EMPA 4O5UA 3LXTA 2GS3A 4GCIA 1YKCA 4H86A 3FRCA 4EF0A 2VD1A 5HR2A 2L6DA
chains in the Genus database with same CATH topology
4POLA 2I81A 4YQUA 2YWMA 4PNGA 4HQSA 3CBUA 3VWUA 3GKXA 2KHPA 4POBA 1R5AA 3KD0A 2H1GA 5ECMB 3RAZA 2H01A 2F3MA 3DMLA 4TR1B 2IMKA 4FYCA 4L0WA 5DALA 1TRUA 1Z9HA 1LBKA 1M9AA 4F2IA 3CYNA 4OWYA 2KP1A 1SKRB 3K8NA 2GSTA 4IJ3A 2L59A 1NSWA 4K7OA 1PA3A 2CX4A 3HDCA 3TDGA 4K5RA 3D4MA 4XS1A 1M99A 5FT3A 2MBTA 2GLRA 3D0ZA 1FG4A 2JL4A 5IOXA 2LKUA 1GL8A 2O87A 3A2XA 3F63A 4WBJA 2VL2C 2RM5A 2VOCA 4XS4A 1A24A 2CAIA 5CRGA 3ZVJA 1A8YA 2A2PA 4IQ1A 3GV1A 3DVWA 1ML6A 4I2TA 4EUYA 4X0XA 4EDZA 1EZKA 3TB2A 5HFGA 3FW2A 3ZL5A 3EC3A 5CYYA 1FAAA 4J2FA 3G9BA 1SL0B 4CY8A 1TRVA 4JE1A 4KF9A 5JCWA 5DQSA 3MIXA 2LRCA 2IL3A 1B8XA 4X43A 12GSA 2HSMA 3ME7A 4WEYA 2M46A 4MZCA 1YKAA 1BG5A 4EIQA 5IMFA 4POKA 1SK0A 2QC7A 1HNCA 2EIOA 2PWJA 4PQ1A 5LNKe 1XWBA 3RHCA 3W8SA 1GNEA 4HJMA 2ALBA 1TRWA 3UOMA 1GTAA 1BEDA 5IPHA 2N5BA 3QPMA 1EP7A 2YJ7A 4ECJA 3EE2A 2X99A 1AQVA 2LJRA 1TKDB 4GXZA 4DSSB 5D73A 3IA1A 3LGCA 4F0BA 2BTOT 5GSSA 1X9MB 4K2DA 1WJKA 4WF5A 2G0FA 1JZRA 4TR1A 5D9TA 2FWHA 2DIZA 3TUEA 1J9BA 1M2AA 4HU9A 2R4VA 3FK8A 3TJFA 3M8NA 6GSYA 3ZFLA 1GLQA 3TRQA 5HFIA 2E2MA 1GUKA 3S9FA 2WJUA 1ZL9A 2J9HA 5AIVA 1A8LA 4IKHA 1F37A 2X4AA 3C73A 2H74A 1YEPA 3KZQA 1T7PB 1X0RA 2RM6A 2HSYA 1JLVA 2I3YA 4D73A 4TXOB 1M2DA 5A4WA 2XPEA 1XZOA 5COHA 3W8JA 3VPTA 2VD0A 3HJMA 2X8HA 4AJ8A 4I8BA 2H1AA 5ECRB 4BA7A 1K0DA 3EVIA 1T4ZA 5CAXA 3BD2A 1T8EB 2YWOA 1TOFA 1DE1A 1M7TA 5JWOB 1OC8A 2YOIA 2C3QA 2VLVA 2X8CA 1WWJA 4MJEA 2IMIA 1ERUA 2CVKA 2DJ3A 1VF4A 1B9YC 1J0FA 3F4SA 2LSTA 1WIKA 3N5OA 1YY7A 1U88A 2GQMA 4XHMA 2IMEA 4KB3A 3D4TA 1Q4JA 5LCZA 1NW2A 2C0GA 5BMUA 2H66A 1THXA 3UIWA 3M0FA 2LRTA 2NDOA 3QAVA 1T00A 1TU8A 4POMA 3NIVA 4PTSA 2FA8A 3GH6A 4HZ4A 2V41A 2PVOC 4AJ6A 1XW5A 3E3EA 2VCTA 4O7HA 1RQMA 1K3YA 4MK3A 2VO4A 2WULA 3GUSA 2I4AA 1YDKA 1OC9B 2VM2A 1K3LA 2WRTA 4K0GA 4NWYA 4KE3A 2MYGA 3QFAC 3UEMA 5INYA 5DBQA 3ZREA 3KGKA 5A5KA 2N5AA 4KDXA 2LUSA 2QKEA 4CHSA 1IYIA 3MNGA 3UBKA 4OD7A 4G19A 1XBSA 1XFLA 3GIXA 4IHUA 2L57A 2LTKA 4X4JA 1Z6MA 2QA1A 1N2AA 3UVTA 2VCWA 3DRNA 1B48A 4JR4A 1XWAA 3PPUA 3VWXA 1F3AA 2P5QA 2DMMA 4KX4A 1AC1A 1XCCA 3PR8A 2BMXA 4ZILA 4TN8A 1JFUA 5CO3A 4YAPA 5HQPA 16GSA 4OFMA 3QDNA 1TXXA 4MF5A 3LW9A 5F07A 3GX8A 1Q98A 4ML1A 5J9BA 2PU9C 2KP2A 2G2QA 2C3NA 2GQKA 2D2ZA 1AUCA 4TR4A 4ULXA 5EL8A 4V2LA 4LMVA 3ZZXA 5A4UA 4JR6A 1BAYA 1Z7RA 4LA1A 2EIQA 2R6KA 1OE7A 4JU5A 5JCGA 1W89A 1AXDA 4JBBA 2ON7A 1EGOA 6GSSA 2DMLA 1A2JA 3GTUB 3IAS2 4NMUA 1UN2A 5J5NA 5DDLA 1MEKA 2C0EA 1S3CA 3P7XA 1GP1A 3ZRDA 4TR3A 3DKSA 4MJAA 4EO3A 1XVQA 3LQ7A 2VIMA 1TW9A 1N8JA 3LSZA 1YF1A 1G0TA 3F8UA 5ECHB 4JZQA 3F3RA 2DJKA 1UA5A 4MA9A 2FA4A 3APQA 5E59A 2YZHA 5F05A 3TKSC 4AJ7A 3DIEA 2OBIA 3HY2A 5KN3A 1ACVA 3HVSA 5HFKA 2O85A 2GVPA 1GSSA 3DEXA 2YV9A 1QXHA 5D96A 3Q6OA 2MMNA 4MF7A 1G7EA 3QMXA 2H8LA 1YZXA 2OKAA 5JCUA 1GULA 2YCDA 4NAXA 1PX6A 3VLNA 1F2EA 3APOA 3LYKA 1Y25A 1PKWA 3A5WA 4V1Ag 5ECSA 3KJYA 2P0GA 2XPDA 3CXGA 3GMFA 2GSRA 4YH2A 1PQNA 2F9SA 5DJLA 3ED3A 2MMAA 1M9BA 3U5RE 2GT6A 2E7PA 4N11A 3V1WA 3G7YA 2VL3A 3D21A 3F3QA 2FUG2 3AY8A 4LLRA 4ICYA 1DE2A 22GSA 3KCMA 3LFLA 5JWQB 5BRTA 3TJKA 5ELGA 1PN9A 2KUCA 1VRSD 4L5OA 2CT6A 3FHKA 2AAWA 4HZ2A 1GRXA 4OO4A 5C04A 2WCIA 1WPIA 14GSA 1QUWA 3I6AA 4ECBA 3FR6A 4J57E 3QAWA 3KMOA 3QAGA 3GTUA 3FEUA 2QA2A 3IAM2 2AYTA 3HD5A 5CNWA 4FYBA 2B1LA 1A0FA 4Q5QA 5J3RA 4Z7XA 4MJCA 2JZSA 2XC2A 3ZLPA 2HZEA 5AGYA 3I69A 4FIWA 1FB0A 3HA9A 1VF1A 3IK7A 2VCXA 5ECOB 1XOBA 4GWRA 2HXKA 2C0DA 4MH2A 4RI7A 4OMVA 2H71A 1K0OA 4PXOA 2VAFA 1B9XC 1Z7PA 1K0CA 1XW9A 1SU9A 2F8FA 2GDRA 7GSSA 1T3BA 2FWFA 3UMAA 1GSQA 1XVWA 2LJKA 1E6BA 2RUFA 3WGDA 3MDKA 1WE0A 2FD3A 1NHYA 2P5RA 1KTEA 3A2WA 4OFTA 1X5CA 2LNSA 3ZTLA 3TKSE 2R5GA 4EL1A 3UL3A 2A2SA 18GSA 3VPQA 4MJBA 3EPTA 1BQ7A 1X5EA 2JADA 2HZFA 1GLPA 4KSMA 2H0GA 2I1UA 2RIIA 1O6JA 3HXSA 5GZZB 4XCSA 1V57A 2CA8A 2R0GA 1FOVA 4ACSA 4D73B 1IYHA 2OE0A 1R7HA 1DBYA 4IS0A 1AQXA 3C1SA 4F9ZA 2GSSA 5A4VA 3BCIA 1GUHA 5D93A 3ZIJA 3F4RA 4HJ2A 2VM1A 2CV4A 2B1KA 4LL4B 4PUAA 4ZL8A 3VK9A 5ECIB 3Q74A 1TU7A 5G5EA 5IMZA 3UAPA 2TRXA 1HD2A 1GNWA 2TIRA 2H1DA 3HZ8A 4G9HA 3WT2A 3WT1A 5H5QA 4MABA 4KGIA 4G0KA 4GRFA 3BBYA 2E2GA 1EEJA 3R3EA 4O32A 3ME8A 2H0HA 2C1YA 1I5GA 2VCVA 3WGEA 2X64A 3F0IA 3IHGA 3UVHA 2F51A 1M2BA 1PL1A 19GSA 2NBSA 1ABAA 2PN8A 3ZVJD 4HUAA 1ZGNA 2H1BA 4L0UA 4XIHA 5DCHA 1VF3A 4E8EA 4YKFA 2HRKA 3BCKA 3O76A 1KEBA 4K7NA 3GHAA 1W4VA 3P8WA 2CAQA 5DQYA 2H6ZA 2UZ8A 3I43A 3CTGA 3HKRA 3IDVA 4N0VA 2YWIA 3ERFA 3GL3A 3GRXA 2H30A 4PURA 2CVBA 1C72A 4IELA 5EPFA 5CREA 3KM6A 2B5YA 4FYUA 2ZCTA 1QFNA 4V2NA 3TOTA 2DC5A 2H72A 1Z6NA 4MNNA 2IIYA 4IGJA 1VF2A 5G2ZA 1UC7A 1XXUA 2IPAA 4FQUA 4GQCA 1PX7A 3LWAA 4I5QA 3HJPA 3FZAA 5FWGA 2IFQA 4K2XA 2FNOA 3TKQA 4EIPA 5DJMA 4PUFC 4PQHA 5D9VA 2E0QA 5GAND 4G0IA 3SBCA 5D8IA 2X8GA 3TOUA 1AIUA 2GZPA 1I9DA 1O81A 1TTZA 1O8WA 1FW1A 2NTOA 3EURA 1WRYA 1SK1A 17GSA 5KN2A 3ZYWA 2F8AA 2H75A 3VWVA 5EVOA 4IN0A 4NHZA 4ZIJA 1B4QA 2GZYA 2YNXA 3IK9A 3L9VA 1O7UA 2K8SA 3P2AA 1EP8A 3IV4A 4OCFA 2H70A 1Y6EA 2OBKA 1DSBA 4PX1A 3TKSA 3FZ4A 4TKYA 2DJ2A 1HYUA 3EMXA 1R5PA 2L4QA 1AQWA 4G2EA 1EOGA 1X9SB 3PGTA 1EEMA 3L0HA 4O5RA 1TK0B 4Q5NA 1GSDA 2AB6A 3EYTA 3GKMA 2DBCA 1J08A 3IC4A 1XPVA 3M9JA 3F9UA 1ZCPA 2PPTA 5ECQB 5JWRB 3KMNA 3E9JB 1TP9A 2GQLA 3UARA 2ZUPA 1PGTA 2WFCA 1MD4A 4I6XA 3H8QA 5DAKB 4HS1A 1QQ2A 5L71A 1GH2A 5IO0A 2GTUA 5B8BA 3GKNA 2B7JA 1TI1A 2L4CA 2AJQB 5D9XA 3GNJA 1M0UA 2VCZA 2HE3A 2EIRA 4DSRA 5B6NA 2LEGA 2H73A 2V6OA 4KCAA 2JACA 2FWGA 4NHWA 3TRXA 3US3A 5F8BA 2B5XA 5F06A 3EWLA 4QQ7A 4TR0A 1S3AA 4NV2A 3P90A 1ERTA 5ELAA 5ECPB 2O7KA 1XWGA 6GSUA 3PH9A 2KOKA 3H4KA 4KAEA 3EU4A 1G6YA 1NHOA 4CW9A 4NPBA 3EINA 1U3IA 2A2RA 4XRDA 3MAKA 5B7CA 3TJJA 3LORA 4MZWA 1A2MA 3IR4A 5HR3A 13GSA 4K8MA 4CY6A 5KN0A 2JZRA 3ERWA 4Z2TA 1AW9A 4L5LA 1THOA 3W6GA 4ZBDA 1KNGA 1EOHA 1LU4A 3ERGA 1MD3A 4N30A 2HZEB 3MSZA 2FLSA 2WS2A 1TK8B 4KH7A 2FCHA 2GZZA 4RQRA 4PNFA 1XWKA 4P3YB 4WR4A 2V2GA 4RUVA 4IP1A 4I2UA 8GSSA 1NM3A 2AV4A 2O89A 4N10A 2V6KA 1CQHA 4TXVA 3CSJA 4ISDA 4XS6A 3CRUA 2YPMA 1FB6A 4K9ZA 4LL1B 3CSHA 1V40A 3LXZA 4K6XA 3GSTA 4Q5FA 1XIYA 2B3SA 5G31A 2YANA 2VL2A 1ZMAA 2IMFA 3U6VA 1ZYNA 2QSIA 3R2QA 1SYXA 3FZ9A 4J56E 4TOPA 3D5JA 1V58A 2DSAA 4IBPA 5ABRA 1AAZA 1JHBA 4XTSA 4A5PA 4GLTA 3VWWA 1EWXA 3M1GA 2PVQA 5DAKA 2B5EA 3L9SA 4ML6A 5FHIA 1ZYPA 2R3XA 4YAVA 2RUEA 2XHFA 1OYJA 4HEA2 3TCOA 2VL9A 3H1NA 5H5RA 2DLXA 2QGVA 4KUNA 3M3MA 3GKKA 3IBHA 2KLXA 2YP6A 1O85A 3F4TA 1TRSA 2L5LA 1RW1A 2LS5A 4WETA 1A0RP 1OVNA 2AHEA 3Q19A 5IMCA 2O8VB 1A2LA 1HNAA 2M80A 5B8AA 1PRXA 4GF0A 3C1RA 2PGTA 1OKDA 3VI5A 3F6DA 1K0NA 4FH8A 5CP1A 4OCEA 2YV7A 2Z9SA 1Z5YE 5IO2A 4V1Ap 2HRFA 5D9WA 2YWNA 1E2YA 1JZWA 4EKZA 1GSEA 2B7KA 1YF0A 20GSA 1PL2A 4ZL7A 5CRDA 3IHQA 4WXTA 1OAZA 3RBTA 3GN3A 1URMA 4NXIA 2WZ9A 3FMWA 4MPGA 4ZXGA 1T1VA 4IJIA 3KTLA 2DKIA 4RI6A 3PINA 1BYEA 4IP6A 1FVKA 3M9KA 1GSYA 4BVXA 1BX9A 4USSA 2BJXA 3L9UA 3CMIA 1S3DA 2R37A 6GSWA 1CQGA 2K9FA 2PUKC 3IPZA 3RPNA 1HQOA 2R0PA 1K0BA 3A2VA 4MDCA 3F6FA 2LQQA 5KEJA 5ENUA 3FY7A 4MLYA 2HI7A 3L78A 4L8EA 3L4NA 3WD6A 11GSA 1Z3EA 2PBJA 4DEJA 2ZNMA 2IFQB 2CQ9A 3DD3A 3HZ4A 2A4HA 3J7Yb 2A4VA 2I9HA 1H4OA 2HT9A 2YN1A 4NV5A 3OR5A 1GSFA 3D22A 1QK8A 1HNBA 5ECLB 3TJGA 1JLWA 1PSQA 1B4PA 1V2AA 4TVEA 4FO5A 4MMMA 5IMAA 2H6XA 3BJ5A 2IN3A 4HU7A 2TRCP 1X9WB 4KDYA 1GTIA 3VI7A 3O6TA 3ZFBA 4G10A 3GX0A 3RPPA 4O92A 4F03A 1OC3A 6GSVA 5HR0A 2C0FA 3ZIVA 3MWHA 1WOUA 2RLIA 5IMVA 5IMDA 1UVZA 4DSQA 3TJBA 2HRAA 4MF6A 2HLSA 1ZYEA 5GSTA 3DXBA 1ILOA 1F9MA 2L5OA 4BVYB 2EC4A 5C00A 3JCML 5E4WA 3LJRA 5ECNB 5G1LA 2JU5A 3J7Yk 4V2MA 1ZZYA 2V32A 5GAPD 2HYXA 3A3TA 3FR9A 5IQYA 2FY6A 1SJ6A 4QL7A 2MBSA 1GTBA 2N5FA 1U6TA 4HQZA 2XBQA 3GA4A 1SD8A 2DKHA 5J4UA 1DUGA 2MMZA 3QOUA 4ZB8A 3FKFA 3SWLA 1TDIA 1F6MC 3I9V2 3FZ5A 3IE3A 3RHBA 4MCUA 2C4JA 2CVDA 2HSHA 1SENA 4BPYA 5HR1A 1X5DA 4HDEA 2LRNA 3EU3A 4TW5A 2OJLA 4KNDA 1G7OA 1MDJA 4ZB6A 3WGXA 3GH9A 4GTUA 4E8HA 4JEDA 2K8VA 1EV9A 2VUPA 4LMWA 4ID0A 1F3BA 4F0CA 4BWSA 4ECCA 5KOXA 5DCGA 4KCEA 2JSZA 4Q5RA 4K5SA 4KA0A 4WKWA 3KIJA 1PN0A 4EVMA 1SL2B 3LEFA 1XOAA 1MTCA 4XRAA 2OADA 2C8UA 2VLTA 4HOJA 1K0AA 1YEXA 3KXOA 4MPFA 3ISOA 3UJ1A 2FHEA 6GSXA 3N9JA 3GSSA 1MDKA 3TRPA 1GSUA 3C7MA 3KP9A 4ECIA 1SL1B 1WMJA 2IJYA 1U3AA 4BVYA 5G5FA 2H19A 3HVXA 1R26A 4YQMA 4BL7B 4IW9A 3H93A 3ZMLA 3FYGA 4X1UA 3G7IA 4EC0A 3KH7A 1ZOFA 2C80A 1U87A 3VURA 2VLUA 3ZMKA 1ERVA 5ECKB 3TKRA 2LQOA 3GYKA 5AIXA 3KP8A 1G6WA 5IM9A 4G0LA 1TJDA 1TI3A 1YJ6A 5J9CA 3VFIA 4DSSA 4O5QA 1EGRA 3HJOA 6GSTA 4AF2A 2CZ3A 1GTUA 3DGQA 4CDOA 4AGSA 3APSA 3DVXA 3HCZA 1LJRA 1GWCA 1K3OA 4K1FA 1XW6A 4EXJA 3FR3A 4QL9A 5LD0A 1QGVA 1MDIA 2OE3A 3E0UA 3Q18A 1PKZA 3O3TA 4F82A 2FWEA 3KH9A 3QD9A 5ID2B 4N0ZA 1XWCA 5AISA 1R4WA 2OA7A 2WGRA 4IVFA 3D6IA 2IMDA 2ES7A 2LV3A 4ZB9A 4ZBBA 1O73A 2M72A 1RK4A 5G1KA 4PQIA 3CRTA 5CRHA 3WYWA 1ERWA 2WB9A 3DYRA 1SK2A 1O8XA 2LJAA 3ZITA 2JZTA 2CZ2A 1V9WA 2OE1A 3LYPA 3QFBC 4KDUA 3MYDA 5G30A 5DVBA 2R0CA 1SKSB 4PGTA 2R2JA 5J41A 1SJZA 1PD21 5KOWA 4TXOA 3LG6A 2HRNA 10GSA 2LNTA 2HNLA 1VGLA 5AN1A 3NOFA 2V1MA 2MMOA 4Z2RA 2C3TA 1GUMA 2XBIA 5IIZA 2H0IA 2H6YA 1A23A 2GT5A 3C8EA 2GSQA 1ON4A 5EY6A 2X49A 4KW6A 3GURA 1JZDA 2YJHA 2FGXA 3HVVA 3NZNA 4OO5A 1FHEA 3G7JA 5F0GA 1SJIA 4I97A 1TK5B 2HFDA 5B6MA 3H79A 1FO5A 4BVXB 5KN1A 4BL7A 4HI7A 1BJXA 1FOHA 2PMTA 3IXRA 4GSNA 4JRRA 2DJ1A 2GGTA 2OACA 5DALB 1K0MA 4MZBA 3TGZA 4YKGA 4OFNA 2DJ0A 1FVJA 3C71A 2P31A 4EE0A 4TRXA 1QMVA 4GSTA 1ZYQB 3DWVA 3GFKA 4BWQA 2L6CA 4RQXA 5H5SA 3UBLA 4WBRD 3KEBA 3HHVA 4DVCA 1OC9A 3QCPA 2B6MA 1V98A 1SD9A 2REMA 5IPGA 3IOSA 1T4YA 3CSIA 4ILFA 2PERA 5ID2A 3QR6A 1PMTA 3HYPA 3BOAA 2J23A 1SKWB 2VCQA 1USBA 4ZL9A 5IOWA 1OKTA 1JZOA 1ST9A 4MH3A 2K18A 5CRWA 4WR5A 4EDYA 4XS4B 2DIYA 2MZCA 9GSSA 4YQVA 2AUVA 2WDUA 3A5IA 3RDWA 1H75A 3GL5A 2CX3A 1EV4A 4K0NA 3CTFA 3IRAA 2IWTA 4MP4A 4IQAA 4Z2UA 1SYRA 1OE8A 3IC8A 4GQFA 4ZBAA 1KBNA 3TKPA 4K7IA 2K6VA 2YZUA 1YQ1A 4GSSA 3KTBA 1WP0A 2ON5A 2H76A 2NVLA 2NPBA 2JSYA 2DJJA 4KSOA 4WF4A 3EMPA 4O5UA 3LXTA 2GS3A 4GCIA 1YKCA 4H86A 3FRCA 4EF0A 2VD1A 5HR2A 2L6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4POL A;  2I81 A;  4YQU A;  2YWM A;  4PNG A;  4HQS A;  3CBU A;  3VWU A;  3GKX A;  2KHP A;  4POB A;  1R5A A;  3KD0 A;  2H1G A;  5ECM B;  3RAZ A;  2H01 A;  2F3M A;  3DML A;  4TR1 B;  2IMK A;  4FYC A;  4L0W A;  5DAL A;  1TRU A;  1Z9H A;  1LBK A;  1M9A A;  4F2I A;  3CYN A;  4OWY A;  2KP1 A;  1SKR B;  3K8N A;  2GST A;  4IJ3 A;  2L59 A;  1NSW A;  4K7O A;  1PA3 A;  2CX4 A;  3HDC A;  3TDG A;  3D4M A;  4XS1 A;  1M99 A;  5FT3 A;  2MBT A;  2GLR A;  3D0Z A;  1FG4 A;  2JL4 A;  5IOX A;  2LKU A;  1GL8 A;  2O87 A;  3A2X A;  3F63 A;  4WBJ A;  2VL2 C;  2RM5 A;  2VOC A;  4XS4 A;  1A24 A;  2CAI A;  5CRG A;  3ZVJ A;  1A8Y A;  4IQ1 A;  3GV1 A;  3DVW A;  1ML6 A;  4I2T A;  4EUY A;  4X0X A;  4EDZ A;  1EZK A;  3TB2 A;  5HFG A;  3FW2 A;  3ZL5 A;  3EC3 A;  5CYY A;  1FAA A;  4J2F A;  3G9B A;  1SL0 B;  1TRV A;  4JE1 A;  5JCW A;  5DQS A;  2LRC A;  2IL3 A;  1B8X A;  4X43 A;  12GS A;  3ME7 A;  4WEY A;  2M46 A;  4MZC A;  1YKA A;  1BG5 A;  5IMF A;  4POK A;  1SK0 A;  2QC7 A;  1HNC A;  2EIO A;  2PWJ A;  4PQ1 A;  5LNK e;  1XWB A;  3RHC A;  3W8S A;  1GNE A;  4HJM A;  2ALB A;  1TRW A;  3UOM A;  1GTA A;  1BED A;  5IPH A;  2N5B A;  3QPM A;  1EP7 A;  2YJ7 A;  4ECJ A;  3EE2 A;  2X99 A;  1AQV A;  2LJR A;  1TKD B;  4GXZ A;  4DSS B;  5D73 A;  3IA1 A;  3LGC A;  4F0B A;  2BTO T;  5GSS A;  1X9M B;  4K2D A;  1WJK A;  4WF5 A;  2G0F A;  1JZR A;  4TR1 A;  5D9T A;  2FWH A;  2DIZ A;  3TUE A;  1J9B A;  1M2A A;  4HU9 A;  2R4V A;  3FK8 A;  3TJF A;  3M8N A;  6GSY A;  3ZFL A;  1GLQ A;  3TRQ A;  5HFI A;  2E2M A;  1GUK A;  3S9F A;  2WJU A;  1ZL9 A;  2J9H A;  5AIV A;  1A8L A;  4IKH A;  1F37 A;  3C73 A;  2H74 A;  1YEP A;  3KZQ A;  1T7P B;  1X0R A;  2RM6 A;  2HSY A;  1JLV A;  2I3Y A;  4D73 A;  4TXO B;  1M2D A;  5A4W A;  2XPE A;  1XZO A;  5COH A;  3W8J A;  3VPT A;  2VD0 A;  3HJM A;  2X8H A;  4AJ8 A;  4I8B A;  2H1A A;  5ECR B;  4BA7 A;  1K0D A;  3EVI A;  1T4Z A;  5CAX A;  3BD2 A;  1T8E B;  2YWO A;  1TOF A;  1DE1 A;  1M7T A;  5JWO B;  1OC8 A;  2YOI A;  2C3Q A;  2VLV A;  2X8C A;  1WWJ A;  4MJE A;  2IMI A;  1ERU A;  2CVK A;  2DJ3 A;  1VF4 A;  1B9Y C;  1J0F A;  3F4S A;  2LST A;  1WIK A;  3N5O A;  1YY7 A;  1U88 A;  2GQM A;  4XHM A;  2IME A;  4KB3 A;  3D4T A;  1Q4J A;  5LCZ A;  1NW2 A;  2C0G A;  2H66 A;  1THX A;  3UIW A;  3M0F A;  2LRT A;  2NDO A;  3QAV A;  1T00 A;  1TU8 A;  4POM A;  3NIV A;  2FA8 A;  3GH6 A;  4HZ4 A;  2V41 A;  2PVO C;  4AJ6 A;  1XW5 A;  3E3E A;  2VCT A;  4O7H A;  1RQM A;  1K3Y A;  4MK3 A;  2VO4 A;  2WUL A;  3GUS A;  2I4A A;  1YDK A;  1OC9 B;  2VM2 A;  1K3L A;  2WRT A;  4K0G A;  4NWY A;  4KE3 A;  2MYG A;  3QFA C;  3UEM A;  5INY A;  5DBQ A;  3ZRE A;  3KGK A;  5A5K A;  2N5A A;  4KDX A;  2LUS A;  2QKE A;  4CHS A;  1IYI A;  3MNG A;  3UBK A;  4OD7 A;  4G19 A;  1XBS A;  1XFL A;  3GIX A;  4IHU A;  2L57 A;  2LTK A;  1Z6M A;  1N2A A;  3UVT A;  2VCW A;  3DRN A;  1B48 A;  4JR4 A;  1XWA A;  3VWX A;  1F3A A;  2P5Q A;  2DMM A;  4KX4 A;  1AC1 A;  1XCC A;  3PR8 A;  2BMX A;  4ZIL A;  4TN8 A;  1JFU A;  5CO3 A;  4YAP A;  5HQP A;  16GS A;  4OFM A;  3QDN A;  1TXX A;  4MF5 A;  5F07 A;  3GX8 A;  1Q98 A;  4ML1 A;  5J9B A;  2PU9 C;  2KP2 A;  2G2Q A;  2C3N A;  2GQK A;  2D2Z A;  1AUC A;  4TR4 A;  4ULX A;  5EL8 A;  4V2L A;  4LMV A;  3ZZX A;  5A4U A;  4JR6 A;  1BAY A;  1Z7R A;  4LA1 A;  2EIQ A;  2R6K A;  1OE7 A;  4JU5 A;  5JCG A;  1W89 A;  1AXD A;  4JBB A;  2ON7 A;  1EGO A;  6GSS A;  2DML A;  1A2J A;  3GTU B;  3IAS 2;  4NMU A;  1UN2 A;  5J5N A;  5DDL A;  1MEK A;  2C0E A;  1S3C A;  3P7X A;  1GP1 A;  3ZRD A;  4TR3 A;  3DKS A;  4MJA A;  4EO3 A;  1XVQ A;  3LQ7 A;  2VIM A;  1TW9 A;  1N8J A;  3LSZ A;  1YF1 A;  1G0T A;  3F8U A;  5ECH B;  4JZQ A;  3F3R A;  2DJK A;  1UA5 A;  4MA9 A;  2FA4 A;  3APQ A;  5E59 A;  2YZH A;  5F05 A;  3TKS C;  4AJ7 A;  3DIE A;  2OBI A;  3HY2 A;  5KN3 A;  1ACV A;  3HVS A;  5HFK A;  2O85 A;  2GVP A;  1GSS A;  3DEX A;  2YV9 A;  1QXH A;  5D96 A;  3Q6O A;  2MMN A;  4MF7 A;  1G7E A;  3QMX A;  2H8L A;  1YZX A;  2OKA A;  5JCU A;  1GUL A;  2YCD A;  4NAX A;  1PX6 A;  3VLN A;  1F2E A;  3APO A;  3LYK A;  1Y25 A;  1PKW A;  3A5W A;  4V1A g;  5ECS A;  3KJY A;  2P0G A;  2XPD A;  3CXG A;  3GMF A;  2GSR A;  4YH2 A;  1PQN A;  2F9S A;  5DJL A;  3ED3 A;  2MMA A;  1M9B A;  3U5R E;  2GT6 A;  2E7P A;  4N11 A;  3V1W A;  3G7Y A;  2VL3 A;  3D21 A;  3F3Q A;  2FUG 2;  3AY8 A;  4LLR A;  1DE2 A;  22GS A;  3KCM A;  3LFL A;  5JWQ B;  3TJK A;  5ELG A;  1PN9 A;  2KUC A;  1VRS D;  4L5O A;  2CT6 A;  3FHK A;  2AAW A;  4HZ2 A;  1GRX A;  4OO4 A;  5C04 A;  2WCI A;  1WPI A;  14GS A;  1QUW A;  3I6A A;  4ECB A;  3FR6 A;  4J57 E;  3QAW A;  3KMO A;  3QAG A;  3GTU A;  3FEU A;  3IAM 2;  2AYT A;  3HD5 A;  5CNW A;  4FYB A;  2B1L A;  1A0F A;  4Q5Q A;  5J3R A;  4Z7X A;  4MJC A;  2JZS A;  2XC2 A;  3ZLP A;  2HZE A;  5AGY A;  3I69 A;  4FIW A;  1FB0 A;  3HA9 A;  1VF1 A;  3IK7 A;  2VCX A;  5ECO B;  1XOB A;  4GWR A;  2HXK A;  2C0D A;  4MH2 A;  4RI7 A;  4OMV A;  2H71 A;  1K0O A;  4PXO A;  2VAF A;  1B9X C;  1Z7P A;  1K0C A;  1XW9 A;  1SU9 A;  2F8F A;  2GDR A;  7GSS A;  1T3B A;  2FWF A;  3UMA A;  1GSQ A;  1XVW A;  2LJK A;  1E6B A;  2RUF A;  3WGD A;  3MDK A;  1WE0 A;  2FD3 A;  1NHY A;  2P5R A;  1KTE A;  3A2W A;  4OFT A;  1X5C A;  2LNS A;  3ZTL A;  3TKS E;  2R5G A;  4EL1 A;  3UL3 A;  2A2S A;  18GS A;  3VPQ A;  4MJB A;  1BQ7 A;  1X5E A;  2JAD A;  2HZF A;  1GLP A;  4KSM A;  2H0G A;  2I1U A;  2RII A;  1O6J A;  3HXS A;  5GZZ B;  4XCS A;  1V57 A;  2CA8 A;  1FOV A;  4ACS A;  4D73 B;  1IYH A;  2OE0 A;  1R7H A;  1DBY A;  4IS0 A;  1AQX A;  3C1S A;  4F9Z A;  2GSS A;  5A4V A;  3BCI A;  1GUH A;  5D93 A;  3ZIJ A;  3F4R A;  4HJ2 A;  2VM1 A;  2CV4 A;  2B1K A;  4LL4 B;  4PUA A;  4ZL8 A;  3VK9 A;  5ECI B;  3Q74 A;  1TU7 A;  5G5E A;  5IMZ A;  3UAP A;  2TRX A;  1HD2 A;  1GNW A;  2TIR A;  2H1D A;  3HZ8 A;  4G9H A;  3WT2 A;  3WT1 A;  5H5Q A;  4MAB A;  4KGI A;  4GRF A;  3BBY A;  2E2G A;  1EEJ A;  4O32 A;  3ME8 A;  2H0H A;  2C1Y A;  1I5G A;  2VCV A;  3WGE A;  2X64 A;  3F0I A;  3UVH A;  2F51 A;  1M2B A;  1PL1 A;  19GS A;  2NBS A;  1ABA A;  2PN8 A;  3ZVJ D;  4HUA A;  1ZGN A;  2H1B A;  4L0U A;  4XIH A;  5DCH A;  1VF3 A;  4E8E A;  3BCK A;  3O76 A;  1KEB A;  4K7N A;  3GHA A;  1W4V A;  3P8W A;  2CAQ A;  5DQY A;  2H6Z A;  3I43 A;  3CTG A;  3HKR A;  3IDV A;  4N0V A;  2YWI A;  3ERF A;  3GL3 A;  3GRX A;  2H30 A;  4PUR A;  2CVB A;  1C72 A;  4IEL A;  5EPF A;  5CRE A;  3KM6 A;  2B5Y A;  4FYU A;  2ZCT A;  1QFN A;  4V2N A;  3TOT A;  2DC5 A;  2H72 A;  1Z6N A;  2IIY A;  4IGJ A;  1VF2 A;  5G2Z A;  1UC7 A;  1XXU A;  2IPA A;  4GQC A;  1PX7 A;  3LWA A;  4I5Q A;  3HJP A;  3FZA A;  5FWG A;  2IFQ A;  2FNO A;  3TKQ A;  5DJM A;  4PUF C;  4PQH A;  5D9V A;  2E0Q A;  5GAN D;  3SBC A;  5D8I A;  2X8G A;  3TOU A;  1AIU A;  2GZP A;  1I9D A;  1O81 A;  1TTZ A;  1O8W A;  1FW1 A;  2NTO A;  3EUR A;  1WRY A;  1SK1 A;  17GS A;  5KN2 A;  3ZYW A;  2F8A A;  2H75 A;  3VWV A;  5EVO A;  4IN0 A;  4NHZ A;  4ZIJ A;  1B4Q A;  2GZY A;  2YNX A;  3IK9 A;  3L9V A;  1O7U A;  2K8S A;  3P2A A;  1EP8 A;  3IV4 A;  4OCF A;  2H70 A;  1Y6E A;  2OBK A;  1DSB A;  4PX1 A;  3TKS A;  3FZ4 A;  4TKY A;  2DJ2 A;  1HYU A;  3EMX A;  1R5P A;  2L4Q A;  1AQW A;  4G2E A;  1EOG A;  1X9S B;  3PGT A;  1EEM A;  3L0H A;  4O5R A;  1TK0 B;  4Q5N A;  1GSD A;  2AB6 A;  3EYT A;  3GKM A;  2DBC A;  1J08 A;  3IC4 A;  1XPV A;  3M9J A;  3F9U A;  1ZCP A;  2PPT A;  5ECQ B;  5JWR B;  3KMN A;  3E9J B;  1TP9 A;  2GQL A;  3UAR A;  2ZUP A;  1PGT A;  2WFC A;  1MD4 A;  4I6X A;  3H8Q A;  5DAK B;  4HS1 A;  1QQ2 A;  5L71 A;  1GH2 A;  5IO0 A;  2GTU A;  5B8B A;  3GKN A;  2B7J A;  1TI1 A;  2L4C A;  2AJQ B;  5D9X A;  3GNJ A;  1M0U A;  2VCZ A;  2HE3 A;  2EIR A;  4DSR A;  5B6N A;  2LEG A;  2H73 A;  2V6O A;  4KCA A;  2JAC A;  2FWG A;  4NHW A;  3TRX A;  3US3 A;  5F8B A;  2B5X A;  5F06 A;  3EWL A;  4QQ7 A;  4TR0 A;  1S3A A;  4NV2 A;  3P90 A;  1ERT A;  5ELA A;  5ECP B;  2O7K A;  1XWG A;  6GSU A;  3PH9 A;  2KOK A;  3H4K A;  4KAE A;  3EU4 A;  1G6Y A;  1NHO A;  4CW9 A;  4NPB A;  3EIN A;  1U3I A;  2A2R A;  4XRD A;  3MAK A;  5B7C A;  3TJJ A;  3LOR A;  4MZW A;  1A2M A;  3IR4 A;  5HR3 A;  13GS A;  4K8M A;  5KN0 A;  2JZR A;  3ERW A;  1AW9 A;  4L5L A;  1THO A;  3W6G A;  4ZBD A;  1KNG A;  1EOH A;  1LU4 A;  3ERG A;  1MD3 A;  4N30 A;  2HZE B;  3MSZ A;  2FLS A;  2WS2 A;  1TK8 B;  4KH7 A;  2FCH A;  2GZZ A;  4RQR A;  4PNF A;  1XWK A;  4P3Y B;  4WR4 A;  2V2G A;  4RUV A;  4IP1 A;  4I2U A;  8GSS A;  1NM3 A;  2AV4 A;  2O89 A;  4N10 A;  2V6K A;  1CQH A;  4TXV A;  3CSJ A;  4ISD A;  4XS6 A;  3CRU A;  2YPM A;  1FB6 A;  4K9Z A;  4LL1 B;  3CSH A;  1V40 A;  3LXZ A;  4K6X A;  3GST A;  4Q5F A;  1XIY A;  2B3S A;  5G31 A;  2YAN A;  2VL2 A;  1ZMA A;  2IMF A;  3U6V A;  2QSI A;  3R2Q A;  1SYX A;  3FZ9 A;  4J56 E;  4TOP A;  3D5J A;  1V58 A;  2DSA A;  4IBP A;  5ABR A;  1AAZ A;  1JHB A;  4XTS A;  4GLT A;  3VWW A;  1EWX A;  3M1G A;  2PVQ A;  5DAK A;  2B5E A;  3L9S A;  4ML6 A;  5FHI A;  2R3X A;  4YAV A;  2RUE A;  2XHF A;  1OYJ A;  4HEA 2;  3TCO A;  2VL9 A;  3H1N A;  5H5R A;  2DLX A;  2QGV A;  4KUN A;  3M3M A;  3GKK A;  3IBH A;  2KLX A;  2YP6 A;  1O85 A;  3F4T A;  1TRS A;  2L5L A;  1RW1 A;  2LS5 A;  4WET A;  1A0R P;  1OVN A;  2AHE A;  3Q19 A;  5IMC A;  2O8V B;  1A2L A;  1HNA A;  2M80 A;  5B8A A;  1PRX A;  4GF0 A;  3C1R A;  2PGT A;  1OKD A;  3VI5 A;  3F6D A;  1K0N A;  4FH8 A;  5CP1 A;  4OCE A;  2YV7 A;  2Z9S A;  1Z5Y E;  5IO2 A;  4V1A p;  2HRF A;  5D9W A;  2YWN A;  1E2Y A;  1JZW A;  4EKZ A;  1GSE A;  2B7K A;  1YF0 A;  20GS A;  1PL2 A;  4ZL7 A;  5CRD A;  3IHQ A;  4WXT A;  1OAZ A;  3RBT A;  3GN3 A;  1URM A;  4NXI A;  2WZ9 A;  4MPG A;  4ZXG A;  1T1V A;  4IJI A;  3KTL A;  4RI6 A;  3PIN A;  1BYE A;  4IP6 A;  1FVK A;  3M9K A;  1GSY A;  4BVX A;  1BX9 A;  2BJX A;  3L9U A;  3CMI A;  1S3D A;  2R37 A;  6GSW A;  1CQG A;  2K9F A;  2PUK C;  3IPZ A;  3RPN A;  1HQO A;  1K0B A;  3A2V A;  4MDC A;  3F6F A;  2LQQ A;  5KEJ A;  5ENU A;  3FY7 A;  4MLY A;  2HI7 A;  3L78 A;  4L8E A;  3L4N A;  3WD6 A;  11GS A;  1Z3E A;  2PBJ A;  4DEJ A;  2ZNM A;  2IFQ B;  2CQ9 A;  3DD3 A;  3HZ4 A;  3J7Y b;  2A4V A;  2I9H A;  1H4O A;  2HT9 A;  2YN1 A;  4NV5 A;  3OR5 A;  1GSF A;  3D22 A;  1QK8 A;  1HNB A;  5ECL B;  3TJG A;  1JLW A;  1PSQ A;  1B4P A;  1V2A A;  4TVE A;  4FO5 A;  4MMM A;  5IMA A;  2H6X A;  3BJ5 A;  2IN3 A;  4HU7 A;  2TRC P;  1X9W B;  4KDY A;  1GTI A;  3VI7 A;  3O6T A;  3ZFB A;  4G10 A;  3GX0 A;  3RPP A;  4O92 A;  4F03 A;  1OC3 A;  6GSV A;  5HR0 A;  2C0F A;  3ZIV A;  3MWH A;  1WOU A;  2RLI A;  5IMV A;  5IMD A;  1UVZ A;  4DSQ A;  3TJB A;  4MF6 A;  2HLS A;  1ZYE A;  5GST A;  3DXB A;  1ILO A;  1F9M A;  2L5O A;  2EC4 A;  5C00 A;  3JCM L;  5E4W A;  3LJR A;  5ECN B;  5G1L A;  2JU5 A;  3J7Y k;  4V2M A;  1ZZY A;  2V32 A;  5GAP D;  2HYX A;  3A3T A;  3FR9 A;  5IQY A;  2FY6 A;  1SJ6 A;  4QL7 A;  2MBS A;  1GTB A;  2N5F A;  1U6T A;  4HQZ A;  2XBQ A;  3GA4 A;  1SD8 A;  5J4U A;  1DUG A;  2MMZ A;  3QOU A;  4ZB8 A;  3FKF A;  3SWL A;  1TDI A;  1F6M C;  3I9V 2;  3FZ5 A;  3IE3 A;  3RHB A;  4MCU A;  2C4J A;  2CVD A;  2HSH A;  1SEN A;  4BPY A;  5HR1 A;  1X5D A;  4HDE A;  2LRN A;  3EU3 A;  4TW5 A;  2OJL A;  4KND A;  1G7O A;  1MDJ A;  4ZB6 A;  3WGX A;  3GH9 A;  4GTU A;  4E8H A;  4JED A;  2K8V A;  1EV9 A;  2VUP A;  4LMW A;  4ID0 A;  1F3B A;  4F0C A;  4BWS A;  4ECC A;  5DCG A;  4KCE A;  2JSZ A;  4Q5R A;  4KA0 A;  4WKW A;  3KIJ A;  4EVM A;  1SL2 B;  3LEF A;  1XOA A;  1MTC A;  4XRA A;  2OAD A;  2C8U A;  2VLT A;  4HOJ A;  1K0A A;  1YEX A;  3KXO A;  4MPF A;  3ISO A;  3UJ1 A;  2FHE A;  6GSX A;  3N9J A;  3GSS A;  1MDK A;  3TRP A;  1GSU A;  3C7M A;  3KP9 A;  4ECI A;  1SL1 B;  1WMJ A;  2IJY A;  1U3A A;  4BVY A;  5G5F A;  2H19 A;  3HVX A;  1R26 A;  4YQM A;  4IW9 A;  3H93 A;  3ZML A;  3FYG A;  4X1U A;  3G7I A;  4EC0 A;  3KH7 A;  1ZOF A;  2C80 A;  1U87 A;  3VUR A;  2VLU A;  3ZMK A;  1ERV A;  5ECK B;  3TKR A;  2LQO A;  3GYK A;  5AIX A;  3KP8 A;  1G6W A;  5IM9 A;  1TJD A;  1TI3 A;  1YJ6 A;  5J9C A;  3VFI A;  4DSS A;  1EGR A;  3HJO A;  6GST A;  4AF2 A;  2CZ3 A;  1GTU A;  3DGQ A;  4CDO A;  4AGS A;  3APS A;  3DVX A;  3HCZ A;  1LJR A;  1GWC A;  1K3O A;  4K1F A;  1XW6 A;  4EXJ A;  3FR3 A;  4QL9 A;  5LD0 A;  1QGV A;  1MDI A;  2OE3 A;  3E0U A;  3Q18 A;  1PKZ A;  3O3T A;  4F82 A;  2FWE A;  3KH9 A;  3QD9 A;  5ID2 B;  4N0Z A;  1XWC A;  5AIS A;  1R4W A;  2OA7 A;  2WGR A;  4IVF A;  3D6I A;  2IMD A;  2ES7 A;  2LV3 A;  4ZB9 A;  4ZBB A;  1O73 A;  2M72 A;  1RK4 A;  5G1K A;  4PQI A;  3CRT A;  5CRH A;  3WYW A;  1ERW A;  2WB9 A;  3DYR A;  1SK2 A;  1O8X A;  2LJA A;  3ZIT A;  2JZT A;  2CZ2 A;  1V9W A;  2OE1 A;  3LYP A;  3QFB C;  4KDU A;  5G30 A;  5DVB A;  1SKS B;  4PGT A;  2R2J A;  5J41 A;  1SJZ A;  1PD2 1;  4TXO A;  3LG6 A;  2HRN A;  10GS A;  2LNT A;  2HNL A;  1VGL A;  5AN1 A;  3NOF A;  2V1M A;  2MMO A;  2C3T A;  1GUM A;  2XBI A;  5IIZ A;  2H0I A;  2H6Y A;  1A23 A;  2GT5 A;  3C8E A;  2GSQ A;  1ON4 A;  5EY6 A;  4KW6 A;  3GUR A;  1JZD A;  2YJH A;  2FGX A;  3HVV A;  3NZN A;  4OO5 A;  1FHE A;  3G7J A;  5F0G A;  1SJI A;  4I97 A;  1TK5 B;  2HFD A;  5B6M A;  3H79 A;  1FO5 A;  5KN1 A;  4BL7 A;  4HI7 A;  1BJX A;  2PMT A;  3IXR A;  4GSN A;  4JRR A;  2DJ1 A;  2GGT A;  2OAC A;  5DAL B;  1K0M A;  4MZB A;  3TGZ A;  4OFN A;  2DJ0 A;  1FVJ A;  3C71 A;  2P31 A;  4EE0 A;  4TRX A;  1QMV A;  4GST A;  1ZYQ B;  3DWV A;  3GFK A;  4BWQ A;  2L6C A;  4RQX A;  5H5S A;  3UBL A;  4WBR D;  3KEB A;  3HHV A;  4DVC A;  1OC9 A;  3QCP A;  2B6M A;  1V98 A;  1SD9 A;  2REM A;  5IPG A;  3IOS A;  1T4Y A;  3CSI A;  4ILF A;  2PER A;  5ID2 A;  3QR6 A;  1PMT A;  3HYP A;  3BOA A;  2J23 A;  1SKW B;  2VCQ A;  1USB A;  4ZL9 A;  5IOW A;  1OKT A;  1JZO A;  1ST9 A;  4MH3 A;  2K18 A;  4WR5 A;  5CRW A;  4EDY A;  4XS4 B;  2DIY A;  2MZC A;  9GSS A;  4YQV A;  2AUV A;  2WDU A;  3RDW A;  1H75 A;  3GL5 A;  2CX3 A;  1EV4 A;  4K0N A;  3CTF A;  3IRA A;  2IWT A;  4MP4 A;  4IQA A;  1SYR A;  1OE8 A;  4GQF A;  4ZBA A;  1KBN A;  3TKP A;  4K7I A;  2K6V A;  2YZU A;  1YQ1 A;  4GSS A;  3KTB A;  1WP0 A;  2ON5 A;  2H76 A;  2NVL A;  2NPB A;  2JSY A;  2DJJ A;  4KSO A;  4WF4 A;  3EMP A;  3LXT A;  2GS3 A;  4GCI A;  1YKC A;  4H86 A;  3FRC A;  4EF0 A;  2VD1 A;  5HR2 A;  2L6D A; 
#chains in the Genus database with same CATH topology
 4POL A;  2I81 A;  4YQU A;  2YWM A;  4PNG A;  4HQS A;  3CBU A;  3VWU A;  3GKX A;  2KHP A;  4POB A;  1R5A A;  3KD0 A;  2H1G A;  5ECM B;  3RAZ A;  2H01 A;  2F3M A;  3DML A;  4TR1 B;  2IMK A;  4FYC A;  4L0W A;  5DAL A;  1TRU A;  1Z9H A;  1LBK A;  1M9A A;  4F2I A;  3CYN A;  4OWY A;  2KP1 A;  1SKR B;  3K8N A;  2GST A;  4IJ3 A;  2L59 A;  1NSW A;  4K7O A;  1PA3 A;  2CX4 A;  3HDC A;  3TDG A;  4K5R A;  3D4M A;  4XS1 A;  1M99 A;  5FT3 A;  2MBT A;  2GLR A;  3D0Z A;  1FG4 A;  2JL4 A;  5IOX A;  2LKU A;  1GL8 A;  2O87 A;  3A2X A;  3F63 A;  4WBJ A;  2VL2 C;  2RM5 A;  2VOC A;  4XS4 A;  1A24 A;  2CAI A;  5CRG A;  3ZVJ A;  1A8Y A;  2A2P A;  4IQ1 A;  3GV1 A;  3DVW A;  1ML6 A;  4I2T A;  4EUY A;  4X0X A;  4EDZ A;  1EZK A;  3TB2 A;  5HFG A;  3FW2 A;  3ZL5 A;  3EC3 A;  5CYY A;  1FAA A;  4J2F A;  3G9B A;  1SL0 B;  4CY8 A;  1TRV A;  4JE1 A;  4KF9 A;  5JCW A;  5DQS A;  3MIX A;  2LRC A;  2IL3 A;  1B8X A;  4X43 A;  12GS A;  2HSM A;  3ME7 A;  4WEY A;  2M46 A;  4MZC A;  1YKA A;  1BG5 A;  4EIQ A;  5IMF A;  4POK A;  1SK0 A;  2QC7 A;  1HNC A;  2EIO A;  2PWJ A;  4PQ1 A;  5LNK e;  1XWB A;  3RHC A;  3W8S A;  1GNE A;  4HJM A;  2ALB A;  1TRW A;  3UOM A;  1GTA A;  1BED A;  5IPH A;  2N5B A;  3QPM A;  1EP7 A;  2YJ7 A;  4ECJ A;  3EE2 A;  2X99 A;  1AQV A;  2LJR A;  1TKD B;  1S3R A;  4GXZ A;  4DSS B;  5D73 A;  3IA1 A;  3LGC A;  4F0B A;  2BTO T;  5GSS A;  1X9M B;  4K2D A;  1WJK A;  4WF5 A;  2G0F A;  1JZR A;  4TR1 A;  5D9T A;  2FWH A;  2DIZ A;  3TUE A;  1J9B A;  1M2A A;  4HU9 A;  2R4V A;  3FK8 A;  3TJF A;  3M8N A;  6GSY A;  3ZFL A;  1GLQ A;  3TRQ A;  5HFI A;  2E2M A;  1GUK A;  3S9F A;  2WJU A;  1ZL9 A;  2J9H A;  5AIV A;  1A8L A;  4IKH A;  1F37 A;  2X4A A;  3C73 A;  2H74 A;  1YEP A;  3KZQ A;  1T7P B;  1X0R A;  2RM6 A;  2HSY A;  1JLV A;  2I3Y A;  4D73 A;  4TXO B;  1M2D A;  5A4W A;  2XPE A;  1XZO A;  5COH A;  3W8J A;  3VPT A;  2VD0 A;  3HJM A;  2X8H A;  4AJ8 A;  4I8B A;  2H1A A;  5ECR B;  4BA7 A;  1K0D A;  3EVI A;  1T4Z A;  5CAX A;  3BD2 A;  1T8E B;  2YWO A;  1TOF A;  1DE1 A;  1M7T A;  5JWO B;  1OC8 A;  2YOI A;  2C3Q A;  2VLV A;  2X8C A;  1WWJ A;  4MJE A;  2IMI A;  1ERU A;  2CVK A;  2DJ3 A;  1VF4 A;  1B9Y C;  1J0F A;  3F4S A;  2LST A;  1WIK A;  3N5O A;  1YY7 A;  1U88 A;  2GQM A;  4XHM A;  2IME A;  4KB3 A;  3D4T A;  1Q4J A;  5LCZ A;  1NW2 A;  2C0G A;  5BMU A;  2H66 A;  1THX A;  3UIW A;  3M0F A;  2LRT A;  2NDO A;  3QAV A;  1T00 A;  1TU8 A;  4POM A;  3NIV A;  4PTS A;  2FA8 A;  3GH6 A;  4HZ4 A;  2V41 A;  2PVO C;  4AJ6 A;  1XW5 A;  3E3E A;  2VCT A;  4O7H A;  1RQM A;  1K3Y A;  4MK3 A;  2VO4 A;  2WUL A;  3GUS A;  2I4A A;  1YDK A;  1OC9 B;  2VM2 A;  1K3L A;  2WRT A;  4K0G A;  4NWY A;  3CQF A;  4KE3 A;  2MYG A;  3QFA C;  3UEM A;  5INY A;  5DBQ A;  3ZRE A;  3KGK A;  5A5K A;  2N5A A;  4KDX A;  2LUS A;  2QKE A;  4CHS A;  1IYI A;  3MNG A;  3UBK A;  4OD7 A;  4G19 A;  1XBS A;  1XFL A;  3GIX A;  4IHU A;  2L57 A;  2LTK A;  4X4J A;  1Z6M A;  2QA1 A;  1N2A A;  3UVT A;  2VCW A;  3DRN A;  1B48 A;  4JR4 A;  1XWA A;  3PPU A;  3VWX A;  1F3A A;  2P5Q A;  2DMM A;  4KX4 A;  1AC1 A;  1M3I A;  1XCC A;  3PR8 A;  2BMX A;  4ZIL A;  4TN8 A;  1JFU A;  5CO3 A;  4YAP A;  5HQP A;  16GS A;  4OFM A;  3QDN A;  1TXX A;  4MF5 A;  3LW9 A;  5F07 A;  3GX8 A;  1Q98 A;  4ML1 A;  5J9B A;  2PU9 C;  2KP2 A;  2G2Q A;  2C3N A;  2GQK A;  2D2Z A;  1AUC A;  4TR4 A;  4ULX A;  5EL8 A;  4V2L A;  4LMV A;  3ZZX A;  5A4U A;  4JR6 A;  1BAY A;  1Z7R A;  4LA1 A;  2EIQ A;  2R6K A;  1OE7 A;  4JU5 A;  5JCG A;  1W89 A;  1AXD A;  4JBB A;  2ON7 A;  1EGO A;  6GSS A;  2DML A;  1A2J A;  3GTU B;  3IAS 2;  4NMU A;  1UN2 A;  5J5N A;  5DDL A;  1MEK A;  2C0E A;  1S3C A;  3P7X A;  1GP1 A;  3ZRD A;  4TR3 A;  3DKS A;  4MJA A;  4EO3 A;  1XVQ A;  3LQ7 A;  2VIM A;  1TW9 A;  1N8J A;  3LSZ A;  1YF1 A;  1G0T A;  3F8U A;  5ECH B;  4JZQ A;  3F3R A;  2DJK A;  1UA5 A;  4MA9 A;  2FA4 A;  3APQ A;  5E59 A;  2YZH A;  5F05 A;  3TKS C;  4AJ7 A;  3DIE A;  2OBI A;  3HY2 A;  5KN3 A;  1ACV A;  3HVS A;  5HFK A;  2O85 A;  2GVP A;  1GSS A;  3DEX A;  2YV9 A;  1QXH A;  5D96 A;  3Q6O A;  2MMN A;  4MF7 A;  1G7E A;  3QMX A;  2H8L A;  1YZX A;  2OKA A;  5JCU A;  1GUL A;  2YCD A;  4NAX A;  1PX6 A;  3VLN A;  1F2E A;  3APO A;  3LYK A;  1Y25 A;  1PKW A;  3A5W A;  4V1A g;  5ECS A;  3KJY A;  2P0G A;  2XPD A;  3CXG A;  3GMF A;  2GSR A;  4YH2 A;  1PQN A;  2F9S A;  5DJL A;  3ED3 A;  2MMA A;  1M9B A;  3U5R E;  2GT6 A;  2E7P A;  4N11 A;  3V1W A;  3G7Y A;  2VL3 A;  3D21 A;  3F3Q A;  2FUG 2;  3AY8 A;  4LLR A;  4ICY A;  1DE2 A;  22GS A;  3KCM A;  3LFL A;  5JWQ B;  5BRT A;  3TJK A;  5ELG A;  1PN9 A;  2KUC A;  1VRS D;  4L5O A;  2CT6 A;  3FHK A;  2AAW A;  4HZ2 A;  1GRX A;  4OO4 A;  5C04 A;  2WCI A;  1WPI A;  14GS A;  1QUW A;  3I6A A;  4ECB A;  3FR6 A;  4J57 E;  3QAW A;  3KMO A;  3QAG A;  3GTU A;  3FEU A;  2QA2 A;  3IAM 2;  2AYT A;  3HD5 A;  5CNW A;  4FYB A;  2B1L A;  1A0F A;  4Q5Q A;  5J3R A;  4Z7X A;  4MJC A;  2JZS A;  2XC2 A;  3ZLP A;  2HZE A;  5AGY A;  3I69 A;  4FIW A;  1FB0 A;  3HA9 A;  1VF1 A;  3IK7 A;  2VCX A;  5ECO B;  1XOB A;  4GWR A;  2HXK A;  2C0D A;  4MH2 A;  4RI7 A;  4OMV A;  2H71 A;  1K0O A;  4PXO A;  2VAF A;  1B9X C;  1Z7P A;  1K0C A;  1XW9 A;  1SU9 A;  2F8F A;  2GDR A;  7GSS A;  1T3B A;  2FWF A;  3UMA A;  1GSQ A;  1XVW A;  2LJK A;  1E6B A;  2RUF A;  3WGD A;  3MDK A;  1WE0 A;  2FD3 A;  1NHY A;  2P5R A;  1KTE A;  3A2W A;  4OFT A;  1X5C A;  2LNS A;  3ZTL A;  3TKS E;  2R5G A;  4EL1 A;  3UL3 A;  2A2S A;  18GS A;  3VPQ A;  4MJB A;  3EPT A;  1BQ7 A;  1X5E A;  2JAD A;  2HZF A;  1GLP A;  4KSM A;  2H0G A;  2I1U A;  2RII A;  1O6J A;  3HXS A;  5GZZ B;  4HSC X;  4XCS A;  1V57 A;  2CA8 A;  2R0G A;  1FOV A;  4ACS A;  4D73 B;  1IYH A;  2OE0 A;  1R7H A;  1DBY A;  4IS0 A;  1AQX A;  3C1S A;  4F9Z A;  2GSS A;  5A4V A;  3BCI A;  1GUH A;  5D93 A;  3ZIJ A;  3F4R A;  4HJ2 A;  2VM1 A;  2CV4 A;  2B1K A;  4LL4 B;  4PUA A;  4ZL8 A;  3VK9 A;  5ECI B;  3Q74 A;  1TU7 A;  5G5E A;  5IMZ A;  3UAP A;  2TRX A;  1HD2 A;  1GNW A;  2TIR A;  2H1D A;  3HZ8 A;  4G9H A;  3WT2 A;  3WT1 A;  5H5Q A;  4MAB A;  4KGI A;  4G0K A;  4GRF A;  3BBY A;  2E2G A;  1EEJ A;  3R3E A;  4O32 A;  3ME8 A;  2H0H A;  2C1Y A;  1I5G A;  2VCV A;  3WGE A;  2X64 A;  3F0I A;  3IHG A;  3UVH A;  2F51 A;  1M2B A;  1PL1 A;  19GS A;  2NBS A;  1ABA A;  2PN8 A;  3ZVJ D;  4HUA A;  1ZGN A;  2H1B A;  4L0U A;  4XIH A;  5DCH A;  1VF3 A;  4E8E A;  4YKF A;  2HRK A;  3BCK A;  3O76 A;  1KEB A;  4K7N A;  3GHA A;  1W4V A;  3P8W A;  2CAQ A;  5DQY A;  2H6Z A;  2UZ8 A;  3I43 A;  3CTG A;  3HKR A;  3IDV A;  4N0V A;  2YWI A;  3ERF A;  3GL3 A;  3GRX A;  2H30 A;  4PUR A;  2CVB A;  1C72 A;  4IEL A;  5EPF A;  5CRE A;  3KM6 A;  2B5Y A;  4FYU A;  2ZCT A;  1QFN A;  4V2N A;  3TOT A;  2DC5 A;  2H72 A;  1Z6N A;  4MNN A;  2IIY A;  4IGJ A;  1VF2 A;  5G2Z A;  1UC7 A;  1XXU A;  2IPA A;  4FQU A;  4GQC A;  1PX7 A;  3LWA A;  4I5Q A;  3HJP A;  3FZA A;  5FWG A;  2IFQ A;  4K2X A;  2FNO A;  3TKQ A;  4EIP A;  5DJM A;  4PUF C;  4PQH A;  5D9V A;  2E0Q A;  5GAN D;  4G0I A;  3SBC A;  5D8I A;  2X8G A;  3TOU A;  1AIU A;  2GZP A;  1I9D A;  1O81 A;  1TTZ A;  1O8W A;  1FW1 A;  2NTO A;  3EUR A;  1WRY A;  1SK1 A;  17GS A;  5KN2 A;  3ZYW A;  2F8A A;  2H75 A;  3VWV A;  5EVO A;  4IN0 A;  4NHZ A;  4ZIJ A;  1B4Q A;  2GZY A;  2YNX A;  3IK9 A;  3L9V A;  1O7U A;  2K8S A;  3P2A A;  1EP8 A;  3IV4 A;  4OCF A;  2H70 A;  1Y6E A;  2OBK A;  1DSB A;  4PX1 A;  3TKS A;  3FZ4 A;  4TKY A;  2DJ2 A;  1HYU A;  3EMX A;  1R5P A;  2L4Q A;  1AQW A;  4G2E A;  1EOG A;  1X9S B;  3PGT A;  1EEM A;  3L0H A;  4O5R A;  1TK0 B;  4Q5N A;  1GSD A;  2AB6 A;  3EYT A;  3GKM A;  2DBC A;  1J08 A;  3IC4 A;  1XPV A;  3M9J A;  3F9U A;  1ZCP A;  2PPT A;  5ECQ B;  5JWR B;  3KMN A;  3E9J B;  1TP9 A;  2GQL A;  3UAR A;  2ZUP A;  1PGT A;  2WFC A;  1MD4 A;  4I6X A;  3H8Q A;  5DAK B;  4HS1 A;  1QQ2 A;  5L71 A;  1GH2 A;  5IO0 A;  2GTU A;  5B8B A;  3GKN A;  2B7J A;  1TI1 A;  2L4C A;  2AJQ B;  5D9X A;  3GNJ A;  1M0U A;  2VCZ A;  2HE3 A;  2EIR A;  4DSR A;  5B6N A;  2LEG A;  2H73 A;  2V6O A;  4KCA A;  2JAC A;  2FWG A;  4NHW A;  3TRX A;  3US3 A;  5F8B A;  2B5X A;  5F06 A;  3EWL A;  4QQ7 A;  4TR0 A;  1S3A A;  4NV2 A;  3P90 A;  1ERT A;  5ELA A;  5ECP B;  2O7K A;  1XWG A;  6GSU A;  3PH9 A;  2KOK A;  3H4K A;  4KAE A;  3EU4 A;  1G6Y A;  1NHO A;  4CW9 A;  4NPB A;  3EIN A;  1U3I A;  2A2R A;  4XRD A;  3MAK A;  5B7C A;  3TJJ A;  3LOR A;  4MZW A;  1A2M A;  3IR4 A;  5HR3 A;  13GS A;  4K8M A;  4CY6 A;  5KN0 A;  2JZR A;  3ERW A;  4Z2T A;  1AW9 A;  4L5L A;  1THO A;  3W6G A;  4ZBD A;  1KNG A;  1EOH A;  1LU4 A;  3ERG A;  1MD3 A;  4N30 A;  2HZE B;  3MSZ A;  2FLS A;  2WS2 A;  1TK8 B;  4KH7 A;  2FCH A;  2GZZ A;  4RQR A;  4PNF A;  1XWK A;  4P3Y B;  4WR4 A;  2V2G A;  4RUV A;  4IP1 A;  4I2U A;  8GSS A;  1NM3 A;  2AV4 A;  2O89 A;  4N10 A;  2V6K A;  1CQH A;  4TXV A;  3CSJ A;  4ISD A;  4XS6 A;  3CRU A;  2YPM A;  1FB6 A;  4K9Z A;  4LL1 B;  3CSH A;  1V40 A;  3LXZ A;  4K6X A;  3GST A;  4Q5F A;  1XIY A;  2B3S A;  5G31 A;  2YAN A;  2VL2 A;  1ZMA A;  2IMF A;  3U6V A;  1ZYN A;  2QSI A;  3R2Q A;  1SYX A;  3FZ9 A;  4J56 E;  4TOP A;  3D5J A;  1V58 A;  2DSA A;  4IBP A;  5ABR A;  1AAZ A;  1JHB A;  4XTS A;  4A5P A;  4GLT A;  3VWW A;  1EWX A;  3M1G A;  2PVQ A;  5DAK A;  2B5E A;  1PFO A;  3L9S A;  4ML6 A;  5FHI A;  1ZYP A;  2R3X A;  4YAV A;  2RUE A;  2XHF A;  1OYJ A;  4HEA 2;  3TCO A;  2VL9 A;  3H1N A;  5H5R A;  2DLX A;  2QGV A;  4KUN A;  3M3M A;  3GKK A;  3IBH A;  2KLX A;  2YP6 A;  1O85 A;  3F4T A;  1TRS A;  2L5L A;  1RW1 A;  2LS5 A;  4WET A;  1A0R P;  1OVN A;  2AHE A;  3Q19 A;  5IMC A;  2O8V B;  1A2L A;  1HNA A;  2M80 A;  5B8A A;  1PRX A;  4GF0 A;  3C1R A;  2PGT A;  1OKD A;  3VI5 A;  3F6D A;  1K0N A;  4FH8 A;  5CP1 A;  4OCE A;  2YV7 A;  2Z9S A;  1Z5Y E;  5IO2 A;  4V1A p;  2HRF A;  5D9W A;  2YWN A;  1E2Y A;  1JZW A;  4EKZ A;  1GSE A;  2B7K A;  1YF0 A;  20GS A;  1PL2 A;  4ZL7 A;  5CRD A;  3IHQ A;  4WXT A;  1OAZ A;  3RBT A;  3GN3 A;  1URM A;  4NXI A;  2WZ9 A;  3FMW A;  4MPG A;  4ZXG A;  1T1V A;  4IJI A;  3KTL A;  2DKI A;  4RI6 A;  3PIN A;  1BYE A;  4IP6 A;  1FVK A;  3M9K A;  1GSY A;  4BVX A;  1BX9 A;  4USS A;  2BJX A;  3L9U A;  3CMI A;  1S3D A;  2R37 A;  6GSW A;  1CQG A;  2K9F A;  2PUK C;  3IPZ A;  3RPN A;  1HQO A;  2R0P A;  1K0B A;  3A2V A;  4MDC A;  3F6F A;  2LQQ A;  5KEJ A;  5ENU A;  3FY7 A;  4MLY A;  2HI7 A;  3L78 A;  4L8E A;  3L4N A;  3WD6 A;  11GS A;  1Z3E A;  2PBJ A;  4DEJ A;  2ZNM A;  2IFQ B;  2CQ9 A;  3DD3 A;  3HZ4 A;  2A4H A;  3J7Y b;  2A4V A;  2I9H A;  1H4O A;  2HT9 A;  2YN1 A;  4NV5 A;  3OR5 A;  1GSF A;  3D22 A;  1QK8 A;  1HNB A;  5ECL B;  3TJG A;  1JLW A;  1PSQ A;  1B4P A;  1V2A A;  4TVE A;  4FO5 A;  4MMM A;  5IMA A;  2H6X A;  3BJ5 A;  2IN3 A;  4HU7 A;  2TRC P;  1X9W B;  4KDY A;  1GTI A;  3VI7 A;  3O6T A;  3ZFB A;  4G10 A;  3GX0 A;  3RPP A;  4O92 A;  4F03 A;  1OC3 A;  6GSV A;  5HR0 A;  2C0F A;  3ZIV A;  3MWH A;  1WOU A;  2RLI A;  5IMV A;  5IMD A;  1UVZ A;  4DSQ A;  3TJB A;  2HRA A;  4MF6 A;  2HLS A;  1ZYE A;  5GST A;  3DXB A;  1ILO A;  1F9M A;  2L5O A;  4BVY B;  2EC4 A;  5C00 A;  3JCM L;  5E4W A;  3LJR A;  5ECN B;  5G1L A;  2JU5 A;  3J7Y k;  4V2M A;  1ZZY A;  2V32 A;  5GAP D;  2HYX A;  3A3T A;  3FR9 A;  5IQY A;  2FY6 A;  1SJ6 A;  4QL7 A;  2MBS A;  1GTB A;  2N5F A;  1U6T A;  4HQZ A;  2XBQ A;  3GA4 A;  1SD8 A;  2DKH A;  5J4U A;  1DUG A;  2MMZ A;  3QOU A;  4ZB8 A;  3FKF A;  3SWL A;  1TDI A;  1F6M C;  3I9V 2;  3FZ5 A;  3IE3 A;  3RHB A;  4MCU A;  2C4J A;  2CVD A;  2HSH A;  1SEN A;  4BPY A;  5HR1 A;  1X5D A;  4HDE A;  2LRN A;  3EU3 A;  4TW5 A;  2OJL A;  4KND A;  1G7O A;  1MDJ A;  4ZB6 A;  3WGX A;  3GH9 A;  4GTU A;  4E8H A;  4JED A;  2K8V A;  1EV9 A;  2VUP A;  4LMW A;  4ID0 A;  1F3B A;  4F0C A;  4BWS A;  4ECC A;  5KOX A;  5DCG A;  4KCE A;  2JSZ A;  4Q5R A;  4K5S A;  4KA0 A;  4WKW A;  3KIJ A;  1PN0 A;  4EVM A;  1SL2 B;  3LEF A;  1XOA A;  1MTC A;  4XRA A;  2OAD A;  2C8U A;  2VLT A;  4HOJ A;  1K0A A;  1YEX A;  3KXO A;  4MPF A;  3ISO A;  3UJ1 A;  2FHE A;  6GSX A;  3N9J A;  3GSS A;  1MDK A;  3TRP A;  1GSU A;  3C7M A;  3KP9 A;  4ECI A;  1SL1 B;  1WMJ A;  2IJY A;  1U3A A;  4BVY A;  5G5F A;  2H19 A;  3HVX A;  1R26 A;  4YQM A;  4BL7 B;  4IW9 A;  3H93 A;  3ZML A;  3FYG A;  4X1U A;  3G7I A;  4EC0 A;  3KH7 A;  1ZOF A;  2C80 A;  1U87 A;  3VUR A;  2VLU A;  3ZMK A;  1ERV A;  5ECK B;  3TKR A;  2LQO A;  3GYK A;  5AIX A;  3KP8 A;  1G6W A;  5IM9 A;  4G0L A;  1TJD A;  1TI3 A;  1YJ6 A;  5J9C A;  3VFI A;  4DSS A;  4O5Q A;  1EGR A;  3HJO A;  6GST A;  4AF2 A;  2CZ3 A;  1GTU A;  3DGQ A;  4CDO A;  4AGS A;  3APS A;  3DVX A;  3HCZ A;  1LJR A;  1GWC A;  1K3O A;  4K1F A;  1XW6 A;  4EXJ A;  3FR3 A;  4QL9 A;  5LD0 A;  1QGV A;  1MDI A;  2OE3 A;  3E0U A;  3Q18 A;  1PKZ A;  3O3T A;  4F82 A;  3HVN A;  2FWE A;  3KH9 A;  3QD9 A;  5ID2 B;  4N0Z A;  1XWC A;  5AIS A;  1R4W A;  2OA7 A;  2WGR A;  4IVF A;  3D6I A;  2IMD A;  2ES7 A;  2LV3 A;  4ZB9 A;  4ZBB A;  1O73 A;  1XG8 A;  1RK4 A;  2M72 A;  5G1K A;  4PQI A;  3CRT A;  5CRH A;  3WYW A;  1ERW A;  2WB9 A;  3DYR A;  1SK2 A;  1O8X A;  2LJA A;  3ZIT A;  2JZT A;  2CZ2 A;  1V9W A;  2OE1 A;  3LYP A;  3QFB C;  4KDU A;  3MYD A;  5G30 A;  5DVB A;  2R0C A;  1SKS B;  4PGT A;  2R2J A;  5J41 A;  1SJZ A;  1PD2 1;  5KOW A;  4TXO A;  3LG6 A;  2HRN A;  10GS A;  2LNT A;  2HNL A;  1VGL A;  5AN1 A;  3NOF A;  2V1M A;  2MMO A;  4Z2R A;  2C3T A;  1GUM A;  2XBI A;  5IIZ A;  2H0I A;  4BIK A;  2H6Y A;  1A23 A;  2GT5 A;  3C8E A;  2GSQ A;  1M3J A;  1ON4 A;  5EY6 A;  2X49 A;  4KW6 A;  3GUR A;  1JZD A;  2YJH A;  2FGX A;  3HVV A;  3NZN A;  4OO5 A;  1FHE A;  3G7J A;  5F0G A;  1SJI A;  4I97 A;  1TK5 B;  2HFD A;  5B6M A;  3H79 A;  1FO5 A;  4BVX B;  5KN1 A;  4BL7 A;  4HI7 A;  1BJX A;  1FOH A;  2PMT A;  3IXR A;  4GSN A;  4JRR A;  2DJ1 A;  2GGT A;  2OAC A;  5DAL B;  1K0M A;  4MZB A;  3TGZ A;  4YKG A;  4OFN A;  2DJ0 A;  1FVJ A;  3C71 A;  2P31 A;  4EE0 A;  4TRX A;  1QMV A;  4GST A;  1ZYQ B;  3DWV A;  3GFK A;  4BWQ A;  2L6C A;  4RQX A;  5H5S A;  3UBL A;  4WBR D;  3KEB A;  3HHV A;  4DVC A;  1OC9 A;  3QCP A;  2B6M A;  1V98 A;  1SD9 A;  2REM A;  5IPG A;  3IOS A;  1T4Y A;  3CSI A;  4ILF A;  2PER A;  5ID2 A;  3QR6 A;  1PMT A;  3HYP A;  3BOA A;  2J23 A;  1SKW B;  2VCQ A;  1USB A;  4ZL9 A;  5IOW A;  1OKT A;  1JZO A;  1ST9 A;  4MH3 A;  2K18 A;  5CRW A;  4WR5 A;  4EDY A;  4XS4 B;  2DIY A;  2MZC A;  9GSS A;  4YQV A;  2AUV A;  2WDU A;  3A5I A;  3RDW A;  1H75 A;  3GL5 A;  2CX3 A;  1EV4 A;  4K0N A;  3CTF A;  3IRA A;  2IWT A;  4MP4 A;  4IQA A;  4Z2U A;  1SYR A;  1OE8 A;  3IC8 A;  4GQF A;  4ZBA A;  1KBN A;  3TKP A;  4K7I A;  2K6V A;  2YZU A;  1YQ1 A;  4GSS A;  3KTB A;  1WP0 A;  2ON5 A;  2H76 A;  2NVL A;  2NPB A;  2JSY A;  2DJJ A;  4KSO A;  4WF4 A;  3EMP A;  4O5U A;  3LXT A;  2GS3 A;  4GCI A;  1YKC A;  4H86 A;  3FRC A;  4EF0 A;  2VD1 A;  5HR2 A;  2L6D A; 
#chains in the Genus database with same CATH homology
 4POL A;  2I81 A;  4YQU A;  2YWM A;  4PNG A;  4HQS A;  3CBU A;  3VWU A;  3GKX A;  2KHP A;  4POB A;  1R5A A;  3KD0 A;  2H1G A;  5ECM B;  3RAZ A;  2H01 A;  2F3M A;  3DML A;  4TR1 B;  2IMK A;  4FYC A;  4L0W A;  5DAL A;  1TRU A;  1Z9H A;  1LBK A;  1M9A A;  4F2I A;  3CYN A;  4OWY A;  2KP1 A;  1SKR B;  3K8N A;  2GST A;  4IJ3 A;  2L59 A;  1NSW A;  4K7O A;  1PA3 A;  2CX4 A;  3HDC A;  3TDG A;  4K5R A;  3D4M A;  4XS1 A;  1M99 A;  5FT3 A;  2MBT A;  2GLR A;  3D0Z A;  1FG4 A;  2JL4 A;  5IOX A;  2LKU A;  1GL8 A;  2O87 A;  3A2X A;  3F63 A;  4WBJ A;  2VL2 C;  2RM5 A;  2VOC A;  4XS4 A;  1A24 A;  2CAI A;  5CRG A;  3ZVJ A;  1A8Y A;  2A2P A;  4IQ1 A;  3GV1 A;  3DVW A;  1ML6 A;  4I2T A;  4EUY A;  4X0X A;  4EDZ A;  1EZK A;  3TB2 A;  5HFG A;  3FW2 A;  3ZL5 A;  3EC3 A;  5CYY A;  1FAA A;  4J2F A;  3G9B A;  1SL0 B;  4CY8 A;  1TRV A;  4JE1 A;  4KF9 A;  5JCW A;  5DQS A;  3MIX A;  2LRC A;  2IL3 A;  1B8X A;  4X43 A;  12GS A;  2HSM A;  3ME7 A;  4WEY A;  2M46 A;  4MZC A;  1YKA A;  1BG5 A;  4EIQ A;  5IMF A;  4POK A;  1SK0 A;  2QC7 A;  1HNC A;  2EIO A;  2PWJ A;  4PQ1 A;  5LNK e;  1XWB A;  3RHC A;  3W8S A;  1GNE A;  4HJM A;  2ALB A;  1TRW A;  3UOM A;  1GTA A;  1BED A;  5IPH A;  2N5B A;  3QPM A;  1EP7 A;  2YJ7 A;  4ECJ A;  3EE2 A;  2X99 A;  1AQV A;  2LJR A;  1TKD B;  4GXZ A;  4DSS B;  5D73 A;  3IA1 A;  3LGC A;  4F0B A;  2BTO T;  5GSS A;  1X9M B;  4K2D A;  1WJK A;  4WF5 A;  2G0F A;  1JZR A;  4TR1 A;  5D9T A;  2FWH A;  2DIZ A;  3TUE A;  1J9B A;  1M2A A;  4HU9 A;  2R4V A;  3FK8 A;  3TJF A;  3M8N A;  6GSY A;  3ZFL A;  1GLQ A;  3TRQ A;  5HFI A;  2E2M A;  1GUK A;  3S9F A;  2WJU A;  1ZL9 A;  2J9H A;  5AIV A;  1A8L A;  4IKH A;  1F37 A;  2X4A A;  3C73 A;  2H74 A;  1YEP A;  3KZQ A;  1T7P B;  1X0R A;  2RM6 A;  2HSY A;  1JLV A;  2I3Y A;  4D73 A;  4TXO B;  1M2D A;  5A4W A;  2XPE A;  1XZO A;  5COH A;  3W8J A;  3VPT A;  2VD0 A;  3HJM A;  2X8H A;  4AJ8 A;  4I8B A;  2H1A A;  5ECR B;  4BA7 A;  1K0D A;  3EVI A;  1T4Z A;  5CAX A;  3BD2 A;  1T8E B;  2YWO A;  1TOF A;  1DE1 A;  1M7T A;  5JWO B;  1OC8 A;  2YOI A;  2C3Q A;  2VLV A;  2X8C A;  1WWJ A;  4MJE A;  2IMI A;  1ERU A;  2CVK A;  2DJ3 A;  1VF4 A;  1B9Y C;  1J0F A;  3F4S A;  2LST A;  1WIK A;  3N5O A;  1YY7 A;  1U88 A;  2GQM A;  4XHM A;  2IME A;  4KB3 A;  3D4T A;  1Q4J A;  5LCZ A;  1NW2 A;  2C0G A;  5BMU A;  2H66 A;  1THX A;  3UIW A;  3M0F A;  2LRT A;  2NDO A;  3QAV A;  1T00 A;  1TU8 A;  4POM A;  3NIV A;  4PTS A;  2FA8 A;  3GH6 A;  4HZ4 A;  2V41 A;  2PVO C;  4AJ6 A;  1XW5 A;  3E3E A;  2VCT A;  4O7H A;  1RQM A;  1K3Y A;  4MK3 A;  2VO4 A;  2WUL A;  3GUS A;  2I4A A;  1YDK A;  1OC9 B;  2VM2 A;  1K3L A;  2WRT A;  4K0G A;  4NWY A;  4KE3 A;  2MYG A;  3QFA C;  3UEM A;  5INY A;  5DBQ A;  3ZRE A;  3KGK A;  5A5K A;  2N5A A;  4KDX A;  2LUS A;  2QKE A;  4CHS A;  1IYI A;  3MNG A;  3UBK A;  4OD7 A;  4G19 A;  1XBS A;  1XFL A;  3GIX A;  4IHU A;  2L57 A;  2LTK A;  4X4J A;  1Z6M A;  2QA1 A;  1N2A A;  3UVT A;  2VCW A;  3DRN A;  1B48 A;  4JR4 A;  1XWA A;  3PPU A;  3VWX A;  1F3A A;  2P5Q A;  2DMM A;  4KX4 A;  1AC1 A;  1XCC A;  3PR8 A;  2BMX A;  4ZIL A;  4TN8 A;  1JFU A;  5CO3 A;  4YAP A;  5HQP A;  16GS A;  4OFM A;  3QDN A;  1TXX A;  4MF5 A;  3LW9 A;  5F07 A;  3GX8 A;  1Q98 A;  4ML1 A;  5J9B A;  2PU9 C;  2KP2 A;  2G2Q A;  2C3N A;  2GQK A;  2D2Z A;  1AUC A;  4TR4 A;  4ULX A;  5EL8 A;  4V2L A;  4LMV A;  3ZZX A;  5A4U A;  4JR6 A;  1BAY A;  1Z7R A;  4LA1 A;  2EIQ A;  2R6K A;  1OE7 A;  4JU5 A;  5JCG A;  1W89 A;  1AXD A;  4JBB A;  2ON7 A;  1EGO A;  6GSS A;  2DML A;  1A2J A;  3GTU B;  3IAS 2;  4NMU A;  1UN2 A;  5J5N A;  5DDL A;  1MEK A;  2C0E A;  1S3C A;  3P7X A;  1GP1 A;  3ZRD A;  4TR3 A;  3DKS A;  4MJA A;  4EO3 A;  1XVQ A;  3LQ7 A;  2VIM A;  1TW9 A;  1N8J A;  3LSZ A;  1YF1 A;  1G0T A;  3F8U A;  5ECH B;  4JZQ A;  3F3R A;  2DJK A;  1UA5 A;  4MA9 A;  2FA4 A;  3APQ A;  5E59 A;  2YZH A;  5F05 A;  3TKS C;  4AJ7 A;  3DIE A;  2OBI A;  3HY2 A;  5KN3 A;  1ACV A;  3HVS A;  5HFK A;  2O85 A;  2GVP A;  1GSS A;  3DEX A;  2YV9 A;  1QXH A;  5D96 A;  3Q6O A;  2MMN A;  4MF7 A;  1G7E A;  3QMX A;  2H8L A;  1YZX A;  2OKA A;  5JCU A;  1GUL A;  2YCD A;  4NAX A;  1PX6 A;  3VLN A;  1F2E A;  3APO A;  3LYK A;  1Y25 A;  1PKW A;  3A5W A;  4V1A g;  5ECS A;  3KJY A;  2P0G A;  2XPD A;  3CXG A;  3GMF A;  2GSR A;  4YH2 A;  1PQN A;  2F9S A;  5DJL A;  3ED3 A;  2MMA A;  1M9B A;  3U5R E;  2GT6 A;  2E7P A;  4N11 A;  3V1W A;  3G7Y A;  2VL3 A;  3D21 A;  3F3Q A;  2FUG 2;  3AY8 A;  4LLR A;  4ICY A;  1DE2 A;  22GS A;  3KCM A;  3LFL A;  5JWQ B;  5BRT A;  3TJK A;  5ELG A;  1PN9 A;  2KUC A;  1VRS D;  4L5O A;  2CT6 A;  3FHK A;  2AAW A;  4HZ2 A;  1GRX A;  4OO4 A;  5C04 A;  2WCI A;  1WPI A;  14GS A;  1QUW A;  3I6A A;  4ECB A;  3FR6 A;  4J57 E;  3QAW A;  3KMO A;  3QAG A;  3GTU A;  3FEU A;  2QA2 A;  3IAM 2;  2AYT A;  3HD5 A;  5CNW A;  4FYB A;  2B1L A;  1A0F A;  4Q5Q A;  5J3R A;  4Z7X A;  4MJC A;  2JZS A;  2XC2 A;  3ZLP A;  2HZE A;  5AGY A;  3I69 A;  4FIW A;  1FB0 A;  3HA9 A;  1VF1 A;  3IK7 A;  2VCX A;  5ECO B;  1XOB A;  4GWR A;  2HXK A;  2C0D A;  4MH2 A;  4RI7 A;  4OMV A;  2H71 A;  1K0O A;  4PXO A;  2VAF A;  1B9X C;  1Z7P A;  1K0C A;  1XW9 A;  1SU9 A;  2F8F A;  2GDR A;  7GSS A;  1T3B A;  2FWF A;  3UMA A;  1GSQ A;  1XVW A;  2LJK A;  1E6B A;  2RUF A;  3WGD A;  3MDK A;  1WE0 A;  2FD3 A;  1NHY A;  2P5R A;  1KTE A;  3A2W A;  4OFT A;  1X5C A;  2LNS A;  3ZTL A;  3TKS E;  2R5G A;  4EL1 A;  3UL3 A;  2A2S A;  18GS A;  3VPQ A;  4MJB A;  3EPT A;  1BQ7 A;  1X5E A;  2JAD A;  2HZF A;  1GLP A;  4KSM A;  2H0G A;  2I1U A;  2RII A;  1O6J A;  3HXS A;  5GZZ B;  4XCS A;  1V57 A;  2CA8 A;  2R0G A;  1FOV A;  4ACS A;  4D73 B;  1IYH A;  2OE0 A;  1R7H A;  1DBY A;  4IS0 A;  1AQX A;  3C1S A;  4F9Z A;  2GSS A;  5A4V A;  3BCI A;  1GUH A;  5D93 A;  3ZIJ A;  3F4R A;  4HJ2 A;  2VM1 A;  2CV4 A;  2B1K A;  4LL4 B;  4PUA A;  4ZL8 A;  3VK9 A;  5ECI B;  3Q74 A;  1TU7 A;  5G5E A;  5IMZ A;  3UAP A;  2TRX A;  1HD2 A;  1GNW A;  2TIR A;  2H1D A;  3HZ8 A;  4G9H A;  3WT2 A;  3WT1 A;  5H5Q A;  4MAB A;  4KGI A;  4G0K A;  4GRF A;  3BBY A;  2E2G A;  1EEJ A;  3R3E A;  4O32 A;  3ME8 A;  2H0H A;  2C1Y A;  1I5G A;  2VCV A;  3WGE A;  2X64 A;  3F0I A;  3IHG A;  3UVH A;  2F51 A;  1M2B A;  1PL1 A;  19GS A;  2NBS A;  1ABA A;  2PN8 A;  3ZVJ D;  4HUA A;  1ZGN A;  2H1B A;  4L0U A;  4XIH A;  5DCH A;  1VF3 A;  4E8E A;  4YKF A;  2HRK A;  3BCK A;  3O76 A;  1KEB A;  4K7N A;  3GHA A;  1W4V A;  3P8W A;  2CAQ A;  5DQY A;  2H6Z A;  2UZ8 A;  3I43 A;  3CTG A;  3HKR A;  3IDV A;  4N0V A;  2YWI A;  3ERF A;  3GL3 A;  3GRX A;  2H30 A;  4PUR A;  2CVB A;  1C72 A;  4IEL A;  5EPF A;  5CRE A;  3KM6 A;  2B5Y A;  4FYU A;  2ZCT A;  1QFN A;  4V2N A;  3TOT A;  2DC5 A;  2H72 A;  1Z6N A;  4MNN A;  2IIY A;  4IGJ A;  1VF2 A;  5G2Z A;  1UC7 A;  1XXU A;  2IPA A;  4FQU A;  4GQC A;  1PX7 A;  3LWA A;  4I5Q A;  3HJP A;  3FZA A;  5FWG A;  2IFQ A;  4K2X A;  2FNO A;  3TKQ A;  4EIP A;  5DJM A;  4PUF C;  4PQH A;  5D9V A;  2E0Q A;  5GAN D;  4G0I A;  3SBC A;  5D8I A;  2X8G A;  3TOU A;  1AIU A;  2GZP A;  1I9D A;  1O81 A;  1TTZ A;  1O8W A;  1FW1 A;  2NTO A;  3EUR A;  1WRY A;  1SK1 A;  17GS A;  5KN2 A;  3ZYW A;  2F8A A;  2H75 A;  3VWV A;  5EVO A;  4IN0 A;  4NHZ A;  4ZIJ A;  1B4Q A;  2GZY A;  2YNX A;  3IK9 A;  3L9V A;  1O7U A;  2K8S A;  3P2A A;  1EP8 A;  3IV4 A;  4OCF A;  2H70 A;  1Y6E A;  2OBK A;  1DSB A;  4PX1 A;  3TKS A;  3FZ4 A;  4TKY A;  2DJ2 A;  1HYU A;  3EMX A;  1R5P A;  2L4Q A;  1AQW A;  4G2E A;  1EOG A;  1X9S B;  3PGT A;  1EEM A;  3L0H A;  4O5R A;  1TK0 B;  4Q5N A;  1GSD A;  2AB6 A;  3EYT A;  3GKM A;  2DBC A;  1J08 A;  3IC4 A;  1XPV A;  3M9J A;  3F9U A;  1ZCP A;  2PPT A;  5ECQ B;  5JWR B;  3KMN A;  3E9J B;  1TP9 A;  2GQL A;  3UAR A;  2ZUP A;  1PGT A;  2WFC A;  1MD4 A;  4I6X A;  3H8Q A;  5DAK B;  4HS1 A;  1QQ2 A;  5L71 A;  1GH2 A;  5IO0 A;  2GTU A;  5B8B A;  3GKN A;  2B7J A;  1TI1 A;  2L4C A;  2AJQ B;  5D9X A;  3GNJ A;  1M0U A;  2VCZ A;  2HE3 A;  2EIR A;  4DSR A;  5B6N A;  2LEG A;  2H73 A;  2V6O A;  4KCA A;  2JAC A;  2FWG A;  4NHW A;  3TRX A;  3US3 A;  5F8B A;  2B5X A;  5F06 A;  3EWL A;  4QQ7 A;  4TR0 A;  1S3A A;  4NV2 A;  3P90 A;  1ERT A;  5ELA A;  5ECP B;  2O7K A;  1XWG A;  6GSU A;  3PH9 A;  2KOK A;  3H4K A;  4KAE A;  3EU4 A;  1G6Y A;  1NHO A;  4CW9 A;  4NPB A;  3EIN A;  1U3I A;  2A2R A;  4XRD A;  3MAK A;  5B7C A;  3TJJ A;  3LOR A;  4MZW A;  1A2M A;  3IR4 A;  5HR3 A;  13GS A;  4K8M A;  4CY6 A;  5KN0 A;  2JZR A;  3ERW A;  4Z2T A;  1AW9 A;  4L5L A;  1THO A;  3W6G A;  4ZBD A;  1KNG A;  1EOH A;  1LU4 A;  3ERG A;  1MD3 A;  4N30 A;  2HZE B;  3MSZ A;  2FLS A;  2WS2 A;  1TK8 B;  4KH7 A;  2FCH A;  2GZZ A;  4RQR A;  4PNF A;  1XWK A;  4P3Y B;  4WR4 A;  2V2G A;  4RUV A;  4IP1 A;  4I2U A;  8GSS A;  1NM3 A;  2AV4 A;  2O89 A;  4N10 A;  2V6K A;  1CQH A;  4TXV A;  3CSJ A;  4ISD A;  4XS6 A;  3CRU A;  2YPM A;  1FB6 A;  4K9Z A;  4LL1 B;  3CSH A;  1V40 A;  3LXZ A;  4K6X A;  3GST A;  4Q5F A;  1XIY A;  2B3S A;  5G31 A;  2YAN A;  2VL2 A;  1ZMA A;  2IMF A;  3U6V A;  1ZYN A;  2QSI A;  3R2Q A;  1SYX A;  3FZ9 A;  4J56 E;  4TOP A;  3D5J A;  1V58 A;  2DSA A;  4IBP A;  5ABR A;  1AAZ A;  1JHB A;  4XTS A;  4A5P A;  4GLT A;  3VWW A;  1EWX A;  3M1G A;  2PVQ A;  5DAK A;  2B5E A;  3L9S A;  4ML6 A;  5FHI A;  1ZYP A;  2R3X A;  4YAV A;  2RUE A;  2XHF A;  1OYJ A;  4HEA 2;  3TCO A;  2VL9 A;  3H1N A;  5H5R A;  2DLX A;  2QGV A;  4KUN A;  3M3M A;  3GKK A;  3IBH A;  2KLX A;  2YP6 A;  1O85 A;  3F4T A;  1TRS A;  2L5L A;  1RW1 A;  2LS5 A;  4WET A;  1A0R P;  1OVN A;  2AHE A;  3Q19 A;  5IMC A;  2O8V B;  1A2L A;  1HNA A;  2M80 A;  5B8A A;  1PRX A;  4GF0 A;  3C1R A;  2PGT A;  1OKD A;  3VI5 A;  3F6D A;  1K0N A;  4FH8 A;  5CP1 A;  4OCE A;  2YV7 A;  2Z9S A;  1Z5Y E;  5IO2 A;  4V1A p;  2HRF A;  5D9W A;  2YWN A;  1E2Y A;  1JZW A;  4EKZ A;  1GSE A;  2B7K A;  1YF0 A;  20GS A;  1PL2 A;  4ZL7 A;  5CRD A;  3IHQ A;  4WXT A;  1OAZ A;  3RBT A;  3GN3 A;  1URM A;  4NXI A;  2WZ9 A;  3FMW A;  4MPG A;  4ZXG A;  1T1V A;  4IJI A;  3KTL A;  2DKI A;  4RI6 A;  3PIN A;  1BYE A;  4IP6 A;  1FVK A;  3M9K A;  1GSY A;  4BVX A;  1BX9 A;  4USS A;  2BJX A;  3L9U A;  3CMI A;  1S3D A;  2R37 A;  6GSW A;  1CQG A;  2K9F A;  2PUK C;  3IPZ A;  3RPN A;  1HQO A;  2R0P A;  1K0B A;  3A2V A;  4MDC A;  3F6F A;  2LQQ A;  5KEJ A;  5ENU A;  3FY7 A;  4MLY A;  2HI7 A;  3L78 A;  4L8E A;  3L4N A;  3WD6 A;  11GS A;  1Z3E A;  2PBJ A;  4DEJ A;  2ZNM A;  2IFQ B;  2CQ9 A;  3DD3 A;  3HZ4 A;  2A4H A;  3J7Y b;  2A4V A;  2I9H A;  1H4O A;  2HT9 A;  2YN1 A;  4NV5 A;  3OR5 A;  1GSF A;  3D22 A;  1QK8 A;  1HNB A;  5ECL B;  3TJG A;  1JLW A;  1PSQ A;  1B4P A;  1V2A A;  4TVE A;  4FO5 A;  4MMM A;  5IMA A;  2H6X A;  3BJ5 A;  2IN3 A;  4HU7 A;  2TRC P;  1X9W B;  4KDY A;  1GTI A;  3VI7 A;  3O6T A;  3ZFB A;  4G10 A;  3GX0 A;  3RPP A;  4O92 A;  4F03 A;  1OC3 A;  6GSV A;  5HR0 A;  2C0F A;  3ZIV A;  3MWH A;  1WOU A;  2RLI A;  5IMV A;  5IMD A;  1UVZ A;  4DSQ A;  3TJB A;  2HRA A;  4MF6 A;  2HLS A;  1ZYE A;  5GST A;  3DXB A;  1ILO A;  1F9M A;  2L5O A;  4BVY B;  2EC4 A;  5C00 A;  3JCM L;  5E4W A;  3LJR A;  5ECN B;  5G1L A;  2JU5 A;  3J7Y k;  4V2M A;  1ZZY A;  2V32 A;  5GAP D;  2HYX A;  3A3T A;  3FR9 A;  5IQY A;  2FY6 A;  1SJ6 A;  4QL7 A;  2MBS A;  1GTB A;  2N5F A;  1U6T A;  4HQZ A;  2XBQ A;  3GA4 A;  1SD8 A;  2DKH A;  5J4U A;  1DUG A;  2MMZ A;  3QOU A;  4ZB8 A;  3FKF A;  3SWL A;  1TDI A;  1F6M C;  3I9V 2;  3FZ5 A;  3IE3 A;  3RHB A;  4MCU A;  2C4J A;  2CVD A;  2HSH A;  1SEN A;  4BPY A;  5HR1 A;  1X5D A;  4HDE A;  2LRN A;  3EU3 A;  4TW5 A;  2OJL A;  4KND A;  1G7O A;  1MDJ A;  4ZB6 A;  3WGX A;  3GH9 A;  4GTU A;  4E8H A;  4JED A;  2K8V A;  1EV9 A;  2VUP A;  4LMW A;  4ID0 A;  1F3B A;  4F0C A;  4BWS A;  4ECC A;  5KOX A;  5DCG A;  4KCE A;  2JSZ A;  4Q5R A;  4K5S A;  4KA0 A;  4WKW A;  3KIJ A;  1PN0 A;  4EVM A;  1SL2 B;  3LEF A;  1XOA A;  1MTC A;  4XRA A;  2OAD A;  2C8U A;  2VLT A;  4HOJ A;  1K0A A;  1YEX A;  3KXO A;  4MPF A;  3ISO A;  3UJ1 A;  2FHE A;  6GSX A;  3N9J A;  3GSS A;  1MDK A;  3TRP A;  1GSU A;  3C7M A;  3KP9 A;  4ECI A;  1SL1 B;  1WMJ A;  2IJY A;  1U3A A;  4BVY A;  5G5F A;  2H19 A;  3HVX A;  1R26 A;  4YQM A;  4BL7 B;  4IW9 A;  3H93 A;  3ZML A;  3FYG A;  4X1U A;  3G7I A;  4EC0 A;  3KH7 A;  1ZOF A;  2C80 A;  1U87 A;  3VUR A;  2VLU A;  3ZMK A;  1ERV A;  5ECK B;  3TKR A;  2LQO A;  3GYK A;  5AIX A;  3KP8 A;  1G6W A;  5IM9 A;  4G0L A;  1TJD A;  1TI3 A;  1YJ6 A;  5J9C A;  3VFI A;  4DSS A;  4O5Q A;  1EGR A;  3HJO A;  6GST A;  4AF2 A;  2CZ3 A;  1GTU A;  3DGQ A;  4CDO A;  4AGS A;  3APS A;  3DVX A;  3HCZ A;  1LJR A;  1GWC A;  1K3O A;  4K1F A;  1XW6 A;  4EXJ A;  3FR3 A;  4QL9 A;  5LD0 A;  1QGV A;  1MDI A;  2OE3 A;  3E0U A;  3Q18 A;  1PKZ A;  3O3T A;  4F82 A;  2FWE A;  3KH9 A;  3QD9 A;  5ID2 B;  4N0Z A;  1XWC A;  5AIS A;  1R4W A;  2OA7 A;  2WGR A;  4IVF A;  3D6I A;  2IMD A;  2ES7 A;  2LV3 A;  4ZB9 A;  4ZBB A;  1O73 A;  2M72 A;  1RK4 A;  5G1K A;  4PQI A;  3CRT A;  5CRH A;  3WYW A;  1ERW A;  2WB9 A;  3DYR A;  1SK2 A;  1O8X A;  2LJA A;  3ZIT A;  2JZT A;  2CZ2 A;  1V9W A;  2OE1 A;  3LYP A;  3QFB C;  4KDU A;  3MYD A;  5G30 A;  5DVB A;  2R0C A;  1SKS B;  4PGT A;  2R2J A;  5J41 A;  1SJZ A;  1PD2 1;  5KOW A;  4TXO A;  3LG6 A;  2HRN A;  10GS A;  2LNT A;  2HNL A;  1VGL A;  5AN1 A;  3NOF A;  2V1M A;  2MMO A;  4Z2R A;  2C3T A;  1GUM A;  2XBI A;  5IIZ A;  2H0I A;  2H6Y A;  1A23 A;  2GT5 A;  3C8E A;  2GSQ A;  1ON4 A;  5EY6 A;  2X49 A;  4KW6 A;  3GUR A;  1JZD A;  2YJH A;  2FGX A;  3HVV A;  3NZN A;  4OO5 A;  1FHE A;  3G7J A;  5F0G A;  1SJI A;  4I97 A;  1TK5 B;  2HFD A;  5B6M A;  3H79 A;  1FO5 A;  4BVX B;  5KN1 A;  4BL7 A;  4HI7 A;  1BJX A;  1FOH A;  2PMT A;  3IXR A;  4GSN A;  4JRR A;  2DJ1 A;  2GGT A;  2OAC A;  5DAL B;  1K0M A;  4MZB A;  3TGZ A;  4YKG A;  4OFN A;  2DJ0 A;  1FVJ A;  3C71 A;  2P31 A;  4EE0 A;  4TRX A;  1QMV A;  4GST A;  1ZYQ B;  3DWV A;  3GFK A;  4BWQ A;  2L6C A;  4RQX A;  5H5S A;  3UBL A;  4WBR D;  3KEB A;  3HHV A;  4DVC A;  1OC9 A;  3QCP A;  2B6M A;  1V98 A;  1SD9 A;  2REM A;  5IPG A;  3IOS A;  1T4Y A;  3CSI A;  4ILF A;  2PER A;  5ID2 A;  3QR6 A;  1PMT A;  3HYP A;  3BOA A;  2J23 A;  1SKW B;  2VCQ A;  1USB A;  4ZL9 A;  5IOW A;  1OKT A;  1JZO A;  1ST9 A;  4MH3 A;  2K18 A;  5CRW A;  4WR5 A;  4EDY A;  4XS4 B;  2DIY A;  2MZC A;  9GSS A;  4YQV A;  2AUV A;  2WDU A;  3A5I A;  3RDW A;  1H75 A;  3GL5 A;  2CX3 A;  1EV4 A;  4K0N A;  3CTF A;  3IRA A;  2IWT A;  4MP4 A;  4IQA A;  4Z2U A;  1SYR A;  1OE8 A;  3IC8 A;  4GQF A;  4ZBA A;  1KBN A;  3TKP A;  4K7I A;  2K6V A;  2YZU A;  1YQ1 A;  4GSS A;  3KTB A;  1WP0 A;  2ON5 A;  2H76 A;  2NVL A;  2NPB A;  2JSY A;  2DJJ A;  4KSO A;  4WF4 A;  3EMP A;  4O5U A;  3LXT A;  2GS3 A;  4GCI A;  1YKC A;  4H86 A;  3FRC A;  4EF0 A;  2VD1 A;  5HR2 A;  2L6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...