5LNKe

Entire ovine respiratory complex i
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
84
structure length
84
Chain Sequence
LGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQEKNVSLNNFSADQVTRALENVLSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial complex I, 51 kDa subunit
publication title Atomic structure of the entire mammalian mitochondrial complex I.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 19
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2016-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
e PF05047 L51_S25_CI-B8 Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5lnke00
3QAGA 2DJ3A 4P3YB 1BQ7A 5IIZA 3GN3A 4LL4B 4EE0A 1MD4A 2HRNA 3HZ4A 2FGXA 2PWJA 1DUGA 3FZ9A 4XHMA 4IN0A 1OC9B 3HJPA 2OKAA 5ABRA 1V57A 4XRDA 1M9BA 2ALBA 3N9JA 16GSA 4F0CA 1GNEA 3CMIA 2CVBA 1TRUA 1O8WA 3HJOA 2AYTA 3VLNA 1FOVA 2L5OA 4GCIA 2LRTA 3TCOA 3LGCA 4G9HA 1MD3A 3TKSC 1XVWA 1THXA 5HFGA 3HDCA 2DJJA 4MK3A 2RM6A 2AB6A 2HXKA 3Q19A 1WJKA 5ECNB 4EXJA 2J23A 4JEDA 1N8JA 3DD3A 1UA5A 2LQQA 2VD0A 4OWYA 2X8HA 5E59A 1NSWA 4E8EA 3UBLA 4OMVA 3EVIA 1G6YA 1O7UA 1ZL9A 2KUCA 3QOUA 2HT9A 3KJYA 4EKZA 3EINA 2GQLA 1TI1A 4ZILA 4DEJA 4TR1A 1GTAA 2OADA 1O6JA 4EO3A 2I1UA 2DJ2A 4ZXGA 5FT3A 2JU5A 1ILOA 1VF2A 1OYJA 4EUYA 2PN8A 3QR6A 3RHBA 4HJ2A 2MMAA 5ECQB 1PKWA 13GSA 3GFKA 5DAKB 1SL1B 4TKYA 3VFIA 2VM1A 5C04A 2FA8A 3K8NA 1JZDA 4YH2A 1JZRA 1GUKA 3KD0A 1TRVA 5J9CA 1UVZA 2EIOA 3LWAA 5JWQB 3IBHA 1EEMA 2YN1A 4ZBBA 2TRXA 1S3AA 3LSZA 4FIWA 5KN1A 1ZCPA 2L4QA 3GX0A 1HNBA 1CQGA 2H0IA 1TI3A 4MPGA 3NZNA 22GSA 1XPVA 1GRXA 2H6YA 5IPHA 1BG5A 1GH2A 3D0ZA 4FH8A 2JZRA 2M46A 5B8AA 3RHCA 5CYYA 5B6MA 1RK4A 4WBRD 4J2FA 3U6VA 1GTBA 3UMAA 6GSUA 5HFIA 1GSSA 4K7OA 2VL9A 2N5AA 5FHIA 3A3TA 5A4UA 1GL8A 1O8XA 3ZVJD 1UN2A 3HZ8A 3TOUA 2GSQA 2H6XA 3ZZXA 1ST9A 4MLYA 4N0VA 3IAS2 5IO2A 1YDKA 1B8XA 5G5EA 4I8BA 1R26A 1YY7A 1SD9A 5B8BA 1ACVA 1Z6NA 3EU4A 1JFUA 1X9WB 4NV2A 5EY6A 2VCXA 2A2RA 4Q5FA 5D9TA 1Y6EA 4DVCA 2HI7A 1YKAA 3EURA 3ERGA 2DJKA 5DCGA 2L5LA 4JE1A 5LCZA 1U88A 4MJBA 1AW9A 3L9VA 3GKXA 1PKZA 1AQXA 5D96A 2R37A 5KN3A 3IR4A 4RI7A 2C3NA 2YJHA 4WR5A 5ID2A 3ZTLA 3TRXA 1M7TA 3BD2A 3NIVA 3QAWA 2HZEA 3GKNA 4POKA 2LRCA 3KP8A 1O85A 1T7PB 1OAZA 5ECRB 2AV4A 4K7NA 2DLXA 1GSFA 1F9MA 3D4TA 1ON4A 1GSUA 1OKDA 2GTUA 1XOAA 2R3XA 2YJ7A 5G30A 1Z7RA 3MDKA 4KH7A 1PRXA 2LUSA 3TOTA 2D2ZA 4ISDA 4Q5RA 1Z7PA 4TR4A 1Y25A 1A0RP 3ZMLA 3MAKA 3O3TA 4FYBA 4ZB8A 2VLTA 4XS4B 5J3RA 1SKRB 1ZZYA 1QXHA 2TRCP 4IBPA 2I81A 1AUCA 2WS2A 1GUMA 1FW1A 1H4OA 5H5QA 1OE7A 2P31A 3ED3A 2C0DA 3EYTA 1DE2A 1FB6A 3UOMA 3ZFLA 1X5DA 1S3CA 2DMMA 1KEBA 3L9SA 2L6DA 1JZWA 2YWMA 4BVYA 2EIRA 5F0GA 3RDWA 3GYKA 5INYA 3MWHA 4XRAA 3VI7A 1BAYA 2C3QA 2OACA 2VOCA 5D73A 1HNAA 1YZXA 4LL1B 2YANA 4O5RA 4O92A 5JWRB 5DALA 1UC7A 1QMVA 1XOBA 1SJZA 4J57E 3IC4A 5COHA 3P2AA 1YEXA 4PUAA 4F0BA 3UAPA 4K2DA 1AC1A 1M99A 1ML6A 3DEXA 5D9XA 3UIWA 4JBBA 2C8UA 5DVBA 1SYRA 2JZSA 1T3BA 1TU7A 1SD8A 6GSVA 2Z9SA 2GLRA 5LNKe 4NHZA 3F6FA 3MNGA 1A0FA 2A2SA 2DIYA 3F63A 1DBYA 4WBJA 4EDZA 5HR0A 3GIXA 5IMAA 4MH3A 1SKWB 4N11A 1A8LA 2B5XA 4KAEA 3FZ4A 4PX1A 4TW5A 5F8BA 3TJGA 1Z5YE 2BTOT 1A8YA 2JL4A 3A5WA 3F9UA 1H75A 4G10A 3BCKA 3TUEA 4BL7A 3U5RE 2H6ZA 4V1Ag 3TRPA 3E3EA 4FO5A 1PSQA 2C80A 1WOUA 3BJ5A 1GP1A 4OFNA 2FLSA 5J41A 4BA7A 19GSA 3LORA 1V98A 3SWLA 1X9SB 4K7IA 4IJIA 4RQRA 2WCIA 4QL9A 2YWNA 2WFCA 3UJ1A 4KCEA 4N0ZA 2LV3A 3O6TA 1GLPA 3L9UA 1U3IA 1W4VA 2F8FA 1M9AA 1TW9A 2GDRA 1M2BA 3VI5A 3DRNA 3DMLA 11GSA 2FHEA 18GSA 2XC2A 2O89A 2XPEA 2I9HA 1ERTA 2C0FA 3ZITA 1I5GA 1HNCA 3QCPA 1CQHA 1BEDA 4I97A 2K9FA 5G5FA 5IMDA 1XIYA 2G0FA 3FRCA 1TXXA 17GSA 2F9SA 5H5SA 3GH6A 1WWJA 3HHVA 3RPNA 5HR1A 1VGLA 1X0RA 1G6WA 1WIKA 3Q6OA 3PR8A 1HQOA 4IP1A 5IMFA 1ZMAA 4X1UA 2YP6A 2L57A 2PVOC 4ACSA 1R5AA 4HU7A 1THOA 3L4NA 5A4VA 1SL2B 1JHBA 1YJ6A 2F8AA 1AAZA 4GWRA 2JACA 4QQ7A 3H93A 2CT6A 5IM9A 2OE0A 4CDOA 3TKSA 3C71A 3EC3A 3JCML 4MJAA 1NM3A 1JZOA 2LJKA 3FHKA 2V6KA 1OC9A 2YZHA 2V2GA 1TRSA 5HQPA 3DXBA 4K0NA 1V2AA 3WGXA 4CW9A 4Q5NA 2ZUPA 2X99A 3KEBA 2H1DA 1U3AA 6GSWA 2NPBA 4F2IA 1GSQA 4K9ZA 4GXZA 5DJLA 1EZKA 4MH2A 4WR4A 2B6MA 1SJ6A 4KDUA 4X0XA 5G31A 5IOWA 3BCIA 2HSHA 1MDIA 1TTZA 3BOAA 2C4JA 3C7MA 2CX4A 2IL3A 3US3A 3W8JA 3E0UA 1VF1A 4V2MA 2O7KA 4IJ3A 2M72A 4NAXA 3IV4A 2L4CA 4ZL9A 3G9BA 4K0GA 3M3MA 1GNWA 2NDOA 2GZPA 3TRQA 1R7HA 4ILFA 5GSSA 1ABAA 1TOFA 1FB0A 2DMLA 1A24A 1XWAA 3V1WA 3C1RA 4HJMA 3Q18A 4AJ8A 3QFBC 2XBQA 4MPFA 1PL2A 3CRUA 2O87A 2IFQB 2P5RA 2VIMA 5ECHB 1TK5B 2XBIA 2N5BA 2V1MA 2IMEA 5G1LA 2GQMA 3HVXA 3GKKA 3WGDA 4HQZA 3DVXA 1SK1A 3H1NA 3QD9A 3APSA 3D5JA 1B4PA 4XS1A 2R2JA 3TKPA 3KTBA 2FWGA 2K18A 2JSZA 3MSZA 2G2QA 1GSYA 2PGTA 5CRHA 5DAKA 5EL8A 3I6AA 4D73B 3KCMA 2DSAA 3ZLPA 2LJRA 2X8GA 3G7IA 1AIUA 1F2EA 1YEPA 5F05A 4ZBDA 4PXOA 2C0GA 3FZAA 2JSYA 3CSJA 4KDYA 5EPFA 1VF3A 3CBUA 3O76A 5KEJA 5JCUA 4TOPA 1I9DA 1SL0B 4YAVA 4ECCA 5ECLB 3LQ7A 4MP4A 3F4SA 5C00A 2H66A 3CXGA 5GAND 1TK0B 3P8WA 3L78A 2H73A 2DBCA 4OFMA 4EVMA 3KXOA 4MF5A 3IXRA 2CQ9A 2AJQB 2RLIA 2L59A 5CAXA 4YQMA 3D22A 2CV4A 2KP1A 1TKDB 3ZRDA 3KZQA 3TKRA 4TR0A 3LJRA 1TDIA 3KTLA 4NMUA 2HFDA 5HR3A 1EP8A 3IRAA 4PNGA 4JZQA 4MZBA 2ZNMA 4MZWA 2PERA 2XPDA 3IOSA 3CSIA 1RQMA 1EGOA 3M0FA 1XZOA 4DSRA 3D21A 2B3SA 3TB2A 5FWGA 2H19A 3LXTA 5IMZA 3F3QA 3FKFA 3GHAA 1KBNA 2C1YA 4RUVA 1W89A 3VWVA 2CAIA 3F4TA 1SU9A 2KP2A 1EEJA 4F03A 1AXDA 1EOGA 1QQ2A 2CA8A 2PMTA 4OCEA 2VUPA 1ERVA 1EV9A 5KN2A 4QL7A 4Z7XA 3H79A 3ZL5A 2WJUA 3EE2A 2AHEA 4ZL8A 3APQA 1WRYA 1Q4JA 1F37A 3R2QA 4WXTA 4LA1A 2VCVA 4IKHA 4WETA 1K3LA 4TN8A 4ZIJA 3F3RA 3GURA 1TJDA 4ZB9A 4MCUA 5HR2A 3ZREA 3GA4A 2MMZA 2IJYA 4ZB6A 3KH7A 6GSTA 3S9FA 3LG6A 2CZ2A 5DQSA 5CREA 5ELGA 2GVPA 3F6DA 1GSEA 3IK7A 3LFLA 8GSSA 3PH9A 1BX9A 3DVWA 1SK2A 12GSA 5L71A 3FR9A 3F8UA 4L5LA 4HI7A 2H8LA 2MBTA 4OO5A 1ZOFA 2VD1A 2CVKA 4XCSA 1XCCA 3KGKA 2WRTA 3GTUA 2GSSA 1K0CA 2FWHA 5ECIB 3TJJA 5B7CA 4AJ6A 4XS4A 2LJAA 4GSNA 4RQXA 4TXVA 2IWTA 1O81A 3HVSA 3GL3A 5DCHA 2DC5A 5G1KA 2GQKA 5DALB 4HU9A 2GGTA 4ECBA 1PQNA 4MF6A 4KDXA 2WZ9A 3F4RA 1MTCA 5ECPB 2VLVA 1F3BA 4G2EA 4WEYA 2O8VB 1A2LA 4NWYA 3GV1A 4KB3A 4HS1A 3ERFA 4I5QA 4F82A 2YPMA 2MMOA 2XHFA 2PPTA 4PURA 1BYEA 4OD7A 3VURA 2YCDA 1Z9HA 2JZTA 2YZUA 5CRWA 5GAPD 1T4ZA 4MABA 3UVTA 5LD0A 4NHWA 3TJKA 3I43A 2IMDA 1G7OA 2EC4A 2MMNA 3FW2A 1K0BA 3CYNA 2J9HA 1WP0A 3ZFBA 1Q98A 1SYXA 4GQCA 3ZIJA 1OC3A 2VL2C 5ECSA 1DSBA 1PL1A 5JWOB 2C3TA 4KE3A 2QKEA 3HYPA 1C72A 2HYXA 4N10A 4BPYA 5AN1A 4IGJA 3ME7A 3BBYA 4AGSA 5AIXA 1NW2A 3IDVA 1Z3EA 1EGRA 2BJXA 1M2AA 2B5EA 3KMOA 2H0HA 5ECMB 4TXOA 2LNSA 4K8MA 2QGVA 4GLTA 2V6OA 3EWLA 5IO0A 1FHEA 2IIYA 1GLQA 2VM2A 4ZBAA 5AGYA 3L0HA 4HOJA 4POBA 4WF5A 1GUHA 4IELA 1T00A 4I2TA 4IW9A 3TKQA 4IQ1A 3NOFA 4L0UA 2X64A 3EMXA 2OE3A 4V1Ap 3GKMA 4PGTA 4E8HA 4PQIA 2HE3A 1U87A 1EP7A 2GT6A 4IS0A 3C73A 2K8VA 3HD5A 4ECIA 1K3YA 1E2YA 3ZVJA 2H70A 1J0FA 4XIHA 2H75A 2WDUA 4GSTA 4BWSA 5B6NA 3DGQA 1NHYA 2IN3A 4YAPA 3UEMA 3N5OA 5IMVA 4I2UA 2F3MA 2H71A 2RM5A 5A4WA 3RBTA 5CP1A 3ZIVA 1TRWA 4KA0A 1MDJA 4AJ7A 1IYHA 3HCZA 4OFTA 4LMVA 4DSSA 3W6GA 6GSSA 1N2AA 1ERWA 2GS3A 3WT1A 1V58A 5ELAA 4MA9A 2RUFA 3GNJA 4HUAA 1JLVA 4MF7A 5IQYA 4HZ4A 5AIVA 3WGEA 5A5KA 2B1LA 3CSHA 4NV5A 2GZYA 4J56E 4N30A 1GTUA 5D9WA 2N5FA 4LLRA 4HDEA 1GTIA 1EWXA 2FCHA 4EDYA 5H5RA 3A2XA 1M2DA 1K3OA 2B7JA 2QC7A 1S3DA 1QK8A 2FA4A 3HKRA 4BVXA 2O85A 5GSTA 1K0DA 1YKCA 1LBKA 2RIIA 4TR3A 1B48A 3VWXA 1K0NA 2V32A 2V41A 5EVOA 2FD3A 1T8EB 2R5GA 3KMNA 2QSIA 3ERWA 1YQ1A 3FYGA 4JRRA 3FK8A 2LNTA 2H72A 2OJLA 3UL3A 1K0OA 1FO5A 3TGZA 1PGTA 3EMPA 4BWQA 1TP9A 4PNFA 3TKSE 2OA7A 4MMMA 4TR1B 1F3AA 3W8SA 1X5EA 1RW1A 4PQ1A 2KLXA 4IHUA 3RAZA 2CVDA 2OBIA 2E2GA 3ZMKA 5IOXA 4MJEA 14GSA 4EL1A 1X5CA 5CNWA 5DQYA 3UVHA 4LMWA 4WF4A 5D93A 3J7Yb 1XWGA 3I69A 3A2WA 4TVEA 2EIQA 1U6TA 1K0MA 1SJIA 3H4KA 2FNOA 2MZCA 2LRNA 2A4VA 3LXZA 4KX4A 1V9WA 2AUVA 2GT5A 4ZL7A 4WKWA 3KIJA 1E6BA 4EC0A 7GSSA 2M80A 4K1FA 3KP9A 2K8SA 4KGIA 3GX8A 1HD2A 2RUEA 4ML1A 1HYUA 1SKSB 5J4UA 3H8QA 1OC8A 5CRGA 2KOKA 4MJCA 3PGTA 1JLWA 2IFQA 2E2MA 2HNLA 1OVNA 3GRXA 1PX6A 1R4WA 2H76A 3GUSA 3DIEA 3CTGA 1A23A 1G0TA 2H1BA 1F6MC 4V2NA 4F9ZA 1PMTA 3CTFA 2LEGA 4NPBA 4YQUA 4POMA 2LTKA 1QUWA 3IE3A 9GSSA 2WULA 3VWWA 2JADA 4TRXA 2FWFA 3LYPA 3IPZA 2GZZA 3SBCA 2E7PA 2X8CA 2CAQA 3M8NA 3TJBA 1XWCA 2R4VA 5CRDA 4D73A 1QGVA 2YV9A 1XWBA 3VPQA 3FEUA 5G2ZA 3ZYWA 4O32A 2VL3A 2C0EA 1XBSA 2PVQA 1XXUA 3FR3A 3UARA 3P7XA 5ECOB 4PQHA 1URMA 4K6XA 3D6IA 1BJXA 4IQAA 4HQSA 1ERUA 4PUFC 3FY7A 2H01A 4GTUA 1OE8A 2HLSA 4KNDA 3G7YA 3VK9A 4NXIA 3M9KA 1PX7A 5DDLA 3IA1A 3C8EA 4XTSA 5F07A 3GH9A 3HJMA 1VF4A 1XW9A 2HRFA 4KW6A 1GULA 4L8EA 2B5YA 2NVLA 5ID2B 2LKUA 3LEFA 1ZGNA 4L0WA 3F0IA 2HZEB 3DKSA 3FZ5A 4V2LA 2YV7A 5IPGA 6GSXA 4L5OA 3HY2A 3A2VA 1KTEA 5GZZB 2DJ0A 2VCQA 3ME8A 3WD6A 1Z6MA 2AAWA 4G19A 2YWIA 2BMXA 3HVVA 5JCGA 2I4AA 4GRFA 4FYUA 1ZYEA 2H1AA 2WB9A 1TK8B 5HFKA 2GSTA 3CRTA 1X9MB 1NHOA 5J9BA 2MBSA 3QFAC 1WE0A 1XW6A 2OE1A 1IYIA 2LS5A 1LJRA 2YWOA 2KHPA 3RPPA 2P5QA 3APOA 3Q74A 3DWVA 3QPMA 3WT2A 1GSDA 2REMA 1XW5A 2P0GA 2ZCTA 2K6VA 4MDCA 1KNGA 1A2MA 2PBJA 3J7Yk 3GTUB 1SENA 2CZ3A 2VCTA 1TU8A 3GSTA 2IMFA 2YNXA 4ULXA 1G7EA 4HEA2 3G7JA 2VCZA 2HZFA 5JCWA 3P90A 1R5PA 2H30A 3QDNA 2CX3A 3TJFA 4KSMA 1FAAA 2YOIA 4POLA 2VO4A 4ECJA 4KCAA 2F51A 2DIZA 3IAM2 5E4WA 1M0UA 3VWUA 3M1GA 2WGRA 1J9BA 2IMKA 1XFLA 3TDGA 2L6CA 1XVQA 1WMJA 3HA9A 4JR4A 5CO3A 2H0GA 5J5NA 4MZCA 3KM6A 4DSQA 1EV4A 4EF0A 1FVKA 2PUKC 3IHQA 2R6KA 2VLUA 2E0QA 4JU5A 2VCWA 2LQOA 2MYGA 3QMXA 4IVFA 1USBA 1B9YC 6GSYA 4OCFA 4GSSA 4CHSA 20GSA 3E9JB 2VL2A 5DBQA 1AQVA 2B7KA 3LYKA 1VRSD 2FY6A 2NTOA 4YQVA 3KH9A 3M9JA 5ENUA 2I3YA 2ON7A 4XS6A 1QFNA 3I9V2 3VPTA 2VAFA 2H1GA 4ML6A 5D8IA 3GL5A 5F06A 2NBSA 3GMFA 10GSA 1PD21 3C1SA 5AISA 5KN0A 1MDKA 4H86A 2HSYA 4I6XA 3QAVA 4FYCA 4IP6A 1B9XC 3PINA 1J08A 3D4MA 2OBKA 2B1KA 1PA3A 1K0AA 2ES7A 4JR6A 2DJ1A 4KUNA 3OR5A 4TXOB 3IK9A 4RI6A 1XWKA 1V40A 4HZ2A 4KSOA 3AY8A 4O7HA 1EOHA 1MEKA 1T1VA 2FUG2 4Q5QA 3FR6A 3WYWA 1PN9A 5D9VA 2IMIA 3HXSA 2H74A 1A2JA 2FWEA 1O73A 2IPAA 5IMCA 1SK0A 4GF0A 2LSTA 3ISOA 4GQFA 3EU3A 1OKTA 2ON5A 1FVJA 1YF0A 1DE1A 3DYRA 4AF2A 1WPIA 2GSRA 4OO4A 2PU9C 2TIRA 1T4YA 4ID0A 4X43A 5DJMA 1LU4A 1GWCA 1AQWA 4DSSB 1ZYQB 1YF1A 3UBKA 1FG4A 3GSSA 1B4QA 5ECKB
chains in the Genus database with same CATH superfamily
3QAGA 2DJ3A 4P3YB 1BQ7A 5IIZA 4Z2RA 3GN3A 4LL4B 4EE0A 1MD4A 2HRNA 3HZ4A 2FGXA 2PWJA 1DUGA 3FZ9A 4XHMA 4IN0A 1OC9B 3HJPA 2OKAA 5ABRA 1V57A 4XRDA 1M3IA 1M9BA 2ALBA 3N9JA 16GSA 4F0CA 1GNEA 3CMIA 2CVBA 1TRUA 1O8WA 3HJOA 2AYTA 3VLNA 1FOVA 2L5OA 4GCIA 2LRTA 3TCOA 3LGCA 4G9HA 1MD3A 3TKSC 1XVWA 1THXA 5HFGA 3HDCA 2DJJA 4MK3A 2RM6A 2AB6A 2HXKA 3Q19A 1WJKA 5ECNB 4EXJA 2J23A 4JEDA 1N8JA 3DD3A 1UA5A 2LQQA 2VD0A 4OWYA 2X8HA 5E59A 1NSWA 4E8EA 3UBLA 4K2XA 4OMVA 3EVIA 1G6YA 1O7UA 1ZL9A 2KUCA 3QOUA 2HT9A 3KJYA 4EKZA 3EINA 2GQLA 1TI1A 4ZILA 4DEJA 4TR1A 1GTAA 2OADA 1O6JA 4EO3A 2I1UA 2DJ2A 4ZXGA 5FT3A 2JU5A 1ILOA 1VF2A 1PFOA 3CQFA 1OYJA 4EUYA 2PN8A 3QR6A 3RHBA 4HJ2A 2MMAA 5ECQB 3FMWA 1PKWA 13GSA 3GFKA 5DAKB 1SL1B 4TKYA 3VFIA 2VM1A 5C04A 2FA8A 3K8NA 1JZDA 4YH2A 1JZRA 1GUKA 3KD0A 1TRVA 5J9CA 1UVZA 2EIOA 3LWAA 5JWQB 3IBHA 1EEMA 2YN1A 4ZBBA 2TRXA 1S3AA 3LSZA 4FIWA 5KN1A 1ZCPA 2L4QA 3GX0A 1HNBA 1CQGA 2H0IA 1TI3A 4MPGA 3NZNA 22GSA 1XPVA 1GRXA 2H6YA 5IPHA 1BG5A 1GH2A 3D0ZA 4FH8A 2JZRA 2M46A 5B8AA 3RHCA 4PTSA 3R3EA 5CYYA 5B6MA 1RK4A 4WBRD 4J2FA 3U6VA 1GTBA 4USSA 3UMAA 6GSUA 5HFIA 1GSSA 4K7OA 2VL9A 2N5AA 5FHIA 3A3TA 5A4UA 1GL8A 2HRAA 1O8XA 3ZVJD 1UN2A 3HZ8A 3TOUA 2GSQA 2H6XA 3ZZXA 1ST9A 5KOXA 4MLYA 4N0VA 3IAS2 5IO2A 1YDKA 1B8XA 5G5EA 4I8BA 1R26A 1YY7A 1SD9A 5B8BA 1ACVA 1Z6NA 3EU4A 1JFUA 1X9WB 4NV2A 5EY6A 2VCXA 2A2RA 4Q5FA 5D9TA 1Y6EA 4DVCA 2HI7A 5BMUA 1YKAA 3EURA 3ERGA 2DJKA 5DCGA 2L5LA 3MIXA 4JE1A 5LCZA 1U88A 4MJBA 1AW9A 3L9VA 3GKXA 1PKZA 3EPTA 1AQXA 5D96A 2R37A 5KN3A 3IR4A 4RI7A 2C3NA 2YJHA 4WR5A 5ID2A 3ZTLA 3TRXA 1M7TA 3BD2A 3NIVA 3QAWA 2HZEA 3GKNA 4POKA 2LRCA 3KP8A 1O85A 1T7PB 1OAZA 5ECRB 2AV4A 4K7NA 4CY8A 2DLXA 1GSFA 4Z2UA 1F9MA 3D4TA 1ON4A 4G0LA 1GSUA 1OKDA 2GTUA 1XOAA 2R3XA 2YJ7A 5G30A 1Z7RA 3MDKA 4KH7A 1PRXA 2LUSA 3TOTA 2D2ZA 4ISDA 4Q5RA 1Z7PA 4TR4A 1Y25A 1A0RP 3ZMLA 3MAKA 3O3TA 4FYBA 4ZB8A 2VLTA 4HSCX 4XS4B 5J3RA 1SKRB 1ZZYA 1QXHA 2TRCP 4IBPA 2I81A 1AUCA 2WS2A 1GUMA 1FW1A 1H4OA 5H5QA 1OE7A 2P31A 3ED3A 2C0DA 3EYTA 1DE2A 1FB6A 3UOMA 3ZFLA 1X5DA 1S3CA 2DMMA 1KEBA 3L9SA 2L6DA 1JZWA 2YWMA 4BVYA 2EIRA 5F0GA 3RDWA 3GYKA 5INYA 3MWHA 4XRAA 3VI7A 1BAYA 2C3QA 2OACA 2VOCA 5D73A 1HNAA 1PN0A 2X4AA 1YZXA 4LL1B 2YANA 4O5RA 4O92A 5JWRB 5DALA 1UC7A 1QMVA 1XOBA 1SJZA 4J57E 3IC4A 5COHA 3P2AA 1YEXA 4PUAA 4F0BA 3UAPA 4K2DA 1AC1A 1M99A 1ML6A 3DEXA 5D9XA 3UIWA 4JBBA 2C8UA 5DVBA 1SYRA 2JZSA 1T3BA 1TU7A 1SD8A 6GSVA 2Z9SA 2GLRA 5LNKe 4NHZA 3F6FA 3MNGA 1A0FA 2A2SA 2DIYA 3F63A 1DBYA 4WBJA 4EDZA 5HR0A 3GIXA 5IMAA 4MH3A 1SKWB 4N11A 1A8LA 2B5XA 4KAEA 3FZ4A 4PX1A 4TW5A 5F8BA 3TJGA 2QA2A 1Z5YE 2BTOT 1A8YA 2JL4A 3A5WA 3F9UA 1H75A 4G10A 3BCKA 3TUEA 4BL7A 3U5RE 2H6ZA 4V1Ag 3TRPA 3E3EA 4FO5A 1PSQA 2C80A 1WOUA 3BJ5A 1GP1A 4OFNA 2FLSA 5J41A 4BA7A 19GSA 3LORA 1V98A 3SWLA 1X9SB 4K7IA 4IJIA 4RQRA 2WCIA 4QL9A 2R0CA 2YWNA 2WFCA 3UJ1A 4KCEA 4N0ZA 2LV3A 3O6TA 1GLPA 3L9UA 1U3IA 1W4VA 2F8FA 1M9AA 2R0GA 1TW9A 2GDRA 1M2BA 3VI5A 3DRNA 3DMLA 11GSA 4K5RA 2FHEA 18GSA 2XC2A 2O89A 2XPEA 2I9HA 1ERTA 2C0FA 3ZITA 1I5GA 1HNCA 3QCPA 1CQHA 1BEDA 4I97A 2K9FA 5G5FA 5IMDA 1XIYA 2G0FA 3FRCA 1TXXA 17GSA 2F9SA 5H5SA 3GH6A 1WWJA 3HHVA 3RPNA 5HR1A 1VGLA 1X0RA 1G6WA 1WIKA 3Q6OA 3PR8A 1HQOA 4IP1A 5IMFA 1ZMAA 4X1UA 2YP6A 2L57A 2PVOC 4ACSA 1R5AA 4HU7A 1THOA 3L4NA 5A4VA 1SL2B 1JHBA 1YJ6A 2F8AA 1AAZA 4GWRA 2JACA 4QQ7A 4BVXB 3H93A 2CT6A 5IM9A 2OE0A 4CDOA 3TKSA 3C71A 3EC3A 2R0PA 3JCML 4MJAA 1NM3A 1JZOA 2LJKA 3FHKA 2V6KA 1OC9A 2YZHA 2V2GA 1TRSA 5HQPA 3DXBA 4K0NA 1V2AA 3WGXA 4CW9A 4Q5NA 2ZUPA 2X99A 3KEBA 2H1DA 1U3AA 6GSWA 2NPBA 4F2IA 1GSQA 4G0KA 4K9ZA 4GXZA 5DJLA 1EZKA 4EIQA 4MH2A 4WR4A 2B6MA 1SJ6A 4KDUA 4X0XA 5G31A 5IOWA 3BCIA 2HSHA 1MDIA 1TTZA 3BOAA 5KOWA 2C4JA 3C7MA 2CX4A 2IL3A 3US3A 3W8JA 3E0UA 1VF1A 4V2MA 2O7KA 4IJ3A 2M72A 4NAXA 3IV4A 2L4CA 4ZL9A 3G9BA 4K0GA 3M3MA 1GNWA 2NDOA 2GZPA 3TRQA 1R7HA 4ILFA 5GSSA 1ABAA 1TOFA 1FB0A 2DMLA 1A24A 1XWAA 3V1WA 3C1RA 4HJMA 3Q18A 4AJ8A 3QFBC 2XBQA 4MPFA 1PL2A 3CRUA 2A2PA 2O87A 2IFQB 2P5RA 2VIMA 3IHGA 5ECHB 1TK5B 2XBIA 4YKFA 2N5BA 2V1MA 2IMEA 5G1LA 2GQMA 3HVXA 3GKKA 3WGDA 4HQZA 3DVXA 1SK1A 3H1NA 3QD9A 3APSA 3D5JA 4YKGA 1B4PA 4XS1A 1FOHA 2R2JA 3TKPA 3KTBA 2FWGA 2K18A 2JSZA 3MSZA 2G2QA 1GSYA 2PGTA 5CRHA 5DAKA 5EL8A 3I6AA 4D73B 3KCMA 2DSAA 3ZLPA 2LJRA 2X8GA 3G7IA 1AIUA 1F2EA 1YEPA 5F05A 4ZBDA 4PXOA 2C0GA 3FZAA 2JSYA 3CSJA 4KDYA 5EPFA 1VF3A 3CBUA 3O76A 5KEJA 1XG8A 5JCUA 4TOPA 1I9DA 1SL0B 4YAVA 4ECCA 5ECLB 3LQ7A 4MP4A 3F4SA 5C00A 2H66A 3CXGA 5GAND 1TK0B 3P8WA 3L78A 2H73A 2DBCA 4OFMA 4EVMA 3KXOA 4MF5A 3IXRA 2CQ9A 2AJQB 2RLIA 2L59A 5CAXA 4YQMA 3D22A 2CV4A 2KP1A 1TKDB 3ZRDA 3KZQA 3TKRA 4TR0A 3LJRA 1TDIA 3KTLA 4NMUA 2HFDA 4A5PA 5HR3A 1EP8A 3IRAA 4PNGA 4JZQA 4MZBA 2ZNMA 4MZWA 2PERA 2XPDA 3IOSA 3CSIA 1RQMA 1EGOA 3M0FA 1XZOA 4DSRA 3D21A 2B3SA 3TB2A 5FWGA 2H19A 3LXTA 5IMZA 3F3QA 3FKFA 3GHAA 1KBNA 2C1YA 4RUVA 1W89A 3VWVA 5BRTA 2CAIA 3F4TA 1SU9A 2KP2A 1EEJA 4F03A 1AXDA 1EOGA 1QQ2A 2CA8A 2PMTA 4OCEA 2VUPA 1ERVA 1EV9A 5KN2A 4QL7A 4Z7XA 3H79A 3ZL5A 2WJUA 3EE2A 2AHEA 4ZL8A 3APQA 1WRYA 1Q4JA 1F37A 3R2QA 4WXTA 4LA1A 2VCVA 4IKHA 4WETA 1K3LA 4TN8A 4ZIJA 3F3RA 3GURA 1TJDA 4ZB9A 4MCUA 5HR2A 3ZREA 3GA4A 2MMZA 2IJYA 4ZB6A 3KH7A 6GSTA 3S9FA 3LG6A 2CZ2A 5DQSA 5CREA 5ELGA 2GVPA 3F6DA 1GSEA 3IK7A 3LFLA 8GSSA 3PH9A 1BX9A 3DVWA 1SK2A 12GSA 5L71A 3FR9A 3F8UA 4L5LA 4HI7A 2H8LA 2MBTA 4OO5A 1ZOFA 2VD1A 2CVKA 4XCSA 1XCCA 3KGKA 2WRTA 3GTUA 2GSSA 1K0CA 2FWHA 5ECIB 3TJJA 5B7CA 4AJ6A 4XS4A 4BVYB 2LJAA 4GSNA 4RQXA 4TXVA 2IWTA 3IC8A 1O81A 3HVSA 4X4JA 3GL3A 5DCHA 2DC5A 5G1KA 2GQKA 5DALB 4HU9A 2GGTA 4ECBA 1PQNA 4MF6A 4KDXA 2WZ9A 3F4RA 1MTCA 5ECPB 2VLVA 1F3BA 4G2EA 4WEYA 2O8VB 1A2LA 4NWYA 3GV1A 4KB3A 4HS1A 3ERFA 4I5QA 4F82A 2YPMA 2MMOA 2XHFA 2PPTA 4PURA 1BYEA 4OD7A 3VURA 2YCDA 1Z9HA 2JZTA 2YZUA 5CRWA 5GAPD 1T4ZA 4MABA 3UVTA 5LD0A 4NHWA 3TJKA 3I43A 2IMDA 4FQUA 1G7OA 2EC4A 2MMNA 3FW2A 1K0BA 1ZYPA 3CYNA 2J9HA 1WP0A 3ZFBA 1Q98A 1SYXA 4GQCA 3ZIJA 1OC3A 2VL2C 5ECSA 1DSBA 1PL1A 5JWOB 2C3TA 4KE3A 2QKEA 3HYPA 1C72A 2HYXA 4N10A 4BPYA 5AN1A 4IGJA 3ME7A 3BBYA 4AGSA 5AIXA 1NW2A 3IDVA 1Z3EA 1EGRA 2BJXA 1M2AA 2B5EA 3KMOA 2H0HA 5ECMB 4TXOA 2LNSA 4K8MA 2QGVA 4GLTA 2V6OA 3EWLA 4K5SA 5IO0A 1FHEA 2IIYA 1GLQA 2VM2A 4ZBAA 5AGYA 3L0HA 4HOJA 4POBA 4WF5A 1GUHA 4IELA 1T00A 4IW9A 4I2TA 3TKQA 2X49A 4IQ1A 3NOFA 4L0UA 2X64A 3EMXA 2OE3A 4V1Ap 3GKMA 4PGTA 4E8HA 4PQIA 2HE3A 1U87A 1EP7A 2A4HA 2GT6A 4IS0A 3C73A 2K8VA 4CY6A 3HD5A 1S3RA 3MYDA 4ECIA 1K3YA 1E2YA 3ZVJA 2H70A 1J0FA 4XIHA 2H75A 2WDUA 4GSTA 4BWSA 5B6NA 3DGQA 1NHYA 2IN3A 4YAPA 3UEMA 3N5OA 5IMVA 4I2UA 2F3MA 2H71A 2RM5A 5A4WA 3RBTA 5CP1A 3ZIVA 1TRWA 4KA0A 1MDJA 4AJ7A 1IYHA 3HCZA 4OFTA 4LMVA 4DSSA 3W6GA 6GSSA 1N2AA 1ERWA 2GS3A 3WT1A 1V58A 5ELAA 4MA9A 2RUFA 3GNJA 4HUAA 1JLVA 4MF7A 5IQYA 4HZ4A 5AIVA 3WGEA 5A5KA 2B1LA 3CSHA 4NV5A 2GZYA 4J56E 4N30A 1GTUA 2N5FA 5D9WA 4LLRA 4HDEA 1GTIA 1EWXA 2FCHA 4EDYA 5H5RA 3A2XA 1M2DA 1K3OA 2B7JA 1ZYNA 2QC7A 1S3DA 1QK8A 2FA4A 3HKRA 4BVXA 2O85A 5GSTA 1K0DA 1YKCA 1LBKA 2RIIA 4TR3A 1B48A 3VWXA 1K0NA 2V32A 2V41A 5EVOA 2FD3A 1T8EB 2R5GA 3KMNA 2QSIA 3ERWA 1YQ1A 3FYGA 4JRRA 3FK8A 2LNTA 2H72A 2OJLA 3UL3A 1K0OA 1FO5A 3TGZA 1PGTA 3EMPA 4BWQA 1TP9A 4PNFA 3TKSE 2OA7A 4MMMA 4TR1B 1F3AA 3W8SA 1X5EA 1RW1A 4PQ1A 2KLXA 4IHUA 3RAZA 2CVDA 2OBIA 2E2GA 3ZMKA 5IOXA 4MJEA 14GSA 4EL1A 1X5CA 5CNWA 5DQYA 3UVHA 4LMWA 4WF4A 5D93A 4BIKA 3J7Yb 1XWGA 3I69A 3A2WA 4TVEA 2EIQA 1U6TA 1K0MA 1SJIA 3H4KA 2FNOA 2MZCA 2LRNA 2A4VA 3LXZA 4KX4A 1V9WA 2AUVA 2GT5A 4ZL7A 4WKWA 3KIJA 1E6BA 4EC0A 2QA1A 7GSSA 2M80A 4K1FA 3KP9A 2K8SA 4KGIA 3GX8A 2HRKA 1HD2A 2RUEA 4ML1A 1HYUA 1SKSB 5J4UA 3H8QA 1OC8A 5CRGA 2KOKA 4MJCA 3PGTA 1JLWA 2IFQA 2E2MA 2HNLA 1OVNA 3GRXA 1PX6A 1R4WA 2H76A 3GUSA 3DIEA 3CTGA 1A23A 1G0TA 2H1BA 1F6MC 4V2NA 4F9ZA 1PMTA 3CTFA 2LEGA 4NPBA 4YQUA 4POMA 2LTKA 1QUWA 3IE3A 9GSSA 2WULA 3VWWA 2JADA 4TRXA 2FWFA 3LYPA 3IPZA 2GZZA 3SBCA 2E7PA 2X8CA 2CAQA 3M8NA 3TJBA 1XWCA 2R4VA 5CRDA 4D73A 1QGVA 2YV9A 1XWBA 3VPQA 3FEUA 5G2ZA 3ZYWA 4O32A 2VL3A 2C0EA 1XBSA 2PVQA 4KF9A 1XXUA 3FR3A 3UARA 3P7XA 5ECOB 4PQHA 1URMA 4K6XA 3D6IA 1BJXA 4IQAA 4HQSA 1ERUA 4PUFC 3FY7A 2H01A 4GTUA 1OE8A 2HLSA 4KNDA 3G7YA 3VK9A 4NXIA 3M9KA 1PX7A 5DDLA 3IA1A 3C8EA 4XTSA 5F07A 3GH9A 3HJMA 1VF4A 1XW9A 2HRFA 4KW6A 1GULA 4L8EA 2B5YA 2NVLA 5ID2B 2LKUA 3LEFA 1ZGNA 4L0WA 3F0IA 2HZEB 3DKSA 3FZ5A 4V2LA 2YV7A 1M3JA 5IPGA 6GSXA 4L5OA 3HY2A 3A2VA 1KTEA 5GZZB 2DJ0A 2VCQA 3ME8A 3WD6A 1Z6MA 2AAWA 4G19A 2YWIA 2BMXA 3HVVA 5JCGA 2I4AA 4GRFA 4FYUA 1ZYEA 2H1AA 4G0IA 2WB9A 1TK8B 5HFKA 2GSTA 3CRTA 1X9MB 1NHOA 5J9BA 2MBSA 2DKIA 3QFAC 3HVNA 1WE0A 1XW6A 2OE1A 4MNNA 1IYIA 2LS5A 1LJRA 2YWOA 2KHPA 3RPPA 2P5QA 3APOA 3Q74A 3DWVA 3QPMA 3WT2A 1GSDA 2REMA 1XW5A 2P0GA 2ZCTA 2K6VA 4MDCA 1KNGA 1A2MA 2PBJA 3J7Yk 3GTUB 1SENA 2CZ3A 2VCTA 1TU8A 3GSTA 4EIPA 2IMFA 2YNXA 4ULXA 1G7EA 4HEA2 4ICYA 3G7JA 2VCZA 2HZFA 5JCWA 3P90A 1R5PA 2H30A 3QDNA 2CX3A 3TJFA 4KSMA 1FAAA 2YOIA 4POLA 2VO4A 4ECJA 4KCAA 2F51A 2DIZA 3IAM2 5E4WA 1M0UA 3A5IA 3VWUA 3M1GA 2WGRA 1J9BA 2IMKA 1XFLA 3TDGA 2L6CA 1XVQA 1WMJA 3HA9A 4JR4A 5CO3A 2H0GA 5J5NA 4MZCA 3KM6A 4DSQA 1EV4A 3LW9A 4EF0A 1FVKA 2PUKC 3IHQA 2R6KA 2VLUA 2E0QA 4JU5A 2VCWA 2LQOA 2MYGA 3QMXA 4IVFA 1USBA 1B9YC 6GSYA 4OCFA 4GSSA 4CHSA 20GSA 3E9JB 2VL2A 5DBQA 1AQVA 2B7KA 3LYKA 1VRSD 2FY6A 2NTOA 4YQVA 3KH9A 3M9JA 5ENUA 2I3YA 2ON7A 4XS6A 2DKHA 1QFNA 3I9V2 3VPTA 2VAFA 2HSMA 3PPUA 2H1GA 4ML6A 5D8IA 3GL5A 5F06A 2NBSA 3GMFA 10GSA 1PD21 3C1SA 4O5UA 5AISA 5KN0A 1MDKA 4H86A 2HSYA 4I6XA 3QAVA 4FYCA 4IP6A 1B9XC 3PINA 1J08A 3D4MA 4BL7B 2OBKA 2B1KA 1PA3A 1K0AA 2ES7A 4JR6A 2DJ1A 4KUNA 4O5QA 3OR5A 4TXOB 2UZ8A 3IK9A 4RI6A 1XWKA 1V40A 4HZ2A 4KSOA 3AY8A 4O7HA 1EOHA 1MEKA 1T1VA 2FUG2 4Q5QA 3FR6A 3WYWA 1PN9A 5D9VA 2IMIA 3HXSA 2H74A 1A2JA 2FWEA 1O73A 2IPAA 5IMCA 1SK0A 4GF0A 2LSTA 3ISOA 4GQFA 3EU3A 1OKTA 2ON5A 1FVJA 4Z2TA 1YF0A 1DE1A 3DYRA 4AF2A 1WPIA 2GSRA 4OO4A 2PU9C 2TIRA 1T4YA 4ID0A 4X43A 5DJMA 1LU4A 1GWCA 1AQWA 4DSSB 1ZYQB 1YF1A 3UBKA 1FG4A 3GSSA 1B4QA 5ECKB
chains in the Genus database with same CATH topology
3QAGA 2DJ3A 4P3YB 1BQ7A 5IIZA 4Z2RA 3GN3A 4LL4B 4EE0A 1MD4A 2HRNA 3HZ4A 2FGXA 2PWJA 1DUGA 3FZ9A 4XHMA 4IN0A 1OC9B 3HJPA 2OKAA 5ABRA 1V57A 4XRDA 1M9BA 2ALBA 3N9JA 16GSA 4F0CA 1GNEA 3CMIA 2CVBA 1TRUA 1O8WA 3HJOA 2AYTA 3VLNA 1FOVA 2L5OA 4GCIA 2LRTA 3TCOA 3LGCA 4G9HA 1MD3A 3TKSC 1XVWA 1THXA 5HFGA 3HDCA 2DJJA 4MK3A 2RM6A 2AB6A 2HXKA 3Q19A 1WJKA 5ECNB 4EXJA 2J23A 4JEDA 1N8JA 3DD3A 1UA5A 2LQQA 2VD0A 4OWYA 2X8HA 5E59A 1NSWA 4E8EA 3UBLA 4K2XA 4OMVA 3EVIA 1G6YA 1O7UA 1ZL9A 2KUCA 3QOUA 2HT9A 3KJYA 4EKZA 3EINA 2GQLA 1TI1A 4ZILA 4DEJA 4TR1A 1GTAA 2OADA 1O6JA 4EO3A 2I1UA 2DJ2A 4ZXGA 5FT3A 2JU5A 1ILOA 1VF2A 1OYJA 4EUYA 2PN8A 3QR6A 3RHBA 4HJ2A 2MMAA 5ECQB 3FMWA 1PKWA 13GSA 3GFKA 5DAKB 1SL1B 4TKYA 3VFIA 2VM1A 5C04A 2FA8A 3K8NA 1JZDA 4YH2A 1JZRA 1GUKA 3KD0A 1TRVA 5J9CA 1UVZA 2EIOA 3LWAA 5JWQB 3IBHA 1EEMA 2YN1A 4ZBBA 2TRXA 1S3AA 3LSZA 4FIWA 5KN1A 1ZCPA 2L4QA 3GX0A 1HNBA 1CQGA 2H0IA 1TI3A 4MPGA 3NZNA 22GSA 1XPVA 1GRXA 2H6YA 5IPHA 1BG5A 1GH2A 3D0ZA 4FH8A 2JZRA 2M46A 5B8AA 3RHCA 4PTSA 3R3EA 5CYYA 5B6MA 1RK4A 4WBRD 4J2FA 3U6VA 1GTBA 4USSA 3UMAA 6GSUA 5HFIA 1GSSA 4K7OA 2VL9A 2N5AA 5FHIA 3A3TA 5A4UA 1GL8A 2HRAA 1O8XA 3ZVJD 1UN2A 3HZ8A 3TOUA 2GSQA 2H6XA 3ZZXA 1ST9A 5KOXA 4MLYA 4N0VA 3IAS2 5IO2A 1YDKA 1B8XA 5G5EA 4I8BA 1R26A 1YY7A 1SD9A 5B8BA 1ACVA 1Z6NA 3EU4A 1JFUA 1X9WB 4NV2A 5EY6A 2VCXA 2A2RA 4Q5FA 5D9TA 1Y6EA 4DVCA 2HI7A 5BMUA 1YKAA 3EURA 3ERGA 2DJKA 5DCGA 2L5LA 3MIXA 4JE1A 5LCZA 1U88A 4MJBA 1AW9A 3L9VA 3GKXA 1PKZA 3EPTA 1AQXA 5D96A 2R37A 5KN3A 3IR4A 4RI7A 2C3NA 2YJHA 4WR5A 5ID2A 3ZTLA 3TRXA 1M7TA 3BD2A 3NIVA 3QAWA 2HZEA 3GKNA 4POKA 2LRCA 3KP8A 1O85A 1T7PB 1OAZA 5ECRB 2AV4A 4K7NA 4CY8A 2DLXA 1GSFA 4Z2UA 1F9MA 3D4TA 1ON4A 4G0LA 1GSUA 1OKDA 2GTUA 1XOAA 2R3XA 2YJ7A 5G30A 1Z7RA 3MDKA 4KH7A 1PRXA 2LUSA 3TOTA 2D2ZA 4ISDA 4Q5RA 1Z7PA 4TR4A 1Y25A 1A0RP 3ZMLA 3MAKA 3O3TA 4FYBA 4ZB8A 2VLTA 4XS4B 5J3RA 1SKRB 1ZZYA 1QXHA 2TRCP 4IBPA 2I81A 1AUCA 2WS2A 1GUMA 1FW1A 1H4OA 5H5QA 1OE7A 2P31A 3ED3A 2C0DA 3EYTA 1DE2A 1FB6A 3UOMA 3ZFLA 1X5DA 1S3CA 2DMMA 1KEBA 3L9SA 2L6DA 1JZWA 2YWMA 4BVYA 2EIRA 5F0GA 3RDWA 3GYKA 5INYA 3MWHA 4XRAA 3VI7A 1BAYA 2C3QA 2OACA 2VOCA 5D73A 1HNAA 1PN0A 2X4AA 1YZXA 4LL1B 2YANA 4O5RA 4O92A 5JWRB 5DALA 1UC7A 1QMVA 1XOBA 1SJZA 4J57E 3IC4A 5COHA 3P2AA 1YEXA 4PUAA 4F0BA 3UAPA 4K2DA 1AC1A 1M99A 1ML6A 3DEXA 5D9XA 3UIWA 4JBBA 2C8UA 5DVBA 1SYRA 2JZSA 1T3BA 1TU7A 1SD8A 6GSVA 2Z9SA 2GLRA 5LNKe 4NHZA 3F6FA 3MNGA 1A0FA 2A2SA 2DIYA 3F63A 1DBYA 4WBJA 4EDZA 5HR0A 3GIXA 5IMAA 4MH3A 1SKWB 4N11A 1A8LA 2B5XA 4KAEA 3FZ4A 4PX1A 4TW5A 5F8BA 3TJGA 2QA2A 1Z5YE 2BTOT 1A8YA 2JL4A 3A5WA 3F9UA 1H75A 4G10A 3BCKA 3TUEA 4BL7A 3U5RE 2H6ZA 4V1Ag 3TRPA 3E3EA 4FO5A 1PSQA 2C80A 1WOUA 3BJ5A 1GP1A 4OFNA 2FLSA 5J41A 4BA7A 19GSA 3LORA 1V98A 3SWLA 1X9SB 4K7IA 4IJIA 4RQRA 2WCIA 4QL9A 2R0CA 2YWNA 2WFCA 3UJ1A 4KCEA 4N0ZA 2LV3A 3O6TA 1GLPA 3L9UA 1U3IA 1W4VA 2F8FA 1M9AA 2R0GA 1TW9A 2GDRA 1M2BA 3VI5A 3DRNA 3DMLA 11GSA 4K5RA 2FHEA 18GSA 2XC2A 2O89A 2XPEA 2I9HA 1ERTA 2C0FA 3ZITA 1I5GA 1HNCA 3QCPA 1CQHA 1BEDA 4I97A 2K9FA 5G5FA 5IMDA 1XIYA 2G0FA 3FRCA 1TXXA 17GSA 2F9SA 5H5SA 3GH6A 1WWJA 3HHVA 3RPNA 5HR1A 1VGLA 1X0RA 1G6WA 1WIKA 3Q6OA 3PR8A 1HQOA 4IP1A 5IMFA 1ZMAA 4X1UA 2YP6A 2L57A 2PVOC 4ACSA 1R5AA 4HU7A 1THOA 3L4NA 5A4VA 1SL2B 1JHBA 1YJ6A 2F8AA 1AAZA 4GWRA 2JACA 4QQ7A 4BVXB 3H93A 2CT6A 5IM9A 2OE0A 4CDOA 3TKSA 3C71A 3EC3A 2R0PA 3JCML 4MJAA 1NM3A 1JZOA 2LJKA 3FHKA 2V6KA 1OC9A 2YZHA 2V2GA 1TRSA 5HQPA 3DXBA 4K0NA 1V2AA 3WGXA 4CW9A 4Q5NA 2ZUPA 2X99A 3KEBA 2H1DA 1U3AA 6GSWA 2NPBA 4F2IA 1GSQA 4G0KA 4K9ZA 4GXZA 5DJLA 1EZKA 4EIQA 4MH2A 4WR4A 2B6MA 1SJ6A 4KDUA 4X0XA 5G31A 5IOWA 3BCIA 2HSHA 1MDIA 1TTZA 3BOAA 5KOWA 2C4JA 3C7MA 2CX4A 2IL3A 3US3A 3W8JA 3E0UA 1VF1A 4V2MA 2O7KA 4IJ3A 2M72A 4NAXA 3IV4A 2L4CA 4ZL9A 3G9BA 4K0GA 3M3MA 1GNWA 2NDOA 2GZPA 3TRQA 1R7HA 4ILFA 5GSSA 1ABAA 1TOFA 1FB0A 2DMLA 1A24A 1XWAA 3V1WA 3C1RA 4HJMA 3Q18A 4AJ8A 3QFBC 2XBQA 4MPFA 1PL2A 3CRUA 2A2PA 2O87A 2IFQB 2P5RA 2VIMA 3IHGA 5ECHB 1TK5B 2XBIA 4YKFA 2N5BA 2V1MA 2IMEA 5G1LA 2GQMA 3HVXA 3GKKA 3WGDA 4HQZA 3DVXA 1SK1A 3H1NA 3QD9A 3APSA 3D5JA 4YKGA 1B4PA 4XS1A 1FOHA 2R2JA 3TKPA 3KTBA 2FWGA 2K18A 2JSZA 3MSZA 2G2QA 1GSYA 2PGTA 5CRHA 5DAKA 5EL8A 3I6AA 4D73B 3KCMA 2DSAA 3ZLPA 2LJRA 2X8GA 3G7IA 1AIUA 1F2EA 1YEPA 5F05A 4ZBDA 4PXOA 2C0GA 3FZAA 2JSYA 3CSJA 4KDYA 5EPFA 1VF3A 3CBUA 3O76A 5KEJA 5JCUA 4TOPA 1I9DA 1SL0B 4YAVA 4ECCA 5ECLB 3LQ7A 4MP4A 3F4SA 5C00A 2H66A 3CXGA 5GAND 1TK0B 3P8WA 3L78A 2H73A 2DBCA 4OFMA 4EVMA 3KXOA 4MF5A 3IXRA 2CQ9A 2AJQB 2RLIA 2L59A 5CAXA 4YQMA 3D22A 2CV4A 2KP1A 1TKDB 3ZRDA 3KZQA 3TKRA 4TR0A 3LJRA 1TDIA 3KTLA 4NMUA 2HFDA 4A5PA 5HR3A 1EP8A 3IRAA 4PNGA 4JZQA 4MZBA 2ZNMA 4MZWA 2PERA 2XPDA 3IOSA 3CSIA 1RQMA 1EGOA 3M0FA 1XZOA 4DSRA 3D21A 2B3SA 3TB2A 5FWGA 2H19A 3LXTA 5IMZA 3F3QA 3FKFA 3GHAA 1KBNA 2C1YA 4RUVA 1W89A 3VWVA 5BRTA 2CAIA 3F4TA 1SU9A 2KP2A 1EEJA 4F03A 1AXDA 1EOGA 1QQ2A 2CA8A 2PMTA 4OCEA 2VUPA 1ERVA 1EV9A 5KN2A 4QL7A 4Z7XA 3H79A 3ZL5A 2WJUA 3EE2A 2AHEA 4ZL8A 3APQA 1WRYA 1Q4JA 1F37A 3R2QA 4WXTA 4LA1A 2VCVA 4IKHA 4WETA 1K3LA 4TN8A 4ZIJA 3F3RA 3GURA 1TJDA 4ZB9A 4MCUA 5HR2A 3ZREA 3GA4A 2MMZA 2IJYA 4ZB6A 3KH7A 6GSTA 3S9FA 3LG6A 2CZ2A 5DQSA 5CREA 5ELGA 2GVPA 3F6DA 1GSEA 3IK7A 3LFLA 8GSSA 3PH9A 1BX9A 3DVWA 1SK2A 12GSA 5L71A 3FR9A 3F8UA 4L5LA 4HI7A 2H8LA 2MBTA 4OO5A 1ZOFA 2VD1A 2CVKA 4XCSA 1XCCA 3KGKA 2WRTA 3GTUA 2GSSA 1K0CA 2FWHA 5ECIB 3TJJA 5B7CA 4AJ6A 4XS4A 4BVYB 2LJAA 4GSNA 4RQXA 4TXVA 2IWTA 3IC8A 1O81A 3HVSA 4X4JA 3GL3A 5DCHA 2DC5A 5G1KA 2GQKA 5DALB 4HU9A 2GGTA 4ECBA 1PQNA 4MF6A 4KDXA 2WZ9A 3F4RA 1MTCA 5ECPB 2VLVA 1F3BA 4G2EA 4WEYA 2O8VB 1A2LA 4NWYA 3GV1A 4KB3A 4HS1A 3ERFA 4I5QA 4F82A 2YPMA 2MMOA 2XHFA 2PPTA 4PURA 1BYEA 4OD7A 3VURA 2YCDA 1Z9HA 2JZTA 2YZUA 5CRWA 5GAPD 1T4ZA 4MABA 3UVTA 5LD0A 4NHWA 3TJKA 3I43A 2IMDA 4FQUA 1G7OA 2EC4A 2MMNA 3FW2A 1K0BA 1ZYPA 3CYNA 2J9HA 1WP0A 3ZFBA 1Q98A 1SYXA 4GQCA 3ZIJA 1OC3A 2VL2C 5ECSA 1DSBA 1PL1A 5JWOB 2C3TA 4KE3A 2QKEA 3HYPA 1C72A 2HYXA 4N10A 4BPYA 5AN1A 4IGJA 3ME7A 3BBYA 4AGSA 5AIXA 1NW2A 3IDVA 1Z3EA 1EGRA 2BJXA 1M2AA 2B5EA 3KMOA 2H0HA 5ECMB 4TXOA 2LNSA 4K8MA 2QGVA 4GLTA 2V6OA 3EWLA 4K5SA 5IO0A 1FHEA 2IIYA 1GLQA 2VM2A 4ZBAA 5AGYA 3L0HA 4HOJA 4POBA 4WF5A 1GUHA 4IELA 1T00A 4IW9A 4I2TA 3TKQA 2X49A 4IQ1A 3NOFA 4L0UA 2X64A 3EMXA 2OE3A 4V1Ap 3GKMA 4PGTA 4E8HA 4PQIA 2HE3A 1U87A 1EP7A 2A4HA 2GT6A 4IS0A 3C73A 2K8VA 4CY6A 3HD5A 3MYDA 4ECIA 1K3YA 1E2YA 3ZVJA 2H70A 1J0FA 4XIHA 2H75A 2WDUA 4GSTA 4BWSA 5B6NA 3DGQA 1NHYA 2IN3A 4YAPA 3UEMA 3N5OA 5IMVA 4I2UA 2F3MA 2H71A 2RM5A 5A4WA 3RBTA 5CP1A 3ZIVA 1TRWA 4KA0A 1MDJA 4AJ7A 1IYHA 3HCZA 4OFTA 4LMVA 4DSSA 3W6GA 6GSSA 1N2AA 1ERWA 2GS3A 3WT1A 1V58A 5ELAA 4MA9A 2RUFA 3GNJA 4HUAA 1JLVA 4MF7A 5IQYA 4HZ4A 5AIVA 3WGEA 5A5KA 2B1LA 3CSHA 4NV5A 2GZYA 4J56E 4N30A 1GTUA 2N5FA 5D9WA 4LLRA 4HDEA 1GTIA 1EWXA 2FCHA 4EDYA 5H5RA 3A2XA 1M2DA 1K3OA 2B7JA 1ZYNA 2QC7A 1S3DA 1QK8A 2FA4A 3HKRA 4BVXA 2O85A 5GSTA 1K0DA 1YKCA 1LBKA 2RIIA 4TR3A 1B48A 3VWXA 1K0NA 2V32A 2V41A 5EVOA 2FD3A 1T8EB 2R5GA 3KMNA 2QSIA 3ERWA 1YQ1A 3FYGA 4JRRA 3FK8A 2LNTA 2H72A 2OJLA 3UL3A 1K0OA 1FO5A 3TGZA 1PGTA 3EMPA 4BWQA 1TP9A 4PNFA 3TKSE 2OA7A 4MMMA 4TR1B 1F3AA 3W8SA 1X5EA 1RW1A 4PQ1A 2KLXA 4IHUA 3RAZA 2CVDA 2OBIA 2E2GA 3ZMKA 5IOXA 4MJEA 14GSA 4EL1A 1X5CA 5CNWA 5DQYA 3UVHA 4LMWA 4WF4A 5D93A 3J7Yb 1XWGA 3I69A 3A2WA 4TVEA 2EIQA 1U6TA 1K0MA 1SJIA 3H4KA 2FNOA 2MZCA 2LRNA 2A4VA 3LXZA 4KX4A 1V9WA 2AUVA 2GT5A 4ZL7A 4WKWA 3KIJA 1E6BA 4EC0A 2QA1A 7GSSA 2M80A 4K1FA 3KP9A 2K8SA 4KGIA 3GX8A 2HRKA 1HD2A 2RUEA 4ML1A 1HYUA 1SKSB 5J4UA 3H8QA 1OC8A 5CRGA 2KOKA 4MJCA 3PGTA 1JLWA 2IFQA 2E2MA 2HNLA 1OVNA 3GRXA 1PX6A 1R4WA 2H76A 3GUSA 3DIEA 3CTGA 1A23A 1G0TA 2H1BA 1F6MC 4V2NA 4F9ZA 1PMTA 3CTFA 2LEGA 4NPBA 4YQUA 4POMA 2LTKA 1QUWA 3IE3A 9GSSA 2WULA 3VWWA 2JADA 4TRXA 2FWFA 3LYPA 3IPZA 2GZZA 3SBCA 2E7PA 2X8CA 2CAQA 3M8NA 3TJBA 1XWCA 2R4VA 5CRDA 4D73A 1QGVA 2YV9A 1XWBA 3VPQA 3FEUA 5G2ZA 3ZYWA 4O32A 2VL3A 2C0EA 1XBSA 2PVQA 4KF9A 1XXUA 3FR3A 3UARA 3P7XA 5ECOB 4PQHA 1URMA 4K6XA 3D6IA 1BJXA 4IQAA 4HQSA 1ERUA 4PUFC 3FY7A 2H01A 4GTUA 1OE8A 2HLSA 4KNDA 3G7YA 3VK9A 4NXIA 3M9KA 1PX7A 5DDLA 3IA1A 3C8EA 4XTSA 5F07A 3GH9A 3HJMA 1VF4A 1XW9A 2HRFA 4KW6A 1GULA 4L8EA 2B5YA 2NVLA 5ID2B 2LKUA 3LEFA 1ZGNA 4L0WA 3F0IA 2HZEB 3DKSA 3FZ5A 4V2LA 2YV7A 5IPGA 6GSXA 4L5OA 3HY2A 3A2VA 1KTEA 5GZZB 2DJ0A 2VCQA 3ME8A 3WD6A 1Z6MA 2AAWA 4G19A 2YWIA 2BMXA 3HVVA 5JCGA 2I4AA 4GRFA 4FYUA 1ZYEA 2H1AA 4G0IA 2WB9A 1TK8B 5HFKA 2GSTA 3CRTA 1X9MB 1NHOA 5J9BA 2MBSA 2DKIA 3QFAC 1WE0A 1XW6A 2OE1A 4MNNA 1IYIA 2LS5A 1LJRA 2YWOA 2KHPA 3RPPA 2P5QA 3APOA 3Q74A 3DWVA 3QPMA 3WT2A 1GSDA 2REMA 1XW5A 2P0GA 2ZCTA 2K6VA 4MDCA 1KNGA 1A2MA 2PBJA 3J7Yk 3GTUB 1SENA 2CZ3A 2VCTA 1TU8A 3GSTA 4EIPA 2IMFA 2YNXA 4ULXA 1G7EA 4HEA2 4ICYA 3G7JA 2VCZA 2HZFA 5JCWA 3P90A 1R5PA 2H30A 3QDNA 2CX3A 3TJFA 4KSMA 1FAAA 2YOIA 4POLA 2VO4A 4ECJA 4KCAA 2F51A 2DIZA 3IAM2 5E4WA 1M0UA 3A5IA 3VWUA 3M1GA 2WGRA 1J9BA 2IMKA 1XFLA 3TDGA 2L6CA 1XVQA 1WMJA 3HA9A 4JR4A 5CO3A 2H0GA 5J5NA 4MZCA 3KM6A 4DSQA 1EV4A 3LW9A 4EF0A 1FVKA 2PUKC 3IHQA 2R6KA 2VLUA 2E0QA 4JU5A 2VCWA 2LQOA 2MYGA 3QMXA 4IVFA 1USBA 1B9YC 6GSYA 4OCFA 4GSSA 4CHSA 20GSA 3E9JB 2VL2A 5DBQA 1AQVA 2B7KA 3LYKA 1VRSD 2FY6A 2NTOA 4YQVA 3KH9A 3M9JA 5ENUA 2I3YA 2ON7A 4XS6A 2DKHA 1QFNA 3I9V2 3VPTA 2VAFA 2HSMA 3PPUA 2H1GA 4ML6A 5D8IA 3GL5A 5F06A 2NBSA 3GMFA 10GSA 1PD21 3C1SA 4O5UA 5AISA 5KN0A 1MDKA 4H86A 2HSYA 4I6XA 3QAVA 4FYCA 4IP6A 1B9XC 3PINA 1J08A 3D4MA 4BL7B 2OBKA 2B1KA 1PA3A 1K0AA 2ES7A 4JR6A 2DJ1A 4KUNA 4O5QA 3OR5A 4TXOB 2UZ8A 3IK9A 4RI6A 1XWKA 1V40A 4HZ2A 4KSOA 3AY8A 4O7HA 1EOHA 1MEKA 1T1VA 2FUG2 4Q5QA 3FR6A 3WYWA 1PN9A 5D9VA 2IMIA 3HXSA 2H74A 1A2JA 2FWEA 1O73A 2IPAA 5IMCA 1SK0A 4GF0A 2LSTA 3ISOA 4GQFA 3EU3A 1OKTA 2ON5A 1FVJA 4Z2TA 1YF0A 1DE1A 3DYRA 4AF2A 1WPIA 2GSRA 4OO4A 2PU9C 2TIRA 1T4YA 4ID0A 4X43A 5DJMA 1LU4A 1GWCA 1AQWA 4DSSB 1ZYQB 1YF1A 3UBKA 1FG4A 3GSSA 1B4QA 5ECKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QAG A;  2DJ3 A;  4P3Y B;  1BQ7 A;  5IIZ A;  3GN3 A;  4LL4 B;  4EE0 A;  1MD4 A;  2HRN A;  3HZ4 A;  2FGX A;  2PWJ A;  1DUG A;  3FZ9 A;  4XHM A;  4IN0 A;  1OC9 B;  3HJP A;  2OKA A;  5ABR A;  1V57 A;  4XRD A;  1M9B A;  2ALB A;  3N9J A;  16GS A;  4F0C A;  1GNE A;  3CMI A;  2CVB A;  1TRU A;  1O8W A;  3HJO A;  2AYT A;  3VLN A;  1FOV A;  2L5O A;  4GCI A;  2LRT A;  3TCO A;  3LGC A;  4G9H A;  1MD3 A;  3TKS C;  1XVW A;  1THX A;  5HFG A;  3HDC A;  2DJJ A;  4MK3 A;  2RM6 A;  2AB6 A;  2HXK A;  3Q19 A;  1WJK A;  5ECN B;  4EXJ A;  2J23 A;  4JED A;  1N8J A;  3DD3 A;  1UA5 A;  2LQQ A;  2VD0 A;  4OWY A;  2X8H A;  5E59 A;  1NSW A;  4E8E A;  3UBL A;  4OMV A;  3EVI A;  1G6Y A;  1O7U A;  1ZL9 A;  2KUC A;  3QOU A;  2HT9 A;  3KJY A;  4EKZ A;  3EIN A;  2GQL A;  1TI1 A;  4ZIL A;  4DEJ A;  4TR1 A;  1GTA A;  2OAD A;  1O6J A;  4EO3 A;  2I1U A;  2DJ2 A;  4ZXG A;  5FT3 A;  2JU5 A;  1ILO A;  1VF2 A;  1OYJ A;  4EUY A;  2PN8 A;  3QR6 A;  3RHB A;  4HJ2 A;  2MMA A;  5ECQ B;  1PKW A;  13GS A;  3GFK A;  5DAK B;  1SL1 B;  4TKY A;  3VFI A;  2VM1 A;  5C04 A;  2FA8 A;  3K8N A;  1JZD A;  4YH2 A;  1JZR A;  1GUK A;  3KD0 A;  1TRV A;  5J9C A;  1UVZ A;  2EIO A;  3LWA A;  5JWQ B;  3IBH A;  1EEM A;  2YN1 A;  4ZBB A;  2TRX A;  1S3A A;  3LSZ A;  4FIW A;  5KN1 A;  1ZCP A;  2L4Q A;  3GX0 A;  1HNB A;  1CQG A;  2H0I A;  1TI3 A;  4MPG A;  3NZN A;  22GS A;  1XPV A;  1GRX A;  2H6Y A;  5IPH A;  1BG5 A;  1GH2 A;  3D0Z A;  4FH8 A;  2JZR A;  2M46 A;  5B8A A;  3RHC A;  5CYY A;  5B6M A;  1RK4 A;  4WBR D;  4J2F A;  3U6V A;  1GTB A;  3UMA A;  6GSU A;  5HFI A;  1GSS A;  4K7O A;  2VL9 A;  2N5A A;  5FHI A;  3A3T A;  5A4U A;  1GL8 A;  1O8X A;  3ZVJ D;  1UN2 A;  3HZ8 A;  3TOU A;  2GSQ A;  2H6X A;  3ZZX A;  1ST9 A;  4MLY A;  4N0V A;  3IAS 2;  5IO2 A;  1YDK A;  1B8X A;  5G5E A;  4I8B A;  1R26 A;  1YY7 A;  1SD9 A;  5B8B A;  1ACV A;  1Z6N A;  3EU4 A;  1JFU A;  1X9W B;  4NV2 A;  5EY6 A;  2VCX A;  2A2R A;  4Q5F A;  5D9T A;  1Y6E A;  4DVC A;  2HI7 A;  1YKA A;  3EUR A;  3ERG A;  2DJK A;  5DCG A;  2L5L A;  4JE1 A;  5LCZ A;  1U88 A;  4MJB A;  1AW9 A;  3L9V A;  3GKX A;  1PKZ A;  1AQX A;  5D96 A;  2R37 A;  5KN3 A;  3IR4 A;  4RI7 A;  2C3N A;  2YJH A;  4WR5 A;  5ID2 A;  3ZTL A;  3TRX A;  1M7T A;  3BD2 A;  3NIV A;  3QAW A;  2HZE A;  3GKN A;  4POK A;  2LRC A;  3KP8 A;  1O85 A;  1T7P B;  1OAZ A;  5ECR B;  2AV4 A;  4K7N A;  2DLX A;  1GSF A;  1F9M A;  3D4T A;  1ON4 A;  1GSU A;  1OKD A;  2GTU A;  1XOA A;  2R3X A;  2YJ7 A;  5G30 A;  1Z7R A;  3MDK A;  4KH7 A;  1PRX A;  2LUS A;  3TOT A;  2D2Z A;  4ISD A;  4Q5R A;  1Z7P A;  4TR4 A;  1Y25 A;  1A0R P;  3ZML A;  3MAK A;  3O3T A;  4FYB A;  4ZB8 A;  2VLT A;  4XS4 B;  5J3R A;  1SKR B;  1ZZY A;  1QXH A;  2TRC P;  4IBP A;  2I81 A;  1AUC A;  2WS2 A;  1GUM A;  1FW1 A;  1H4O A;  5H5Q A;  1OE7 A;  2P31 A;  3ED3 A;  2C0D A;  3EYT A;  1DE2 A;  1FB6 A;  3UOM A;  3ZFL A;  1X5D A;  1S3C A;  2DMM A;  1KEB A;  3L9S A;  2L6D A;  1JZW A;  2YWM A;  4BVY A;  2EIR A;  5F0G A;  3RDW A;  3GYK A;  5INY A;  3MWH A;  4XRA A;  3VI7 A;  1BAY A;  2C3Q A;  2OAC A;  2VOC A;  5D73 A;  1HNA A;  1YZX A;  4LL1 B;  2YAN A;  4O5R A;  4O92 A;  5JWR B;  5DAL A;  1UC7 A;  1QMV A;  1XOB A;  1SJZ A;  4J57 E;  3IC4 A;  5COH A;  3P2A A;  1YEX A;  4PUA A;  4F0B A;  3UAP A;  4K2D A;  1AC1 A;  1M99 A;  1ML6 A;  3DEX A;  5D9X A;  3UIW A;  4JBB A;  2C8U A;  5DVB A;  1SYR A;  2JZS A;  1T3B A;  1TU7 A;  1SD8 A;  6GSV A;  2Z9S A;  2GLR A;  5LNK e;  4NHZ A;  3F6F A;  3MNG A;  1A0F A;  2A2S A;  2DIY A;  3F63 A;  1DBY A;  4WBJ A;  4EDZ A;  5HR0 A;  3GIX A;  5IMA A;  4MH3 A;  1SKW B;  4N11 A;  1A8L A;  2B5X A;  4KAE A;  3FZ4 A;  4PX1 A;  4TW5 A;  5F8B A;  3TJG A;  1Z5Y E;  2BTO T;  1A8Y A;  2JL4 A;  3A5W A;  3F9U A;  1H75 A;  4G10 A;  3BCK A;  3TUE A;  4BL7 A;  3U5R E;  2H6Z A;  4V1A g;  3TRP A;  3E3E A;  4FO5 A;  1PSQ A;  2C80 A;  1WOU A;  3BJ5 A;  1GP1 A;  4OFN A;  2FLS A;  5J41 A;  4BA7 A;  19GS A;  3LOR A;  1V98 A;  3SWL A;  1X9S B;  4K7I A;  4IJI A;  4RQR A;  2WCI A;  4QL9 A;  2YWN A;  2WFC A;  3UJ1 A;  4KCE A;  4N0Z A;  2LV3 A;  3O6T A;  1GLP A;  3L9U A;  1U3I A;  1W4V A;  2F8F A;  1M9A A;  1TW9 A;  2GDR A;  1M2B A;  3VI5 A;  3DRN A;  3DML A;  11GS A;  2FHE A;  18GS A;  2XC2 A;  2O89 A;  2XPE A;  2I9H A;  1ERT A;  2C0F A;  3ZIT A;  1I5G A;  1HNC A;  3QCP A;  1CQH A;  1BED A;  4I97 A;  2K9F A;  5G5F A;  5IMD A;  1XIY A;  2G0F A;  3FRC A;  1TXX A;  17GS A;  2F9S A;  5H5S A;  3GH6 A;  1WWJ A;  3HHV A;  3RPN A;  5HR1 A;  1VGL A;  1X0R A;  1G6W A;  1WIK A;  3Q6O A;  3PR8 A;  1HQO A;  4IP1 A;  5IMF A;  1ZMA A;  4X1U A;  2YP6 A;  2L57 A;  2PVO C;  4ACS A;  1R5A A;  4HU7 A;  1THO A;  3L4N A;  5A4V A;  1SL2 B;  1JHB A;  1YJ6 A;  2F8A A;  1AAZ A;  4GWR A;  2JAC A;  4QQ7 A;  3H93 A;  2CT6 A;  5IM9 A;  2OE0 A;  4CDO A;  3TKS A;  3C71 A;  3EC3 A;  3JCM L;  4MJA A;  1NM3 A;  1JZO A;  2LJK A;  3FHK A;  2V6K A;  1OC9 A;  2YZH A;  2V2G A;  1TRS A;  5HQP A;  3DXB A;  4K0N A;  1V2A A;  3WGX A;  4CW9 A;  4Q5N A;  2ZUP A;  2X99 A;  3KEB A;  2H1D A;  1U3A A;  6GSW A;  2NPB A;  4F2I A;  1GSQ A;  4K9Z A;  4GXZ A;  5DJL A;  1EZK A;  4MH2 A;  4WR4 A;  2B6M A;  1SJ6 A;  4KDU A;  4X0X A;  5G31 A;  5IOW A;  3BCI A;  2HSH A;  1MDI A;  1TTZ A;  3BOA A;  2C4J A;  3C7M A;  2CX4 A;  2IL3 A;  3US3 A;  3W8J A;  3E0U A;  1VF1 A;  4V2M A;  2O7K A;  4IJ3 A;  2M72 A;  4NAX A;  3IV4 A;  2L4C A;  4ZL9 A;  3G9B A;  4K0G A;  3M3M A;  1GNW A;  2NDO A;  2GZP A;  3TRQ A;  1R7H A;  4ILF A;  5GSS A;  1ABA A;  1TOF A;  1FB0 A;  2DML A;  1A24 A;  1XWA A;  3V1W A;  3C1R A;  4HJM A;  3Q18 A;  4AJ8 A;  3QFB C;  2XBQ A;  4MPF A;  1PL2 A;  3CRU A;  2O87 A;  2IFQ B;  2P5R A;  2VIM A;  5ECH B;  1TK5 B;  2XBI A;  2N5B A;  2V1M A;  2IME A;  5G1L A;  2GQM A;  3HVX A;  3GKK A;  3WGD A;  4HQZ A;  3DVX A;  1SK1 A;  3H1N A;  3QD9 A;  3APS A;  3D5J A;  1B4P A;  4XS1 A;  2R2J A;  3TKP A;  3KTB A;  2FWG A;  2K18 A;  2JSZ A;  3MSZ A;  2G2Q A;  1GSY A;  2PGT A;  5CRH A;  5DAK A;  5EL8 A;  3I6A A;  4D73 B;  3KCM A;  2DSA A;  3ZLP A;  2LJR A;  2X8G A;  3G7I A;  1AIU A;  1F2E A;  1YEP A;  5F05 A;  4ZBD A;  4PXO A;  2C0G A;  3FZA A;  2JSY A;  3CSJ A;  4KDY A;  5EPF A;  1VF3 A;  3CBU A;  3O76 A;  5KEJ A;  5JCU A;  4TOP A;  1I9D A;  1SL0 B;  4YAV A;  4ECC A;  5ECL B;  3LQ7 A;  4MP4 A;  3F4S A;  5C00 A;  2H66 A;  3CXG A;  5GAN D;  1TK0 B;  3P8W A;  3L78 A;  2H73 A;  2DBC A;  4OFM A;  4EVM A;  3KXO A;  4MF5 A;  3IXR A;  2CQ9 A;  2AJQ B;  2RLI A;  2L59 A;  5CAX A;  4YQM A;  3D22 A;  2CV4 A;  2KP1 A;  1TKD B;  3ZRD A;  3KZQ A;  3TKR A;  4TR0 A;  3LJR A;  1TDI A;  3KTL A;  4NMU A;  2HFD A;  5HR3 A;  1EP8 A;  3IRA A;  4PNG A;  4JZQ A;  4MZB A;  2ZNM A;  4MZW A;  2PER A;  2XPD A;  3IOS A;  3CSI A;  1RQM A;  1EGO A;  3M0F A;  1XZO A;  4DSR A;  3D21 A;  2B3S A;  3TB2 A;  5FWG A;  2H19 A;  3LXT A;  5IMZ A;  3F3Q A;  3FKF A;  3GHA A;  1KBN A;  2C1Y A;  4RUV A;  1W89 A;  3VWV A;  2CAI A;  3F4T A;  1SU9 A;  2KP2 A;  1EEJ A;  4F03 A;  1AXD A;  1EOG A;  1QQ2 A;  2CA8 A;  2PMT A;  4OCE A;  2VUP A;  1ERV A;  1EV9 A;  5KN2 A;  4QL7 A;  4Z7X A;  3H79 A;  3ZL5 A;  2WJU A;  3EE2 A;  2AHE A;  4ZL8 A;  3APQ A;  1WRY A;  1Q4J A;  1F37 A;  3R2Q A;  4WXT A;  4LA1 A;  2VCV A;  4IKH A;  4WET A;  1K3L A;  4TN8 A;  4ZIJ A;  3F3R A;  3GUR A;  1TJD A;  4ZB9 A;  4MCU A;  5HR2 A;  3ZRE A;  3GA4 A;  2MMZ A;  2IJY A;  4ZB6 A;  3KH7 A;  6GST A;  3S9F A;  3LG6 A;  2CZ2 A;  5DQS A;  5CRE A;  5ELG A;  2GVP A;  3F6D A;  1GSE A;  3IK7 A;  3LFL A;  8GSS A;  3PH9 A;  1BX9 A;  3DVW A;  1SK2 A;  12GS A;  5L71 A;  3FR9 A;  3F8U A;  4L5L A;  4HI7 A;  2H8L A;  2MBT A;  4OO5 A;  1ZOF A;  2VD1 A;  2CVK A;  4XCS A;  1XCC A;  3KGK A;  2WRT A;  3GTU A;  2GSS A;  1K0C A;  2FWH A;  5ECI B;  3TJJ A;  5B7C A;  4AJ6 A;  4XS4 A;  2LJA A;  4GSN A;  4RQX A;  4TXV A;  2IWT A;  1O81 A;  3HVS A;  3GL3 A;  5DCH A;  2DC5 A;  5G1K A;  2GQK A;  5DAL B;  4HU9 A;  2GGT A;  4ECB A;  1PQN A;  4MF6 A;  4KDX A;  2WZ9 A;  3F4R A;  1MTC A;  5ECP B;  2VLV A;  1F3B A;  4G2E A;  4WEY A;  2O8V B;  1A2L A;  4NWY A;  3GV1 A;  4KB3 A;  4HS1 A;  3ERF A;  4I5Q A;  4F82 A;  2YPM A;  2MMO A;  2XHF A;  2PPT A;  4PUR A;  1BYE A;  4OD7 A;  3VUR A;  2YCD A;  1Z9H A;  2JZT A;  2YZU A;  5CRW A;  5GAP D;  1T4Z A;  4MAB A;  3UVT A;  5LD0 A;  4NHW A;  3TJK A;  3I43 A;  2IMD A;  1G7O A;  2EC4 A;  2MMN A;  3FW2 A;  1K0B A;  3CYN A;  2J9H A;  1WP0 A;  3ZFB A;  1Q98 A;  1SYX A;  4GQC A;  3ZIJ A;  1OC3 A;  2VL2 C;  5ECS A;  1DSB A;  1PL1 A;  5JWO B;  2C3T A;  4KE3 A;  2QKE A;  3HYP A;  1C72 A;  2HYX A;  4N10 A;  4BPY A;  5AN1 A;  4IGJ A;  3ME7 A;  3BBY A;  4AGS A;  5AIX A;  1NW2 A;  3IDV A;  1Z3E A;  1EGR A;  2BJX A;  1M2A A;  2B5E A;  3KMO A;  2H0H A;  5ECM B;  4TXO A;  2LNS A;  4K8M A;  2QGV A;  4GLT A;  2V6O A;  3EWL A;  5IO0 A;  1FHE A;  2IIY A;  1GLQ A;  2VM2 A;  4ZBA A;  5AGY A;  3L0H A;  4HOJ A;  4POB A;  4WF5 A;  1GUH A;  4IEL A;  1T00 A;  4I2T A;  4IW9 A;  3TKQ A;  4IQ1 A;  3NOF A;  4L0U A;  2X64 A;  3EMX A;  2OE3 A;  4V1A p;  3GKM A;  4PGT A;  4E8H A;  4PQI A;  2HE3 A;  1U87 A;  1EP7 A;  2GT6 A;  4IS0 A;  3C73 A;  2K8V A;  3HD5 A;  4ECI A;  1K3Y A;  1E2Y A;  3ZVJ A;  2H70 A;  1J0F A;  4XIH A;  2H75 A;  2WDU A;  4GST A;  4BWS A;  5B6N A;  3DGQ A;  1NHY A;  2IN3 A;  4YAP A;  3UEM A;  3N5O A;  5IMV A;  4I2U A;  2F3M A;  2H71 A;  2RM5 A;  5A4W A;  3RBT A;  5CP1 A;  3ZIV A;  1TRW A;  4KA0 A;  1MDJ A;  4AJ7 A;  1IYH A;  3HCZ A;  4OFT A;  4LMV A;  4DSS A;  3W6G A;  6GSS A;  1N2A A;  1ERW A;  2GS3 A;  3WT1 A;  1V58 A;  5ELA A;  4MA9 A;  2RUF A;  3GNJ A;  4HUA A;  1JLV A;  4MF7 A;  5IQY A;  4HZ4 A;  5AIV A;  3WGE A;  5A5K A;  2B1L A;  3CSH A;  4NV5 A;  2GZY A;  4J56 E;  4N30 A;  1GTU A;  5D9W A;  2N5F A;  4LLR A;  4HDE A;  1GTI A;  1EWX A;  2FCH A;  4EDY A;  5H5R A;  3A2X A;  1M2D A;  1K3O A;  2B7J A;  2QC7 A;  1S3D A;  1QK8 A;  2FA4 A;  3HKR A;  4BVX A;  2O85 A;  5GST A;  1K0D A;  1YKC A;  1LBK A;  2RII A;  4TR3 A;  1B48 A;  3VWX A;  1K0N A;  2V32 A;  2V41 A;  5EVO A;  2FD3 A;  1T8E B;  2R5G A;  3KMN A;  2QSI A;  3ERW A;  1YQ1 A;  3FYG A;  4JRR A;  3FK8 A;  2LNT A;  2H72 A;  2OJL A;  3UL3 A;  1K0O A;  1FO5 A;  3TGZ A;  1PGT A;  3EMP A;  4BWQ A;  1TP9 A;  4PNF A;  3TKS E;  2OA7 A;  4MMM A;  4TR1 B;  1F3A A;  3W8S A;  1X5E A;  1RW1 A;  4PQ1 A;  2KLX A;  4IHU A;  3RAZ A;  2CVD A;  2OBI A;  2E2G A;  3ZMK A;  5IOX A;  4MJE A;  14GS A;  4EL1 A;  1X5C A;  5CNW A;  5DQY A;  3UVH A;  4LMW A;  4WF4 A;  5D93 A;  3J7Y b;  1XWG A;  3I69 A;  3A2W A;  4TVE A;  2EIQ A;  1U6T A;  1K0M A;  1SJI A;  3H4K A;  2FNO A;  2MZC A;  2LRN A;  2A4V A;  3LXZ A;  4KX4 A;  1V9W A;  2AUV A;  2GT5 A;  4ZL7 A;  4WKW A;  3KIJ A;  1E6B A;  4EC0 A;  7GSS A;  2M80 A;  4K1F A;  3KP9 A;  2K8S A;  4KGI A;  3GX8 A;  1HD2 A;  2RUE A;  4ML1 A;  1HYU A;  1SKS B;  5J4U A;  3H8Q A;  1OC8 A;  5CRG A;  2KOK A;  4MJC A;  3PGT A;  1JLW A;  2IFQ A;  2E2M A;  2HNL A;  1OVN A;  3GRX A;  1PX6 A;  1R4W A;  2H76 A;  3GUS A;  3DIE A;  3CTG A;  1A23 A;  1G0T A;  2H1B A;  1F6M C;  4V2N A;  4F9Z A;  1PMT A;  3CTF A;  2LEG A;  4NPB A;  4YQU A;  4POM A;  2LTK A;  1QUW A;  3IE3 A;  9GSS A;  2WUL A;  3VWW A;  2JAD A;  4TRX A;  2FWF A;  3LYP A;  3IPZ A;  2GZZ A;  3SBC A;  2E7P A;  2X8C A;  2CAQ A;  3M8N A;  3TJB A;  1XWC A;  2R4V A;  5CRD A;  4D73 A;  1QGV A;  2YV9 A;  1XWB A;  3VPQ A;  3FEU A;  5G2Z A;  3ZYW A;  4O32 A;  2VL3 A;  2C0E A;  1XBS A;  2PVQ A;  1XXU A;  3FR3 A;  3UAR A;  3P7X A;  5ECO B;  4PQH A;  1URM A;  4K6X A;  3D6I A;  1BJX A;  4IQA A;  4HQS A;  1ERU A;  4PUF C;  3FY7 A;  2H01 A;  4GTU A;  1OE8 A;  2HLS A;  4KND A;  3G7Y A;  3VK9 A;  4NXI A;  3M9K A;  1PX7 A;  5DDL A;  3IA1 A;  3C8E A;  4XTS A;  5F07 A;  3GH9 A;  3HJM A;  1VF4 A;  1XW9 A;  2HRF A;  4KW6 A;  1GUL A;  4L8E A;  2B5Y A;  2NVL A;  5ID2 B;  2LKU A;  3LEF A;  1ZGN A;  4L0W A;  3F0I A;  2HZE B;  3DKS A;  3FZ5 A;  4V2L A;  2YV7 A;  5IPG A;  6GSX A;  4L5O A;  3HY2 A;  3A2V A;  1KTE A;  5GZZ B;  2DJ0 A;  2VCQ A;  3ME8 A;  3WD6 A;  1Z6M A;  2AAW A;  4G19 A;  2YWI A;  2BMX A;  3HVV A;  5JCG A;  2I4A A;  4GRF A;  4FYU A;  1ZYE A;  2H1A A;  2WB9 A;  1TK8 B;  5HFK A;  2GST A;  3CRT A;  1X9M B;  1NHO A;  5J9B A;  2MBS A;  3QFA C;  1WE0 A;  1XW6 A;  2OE1 A;  1IYI A;  2LS5 A;  1LJR A;  2YWO A;  2KHP A;  3RPP A;  2P5Q A;  3APO A;  3Q74 A;  3DWV A;  3QPM A;  3WT2 A;  1GSD A;  2REM A;  1XW5 A;  2P0G A;  2ZCT A;  2K6V A;  4MDC A;  1KNG A;  1A2M A;  2PBJ A;  3J7Y k;  3GTU B;  1SEN A;  2CZ3 A;  2VCT A;  1TU8 A;  3GST A;  2IMF A;  2YNX A;  4ULX A;  1G7E A;  4HEA 2;  3G7J A;  2VCZ A;  2HZF A;  5JCW A;  3P90 A;  1R5P A;  2H30 A;  3QDN A;  2CX3 A;  3TJF A;  4KSM A;  1FAA A;  2YOI A;  4POL A;  2VO4 A;  4ECJ A;  4KCA A;  2F51 A;  2DIZ A;  3IAM 2;  5E4W A;  1M0U A;  3VWU A;  3M1G A;  2WGR A;  1J9B A;  2IMK A;  1XFL A;  3TDG A;  2L6C A;  1XVQ A;  1WMJ A;  3HA9 A;  4JR4 A;  5CO3 A;  2H0G A;  5J5N A;  4MZC A;  3KM6 A;  4DSQ A;  1EV4 A;  4EF0 A;  1FVK A;  2PUK C;  3IHQ A;  2R6K A;  2VLU A;  2E0Q A;  4JU5 A;  2VCW A;  2LQO A;  2MYG A;  3QMX A;  4IVF A;  1USB A;  1B9Y C;  6GSY A;  4OCF A;  4GSS A;  4CHS A;  20GS A;  3E9J B;  2VL2 A;  5DBQ A;  1AQV A;  2B7K A;  3LYK A;  1VRS D;  2FY6 A;  2NTO A;  4YQV A;  3KH9 A;  3M9J A;  5ENU A;  2I3Y A;  2ON7 A;  4XS6 A;  1QFN A;  3I9V 2;  3VPT A;  2VAF A;  2H1G A;  4ML6 A;  5D8I A;  3GL5 A;  5F06 A;  2NBS A;  3GMF A;  10GS A;  1PD2 1;  3C1S A;  5AIS A;  5KN0 A;  1MDK A;  4H86 A;  2HSY A;  4I6X A;  3QAV A;  4FYC A;  4IP6 A;  1B9X C;  3PIN A;  1J08 A;  3D4M A;  2OBK A;  2B1K A;  1PA3 A;  1K0A A;  2ES7 A;  4JR6 A;  2DJ1 A;  4KUN A;  3OR5 A;  4TXO B;  3IK9 A;  4RI6 A;  1XWK A;  1V40 A;  4HZ2 A;  4KSO A;  3AY8 A;  4O7H A;  1EOH A;  1MEK A;  1T1V A;  2FUG 2;  4Q5Q A;  3FR6 A;  3WYW A;  1PN9 A;  5D9V A;  2IMI A;  3HXS A;  2H74 A;  1A2J A;  2FWE A;  1O73 A;  2IPA A;  5IMC A;  1SK0 A;  4GF0 A;  2LST A;  3ISO A;  4GQF A;  3EU3 A;  1OKT A;  2ON5 A;  1FVJ A;  1YF0 A;  1DE1 A;  3DYR A;  4AF2 A;  1WPI A;  2GSR A;  4OO4 A;  2PU9 C;  2TIR A;  1T4Y A;  4ID0 A;  4X43 A;  5DJM A;  1LU4 A;  1GWC A;  1AQW A;  4DSS B;  1ZYQ B;  1YF1 A;  3UBK A;  1FG4 A;  3GSS A;  1B4Q A;  5ECK B; 
#chains in the Genus database with same CATH topology
 3QAG A;  2DJ3 A;  4P3Y B;  1BQ7 A;  5IIZ A;  4Z2R A;  3GN3 A;  4LL4 B;  4EE0 A;  1MD4 A;  2HRN A;  3HZ4 A;  2FGX A;  2PWJ A;  1DUG A;  3FZ9 A;  4XHM A;  4IN0 A;  1OC9 B;  3HJP A;  2OKA A;  5ABR A;  1V57 A;  4XRD A;  1M3I A;  1M9B A;  2ALB A;  3N9J A;  16GS A;  4F0C A;  1GNE A;  3CMI A;  2CVB A;  1TRU A;  1O8W A;  3HJO A;  2AYT A;  3VLN A;  1FOV A;  2L5O A;  4GCI A;  2LRT A;  3TCO A;  3LGC A;  4G9H A;  1MD3 A;  3TKS C;  1XVW A;  1THX A;  5HFG A;  3HDC A;  2DJJ A;  4MK3 A;  2RM6 A;  2AB6 A;  2HXK A;  3Q19 A;  1WJK A;  5ECN B;  4EXJ A;  2J23 A;  4JED A;  1N8J A;  3DD3 A;  1UA5 A;  2LQQ A;  2VD0 A;  4OWY A;  2X8H A;  5E59 A;  1NSW A;  4E8E A;  3UBL A;  4K2X A;  4OMV A;  3EVI A;  1G6Y A;  1O7U A;  1ZL9 A;  2KUC A;  3QOU A;  2HT9 A;  3KJY A;  4EKZ A;  3EIN A;  2GQL A;  1TI1 A;  4ZIL A;  4DEJ A;  4TR1 A;  1GTA A;  2OAD A;  1O6J A;  4EO3 A;  2I1U A;  2DJ2 A;  4ZXG A;  5FT3 A;  2JU5 A;  1ILO A;  1VF2 A;  1PFO A;  3CQF A;  1OYJ A;  4EUY A;  2PN8 A;  3QR6 A;  3RHB A;  4HJ2 A;  2MMA A;  5ECQ B;  3FMW A;  1PKW A;  13GS A;  3GFK A;  5DAK B;  1SL1 B;  4TKY A;  3VFI A;  2VM1 A;  5C04 A;  2FA8 A;  3K8N A;  1JZD A;  4YH2 A;  1JZR A;  1GUK A;  3KD0 A;  1TRV A;  5J9C A;  1UVZ A;  2EIO A;  3LWA A;  5JWQ B;  3IBH A;  1EEM A;  2YN1 A;  4ZBB A;  2TRX A;  1S3A A;  3LSZ A;  4FIW A;  5KN1 A;  1ZCP A;  2L4Q A;  3GX0 A;  1HNB A;  1CQG A;  2H0I A;  1TI3 A;  4MPG A;  3NZN A;  22GS A;  1XPV A;  1GRX A;  2H6Y A;  5IPH A;  1BG5 A;  1GH2 A;  3D0Z A;  4FH8 A;  2JZR A;  2M46 A;  5B8A A;  3RHC A;  4PTS A;  3R3E A;  5CYY A;  5B6M A;  1RK4 A;  4WBR D;  4J2F A;  3U6V A;  1GTB A;  4USS A;  3UMA A;  6GSU A;  5HFI A;  1GSS A;  4K7O A;  2VL9 A;  2N5A A;  5FHI A;  3A3T A;  5A4U A;  1GL8 A;  2HRA A;  1O8X A;  3ZVJ D;  1UN2 A;  3HZ8 A;  3TOU A;  2GSQ A;  2H6X A;  3ZZX A;  1ST9 A;  5KOX A;  4MLY A;  4N0V A;  3IAS 2;  5IO2 A;  1YDK A;  1B8X A;  5G5E A;  4I8B A;  1R26 A;  1YY7 A;  1SD9 A;  5B8B A;  1ACV A;  1Z6N A;  3EU4 A;  1JFU A;  1X9W B;  4NV2 A;  5EY6 A;  2VCX A;  2A2R A;  4Q5F A;  5D9T A;  1Y6E A;  4DVC A;  2HI7 A;  5BMU A;  1YKA A;  3EUR A;  3ERG A;  2DJK A;  5DCG A;  2L5L A;  3MIX A;  4JE1 A;  5LCZ A;  1U88 A;  4MJB A;  1AW9 A;  3L9V A;  3GKX A;  1PKZ A;  3EPT A;  1AQX A;  5D96 A;  2R37 A;  5KN3 A;  3IR4 A;  4RI7 A;  2C3N A;  2YJH A;  4WR5 A;  5ID2 A;  3ZTL A;  3TRX A;  1M7T A;  3BD2 A;  3NIV A;  3QAW A;  2HZE A;  3GKN A;  4POK A;  2LRC A;  3KP8 A;  1O85 A;  1T7P B;  1OAZ A;  5ECR B;  2AV4 A;  4K7N A;  4CY8 A;  2DLX A;  1GSF A;  4Z2U A;  1F9M A;  3D4T A;  1ON4 A;  4G0L A;  1GSU A;  1OKD A;  2GTU A;  1XOA A;  2R3X A;  2YJ7 A;  5G30 A;  1Z7R A;  3MDK A;  4KH7 A;  1PRX A;  2LUS A;  3TOT A;  2D2Z A;  4ISD A;  4Q5R A;  1Z7P A;  4TR4 A;  1Y25 A;  1A0R P;  3ZML A;  3MAK A;  3O3T A;  4FYB A;  4ZB8 A;  2VLT A;  4HSC X;  4XS4 B;  5J3R A;  1SKR B;  1ZZY A;  1QXH A;  2TRC P;  4IBP A;  2I81 A;  1AUC A;  2WS2 A;  1GUM A;  1FW1 A;  1H4O A;  5H5Q A;  1OE7 A;  2P31 A;  3ED3 A;  2C0D A;  3EYT A;  1DE2 A;  1FB6 A;  3UOM A;  3ZFL A;  1X5D A;  1S3C A;  2DMM A;  1KEB A;  3L9S A;  2L6D A;  1JZW A;  2YWM A;  4BVY A;  2EIR A;  5F0G A;  3RDW A;  3GYK A;  5INY A;  3MWH A;  4XRA A;  3VI7 A;  1BAY A;  2C3Q A;  2OAC A;  2VOC A;  5D73 A;  1HNA A;  1PN0 A;  2X4A A;  1YZX A;  4LL1 B;  2YAN A;  4O5R A;  4O92 A;  5JWR B;  5DAL A;  1UC7 A;  1QMV A;  1XOB A;  1SJZ A;  4J57 E;  3IC4 A;  5COH A;  3P2A A;  1YEX A;  4PUA A;  4F0B A;  3UAP A;  4K2D A;  1AC1 A;  1M99 A;  1ML6 A;  3DEX A;  5D9X A;  3UIW A;  4JBB A;  2C8U A;  5DVB A;  1SYR A;  2JZS A;  1T3B A;  1TU7 A;  1SD8 A;  6GSV A;  2Z9S A;  2GLR A;  5LNK e;  4NHZ A;  3F6F A;  3MNG A;  1A0F A;  2A2S A;  2DIY A;  3F63 A;  1DBY A;  4WBJ A;  4EDZ A;  5HR0 A;  3GIX A;  5IMA A;  4MH3 A;  1SKW B;  4N11 A;  1A8L A;  2B5X A;  4KAE A;  3FZ4 A;  4PX1 A;  4TW5 A;  5F8B A;  3TJG A;  2QA2 A;  1Z5Y E;  2BTO T;  1A8Y A;  2JL4 A;  3A5W A;  3F9U A;  1H75 A;  4G10 A;  3BCK A;  3TUE A;  4BL7 A;  3U5R E;  2H6Z A;  4V1A g;  3TRP A;  3E3E A;  4FO5 A;  1PSQ A;  2C80 A;  1WOU A;  3BJ5 A;  1GP1 A;  4OFN A;  2FLS A;  5J41 A;  4BA7 A;  19GS A;  3LOR A;  1V98 A;  3SWL A;  1X9S B;  4K7I A;  4IJI A;  4RQR A;  2WCI A;  4QL9 A;  2R0C A;  2YWN A;  2WFC A;  3UJ1 A;  4KCE A;  4N0Z A;  2LV3 A;  3O6T A;  1GLP A;  3L9U A;  1U3I A;  1W4V A;  2F8F A;  1M9A A;  2R0G A;  1TW9 A;  2GDR A;  1M2B A;  3VI5 A;  3DRN A;  3DML A;  11GS A;  4K5R A;  2FHE A;  18GS A;  2XC2 A;  2O89 A;  2XPE A;  2I9H A;  1ERT A;  2C0F A;  3ZIT A;  1I5G A;  1HNC A;  3QCP A;  1CQH A;  1BED A;  4I97 A;  2K9F A;  5G5F A;  5IMD A;  1XIY A;  2G0F A;  3FRC A;  1TXX A;  17GS A;  2F9S A;  5H5S A;  3GH6 A;  1WWJ A;  3HHV A;  3RPN A;  5HR1 A;  1VGL A;  1X0R A;  1G6W A;  1WIK A;  3Q6O A;  3PR8 A;  1HQO A;  4IP1 A;  5IMF A;  1ZMA A;  4X1U A;  2YP6 A;  2L57 A;  2PVO C;  4ACS A;  1R5A A;  4HU7 A;  1THO A;  3L4N A;  5A4V A;  1SL2 B;  1JHB A;  1YJ6 A;  2F8A A;  1AAZ A;  4GWR A;  2JAC A;  4QQ7 A;  4BVX B;  3H93 A;  2CT6 A;  5IM9 A;  2OE0 A;  4CDO A;  3TKS A;  3C71 A;  3EC3 A;  2R0P A;  3JCM L;  4MJA A;  1NM3 A;  1JZO A;  2LJK A;  3FHK A;  2V6K A;  1OC9 A;  2YZH A;  2V2G A;  1TRS A;  5HQP A;  3DXB A;  4K0N A;  1V2A A;  3WGX A;  4CW9 A;  4Q5N A;  2ZUP A;  2X99 A;  3KEB A;  2H1D A;  1U3A A;  6GSW A;  2NPB A;  4F2I A;  1GSQ A;  4G0K A;  4K9Z A;  4GXZ A;  5DJL A;  1EZK A;  4EIQ A;  4MH2 A;  4WR4 A;  2B6M A;  1SJ6 A;  4KDU A;  4X0X A;  5G31 A;  5IOW A;  3BCI A;  2HSH A;  1MDI A;  1TTZ A;  3BOA A;  5KOW A;  2C4J A;  3C7M A;  2CX4 A;  2IL3 A;  3US3 A;  3W8J A;  3E0U A;  1VF1 A;  4V2M A;  2O7K A;  4IJ3 A;  2M72 A;  4NAX A;  3IV4 A;  2L4C A;  4ZL9 A;  3G9B A;  4K0G A;  3M3M A;  1GNW A;  2NDO A;  2GZP A;  3TRQ A;  1R7H A;  4ILF A;  5GSS A;  1ABA A;  1TOF A;  1FB0 A;  2DML A;  1A24 A;  1XWA A;  3V1W A;  3C1R A;  4HJM A;  3Q18 A;  4AJ8 A;  3QFB C;  2XBQ A;  4MPF A;  1PL2 A;  3CRU A;  2A2P A;  2O87 A;  2IFQ B;  2P5R A;  2VIM A;  3IHG A;  5ECH B;  1TK5 B;  2XBI A;  4YKF A;  2N5B A;  2V1M A;  2IME A;  5G1L A;  2GQM A;  3HVX A;  3GKK A;  3WGD A;  4HQZ A;  3DVX A;  1SK1 A;  3H1N A;  3QD9 A;  3APS A;  3D5J A;  4YKG A;  1B4P A;  4XS1 A;  1FOH A;  2R2J A;  3TKP A;  3KTB A;  2FWG A;  2K18 A;  2JSZ A;  3MSZ A;  2G2Q A;  1GSY A;  2PGT A;  5CRH A;  5DAK A;  5EL8 A;  3I6A A;  4D73 B;  3KCM A;  2DSA A;  3ZLP A;  2LJR A;  2X8G A;  3G7I A;  1AIU A;  1F2E A;  1YEP A;  5F05 A;  4ZBD A;  4PXO A;  2C0G A;  3FZA A;  2JSY A;  3CSJ A;  4KDY A;  5EPF A;  1VF3 A;  3CBU A;  3O76 A;  5KEJ A;  1XG8 A;  5JCU A;  4TOP A;  1I9D A;  1SL0 B;  4YAV A;  4ECC A;  5ECL B;  3LQ7 A;  4MP4 A;  3F4S A;  5C00 A;  2H66 A;  3CXG A;  5GAN D;  1TK0 B;  3P8W A;  3L78 A;  2H73 A;  2DBC A;  4OFM A;  4EVM A;  3KXO A;  4MF5 A;  3IXR A;  2CQ9 A;  2AJQ B;  2RLI A;  2L59 A;  5CAX A;  4YQM A;  3D22 A;  2CV4 A;  2KP1 A;  1TKD B;  3ZRD A;  3KZQ A;  3TKR A;  4TR0 A;  3LJR A;  1TDI A;  3KTL A;  4NMU A;  2HFD A;  4A5P A;  5HR3 A;  1EP8 A;  3IRA A;  4PNG A;  4JZQ A;  4MZB A;  2ZNM A;  4MZW A;  2PER A;  2XPD A;  3IOS A;  3CSI A;  1RQM A;  1EGO A;  3M0F A;  1XZO A;  4DSR A;  3D21 A;  2B3S A;  3TB2 A;  5FWG A;  2H19 A;  3LXT A;  5IMZ A;  3F3Q A;  3FKF A;  3GHA A;  1KBN A;  2C1Y A;  4RUV A;  1W89 A;  3VWV A;  5BRT A;  2CAI A;  3F4T A;  1SU9 A;  2KP2 A;  1EEJ A;  4F03 A;  1AXD A;  1EOG A;  1QQ2 A;  2CA8 A;  2PMT A;  4OCE A;  2VUP A;  1ERV A;  1EV9 A;  5KN2 A;  4QL7 A;  4Z7X A;  3H79 A;  3ZL5 A;  2WJU A;  3EE2 A;  2AHE A;  4ZL8 A;  3APQ A;  1WRY A;  1Q4J A;  1F37 A;  3R2Q A;  4WXT A;  4LA1 A;  2VCV A;  4IKH A;  4WET A;  1K3L A;  4TN8 A;  4ZIJ A;  3F3R A;  3GUR A;  1TJD A;  4ZB9 A;  4MCU A;  5HR2 A;  3ZRE A;  3GA4 A;  2MMZ A;  2IJY A;  4ZB6 A;  3KH7 A;  6GST A;  3S9F A;  3LG6 A;  2CZ2 A;  5DQS A;  5CRE A;  5ELG A;  2GVP A;  3F6D A;  1GSE A;  3IK7 A;  3LFL A;  8GSS A;  3PH9 A;  1BX9 A;  3DVW A;  1SK2 A;  12GS A;  5L71 A;  3FR9 A;  3F8U A;  4L5L A;  4HI7 A;  2H8L A;  2MBT A;  4OO5 A;  1ZOF A;  2VD1 A;  2CVK A;  4XCS A;  1XCC A;  3KGK A;  2WRT A;  3GTU A;  2GSS A;  1K0C A;  2FWH A;  5ECI B;  3TJJ A;  5B7C A;  4AJ6 A;  4XS4 A;  4BVY B;  2LJA A;  4GSN A;  4RQX A;  4TXV A;  2IWT A;  3IC8 A;  1O81 A;  3HVS A;  4X4J A;  3GL3 A;  5DCH A;  2DC5 A;  5G1K A;  2GQK A;  5DAL B;  4HU9 A;  2GGT A;  4ECB A;  1PQN A;  4MF6 A;  4KDX A;  2WZ9 A;  3F4R A;  1MTC A;  5ECP B;  2VLV A;  1F3B A;  4G2E A;  4WEY A;  2O8V B;  1A2L A;  4NWY A;  3GV1 A;  4KB3 A;  4HS1 A;  3ERF A;  4I5Q A;  4F82 A;  2YPM A;  2MMO A;  2XHF A;  2PPT A;  4PUR A;  1BYE A;  4OD7 A;  3VUR A;  2YCD A;  1Z9H A;  2JZT A;  2YZU A;  5CRW A;  5GAP D;  1T4Z A;  4MAB A;  3UVT A;  5LD0 A;  4NHW A;  3TJK A;  3I43 A;  2IMD A;  4FQU A;  1G7O A;  2EC4 A;  2MMN A;  3FW2 A;  1K0B A;  1ZYP A;  3CYN A;  2J9H A;  1WP0 A;  3ZFB A;  1Q98 A;  1SYX A;  4GQC A;  3ZIJ A;  1OC3 A;  2VL2 C;  5ECS A;  1DSB A;  1PL1 A;  5JWO B;  2C3T A;  4KE3 A;  2QKE A;  3HYP A;  1C72 A;  2HYX A;  4N10 A;  4BPY A;  5AN1 A;  4IGJ A;  3ME7 A;  3BBY A;  4AGS A;  5AIX A;  1NW2 A;  3IDV A;  1Z3E A;  1EGR A;  2BJX A;  1M2A A;  2B5E A;  3KMO A;  2H0H A;  5ECM B;  4TXO A;  2LNS A;  4K8M A;  2QGV A;  4GLT A;  2V6O A;  3EWL A;  4K5S A;  5IO0 A;  1FHE A;  2IIY A;  1GLQ A;  2VM2 A;  4ZBA A;  5AGY A;  3L0H A;  4HOJ A;  4POB A;  4WF5 A;  1GUH A;  4IEL A;  1T00 A;  4IW9 A;  4I2T A;  3TKQ A;  2X49 A;  4IQ1 A;  3NOF A;  4L0U A;  2X64 A;  3EMX A;  2OE3 A;  4V1A p;  3GKM A;  4PGT A;  4E8H A;  4PQI A;  2HE3 A;  1U87 A;  1EP7 A;  2A4H A;  2GT6 A;  4IS0 A;  3C73 A;  2K8V A;  4CY6 A;  3HD5 A;  1S3R A;  3MYD A;  4ECI A;  1K3Y A;  1E2Y A;  3ZVJ A;  2H70 A;  1J0F A;  4XIH A;  2H75 A;  2WDU A;  4GST A;  4BWS A;  5B6N A;  3DGQ A;  1NHY A;  2IN3 A;  4YAP A;  3UEM A;  3N5O A;  5IMV A;  4I2U A;  2F3M A;  2H71 A;  2RM5 A;  5A4W A;  3RBT A;  5CP1 A;  3ZIV A;  1TRW A;  4KA0 A;  1MDJ A;  4AJ7 A;  1IYH A;  3HCZ A;  4OFT A;  4LMV A;  4DSS A;  3W6G A;  6GSS A;  1N2A A;  1ERW A;  2GS3 A;  3WT1 A;  1V58 A;  5ELA A;  4MA9 A;  2RUF A;  3GNJ A;  4HUA A;  1JLV A;  4MF7 A;  5IQY A;  4HZ4 A;  5AIV A;  3WGE A;  5A5K A;  2B1L A;  3CSH A;  4NV5 A;  2GZY A;  4J56 E;  4N30 A;  1GTU A;  2N5F A;  5D9W A;  4LLR A;  4HDE A;  1GTI A;  1EWX A;  2FCH A;  4EDY A;  5H5R A;  3A2X A;  1M2D A;  1K3O A;  2B7J A;  1ZYN A;  2QC7 A;  1S3D A;  1QK8 A;  2FA4 A;  3HKR A;  4BVX A;  2O85 A;  5GST A;  1K0D A;  1YKC A;  1LBK A;  2RII A;  4TR3 A;  1B48 A;  3VWX A;  1K0N A;  2V32 A;  2V41 A;  5EVO A;  2FD3 A;  1T8E B;  2R5G A;  3KMN A;  2QSI A;  3ERW A;  1YQ1 A;  3FYG A;  4JRR A;  3FK8 A;  2LNT A;  2H72 A;  2OJL A;  3UL3 A;  1K0O A;  1FO5 A;  3TGZ A;  1PGT A;  3EMP A;  4BWQ A;  1TP9 A;  4PNF A;  3TKS E;  2OA7 A;  4MMM A;  4TR1 B;  1F3A A;  3W8S A;  1X5E A;  1RW1 A;  4PQ1 A;  2KLX A;  4IHU A;  3RAZ A;  2CVD A;  2OBI A;  2E2G A;  3ZMK A;  5IOX A;  4MJE A;  14GS A;  4EL1 A;  1X5C A;  5CNW A;  5DQY A;  3UVH A;  4LMW A;  4WF4 A;  5D93 A;  4BIK A;  3J7Y b;  1XWG A;  3I69 A;  3A2W A;  4TVE A;  2EIQ A;  1U6T A;  1K0M A;  1SJI A;  3H4K A;  2FNO A;  2MZC A;  2LRN A;  2A4V A;  3LXZ A;  4KX4 A;  1V9W A;  2AUV A;  2GT5 A;  4ZL7 A;  4WKW A;  3KIJ A;  1E6B A;  4EC0 A;  2QA1 A;  7GSS A;  2M80 A;  4K1F A;  3KP9 A;  2K8S A;  4KGI A;  3GX8 A;  2HRK A;  1HD2 A;  2RUE A;  4ML1 A;  1HYU A;  1SKS B;  5J4U A;  3H8Q A;  1OC8 A;  5CRG A;  2KOK A;  4MJC A;  3PGT A;  1JLW A;  2IFQ A;  2E2M A;  2HNL A;  1OVN A;  3GRX A;  1PX6 A;  1R4W A;  2H76 A;  3GUS A;  3DIE A;  3CTG A;  1A23 A;  1G0T A;  2H1B A;  1F6M C;  4V2N A;  4F9Z A;  1PMT A;  3CTF A;  2LEG A;  4NPB A;  4YQU A;  4POM A;  2LTK A;  1QUW A;  3IE3 A;  9GSS A;  2WUL A;  3VWW A;  2JAD A;  4TRX A;  2FWF A;  3LYP A;  3IPZ A;  2GZZ A;  3SBC A;  2E7P A;  2X8C A;  2CAQ A;  3M8N A;  3TJB A;  1XWC A;  2R4V A;  5CRD A;  4D73 A;  1QGV A;  2YV9 A;  1XWB A;  3VPQ A;  3FEU A;  5G2Z A;  3ZYW A;  4O32 A;  2VL3 A;  2C0E A;  1XBS A;  2PVQ A;  4KF9 A;  1XXU A;  3FR3 A;  3UAR A;  3P7X A;  5ECO B;  4PQH A;  1URM A;  4K6X A;  3D6I A;  1BJX A;  4IQA A;  4HQS A;  1ERU A;  4PUF C;  3FY7 A;  2H01 A;  4GTU A;  1OE8 A;  2HLS A;  4KND A;  3G7Y A;  3VK9 A;  4NXI A;  3M9K A;  1PX7 A;  5DDL A;  3IA1 A;  3C8E A;  4XTS A;  5F07 A;  3GH9 A;  3HJM A;  1VF4 A;  1XW9 A;  2HRF A;  4KW6 A;  1GUL A;  4L8E A;  2B5Y A;  2NVL A;  5ID2 B;  2LKU A;  3LEF A;  1ZGN A;  4L0W A;  3F0I A;  2HZE B;  3DKS A;  3FZ5 A;  4V2L A;  2YV7 A;  1M3J A;  5IPG A;  6GSX A;  4L5O A;  3HY2 A;  3A2V A;  1KTE A;  5GZZ B;  2DJ0 A;  2VCQ A;  3ME8 A;  3WD6 A;  1Z6M A;  2AAW A;  4G19 A;  2YWI A;  2BMX A;  3HVV A;  5JCG A;  2I4A A;  4GRF A;  4FYU A;  1ZYE A;  2H1A A;  4G0I A;  2WB9 A;  1TK8 B;  5HFK A;  2GST A;  3CRT A;  1X9M B;  1NHO A;  5J9B A;  2MBS A;  2DKI A;  3QFA C;  3HVN A;  1WE0 A;  1XW6 A;  2OE1 A;  4MNN A;  1IYI A;  2LS5 A;  1LJR A;  2YWO A;  2KHP A;  3RPP A;  2P5Q A;  3APO A;  3Q74 A;  3DWV A;  3QPM A;  3WT2 A;  1GSD A;  2REM A;  1XW5 A;  2P0G A;  2ZCT A;  2K6V A;  4MDC A;  1KNG A;  1A2M A;  2PBJ A;  3J7Y k;  3GTU B;  1SEN A;  2CZ3 A;  2VCT A;  1TU8 A;  3GST A;  4EIP A;  2IMF A;  2YNX A;  4ULX A;  1G7E A;  4HEA 2;  4ICY A;  3G7J A;  2VCZ A;  2HZF A;  5JCW A;  3P90 A;  1R5P A;  2H30 A;  3QDN A;  2CX3 A;  3TJF A;  4KSM A;  1FAA A;  2YOI A;  4POL A;  2VO4 A;  4ECJ A;  4KCA A;  2F51 A;  2DIZ A;  3IAM 2;  5E4W A;  1M0U A;  3A5I A;  3VWU A;  3M1G A;  2WGR A;  1J9B A;  2IMK A;  1XFL A;  3TDG A;  2L6C A;  1XVQ A;  1WMJ A;  3HA9 A;  4JR4 A;  5CO3 A;  2H0G A;  5J5N A;  4MZC A;  3KM6 A;  4DSQ A;  1EV4 A;  3LW9 A;  4EF0 A;  1FVK A;  2PUK C;  3IHQ A;  2R6K A;  2VLU A;  2E0Q A;  4JU5 A;  2VCW A;  2LQO A;  2MYG A;  3QMX A;  4IVF A;  1USB A;  1B9Y C;  6GSY A;  4OCF A;  4GSS A;  4CHS A;  20GS A;  3E9J B;  2VL2 A;  5DBQ A;  1AQV A;  2B7K A;  3LYK A;  1VRS D;  2FY6 A;  2NTO A;  4YQV A;  3KH9 A;  3M9J A;  5ENU A;  2I3Y A;  2ON7 A;  4XS6 A;  2DKH A;  1QFN A;  3I9V 2;  3VPT A;  2VAF A;  2HSM A;  3PPU A;  2H1G A;  4ML6 A;  5D8I A;  3GL5 A;  5F06 A;  2NBS A;  3GMF A;  10GS A;  1PD2 1;  3C1S A;  4O5U A;  5AIS A;  5KN0 A;  1MDK A;  4H86 A;  2HSY A;  4I6X A;  3QAV A;  4FYC A;  4IP6 A;  1B9X C;  3PIN A;  1J08 A;  3D4M A;  4BL7 B;  2OBK A;  2B1K A;  1PA3 A;  1K0A A;  2ES7 A;  4JR6 A;  2DJ1 A;  4KUN A;  4O5Q A;  3OR5 A;  4TXO B;  2UZ8 A;  3IK9 A;  4RI6 A;  1XWK A;  1V40 A;  4HZ2 A;  4KSO A;  3AY8 A;  4O7H A;  1EOH A;  1MEK A;  1T1V A;  2FUG 2;  4Q5Q A;  3FR6 A;  3WYW A;  1PN9 A;  5D9V A;  2IMI A;  3HXS A;  2H74 A;  1A2J A;  2FWE A;  1O73 A;  2IPA A;  5IMC A;  1SK0 A;  4GF0 A;  2LST A;  3ISO A;  4GQF A;  3EU3 A;  1OKT A;  2ON5 A;  1FVJ A;  4Z2T A;  1YF0 A;  1DE1 A;  3DYR A;  4AF2 A;  1WPI A;  2GSR A;  4OO4 A;  2PU9 C;  2TIR A;  1T4Y A;  4ID0 A;  4X43 A;  5DJM A;  1LU4 A;  1GWC A;  1AQW A;  4DSS B;  1ZYQ B;  1YF1 A;  3UBK A;  1FG4 A;  3GSS A;  1B4Q A;  5ECK B; 
#chains in the Genus database with same CATH homology
 3QAG A;  2DJ3 A;  4P3Y B;  1BQ7 A;  5IIZ A;  4Z2R A;  3GN3 A;  4LL4 B;  4EE0 A;  1MD4 A;  2HRN A;  3HZ4 A;  2FGX A;  2PWJ A;  1DUG A;  3FZ9 A;  4XHM A;  4IN0 A;  1OC9 B;  3HJP A;  2OKA A;  5ABR A;  1V57 A;  4XRD A;  1M9B A;  2ALB A;  3N9J A;  16GS A;  4F0C A;  1GNE A;  3CMI A;  2CVB A;  1TRU A;  1O8W A;  3HJO A;  2AYT A;  3VLN A;  1FOV A;  2L5O A;  4GCI A;  2LRT A;  3TCO A;  3LGC A;  4G9H A;  1MD3 A;  3TKS C;  1XVW A;  1THX A;  5HFG A;  3HDC A;  2DJJ A;  4MK3 A;  2RM6 A;  2AB6 A;  2HXK A;  3Q19 A;  1WJK A;  5ECN B;  4EXJ A;  2J23 A;  4JED A;  1N8J A;  3DD3 A;  1UA5 A;  2LQQ A;  2VD0 A;  4OWY A;  2X8H A;  5E59 A;  1NSW A;  4E8E A;  3UBL A;  4K2X A;  4OMV A;  3EVI A;  1G6Y A;  1O7U A;  1ZL9 A;  2KUC A;  3QOU A;  2HT9 A;  3KJY A;  4EKZ A;  3EIN A;  2GQL A;  1TI1 A;  4ZIL A;  4DEJ A;  4TR1 A;  1GTA A;  2OAD A;  1O6J A;  4EO3 A;  2I1U A;  2DJ2 A;  4ZXG A;  5FT3 A;  2JU5 A;  1ILO A;  1VF2 A;  1OYJ A;  4EUY A;  2PN8 A;  3QR6 A;  3RHB A;  4HJ2 A;  2MMA A;  5ECQ B;  3FMW A;  1PKW A;  13GS A;  3GFK A;  5DAK B;  1SL1 B;  4TKY A;  3VFI A;  2VM1 A;  5C04 A;  2FA8 A;  3K8N A;  1JZD A;  4YH2 A;  1JZR A;  1GUK A;  3KD0 A;  1TRV A;  5J9C A;  1UVZ A;  2EIO A;  3LWA A;  5JWQ B;  3IBH A;  1EEM A;  2YN1 A;  4ZBB A;  2TRX A;  1S3A A;  3LSZ A;  4FIW A;  5KN1 A;  1ZCP A;  2L4Q A;  3GX0 A;  1HNB A;  1CQG A;  2H0I A;  1TI3 A;  4MPG A;  3NZN A;  22GS A;  1XPV A;  1GRX A;  2H6Y A;  5IPH A;  1BG5 A;  1GH2 A;  3D0Z A;  4FH8 A;  2JZR A;  2M46 A;  5B8A A;  3RHC A;  4PTS A;  3R3E A;  5CYY A;  5B6M A;  1RK4 A;  4WBR D;  4J2F A;  3U6V A;  1GTB A;  4USS A;  3UMA A;  6GSU A;  5HFI A;  1GSS A;  4K7O A;  2VL9 A;  2N5A A;  5FHI A;  3A3T A;  5A4U A;  1GL8 A;  2HRA A;  1O8X A;  3ZVJ D;  1UN2 A;  3HZ8 A;  3TOU A;  2GSQ A;  2H6X A;  3ZZX A;  1ST9 A;  5KOX A;  4MLY A;  4N0V A;  3IAS 2;  5IO2 A;  1YDK A;  1B8X A;  5G5E A;  4I8B A;  1R26 A;  1YY7 A;  1SD9 A;  5B8B A;  1ACV A;  1Z6N A;  3EU4 A;  1JFU A;  1X9W B;  4NV2 A;  5EY6 A;  2VCX A;  2A2R A;  4Q5F A;  5D9T A;  1Y6E A;  4DVC A;  2HI7 A;  5BMU A;  1YKA A;  3EUR A;  3ERG A;  2DJK A;  5DCG A;  2L5L A;  3MIX A;  4JE1 A;  5LCZ A;  1U88 A;  4MJB A;  1AW9 A;  3L9V A;  3GKX A;  1PKZ A;  3EPT A;  1AQX A;  5D96 A;  2R37 A;  5KN3 A;  3IR4 A;  4RI7 A;  2C3N A;  2YJH A;  4WR5 A;  5ID2 A;  3ZTL A;  3TRX A;  1M7T A;  3BD2 A;  3NIV A;  3QAW A;  2HZE A;  3GKN A;  4POK A;  2LRC A;  3KP8 A;  1O85 A;  1T7P B;  1OAZ A;  5ECR B;  2AV4 A;  4K7N A;  4CY8 A;  2DLX A;  1GSF A;  4Z2U A;  1F9M A;  3D4T A;  1ON4 A;  4G0L A;  1GSU A;  1OKD A;  2GTU A;  1XOA A;  2R3X A;  2YJ7 A;  5G30 A;  1Z7R A;  3MDK A;  4KH7 A;  1PRX A;  2LUS A;  3TOT A;  2D2Z A;  4ISD A;  4Q5R A;  1Z7P A;  4TR4 A;  1Y25 A;  1A0R P;  3ZML A;  3MAK A;  3O3T A;  4FYB A;  4ZB8 A;  2VLT A;  4XS4 B;  5J3R A;  1SKR B;  1ZZY A;  1QXH A;  2TRC P;  4IBP A;  2I81 A;  1AUC A;  2WS2 A;  1GUM A;  1FW1 A;  1H4O A;  5H5Q A;  1OE7 A;  2P31 A;  3ED3 A;  2C0D A;  3EYT A;  1DE2 A;  1FB6 A;  3UOM A;  3ZFL A;  1X5D A;  1S3C A;  2DMM A;  1KEB A;  3L9S A;  2L6D A;  1JZW A;  2YWM A;  4BVY A;  2EIR A;  5F0G A;  3RDW A;  3GYK A;  5INY A;  3MWH A;  4XRA A;  3VI7 A;  1BAY A;  2C3Q A;  2OAC A;  2VOC A;  5D73 A;  1HNA A;  1PN0 A;  2X4A A;  1YZX A;  4LL1 B;  2YAN A;  4O5R A;  4O92 A;  5JWR B;  5DAL A;  1UC7 A;  1QMV A;  1XOB A;  1SJZ A;  4J57 E;  3IC4 A;  5COH A;  3P2A A;  1YEX A;  4PUA A;  4F0B A;  3UAP A;  4K2D A;  1AC1 A;  1M99 A;  1ML6 A;  3DEX A;  5D9X A;  3UIW A;  4JBB A;  2C8U A;  5DVB A;  1SYR A;  2JZS A;  1T3B A;  1TU7 A;  1SD8 A;  6GSV A;  2Z9S A;  2GLR A;  5LNK e;  4NHZ A;  3F6F A;  3MNG A;  1A0F A;  2A2S A;  2DIY A;  3F63 A;  1DBY A;  4WBJ A;  4EDZ A;  5HR0 A;  3GIX A;  5IMA A;  4MH3 A;  1SKW B;  4N11 A;  1A8L A;  2B5X A;  4KAE A;  3FZ4 A;  4PX1 A;  4TW5 A;  5F8B A;  3TJG A;  2QA2 A;  1Z5Y E;  2BTO T;  1A8Y A;  2JL4 A;  3A5W A;  3F9U A;  1H75 A;  4G10 A;  3BCK A;  3TUE A;  4BL7 A;  3U5R E;  2H6Z A;  4V1A g;  3TRP A;  3E3E A;  4FO5 A;  1PSQ A;  2C80 A;  1WOU A;  3BJ5 A;  1GP1 A;  4OFN A;  2FLS A;  5J41 A;  4BA7 A;  19GS A;  3LOR A;  1V98 A;  3SWL A;  1X9S B;  4K7I A;  4IJI A;  4RQR A;  2WCI A;  4QL9 A;  2R0C A;  2YWN A;  2WFC A;  3UJ1 A;  4KCE A;  4N0Z A;  2LV3 A;  3O6T A;  1GLP A;  3L9U A;  1U3I A;  1W4V A;  2F8F A;  1M9A A;  2R0G A;  1TW9 A;  2GDR A;  1M2B A;  3VI5 A;  3DRN A;  3DML A;  11GS A;  4K5R A;  2FHE A;  18GS A;  2XC2 A;  2O89 A;  2XPE A;  2I9H A;  1ERT A;  2C0F A;  3ZIT A;  1I5G A;  1HNC A;  3QCP A;  1CQH A;  1BED A;  4I97 A;  2K9F A;  5G5F A;  5IMD A;  1XIY A;  2G0F A;  3FRC A;  1TXX A;  17GS A;  2F9S A;  5H5S A;  3GH6 A;  1WWJ A;  3HHV A;  3RPN A;  5HR1 A;  1VGL A;  1X0R A;  1G6W A;  1WIK A;  3Q6O A;  3PR8 A;  1HQO A;  4IP1 A;  5IMF A;  1ZMA A;  4X1U A;  2YP6 A;  2L57 A;  2PVO C;  4ACS A;  1R5A A;  4HU7 A;  1THO A;  3L4N A;  5A4V A;  1SL2 B;  1JHB A;  1YJ6 A;  2F8A A;  1AAZ A;  4GWR A;  2JAC A;  4QQ7 A;  4BVX B;  3H93 A;  2CT6 A;  5IM9 A;  2OE0 A;  4CDO A;  3TKS A;  3C71 A;  3EC3 A;  2R0P A;  3JCM L;  4MJA A;  1NM3 A;  1JZO A;  2LJK A;  3FHK A;  2V6K A;  1OC9 A;  2YZH A;  2V2G A;  1TRS A;  5HQP A;  3DXB A;  4K0N A;  1V2A A;  3WGX A;  4CW9 A;  4Q5N A;  2ZUP A;  2X99 A;  3KEB A;  2H1D A;  1U3A A;  6GSW A;  2NPB A;  4F2I A;  1GSQ A;  4G0K A;  4K9Z A;  4GXZ A;  5DJL A;  1EZK A;  4EIQ A;  4MH2 A;  4WR4 A;  2B6M A;  1SJ6 A;  4KDU A;  4X0X A;  5G31 A;  5IOW A;  3BCI A;  2HSH A;  1MDI A;  1TTZ A;  3BOA A;  5KOW A;  2C4J A;  3C7M A;  2CX4 A;  2IL3 A;  3US3 A;  3W8J A;  3E0U A;  1VF1 A;  4V2M A;  2O7K A;  4IJ3 A;  2M72 A;  4NAX A;  3IV4 A;  2L4C A;  4ZL9 A;  3G9B A;  4K0G A;  3M3M A;  1GNW A;  2NDO A;  2GZP A;  3TRQ A;  1R7H A;  4ILF A;  5GSS A;  1ABA A;  1TOF A;  1FB0 A;  2DML A;  1A24 A;  1XWA A;  3V1W A;  3C1R A;  4HJM A;  3Q18 A;  4AJ8 A;  3QFB C;  2XBQ A;  4MPF A;  1PL2 A;  3CRU A;  2A2P A;  2O87 A;  2IFQ B;  2P5R A;  2VIM A;  3IHG A;  5ECH B;  1TK5 B;  2XBI A;  4YKF A;  2N5B A;  2V1M A;  2IME A;  5G1L A;  2GQM A;  3HVX A;  3GKK A;  3WGD A;  4HQZ A;  3DVX A;  1SK1 A;  3H1N A;  3QD9 A;  3APS A;  3D5J A;  4YKG A;  1B4P A;  4XS1 A;  1FOH A;  2R2J A;  3TKP A;  3KTB A;  2FWG A;  2K18 A;  2JSZ A;  3MSZ A;  2G2Q A;  1GSY A;  2PGT A;  5CRH A;  5DAK A;  5EL8 A;  3I6A A;  4D73 B;  3KCM A;  2DSA A;  3ZLP A;  2LJR A;  2X8G A;  3G7I A;  1AIU A;  1F2E A;  1YEP A;  5F05 A;  4ZBD A;  4PXO A;  2C0G A;  3FZA A;  2JSY A;  3CSJ A;  4KDY A;  5EPF A;  1VF3 A;  3CBU A;  3O76 A;  5KEJ A;  5JCU A;  4TOP A;  1I9D A;  1SL0 B;  4YAV A;  4ECC A;  5ECL B;  3LQ7 A;  4MP4 A;  3F4S A;  5C00 A;  2H66 A;  3CXG A;  5GAN D;  1TK0 B;  3P8W A;  3L78 A;  2H73 A;  2DBC A;  4OFM A;  4EVM A;  3KXO A;  4MF5 A;  3IXR A;  2CQ9 A;  2AJQ B;  2RLI A;  2L59 A;  5CAX A;  4YQM A;  3D22 A;  2CV4 A;  2KP1 A;  1TKD B;  3ZRD A;  3KZQ A;  3TKR A;  4TR0 A;  3LJR A;  1TDI A;  3KTL A;  4NMU A;  2HFD A;  4A5P A;  5HR3 A;  1EP8 A;  3IRA A;  4PNG A;  4JZQ A;  4MZB A;  2ZNM A;  4MZW A;  2PER A;  2XPD A;  3IOS A;  3CSI A;  1RQM A;  1EGO A;  3M0F A;  1XZO A;  4DSR A;  3D21 A;  2B3S A;  3TB2 A;  5FWG A;  2H19 A;  3LXT A;  5IMZ A;  3F3Q A;  3FKF A;  3GHA A;  1KBN A;  2C1Y A;  4RUV A;  1W89 A;  3VWV A;  5BRT A;  2CAI A;  3F4T A;  1SU9 A;  2KP2 A;  1EEJ A;  4F03 A;  1AXD A;  1EOG A;  1QQ2 A;  2CA8 A;  2PMT A;  4OCE A;  2VUP A;  1ERV A;  1EV9 A;  5KN2 A;  4QL7 A;  4Z7X A;  3H79 A;  3ZL5 A;  2WJU A;  3EE2 A;  2AHE A;  4ZL8 A;  3APQ A;  1WRY A;  1Q4J A;  1F37 A;  3R2Q A;  4WXT A;  4LA1 A;  2VCV A;  4IKH A;  4WET A;  1K3L A;  4TN8 A;  4ZIJ A;  3F3R A;  3GUR A;  1TJD A;  4ZB9 A;  4MCU A;  5HR2 A;  3ZRE A;  3GA4 A;  2MMZ A;  2IJY A;  4ZB6 A;  3KH7 A;  6GST A;  3S9F A;  3LG6 A;  2CZ2 A;  5DQS A;  5CRE A;  5ELG A;  2GVP A;  3F6D A;  1GSE A;  3IK7 A;  3LFL A;  8GSS A;  3PH9 A;  1BX9 A;  3DVW A;  1SK2 A;  12GS A;  5L71 A;  3FR9 A;  3F8U A;  4L5L A;  4HI7 A;  2H8L A;  2MBT A;  4OO5 A;  1ZOF A;  2VD1 A;  2CVK A;  4XCS A;  1XCC A;  3KGK A;  2WRT A;  3GTU A;  2GSS A;  1K0C A;  2FWH A;  5ECI B;  3TJJ A;  5B7C A;  4AJ6 A;  4XS4 A;  4BVY B;  2LJA A;  4GSN A;  4RQX A;  4TXV A;  2IWT A;  3IC8 A;  1O81 A;  3HVS A;  4X4J A;  3GL3 A;  5DCH A;  2DC5 A;  5G1K A;  2GQK A;  5DAL B;  4HU9 A;  2GGT A;  4ECB A;  1PQN A;  4MF6 A;  4KDX A;  2WZ9 A;  3F4R A;  1MTC A;  5ECP B;  2VLV A;  1F3B A;  4G2E A;  4WEY A;  2O8V B;  1A2L A;  4NWY A;  3GV1 A;  4KB3 A;  4HS1 A;  3ERF A;  4I5Q A;  4F82 A;  2YPM A;  2MMO A;  2XHF A;  2PPT A;  4PUR A;  1BYE A;  4OD7 A;  3VUR A;  2YCD A;  1Z9H A;  2JZT A;  2YZU A;  5CRW A;  5GAP D;  1T4Z A;  4MAB A;  3UVT A;  5LD0 A;  4NHW A;  3TJK A;  3I43 A;  2IMD A;  4FQU A;  1G7O A;  2EC4 A;  2MMN A;  3FW2 A;  1K0B A;  1ZYP A;  3CYN A;  2J9H A;  1WP0 A;  3ZFB A;  1Q98 A;  1SYX A;  4GQC A;  3ZIJ A;  1OC3 A;  2VL2 C;  5ECS A;  1DSB A;  1PL1 A;  5JWO B;  2C3T A;  4KE3 A;  2QKE A;  3HYP A;  1C72 A;  2HYX A;  4N10 A;  4BPY A;  5AN1 A;  4IGJ A;  3ME7 A;  3BBY A;  4AGS A;  5AIX A;  1NW2 A;  3IDV A;  1Z3E A;  1EGR A;  2BJX A;  1M2A A;  2B5E A;  3KMO A;  2H0H A;  5ECM B;  4TXO A;  2LNS A;  4K8M A;  2QGV A;  4GLT A;  2V6O A;  3EWL A;  4K5S A;  5IO0 A;  1FHE A;  2IIY A;  1GLQ A;  2VM2 A;  4ZBA A;  5AGY A;  3L0H A;  4HOJ A;  4POB A;  4WF5 A;  1GUH A;  4IEL A;  1T00 A;  4IW9 A;  4I2T A;  3TKQ A;  2X49 A;  4IQ1 A;  3NOF A;  4L0U A;  2X64 A;  3EMX A;  2OE3 A;  4V1A p;  3GKM A;  4PGT A;  4E8H A;  4PQI A;  2HE3 A;  1U87 A;  1EP7 A;  2A4H A;  2GT6 A;  4IS0 A;  3C73 A;  2K8V A;  4CY6 A;  3HD5 A;  3MYD A;  4ECI A;  1K3Y A;  1E2Y A;  3ZVJ A;  2H70 A;  1J0F A;  4XIH A;  2H75 A;  2WDU A;  4GST A;  4BWS A;  5B6N A;  3DGQ A;  1NHY A;  2IN3 A;  4YAP A;  3UEM A;  3N5O A;  5IMV A;  4I2U A;  2F3M A;  2H71 A;  2RM5 A;  5A4W A;  3RBT A;  5CP1 A;  3ZIV A;  1TRW A;  4KA0 A;  1MDJ A;  4AJ7 A;  1IYH A;  3HCZ A;  4OFT A;  4LMV A;  4DSS A;  3W6G A;  6GSS A;  1N2A A;  1ERW A;  2GS3 A;  3WT1 A;  1V58 A;  5ELA A;  4MA9 A;  2RUF A;  3GNJ A;  4HUA A;  1JLV A;  4MF7 A;  5IQY A;  4HZ4 A;  5AIV A;  3WGE A;  5A5K A;  2B1L A;  3CSH A;  4NV5 A;  2GZY A;  4J56 E;  4N30 A;  1GTU A;  2N5F A;  5D9W A;  4LLR A;  4HDE A;  1GTI A;  1EWX A;  2FCH A;  4EDY A;  5H5R A;  3A2X A;  1M2D A;  1K3O A;  2B7J A;  1ZYN A;  2QC7 A;  1S3D A;  1QK8 A;  2FA4 A;  3HKR A;  4BVX A;  2O85 A;  5GST A;  1K0D A;  1YKC A;  1LBK A;  2RII A;  4TR3 A;  1B48 A;  3VWX A;  1K0N A;  2V32 A;  2V41 A;  5EVO A;  2FD3 A;  1T8E B;  2R5G A;  3KMN A;  2QSI A;  3ERW A;  1YQ1 A;  3FYG A;  4JRR A;  3FK8 A;  2LNT A;  2H72 A;  2OJL A;  3UL3 A;  1K0O A;  1FO5 A;  3TGZ A;  1PGT A;  3EMP A;  4BWQ A;  1TP9 A;  4PNF A;  3TKS E;  2OA7 A;  4MMM A;  4TR1 B;  1F3A A;  3W8S A;  1X5E A;  1RW1 A;  4PQ1 A;  2KLX A;  4IHU A;  3RAZ A;  2CVD A;  2OBI A;  2E2G A;  3ZMK A;  5IOX A;  4MJE A;  14GS A;  4EL1 A;  1X5C A;  5CNW A;  5DQY A;  3UVH A;  4LMW A;  4WF4 A;  5D93 A;  3J7Y b;  1XWG A;  3I69 A;  3A2W A;  4TVE A;  2EIQ A;  1U6T A;  1K0M A;  1SJI A;  3H4K A;  2FNO A;  2MZC A;  2LRN A;  2A4V A;  3LXZ A;  4KX4 A;  1V9W A;  2AUV A;  2GT5 A;  4ZL7 A;  4WKW A;  3KIJ A;  1E6B A;  4EC0 A;  2QA1 A;  7GSS A;  2M80 A;  4K1F A;  3KP9 A;  2K8S A;  4KGI A;  3GX8 A;  2HRK A;  1HD2 A;  2RUE A;  4ML1 A;  1HYU A;  1SKS B;  5J4U A;  3H8Q A;  1OC8 A;  5CRG A;  2KOK A;  4MJC A;  3PGT A;  1JLW A;  2IFQ A;  2E2M A;  2HNL A;  1OVN A;  3GRX A;  1PX6 A;  1R4W A;  2H76 A;  3GUS A;  3DIE A;  3CTG A;  1A23 A;  1G0T A;  2H1B A;  1F6M C;  4V2N A;  4F9Z A;  1PMT A;  3CTF A;  2LEG A;  4NPB A;  4YQU A;  4POM A;  2LTK A;  1QUW A;  3IE3 A;  9GSS A;  2WUL A;  3VWW A;  2JAD A;  4TRX A;  2FWF A;  3LYP A;  3IPZ A;  2GZZ A;  3SBC A;  2E7P A;  2X8C A;  2CAQ A;  3M8N A;  3TJB A;  1XWC A;  2R4V A;  5CRD A;  4D73 A;  1QGV A;  2YV9 A;  1XWB A;  3VPQ A;  3FEU A;  5G2Z A;  3ZYW A;  4O32 A;  2VL3 A;  2C0E A;  1XBS A;  2PVQ A;  4KF9 A;  1XXU A;  3FR3 A;  3UAR A;  3P7X A;  5ECO B;  4PQH A;  1URM A;  4K6X A;  3D6I A;  1BJX A;  4IQA A;  4HQS A;  1ERU A;  4PUF C;  3FY7 A;  2H01 A;  4GTU A;  1OE8 A;  2HLS A;  4KND A;  3G7Y A;  3VK9 A;  4NXI A;  3M9K A;  1PX7 A;  5DDL A;  3IA1 A;  3C8E A;  4XTS A;  5F07 A;  3GH9 A;  3HJM A;  1VF4 A;  1XW9 A;  2HRF A;  4KW6 A;  1GUL A;  4L8E A;  2B5Y A;  2NVL A;  5ID2 B;  2LKU A;  3LEF A;  1ZGN A;  4L0W A;  3F0I A;  2HZE B;  3DKS A;  3FZ5 A;  4V2L A;  2YV7 A;  5IPG A;  6GSX A;  4L5O A;  3HY2 A;  3A2V A;  1KTE A;  5GZZ B;  2DJ0 A;  2VCQ A;  3ME8 A;  3WD6 A;  1Z6M A;  2AAW A;  4G19 A;  2YWI A;  2BMX A;  3HVV A;  5JCG A;  2I4A A;  4GRF A;  4FYU A;  1ZYE A;  2H1A A;  4G0I A;  2WB9 A;  1TK8 B;  5HFK A;  2GST A;  3CRT A;  1X9M B;  1NHO A;  5J9B A;  2MBS A;  2DKI A;  3QFA C;  1WE0 A;  1XW6 A;  2OE1 A;  4MNN A;  1IYI A;  2LS5 A;  1LJR A;  2YWO A;  2KHP A;  3RPP A;  2P5Q A;  3APO A;  3Q74 A;  3DWV A;  3QPM A;  3WT2 A;  1GSD A;  2REM A;  1XW5 A;  2P0G A;  2ZCT A;  2K6V A;  4MDC A;  1KNG A;  1A2M A;  2PBJ A;  3J7Y k;  3GTU B;  1SEN A;  2CZ3 A;  2VCT A;  1TU8 A;  3GST A;  4EIP A;  2IMF A;  2YNX A;  4ULX A;  1G7E A;  4HEA 2;  4ICY A;  3G7J A;  2VCZ A;  2HZF A;  5JCW A;  3P90 A;  1R5P A;  2H30 A;  3QDN A;  2CX3 A;  3TJF A;  4KSM A;  1FAA A;  2YOI A;  4POL A;  2VO4 A;  4ECJ A;  4KCA A;  2F51 A;  2DIZ A;  3IAM 2;  5E4W A;  1M0U A;  3A5I A;  3VWU A;  3M1G A;  2WGR A;  1J9B A;  2IMK A;  1XFL A;  3TDG A;  2L6C A;  1XVQ A;  1WMJ A;  3HA9 A;  4JR4 A;  5CO3 A;  2H0G A;  5J5N A;  4MZC A;  3KM6 A;  4DSQ A;  1EV4 A;  3LW9 A;  4EF0 A;  1FVK A;  2PUK C;  3IHQ A;  2R6K A;  2VLU A;  2E0Q A;  4JU5 A;  2VCW A;  2LQO A;  2MYG A;  3QMX A;  4IVF A;  1USB A;  1B9Y C;  6GSY A;  4OCF A;  4GSS A;  4CHS A;  20GS A;  3E9J B;  2VL2 A;  5DBQ A;  1AQV A;  2B7K A;  3LYK A;  1VRS D;  2FY6 A;  2NTO A;  4YQV A;  3KH9 A;  3M9J A;  5ENU A;  2I3Y A;  2ON7 A;  4XS6 A;  2DKH A;  1QFN A;  3I9V 2;  3VPT A;  2VAF A;  2HSM A;  3PPU A;  2H1G A;  4ML6 A;  5D8I A;  3GL5 A;  5F06 A;  2NBS A;  3GMF A;  10GS A;  1PD2 1;  3C1S A;  4O5U A;  5AIS A;  5KN0 A;  1MDK A;  4H86 A;  2HSY A;  4I6X A;  3QAV A;  4FYC A;  4IP6 A;  1B9X C;  3PIN A;  1J08 A;  3D4M A;  4BL7 B;  2OBK A;  2B1K A;  1PA3 A;  1K0A A;  2ES7 A;  4JR6 A;  2DJ1 A;  4KUN A;  4O5Q A;  3OR5 A;  4TXO B;  2UZ8 A;  3IK9 A;  4RI6 A;  1XWK A;  1V40 A;  4HZ2 A;  4KSO A;  3AY8 A;  4O7H A;  1EOH A;  1MEK A;  1T1V A;  2FUG 2;  4Q5Q A;  3FR6 A;  3WYW A;  1PN9 A;  5D9V A;  2IMI A;  3HXS A;  2H74 A;  1A2J A;  2FWE A;  1O73 A;  2IPA A;  5IMC A;  1SK0 A;  4GF0 A;  2LST A;  3ISO A;  4GQF A;  3EU3 A;  1OKT A;  2ON5 A;  1FVJ A;  4Z2T A;  1YF0 A;  1DE1 A;  3DYR A;  4AF2 A;  1WPI A;  2GSR A;  4OO4 A;  2PU9 C;  2TIR A;  1T4Y A;  4ID0 A;  4X43 A;  5DJM A;  1LU4 A;  1GWC A;  1AQW A;  4DSS B;  1ZYQ B;  1YF1 A;  3UBK A;  1FG4 A;  3GSS A;  1B4Q A;  5ECK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...