2DLXA

Solution structure of the uas domain of human ubx domain-containing protein 7
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
153
structure length
153
Chain Sequence
GSSGSSGIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLVEWHQLDVSSFLDQVTGFLGEHGQLDGLSSSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UBX domain-containing protein 7
publication title Solution structure of the UAS domain of human UBX domain-containing protein 7
rcsb
source organism Homo sapiens
total genus 23
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13899 Thioredoxin_7 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2dlxA01
3GX0A 2VUPA 1ZMAA 5F8BA 3N5OA 5E59A 2YCDA 2H0GA 4MF6A 5B8AA 4WKWA 2C4JA 5B7CA 2D2ZA 5HFKA 5G30A 4ISDA 1B4PA 1M99A 3KJYA 1KBNA 1T4ZA 3QD9A 2R37A 1BEDA 1SU9A 4MZBA 3QDNA 1HNBA 4KCAA 2NBSA 1XZOA 2N5AA 2KLXA 3ED3A 4XS1A 3F6FA 2LNSA 1O6JA 2WDUA 1ERTA 1EP7A 4OWYA 6GSVA 5F07A 1JZRA 2RUEA 3UVHA 3D22A 3TOUA 2F9SA 5B8BA 3RPNA 4ECCA 5L71A 5CAXA 3TJKA 2IMKA 1TI1A 2FGXA 2JSYA 1ERUA 1YDKA 3VPQA 2EIRA 16GSA 1SL0B 2V41A 3QOUA 2F8AA 3DVXA 2V2GA 2FWGA 2A4VA 3HVVA 1URMA 2GLRA 3M3MA 4AJ7A 4ECJA 1FB0A 3FYGA 5ECHB 5IPHA 3KIJA 1EGRA 2G0FA 6GSXA 2LKUA 1X5CA 1DE1A 2R3XA 3W8JA 4EKZA 1EV9A 1QMVA 2B6MA 1IYIA 3ZLPA 4OD7A 1WWJA 2I81A 3HKRA 4KUNA 4BVXA 10GSA 2F8FA 4RI7A 4KSMA 1R26A 5A4UA 4JZQA 3ZMKA 4MPGA 3CMIA 2HNLA 1XWBA 3APSA 3F4RA 1WP0A 5GSTA 3UARA 5JCGA 4NXIA 4F9ZA 1K0NA 2KHPA 3LGCA 2VL2C 2K8VA 3MWHA 1GL8A 3D6IA 5GZZB 3TGZA 2FA4A 5AISA 2LNTA 2C8UA 3E0UA 5ELGA 4F03A 3GKMA 3BJ5A 1WIKA 4CDOA 5DVBA 1ZGNA 1GSQA 2H30A 1SK1A 1YJ6A 2X8CA 3UBKA 2ZCTA 2GS3A 4IQ1A 1G7OA 5IO2A 2I1UA 1PKZA 1RW1A 4MH2A 4TXVA 2X99A 4GSNA 1FG4A 1FW1A 4V1Ap 3F8UA 5IMCA 4I2UA 3TKSA 3ZIVA 2MZCA 4V2NA 1B48A 2DC5A 4N0VA 4ZXGA 4TRXA 3AY8A 3CYNA 4ML6A 2L57A 2VL3A 1R4WA 3LJRA 1YY7A 2WCIA 14GSA 4FYCA 4IBPA 2C1YA 4TOPA 4RI6A 5DCHA 1Z6MA 1WPIA 4FO5A 2CQ9A 3M8NA 3I43A 2PUKC 2RM5A 2VCTA 4PUFC 3K8NA 4OO4A 1K0OA 1HNAA 2DSAA 3HYPA 1GTAA 4FIWA 4WETA 2CX4A 1W4VA 1ON4A 2V6KA 2L5LA 2I3YA 2OA7A 2P0GA 3EMXA 5D93A 5KN2A 3IDVA 4N11A 1VF4A 4NHWA 1VF3A 3H8QA 5A4WA 3IK7A 3IXRA 5JWRB 3UL3A 5J4UA 5LNKe 1A23A 1XWAA 1PX7A 3QCPA 3TKQA 4MH3A 2WFCA 1XW5A 4X1UA 1F37A 4NMUA 5HR0A 4JU5A 5JWQB 2GZPA 2JL4A 5AGYA 2ZNMA 2V1MA 3CBUA 3FZ5A 2IIYA 3GH9A 4MK3A 4PGTA 1THOA 4MCUA 4TXOB 5IOWA 3CXGA 3SWLA 5GAPD 4IHUA 5KEJA 3IK9A 3IOSA 1Z7PA 2LV3A 3EURA 5DJMA 2PGTA 3E3EA 2J23A 12GSA 4GQFA 4KDXA 3TCOA 3ZITA 3FKFA 3VWUA 18GSA 4K0NA 5HQPA 1X0RA 1PSQA 2LRCA 1AQVA 4MPFA 4K7IA 1A24A 1VF1A 2XC2A 2DMMA 4NWYA 3QR6A 2OE3A 4X0XA 2JZTA 3ZZXA 3CSJA 2H73A 4PUAA 1ACVA 1EP8A 2H0IA 4JR4A 1O8WA 1GH2A 2GDRA 2H19A 4MZWA 3GSSA 3OR5A 1ZZYA 4KE3A 3GX8A 1TI3A 2BJXA 5B6MA 2MYGA 5DCGA 4WBJA 3L4NA 1GSDA 3J7Yk 3GL5A 4KAEA 4GXZA 1ZYEA 2VM1A 6GSWA 5IOXA 4F0CA 3GTUA 5D9XA 5J9CA 3A3TA 5D73A 3MNGA 5ECPB 3HDCA 1PL1A 1OC3A 1GSUA 1LU4A 3P2AA 3NZNA 1JHBA 1TK5B 2YV7A 2DMLA 5IMFA 5J5NA 5DJLA 3C71A 4HDEA 3HJOA 5KN3A 2GSQA 2CZ3A 4BA7A 3BOAA 3D4MA 1YF0A 4O32A 1PMTA 3KCMA 3LG6A 2B1LA 1OC9A 2JZRA 1EGOA 4FH8A 2H1DA 1SK2A 2CVBA 5D8IA 2VL2A 4DEJA 1K0BA 4OCEA 1XW9A 2HFDA 3LXTA 2FUG2 2PPTA 2CT6A 1S3DA 1DSBA 2AUVA 2N5BA 2GGTA 4LL4B 5ECOB 1AUCA 4CHSA 1MD3A 2FWHA 5IMZA 3A2VA 1Z5YE 1A2MA 1SJIA 4F2IA 2HLSA 4HZ2A 3A5WA 2XHFA 1MDIA 2LJRA 3TUEA 1M2BA 3GTUB 2YZUA 2WGRA 2YN1A 4I5QA 3E9JB 20GSA 4Q5QA 4K6XA 4KDUA 2LRTA 4EDZA 3RHCA 1TW9A 2X64A 3L9SA 4O5RA 1AXDA 4XTSA 5CRDA 1TKDB 1BAYA 8GSSA 2VCVA 4NAXA 2KOKA 1OKTA 4N10A 2A2SA 1OC9B 2DJ2A 2HRFA 1U3IA 1V57A 4HJ2A 2IFQA 2PVOC 4POMA 1PGTA 3TKPA 3UVTA 4XS4A 4GLTA 3GL3A 1M2AA 1WE0A 1SD9A 4GTUA 1DBYA 4HU7A 2GQLA 1GLPA 1YEPA 2OE0A 1LJRA 3ERFA 3F3QA 1E2YA 2K8SA 3F63A 3VFIA 5ECMB 1HD2A 2FY6A 1EV4A 5H5QA 5G31A 2VOCA 4JR6A 1RQMA 4IGJA 2C80A 5IPGA 4D73A 3ZVJA 3EMPA 1XWKA 3A2XA 4HQZA 4MZCA 3US3A 2FA8A 4XRDA 2HXKA 4TR1B 5G2ZA 2H6YA 5FWGA 2DIZA 3GKKA 2H76A 3ZREA 4NHZA 3APQA 5G1LA 1AC1A 1TOFA 5E4WA 2HSYA 2YWMA 4XS6A 5ECKB 2BTOT 5COHA 3U6VA 3C73A 2HE3A 4FYUA 4POKA 2DJ3A 3EINA 5JCUA 3PH9A 3QMXA 3DKSA 3P90A 1ZOFA 1AQXA 3ME7A 3H93A 5A5KA 1ST9A 3VWWA 3FRCA 2CVKA 2MMNA 4IS0A 4OCFA 3H1NA 2TRCP 4NV2A 4F82A 2R6KA 1T00A 3UAPA 2IFQB 1GRXA 4MJAA 2KUCA 4K7OA 4IQAA 3IE3A 3UOMA 5JWOB 4L5OA 1QK8A 2C0EA 4KDYA 4XS4B 1F6MC 3FR9A 1O85A 1Z9HA 2GTUA 6GSSA 4PXOA 3ZVJD 1Y6EA 4J57E 1FO5A 1M9BA 4KA0A 9GSSA 3IC4A 4JBBA 3TOTA 4KCEA 2LQQA 1T4YA 1SKSB 4D73B 1J0FA 1MEKA 1XVQA 2KP1A 5CYYA 1OE7A 3QFAC 3ZFBA 4TN8A 3C8EA 1U3AA 4EO3A 3I6AA 1PL2A 2VCZA 1GUKA 1A8YA 5AIVA 1S3CA 1TU8A 2B7JA 4Z7XA 5DALA 4HU9A 4POLA 2J9HA 2DJ0A 3LEFA 1GSSA 3EE2A 3IBHA 3Q6OA 1Q98A 1K0AA 1EEMA 5GAND 3O3TA 1E6BA 1X9SB 3ISOA 3PGTA 4ML1A 1O8XA 5AIXA 1GSEA 4MJCA 1R7HA 1F3AA 5INYA 2CA8A 4ULXA 1SENA 4ZBAA 2GZZA 2O87A 5F06A 2H1AA 3CRUA 1GUHA 4EF0A 4TXOA 5H5RA 4LL1B 3WGXA 3KTBA 4K9ZA 3F4SA 4AJ8A 3QFBC 2I4AA 5KN0A 3D0ZA 2RLIA 4IKHA 1TRWA 1N8JA 3RHBA 4WBRD 4ZIJA 1MD4A 3VWXA 1CQGA 2CAQA 2HZFA 2REMA 5JCWA 1EEJA 2OKAA 3HHVA 3QPMA 4ECIA 2VCQA 3G7YA 4PURA 4PQHA 1A0RP 3UJ1A 4LA1A 2QGVA 4J2FA 4PX1A 4RQXA 4QL9A 4EE0A 2FLSA 3KZQA 5AN1A 1SL1B 1AQWA 3GFKA 22GSA 1TXXA 4YH2A 2VLTA 2FHEA 5DALB 3EWLA 1QGVA 4MLYA 3LORA 1G6YA 1WJKA 5B6NA 2H1BA 4V1Ag 4EVMA 3TKSE 5EY6A 4LMVA 4HUAA 1QFNA 1XCCA 1B9XC 5ECSA 3WGDA 3U5RE 2AAWA 3HZ8A 2VO4A 3HD5A 5FT3A 2L5OA 1V9WA 2H72A 4PNFA 3KTLA 1UN2A 4DSRA 3DVWA 4XCSA 3IRAA 3HJPA 3LFLA 4ZB6A 3F3RA 4TR0A 3M9KA 2IMFA 4GWRA 3ERGA 1SKWB 4HQSA 3GKXA 2O85A 2C3TA 2HRNA 2LRNA 2B5YA 3WT1A 3TJJA 3M9JA 4I97A 2MMAA 2EIQA 5FHIA 1DE2A 5IIZA 4WXTA 2PERA 3DEXA 2YOIA 4OFMA 2LEGA 2H66A 4EDYA 2IL3A 2C0GA 4TR4A 4ZILA 3WT2A 1Y25A 2FWFA 1UVZA 3GUSA 4HOJA 1CQHA 1X9MB 4XIHA 2DLXA 3DWVA 1YKCA 2M72A 1V2AA 5C04A 1SJ6A 3KMOA 3TRQA 3EC3A 5KN1A 3DGQA 2HYXA 3HXSA 1OAZA 3O76A 2WULA 3GSTA 2YPMA 3KD0A 2JACA 2OJLA 2E2GA 4QQ7A 4V2LA 4N30A 3IR4A 1Q4JA 2TRXA 3RDWA 1UA5A 5HFIA 4ECBA 5D9WA 5DDLA 3DMLA 4IELA 3PINA 2E2MA 2QKEA 3LXZA 1Z3EA 6GSTA 4GRFA 2JADA 3A2WA 2DJJA 1X9WB 4YQUA 3J7Yb 3H79A 2QC7A 4AGSA 1AW9A 4K1FA 3FZAA 2NPBA 3KGKA 2WJUA 3UEMA 2L4QA 1XXUA 3ME8A 5HR3A 3RPPA 4WR4A 3LYPA 3RAZA 2H01A 1R5PA 5G5FA 1NHYA 3FEUA 1A2LA 2VD0A 2VL9A 4PQ1A 3VURA 3ZRDA 1Z7RA 1AAZA 2OE1A 2R5GA 4MJEA 1OC8A 2OBIA 2LTKA 1MDKA 2LUSA 5IMVA 3F9UA 1FB6A 2CX3A 4XHMA 3TRXA 3DD3A 1GWCA 1ABAA 2AHEA 4KB3A 2GT5A 4L8EA 1PKWA 4MDCA 4MF5A 2R4VA 4TR1A 1JLVA 3KH7A 4NV5A 1T1VA 1GTUA 2H75A 1SK0A 1VF2A 3GHAA 2C0FA 4ACSA 1K0DA 2H0HA 3TKSC 3FZ4A 2H6ZA 2RM6A 1M0UA 4LLRA 4L5LA 5F0GA 5EVOA 1M2DA 3GURA 1F3BA 3ZTLA 1FOVA 4I8BA 4J56E 3HJMA 1T8EB 2H71A 2IJYA 1UC7A 1GLQA 1TRVA 4PNGA 5DQYA 4IW9A 5CRWA 3QAVA 4GCIA 1A2JA 1B8XA 2ON5A 2DBCA 4LMWA 4MMMA 2LJAA 4GSTA 2L59A 4K8MA 4ZL8A 5A4VA 5HR2A 4ILFA 4BL7A 2MMOA 3LWAA 1TDIA 1K3YA 2GVPA 1EOHA 1HQOA 1GNEA 4HS1A 2OACA 3O6TA 1ML6A 1SYXA 3VPTA 1H4OA 2PU9C 3ZIJA 2IMIA 2M46A 5HFGA 1OYJA 3VI7A 4HEA2 7GSSA 1O81A 3HCZA 5IMDA 3CSIA 2WB9A 1TRSA 1QUWA 2PVQA 3ZMLA 2WS2A 1BX9A 1XBSA 2QSIA 5LCZA 2K6VA 4HZ4A 1BQ7A 3P7XA 4JRRA 2B5EA 4G10A 1VGLA 3QAGA 2VCWA 1R5AA 3TJGA 4GSSA 3BD2A 2M80A 3Q19A 2YWNA 2A2RA 4EUYA 4ZL7A 3HVSA 5DQSA 3CTGA 2YP6A 5LD0A 3F0IA 1GNWA 1XVWA 2IMDA 3HA9A 4XRAA 2P31A 3ERWA 5D96A 2DJ1A 1V58A 2X8GA 4AJ6A 4GQCA 4CW9A 3C1RA 2V6OA 4MABA 4HJMA 2WRTA 1TU7A 3VLNA 5CRGA 2K18A 4OFTA 3MSZA 2DIYA 1O73A 2RIIA 4YAPA 2HI7A 1W89A 4POBA 4V2MA 3EU3A 4I6XA 3PR8A 3C7MA 5ECQB 4OO5A 4E8HA 4YQVA 2GQMA 3TB2A 1J08A 1THXA 1AIUA 1WRYA 3HVXA 1XWCA 1SKRB 2VD1A 3BCKA 2P5QA 3UIWA 1USBA 1NM3A 4I2TA 1TK8B 3IPZA 1GUMA 2MBSA 1SL2B 2G2QA 2ALBA 2GT6A 5ECNB 2DJKA 4YQMA 1ZCPA 1I9DA 5ELAA 4OFNA 3MDKA 1A8LA 1OVNA 4EXJA 5CO3A 3V1WA 1X5EA 3F6DA 5CRHA 4HI7A 2HZEA 1Z6NA 1EZKA 3IV4A 5DAKA 1B9YC 1LBKA 4O92A 1M9AA 3KH9A 2HT9A 3MAKA 2V32A 3GA4A 4KNDA 2HSHA 4RUVA 1BYEA 3LQ7A 2FD3A 5CP1A 1PN9A 4AF2A 3IHQA 3GRXA 3Q74A 1JZOA 3APOA 11GSA 3EU4A 1OE8A 4IP1A 4IVFA 1O7UA 3N9JA 1DUGA 3FZ9A 4K7NA 4KH7A 5J3RA 1XFLA 2GZYA 1ERVA 3GKNA 4Q5NA 3L78A 2B5XA 3LSZA 4L0UA 1TK0B 1TJDA 3DXBA 4DVCA 3KEBA 4ZL9A 4Q5FA 3R2QA 3DYRA 1MTCA 2R2JA 2GSRA 1WMJA 2YJHA 3WYWA 5G5EA 1U6TA 1N2AA 4KX4A 4BPYA 3LYKA 1XOBA 3D21A 2VIMA 1XPVA 2TIRA 1F2EA 2AV4A 1BG5A 3FR6A 1M7TA 2FCHA 2YWIA 1QQ2A 1JZWA 4WR5A 5ID2A 3EYTA 2VCXA 2GSTA 2HZEB 19GSA 1OKDA 2H74A 2PBJA 1S3AA 4MA9A 3QAWA 1HNCA 5IM9A 1TRUA 4KW6A 3CRTA 1PD21 5DAKB 3DRNA 3CTFA 1PRXA 3IAM2 3ZFLA 2L6CA 1J9BA 5F05A 1T7PB 2NTOA 2LS5A 1JZDA 2H1GA 5GSSA 1GSYA 3FK8A 5ABRA 5DBQA 2GSSA 2YJ7A 4GF0A 3BBYA 2RUFA 4ID0A 4IJIA 4TKYA 2KP2A 5CREA 1K3LA 2YV9A 3VI5A 3GH6A 3NIVA 2PN8A 2H70A 3GIXA 3TJFA 4WEYA 2OADA 1NHOA 2JZSA 1YKAA 3W8SA 4K0GA 4ZB9A 4DSQA 1K3OA 3KP8A 2YZHA 2LJKA 2CAIA 1GULA 1RK4A 5ECLB 1SD8A 3WD6A 2CZ2A 2MMZA 4N0ZA 17GSA 1GSFA 1FVJA 1XW6A 2CVDA 5HR1A 3FR3A 1IYHA 1PQNA 3G9BA 1YEXA 3KP9A 2AB6A 4G2EA 3HY2A 3L9UA 4MP4A 3L9VA 3G7JA 4H86A 4Q5RA 1XIYA 1XWGA 3I9V2 1K0MA 3CSHA 4G9HA 5ID2B 1GTIA 2O8VB 3FW2A 2I9HA 5CNWA 2BMXA 3IAS2 3C1SA 1K0CA 3IA1A 5EL8A 3G7IA 1MDJA 1KNGA 3VWVA 4O7HA 2WZ9A 2PMTA 5H5SA 3M0FA 2ES7A 2ZUPA 3BCIA 4IP6A 2P5RA 4FYBA 3I69A 2K9FA 2O7KA 1TP9A 2H6XA 4TVEA 3GN3A 1KEBA 3GYKA 2AJQB 2FNOA 3KM6A 3TKRA 3NOFA 2VLUA 3D4TA 3P8WA 1XOAA 2IWTA 2E7PA 3M1GA 1I5GA 4MJBA 2XPEA 3D5JA 1NW2A 4RQRA 4MF7A 5J9BA 4L0WA 3EVIA 1V98A 2ON7A 2AYTA 1TTZA 1YZXA 5D9VA 4DSSA 5C00A 13GSA 2YNXA 2IN3A 2NVLA 1ERWA 3KMNA 4IJ3A 1GTBA 5EPFA 1SYRA 3DIEA 2F3MA 1GP1A 4ZBBA 3UBLA 5D9TA 2GQKA 2JSZA 2VM2A 4F0BA 1ZL9A 2XBQA 4JE1A 1FHEA 1JLWA 2OBKA 3SBCA 2F51A 3UMAA 1ZYQB 3FY7A 6GSUA 4NPBA 3GMFA 4BWQA 2H8LA 1EWXA 2C3NA 3S9FA 1ILOA 2EC4A 2XBIA 2L4CA 3JCML 2B7KA 1HYUA 3KXOA 4QL7A 2Z9SA 5J41A 4EC0A 2IPAA 1F9MA 1X5DA 1JFUA 2E0QA 3W6GA 1T3BA 4PQIA 1WOUA 4P3YB 2EIOA 2NDOA 2FWEA 1SJZA 2X8HA 3VK9A 6GSYA 3ZYWA 2N5FA 1V40A 2YWOA 4TR3A 5IMAA 1U88A 4ZB8A 5IQYA 1NSWA 2VLVA 3L0HA 1G6WA 3F4TA 4EL1A 1G7EA 2B3SA 3RBTA 1EOGA 5IO0A 1BJXA 2MBTA 4KSOA 3TJBA 5ENUA 3GNJA 1FVKA 4KGIA 2C0DA 2L6DA 1FAAA 4BVYA 2CV4A 4WF4A 1H75A 1B4QA 1VRSD 4DSSB 4TW5A 4BWSA 1A0FA 1C72A 3GV1A 1U87A 3TRPA 1QXHA 1PX6A 4JEDA 2XPDA 2C3QA 4WF5A 3ZL5A 1YF1A 2IMEA 5ECRB 2PWJA 5ECIB 4K2DA 1G0TA 1PA3A 2JU5A 3TDGA 1KTEA 3H4KA 2LQOA 4YAVA 4ZBDA 3WGEA 4E8EA 2LSTA 3HZ4A 2YANA 2O89A 4OMVA 4IN0A 2VAFA 4G19A 3Q18A 1YQ1A 2B1KA 5G1KA 4X43A 3FHKA
chains in the Genus database with same CATH superfamily
3GX0A 2VUPA 1ZMAA 5F8BA 3N5OA 5E59A 2YCDA 2H0GA 4MF6A 5B8AA 4WKWA 2C4JA 5B7CA 2D2ZA 5HFKA 5G30A 4ISDA 1B4PA 1M99A 3KJYA 1KBNA 1T4ZA 3QD9A 2R37A 1BEDA 1SU9A 4MZBA 3QDNA 1HNBA 4KCAA 2NBSA 1XZOA 2N5AA 2KLXA 3ED3A 4XS1A 3F6FA 2LNSA 1O6JA 2WDUA 1ERTA 1EP7A 4OWYA 6GSVA 5F07A 1JZRA 2RUEA 3UVHA 3D22A 3TOUA 2F9SA 5B8BA 3RPNA 4ECCA 5L71A 5CAXA 3TJKA 2IMKA 1TI1A 2FGXA 2JSYA 1ERUA 1YDKA 3VPQA 2EIRA 16GSA 1SL0B 2V41A 3QOUA 2F8AA 3DVXA 2V2GA 2FWGA 2A4VA 3HVVA 1URMA 2GLRA 3M3MA 4AJ7A 4ECJA 1FB0A 3FYGA 5ECHB 5IPHA 3KIJA 1EGRA 2G0FA 6GSXA 2LKUA 1X5CA 1DE1A 2R3XA 3W8JA 4EKZA 1EV9A 1QMVA 2B6MA 1IYIA 3ZLPA 4OD7A 1WWJA 2I81A 3HKRA 4KUNA 4BVXA 10GSA 2F8FA 4RI7A 4KSMA 1R26A 5A4UA 4JZQA 3ZMKA 4MPGA 3EPTA 3CMIA 2HNLA 1XWBA 3APSA 3F4RA 1WP0A 5GSTA 3UARA 5JCGA 4NXIA 4F9ZA 1K0NA 2KHPA 3LGCA 2VL2C 2K8VA 3MWHA 1GL8A 3D6IA 5GZZB 3TGZA 2FA4A 5AISA 2LNTA 2C8UA 3E0UA 1M3IA 5ELGA 4F03A 3GKMA 3BJ5A 1WIKA 4CDOA 5DVBA 1ZGNA 1GSQA 2H30A 1SK1A 1YJ6A 2X8CA 3UBKA 2ZCTA 2GS3A 4IQ1A 1G7OA 5IO2A 2I1UA 1PKZA 2DKIA 1RW1A 4MH2A 4TXVA 4G0LA 2X99A 4GSNA 1FG4A 1FW1A 4V1Ap 3F8UA 5IMCA 4I2UA 3TKSA 3ZIVA 2MZCA 4V2NA 1B48A 2DC5A 4N0VA 4ZXGA 4TRXA 3AY8A 3CYNA 4ML6A 2L57A 3MIXA 2VL3A 1R4WA 3LJRA 1YY7A 2WCIA 14GSA 4FYCA 4IBPA 2C1YA 4TOPA 4RI6A 5DCHA 1Z6MA 1WPIA 4FO5A 2CQ9A 3M8NA 3I43A 2PUKC 2RM5A 2VCTA 4PUFC 3K8NA 4OO4A 1K0OA 1HNAA 2DSAA 3HYPA 1GTAA 4FIWA 4WETA 2CX4A 1W4VA 1ON4A 4EIPA 2V6KA 2L5LA 2I3YA 2OA7A 2P0GA 3EMXA 5D93A 5KN2A 3IDVA 4N11A 1VF4A 4NHWA 1VF3A 3H8QA 5A4WA 3IK7A 3IXRA 5JWRB 3UL3A 5J4UA 5LNKe 1A23A 1XWAA 1PX7A 3QCPA 3TKQA 4MH3A 2WFCA 1XW5A 4X1UA 1F37A 4NMUA 5HR0A 4JU5A 5JWQB 2GZPA 2JL4A 5AGYA 2ZNMA 2V1MA 3CBUA 3FZ5A 2IIYA 3GH9A 4MK3A 2UZ8A 4PGTA 1THOA 4MCUA 4TXOB 5IOWA 3CXGA 3SWLA 5GAPD 4IHUA 5KEJA 3IK9A 3IOSA 1Z7PA 2LV3A 3EURA 5DJMA 2PGTA 3E3EA 2J23A 12GSA 4GQFA 4KDXA 3TCOA 3ZITA 3FKFA 3VWUA 18GSA 4K0NA 5HQPA 1X0RA 1PSQA 2LRCA 1AQVA 4MPFA 4K7IA 1A24A 1VF1A 2XC2A 2DMMA 4NWYA 3QR6A 2OE3A 4X0XA 2JZTA 3ZZXA 3CSJA 2H73A 4PUAA 1ACVA 1EP8A 2H0IA 2X49A 4JR4A 1O8WA 1GH2A 2GDRA 2H19A 4MZWA 3GSSA 3OR5A 1ZZYA 4KE3A 3GX8A 1TI3A 2BJXA 5B6MA 2MYGA 5DCGA 4WBJA 3L4NA 1GSDA 3J7Yk 3GL5A 4KAEA 4GXZA 2HSMA 1ZYEA 2VM1A 6GSWA 5IOXA 4F0CA 3GTUA 5D9XA 5J9CA 4A5PA 4K5SA 3A3TA 5D73A 3MNGA 5ECPB 3HDCA 1PL1A 1OC3A 1GSUA 1LU4A 3P2AA 3NZNA 1JHBA 1TK5B 2YV7A 2DMLA 5IMFA 5J5NA 5DJLA 3C71A 4HDEA 3HJOA 5KN3A 2GSQA 2CZ3A 4BA7A 3BOAA 3D4MA 1YF0A 4O32A 1PMTA 3KCMA 3LG6A 2B1LA 1OC9A 2JZRA 1EGOA 4FH8A 4CY8A 2H1DA 1SK2A 2CVBA 5D8IA 2VL2A 4DEJA 1K0BA 4OCEA 1XW9A 2HFDA 3LXTA 2HRAA 2FUG2 2PPTA 2CT6A 3PPUA 1S3DA 1DSBA 2AUVA 2N5BA 2GGTA 4LL4B 5ECOB 1AUCA 4CHSA 1MD3A 2FWHA 5IMZA 3A2VA 1Z5YE 1A2MA 1SJIA 4F2IA 2HLSA 4HZ2A 3A5WA 2XHFA 1MDIA 2LJRA 3TUEA 1M2BA 1PN0A 3GTUB 2YZUA 2WGRA 2YN1A 4I5QA 3E9JB 20GSA 4Q5QA 4K6XA 4KDUA 2LRTA 4EDZA 3RHCA 1TW9A 2X64A 3L9SA 4O5RA 1AXDA 4XTSA 5CRDA 1TKDB 5KOXA 1BAYA 8GSSA 2VCVA 4NAXA 2KOKA 1OKTA 4N10A 2A2SA 1OC9B 2DJ2A 2HRFA 1U3IA 1V57A 4HJ2A 2IFQA 2PVOC 4POMA 1PGTA 3TKPA 3UVTA 4XS4A 4GLTA 3GL3A 1M2AA 1WE0A 1SD9A 4GTUA 1DBYA 4HU7A 2GQLA 1GLPA 1YEPA 2OE0A 1LJRA 3ERFA 3F3QA 2DKHA 2QA1A 1E2YA 2K8SA 3F63A 3VFIA 5ECMB 1HD2A 2FY6A 1EV4A 5H5QA 5G31A 2VOCA 4JR6A 1RQMA 4IGJA 2C80A 5IPGA 4D73A 3ZVJA 3EMPA 1XWKA 3A2XA 4HQZA 4MZCA 3US3A 2FA8A 4XRDA 2HXKA 4TR1B 5G2ZA 2H6YA 5FWGA 2DIZA 3GKKA 2H76A 3ZREA 4NHZA 3APQA 5G1LA 3HVNA 1AC1A 1TOFA 5E4WA 2HSYA 2YWMA 4XS6A 5ECKB 2BTOT 5COHA 3U6VA 3C73A 2HE3A 4FYUA 4POKA 2DJ3A 3EINA 5JCUA 3PH9A 3QMXA 3DKSA 3P90A 1ZOFA 1AQXA 3ME7A 3H93A 5A5KA 1ST9A 3VWWA 3FRCA 4Z2TA 2CVKA 2MMNA 4IS0A 4OCFA 3H1NA 2TRCP 4NV2A 4F82A 2R6KA 1T00A 3UAPA 2IFQB 1GRXA 4MJAA 2KUCA 4K7OA 4IQAA 3IE3A 3UOMA 5JWOB 4L5OA 1QK8A 2C0EA 4KDYA 4XS4B 1F6MC 3FR9A 1O85A 1Z9HA 2GTUA 6GSSA 4PXOA 3ZVJD 1Y6EA 4J57E 1FO5A 4FQUA 1M9BA 4KA0A 9GSSA 3IC4A 4JBBA 3TOTA 4KCEA 2LQQA 1T4YA 1SKSB 4D73B 1J0FA 1MEKA 1XVQA 2KP1A 5CYYA 1OE7A 3QFAC 3ZFBA 4TN8A 3C8EA 1U3AA 4EO3A 3I6AA 1PL2A 2VCZA 1GUKA 1A8YA 1S3CA 1TU8A 2B7JA 4Z7XA 5AIVA 5DALA 4HU9A 4POLA 2J9HA 2DJ0A 3LEFA 1GSSA 3EE2A 3IBHA 3Q6OA 1Q98A 1K0AA 1EEMA 5GAND 3O3TA 1E6BA 1FOHA 1X9SB 3ISOA 3PGTA 3MYDA 4ML1A 1O8XA 5AIXA 1GSEA 4MJCA 1R7HA 1F3AA 5INYA 2CA8A 4ULXA 1SENA 4ZBAA 2GZZA 2O87A 5F06A 2H1AA 3CRUA 1GUHA 4EF0A 4TXOA 5H5RA 4LL1B 3WGXA 3KTBA 4K9ZA 3F4SA 1S3RA 4AJ8A 3QFBC 2I4AA 5KN0A 3D0ZA 2RLIA 4IKHA 1TRWA 3R3EA 1N8JA 3RHBA 4WBRD 3IHGA 4ZIJA 1MD4A 3VWXA 1CQGA 2CAQA 2HZFA 2REMA 5JCWA 1EEJA 2OKAA 3HHVA 3QPMA 4ECIA 2VCQA 3G7YA 4PURA 4PQHA 1A0RP 3UJ1A 4LA1A 2QGVA 4J2FA 4PX1A 4RQXA 4QL9A 4EE0A 2FLSA 3KZQA 4EIQA 5AN1A 1SL1B 1AQWA 3GFKA 22GSA 1TXXA 4YH2A 2VLTA 2FHEA 5DALB 3EWLA 1QGVA 4MLYA 3LORA 1G6YA 2R0PA 1WJKA 5B6NA 2H1BA 4V1Ag 4EVMA 3TKSE 5EY6A 4LMVA 4HUAA 1QFNA 1XCCA 1B9XC 5ECSA 3WGDA 3U5RE 2AAWA 3HZ8A 2VO4A 2R0GA 3HD5A 5FT3A 2L5OA 1V9WA 2H72A 4PNFA 3KTLA 1UN2A 4DSRA 3DVWA 4XCSA 3IRAA 3HJPA 2QA2A 3LFLA 4ZB6A 3F3RA 4TR0A 3A5IA 3M9KA 2IMFA 4GWRA 3ERGA 1SKWB 4HQSA 3GKXA 2O85A 2C3TA 2HRNA 2LRNA 2B5YA 3WT1A 3TJJA 3M9JA 4I97A 2MMAA 2EIQA 5FHIA 1DE2A 5IIZA 4WXTA 2PERA 3DEXA 2YOIA 4OFMA 2LEGA 2H66A 4EDYA 2IL3A 2C0GA 4TR4A 4ZILA 3WT2A 1Y25A 2FWFA 1UVZA 3GUSA 4HOJA 1CQHA 1X9MB 4XIHA 2DLXA 3DWVA 1YKCA 2M72A 1V2AA 5C04A 1SJ6A 3KMOA 3TRQA 3EC3A 5KN1A 3DGQA 2HYXA 3HXSA 1OAZA 3O76A 2WULA 3GSTA 2YPMA 3KD0A 2JACA 2OJLA 2E2GA 4QQ7A 4V2LA 4N30A 3IR4A 1Q4JA 2TRXA 3RDWA 1UA5A 4HSCX 5HFIA 4ECBA 5D9WA 5DDLA 3DMLA 4IELA 3PINA 2E2MA 2QKEA 3LXZA 1Z3EA 6GSTA 1PFOA 4GRFA 2X4AA 2JADA 3A2WA 2DJJA 1X9WB 4YQUA 3J7Yb 4USSA 3H79A 2QC7A 4AGSA 1AW9A 4K1FA 3FZAA 2NPBA 3KGKA 2WJUA 3UEMA 2L4QA 1XXUA 3ME8A 5HR3A 3RPPA 4WR4A 3LYPA 3RAZA 2H01A 1R5PA 5G5FA 1NHYA 3FEUA 1A2LA 2VD0A 2VL9A 4PQ1A 3LW9A 3VURA 3ZRDA 1Z7RA 1AAZA 2OE1A 2R5GA 4MJEA 1OC8A 2OBIA 2LTKA 1MDKA 2LUSA 5IMVA 3F9UA 1FB6A 2CX3A 4XHMA 3TRXA 3DD3A 1GWCA 1ABAA 2AHEA 4KB3A 2GT5A 4L8EA 1PKWA 4MDCA 4MF5A 2R4VA 4TR1A 1JLVA 3KH7A 4NV5A 3CQFA 1T1VA 1GTUA 2H75A 4PTSA 1SK0A 1VF2A 3GHAA 2C0FA 4ACSA 1K0DA 2H0HA 3TKSC 3FZ4A 2H6ZA 2RM6A 1M0UA 4LLRA 4L5LA 5F0GA 5EVOA 1M2DA 3GURA 1F3BA 3ZTLA 1FOVA 4I8BA 4J56E 4BIKA 3HJMA 1T8EB 2H71A 2IJYA 1UC7A 1GLQA 1TRVA 4PNGA 5DQYA 4IW9A 5CRWA 3QAVA 4GCIA 1A2JA 1B8XA 2ON5A 2DBCA 4LMWA 4MMMA 2LJAA 4GSTA 2L59A 4K8MA 4ZL8A 5A4VA 5HR2A 4ILFA 4MNNA 4K2XA 1ZYPA 4BL7A 2MMOA 3LWAA 1TDIA 1K3YA 2GVPA 4K5RA 1EOHA 1HQOA 1GNEA 4HS1A 2OACA 3O6TA 1ML6A 1SYXA 3VPTA 1H4OA 2PU9C 3ZIJA 2IMIA 2M46A 5HFGA 1OYJA 3VI7A 4HEA2 7GSSA 1O81A 3HCZA 5IMDA 3CSIA 2WB9A 1TRSA 1QUWA 2PVQA 3ZMLA 2WS2A 1BX9A 1XBSA 2QSIA 5LCZA 2K6VA 4HZ4A 1BQ7A 3P7XA 4JRRA 2B5EA 4G10A 1VGLA 3QAGA 2VCWA 1R5AA 3TJGA 4GSSA 5BMUA 3BD2A 2M80A 3Q19A 2YWNA 2A2RA 4EUYA 4ZL7A 3HVSA 5DQSA 3CTGA 2YP6A 5LD0A 3F0IA 1GNWA 1XVWA 2IMDA 3HA9A 4XRAA 2P31A 3ERWA 5D96A 2DJ1A 1V58A 2X8GA 4AJ6A 4GQCA 4CW9A 3C1RA 2V6OA 4MABA 4HJMA 2WRTA 1TU7A 3VLNA 5CRGA 2K18A 4OFTA 4BL7B 3MSZA 2DIYA 1O73A 2RIIA 4YAPA 2HI7A 1W89A 4BVYB 4POBA 4V2MA 3EU3A 4I6XA 3PR8A 3C7MA 5ECQB 4OO5A 4E8HA 4YQVA 2GQMA 3TB2A 1J08A 1THXA 1AIUA 1WRYA 3HVXA 1XWCA 1SKRB 2VD1A 3BCKA 2P5QA 3UIWA 1USBA 1NM3A 4I2TA 1TK8B 3IPZA 1GUMA 2MBSA 1SL2B 2G2QA 2ALBA 2GT6A 5ECNB 2DJKA 4YQMA 1ZCPA 1I9DA 5ELAA 4OFNA 3MDKA 1A8LA 1OVNA 4EXJA 5CO3A 1XG8A 3V1WA 1X5EA 3F6DA 5CRHA 4HI7A 2HZEA 1Z6NA 5KOWA 4O5QA 1EZKA 3IV4A 5DAKA 1B9YC 1LBKA 4O92A 1M9AA 3KH9A 2HT9A 3MAKA 2V32A 3GA4A 4KNDA 2HSHA 4RUVA 1BYEA 3LQ7A 2FD3A 5CP1A 1PN9A 4AF2A 3IHQA 3GRXA 3Q74A 1JZOA 3APOA 11GSA 4Z2RA 3EU4A 1OE8A 4IP1A 4IVFA 1O7UA 3N9JA 1DUGA 3FZ9A 4K7NA 4KH7A 5J3RA 1XFLA 2GZYA 1ERVA 3GKNA 4Q5NA 4Z2UA 2R0CA 3L78A 2B5XA 3LSZA 4O5UA 4L0UA 1TK0B 1TJDA 3DXBA 4DVCA 3KEBA 4ZL9A 4Q5FA 3R2QA 3DYRA 1MTCA 2R2JA 2GSRA 4KF9A 1WMJA 2YJHA 3WYWA 5G5EA 1U6TA 1N2AA 4KX4A 4BPYA 3LYKA 1XOBA 3D21A 2VIMA 1XPVA 2TIRA 1F2EA 2AV4A 1BG5A 3FR6A 1M7TA 2FCHA 2YWIA 1QQ2A 1JZWA 4WR5A 5ID2A 3EYTA 2VCXA 4BVXB 2GSTA 2HZEB 19GSA 1OKDA 2H74A 2PBJA 1S3AA 4MA9A 3QAWA 1HNCA 5IM9A 1TRUA 4KW6A 3CRTA 1PD21 5DAKB 3DRNA 3CTFA 1PRXA 3IAM2 3ZFLA 2L6CA 1J9BA 5F05A 1T7PB 4CY6A 2NTOA 2LS5A 1JZDA 2H1GA 5GSSA 1GSYA 3FK8A 5ABRA 5DBQA 2GSSA 2YJ7A 4GF0A 3BBYA 2RUFA 4ID0A 4IJIA 4TKYA 2KP2A 5CREA 3IC8A 1K3LA 2YV9A 3VI5A 3GH6A 3NIVA 2PN8A 2H70A 3GIXA 3TJFA 4WEYA 2OADA 1NHOA 2JZSA 1YKAA 3W8SA 4K0GA 4ZB9A 4DSQA 1K3OA 3KP8A 2YZHA 2LJKA 2CAIA 1GULA 1RK4A 5ECLB 1SD8A 3WD6A 2CZ2A 2MMZA 4N0ZA 17GSA 1GSFA 1FVJA 1XW6A 2CVDA 4ICYA 5HR1A 3FR3A 1IYHA 1PQNA 3G9BA 1YEXA 3KP9A 2AB6A 4G2EA 3HY2A 3L9UA 4MP4A 3L9VA 3G7JA 4H86A 4Q5RA 1XIYA 1XWGA 2A4HA 3I9V2 1K0MA 3CSHA 4G9HA 5ID2B 1GTIA 2O8VB 3FW2A 2I9HA 5CNWA 2BMXA 3IAS2 3C1SA 1K0CA 3IA1A 5EL8A 3G7IA 1MDJA 1KNGA 3VWVA 4O7HA 2WZ9A 2PMTA 5H5SA 5BRTA 3M0FA 2ES7A 2ZUPA 3BCIA 1M3JA 4IP6A 2P5RA 4FYBA 3I69A 2K9FA 2O7KA 1TP9A 2H6XA 4TVEA 3GN3A 1KEBA 3GYKA 2AJQB 2FNOA 3KM6A 3TKRA 4YKGA 3NOFA 2VLUA 3D4TA 3P8WA 1XOAA 2IWTA 2E7PA 4G0IA 4YKFA 3M1GA 1I5GA 4MJBA 2XPEA 3D5JA 1NW2A 4RQRA 4MF7A 5J9BA 4L0WA 3EVIA 1V98A 2ON7A 2AYTA 1TTZA 1YZXA 5D9VA 4DSSA 5C00A 4X4JA 4G0KA 13GSA 2YNXA 2IN3A 2NVLA 1ERWA 3KMNA 4IJ3A 1GTBA 5EPFA 1SYRA 3DIEA 2F3MA 1GP1A 4ZBBA 3UBLA 5D9TA 2GQKA 2JSZA 2VM2A 1ZYNA 4F0BA 1ZL9A 2XBQA 4JE1A 1FHEA 1JLWA 2OBKA 3SBCA 2F51A 3UMAA 1ZYQB 3FY7A 6GSUA 4NPBA 3GMFA 4BWQA 2H8LA 1EWXA 2C3NA 3S9FA 1ILOA 2EC4A 2XBIA 2L4CA 3JCML 2B7KA 1HYUA 3KXOA 4QL7A 2Z9SA 5J41A 4EC0A 2IPAA 1F9MA 1X5DA 1JFUA 2E0QA 3W6GA 1T3BA 4PQIA 1WOUA 4P3YB 2EIOA 2NDOA 2FWEA 1SJZA 2X8HA 3VK9A 3FMWA 6GSYA 3ZYWA 2N5FA 1V40A 2YWOA 4TR3A 5IMAA 1U88A 4ZB8A 5IQYA 2HRKA 1NSWA 2VLVA 3L0HA 1G6WA 3F4TA 4EL1A 1G7EA 2B3SA 3RBTA 1EOGA 5IO0A 1BJXA 2MBTA 4KSOA 3TJBA 5ENUA 3GNJA 1FVKA 4KGIA 2C0DA 2L6DA 1FAAA 4BVYA 2CV4A 4WF4A 1H75A 1B4QA 1VRSD 4DSSB 4TW5A 4BWSA 1A0FA 1C72A 3GV1A 1U87A 3TRPA 1QXHA 1PX6A 4JEDA 2XPDA 2C3QA 4WF5A 3ZL5A 1YF1A 2IMEA 5ECRB 2PWJA 5ECIB 4K2DA 1G0TA 1PA3A 2JU5A 3TDGA 1KTEA 3H4KA 2LQOA 4YAVA 4ZBDA 3WGEA 4E8EA 2LSTA 3HZ4A 2YANA 2O89A 4OMVA 4IN0A 2VAFA 4G19A 3Q18A 1YQ1A 2A2PA 2B1KA 5G1KA 4X43A 3FHKA
chains in the Genus database with same CATH topology
3GX0A 2VUPA 1ZMAA 5F8BA 3N5OA 5E59A 2YCDA 2H0GA 4MF6A 5B8AA 4WKWA 2C4JA 5B7CA 2D2ZA 5HFKA 5G30A 4ISDA 1B4PA 1M99A 3KJYA 1KBNA 1T4ZA 3QD9A 2R37A 1BEDA 1SU9A 4MZBA 3QDNA 1HNBA 4KCAA 2NBSA 1XZOA 2N5AA 2KLXA 3ED3A 4XS1A 3F6FA 2LNSA 1O6JA 2WDUA 1ERTA 1EP7A 4OWYA 6GSVA 5F07A 1JZRA 2RUEA 3UVHA 3D22A 3TOUA 2F9SA 5B8BA 3RPNA 4ECCA 5L71A 5CAXA 3TJKA 2IMKA 1TI1A 2FGXA 2JSYA 1ERUA 1YDKA 3VPQA 2EIRA 16GSA 1SL0B 2V41A 3QOUA 2F8AA 3DVXA 2V2GA 2FWGA 2A4VA 3HVVA 1URMA 2GLRA 3M3MA 4AJ7A 4ECJA 1FB0A 3FYGA 5ECHB 5IPHA 3KIJA 1EGRA 2G0FA 6GSXA 2LKUA 1X5CA 1DE1A 2R3XA 3W8JA 4EKZA 1EV9A 1QMVA 2B6MA 1IYIA 3ZLPA 4OD7A 1WWJA 2I81A 3HKRA 4KUNA 4BVXA 10GSA 2F8FA 4RI7A 4KSMA 1R26A 5A4UA 4JZQA 3ZMKA 4MPGA 3EPTA 3CMIA 2HNLA 1XWBA 3APSA 3F4RA 1WP0A 5GSTA 3UARA 5JCGA 4NXIA 4F9ZA 1K0NA 2KHPA 3LGCA 2VL2C 2K8VA 3MWHA 1GL8A 3D6IA 5GZZB 3TGZA 2FA4A 5AISA 2LNTA 2C8UA 3E0UA 5ELGA 4F03A 3GKMA 3BJ5A 1WIKA 4CDOA 5DVBA 1ZGNA 1GSQA 2H30A 1SK1A 1YJ6A 2X8CA 3UBKA 2ZCTA 2GS3A 4IQ1A 1G7OA 5IO2A 2I1UA 1PKZA 2DKIA 1RW1A 4MH2A 4TXVA 4G0LA 2X99A 4GSNA 1FG4A 1FW1A 4V1Ap 3F8UA 5IMCA 4I2UA 3TKSA 3ZIVA 2MZCA 4V2NA 1B48A 2DC5A 4N0VA 4ZXGA 4TRXA 3AY8A 3CYNA 4ML6A 2L57A 3MIXA 2VL3A 1R4WA 3LJRA 1YY7A 2WCIA 14GSA 4FYCA 4IBPA 2C1YA 4TOPA 4RI6A 5DCHA 1Z6MA 1WPIA 4FO5A 2CQ9A 3M8NA 3I43A 2PUKC 2RM5A 2VCTA 4PUFC 3K8NA 4OO4A 1K0OA 1HNAA 2DSAA 3HYPA 1GTAA 4FIWA 4WETA 2CX4A 1W4VA 1ON4A 4EIPA 2V6KA 2L5LA 2I3YA 2OA7A 2P0GA 3EMXA 5D93A 5KN2A 3IDVA 4N11A 1VF4A 4NHWA 1VF3A 3H8QA 5A4WA 3IK7A 3IXRA 5JWRB 3UL3A 5J4UA 5LNKe 1A23A 1XWAA 1PX7A 3QCPA 3TKQA 4MH3A 2WFCA 1XW5A 4X1UA 1F37A 4NMUA 5HR0A 4JU5A 5JWQB 2GZPA 2JL4A 5AGYA 2ZNMA 2V1MA 3CBUA 3FZ5A 2IIYA 3GH9A 4MK3A 2UZ8A 4PGTA 1THOA 4MCUA 4TXOB 5IOWA 3CXGA 3SWLA 5GAPD 4IHUA 5KEJA 3IK9A 3IOSA 1Z7PA 2LV3A 3EURA 5DJMA 2PGTA 3E3EA 2J23A 12GSA 4GQFA 4KDXA 3TCOA 3ZITA 3FKFA 3VWUA 18GSA 4K0NA 5HQPA 1X0RA 1PSQA 2LRCA 1AQVA 4MPFA 4K7IA 1A24A 1VF1A 2XC2A 2DMMA 4NWYA 3QR6A 2OE3A 4X0XA 2JZTA 3ZZXA 3CSJA 2H73A 4PUAA 1ACVA 1EP8A 2H0IA 2X49A 4JR4A 1O8WA 1GH2A 2GDRA 2H19A 4MZWA 3GSSA 3OR5A 1ZZYA 4KE3A 3GX8A 1TI3A 2BJXA 5B6MA 2MYGA 5DCGA 4WBJA 3L4NA 1GSDA 3J7Yk 3GL5A 4KAEA 4GXZA 2HSMA 1ZYEA 2VM1A 6GSWA 5IOXA 4F0CA 3GTUA 5D9XA 5J9CA 4A5PA 4K5SA 3A3TA 5D73A 3MNGA 5ECPB 3HDCA 1PL1A 1OC3A 1GSUA 1LU4A 3P2AA 3NZNA 1JHBA 1TK5B 2YV7A 2DMLA 5IMFA 5J5NA 5DJLA 3C71A 4HDEA 3HJOA 5KN3A 2GSQA 2CZ3A 4BA7A 3BOAA 3D4MA 1YF0A 4O32A 1PMTA 3KCMA 3LG6A 2B1LA 1OC9A 2JZRA 1EGOA 4FH8A 4CY8A 2H1DA 1SK2A 2CVBA 5D8IA 2VL2A 4DEJA 1K0BA 4OCEA 1XW9A 2HFDA 3LXTA 2HRAA 2FUG2 2PPTA 2CT6A 3PPUA 1S3DA 1DSBA 2AUVA 2N5BA 2GGTA 4LL4B 5ECOB 1AUCA 4CHSA 1MD3A 2FWHA 5IMZA 3A2VA 1Z5YE 1A2MA 1SJIA 4F2IA 2HLSA 4HZ2A 3A5WA 2XHFA 1MDIA 2LJRA 3TUEA 1M2BA 1PN0A 3GTUB 2YZUA 2WGRA 2YN1A 4I5QA 3E9JB 20GSA 4Q5QA 4K6XA 4KDUA 2LRTA 4EDZA 3RHCA 1TW9A 2X64A 3L9SA 4O5RA 1AXDA 4XTSA 5CRDA 1TKDB 5KOXA 1BAYA 8GSSA 2VCVA 4NAXA 2KOKA 1OKTA 4N10A 2A2SA 1OC9B 2DJ2A 2HRFA 1U3IA 1V57A 4HJ2A 2IFQA 2PVOC 4POMA 1PGTA 3TKPA 3UVTA 4XS4A 4GLTA 3GL3A 1M2AA 1WE0A 1SD9A 4GTUA 1DBYA 4HU7A 2GQLA 1GLPA 1YEPA 2OE0A 1LJRA 3ERFA 3F3QA 2DKHA 2QA1A 1E2YA 2K8SA 3F63A 3VFIA 5ECMB 1HD2A 2FY6A 1EV4A 5H5QA 5G31A 2VOCA 4JR6A 1RQMA 4IGJA 2C80A 5IPGA 4D73A 3ZVJA 3EMPA 1XWKA 3A2XA 4HQZA 4MZCA 3US3A 2FA8A 4XRDA 2HXKA 4TR1B 5G2ZA 2H6YA 5FWGA 2DIZA 3GKKA 2H76A 3ZREA 4NHZA 3APQA 5G1LA 1AC1A 1TOFA 5E4WA 2HSYA 2YWMA 4XS6A 5ECKB 2BTOT 5COHA 3U6VA 3C73A 2HE3A 4FYUA 4POKA 2DJ3A 3EINA 5JCUA 3PH9A 3QMXA 3DKSA 3P90A 1ZOFA 1AQXA 3ME7A 3H93A 5A5KA 1ST9A 3VWWA 3FRCA 4Z2TA 2CVKA 2MMNA 4IS0A 4OCFA 3H1NA 2TRCP 4NV2A 4F82A 2R6KA 1T00A 3UAPA 2IFQB 1GRXA 4MJAA 2KUCA 4K7OA 4IQAA 3IE3A 3UOMA 5JWOB 4L5OA 1QK8A 2C0EA 4KDYA 4XS4B 1F6MC 3FR9A 1O85A 1Z9HA 2GTUA 6GSSA 4PXOA 3ZVJD 1Y6EA 4J57E 1FO5A 4FQUA 1M9BA 4KA0A 9GSSA 3IC4A 4JBBA 3TOTA 4KCEA 2LQQA 1T4YA 1SKSB 4D73B 1J0FA 1MEKA 1XVQA 2KP1A 5CYYA 1OE7A 3QFAC 3ZFBA 4TN8A 3C8EA 1U3AA 4EO3A 3I6AA 1PL2A 2VCZA 1GUKA 1A8YA 5AIVA 1S3CA 1TU8A 2B7JA 4Z7XA 5DALA 4HU9A 4POLA 2J9HA 2DJ0A 3LEFA 1GSSA 3EE2A 3IBHA 3Q6OA 1Q98A 1K0AA 1EEMA 5GAND 3O3TA 1E6BA 1FOHA 1X9SB 3ISOA 3PGTA 3MYDA 4ML1A 1O8XA 5AIXA 1GSEA 4MJCA 1R7HA 1F3AA 5INYA 2CA8A 4ULXA 1SENA 4ZBAA 2GZZA 2O87A 5F06A 2H1AA 3CRUA 1GUHA 4EF0A 4TXOA 5H5RA 4LL1B 3WGXA 3KTBA 4K9ZA 3F4SA 4AJ8A 3QFBC 2I4AA 5KN0A 3D0ZA 2RLIA 4IKHA 1TRWA 3R3EA 1N8JA 3RHBA 4WBRD 3IHGA 4ZIJA 1MD4A 3VWXA 1CQGA 2CAQA 2HZFA 2REMA 5JCWA 1EEJA 2OKAA 3HHVA 3QPMA 4ECIA 2VCQA 3G7YA 4PURA 4PQHA 1A0RP 3UJ1A 4LA1A 2QGVA 4J2FA 4PX1A 4RQXA 4QL9A 4EE0A 2FLSA 3KZQA 4EIQA 5AN1A 1SL1B 1AQWA 3GFKA 22GSA 1TXXA 4YH2A 2VLTA 2FHEA 5DALB 3EWLA 1QGVA 4MLYA 3LORA 1G6YA 2R0PA 1WJKA 5B6NA 2H1BA 4V1Ag 4EVMA 3TKSE 5EY6A 4LMVA 4HUAA 1QFNA 1XCCA 1B9XC 5ECSA 3WGDA 3U5RE 2AAWA 3HZ8A 2VO4A 2R0GA 3HD5A 5FT3A 2L5OA 1V9WA 2H72A 4PNFA 3KTLA 1UN2A 4DSRA 3DVWA 4XCSA 3IRAA 3HJPA 2QA2A 3LFLA 4ZB6A 3F3RA 4TR0A 3A5IA 3M9KA 2IMFA 4GWRA 3ERGA 1SKWB 4HQSA 3GKXA 2O85A 2C3TA 2HRNA 2LRNA 2B5YA 3WT1A 3TJJA 3M9JA 4I97A 2MMAA 2EIQA 5FHIA 1DE2A 5IIZA 4WXTA 2PERA 3DEXA 2YOIA 4OFMA 2LEGA 2H66A 4EDYA 2IL3A 2C0GA 4TR4A 4ZILA 3WT2A 1Y25A 2FWFA 1UVZA 3GUSA 4HOJA 1CQHA 1X9MB 4XIHA 2DLXA 3DWVA 1YKCA 2M72A 1V2AA 5C04A 1SJ6A 3KMOA 3TRQA 3EC3A 5KN1A 3DGQA 2HYXA 3HXSA 1OAZA 3O76A 2WULA 3GSTA 2YPMA 3KD0A 2JACA 2OJLA 2E2GA 4QQ7A 4V2LA 4N30A 3IR4A 1Q4JA 2TRXA 3RDWA 1UA5A 5HFIA 4ECBA 5D9WA 5DDLA 3DMLA 4IELA 3PINA 2E2MA 2QKEA 3LXZA 1Z3EA 6GSTA 4GRFA 2X4AA 2JADA 3A2WA 2DJJA 1X9WB 4YQUA 3J7Yb 4USSA 3H79A 2QC7A 4AGSA 1AW9A 4K1FA 3FZAA 2NPBA 3KGKA 2WJUA 3UEMA 2L4QA 1XXUA 3ME8A 5HR3A 3RPPA 4WR4A 3LYPA 3RAZA 2H01A 1R5PA 5G5FA 1NHYA 3FEUA 1A2LA 2VD0A 2VL9A 4PQ1A 3LW9A 3VURA 3ZRDA 1Z7RA 1AAZA 2OE1A 2R5GA 4MJEA 1OC8A 2OBIA 2LTKA 1MDKA 2LUSA 5IMVA 3F9UA 1FB6A 2CX3A 4XHMA 3TRXA 3DD3A 1GWCA 1ABAA 2AHEA 4KB3A 2GT5A 4L8EA 1PKWA 4MDCA 4MF5A 2R4VA 4TR1A 1JLVA 3KH7A 4NV5A 1T1VA 1GTUA 2H75A 4PTSA 1SK0A 1VF2A 3GHAA 2C0FA 4ACSA 1K0DA 2H0HA 3TKSC 3FZ4A 2H6ZA 2RM6A 1M0UA 4LLRA 4L5LA 5F0GA 5EVOA 1M2DA 3GURA 1F3BA 3ZTLA 1FOVA 4I8BA 4J56E 3HJMA 1T8EB 2H71A 2IJYA 1UC7A 1GLQA 1TRVA 4PNGA 5DQYA 4IW9A 5CRWA 3QAVA 4GCIA 1A2JA 1B8XA 2ON5A 2DBCA 4LMWA 4MMMA 2LJAA 4GSTA 2L59A 4K8MA 4ZL8A 5A4VA 5HR2A 4ILFA 4MNNA 4K2XA 1ZYPA 4BL7A 2MMOA 3LWAA 1TDIA 1K3YA 2GVPA 4K5RA 1EOHA 1HQOA 1GNEA 4HS1A 2OACA 3O6TA 1ML6A 1SYXA 3VPTA 1H4OA 2PU9C 3ZIJA 2IMIA 2M46A 5HFGA 1OYJA 3VI7A 4HEA2 7GSSA 1O81A 3HCZA 5IMDA 3CSIA 2WB9A 1TRSA 1QUWA 2PVQA 3ZMLA 2WS2A 1BX9A 1XBSA 2QSIA 5LCZA 2K6VA 4HZ4A 1BQ7A 3P7XA 4JRRA 2B5EA 4G10A 1VGLA 3QAGA 2VCWA 1R5AA 3TJGA 4GSSA 5BMUA 3BD2A 2M80A 3Q19A 2YWNA 2A2RA 4EUYA 4ZL7A 3HVSA 5DQSA 3CTGA 2YP6A 5LD0A 3F0IA 1GNWA 1XVWA 2IMDA 3HA9A 4XRAA 2P31A 3ERWA 5D96A 2DJ1A 1V58A 2X8GA 4AJ6A 4GQCA 4CW9A 3C1RA 2V6OA 4MABA 4HJMA 2WRTA 1TU7A 3VLNA 5CRGA 2K18A 4OFTA 4BL7B 3MSZA 2DIYA 1O73A 2RIIA 4YAPA 2HI7A 1W89A 4BVYB 4POBA 4V2MA 3EU3A 4I6XA 3PR8A 3C7MA 5ECQB 4OO5A 4E8HA 4YQVA 2GQMA 3TB2A 1J08A 1THXA 1AIUA 1WRYA 3HVXA 1XWCA 1SKRB 2VD1A 3BCKA 2P5QA 3UIWA 1USBA 1NM3A 4I2TA 1TK8B 3IPZA 1GUMA 2MBSA 1SL2B 2G2QA 2ALBA 2GT6A 5ECNB 2DJKA 4YQMA 1ZCPA 1I9DA 5ELAA 4OFNA 3MDKA 1A8LA 1OVNA 4EXJA 5CO3A 3V1WA 1X5EA 3F6DA 5CRHA 4HI7A 2HZEA 1Z6NA 5KOWA 4O5QA 1EZKA 3IV4A 5DAKA 1B9YC 1LBKA 4O92A 1M9AA 3KH9A 2HT9A 3MAKA 2V32A 3GA4A 4KNDA 2HSHA 4RUVA 1BYEA 3LQ7A 2FD3A 5CP1A 1PN9A 4AF2A 3IHQA 3GRXA 3Q74A 1JZOA 3APOA 11GSA 4Z2RA 3EU4A 1OE8A 4IP1A 4IVFA 1O7UA 3N9JA 1DUGA 3FZ9A 4K7NA 4KH7A 5J3RA 1XFLA 2GZYA 1ERVA 3GKNA 4Q5NA 4Z2UA 2R0CA 3L78A 2B5XA 3LSZA 4O5UA 4L0UA 1TK0B 1TJDA 3DXBA 4DVCA 3KEBA 4ZL9A 4Q5FA 3R2QA 3DYRA 1MTCA 2R2JA 2GSRA 4KF9A 1WMJA 2YJHA 3WYWA 5G5EA 1U6TA 1N2AA 4KX4A 4BPYA 3LYKA 1XOBA 3D21A 2VIMA 1XPVA 2TIRA 1F2EA 2AV4A 1BG5A 3FR6A 1M7TA 2FCHA 2YWIA 1QQ2A 1JZWA 4WR5A 5ID2A 3EYTA 2VCXA 4BVXB 2GSTA 2HZEB 19GSA 1OKDA 2H74A 2PBJA 1S3AA 4MA9A 3QAWA 1HNCA 5IM9A 1TRUA 4KW6A 3CRTA 1PD21 5DAKB 3DRNA 3CTFA 1PRXA 3IAM2 3ZFLA 2L6CA 1J9BA 5F05A 1T7PB 4CY6A 2NTOA 2LS5A 1JZDA 2H1GA 5GSSA 1GSYA 3FK8A 5ABRA 5DBQA 2GSSA 2YJ7A 4GF0A 3BBYA 2RUFA 4ID0A 4IJIA 4TKYA 2KP2A 5CREA 3IC8A 1K3LA 2YV9A 3VI5A 3GH6A 3NIVA 2PN8A 2H70A 3GIXA 3TJFA 4WEYA 2OADA 1NHOA 2JZSA 1YKAA 3W8SA 4K0GA 4ZB9A 4DSQA 1K3OA 3KP8A 2YZHA 2LJKA 2CAIA 1GULA 1RK4A 5ECLB 1SD8A 3WD6A 2CZ2A 2MMZA 4N0ZA 17GSA 1GSFA 1FVJA 1XW6A 2CVDA 4ICYA 5HR1A 3FR3A 1IYHA 1PQNA 3G9BA 1YEXA 3KP9A 2AB6A 4G2EA 3HY2A 3L9UA 4MP4A 3L9VA 3G7JA 4H86A 4Q5RA 1XIYA 1XWGA 2A4HA 3I9V2 1K0MA 3CSHA 4G9HA 5ID2B 1GTIA 2O8VB 3FW2A 2I9HA 5CNWA 2BMXA 3IAS2 3C1SA 1K0CA 3IA1A 5EL8A 3G7IA 1MDJA 1KNGA 3VWVA 4O7HA 2WZ9A 2PMTA 5H5SA 5BRTA 3M0FA 2ES7A 2ZUPA 3BCIA 4IP6A 2P5RA 4FYBA 3I69A 2K9FA 2O7KA 1TP9A 2H6XA 4TVEA 3GN3A 1KEBA 3GYKA 2AJQB 2FNOA 3KM6A 3TKRA 4YKGA 3NOFA 2VLUA 3D4TA 3P8WA 1XOAA 2IWTA 2E7PA 4G0IA 4YKFA 3M1GA 1I5GA 4MJBA 2XPEA 3D5JA 1NW2A 4RQRA 4MF7A 5J9BA 4L0WA 3EVIA 1V98A 2ON7A 2AYTA 1TTZA 1YZXA 5D9VA 4DSSA 5C00A 4X4JA 4G0KA 13GSA 2YNXA 2IN3A 2NVLA 1ERWA 3KMNA 4IJ3A 1GTBA 5EPFA 1SYRA 3DIEA 2F3MA 1GP1A 4ZBBA 3UBLA 5D9TA 2GQKA 2JSZA 2VM2A 1ZYNA 4F0BA 1ZL9A 2XBQA 4JE1A 1FHEA 1JLWA 2OBKA 3SBCA 2F51A 3UMAA 1ZYQB 3FY7A 6GSUA 4NPBA 3GMFA 4BWQA 2H8LA 1EWXA 2C3NA 3S9FA 1ILOA 2EC4A 2XBIA 2L4CA 3JCML 2B7KA 1HYUA 3KXOA 4QL7A 2Z9SA 5J41A 4EC0A 2IPAA 1F9MA 1X5DA 1JFUA 2E0QA 3W6GA 1T3BA 4PQIA 1WOUA 4P3YB 2EIOA 2NDOA 2FWEA 1SJZA 2X8HA 3VK9A 3FMWA 6GSYA 3ZYWA 2N5FA 1V40A 2YWOA 4TR3A 5IMAA 1U88A 4ZB8A 5IQYA 2HRKA 1NSWA 2VLVA 3L0HA 1G6WA 3F4TA 4EL1A 1G7EA 2B3SA 3RBTA 1EOGA 5IO0A 1BJXA 2MBTA 4KSOA 3TJBA 5ENUA 3GNJA 1FVKA 4KGIA 2C0DA 2L6DA 1FAAA 4BVYA 2CV4A 4WF4A 1H75A 1B4QA 1VRSD 4DSSB 4TW5A 4BWSA 1A0FA 1C72A 3GV1A 1U87A 3TRPA 1QXHA 1PX6A 4JEDA 2XPDA 2C3QA 4WF5A 3ZL5A 1YF1A 2IMEA 5ECRB 2PWJA 5ECIB 4K2DA 1G0TA 1PA3A 2JU5A 3TDGA 1KTEA 3H4KA 2LQOA 4YAVA 4ZBDA 3WGEA 4E8EA 2LSTA 3HZ4A 2YANA 2O89A 4OMVA 4IN0A 2VAFA 4G19A 3Q18A 1YQ1A 2A2PA 2B1KA 5G1KA 4X43A 3FHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GX0 A;  2VUP A;  1ZMA A;  5F8B A;  3N5O A;  5E59 A;  2YCD A;  2H0G A;  4MF6 A;  5B8A A;  4WKW A;  2C4J A;  5B7C A;  2D2Z A;  5HFK A;  5G30 A;  4ISD A;  1B4P A;  1M99 A;  3KJY A;  1KBN A;  1T4Z A;  3QD9 A;  2R37 A;  1BED A;  1SU9 A;  4MZB A;  3QDN A;  1HNB A;  4KCA A;  2NBS A;  1XZO A;  2N5A A;  2KLX A;  3ED3 A;  4XS1 A;  3F6F A;  2LNS A;  1O6J A;  2WDU A;  1ERT A;  1EP7 A;  4OWY A;  6GSV A;  5F07 A;  1JZR A;  2RUE A;  3UVH A;  3D22 A;  3TOU A;  2F9S A;  5B8B A;  3RPN A;  4ECC A;  5L71 A;  5CAX A;  3TJK A;  2IMK A;  1TI1 A;  2FGX A;  2JSY A;  1ERU A;  1YDK A;  3VPQ A;  2EIR A;  16GS A;  1SL0 B;  2V41 A;  3QOU A;  2F8A A;  3DVX A;  2V2G A;  2FWG A;  2A4V A;  3HVV A;  1URM A;  2GLR A;  3M3M A;  4AJ7 A;  4ECJ A;  1FB0 A;  3FYG A;  5ECH B;  5IPH A;  3KIJ A;  1EGR A;  2G0F A;  6GSX A;  2LKU A;  1X5C A;  1DE1 A;  2R3X A;  3W8J A;  4EKZ A;  1EV9 A;  1QMV A;  2B6M A;  1IYI A;  3ZLP A;  4OD7 A;  1WWJ A;  2I81 A;  3HKR A;  4KUN A;  4BVX A;  10GS A;  2F8F A;  4RI7 A;  4KSM A;  1R26 A;  5A4U A;  4JZQ A;  3ZMK A;  4MPG A;  3CMI A;  2HNL A;  1XWB A;  3APS A;  3F4R A;  1WP0 A;  5GST A;  3UAR A;  5JCG A;  4NXI A;  4F9Z A;  1K0N A;  2KHP A;  3LGC A;  2VL2 C;  2K8V A;  3MWH A;  1GL8 A;  3D6I A;  5GZZ B;  3TGZ A;  2FA4 A;  5AIS A;  2LNT A;  2C8U A;  3E0U A;  5ELG A;  4F03 A;  3GKM A;  3BJ5 A;  1WIK A;  4CDO A;  5DVB A;  1ZGN A;  1GSQ A;  2H30 A;  1SK1 A;  1YJ6 A;  2X8C A;  3UBK A;  2ZCT A;  2GS3 A;  4IQ1 A;  1G7O A;  5IO2 A;  2I1U A;  1PKZ A;  1RW1 A;  4MH2 A;  4TXV A;  2X99 A;  4GSN A;  1FG4 A;  1FW1 A;  4V1A p;  3F8U A;  5IMC A;  4I2U A;  3TKS A;  3ZIV A;  2MZC A;  4V2N A;  1B48 A;  2DC5 A;  4N0V A;  4ZXG A;  4TRX A;  3AY8 A;  3CYN A;  4ML6 A;  2L57 A;  2VL3 A;  1R4W A;  3LJR A;  1YY7 A;  2WCI A;  14GS A;  4FYC A;  4IBP A;  2C1Y A;  4TOP A;  4RI6 A;  5DCH A;  1Z6M A;  1WPI A;  4FO5 A;  2CQ9 A;  3M8N A;  3I43 A;  2PUK C;  2RM5 A;  2VCT A;  4PUF C;  3K8N A;  4OO4 A;  1K0O A;  1HNA A;  2DSA A;  3HYP A;  1GTA A;  4FIW A;  4WET A;  2CX4 A;  1W4V A;  1ON4 A;  2V6K A;  2L5L A;  2I3Y A;  2OA7 A;  2P0G A;  3EMX A;  5D93 A;  5KN2 A;  3IDV A;  4N11 A;  1VF4 A;  4NHW A;  1VF3 A;  3H8Q A;  5A4W A;  3IK7 A;  3IXR A;  5JWR B;  3UL3 A;  5J4U A;  5LNK e;  1A23 A;  1XWA A;  1PX7 A;  3QCP A;  3TKQ A;  4MH3 A;  2WFC A;  1XW5 A;  4X1U A;  1F37 A;  4NMU A;  5HR0 A;  4JU5 A;  5JWQ B;  2GZP A;  2JL4 A;  5AGY A;  2ZNM A;  2V1M A;  3CBU A;  3FZ5 A;  2IIY A;  3GH9 A;  4MK3 A;  4PGT A;  1THO A;  4MCU A;  4TXO B;  5IOW A;  3CXG A;  3SWL A;  5GAP D;  4IHU A;  5KEJ A;  3IK9 A;  3IOS A;  1Z7P A;  2LV3 A;  3EUR A;  5DJM A;  2PGT A;  3E3E A;  2J23 A;  12GS A;  4GQF A;  4KDX A;  3TCO A;  3ZIT A;  3FKF A;  3VWU A;  18GS A;  4K0N A;  5HQP A;  1X0R A;  1PSQ A;  2LRC A;  1AQV A;  4MPF A;  4K7I A;  1A24 A;  1VF1 A;  2XC2 A;  2DMM A;  4NWY A;  3QR6 A;  2OE3 A;  4X0X A;  2JZT A;  3ZZX A;  3CSJ A;  2H73 A;  4PUA A;  1ACV A;  1EP8 A;  2H0I A;  4JR4 A;  1O8W A;  1GH2 A;  2GDR A;  2H19 A;  4MZW A;  3GSS A;  3OR5 A;  1ZZY A;  4KE3 A;  3GX8 A;  1TI3 A;  2BJX A;  5B6M A;  2MYG A;  5DCG A;  4WBJ A;  3L4N A;  1GSD A;  3J7Y k;  3GL5 A;  4KAE A;  4GXZ A;  1ZYE A;  2VM1 A;  6GSW A;  5IOX A;  4F0C A;  3GTU A;  5D9X A;  5J9C A;  3A3T A;  5D73 A;  3MNG A;  5ECP B;  3HDC A;  1PL1 A;  1OC3 A;  1GSU A;  1LU4 A;  3P2A A;  3NZN A;  1JHB A;  1TK5 B;  2YV7 A;  2DML A;  5IMF A;  5J5N A;  5DJL A;  3C71 A;  4HDE A;  3HJO A;  5KN3 A;  2GSQ A;  2CZ3 A;  4BA7 A;  3BOA A;  3D4M A;  1YF0 A;  4O32 A;  1PMT A;  3KCM A;  3LG6 A;  2B1L A;  1OC9 A;  2JZR A;  1EGO A;  4FH8 A;  2H1D A;  1SK2 A;  2CVB A;  5D8I A;  2VL2 A;  4DEJ A;  1K0B A;  4OCE A;  1XW9 A;  2HFD A;  3LXT A;  2FUG 2;  2PPT A;  2CT6 A;  1S3D A;  1DSB A;  2AUV A;  2N5B A;  2GGT A;  4LL4 B;  5ECO B;  1AUC A;  4CHS A;  1MD3 A;  2FWH A;  5IMZ A;  3A2V A;  1Z5Y E;  1A2M A;  1SJI A;  4F2I A;  2HLS A;  4HZ2 A;  3A5W A;  2XHF A;  1MDI A;  2LJR A;  3TUE A;  1M2B A;  3GTU B;  2YZU A;  2WGR A;  2YN1 A;  4I5Q A;  3E9J B;  20GS A;  4Q5Q A;  4K6X A;  4KDU A;  2LRT A;  4EDZ A;  3RHC A;  1TW9 A;  2X64 A;  3L9S A;  4O5R A;  1AXD A;  4XTS A;  5CRD A;  1TKD B;  1BAY A;  8GSS A;  2VCV A;  4NAX A;  2KOK A;  1OKT A;  4N10 A;  2A2S A;  1OC9 B;  2DJ2 A;  2HRF A;  1U3I A;  1V57 A;  4HJ2 A;  2IFQ A;  2PVO C;  4POM A;  1PGT A;  3TKP A;  3UVT A;  4XS4 A;  4GLT A;  3GL3 A;  1M2A A;  1WE0 A;  1SD9 A;  4GTU A;  1DBY A;  4HU7 A;  2GQL A;  1GLP A;  1YEP A;  2OE0 A;  1LJR A;  3ERF A;  3F3Q A;  1E2Y A;  2K8S A;  3F63 A;  3VFI A;  5ECM B;  1HD2 A;  2FY6 A;  1EV4 A;  5H5Q A;  5G31 A;  2VOC A;  4JR6 A;  1RQM A;  4IGJ A;  2C80 A;  5IPG A;  4D73 A;  3ZVJ A;  3EMP A;  1XWK A;  3A2X A;  4HQZ A;  4MZC A;  3US3 A;  2FA8 A;  4XRD A;  2HXK A;  4TR1 B;  5G2Z A;  2H6Y A;  5FWG A;  2DIZ A;  3GKK A;  2H76 A;  3ZRE A;  4NHZ A;  3APQ A;  5G1L A;  1AC1 A;  1TOF A;  5E4W A;  2HSY A;  2YWM A;  4XS6 A;  5ECK B;  2BTO T;  5COH A;  3U6V A;  3C73 A;  2HE3 A;  4FYU A;  4POK A;  2DJ3 A;  3EIN A;  5JCU A;  3PH9 A;  3QMX A;  3DKS A;  3P90 A;  1ZOF A;  1AQX A;  3ME7 A;  3H93 A;  5A5K A;  1ST9 A;  3VWW A;  3FRC A;  2CVK A;  2MMN A;  4IS0 A;  4OCF A;  3H1N A;  2TRC P;  4NV2 A;  4F82 A;  2R6K A;  1T00 A;  3UAP A;  2IFQ B;  1GRX A;  4MJA A;  2KUC A;  4K7O A;  4IQA A;  3IE3 A;  3UOM A;  5JWO B;  4L5O A;  1QK8 A;  2C0E A;  4KDY A;  4XS4 B;  1F6M C;  3FR9 A;  1O85 A;  1Z9H A;  2GTU A;  6GSS A;  4PXO A;  3ZVJ D;  1Y6E A;  4J57 E;  1FO5 A;  1M9B A;  4KA0 A;  9GSS A;  3IC4 A;  4JBB A;  3TOT A;  4KCE A;  2LQQ A;  1T4Y A;  1SKS B;  4D73 B;  1J0F A;  1MEK A;  1XVQ A;  2KP1 A;  5CYY A;  1OE7 A;  3QFA C;  3ZFB A;  4TN8 A;  3C8E A;  1U3A A;  4EO3 A;  3I6A A;  1PL2 A;  2VCZ A;  1GUK A;  1A8Y A;  5AIV A;  1S3C A;  1TU8 A;  2B7J A;  4Z7X A;  5DAL A;  4HU9 A;  4POL A;  2J9H A;  2DJ0 A;  3LEF A;  1GSS A;  3EE2 A;  3IBH A;  3Q6O A;  1Q98 A;  1K0A A;  1EEM A;  5GAN D;  3O3T A;  1E6B A;  1X9S B;  3ISO A;  3PGT A;  4ML1 A;  1O8X A;  5AIX A;  1GSE A;  4MJC A;  1R7H A;  1F3A A;  5INY A;  2CA8 A;  4ULX A;  1SEN A;  4ZBA A;  2GZZ A;  2O87 A;  5F06 A;  2H1A A;  3CRU A;  1GUH A;  4EF0 A;  4TXO A;  5H5R A;  4LL1 B;  3WGX A;  3KTB A;  4K9Z A;  3F4S A;  4AJ8 A;  3QFB C;  2I4A A;  5KN0 A;  3D0Z A;  2RLI A;  4IKH A;  1TRW A;  1N8J A;  3RHB A;  4WBR D;  4ZIJ A;  1MD4 A;  3VWX A;  1CQG A;  2CAQ A;  2HZF A;  2REM A;  5JCW A;  1EEJ A;  2OKA A;  3HHV A;  3QPM A;  4ECI A;  2VCQ A;  3G7Y A;  4PUR A;  4PQH A;  1A0R P;  3UJ1 A;  4LA1 A;  2QGV A;  4J2F A;  4PX1 A;  4RQX A;  4QL9 A;  4EE0 A;  2FLS A;  3KZQ A;  5AN1 A;  1SL1 B;  1AQW A;  3GFK A;  22GS A;  1TXX A;  4YH2 A;  2VLT A;  2FHE A;  5DAL B;  3EWL A;  1QGV A;  4MLY A;  3LOR A;  1G6Y A;  1WJK A;  5B6N A;  2H1B A;  4V1A g;  4EVM A;  3TKS E;  5EY6 A;  4LMV A;  4HUA A;  1QFN A;  1XCC A;  1B9X C;  5ECS A;  3WGD A;  3U5R E;  2AAW A;  3HZ8 A;  2VO4 A;  3HD5 A;  5FT3 A;  2L5O A;  1V9W A;  2H72 A;  4PNF A;  3KTL A;  1UN2 A;  4DSR A;  3DVW A;  4XCS A;  3IRA A;  3HJP A;  3LFL A;  4ZB6 A;  3F3R A;  4TR0 A;  3M9K A;  2IMF A;  4GWR A;  3ERG A;  1SKW B;  4HQS A;  3GKX A;  2O85 A;  2C3T A;  2HRN A;  2LRN A;  2B5Y A;  3WT1 A;  3TJJ A;  3M9J A;  4I97 A;  2MMA A;  2EIQ A;  5FHI A;  1DE2 A;  5IIZ A;  4WXT A;  2PER A;  3DEX A;  2YOI A;  4OFM A;  2LEG A;  2H66 A;  4EDY A;  2IL3 A;  2C0G A;  4TR4 A;  4ZIL A;  3WT2 A;  1Y25 A;  2FWF A;  1UVZ A;  3GUS A;  4HOJ A;  1CQH A;  1X9M B;  4XIH A;  2DLX A;  3DWV A;  1YKC A;  2M72 A;  1V2A A;  5C04 A;  1SJ6 A;  3KMO A;  3TRQ A;  3EC3 A;  5KN1 A;  3DGQ A;  2HYX A;  3HXS A;  1OAZ A;  3O76 A;  2WUL A;  3GST A;  2YPM A;  3KD0 A;  2JAC A;  2OJL A;  2E2G A;  4QQ7 A;  4V2L A;  4N30 A;  3IR4 A;  1Q4J A;  2TRX A;  3RDW A;  1UA5 A;  5HFI A;  4ECB A;  5D9W A;  5DDL A;  3DML A;  4IEL A;  3PIN A;  2E2M A;  2QKE A;  3LXZ A;  1Z3E A;  6GST A;  4GRF A;  2JAD A;  3A2W A;  2DJJ A;  1X9W B;  4YQU A;  3J7Y b;  3H79 A;  2QC7 A;  4AGS A;  1AW9 A;  4K1F A;  3FZA A;  2NPB A;  3KGK A;  2WJU A;  3UEM A;  2L4Q A;  1XXU A;  3ME8 A;  5HR3 A;  3RPP A;  4WR4 A;  3LYP A;  3RAZ A;  2H01 A;  1R5P A;  5G5F A;  1NHY A;  3FEU A;  1A2L A;  2VD0 A;  2VL9 A;  4PQ1 A;  3VUR A;  3ZRD A;  1Z7R A;  1AAZ A;  2OE1 A;  2R5G A;  4MJE A;  1OC8 A;  2OBI A;  2LTK A;  1MDK A;  2LUS A;  5IMV A;  3F9U A;  1FB6 A;  2CX3 A;  4XHM A;  3TRX A;  3DD3 A;  1GWC A;  1ABA A;  2AHE A;  4KB3 A;  2GT5 A;  4L8E A;  1PKW A;  4MDC A;  4MF5 A;  2R4V A;  4TR1 A;  1JLV A;  3KH7 A;  4NV5 A;  1T1V A;  1GTU A;  2H75 A;  1SK0 A;  1VF2 A;  3GHA A;  2C0F A;  4ACS A;  1K0D A;  2H0H A;  3TKS C;  3FZ4 A;  2H6Z A;  2RM6 A;  1M0U A;  4LLR A;  4L5L A;  5F0G A;  5EVO A;  1M2D A;  3GUR A;  1F3B A;  3ZTL A;  1FOV A;  4I8B A;  4J56 E;  3HJM A;  1T8E B;  2H71 A;  2IJY A;  1UC7 A;  1GLQ A;  1TRV A;  4PNG A;  5DQY A;  4IW9 A;  5CRW A;  3QAV A;  4GCI A;  1A2J A;  1B8X A;  2ON5 A;  2DBC A;  4LMW A;  4MMM A;  2LJA A;  4GST A;  2L59 A;  4K8M A;  4ZL8 A;  5A4V A;  5HR2 A;  4ILF A;  4BL7 A;  2MMO A;  3LWA A;  1TDI A;  1K3Y A;  2GVP A;  1EOH A;  1HQO A;  1GNE A;  4HS1 A;  2OAC A;  3O6T A;  1ML6 A;  1SYX A;  3VPT A;  1H4O A;  2PU9 C;  3ZIJ A;  2IMI A;  2M46 A;  5HFG A;  1OYJ A;  3VI7 A;  4HEA 2;  7GSS A;  1O81 A;  3HCZ A;  5IMD A;  3CSI A;  2WB9 A;  1TRS A;  1QUW A;  2PVQ A;  3ZML A;  2WS2 A;  1BX9 A;  1XBS A;  2QSI A;  5LCZ A;  2K6V A;  4HZ4 A;  1BQ7 A;  3P7X A;  4JRR A;  2B5E A;  4G10 A;  1VGL A;  3QAG A;  2VCW A;  1R5A A;  3TJG A;  4GSS A;  3BD2 A;  2M80 A;  3Q19 A;  2YWN A;  2A2R A;  4EUY A;  4ZL7 A;  3HVS A;  5DQS A;  3CTG A;  2YP6 A;  5LD0 A;  3F0I A;  1GNW A;  1XVW A;  2IMD A;  3HA9 A;  4XRA A;  2P31 A;  3ERW A;  5D96 A;  2DJ1 A;  1V58 A;  2X8G A;  4AJ6 A;  4GQC A;  4CW9 A;  3C1R A;  2V6O A;  4MAB A;  4HJM A;  2WRT A;  1TU7 A;  3VLN A;  5CRG A;  2K18 A;  4OFT A;  3MSZ A;  2DIY A;  1O73 A;  2RII A;  4YAP A;  2HI7 A;  1W89 A;  4POB A;  4V2M A;  3EU3 A;  4I6X A;  3PR8 A;  3C7M A;  5ECQ B;  4OO5 A;  4E8H A;  4YQV A;  2GQM A;  3TB2 A;  1J08 A;  1THX A;  1AIU A;  1WRY A;  3HVX A;  1XWC A;  1SKR B;  2VD1 A;  3BCK A;  2P5Q A;  3UIW A;  1USB A;  1NM3 A;  4I2T A;  1TK8 B;  3IPZ A;  1GUM A;  2MBS A;  1SL2 B;  2G2Q A;  2ALB A;  2GT6 A;  5ECN B;  2DJK A;  4YQM A;  1ZCP A;  1I9D A;  5ELA A;  4OFN A;  3MDK A;  1A8L A;  1OVN A;  4EXJ A;  5CO3 A;  3V1W A;  1X5E A;  3F6D A;  5CRH A;  4HI7 A;  2HZE A;  1Z6N A;  1EZK A;  3IV4 A;  5DAK A;  1B9Y C;  1LBK A;  4O92 A;  1M9A A;  3KH9 A;  2HT9 A;  3MAK A;  2V32 A;  3GA4 A;  4KND A;  2HSH A;  4RUV A;  1BYE A;  3LQ7 A;  2FD3 A;  5CP1 A;  1PN9 A;  4AF2 A;  3IHQ A;  3GRX A;  3Q74 A;  1JZO A;  3APO A;  11GS A;  3EU4 A;  1OE8 A;  4IP1 A;  4IVF A;  1O7U A;  3N9J A;  1DUG A;  3FZ9 A;  4K7N A;  4KH7 A;  5J3R A;  1XFL A;  2GZY A;  1ERV A;  3GKN A;  4Q5N A;  3L78 A;  2B5X A;  3LSZ A;  4L0U A;  1TK0 B;  1TJD A;  3DXB A;  4DVC A;  3KEB A;  4ZL9 A;  4Q5F A;  3R2Q A;  3DYR A;  1MTC A;  2R2J A;  2GSR A;  1WMJ A;  2YJH A;  3WYW A;  5G5E A;  1U6T A;  1N2A A;  4KX4 A;  4BPY A;  3LYK A;  1XOB A;  3D21 A;  2VIM A;  1XPV A;  2TIR A;  1F2E A;  2AV4 A;  1BG5 A;  3FR6 A;  1M7T A;  2FCH A;  2YWI A;  1QQ2 A;  1JZW A;  4WR5 A;  5ID2 A;  3EYT A;  2VCX A;  2GST A;  2HZE B;  19GS A;  1OKD A;  2H74 A;  2PBJ A;  1S3A A;  4MA9 A;  3QAW A;  1HNC A;  5IM9 A;  1TRU A;  4KW6 A;  3CRT A;  1PD2 1;  5DAK B;  3DRN A;  3CTF A;  1PRX A;  3IAM 2;  3ZFL A;  2L6C A;  1J9B A;  5F05 A;  1T7P B;  2NTO A;  2LS5 A;  1JZD A;  2H1G A;  5GSS A;  1GSY A;  3FK8 A;  5ABR A;  5DBQ A;  2GSS A;  2YJ7 A;  4GF0 A;  3BBY A;  2RUF A;  4ID0 A;  4IJI A;  4TKY A;  2KP2 A;  5CRE A;  1K3L A;  2YV9 A;  3VI5 A;  3GH6 A;  3NIV A;  2PN8 A;  2H70 A;  3GIX A;  3TJF A;  4WEY A;  2OAD A;  1NHO A;  2JZS A;  1YKA A;  3W8S A;  4K0G A;  4ZB9 A;  4DSQ A;  1K3O A;  3KP8 A;  2YZH A;  2LJK A;  2CAI A;  1GUL A;  1RK4 A;  5ECL B;  1SD8 A;  3WD6 A;  2CZ2 A;  2MMZ A;  4N0Z A;  17GS A;  1GSF A;  1FVJ A;  1XW6 A;  2CVD A;  5HR1 A;  3FR3 A;  1IYH A;  1PQN A;  3G9B A;  1YEX A;  3KP9 A;  2AB6 A;  4G2E A;  3HY2 A;  3L9U A;  4MP4 A;  3L9V A;  3G7J A;  4H86 A;  4Q5R A;  1XIY A;  1XWG A;  3I9V 2;  1K0M A;  3CSH A;  4G9H A;  5ID2 B;  1GTI A;  2O8V B;  3FW2 A;  2I9H A;  5CNW A;  2BMX A;  3IAS 2;  3C1S A;  1K0C A;  3IA1 A;  5EL8 A;  3G7I A;  1MDJ A;  1KNG A;  3VWV A;  4O7H A;  2WZ9 A;  2PMT A;  5H5S A;  3M0F A;  2ES7 A;  2ZUP A;  3BCI A;  4IP6 A;  2P5R A;  4FYB A;  3I69 A;  2K9F A;  2O7K A;  1TP9 A;  2H6X A;  4TVE A;  3GN3 A;  1KEB A;  3GYK A;  2AJQ B;  2FNO A;  3KM6 A;  3TKR A;  3NOF A;  2VLU A;  3D4T A;  3P8W A;  1XOA A;  2IWT A;  2E7P A;  3M1G A;  1I5G A;  4MJB A;  2XPE A;  3D5J A;  1NW2 A;  4RQR A;  4MF7 A;  5J9B A;  4L0W A;  3EVI A;  1V98 A;  2ON7 A;  2AYT A;  1TTZ A;  1YZX A;  5D9V A;  4DSS A;  5C00 A;  13GS A;  2YNX A;  2IN3 A;  2NVL A;  1ERW A;  3KMN A;  4IJ3 A;  1GTB A;  5EPF A;  1SYR A;  3DIE A;  2F3M A;  1GP1 A;  4ZBB A;  3UBL A;  5D9T A;  2GQK A;  2JSZ A;  2VM2 A;  4F0B A;  1ZL9 A;  2XBQ A;  4JE1 A;  1FHE A;  1JLW A;  2OBK A;  3SBC A;  2F51 A;  3UMA A;  1ZYQ B;  3FY7 A;  6GSU A;  4NPB A;  3GMF A;  4BWQ A;  2H8L A;  1EWX A;  2C3N A;  3S9F A;  1ILO A;  2EC4 A;  2XBI A;  2L4C A;  3JCM L;  2B7K A;  1HYU A;  3KXO A;  4QL7 A;  2Z9S A;  5J41 A;  4EC0 A;  2IPA A;  1F9M A;  1X5D A;  1JFU A;  2E0Q A;  3W6G A;  1T3B A;  4PQI A;  1WOU A;  4P3Y B;  2EIO A;  2NDO A;  2FWE A;  1SJZ A;  2X8H A;  3VK9 A;  6GSY A;  3ZYW A;  2N5F A;  1V40 A;  2YWO A;  4TR3 A;  5IMA A;  1U88 A;  4ZB8 A;  5IQY A;  1NSW A;  2VLV A;  3L0H A;  1G6W A;  3F4T A;  4EL1 A;  1G7E A;  2B3S A;  3RBT A;  1EOG A;  5IO0 A;  1BJX A;  2MBT A;  4KSO A;  3TJB A;  5ENU A;  3GNJ A;  1FVK A;  4KGI A;  2C0D A;  2L6D A;  1FAA A;  4BVY A;  2CV4 A;  4WF4 A;  1H75 A;  1B4Q A;  1VRS D;  4DSS B;  4TW5 A;  4BWS A;  1A0F A;  1C72 A;  3GV1 A;  1U87 A;  3TRP A;  1QXH A;  1PX6 A;  4JED A;  2XPD A;  2C3Q A;  4WF5 A;  3ZL5 A;  1YF1 A;  2IME A;  5ECR B;  2PWJ A;  5ECI B;  4K2D A;  1G0T A;  1PA3 A;  2JU5 A;  3TDG A;  1KTE A;  3H4K A;  2LQO A;  4YAV A;  4ZBD A;  3WGE A;  4E8E A;  2LST A;  3HZ4 A;  2YAN A;  2O89 A;  4OMV A;  4IN0 A;  2VAF A;  4G19 A;  3Q18 A;  1YQ1 A;  2B1K A;  5G1K A;  4X43 A;  3FHK A; 
#chains in the Genus database with same CATH topology
 3GX0 A;  2VUP A;  1ZMA A;  5F8B A;  3N5O A;  5E59 A;  2YCD A;  2H0G A;  4MF6 A;  5B8A A;  4WKW A;  2C4J A;  5B7C A;  2D2Z A;  5HFK A;  5G30 A;  4ISD A;  1B4P A;  1M99 A;  3KJY A;  1KBN A;  1T4Z A;  3QD9 A;  2R37 A;  1BED A;  1SU9 A;  4MZB A;  3QDN A;  1HNB A;  4KCA A;  2NBS A;  1XZO A;  2N5A A;  2KLX A;  3ED3 A;  4XS1 A;  3F6F A;  2LNS A;  1O6J A;  2WDU A;  1ERT A;  1EP7 A;  4OWY A;  6GSV A;  5F07 A;  1JZR A;  2RUE A;  3UVH A;  3D22 A;  3TOU A;  2F9S A;  5B8B A;  3RPN A;  4ECC A;  5L71 A;  5CAX A;  3TJK A;  2IMK A;  1TI1 A;  2FGX A;  2JSY A;  1ERU A;  1YDK A;  3VPQ A;  2EIR A;  16GS A;  1SL0 B;  2V41 A;  3QOU A;  2F8A A;  3DVX A;  2V2G A;  2FWG A;  2A4V A;  3HVV A;  1URM A;  2GLR A;  3M3M A;  4AJ7 A;  4ECJ A;  1FB0 A;  3FYG A;  5ECH B;  5IPH A;  3KIJ A;  1EGR A;  2G0F A;  6GSX A;  2LKU A;  1X5C A;  1DE1 A;  2R3X A;  3W8J A;  4EKZ A;  1EV9 A;  1QMV A;  2B6M A;  1IYI A;  3ZLP A;  4OD7 A;  1WWJ A;  2I81 A;  3HKR A;  4KUN A;  4BVX A;  10GS A;  2F8F A;  4RI7 A;  4KSM A;  1R26 A;  5A4U A;  4JZQ A;  3ZMK A;  4MPG A;  3EPT A;  3CMI A;  2HNL A;  1XWB A;  3APS A;  3F4R A;  1WP0 A;  5GST A;  3UAR A;  5JCG A;  4NXI A;  4F9Z A;  1K0N A;  2KHP A;  3LGC A;  2VL2 C;  2K8V A;  3MWH A;  1GL8 A;  3D6I A;  5GZZ B;  3TGZ A;  2FA4 A;  5AIS A;  2LNT A;  2C8U A;  3E0U A;  1M3I A;  5ELG A;  4F03 A;  3GKM A;  3BJ5 A;  1WIK A;  4CDO A;  5DVB A;  1ZGN A;  1GSQ A;  2H30 A;  1SK1 A;  1YJ6 A;  2X8C A;  3UBK A;  2ZCT A;  2GS3 A;  4IQ1 A;  1G7O A;  5IO2 A;  2I1U A;  1PKZ A;  2DKI A;  1RW1 A;  4MH2 A;  4TXV A;  4G0L A;  2X99 A;  4GSN A;  1FG4 A;  1FW1 A;  4V1A p;  3F8U A;  5IMC A;  4I2U A;  3TKS A;  3ZIV A;  2MZC A;  4V2N A;  1B48 A;  2DC5 A;  4N0V A;  4ZXG A;  4TRX A;  3AY8 A;  3CYN A;  4ML6 A;  2L57 A;  3MIX A;  2VL3 A;  1R4W A;  3LJR A;  1YY7 A;  2WCI A;  14GS A;  4FYC A;  4IBP A;  2C1Y A;  4TOP A;  4RI6 A;  5DCH A;  1Z6M A;  1WPI A;  4FO5 A;  2CQ9 A;  3M8N A;  3I43 A;  2PUK C;  2RM5 A;  2VCT A;  4PUF C;  3K8N A;  4OO4 A;  1K0O A;  1HNA A;  2DSA A;  3HYP A;  1GTA A;  4FIW A;  4WET A;  2CX4 A;  1W4V A;  1ON4 A;  4EIP A;  2V6K A;  2L5L A;  2I3Y A;  2OA7 A;  2P0G A;  3EMX A;  5D93 A;  5KN2 A;  3IDV A;  4N11 A;  1VF4 A;  4NHW A;  1VF3 A;  3H8Q A;  5A4W A;  3IK7 A;  3IXR A;  5JWR B;  3UL3 A;  5J4U A;  5LNK e;  1A23 A;  1XWA A;  1PX7 A;  3QCP A;  3TKQ A;  4MH3 A;  2WFC A;  1XW5 A;  4X1U A;  1F37 A;  4NMU A;  5HR0 A;  4JU5 A;  5JWQ B;  2GZP A;  2JL4 A;  5AGY A;  2ZNM A;  2V1M A;  3CBU A;  3FZ5 A;  2IIY A;  3GH9 A;  4MK3 A;  2UZ8 A;  4PGT A;  1THO A;  4MCU A;  4TXO B;  5IOW A;  3CXG A;  3SWL A;  5GAP D;  4IHU A;  5KEJ A;  3IK9 A;  3IOS A;  1Z7P A;  2LV3 A;  3EUR A;  5DJM A;  2PGT A;  3E3E A;  2J23 A;  12GS A;  4GQF A;  4KDX A;  3TCO A;  3ZIT A;  3FKF A;  3VWU A;  18GS A;  4K0N A;  5HQP A;  1X0R A;  1PSQ A;  2LRC A;  1AQV A;  4MPF A;  4K7I A;  1A24 A;  1VF1 A;  2XC2 A;  2DMM A;  4NWY A;  3QR6 A;  2OE3 A;  4X0X A;  2JZT A;  3ZZX A;  3CSJ A;  2H73 A;  4PUA A;  1ACV A;  1EP8 A;  2H0I A;  2X49 A;  4JR4 A;  1O8W A;  1GH2 A;  2GDR A;  2H19 A;  4MZW A;  3GSS A;  3OR5 A;  1ZZY A;  4KE3 A;  3GX8 A;  1TI3 A;  2BJX A;  5B6M A;  2MYG A;  5DCG A;  4WBJ A;  3L4N A;  1GSD A;  3J7Y k;  3GL5 A;  4KAE A;  4GXZ A;  2HSM A;  1ZYE A;  2VM1 A;  6GSW A;  5IOX A;  4F0C A;  3GTU A;  5D9X A;  5J9C A;  4A5P A;  4K5S A;  3A3T A;  5D73 A;  3MNG A;  5ECP B;  3HDC A;  1PL1 A;  1OC3 A;  1GSU A;  1LU4 A;  3P2A A;  3NZN A;  1JHB A;  1TK5 B;  2YV7 A;  2DML A;  5IMF A;  5J5N A;  5DJL A;  3C71 A;  4HDE A;  3HJO A;  5KN3 A;  2GSQ A;  2CZ3 A;  4BA7 A;  3BOA A;  3D4M A;  1YF0 A;  4O32 A;  1PMT A;  3KCM A;  3LG6 A;  2B1L A;  1OC9 A;  2JZR A;  1EGO A;  4FH8 A;  4CY8 A;  2H1D A;  1SK2 A;  2CVB A;  5D8I A;  2VL2 A;  4DEJ A;  1K0B A;  4OCE A;  1XW9 A;  2HFD A;  3LXT A;  2HRA A;  2FUG 2;  2PPT A;  2CT6 A;  3PPU A;  1S3D A;  1DSB A;  2AUV A;  2N5B A;  2GGT A;  4LL4 B;  5ECO B;  1AUC A;  4CHS A;  1MD3 A;  2FWH A;  5IMZ A;  3A2V A;  1Z5Y E;  1A2M A;  1SJI A;  4F2I A;  2HLS A;  4HZ2 A;  3A5W A;  2XHF A;  1MDI A;  2LJR A;  3TUE A;  1M2B A;  1PN0 A;  3GTU B;  2YZU A;  2WGR A;  2YN1 A;  4I5Q A;  3E9J B;  20GS A;  4Q5Q A;  4K6X A;  4KDU A;  2LRT A;  4EDZ A;  3RHC A;  1TW9 A;  2X64 A;  3L9S A;  4O5R A;  1AXD A;  4XTS A;  5CRD A;  1TKD B;  5KOX A;  1BAY A;  8GSS A;  2VCV A;  4NAX A;  2KOK A;  1OKT A;  4N10 A;  2A2S A;  1OC9 B;  2DJ2 A;  2HRF A;  1U3I A;  1V57 A;  4HJ2 A;  2IFQ A;  2PVO C;  4POM A;  1PGT A;  3TKP A;  3UVT A;  4XS4 A;  4GLT A;  3GL3 A;  1M2A A;  1WE0 A;  1SD9 A;  4GTU A;  1DBY A;  4HU7 A;  2GQL A;  1GLP A;  1YEP A;  2OE0 A;  1LJR A;  3ERF A;  3F3Q A;  2DKH A;  2QA1 A;  1E2Y A;  2K8S A;  3F63 A;  3VFI A;  5ECM B;  1HD2 A;  2FY6 A;  1EV4 A;  5H5Q A;  5G31 A;  2VOC A;  4JR6 A;  1RQM A;  4IGJ A;  2C80 A;  5IPG A;  4D73 A;  3ZVJ A;  3EMP A;  1XWK A;  3A2X A;  4HQZ A;  4MZC A;  3US3 A;  2FA8 A;  4XRD A;  2HXK A;  4TR1 B;  5G2Z A;  2H6Y A;  5FWG A;  2DIZ A;  3GKK A;  2H76 A;  3ZRE A;  4NHZ A;  3APQ A;  5G1L A;  3HVN A;  1AC1 A;  1TOF A;  5E4W A;  2HSY A;  2YWM A;  4XS6 A;  5ECK B;  2BTO T;  5COH A;  3U6V A;  3C73 A;  2HE3 A;  4FYU A;  4POK A;  2DJ3 A;  3EIN A;  5JCU A;  3PH9 A;  3QMX A;  3DKS A;  3P90 A;  1ZOF A;  1AQX A;  3ME7 A;  3H93 A;  5A5K A;  1ST9 A;  3VWW A;  3FRC A;  4Z2T A;  2CVK A;  2MMN A;  4IS0 A;  4OCF A;  3H1N A;  2TRC P;  4NV2 A;  4F82 A;  2R6K A;  1T00 A;  3UAP A;  2IFQ B;  1GRX A;  4MJA A;  2KUC A;  4K7O A;  4IQA A;  3IE3 A;  3UOM A;  5JWO B;  4L5O A;  1QK8 A;  2C0E A;  4KDY A;  4XS4 B;  1F6M C;  3FR9 A;  1O85 A;  1Z9H A;  2GTU A;  6GSS A;  4PXO A;  3ZVJ D;  1Y6E A;  4J57 E;  1FO5 A;  4FQU A;  1M9B A;  4KA0 A;  9GSS A;  3IC4 A;  4JBB A;  3TOT A;  4KCE A;  2LQQ A;  1T4Y A;  1SKS B;  4D73 B;  1J0F A;  1MEK A;  1XVQ A;  2KP1 A;  5CYY A;  1OE7 A;  3QFA C;  3ZFB A;  4TN8 A;  3C8E A;  1U3A A;  4EO3 A;  3I6A A;  1PL2 A;  2VCZ A;  1GUK A;  1A8Y A;  1S3C A;  1TU8 A;  2B7J A;  4Z7X A;  5AIV A;  5DAL A;  4HU9 A;  4POL A;  2J9H A;  2DJ0 A;  3LEF A;  1GSS A;  3EE2 A;  3IBH A;  3Q6O A;  1Q98 A;  1K0A A;  1EEM A;  5GAN D;  3O3T A;  1E6B A;  1FOH A;  1X9S B;  3ISO A;  3PGT A;  3MYD A;  4ML1 A;  1O8X A;  5AIX A;  1GSE A;  4MJC A;  1R7H A;  1F3A A;  5INY A;  2CA8 A;  4ULX A;  1SEN A;  4ZBA A;  2GZZ A;  2O87 A;  5F06 A;  2H1A A;  3CRU A;  1GUH A;  4EF0 A;  4TXO A;  5H5R A;  4LL1 B;  3WGX A;  3KTB A;  4K9Z A;  3F4S A;  1S3R A;  4AJ8 A;  3QFB C;  2I4A A;  5KN0 A;  3D0Z A;  2RLI A;  4IKH A;  1TRW A;  3R3E A;  1N8J A;  3RHB A;  4WBR D;  3IHG A;  4ZIJ A;  1MD4 A;  3VWX A;  1CQG A;  2CAQ A;  2HZF A;  2REM A;  5JCW A;  1EEJ A;  2OKA A;  3HHV A;  3QPM A;  4ECI A;  2VCQ A;  3G7Y A;  4PUR A;  4PQH A;  1A0R P;  3UJ1 A;  4LA1 A;  2QGV A;  4J2F A;  4PX1 A;  4RQX A;  4QL9 A;  4EE0 A;  2FLS A;  3KZQ A;  4EIQ A;  5AN1 A;  1SL1 B;  1AQW A;  3GFK A;  22GS A;  1TXX A;  4YH2 A;  2VLT A;  2FHE A;  5DAL B;  3EWL A;  1QGV A;  4MLY A;  3LOR A;  1G6Y A;  2R0P A;  1WJK A;  5B6N A;  2H1B A;  4V1A g;  4EVM A;  3TKS E;  5EY6 A;  4LMV A;  4HUA A;  1QFN A;  1XCC A;  1B9X C;  5ECS A;  3WGD A;  3U5R E;  2AAW A;  3HZ8 A;  2VO4 A;  2R0G A;  3HD5 A;  5FT3 A;  2L5O A;  1V9W A;  2H72 A;  4PNF A;  3KTL A;  1UN2 A;  4DSR A;  3DVW A;  4XCS A;  3IRA A;  3HJP A;  2QA2 A;  3LFL A;  4ZB6 A;  3F3R A;  4TR0 A;  3A5I A;  3M9K A;  2IMF A;  4GWR A;  3ERG A;  1SKW B;  4HQS A;  3GKX A;  2O85 A;  2C3T A;  2HRN A;  2LRN A;  2B5Y A;  3WT1 A;  3TJJ A;  3M9J A;  4I97 A;  2MMA A;  2EIQ A;  5FHI A;  1DE2 A;  5IIZ A;  4WXT A;  2PER A;  3DEX A;  2YOI A;  4OFM A;  2LEG A;  2H66 A;  4EDY A;  2IL3 A;  2C0G A;  4TR4 A;  4ZIL A;  3WT2 A;  1Y25 A;  2FWF A;  1UVZ A;  3GUS A;  4HOJ A;  1CQH A;  1X9M B;  4XIH A;  2DLX A;  3DWV A;  1YKC A;  2M72 A;  1V2A A;  5C04 A;  1SJ6 A;  3KMO A;  3TRQ A;  3EC3 A;  5KN1 A;  3DGQ A;  2HYX A;  3HXS A;  1OAZ A;  3O76 A;  2WUL A;  3GST A;  2YPM A;  3KD0 A;  2JAC A;  2OJL A;  2E2G A;  4QQ7 A;  4V2L A;  4N30 A;  3IR4 A;  1Q4J A;  2TRX A;  3RDW A;  1UA5 A;  4HSC X;  5HFI A;  4ECB A;  5D9W A;  5DDL A;  3DML A;  4IEL A;  3PIN A;  2E2M A;  2QKE A;  3LXZ A;  1Z3E A;  6GST A;  1PFO A;  4GRF A;  2X4A A;  2JAD A;  3A2W A;  2DJJ A;  1X9W B;  4YQU A;  3J7Y b;  4USS A;  3H79 A;  2QC7 A;  4AGS A;  1AW9 A;  4K1F A;  3FZA A;  2NPB A;  3KGK A;  2WJU A;  3UEM A;  2L4Q A;  1XXU A;  3ME8 A;  5HR3 A;  3RPP A;  4WR4 A;  3LYP A;  3RAZ A;  2H01 A;  1R5P A;  5G5F A;  1NHY A;  3FEU A;  1A2L A;  2VD0 A;  2VL9 A;  4PQ1 A;  3LW9 A;  3VUR A;  3ZRD A;  1Z7R A;  1AAZ A;  2OE1 A;  2R5G A;  4MJE A;  1OC8 A;  2OBI A;  2LTK A;  1MDK A;  2LUS A;  5IMV A;  3F9U A;  1FB6 A;  2CX3 A;  4XHM A;  3TRX A;  3DD3 A;  1GWC A;  1ABA A;  2AHE A;  4KB3 A;  2GT5 A;  4L8E A;  1PKW A;  4MDC A;  4MF5 A;  2R4V A;  4TR1 A;  1JLV A;  3KH7 A;  4NV5 A;  3CQF A;  1T1V A;  1GTU A;  2H75 A;  4PTS A;  1SK0 A;  1VF2 A;  3GHA A;  2C0F A;  4ACS A;  1K0D A;  2H0H A;  3TKS C;  3FZ4 A;  2H6Z A;  2RM6 A;  1M0U A;  4LLR A;  4L5L A;  5F0G A;  5EVO A;  1M2D A;  3GUR A;  1F3B A;  3ZTL A;  1FOV A;  4I8B A;  4J56 E;  4BIK A;  3HJM A;  1T8E B;  2H71 A;  2IJY A;  1UC7 A;  1GLQ A;  1TRV A;  4PNG A;  5DQY A;  4IW9 A;  5CRW A;  3QAV A;  4GCI A;  1A2J A;  1B8X A;  2ON5 A;  2DBC A;  4LMW A;  4MMM A;  2LJA A;  4GST A;  2L59 A;  4K8M A;  4ZL8 A;  5A4V A;  5HR2 A;  4ILF A;  4MNN A;  4K2X A;  1ZYP A;  4BL7 A;  2MMO A;  3LWA A;  1TDI A;  1K3Y A;  2GVP A;  4K5R A;  1EOH A;  1HQO A;  1GNE A;  4HS1 A;  2OAC A;  3O6T A;  1ML6 A;  1SYX A;  3VPT A;  1H4O A;  2PU9 C;  3ZIJ A;  2IMI A;  2M46 A;  5HFG A;  1OYJ A;  3VI7 A;  4HEA 2;  7GSS A;  1O81 A;  3HCZ A;  5IMD A;  3CSI A;  2WB9 A;  1TRS A;  1QUW A;  2PVQ A;  3ZML A;  2WS2 A;  1BX9 A;  1XBS A;  2QSI A;  5LCZ A;  2K6V A;  4HZ4 A;  1BQ7 A;  3P7X A;  4JRR A;  2B5E A;  4G10 A;  1VGL A;  3QAG A;  2VCW A;  1R5A A;  3TJG A;  4GSS A;  5BMU A;  3BD2 A;  2M80 A;  3Q19 A;  2YWN A;  2A2R A;  4EUY A;  4ZL7 A;  3HVS A;  5DQS A;  3CTG A;  2YP6 A;  5LD0 A;  3F0I A;  1GNW A;  1XVW A;  2IMD A;  3HA9 A;  4XRA A;  2P31 A;  3ERW A;  5D96 A;  2DJ1 A;  1V58 A;  2X8G A;  4AJ6 A;  4GQC A;  4CW9 A;  3C1R A;  2V6O A;  4MAB A;  4HJM A;  2WRT A;  1TU7 A;  3VLN A;  5CRG A;  2K18 A;  4OFT A;  4BL7 B;  3MSZ A;  2DIY A;  1O73 A;  2RII A;  4YAP A;  2HI7 A;  1W89 A;  4BVY B;  4POB A;  4V2M A;  3EU3 A;  4I6X A;  3PR8 A;  3C7M A;  5ECQ B;  4OO5 A;  4E8H A;  4YQV A;  2GQM A;  3TB2 A;  1J08 A;  1THX A;  1AIU A;  1WRY A;  3HVX A;  1XWC A;  1SKR B;  2VD1 A;  3BCK A;  2P5Q A;  3UIW A;  1USB A;  1NM3 A;  4I2T A;  1TK8 B;  3IPZ A;  1GUM A;  2MBS A;  1SL2 B;  2G2Q A;  2ALB A;  2GT6 A;  5ECN B;  2DJK A;  4YQM A;  1ZCP A;  1I9D A;  5ELA A;  4OFN A;  3MDK A;  1A8L A;  1OVN A;  4EXJ A;  5CO3 A;  1XG8 A;  3V1W A;  1X5E A;  3F6D A;  5CRH A;  4HI7 A;  2HZE A;  1Z6N A;  5KOW A;  4O5Q A;  1EZK A;  3IV4 A;  5DAK A;  1B9Y C;  1LBK A;  4O92 A;  1M9A A;  3KH9 A;  2HT9 A;  3MAK A;  2V32 A;  3GA4 A;  4KND A;  2HSH A;  4RUV A;  1BYE A;  3LQ7 A;  2FD3 A;  5CP1 A;  1PN9 A;  4AF2 A;  3IHQ A;  3GRX A;  3Q74 A;  1JZO A;  3APO A;  11GS A;  4Z2R A;  3EU4 A;  1OE8 A;  4IP1 A;  4IVF A;  1O7U A;  3N9J A;  1DUG A;  3FZ9 A;  4K7N A;  4KH7 A;  5J3R A;  1XFL A;  2GZY A;  1ERV A;  3GKN A;  4Q5N A;  4Z2U A;  2R0C A;  3L78 A;  2B5X A;  3LSZ A;  4O5U A;  4L0U A;  1TK0 B;  1TJD A;  3DXB A;  4DVC A;  3KEB A;  4ZL9 A;  4Q5F A;  3R2Q A;  3DYR A;  1MTC A;  2R2J A;  2GSR A;  4KF9 A;  1WMJ A;  2YJH A;  3WYW A;  5G5E A;  1U6T A;  1N2A A;  4KX4 A;  4BPY A;  3LYK A;  1XOB A;  3D21 A;  2VIM A;  1XPV A;  2TIR A;  1F2E A;  2AV4 A;  1BG5 A;  3FR6 A;  1M7T A;  2FCH A;  2YWI A;  1QQ2 A;  1JZW A;  4WR5 A;  5ID2 A;  3EYT A;  2VCX A;  4BVX B;  2GST A;  2HZE B;  19GS A;  1OKD A;  2H74 A;  2PBJ A;  1S3A A;  4MA9 A;  3QAW A;  1HNC A;  5IM9 A;  1TRU A;  4KW6 A;  3CRT A;  1PD2 1;  5DAK B;  3DRN A;  3CTF A;  1PRX A;  3IAM 2;  3ZFL A;  2L6C A;  1J9B A;  5F05 A;  1T7P B;  4CY6 A;  2NTO A;  2LS5 A;  1JZD A;  2H1G A;  5GSS A;  1GSY A;  3FK8 A;  5ABR A;  5DBQ A;  2GSS A;  2YJ7 A;  4GF0 A;  3BBY A;  2RUF A;  4ID0 A;  4IJI A;  4TKY A;  2KP2 A;  5CRE A;  3IC8 A;  1K3L A;  2YV9 A;  3VI5 A;  3GH6 A;  3NIV A;  2PN8 A;  2H70 A;  3GIX A;  3TJF A;  4WEY A;  2OAD A;  1NHO A;  2JZS A;  1YKA A;  3W8S A;  4K0G A;  4ZB9 A;  4DSQ A;  1K3O A;  3KP8 A;  2YZH A;  2LJK A;  2CAI A;  1GUL A;  1RK4 A;  5ECL B;  1SD8 A;  3WD6 A;  2CZ2 A;  2MMZ A;  4N0Z A;  17GS A;  1GSF A;  1FVJ A;  1XW6 A;  2CVD A;  4ICY A;  5HR1 A;  3FR3 A;  1IYH A;  1PQN A;  3G9B A;  1YEX A;  3KP9 A;  2AB6 A;  4G2E A;  3HY2 A;  3L9U A;  4MP4 A;  3L9V A;  3G7J A;  4H86 A;  4Q5R A;  1XIY A;  1XWG A;  2A4H A;  3I9V 2;  1K0M A;  3CSH A;  4G9H A;  5ID2 B;  1GTI A;  2O8V B;  3FW2 A;  2I9H A;  5CNW A;  2BMX A;  3IAS 2;  3C1S A;  1K0C A;  3IA1 A;  5EL8 A;  3G7I A;  1MDJ A;  1KNG A;  3VWV A;  4O7H A;  2WZ9 A;  2PMT A;  5H5S A;  5BRT A;  3M0F A;  2ES7 A;  2ZUP A;  3BCI A;  1M3J A;  4IP6 A;  2P5R A;  4FYB A;  3I69 A;  2K9F A;  2O7K A;  1TP9 A;  2H6X A;  4TVE A;  3GN3 A;  1KEB A;  3GYK A;  2AJQ B;  2FNO A;  3KM6 A;  3TKR A;  4YKG A;  3NOF A;  2VLU A;  3D4T A;  3P8W A;  1XOA A;  2IWT A;  2E7P A;  4G0I A;  4YKF A;  3M1G A;  1I5G A;  4MJB A;  2XPE A;  3D5J A;  1NW2 A;  4RQR A;  4MF7 A;  5J9B A;  4L0W A;  3EVI A;  1V98 A;  2ON7 A;  2AYT A;  1TTZ A;  1YZX A;  5D9V A;  4DSS A;  5C00 A;  4X4J A;  4G0K A;  13GS A;  2YNX A;  2IN3 A;  2NVL A;  1ERW A;  3KMN A;  4IJ3 A;  1GTB A;  5EPF A;  1SYR A;  3DIE A;  2F3M A;  1GP1 A;  4ZBB A;  3UBL A;  5D9T A;  2GQK A;  2JSZ A;  2VM2 A;  1ZYN A;  4F0B A;  1ZL9 A;  2XBQ A;  4JE1 A;  1FHE A;  1JLW A;  2OBK A;  3SBC A;  2F51 A;  3UMA A;  1ZYQ B;  3FY7 A;  6GSU A;  4NPB A;  3GMF A;  4BWQ A;  2H8L A;  1EWX A;  2C3N A;  3S9F A;  1ILO A;  2EC4 A;  2XBI A;  2L4C A;  3JCM L;  2B7K A;  1HYU A;  3KXO A;  4QL7 A;  2Z9S A;  5J41 A;  4EC0 A;  2IPA A;  1F9M A;  1X5D A;  1JFU A;  2E0Q A;  3W6G A;  1T3B A;  4PQI A;  1WOU A;  4P3Y B;  2EIO A;  2NDO A;  2FWE A;  1SJZ A;  2X8H A;  3VK9 A;  3FMW A;  6GSY A;  3ZYW A;  2N5F A;  1V40 A;  2YWO A;  4TR3 A;  5IMA A;  1U88 A;  4ZB8 A;  5IQY A;  2HRK A;  1NSW A;  2VLV A;  3L0H A;  1G6W A;  3F4T A;  4EL1 A;  1G7E A;  2B3S A;  3RBT A;  1EOG A;  5IO0 A;  1BJX A;  2MBT A;  4KSO A;  3TJB A;  5ENU A;  3GNJ A;  1FVK A;  4KGI A;  2C0D A;  2L6D A;  1FAA A;  4BVY A;  2CV4 A;  4WF4 A;  1H75 A;  1B4Q A;  1VRS D;  4DSS B;  4TW5 A;  4BWS A;  1A0F A;  1C72 A;  3GV1 A;  1U87 A;  3TRP A;  1QXH A;  1PX6 A;  4JED A;  2XPD A;  2C3Q A;  4WF5 A;  3ZL5 A;  1YF1 A;  2IME A;  5ECR B;  2PWJ A;  5ECI B;  4K2D A;  1G0T A;  1PA3 A;  2JU5 A;  3TDG A;  1KTE A;  3H4K A;  2LQO A;  4YAV A;  4ZBD A;  3WGE A;  4E8E A;  2LST A;  3HZ4 A;  2YAN A;  2O89 A;  4OMV A;  4IN0 A;  2VAF A;  4G19 A;  3Q18 A;  1YQ1 A;  2A2P A;  2B1K A;  5G1K A;  4X43 A;  3FHK A; 
#chains in the Genus database with same CATH homology
 3GX0 A;  2VUP A;  1ZMA A;  5F8B A;  3N5O A;  5E59 A;  2YCD A;  2H0G A;  4MF6 A;  5B8A A;  4WKW A;  2C4J A;  5B7C A;  2D2Z A;  5HFK A;  5G30 A;  4ISD A;  1B4P A;  1M99 A;  3KJY A;  1KBN A;  1T4Z A;  3QD9 A;  2R37 A;  1BED A;  1SU9 A;  4MZB A;  3QDN A;  1HNB A;  4KCA A;  2NBS A;  1XZO A;  2N5A A;  2KLX A;  3ED3 A;  4XS1 A;  3F6F A;  2LNS A;  1O6J A;  2WDU A;  1ERT A;  1EP7 A;  4OWY A;  6GSV A;  5F07 A;  1JZR A;  2RUE A;  3UVH A;  3D22 A;  3TOU A;  2F9S A;  5B8B A;  3RPN A;  4ECC A;  5L71 A;  5CAX A;  3TJK A;  2IMK A;  1TI1 A;  2FGX A;  2JSY A;  1ERU A;  1YDK A;  3VPQ A;  2EIR A;  16GS A;  1SL0 B;  2V41 A;  3QOU A;  2F8A A;  3DVX A;  2V2G A;  2FWG A;  2A4V A;  3HVV A;  1URM A;  2GLR A;  3M3M A;  4AJ7 A;  4ECJ A;  1FB0 A;  3FYG A;  5ECH B;  5IPH A;  3KIJ A;  1EGR A;  2G0F A;  6GSX A;  2LKU A;  1X5C A;  1DE1 A;  2R3X A;  3W8J A;  4EKZ A;  1EV9 A;  1QMV A;  2B6M A;  1IYI A;  3ZLP A;  4OD7 A;  1WWJ A;  2I81 A;  3HKR A;  4KUN A;  4BVX A;  10GS A;  2F8F A;  4RI7 A;  4KSM A;  1R26 A;  5A4U A;  4JZQ A;  3ZMK A;  4MPG A;  3EPT A;  3CMI A;  2HNL A;  1XWB A;  3APS A;  3F4R A;  1WP0 A;  5GST A;  3UAR A;  5JCG A;  4NXI A;  4F9Z A;  1K0N A;  2KHP A;  3LGC A;  2VL2 C;  2K8V A;  3MWH A;  1GL8 A;  3D6I A;  5GZZ B;  3TGZ A;  2FA4 A;  5AIS A;  2LNT A;  2C8U A;  3E0U A;  5ELG A;  4F03 A;  3GKM A;  3BJ5 A;  1WIK A;  4CDO A;  5DVB A;  1ZGN A;  1GSQ A;  2H30 A;  1SK1 A;  1YJ6 A;  2X8C A;  3UBK A;  2ZCT A;  2GS3 A;  4IQ1 A;  1G7O A;  5IO2 A;  2I1U A;  1PKZ A;  2DKI A;  1RW1 A;  4MH2 A;  4TXV A;  4G0L A;  2X99 A;  4GSN A;  1FG4 A;  1FW1 A;  4V1A p;  3F8U A;  5IMC A;  4I2U A;  3TKS A;  3ZIV A;  2MZC A;  4V2N A;  1B48 A;  2DC5 A;  4N0V A;  4ZXG A;  4TRX A;  3AY8 A;  3CYN A;  4ML6 A;  2L57 A;  3MIX A;  2VL3 A;  1R4W A;  3LJR A;  1YY7 A;  2WCI A;  14GS A;  4FYC A;  4IBP A;  2C1Y A;  4TOP A;  4RI6 A;  5DCH A;  1Z6M A;  1WPI A;  4FO5 A;  2CQ9 A;  3M8N A;  3I43 A;  2PUK C;  2RM5 A;  2VCT A;  4PUF C;  3K8N A;  4OO4 A;  1K0O A;  1HNA A;  2DSA A;  3HYP A;  1GTA A;  4FIW A;  4WET A;  2CX4 A;  1W4V A;  1ON4 A;  4EIP A;  2V6K A;  2L5L A;  2I3Y A;  2OA7 A;  2P0G A;  3EMX A;  5D93 A;  5KN2 A;  3IDV A;  4N11 A;  1VF4 A;  4NHW A;  1VF3 A;  3H8Q A;  5A4W A;  3IK7 A;  3IXR A;  5JWR B;  3UL3 A;  5J4U A;  5LNK e;  1A23 A;  1XWA A;  1PX7 A;  3QCP A;  3TKQ A;  4MH3 A;  2WFC A;  1XW5 A;  4X1U A;  1F37 A;  4NMU A;  5HR0 A;  4JU5 A;  5JWQ B;  2GZP A;  2JL4 A;  5AGY A;  2ZNM A;  2V1M A;  3CBU A;  3FZ5 A;  2IIY A;  3GH9 A;  4MK3 A;  2UZ8 A;  4PGT A;  1THO A;  4MCU A;  4TXO B;  5IOW A;  3CXG A;  3SWL A;  5GAP D;  4IHU A;  5KEJ A;  3IK9 A;  3IOS A;  1Z7P A;  2LV3 A;  3EUR A;  5DJM A;  2PGT A;  3E3E A;  2J23 A;  12GS A;  4GQF A;  4KDX A;  3TCO A;  3ZIT A;  3FKF A;  3VWU A;  18GS A;  4K0N A;  5HQP A;  1X0R A;  1PSQ A;  2LRC A;  1AQV A;  4MPF A;  4K7I A;  1A24 A;  1VF1 A;  2XC2 A;  2DMM A;  4NWY A;  3QR6 A;  2OE3 A;  4X0X A;  2JZT A;  3ZZX A;  3CSJ A;  2H73 A;  4PUA A;  1ACV A;  1EP8 A;  2H0I A;  2X49 A;  4JR4 A;  1O8W A;  1GH2 A;  2GDR A;  2H19 A;  4MZW A;  3GSS A;  3OR5 A;  1ZZY A;  4KE3 A;  3GX8 A;  1TI3 A;  2BJX A;  5B6M A;  2MYG A;  5DCG A;  4WBJ A;  3L4N A;  1GSD A;  3J7Y k;  3GL5 A;  4KAE A;  4GXZ A;  2HSM A;  1ZYE A;  2VM1 A;  6GSW A;  5IOX A;  4F0C A;  3GTU A;  5D9X A;  5J9C A;  4A5P A;  4K5S A;  3A3T A;  5D73 A;  3MNG A;  5ECP B;  3HDC A;  1PL1 A;  1OC3 A;  1GSU A;  1LU4 A;  3P2A A;  3NZN A;  1JHB A;  1TK5 B;  2YV7 A;  2DML A;  5IMF A;  5J5N A;  5DJL A;  3C71 A;  4HDE A;  3HJO A;  5KN3 A;  2GSQ A;  2CZ3 A;  4BA7 A;  3BOA A;  3D4M A;  1YF0 A;  4O32 A;  1PMT A;  3KCM A;  3LG6 A;  2B1L A;  1OC9 A;  2JZR A;  1EGO A;  4FH8 A;  4CY8 A;  2H1D A;  1SK2 A;  2CVB A;  5D8I A;  2VL2 A;  4DEJ A;  1K0B A;  4OCE A;  1XW9 A;  2HFD A;  3LXT A;  2HRA A;  2FUG 2;  2PPT A;  2CT6 A;  3PPU A;  1S3D A;  1DSB A;  2AUV A;  2N5B A;  2GGT A;  4LL4 B;  5ECO B;  1AUC A;  4CHS A;  1MD3 A;  2FWH A;  5IMZ A;  3A2V A;  1Z5Y E;  1A2M A;  1SJI A;  4F2I A;  2HLS A;  4HZ2 A;  3A5W A;  2XHF A;  1MDI A;  2LJR A;  3TUE A;  1M2B A;  1PN0 A;  3GTU B;  2YZU A;  2WGR A;  2YN1 A;  4I5Q A;  3E9J B;  20GS A;  4Q5Q A;  4K6X A;  4KDU A;  2LRT A;  4EDZ A;  3RHC A;  1TW9 A;  2X64 A;  3L9S A;  4O5R A;  1AXD A;  4XTS A;  5CRD A;  1TKD B;  5KOX A;  1BAY A;  8GSS A;  2VCV A;  4NAX A;  2KOK A;  1OKT A;  4N10 A;  2A2S A;  1OC9 B;  2DJ2 A;  2HRF A;  1U3I A;  1V57 A;  4HJ2 A;  2IFQ A;  2PVO C;  4POM A;  1PGT A;  3TKP A;  3UVT A;  4XS4 A;  4GLT A;  3GL3 A;  1M2A A;  1WE0 A;  1SD9 A;  4GTU A;  1DBY A;  4HU7 A;  2GQL A;  1GLP A;  1YEP A;  2OE0 A;  1LJR A;  3ERF A;  3F3Q A;  2DKH A;  2QA1 A;  1E2Y A;  2K8S A;  3F63 A;  3VFI A;  5ECM B;  1HD2 A;  2FY6 A;  1EV4 A;  5H5Q A;  5G31 A;  2VOC A;  4JR6 A;  1RQM A;  4IGJ A;  2C80 A;  5IPG A;  4D73 A;  3ZVJ A;  3EMP A;  1XWK A;  3A2X A;  4HQZ A;  4MZC A;  3US3 A;  2FA8 A;  4XRD A;  2HXK A;  4TR1 B;  5G2Z A;  2H6Y A;  5FWG A;  2DIZ A;  3GKK A;  2H76 A;  3ZRE A;  4NHZ A;  3APQ A;  5G1L A;  1AC1 A;  1TOF A;  5E4W A;  2HSY A;  2YWM A;  4XS6 A;  5ECK B;  2BTO T;  5COH A;  3U6V A;  3C73 A;  2HE3 A;  4FYU A;  4POK A;  2DJ3 A;  3EIN A;  5JCU A;  3PH9 A;  3QMX A;  3DKS A;  3P90 A;  1ZOF A;  1AQX A;  3ME7 A;  3H93 A;  5A5K A;  1ST9 A;  3VWW A;  3FRC A;  4Z2T A;  2CVK A;  2MMN A;  4IS0 A;  4OCF A;  3H1N A;  2TRC P;  4NV2 A;  4F82 A;  2R6K A;  1T00 A;  3UAP A;  2IFQ B;  1GRX A;  4MJA A;  2KUC A;  4K7O A;  4IQA A;  3IE3 A;  3UOM A;  5JWO B;  4L5O A;  1QK8 A;  2C0E A;  4KDY A;  4XS4 B;  1F6M C;  3FR9 A;  1O85 A;  1Z9H A;  2GTU A;  6GSS A;  4PXO A;  3ZVJ D;  1Y6E A;  4J57 E;  1FO5 A;  4FQU A;  1M9B A;  4KA0 A;  9GSS A;  3IC4 A;  4JBB A;  3TOT A;  4KCE A;  2LQQ A;  1T4Y A;  1SKS B;  4D73 B;  1J0F A;  1MEK A;  1XVQ A;  2KP1 A;  5CYY A;  1OE7 A;  3QFA C;  3ZFB A;  4TN8 A;  3C8E A;  1U3A A;  4EO3 A;  3I6A A;  1PL2 A;  2VCZ A;  1GUK A;  1A8Y A;  5AIV A;  1S3C A;  1TU8 A;  2B7J A;  4Z7X A;  5DAL A;  4HU9 A;  4POL A;  2J9H A;  2DJ0 A;  3LEF A;  1GSS A;  3EE2 A;  3IBH A;  3Q6O A;  1Q98 A;  1K0A A;  1EEM A;  5GAN D;  3O3T A;  1E6B A;  1FOH A;  1X9S B;  3ISO A;  3PGT A;  3MYD A;  4ML1 A;  1O8X A;  5AIX A;  1GSE A;  4MJC A;  1R7H A;  1F3A A;  5INY A;  2CA8 A;  4ULX A;  1SEN A;  4ZBA A;  2GZZ A;  2O87 A;  5F06 A;  2H1A A;  3CRU A;  1GUH A;  4EF0 A;  4TXO A;  5H5R A;  4LL1 B;  3WGX A;  3KTB A;  4K9Z A;  3F4S A;  4AJ8 A;  3QFB C;  2I4A A;  5KN0 A;  3D0Z A;  2RLI A;  4IKH A;  1TRW A;  3R3E A;  1N8J A;  3RHB A;  4WBR D;  3IHG A;  4ZIJ A;  1MD4 A;  3VWX A;  1CQG A;  2CAQ A;  2HZF A;  2REM A;  5JCW A;  1EEJ A;  2OKA A;  3HHV A;  3QPM A;  4ECI A;  2VCQ A;  3G7Y A;  4PUR A;  4PQH A;  1A0R P;  3UJ1 A;  4LA1 A;  2QGV A;  4J2F A;  4PX1 A;  4RQX A;  4QL9 A;  4EE0 A;  2FLS A;  3KZQ A;  4EIQ A;  5AN1 A;  1SL1 B;  1AQW A;  3GFK A;  22GS A;  1TXX A;  4YH2 A;  2VLT A;  2FHE A;  5DAL B;  3EWL A;  1QGV A;  4MLY A;  3LOR A;  1G6Y A;  2R0P A;  1WJK A;  5B6N A;  2H1B A;  4V1A g;  4EVM A;  3TKS E;  5EY6 A;  4LMV A;  4HUA A;  1QFN A;  1XCC A;  1B9X C;  5ECS A;  3WGD A;  3U5R E;  2AAW A;  3HZ8 A;  2VO4 A;  2R0G A;  3HD5 A;  5FT3 A;  2L5O A;  1V9W A;  2H72 A;  4PNF A;  3KTL A;  1UN2 A;  4DSR A;  3DVW A;  4XCS A;  3IRA A;  3HJP A;  2QA2 A;  3LFL A;  4ZB6 A;  3F3R A;  4TR0 A;  3A5I A;  3M9K A;  2IMF A;  4GWR A;  3ERG A;  1SKW B;  4HQS A;  3GKX A;  2O85 A;  2C3T A;  2HRN A;  2LRN A;  2B5Y A;  3WT1 A;  3TJJ A;  3M9J A;  4I97 A;  2MMA A;  2EIQ A;  5FHI A;  1DE2 A;  5IIZ A;  4WXT A;  2PER A;  3DEX A;  2YOI A;  4OFM A;  2LEG A;  2H66 A;  4EDY A;  2IL3 A;  2C0G A;  4TR4 A;  4ZIL A;  3WT2 A;  1Y25 A;  2FWF A;  1UVZ A;  3GUS A;  4HOJ A;  1CQH A;  1X9M B;  4XIH A;  2DLX A;  3DWV A;  1YKC A;  2M72 A;  1V2A A;  5C04 A;  1SJ6 A;  3KMO A;  3TRQ A;  3EC3 A;  5KN1 A;  3DGQ A;  2HYX A;  3HXS A;  1OAZ A;  3O76 A;  2WUL A;  3GST A;  2YPM A;  3KD0 A;  2JAC A;  2OJL A;  2E2G A;  4QQ7 A;  4V2L A;  4N30 A;  3IR4 A;  1Q4J A;  2TRX A;  3RDW A;  1UA5 A;  5HFI A;  4ECB A;  5D9W A;  5DDL A;  3DML A;  4IEL A;  3PIN A;  2E2M A;  2QKE A;  3LXZ A;  1Z3E A;  6GST A;  4GRF A;  2X4A A;  2JAD A;  3A2W A;  2DJJ A;  1X9W B;  4YQU A;  3J7Y b;  4USS A;  3H79 A;  2QC7 A;  4AGS A;  1AW9 A;  4K1F A;  3FZA A;  2NPB A;  3KGK A;  2WJU A;  3UEM A;  2L4Q A;  1XXU A;  3ME8 A;  5HR3 A;  3RPP A;  4WR4 A;  3LYP A;  3RAZ A;  2H01 A;  1R5P A;  5G5F A;  1NHY A;  3FEU A;  1A2L A;  2VD0 A;  2VL9 A;  4PQ1 A;  3LW9 A;  3VUR A;  3ZRD A;  1Z7R A;  1AAZ A;  2OE1 A;  2R5G A;  4MJE A;  1OC8 A;  2OBI A;  2LTK A;  1MDK A;  2LUS A;  5IMV A;  3F9U A;  1FB6 A;  2CX3 A;  4XHM A;  3TRX A;  3DD3 A;  1GWC A;  1ABA A;  2AHE A;  4KB3 A;  2GT5 A;  4L8E A;  1PKW A;  4MDC A;  4MF5 A;  2R4V A;  4TR1 A;  1JLV A;  3KH7 A;  4NV5 A;  1T1V A;  1GTU A;  2H75 A;  4PTS A;  1SK0 A;  1VF2 A;  3GHA A;  2C0F A;  4ACS A;  1K0D A;  2H0H A;  3TKS C;  3FZ4 A;  2H6Z A;  2RM6 A;  1M0U A;  4LLR A;  4L5L A;  5F0G A;  5EVO A;  1M2D A;  3GUR A;  1F3B A;  3ZTL A;  1FOV A;  4I8B A;  4J56 E;  3HJM A;  1T8E B;  2H71 A;  2IJY A;  1UC7 A;  1GLQ A;  1TRV A;  4PNG A;  5DQY A;  4IW9 A;  5CRW A;  3QAV A;  4GCI A;  1A2J A;  1B8X A;  2ON5 A;  2DBC A;  4LMW A;  4MMM A;  2LJA A;  4GST A;  2L59 A;  4K8M A;  4ZL8 A;  5A4V A;  5HR2 A;  4ILF A;  4MNN A;  4K2X A;  1ZYP A;  4BL7 A;  2MMO A;  3LWA A;  1TDI A;  1K3Y A;  2GVP A;  4K5R A;  1EOH A;  1HQO A;  1GNE A;  4HS1 A;  2OAC A;  3O6T A;  1ML6 A;  1SYX A;  3VPT A;  1H4O A;  2PU9 C;  3ZIJ A;  2IMI A;  2M46 A;  5HFG A;  1OYJ A;  3VI7 A;  4HEA 2;  7GSS A;  1O81 A;  3HCZ A;  5IMD A;  3CSI A;  2WB9 A;  1TRS A;  1QUW A;  2PVQ A;  3ZML A;  2WS2 A;  1BX9 A;  1XBS A;  2QSI A;  5LCZ A;  2K6V A;  4HZ4 A;  1BQ7 A;  3P7X A;  4JRR A;  2B5E A;  4G10 A;  1VGL A;  3QAG A;  2VCW A;  1R5A A;  3TJG A;  4GSS A;  5BMU A;  3BD2 A;  2M80 A;  3Q19 A;  2YWN A;  2A2R A;  4EUY A;  4ZL7 A;  3HVS A;  5DQS A;  3CTG A;  2YP6 A;  5LD0 A;  3F0I A;  1GNW A;  1XVW A;  2IMD A;  3HA9 A;  4XRA A;  2P31 A;  3ERW A;  5D96 A;  2DJ1 A;  1V58 A;  2X8G A;  4AJ6 A;  4GQC A;  4CW9 A;  3C1R A;  2V6O A;  4MAB A;  4HJM A;  2WRT A;  1TU7 A;  3VLN A;  5CRG A;  2K18 A;  4OFT A;  4BL7 B;  3MSZ A;  2DIY A;  1O73 A;  2RII A;  4YAP A;  2HI7 A;  1W89 A;  4BVY B;  4POB A;  4V2M A;  3EU3 A;  4I6X A;  3PR8 A;  3C7M A;  5ECQ B;  4OO5 A;  4E8H A;  4YQV A;  2GQM A;  3TB2 A;  1J08 A;  1THX A;  1AIU A;  1WRY A;  3HVX A;  1XWC A;  1SKR B;  2VD1 A;  3BCK A;  2P5Q A;  3UIW A;  1USB A;  1NM3 A;  4I2T A;  1TK8 B;  3IPZ A;  1GUM A;  2MBS A;  1SL2 B;  2G2Q A;  2ALB A;  2GT6 A;  5ECN B;  2DJK A;  4YQM A;  1ZCP A;  1I9D A;  5ELA A;  4OFN A;  3MDK A;  1A8L A;  1OVN A;  4EXJ A;  5CO3 A;  3V1W A;  1X5E A;  3F6D A;  5CRH A;  4HI7 A;  2HZE A;  1Z6N A;  5KOW A;  4O5Q A;  1EZK A;  3IV4 A;  5DAK A;  1B9Y C;  1LBK A;  4O92 A;  1M9A A;  3KH9 A;  2HT9 A;  3MAK A;  2V32 A;  3GA4 A;  4KND A;  2HSH A;  4RUV A;  1BYE A;  3LQ7 A;  2FD3 A;  5CP1 A;  1PN9 A;  4AF2 A;  3IHQ A;  3GRX A;  3Q74 A;  1JZO A;  3APO A;  11GS A;  4Z2R A;  3EU4 A;  1OE8 A;  4IP1 A;  4IVF A;  1O7U A;  3N9J A;  1DUG A;  3FZ9 A;  4K7N A;  4KH7 A;  5J3R A;  1XFL A;  2GZY A;  1ERV A;  3GKN A;  4Q5N A;  4Z2U A;  2R0C A;  3L78 A;  2B5X A;  3LSZ A;  4O5U A;  4L0U A;  1TK0 B;  1TJD A;  3DXB A;  4DVC A;  3KEB A;  4ZL9 A;  4Q5F A;  3R2Q A;  3DYR A;  1MTC A;  2R2J A;  2GSR A;  4KF9 A;  1WMJ A;  2YJH A;  3WYW A;  5G5E A;  1U6T A;  1N2A A;  4KX4 A;  4BPY A;  3LYK A;  1XOB A;  3D21 A;  2VIM A;  1XPV A;  2TIR A;  1F2E A;  2AV4 A;  1BG5 A;  3FR6 A;  1M7T A;  2FCH A;  2YWI A;  1QQ2 A;  1JZW A;  4WR5 A;  5ID2 A;  3EYT A;  2VCX A;  4BVX B;  2GST A;  2HZE B;  19GS A;  1OKD A;  2H74 A;  2PBJ A;  1S3A A;  4MA9 A;  3QAW A;  1HNC A;  5IM9 A;  1TRU A;  4KW6 A;  3CRT A;  1PD2 1;  5DAK B;  3DRN A;  3CTF A;  1PRX A;  3IAM 2;  3ZFL A;  2L6C A;  1J9B A;  5F05 A;  1T7P B;  4CY6 A;  2NTO A;  2LS5 A;  1JZD A;  2H1G A;  5GSS A;  1GSY A;  3FK8 A;  5ABR A;  5DBQ A;  2GSS A;  2YJ7 A;  4GF0 A;  3BBY A;  2RUF A;  4ID0 A;  4IJI A;  4TKY A;  2KP2 A;  5CRE A;  3IC8 A;  1K3L A;  2YV9 A;  3VI5 A;  3GH6 A;  3NIV A;  2PN8 A;  2H70 A;  3GIX A;  3TJF A;  4WEY A;  2OAD A;  1NHO A;  2JZS A;  1YKA A;  3W8S A;  4K0G A;  4ZB9 A;  4DSQ A;  1K3O A;  3KP8 A;  2YZH A;  2LJK A;  2CAI A;  1GUL A;  1RK4 A;  5ECL B;  1SD8 A;  3WD6 A;  2CZ2 A;  2MMZ A;  4N0Z A;  17GS A;  1GSF A;  1FVJ A;  1XW6 A;  2CVD A;  4ICY A;  5HR1 A;  3FR3 A;  1IYH A;  1PQN A;  3G9B A;  1YEX A;  3KP9 A;  2AB6 A;  4G2E A;  3HY2 A;  3L9U A;  4MP4 A;  3L9V A;  3G7J A;  4H86 A;  4Q5R A;  1XIY A;  1XWG A;  2A4H A;  3I9V 2;  1K0M A;  3CSH A;  4G9H A;  5ID2 B;  1GTI A;  2O8V B;  3FW2 A;  2I9H A;  5CNW A;  2BMX A;  3IAS 2;  3C1S A;  1K0C A;  3IA1 A;  5EL8 A;  3G7I A;  1MDJ A;  1KNG A;  3VWV A;  4O7H A;  2WZ9 A;  2PMT A;  5H5S A;  5BRT A;  3M0F A;  2ES7 A;  2ZUP A;  3BCI A;  4IP6 A;  2P5R A;  4FYB A;  3I69 A;  2K9F A;  2O7K A;  1TP9 A;  2H6X A;  4TVE A;  3GN3 A;  1KEB A;  3GYK A;  2AJQ B;  2FNO A;  3KM6 A;  3TKR A;  4YKG A;  3NOF A;  2VLU A;  3D4T A;  3P8W A;  1XOA A;  2IWT A;  2E7P A;  4G0I A;  4YKF A;  3M1G A;  1I5G A;  4MJB A;  2XPE A;  3D5J A;  1NW2 A;  4RQR A;  4MF7 A;  5J9B A;  4L0W A;  3EVI A;  1V98 A;  2ON7 A;  2AYT A;  1TTZ A;  1YZX A;  5D9V A;  4DSS A;  5C00 A;  4X4J A;  4G0K A;  13GS A;  2YNX A;  2IN3 A;  2NVL A;  1ERW A;  3KMN A;  4IJ3 A;  1GTB A;  5EPF A;  1SYR A;  3DIE A;  2F3M A;  1GP1 A;  4ZBB A;  3UBL A;  5D9T A;  2GQK A;  2JSZ A;  2VM2 A;  1ZYN A;  4F0B A;  1ZL9 A;  2XBQ A;  4JE1 A;  1FHE A;  1JLW A;  2OBK A;  3SBC A;  2F51 A;  3UMA A;  1ZYQ B;  3FY7 A;  6GSU A;  4NPB A;  3GMF A;  4BWQ A;  2H8L A;  1EWX A;  2C3N A;  3S9F A;  1ILO A;  2EC4 A;  2XBI A;  2L4C A;  3JCM L;  2B7K A;  1HYU A;  3KXO A;  4QL7 A;  2Z9S A;  5J41 A;  4EC0 A;  2IPA A;  1F9M A;  1X5D A;  1JFU A;  2E0Q A;  3W6G A;  1T3B A;  4PQI A;  1WOU A;  4P3Y B;  2EIO A;  2NDO A;  2FWE A;  1SJZ A;  2X8H A;  3VK9 A;  3FMW A;  6GSY A;  3ZYW A;  2N5F A;  1V40 A;  2YWO A;  4TR3 A;  5IMA A;  1U88 A;  4ZB8 A;  5IQY A;  2HRK A;  1NSW A;  2VLV A;  3L0H A;  1G6W A;  3F4T A;  4EL1 A;  1G7E A;  2B3S A;  3RBT A;  1EOG A;  5IO0 A;  1BJX A;  2MBT A;  4KSO A;  3TJB A;  5ENU A;  3GNJ A;  1FVK A;  4KGI A;  2C0D A;  2L6D A;  1FAA A;  4BVY A;  2CV4 A;  4WF4 A;  1H75 A;  1B4Q A;  1VRS D;  4DSS B;  4TW5 A;  4BWS A;  1A0F A;  1C72 A;  3GV1 A;  1U87 A;  3TRP A;  1QXH A;  1PX6 A;  4JED A;  2XPD A;  2C3Q A;  4WF5 A;  3ZL5 A;  1YF1 A;  2IME A;  5ECR B;  2PWJ A;  5ECI B;  4K2D A;  1G0T A;  1PA3 A;  2JU5 A;  3TDG A;  1KTE A;  3H4K A;  2LQO A;  4YAV A;  4ZBD A;  3WGE A;  4E8E A;  2LST A;  3HZ4 A;  2YAN A;  2O89 A;  4OMV A;  4IN0 A;  2VAF A;  4G19 A;  3Q18 A;  1YQ1 A;  2A2P A;  2B1K A;  5G1K A;  4X43 A;  3FHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...