2DLXA

Solution structure of the uas domain of human ubx domain-containing protein 7
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
153
structure length
153
Chain Sequence
GSSGSSGIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLVEWHQLDVSSFLDQVTGFLGEHGQLDGLSSSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBX domain-containing protein 7
publication title Solution structure of the UAS domain of human UBX domain-containing protein 7
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 23
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13899 Thioredoxin_7 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2dlxA01
16GSA 2H72A 2J23A 3WGXA 3MNGA 3KZQA 4HZ2A 3ZFLA 3E9JB 2JZTA 4NHWA 3GHAA 3IC4A 5HFIA 4LLRA 4WXTA 2OADA 4HQSA 4PNGA 4DSSB 2J9HA 1A23A 2AUVA 1OC8A 4HOJA 1WE0A 4G19A 4LA1A 5ECHB 1TK8B 2O8VB 2V2GA 4RI7A 4E8HA 5G31A 1A0RP 1ON4A 2RUFA 1JHBA 3LWAA 4MK3A 4WR5A 2JACA 3EURA 5J41A 1M99A 5H5RA 2PVOC 2R2JA 4YH2A 1JZWA 1SK1A 1F3BA 3C1SA 3VWVA 4XTSA 3FR6A 4KAEA 1A2JA 2H6YA 1GNWA 5LD0A 4TXOB 2GSTA 4NMUA 1M2DA 3Q6OA 4TN8A 3KTBA 3GTUB 5KEJA 1EEJA 1GLPA 5LNKe 5DQYA 3ZMLA 1HNAA 2FGXA 2H73A 2HSHA 2L59A 3P90A 4J57E 2CVBA 4AJ7A 4EXJA 3WD6A 1EV4A 3TJFA 3BCIA 2YCDA 4I2TA 4PXOA 1MEKA 1I9DA 1K0NA 1GSQA 4ML6A 1U88A 1F9MA 1YKCA 3M1GA 1GNEA 3ZMKA 1NHYA 1FB6A 4NV2A 1TXXA 1FVJA 2CX3A 2OKAA 3C73A 1GTAA 2OBKA 3QAWA 2XBIA 1SL2B 12GSA 3K8NA 5EVOA 4MZCA 5B7CA 3D4MA 5GAPD 3D5JA 2OACA 5JWQB 1XWGA 3GMFA 3L9UA 1K3OA 2B6MA 4ZILA 2B1LA 3W8JA 5G5EA 1GSYA 2QKEA 1FO5A 4AJ8A 3TOTA 1PL1A 1FVKA 1THXA 3CBUA 3HZ4A 4XRDA 4WBJA 1TKDB 1O8WA 5ECOB 1TK5B 3GL3A 4POBA 1FHEA 2MZCA 2C0FA 1X5CA 4O32A 3MSZA 1VF4A 4EKZA 4Q5QA 4GQCA 9GSSA 4PQ1A 4TR1A 3LJRA 5ECQB 3IE3A 1SD9A 2FCHA 1K0MA 4MH2A 4HU9A 2P5RA 2L5OA 3TJBA 3U5RE 2XC2A 3C1RA 2B7JA 5ECIB 1Z7PA 2H19A 1T8EB 2P5QA 3I69A 1RQMA 5JCGA 3UMAA 2K9FA 5DCGA 4ZBDA 1MD3A 2YPMA 2A2RA 1S3AA 1V98A 2GZYA 5F05A 19GSA 6GSTA 3KJYA 2FA8A 4GWRA 5D9VA 3L9VA 3TKSE 1PN9A 4MABA 3HZ8A 4ML1A 1B4QA 2VCQA 3ZTLA 4JE1A 3DGQA 2CT6A 1X0RA 5IPGA 2GT5A 2VO4A 1NHOA 1T1VA 3IBHA 3H4KA 1XW6A 5A4WA 3ZREA 1U3IA 3GA4A 3L78A 1XWCA 3GV1A 3GX0A 2H0IA 4BA7A 4NWYA 1XIYA 4TXVA 3EYTA 5IIZA 4HS1A 1R26A 3KEBA 2GQMA 5F07A 4NXIA 4OWYA 2O87A 4ECCA 1T4ZA 1AIUA 2H76A 2EIOA 4EE0A 5CAXA 2GZPA 5GAND 2F9SA 4GLTA 1YEPA 2IMKA 5JCWA 3W8SA 1VF1A 5AIXA 3F3RA 4IP6A 1G0TA 4DSQA 4LMWA 2HZFA 3ZZXA 3TKRA 1GULA 3LXZA 1MDIA 2PERA 1CQGA 3BD2A 4K1FA 1O6JA 3UBKA 1SJ6A 2HRFA 3HJOA 2TIRA 2LQOA 4POLA 2GTUA 2XPEA 5KN2A 3KP8A 3BJ5A 1BQ7A 3FKFA 3UBLA 2HRNA 3TJKA 1F37A 5HFGA 3PH9A 3FHKA 2X64A 2TRXA 4K0NA 3IPZA 2C0DA 1YEXA 2HNLA 3F4SA 2FWHA 1SJZA 1OC3A 4EUYA 1GSDA 4POKA 3WT2A 5DDLA 5IMVA 1SKRB 4GTUA 4JBBA 4ULXA 4K6XA 2WJUA 3O76A 3A5WA 5CREA 1Q4JA 1W89A 5D93A 2RUEA 4TVEA 3LG6A 1HNBA 4WF5A 3HVSA 4OMVA 2YOIA 3Q18A 1V2AA 3CTGA 1XXUA 4ILFA 2YANA 3G9BA 4DSSA 1J9BA 5JWOB 5HFKA 1A8LA 2LJAA 4K7NA 1KTEA 1B9XC 3IV4A 4G10A 2EIRA 1OC9B 2OE1A 4X43A 2RLIA 2VLTA 2B5YA 3QPMA 4KSMA 4TKYA 4PQIA 3CMIA 5D9WA 4RQRA 3UJ1A 3UEMA 5KN1A 3I43A 2AAWA 4K9ZA 4KCAA 3GKXA 3TJGA 17GSA 2P0GA 2WZ9A 4TR3A 2LJRA 1XOBA 1PA3A 22GSA 4TXOA 3KXOA 1SENA 1BG5A 5ECSA 2IN3A 2VCTA 3GTUA 4WKWA 1XVQA 2D2ZA 2FWEA 1UVZA 5AIVA 3MAKA 4ZIJA 3ZITA 1M2AA 3SWLA 3DIEA 3DMLA 4JR6A 3G7YA 1KNGA 3FK8A 4WBRD 1GP1A 5DAKB 2O89A 1MD4A 2VIMA 2CQ9A 1R5PA 2KUCA 3G7JA 4IN0A 4EO3A 3D21A 2H30A 2DJ1A 3GRXA 5D9TA 5B8BA 1SL1B 1V40A 3L0HA 1OAZA 2NVLA 5IQYA 5AGYA 4BL7A 2R6KA 1FB0A 4ZBAA 2FLSA 3DXBA 3C8EA 1Q98A 3GUSA 5E59A 1C72A 1DE2A 1RW1A 5C00A 1OVNA 2LUSA 2E7PA 3CRUA 3GSSA 4PNFA 3KTLA 5F06A 5CNWA 1BJXA 3TOUA 3F0IA 2B1KA 2JL4A 2PVQA 3SBCA 2IMEA 3EINA 1YKAA 4L5LA 1UN2A 4MLYA 5AISA 4YQVA 3QFAC 4IJ3A 2HZEB 1E2YA 3EU4A 3QDNA 4KUNA 1S3CA 4G9HA 1M0UA 3VWWA 1WMJA 2YWNA 5KN0A 1G7EA 4GSSA 5CO3A 3KP9A 1TU8A 3CSHA 5CRDA 1VF3A 5DALB 1NW2A 5J5NA 2LNTA 3UARA 2C3TA 3HVVA 3A2XA 2L6CA 4EVMA 2YJ7A 1SD8A 2VCVA 5DJMA 3EWLA 3BCKA 3APQA 3TKPA 2LTKA 3IAM2 2GGTA 1GUKA 3LGCA 4MMMA 2OBIA 1M7TA 4XS6A 4TRXA 4YAVA 3HJMA 2Z9SA 2VD0A 1H4OA 4YAPA 5A4VA 4K0GA 3KGKA 2C8UA 1XOAA 1PX6A 3D6IA 20GSA 1J0FA 1EP8A 3BBYA 2GT6A 2IWTA 3H8QA 5J3RA 2QSIA 2JADA 2WFCA 2DJJA 5HR3A 5DQSA 3GL5A 4KB3A 2V6KA 1WIKA 2H0GA 3FZ5A 5D9XA 2H70A 5G2ZA 2K8SA 2KOKA 4MCUA 2GDRA 1HYUA 4N30A 4KA0A 1TRWA 2H8LA 2I3YA 3I6AA 4L0UA 2QC7A 4MZWA 4AGSA 2KP2A 5DVBA 1GSSA 3LYKA 4FO5A 5HR0A 14GSA 1T00A 1B9YC 1Z7RA 1XW5A 2VCWA 3FEUA 3IRAA 2DJKA 3H1NA 1ZL9A 3ZVJA 2C4JA 1SKWB 1SK0A 2E2GA 2N5AA 3US3A 3J7Yk 2KHPA 1QK8A 1IYHA 1XW9A 1T7PB 4FIWA 3ZVJD 2X99A 1EZKA 2F51A 2REMA 2OJLA 3KMOA 4ECIA 1R5AA 3F63A 1OKDA 2VCXA 7GSSA 1PX7A 3FY7A 5J9CA 3C7MA 2N5BA 2CZ2A 4XRAA 2FWGA 1Y25A 4OFMA 2ZUPA 3TRQA 3E3EA 1XVWA 3D0ZA 1QGVA 2MMOA 1O81A 3GNJA 2EIQA 4F82A 2JSYA 3TKSA 4DVCA 4IELA 4ZL7A 4HI7A 4AJ6A 2H66A 3IK9A 2MBTA 2YV7A 3EMXA 2LEGA 2FD3A 2VD1A 3TB2A 1O85A 2LKUA 1ACVA 3GH6A 4IQAA 4NAXA 5ECKB 5ECRB 1ZMAA 2M80A 4BVXA 3QMXA 4TW5A 4IP1A 6GSVA 2M46A 1YF1A 1JLVA 1K0CA 1KBNA 5CRGA 3VPQA 2H1AA 5ECMB 2P31A 4GF0A 4KDXA 2YZUA 3QR6A 2C1YA 5E4WA 4ZL8A 4ZXGA 2FHEA 3ZIJA 4MPGA 1SL0B 1WRYA 5H5QA 4XS4A 4GSNA 4NHZA 1PGTA 6GSWA 4GSTA 3HHVA 1WP0A 1XFLA 4H86A 4O7HA 1OC9A 2WDUA 2GQLA 4GRFA 4OCFA 5ELGA 1G7OA 3GYKA 3MWHA 1J08A 5G1LA 2HE3A 3DD3A 2VM1A 4MF6A 1IYIA 2YP6A 3F8UA 3IR4A 2CZ3A 4MPFA 6GSYA 5IMCA 1EGRA 5IOWA 4MZBA 1ST9A 1ERUA 1TRVA 2RM6A 3FR9A 4N10A 3ZYWA 3TKQA 4I2UA 4ZB9A 2JSZA 5GZZB 2IFQB 1AC1A 1EGOA 1GSFA 4K7OA 3RPPA 5IOXA 3KD0A 4DEJA 4MJCA 3RAZA 2DJ2A 4IBPA 1TI1A 4D73B 3S9FA 2LV3A 3UVHA 2A4VA 1YQ1A 2AV4A 3FYGA 2AB6A 3PGTA 13GSA 5DAKA 1ZYQB 2LJKA 1AW9A 2X8HA 3ZL5A 3WGDA 3GSTA 2NPBA 1B4PA 3UIWA 2LRTA 3F6DA 2VCZA 4V1Ag 2CAIA 4HQZA 5ID2B 2YJHA 4KSOA 1JZDA 1OE8A 5HQPA 4F0CA 4F2IA 1TDIA 3AY8A 3E0UA 1FAAA 3EMPA 4ISDA 1FG4A 4IQ1A 2JU5A 3FR3A 5AN1A 1GSUA 3GKNA 2LNSA 5D96A 4KNDA 2BTOT 2DC5A 1W4VA 1WPIA 4XHMA 5EPFA 1EOGA 1GWCA 1U3AA 1EWXA 2YNXA 1G6WA 4KH7A 2K6VA 2PBJA 2VAFA 3V1WA 2HZEA 4LL1B 2C80A 3ZLPA 3BOAA 1USBA 2F8AA 4I8BA 2GVPA 1X5DA 2HFDA 2YWOA 1JFUA 2WRTA 1A8YA 4V1Ap 5DALA 3GN3A 4XCSA 1ABAA 3NIVA 4O5RA 1ML6A 4I6XA 1SKSB 2XHFA 3M8NA 3EU3A 3KMNA 2CVDA 4TOPA 1EP7A 4XS4B 3W6GA 4N0VA 4L0WA 2B3SA 5B6MA 3HJPA 2I9HA 1Z6MA 2WCIA 2ON5A 1T4YA 1LJRA 1GUMA 5JWRB 5COHA 1QMVA 3QD9A 2BMXA 2I4AA 1GTBA 1X9MB 6GSUA 4IVFA 2MBSA 4FYUA 3LSZA 4MH3A 2B5XA 4ECBA 4IHUA 4J2FA 2DIZA 2N5FA 3IHQA 2GLRA 3RPNA 4NPBA 1N8JA 2M72A 3F6FA 3WYWA 1Y6EA 4RUVA 2C0GA 3FRCA 1A24A 3EVIA 2DIYA 3F3QA 4GCIA 1AQVA 2A2SA 2LQQA 4CDOA 1M9BA 2FNOA 3LYPA 5ECPB 2JZRA 3VPTA 2AJQB 1RK4A 1AQXA 2CVKA 4HJMA 3LFLA 1GTUA 4I97A 5INYA 2IMFA 2AHEA 3N9JA 1O8XA 1ERWA 5HR2A 3JCML 4PGTA 3CSJA 1V57A 2IJYA 4RQXA 4PQHA 5IMDA 5G5FA 5B8AA 1ZYEA 2HI7A 4P3YB 1TK0B 4QQ7A 2QGVA 2R37A 4K7IA 5G30A 3GFKA 4QL7A 2HSYA 1DBYA 2VL2C 4DSRA 3FW2A 4K2DA 1JZOA 4OD7A 1N2AA 1BAYA 1LBKA 3OR5A 5A5KA 4FYBA 1URMA 4RI6A 3HD5A 4PURA 1ZOFA 5ABRA 5CP1A 4GXZA 3HKRA 3NZNA 2WGRA 3U6VA 2V1MA 4V2NA 4HEA2 2GSRA 3HYPA 2B5EA 3GKMA 1K3LA 3ERFA 3L9SA 1Z5YE 4XS1A 4QL9A 3IXRA 1TJDA 2F8FA 1THOA 4O92A 2BJXA 3F9UA 3A2VA 1TRUA 3FZ4A 2YWIA 3GIXA 3J7Yb 3M3MA 3ZRDA 1PQNA 2MMNA 1GSEA 2DBCA 3IK7A 5IPHA 1QUWA 1TI3A 1X9WB 2H75A 3KCMA 2CV4A 3WGEA 3LQ7A 2PUKC 2DLXA 3RDWA 6GSXA 2H1DA 1O7UA 1R7HA 5C04A 1EOHA 1XBSA 4HZ4A 4IKHA 3NOFA 1GRXA 3KM6A 1ILOA 3APOA 4Q5NA 3DWVA 3TUEA 2L4QA 1SJIA 2GS3A 4N0ZA 2L5LA 2ALBA 5DBQA 4G2EA 1SK2A 2HXKA 5IMAA 1K0AA 4K8MA 4L8EA 5F0GA 3MDKA 3TRPA 1LU4A 1AUCA 5CRWA 2O7KA 3C71A 2R3XA 2IFQA 1BYEA 4OO4A 4EF0A 3HY2A 3QOUA 2FWFA 2O85A 4EC0A 2PMTA 2RM5A 4MF5A 3VWXA 3M0FA 2KLXA 5F8BA 3CXGA 4D73A 2CAQA 1PSQA 3DYRA 1S3DA 1VF2A 4BPYA 3ERGA 3LXTA 5DCHA 2YN1A 3IOSA 3RHBA 2LS5A 4ACSA 2HLSA 2E0QA 2H6XA 8GSSA 5ID2A 4L5OA 4KDUA 3QAGA 1DE1A 4NV5A 3VLNA 1WOUA 4HUAA 1U6TA 1GTIA 4KGIA 3FZAA 3QFBC 3UOMA 2L57A 2OE3A 2OA7A 4KDYA 1FW1A 1TOFA 1V58A 3UAPA 3ME7A 2VUPA 1YF0A 3GURA 1OKTA 1TU7A 3RBTA 3GKKA 1PD21 4FH8A 4V2MA 4IGJA 3ZFBA 1XWKA 2G0FA 4OCEA 1MDKA 4BVYA 3TCOA 1K0DA 1CQHA 4BWQA 3TJJA 1HQOA 1NM3A 4POMA 1BX9A 2GZZA 2XBQA 1SYRA 5D73A 2F3MA 5HR1A 5GSTA 2ZNMA 3F4RA 2H6ZA 3L4NA 2I81A 3QAVA 3ZIVA 1F6MC 5FHIA 1NSWA 2XPDA 1GL8A 3VWUA 3Q74A 2IMDA 3APSA 1R4WA 4YQMA 2H71A 3TGZA 1DSBA 1Z3EA 4ZB8A 4X1UA 1VGLA 3TDGA 4F9ZA 4WETA 1ZGNA 1TRSA 2K8VA 5G1KA 3GH9A 2MMZA 2PGTA 3TKSC 2ZCTA 4OFTA 2H01A 1OE7A 4F0BA 5JCUA 3HCZA 2I1UA 2VM2A 2K18A 2YZHA 4EDZA 2L4CA 5A4UA 3DVWA 4Q5RA 3DRNA 2V41A 1H75A 2H1GA 3ERWA 4KW6A 3UL3A 2DJ0A 2IL3A 3ME8A 3DKSA 4KX4A 4HDEA 1TP9A 5L71A 1AXDA 4LMVA 1A2LA 3EE2A 3O6TA 4I5QA 2VOCA 4EDYA 4ZB6A 2WS2A 1KEBA 2DMLA 1GH2A 4CW9A 2CX4A 1MDJA 2HT9A 1F3AA 1UC7A 1E6BA 1PRXA 3Q19A 1XWAA 5EL8A 3P7XA 4ID0A 1AQWA 3CYNA 2V6OA 5D8IA 3WT1A 2DJ3A 1ERTA 3CSIA 2PN8A 1VRSD 2EC4A 2GQKA 3GX8A 3HXSA 4MJAA 4JEDA 11GSA 1QQ2A 1UA5A 3I9V2 4IW9A 4N11A 1BEDA 3ED3A 1A0FA 1B48A 1K3YA 2L6DA 2IIYA 4JRRA 1ZZYA 4TR4A 4FYCA 1QFNA 2NDOA 4OO5A 3F4TA 4IS0A 3A3TA 1M2BA 1WWJA 3H79A 3VI7A 3P8WA 3QCPA 4MA9A 2X8CA 1YDKA 5LCZA 5IMZA 5ELAA 1JZRA 2H0HA 3D4TA 1FOVA 1YY7A 1ZCPA 2NTOA 3HDCA 1AAZA 4MJBA 3ISOA 5IM9A 2GSSA 1K0BA 1TTZA 4HU7A 4JZQA 3A2WA 4TR1B 2VL3A 5KN3A 3N5OA 2MYGA 4KCEA 1WJKA 3FZ9A 4TR0A 2CA8A 4JU5A 1YJ6A 1HNCA 2KP1A 1Z9HA 3PINA 4MF7A 1GLQA 1QXHA 5ECLB 4MP4A 4PX1A 4YQUA 1JLWA 1XPVA 3VFIA 2DMMA 2TRCP 3P2AA 1HD2A 5J9BA 2FUG2 2PU9C 3RHCA 2JZSA 2C3NA 1TW9A 2YWMA 1EEMA 1PKWA 3H93A 2H1BA 1PMTA 2FA4A 2RIIA 3KIJA 5J4UA 1Z6NA 2LRNA 4ZBBA 3G7IA 4JR4A 1DUGA 1EV9A 3DEXA 3VI5A 1A2MA 2OE0A 3LEFA 2GSQA 3M9KA 4PUFC 1XZOA 2DSAA 2ON7A 2G2QA 2ES7A 1MTCA 1M9AA 3KH9A 3EC3A 3HA9A 4WR4A 4BWSA 4WF4A 3VK9A 2PPTA 2V32A 4J56E 3CRTA 4OFNA 2VL2A 2R5GA 1XWBA 4EL1A 4V2LA 1SYXA 2PWJA 2VLVA 1O73A 1I5GA 5IO2A 2YV9A 3O3TA 4PUAA 4F03A 2HYXA 4MDCA 1GUHA 2VLUA 3M9JA 4Q5FA 2WB9A 3PR8A 5GSSA 1G6YA 2R4VA 1SU9A 2C0EA 1T3BA 1YZXA 4E8EA 5FWGA 2H74A 3IDVA 18GSA 2LRCA 3TRXA 3D22A 3CTFA 5EY6A 4KE3A 1X5EA 5H5SA 1XCCA 3R2QA 4X0XA 5ECNB 3IAS2 1V9WA 3LORA 4HJ2A 2E2MA 4GQFA 4WEYA 1X9SB 3UVTA 4XIHA 4ECJA 2IMIA 2FY6A 5ENUA 10GSA 1PL2A 1OYJA 3HVXA 2X8GA 2MMAA 3DVXA 1PKZA 1K0OA 5B6NA 2C3QA 5FT3A 3KH7A 5DJLA 4Z7XA 4AF2A 4IJIA 4CHSA 2AYTA 1U87A 2VL9A 5CYYA 2LSTA 2NBSA 3IA1A 4LL4B 1ERVA 4ZL9A 2IPAA 1B8XA 6GSSA 5IO0A 3VURA 2WULA 5CRHA 2B7KA 5IMFA 1F2EA 4MJEA
chains in the Genus database with same CATH superfamily
16GSA 2H72A 2J23A 3WGXA 3MNGA 3KZQA 4HZ2A 3ZFLA 3E9JB 2JZTA 4NHWA 3GHAA 3IC4A 5HFIA 4LLRA 4WXTA 2OADA 4HQSA 4PNGA 4DSSB 2J9HA 1A23A 2AUVA 1OC8A 4HOJA 1WE0A 4G19A 4LA1A 5ECHB 1TK8B 2O8VB 2V2GA 4RI7A 4E8HA 5G31A 1A0RP 1ON4A 2RUFA 1JHBA 3LWAA 4MK3A 4WR5A 2JACA 3EURA 5J41A 1M99A 5H5RA 2PVOC 2R2JA 4YH2A 1JZWA 1SK1A 1F3BA 3C1SA 3VWVA 4XTSA 3FR6A 4KAEA 1A2JA 2H6YA 1GNWA 5LD0A 3A5IA 2R0GA 4TXOB 2GSTA 4NMUA 1M2DA 3Q6OA 4TN8A 3KTBA 3GTUB 5KEJA 1EEJA 1GLPA 5LNKe 5DQYA 3ZMLA 1HNAA 2FGXA 2H73A 4ICYA 2HSHA 2L59A 3P90A 4J57E 2CVBA 4AJ7A 4EXJA 3WD6A 1EV4A 3TJFA 3BCIA 2YCDA 4I2TA 4PXOA 1MEKA 1I9DA 1K0NA 1GSQA 4ML6A 1U88A 1F9MA 1YKCA 3M1GA 1GNEA 3ZMKA 1NHYA 1FB6A 4NV2A 1TXXA 1FVJA 2CX3A 2OKAA 3C73A 1GTAA 2OBKA 3QAWA 2HRKA 2XBIA 3EPTA 1SL2B 4BL7B 12GSA 3K8NA 5BMUA 5EVOA 4MZCA 5B7CA 3D4MA 5GAPD 3D5JA 2OACA 5JWQB 1XWGA 3GMFA 3L9UA 1K3OA 2B6MA 4ZILA 2B1LA 3W8JA 5G5EA 1GSYA 2QKEA 1FO5A 4AJ8A 3TOTA 1PL1A 1FVKA 1THXA 3CBUA 3HZ4A 4XRDA 4WBJA 1TKDB 1O8WA 5ECOB 1TK5B 3GL3A 4POBA 1FHEA 2MZCA 2C0FA 1X5CA 4O32A 3MSZA 1VF4A 4EKZA 3R3EA 4Q5QA 4GQCA 9GSSA 4PQ1A 4TR1A 3LJRA 5ECQB 3IE3A 1SD9A 2FCHA 1K0MA 4MH2A 4HU9A 2P5RA 2L5OA 3TJBA 3U5RE 2XC2A 3C1RA 2B7JA 5ECIB 1Z7PA 2H19A 1T8EB 2P5QA 1FOHA 3I69A 1RQMA 5JCGA 2X4AA 2K9FA 3UMAA 5DCGA 4ZBDA 1MD3A 2YPMA 2A2RA 1S3AA 1V98A 2GZYA 5F05A 19GSA 6GSTA 3KJYA 2FA8A 4GWRA 5D9VA 3L9VA 3TKSE 1PN9A 4YKGA 4MABA 3HZ8A 4ML1A 1B4QA 2VCQA 3ZTLA 4JE1A 3DGQA 2CT6A 1X0RA 5IPGA 2GT5A 2VO4A 1NHOA 1T1VA 3IBHA 3H4KA 1XW6A 5A4WA 3ZREA 1U3IA 3GA4A 3L78A 1XWCA 3GV1A 3GX0A 2H0IA 4BA7A 4NWYA 1XIYA 4TXVA 3EYTA 5IIZA 4HS1A 1R26A 3KEBA 2GQMA 5F07A 4NXIA 4OWYA 2O87A 4ECCA 1T4ZA 1AIUA 2H76A 2EIOA 4G0KA 4EE0A 5CAXA 2GZPA 5GAND 2F9SA 4GLTA 1YEPA 2IMKA 5JCWA 3W8SA 3IHGA 1VF1A 5AIXA 3F3RA 4IP6A 1G0TA 4DSQA 4LMWA 2HZFA 3ZZXA 3TKRA 1GULA 3LXZA 1MDIA 2PERA 2UZ8A 1CQGA 3BD2A 4K1FA 1O6JA 3UBKA 1SJ6A 2HRFA 3HJOA 2TIRA 2LQOA 4POLA 2GTUA 2XPEA 5KN2A 3KP8A 3BJ5A 1BQ7A 3FKFA 3UBLA 2HRNA 3TJKA 1F37A 5HFGA 3PH9A 3FHKA 2X64A 2TRXA 4K0NA 3IPZA 2C0DA 1YEXA 2HNLA 3F4SA 2FWHA 1SJZA 1OC3A 4EUYA 1GSDA 4POKA 3WT2A 5DDLA 5IMVA 1SKRB 4GTUA 4JBBA 4BVXB 4Z2UA 4ULXA 4K6XA 2WJUA 3O76A 3A5WA 5CREA 1Q4JA 1W89A 5D93A 2RUEA 4TVEA 3LG6A 1HNBA 4WF5A 3HVSA 4OMVA 4EIQA 2YOIA 3Q18A 4O5UA 1V2AA 3CTGA 1XXUA 4ILFA 2YANA 3G9BA 4DSSA 1J9BA 5JWOB 5HFKA 1A8LA 2LJAA 4K7NA 5BRTA 1KTEA 1B9XC 3IV4A 4G10A 2EIRA 1OC9B 2OE1A 4X43A 2RLIA 2VLTA 2B5YA 3QPMA 4KSMA 4TKYA 4PQIA 3CMIA 5D9WA 2HSMA 4RQRA 3UJ1A 3UEMA 5KN1A 4HSCX 3I43A 2AAWA 4K9ZA 4KCAA 3GKXA 3TJGA 17GSA 2P0GA 2WZ9A 4TR3A 2LJRA 1XOBA 1PA3A 22GSA 4TXOA 2DKIA 3KXOA 1SENA 1BG5A 5ECSA 2IN3A 2VCTA 3GTUA 4WKWA 1XVQA 2D2ZA 2FWEA 1UVZA 5AIVA 3MAKA 4ZIJA 3ZITA 1M2AA 3SWLA 3DIEA 3DMLA 4JR6A 3G7YA 1KNGA 3FK8A 4WBRD 1GP1A 5DAKB 2O89A 1MD4A 2VIMA 2CQ9A 1R5PA 1XG8A 2KUCA 3G7JA 4IN0A 4EO3A 3D21A 2H30A 2DJ1A 3GRXA 5D9TA 5B8BA 1SL1B 1V40A 3L0HA 1OAZA 2NVLA 5IQYA 5AGYA 4BL7A 2R6KA 1FB0A 4ZBAA 2FLSA 3DXBA 3C8EA 1Q98A 3GUSA 5E59A 1C72A 1DE2A 4CY6A 1RW1A 5C00A 1OVNA 2LUSA 2E7PA 3CRUA 3GSSA 4PNFA 3KTLA 5F06A 5CNWA 1BJXA 3TOUA 3F0IA 2B1KA 2JL4A 2PVQA 3SBCA 2IMEA 3EINA 1YKAA 4L5LA 1UN2A 4MLYA 5AISA 4YQVA 3QFAC 4IJ3A 2HZEB 1E2YA 3EU4A 3QDNA 4KUNA 1S3CA 4G9HA 1M0UA 3VWWA 1WMJA 2YWNA 5KN0A 1G7EA 4GSSA 5CO3A 3KP9A 1TU8A 3CSHA 5CRDA 1VF3A 5DALB 1NW2A 5J5NA 2LNTA 3UARA 2C3TA 3HVVA 3A2XA 2L6CA 4EVMA 2YJ7A 1SD8A 2VCVA 5DJMA 3EWLA 3BCKA 3APQA 3TKPA 2LTKA 3IAM2 2HRAA 2GGTA 1GUKA 3LGCA 4MMMA 2OBIA 1M7TA 4XS6A 4TRXA 4YAVA 3HJMA 2Z9SA 2VD0A 1H4OA 4YAPA 5A4VA 4K0GA 3KGKA 2C8UA 1XOAA 1PX6A 3D6IA 20GSA 1J0FA 1EP8A 3BBYA 2GT6A 2IWTA 3H8QA 5J3RA 2QSIA 2JADA 2WFCA 2DJJA 5HR3A 5DQSA 3GL5A 4KB3A 2V6KA 1WIKA 2H0GA 3FZ5A 5D9XA 2H70A 5G2ZA 2K8SA 2KOKA 4MCUA 2GDRA 1HYUA 4N30A 4KA0A 1TRWA 2H8LA 2I3YA 3I6AA 4L0UA 2QC7A 4MZWA 4AGSA 2KP2A 5DVBA 1GSSA 3LYKA 4FO5A 5HR0A 14GSA 1T00A 1B9YC 1Z7RA 1XW5A 2VCWA 3FEUA 3IRAA 5KOWA 2DJKA 3H1NA 1ZL9A 3ZVJA 2C4JA 1SKWB 1SK0A 2E2GA 2N5AA 3US3A 3J7Yk 4FQUA 4MNNA 2KHPA 1QK8A 1IYHA 1XW9A 1T7PB 4Z2RA 4FIWA 3ZVJD 2X99A 1EZKA 2F51A 2REMA 2OJLA 3KMOA 4ECIA 1R5AA 3F63A 1OKDA 2VCXA 7GSSA 1PX7A 3FY7A 5J9CA 3C7MA 2DKHA 2N5BA 2CZ2A 4XRAA 2FWGA 1Y25A 4OFMA 2ZUPA 3TRQA 3E3EA 1XVWA 3D0ZA 1QGVA 2MMOA 1O81A 3GNJA 2EIQA 4F82A 2JSYA 3TKSA 4DVCA 4IELA 4ZL7A 4HI7A 4AJ6A 2H66A 3IK9A 2MBTA 2YV7A 3EMXA 2LEGA 2FD3A 2VD1A 3TB2A 1O85A 2LKUA 1ACVA 3GH6A 4IQAA 4NAXA 5ECKB 5ECRB 1ZMAA 2M80A 4BVXA 3QMXA 4TW5A 4IP1A 6GSVA 2M46A 1YF1A 1JLVA 1K0CA 1KBNA 5CRGA 3VPQA 2H1AA 5ECMB 2P31A 4GF0A 4KDXA 2YZUA 3QR6A 2C1YA 5E4WA 4ZL8A 4ZXGA 2FHEA 3ZIJA 4MPGA 1SL0B 1WRYA 5H5QA 4XS4A 3HVNA 4GSNA 4NHZA 1PGTA 6GSWA 4GSTA 3HHVA 1WP0A 1XFLA 4H86A 4O7HA 1OC9A 4USSA 2WDUA 2GQLA 4GRFA 4OCFA 5ELGA 1G7OA 3GYKA 3MWHA 1J08A 5G1LA 2HE3A 3DD3A 2VM1A 4MF6A 1IYIA 2YP6A 3F8UA 3IR4A 2CZ3A 4MPFA 6GSYA 5IMCA 1EGRA 4K5SA 5IOWA 4MZBA 1ST9A 1ERUA 1TRVA 2RM6A 3FR9A 4N10A 3ZYWA 3TKQA 4I2UA 4ZB9A 2JSZA 5GZZB 2IFQB 1AC1A 1EGOA 1GSFA 4K7OA 3RPPA 5IOXA 3KD0A 4DEJA 4MJCA 3RAZA 2DJ2A 4IBPA 1TI1A 4D73B 3S9FA 2LV3A 3UVHA 2A4VA 1YQ1A 2AV4A 3FYGA 2AB6A 3PGTA 13GSA 5DAKA 1ZYQB 2LJKA 1AW9A 2X8HA 3ZL5A 3WGDA 3GSTA 2NPBA 1B4PA 3UIWA 2LRTA 3F6DA 2VCZA 4V1Ag 2CAIA 4HQZA 5ID2B 2YJHA 4KSOA 2R0CA 1JZDA 1OE8A 5HQPA 4F0CA 4F2IA 1TDIA 3AY8A 3E0UA 1FAAA 3EMPA 4ISDA 1FG4A 3PPUA 4G0LA 4IQ1A 2JU5A 3FR3A 5AN1A 1GSUA 3GKNA 2LNSA 5D96A 4KNDA 2BTOT 2DC5A 1W4VA 1WPIA 4XHMA 5EPFA 1EOGA 1GWCA 1U3AA 1EWXA 2YNXA 1G6WA 4KH7A 4BVYB 2K6VA 2PBJA 2VAFA 3V1WA 2HZEA 4LL1B 2C80A 3ZLPA 3BOAA 1USBA 2F8AA 4I8BA 2GVPA 1X5DA 2HFDA 2YWOA 1JFUA 2WRTA 1A8YA 4V1Ap 5DALA 3GN3A 4XCSA 1ABAA 3NIVA 4O5RA 1ML6A 4K5RA 4I6XA 1SKSB 2XHFA 3M8NA 3EU3A 3KMNA 2CVDA 1ZYNA 4TOPA 1EP7A 4XS4B 3W6GA 4N0VA 1PN0A 4L0WA 2B3SA 4K2XA 5B6MA 3HJPA 2I9HA 1Z6MA 2WCIA 2ON5A 1T4YA 1LJRA 1GUMA 5JWRB 5COHA 1QMVA 3QD9A 2BMXA 2I4AA 1GTBA 1X9MB 6GSUA 4IVFA 2MBSA 4FYUA 3LSZA 4MH3A 2B5XA 4ECBA 4IHUA 4J2FA 2DIZA 2N5FA 3IHQA 2GLRA 3RPNA 4NPBA 1N8JA 2M72A 3F6FA 3WYWA 1Y6EA 4RUVA 2C0GA 3FRCA 3MIXA 1A24A 3EVIA 2DIYA 3F3QA 4GCIA 1AQVA 2A2SA 2LQQA 4CDOA 1M9BA 2FNOA 3LYPA 5ECPB 2JZRA 3VPTA 2AJQB 1RK4A 1AQXA 2CVKA 4HJMA 3LFLA 1GTUA 4I97A 5INYA 2IMFA 2AHEA 3N9JA 1O8XA 1ERWA 5HR2A 3JCML 4PGTA 3CSJA 1V57A 2IJYA 4RQXA 4PQHA 5IMDA 5G5FA 5B8AA 1ZYEA 2HI7A 4P3YB 1TK0B 4QQ7A 2QGVA 2R37A 4K7IA 5G30A 3GFKA 4QL7A 2HSYA 4X4JA 1DBYA 2VL2C 4DSRA 3FW2A 4K2DA 1JZOA 4OD7A 1N2AA 1BAYA 1LBKA 3OR5A 5A5KA 4FYBA 1URMA 4RI6A 3FMWA 3HD5A 1ZOFA 4PURA 5ABRA 5CP1A 4GXZA 3HKRA 5KOXA 3NZNA 2WGRA 3U6VA 2V1MA 4V2NA 4HEA2 2GSRA 3HYPA 2B5EA 3GKMA 1K3LA 3ERFA 3L9SA 1Z5YE 4XS1A 4QL9A 3IXRA 1TJDA 2F8FA 1THOA 4O92A 2BJXA 3F9UA 3A2VA 1TRUA 3FZ4A 2YWIA 3GIXA 3J7Yb 3M3MA 3ZRDA 3IC8A 1PQNA 2MMNA 1GSEA 2DBCA 3IK7A 5IPHA 1QUWA 1TI3A 1X9WB 2H75A 3KCMA 2CV4A 3WGEA 3LQ7A 2PUKC 2DLXA 3RDWA 6GSXA 2H1DA 1O7UA 1R7HA 5C04A 1EOHA 1XBSA 4HZ4A 4IKHA 1M3JA 3NOFA 1GRXA 3KM6A 1ILOA 3APOA 4Q5NA 3DWVA 3TUEA 2L4QA 1SJIA 2GS3A 4N0ZA 2L5LA 2ALBA 5DBQA 4G2EA 1SK2A 1PFOA 2HXKA 5IMAA 3MYDA 1K0AA 4K8MA 4L8EA 5F0GA 3MDKA 3TRPA 1LU4A 1AUCA 3CQFA 2QA2A 5CRWA 2O7KA 3C71A 2R3XA 2IFQA 1BYEA 4OO4A 4EF0A 3HY2A 3QOUA 2FWFA 2O85A 4EC0A 2PMTA 2RM5A 4MF5A 3VWXA 3M0FA 2KLXA 5F8BA 3CXGA 4D73A 2CAQA 1PSQA 3DYRA 1S3DA 1VF2A 4BPYA 3ERGA 3LXTA 5DCHA 2YN1A 3IOSA 3RHBA 2LS5A 4ACSA 2HLSA 2E0QA 2H6XA 8GSSA 5ID2A 4L5OA 2QA1A 4KDUA 3QAGA 1DE1A 4NV5A 3VLNA 1WOUA 4HUAA 1U6TA 1GTIA 4KGIA 3FZAA 2X49A 3QFBC 3UOMA 2L57A 2OE3A 2OA7A 4KDYA 1FW1A 1TOFA 1V58A 3UAPA 3ME7A 2VUPA 3LW9A 1YF0A 3GURA 1OKTA 1TU7A 3RBTA 3GKKA 1PD21 4FH8A 4V2MA 4IGJA 3ZFBA 1XWKA 2G0FA 4OCEA 1MDKA 4BVYA 3TCOA 1K0DA 1CQHA 4BWQA 3TJJA 1HQOA 1NM3A 4POMA 1BX9A 2GZZA 2XBQA 1SYRA 5D73A 2F3MA 4EIPA 5HR1A 5GSTA 2ZNMA 3F4RA 2H6ZA 3L4NA 2I81A 3QAVA 2R0PA 3ZIVA 1F6MC 5FHIA 1NSWA 4Z2TA 2XPDA 1GL8A 3VWUA 3Q74A 2IMDA 3APSA 1R4WA 4YQMA 2H71A 3TGZA 1DSBA 1Z3EA 4ZB8A 4X1UA 1VGLA 3TDGA 4F9ZA 4WETA 1ZGNA 1TRSA 2K8VA 5G1KA 3GH9A 2MMZA 2PGTA 3TKSC 2ZCTA 4OFTA 2H01A 1OE7A 4F0BA 5JCUA 3HCZA 2I1UA 2VM2A 2K18A 2YZHA 4EDZA 2L4CA 5A4UA 3DVWA 4Q5RA 3DRNA 2V41A 1H75A 2H1GA 3ERWA 4KW6A 3UL3A 2DJ0A 2IL3A 3ME8A 3DKSA 4KX4A 4HDEA 1TP9A 5L71A 1AXDA 4LMVA 1A2LA 3EE2A 3O6TA 4I5QA 2VOCA 4EDYA 4ZB6A 2WS2A 1KEBA 2DMLA 1GH2A 4CW9A 2CX4A 1MDJA 2HT9A 1F3AA 1UC7A 1E6BA 1PRXA 3Q19A 1XWAA 5EL8A 3P7XA 4ID0A 1AQWA 3CYNA 2V6OA 5D8IA 3WT1A 2DJ3A 1ERTA 3CSIA 2PN8A 1VRSD 2EC4A 2GQKA 3GX8A 3HXSA 4MJAA 4JEDA 11GSA 1QQ2A 1UA5A 3I9V2 4IW9A 4N11A 1BEDA 3ED3A 1A0FA 1B48A 4YKFA 1K3YA 2L6DA 2IIYA 4JRRA 1ZZYA 4TR4A 4FYCA 1QFNA 2NDOA 2A4HA 4OO5A 3F4TA 4IS0A 3A3TA 1M2BA 1WWJA 3H79A 4A5PA 3VI7A 3P8WA 3QCPA 4MA9A 2X8CA 1YDKA 5LCZA 1M3IA 5IMZA 5ELAA 1JZRA 2H0HA 3D4TA 1FOVA 1YY7A 1ZCPA 2NTOA 3HDCA 1AAZA 4MJBA 3ISOA 5IM9A 2GSSA 4PTSA 1K0BA 1TTZA 4HU7A 4JZQA 3A2WA 4TR1B 2VL3A 5KN3A 3N5OA 2MYGA 4KCEA 1WJKA 3FZ9A 4TR0A 2CA8A 4JU5A 1YJ6A 1HNCA 2KP1A 1Z9HA 3PINA 4MF7A 1GLQA 1QXHA 5ECLB 4MP4A 4PX1A 4YQUA 1JLWA 1XPVA 3VFIA 2DMMA 2TRCP 2A2PA 3P2AA 1HD2A 5J9BA 2FUG2 4BIKA 2PU9C 3RHCA 2JZSA 2C3NA 1TW9A 2YWMA 1EEMA 1PKWA 3H93A 2H1BA 1PMTA 2FA4A 2RIIA 3KIJA 5J4UA 1Z6NA 2LRNA 4ZBBA 3G7IA 4JR4A 1DUGA 1EV9A 3DEXA 3VI5A 1A2MA 2OE0A 3LEFA 2GSQA 3M9KA 4PUFC 1XZOA 2DSAA 2ON7A 1ZYPA 2G2QA 2ES7A 1MTCA 1M9AA 1S3RA 3KH9A 3EC3A 3HA9A 4WR4A 4BWSA 4KF9A 4WF4A 3VK9A 2PPTA 2V32A 4J56E 3CRTA 4OFNA 2VL2A 2R5GA 1XWBA 4EL1A 4V2LA 1SYXA 2PWJA 2VLVA 1O73A 1I5GA 5IO2A 2YV9A 3O3TA 4CY8A 4PUAA 4F03A 2HYXA 4MDCA 1GUHA 2VLUA 3M9JA 4Q5FA 2WB9A 3PR8A 5GSSA 1G6YA 2R4VA 1SU9A 2C0EA 1T3BA 1YZXA 4E8EA 5FWGA 2H74A 3IDVA 18GSA 2LRCA 3TRXA 3D22A 3CTFA 5EY6A 4KE3A 1X5EA 5H5SA 1XCCA 3R2QA 4X0XA 5ECNB 3IAS2 1V9WA 3LORA 4HJ2A 2E2MA 4GQFA 4WEYA 1X9SB 3UVTA 4XIHA 4ECJA 2IMIA 2FY6A 5ENUA 10GSA 1PL2A 1OYJA 3HVXA 2X8GA 2MMAA 3DVXA 1PKZA 1K0OA 5B6NA 2C3QA 5FT3A 3KH7A 5DJLA 4Z7XA 4AF2A 4IJIA 4CHSA 2AYTA 1U87A 2VL9A 5CYYA 2LSTA 2NBSA 3IA1A 4LL4B 1ERVA 4ZL9A 2IPAA 1B8XA 6GSSA 5IO0A 3VURA 2WULA 5CRHA 2B7KA 5IMFA 4O5QA 1F2EA 4G0IA 4MJEA
chains in the Genus database with same CATH topology
16GSA 2H72A 2J23A 3WGXA 3MNGA 3KZQA 4HZ2A 3ZFLA 3E9JB 2JZTA 4NHWA 3GHAA 3IC4A 5HFIA 4LLRA 4WXTA 2OADA 4HQSA 4PNGA 4DSSB 2J9HA 1A23A 2AUVA 1OC8A 4HOJA 1WE0A 4G19A 4LA1A 5ECHB 1TK8B 2O8VB 2V2GA 4RI7A 4E8HA 5G31A 1A0RP 1ON4A 2RUFA 1JHBA 3LWAA 4MK3A 4WR5A 2JACA 3EURA 5J41A 1M99A 5H5RA 2PVOC 2R2JA 4YH2A 1JZWA 1SK1A 1F3BA 3C1SA 3VWVA 4XTSA 3FR6A 4KAEA 1A2JA 2H6YA 1GNWA 5LD0A 3A5IA 2R0GA 4TXOB 2GSTA 4NMUA 1M2DA 3Q6OA 4TN8A 3KTBA 3GTUB 5KEJA 1EEJA 1GLPA 5LNKe 5DQYA 3ZMLA 1HNAA 2FGXA 2H73A 4ICYA 2HSHA 2L59A 3P90A 4J57E 2CVBA 4AJ7A 4EXJA 3WD6A 1EV4A 3TJFA 3BCIA 2YCDA 4I2TA 4PXOA 1MEKA 1I9DA 1K0NA 1GSQA 4ML6A 1U88A 1F9MA 1YKCA 3M1GA 1GNEA 3ZMKA 1NHYA 1FB6A 4NV2A 1TXXA 1FVJA 2CX3A 2OKAA 3C73A 1GTAA 2OBKA 3QAWA 2HRKA 2XBIA 3EPTA 1SL2B 4BL7B 12GSA 3K8NA 5BMUA 5EVOA 4MZCA 5B7CA 3D4MA 5GAPD 3D5JA 2OACA 5JWQB 1XWGA 3GMFA 3L9UA 1K3OA 2B6MA 4ZILA 2B1LA 3W8JA 5G5EA 1GSYA 2QKEA 1FO5A 4AJ8A 3TOTA 1PL1A 1FVKA 1THXA 3CBUA 3HZ4A 4XRDA 4WBJA 1TKDB 1O8WA 5ECOB 1TK5B 3GL3A 4POBA 1FHEA 2MZCA 2C0FA 1X5CA 4O32A 3MSZA 1VF4A 4EKZA 3R3EA 4Q5QA 4GQCA 9GSSA 4PQ1A 4TR1A 3LJRA 5ECQB 3IE3A 1SD9A 2FCHA 1K0MA 4MH2A 4HU9A 2P5RA 2L5OA 3TJBA 3U5RE 2XC2A 3C1RA 2B7JA 5ECIB 1Z7PA 2H19A 1T8EB 2P5QA 1FOHA 3I69A 1RQMA 5JCGA 2X4AA 2K9FA 3UMAA 5DCGA 4ZBDA 1MD3A 2YPMA 2A2RA 1S3AA 1V98A 2GZYA 5F05A 19GSA 6GSTA 3KJYA 2FA8A 4GWRA 5D9VA 3L9VA 3TKSE 1PN9A 4YKGA 4MABA 3HZ8A 4ML1A 1B4QA 2VCQA 3ZTLA 4JE1A 3DGQA 2CT6A 1X0RA 5IPGA 2GT5A 2VO4A 1NHOA 1T1VA 3IBHA 3H4KA 1XW6A 5A4WA 3ZREA 1U3IA 3GA4A 3L78A 1XWCA 3GV1A 3GX0A 2H0IA 4BA7A 4NWYA 1XIYA 4TXVA 3EYTA 5IIZA 4HS1A 1R26A 3KEBA 2GQMA 5F07A 4NXIA 4OWYA 2O87A 4ECCA 1T4ZA 1AIUA 2H76A 2EIOA 4G0KA 4EE0A 5CAXA 2GZPA 5GAND 2F9SA 4GLTA 1YEPA 2IMKA 5JCWA 3W8SA 3IHGA 1VF1A 5AIXA 3F3RA 4IP6A 1G0TA 4DSQA 4LMWA 2HZFA 3ZZXA 3TKRA 1GULA 3LXZA 1MDIA 2PERA 2UZ8A 1CQGA 3BD2A 4K1FA 1O6JA 3UBKA 1SJ6A 2HRFA 3HJOA 2TIRA 2LQOA 4POLA 2GTUA 2XPEA 5KN2A 3KP8A 3BJ5A 1BQ7A 3FKFA 3UBLA 2HRNA 3TJKA 1F37A 5HFGA 3PH9A 3FHKA 2X64A 2TRXA 4K0NA 3IPZA 2C0DA 1YEXA 2HNLA 3F4SA 2FWHA 1SJZA 1OC3A 4EUYA 1GSDA 4POKA 3WT2A 5DDLA 5IMVA 1SKRB 4GTUA 4JBBA 4BVXB 4Z2UA 4ULXA 4K6XA 2WJUA 3O76A 3A5WA 5CREA 1Q4JA 1W89A 5D93A 2RUEA 4TVEA 3LG6A 1HNBA 4WF5A 3HVSA 4OMVA 4EIQA 2YOIA 3Q18A 4O5UA 1V2AA 3CTGA 1XXUA 4ILFA 2YANA 3G9BA 4DSSA 1J9BA 5JWOB 5HFKA 1A8LA 2LJAA 4K7NA 5BRTA 1KTEA 1B9XC 3IV4A 4G10A 2EIRA 1OC9B 2OE1A 4X43A 2RLIA 2VLTA 2B5YA 3QPMA 4KSMA 4TKYA 4PQIA 3CMIA 5D9WA 2HSMA 4RQRA 3UJ1A 3UEMA 5KN1A 3I43A 2AAWA 4K9ZA 4KCAA 3GKXA 3TJGA 17GSA 2P0GA 2WZ9A 4TR3A 2LJRA 1XOBA 1PA3A 22GSA 4TXOA 2DKIA 3KXOA 1SENA 1BG5A 5ECSA 2IN3A 2VCTA 3GTUA 4WKWA 1XVQA 2D2ZA 2FWEA 1UVZA 5AIVA 3MAKA 4ZIJA 3ZITA 1M2AA 3SWLA 3DIEA 3DMLA 4JR6A 3G7YA 1KNGA 3FK8A 4WBRD 1GP1A 5DAKB 2O89A 1MD4A 2VIMA 2CQ9A 1R5PA 2KUCA 3G7JA 4IN0A 4EO3A 3D21A 2H30A 2DJ1A 3GRXA 5D9TA 5B8BA 1SL1B 1V40A 3L0HA 1OAZA 2NVLA 5IQYA 5AGYA 4BL7A 2R6KA 1FB0A 4ZBAA 2FLSA 3DXBA 3C8EA 1Q98A 3GUSA 5E59A 1C72A 1DE2A 4CY6A 1RW1A 5C00A 1OVNA 2LUSA 2E7PA 3CRUA 3GSSA 4PNFA 3KTLA 5F06A 5CNWA 1BJXA 3TOUA 3F0IA 2B1KA 2JL4A 2PVQA 3SBCA 2IMEA 3EINA 1YKAA 4L5LA 1UN2A 4MLYA 5AISA 4YQVA 3QFAC 4IJ3A 2HZEB 1E2YA 3EU4A 3QDNA 4KUNA 1S3CA 4G9HA 1M0UA 3VWWA 1WMJA 2YWNA 5KN0A 1G7EA 4GSSA 5CO3A 3KP9A 1TU8A 3CSHA 5CRDA 1VF3A 5DALB 1NW2A 5J5NA 2LNTA 3UARA 2C3TA 3HVVA 3A2XA 2L6CA 4EVMA 2YJ7A 1SD8A 2VCVA 5DJMA 3EWLA 3BCKA 3APQA 3TKPA 2LTKA 3IAM2 2HRAA 2GGTA 1GUKA 3LGCA 4MMMA 2OBIA 1M7TA 4XS6A 4TRXA 4YAVA 3HJMA 2Z9SA 2VD0A 1H4OA 4YAPA 5A4VA 4K0GA 3KGKA 2C8UA 1XOAA 1PX6A 3D6IA 20GSA 1J0FA 1EP8A 3BBYA 2GT6A 2IWTA 3H8QA 5J3RA 2QSIA 2JADA 2WFCA 2DJJA 5HR3A 5DQSA 3GL5A 4KB3A 2V6KA 1WIKA 2H0GA 3FZ5A 5D9XA 2H70A 5G2ZA 2K8SA 2KOKA 4MCUA 2GDRA 1HYUA 4N30A 4KA0A 1TRWA 2H8LA 2I3YA 3I6AA 4L0UA 2QC7A 4MZWA 4AGSA 2KP2A 5DVBA 1GSSA 3LYKA 4FO5A 5HR0A 14GSA 1T00A 1B9YC 1Z7RA 1XW5A 2VCWA 3FEUA 3IRAA 5KOWA 2DJKA 3H1NA 1ZL9A 3ZVJA 2C4JA 1SKWB 1SK0A 2E2GA 2N5AA 3US3A 3J7Yk 4FQUA 4MNNA 2KHPA 1QK8A 1IYHA 1XW9A 1T7PB 4Z2RA 4FIWA 3ZVJD 2X99A 1EZKA 2F51A 2REMA 2OJLA 3KMOA 4ECIA 1R5AA 3F63A 1OKDA 2VCXA 7GSSA 1PX7A 3FY7A 5J9CA 3C7MA 2DKHA 2N5BA 2CZ2A 4XRAA 2FWGA 1Y25A 4OFMA 2ZUPA 3TRQA 3E3EA 1XVWA 3D0ZA 1QGVA 2MMOA 1O81A 3GNJA 2EIQA 4F82A 2JSYA 3TKSA 4DVCA 4IELA 4ZL7A 4HI7A 4AJ6A 2H66A 3IK9A 2MBTA 2YV7A 3EMXA 2LEGA 2FD3A 2VD1A 3TB2A 1O85A 2LKUA 1ACVA 3GH6A 4IQAA 4NAXA 5ECKB 5ECRB 1ZMAA 2M80A 4BVXA 3QMXA 4TW5A 4IP1A 6GSVA 2M46A 1YF1A 1JLVA 1K0CA 1KBNA 5CRGA 3VPQA 2H1AA 5ECMB 2P31A 4GF0A 4KDXA 2YZUA 3QR6A 2C1YA 5E4WA 4ZL8A 4ZXGA 2FHEA 3ZIJA 4MPGA 1SL0B 1WRYA 5H5QA 4XS4A 4GSNA 4NHZA 1PGTA 6GSWA 4GSTA 3HHVA 1WP0A 1XFLA 4H86A 4O7HA 1OC9A 4USSA 2WDUA 2GQLA 4GRFA 4OCFA 5ELGA 1G7OA 3GYKA 3MWHA 1J08A 5G1LA 2HE3A 3DD3A 2VM1A 4MF6A 1IYIA 2YP6A 3F8UA 3IR4A 2CZ3A 4MPFA 6GSYA 5IMCA 1EGRA 4K5SA 5IOWA 4MZBA 1ST9A 1ERUA 1TRVA 2RM6A 3FR9A 4N10A 3ZYWA 3TKQA 4I2UA 4ZB9A 2JSZA 5GZZB 2IFQB 1AC1A 1EGOA 1GSFA 4K7OA 3RPPA 5IOXA 3KD0A 4DEJA 4MJCA 3RAZA 2DJ2A 4IBPA 1TI1A 4D73B 3S9FA 2LV3A 3UVHA 2A4VA 1YQ1A 2AV4A 3FYGA 2AB6A 3PGTA 13GSA 5DAKA 1ZYQB 2LJKA 1AW9A 2X8HA 3ZL5A 3WGDA 3GSTA 2NPBA 1B4PA 3UIWA 2LRTA 3F6DA 2VCZA 4V1Ag 2CAIA 4HQZA 5ID2B 2YJHA 4KSOA 2R0CA 1JZDA 1OE8A 5HQPA 4F0CA 4F2IA 1TDIA 3AY8A 3E0UA 1FAAA 3EMPA 4ISDA 1FG4A 3PPUA 4G0LA 4IQ1A 2JU5A 3FR3A 5AN1A 1GSUA 3GKNA 2LNSA 5D96A 4KNDA 2BTOT 2DC5A 1W4VA 1WPIA 4XHMA 5EPFA 1EOGA 1GWCA 1U3AA 1EWXA 2YNXA 1G6WA 4KH7A 4BVYB 2K6VA 2PBJA 2VAFA 3V1WA 2HZEA 4LL1B 2C80A 3ZLPA 3BOAA 1USBA 2F8AA 4I8BA 2GVPA 1X5DA 2HFDA 2YWOA 1JFUA 2WRTA 1A8YA 4V1Ap 5DALA 3GN3A 4XCSA 1ABAA 3NIVA 4O5RA 1ML6A 4K5RA 4I6XA 1SKSB 2XHFA 3M8NA 3EU3A 3KMNA 2CVDA 1ZYNA 4TOPA 1EP7A 4XS4B 3W6GA 4N0VA 1PN0A 4L0WA 2B3SA 4K2XA 5B6MA 3HJPA 2I9HA 1Z6MA 2WCIA 2ON5A 1T4YA 1LJRA 1GUMA 5JWRB 5COHA 1QMVA 3QD9A 2BMXA 2I4AA 1GTBA 1X9MB 6GSUA 4IVFA 2MBSA 4FYUA 3LSZA 4MH3A 2B5XA 4ECBA 4IHUA 4J2FA 2DIZA 2N5FA 3IHQA 2GLRA 3RPNA 4NPBA 1N8JA 2M72A 3F6FA 3WYWA 1Y6EA 4RUVA 2C0GA 3FRCA 3MIXA 1A24A 3EVIA 2DIYA 3F3QA 4GCIA 1AQVA 2A2SA 2LQQA 4CDOA 1M9BA 2FNOA 3LYPA 5ECPB 2JZRA 3VPTA 2AJQB 1RK4A 1AQXA 2CVKA 4HJMA 3LFLA 1GTUA 4I97A 5INYA 2IMFA 2AHEA 3N9JA 1O8XA 1ERWA 5HR2A 3JCML 4PGTA 3CSJA 1V57A 2IJYA 4RQXA 4PQHA 5IMDA 5G5FA 5B8AA 1ZYEA 2HI7A 4P3YB 1TK0B 4QQ7A 2QGVA 2R37A 4K7IA 5G30A 3GFKA 4QL7A 2HSYA 4X4JA 1DBYA 2VL2C 4DSRA 3FW2A 4K2DA 1JZOA 4OD7A 1N2AA 1BAYA 1LBKA 3OR5A 5A5KA 4FYBA 1URMA 4RI6A 3FMWA 3HD5A 1ZOFA 4PURA 5ABRA 5CP1A 4GXZA 3HKRA 5KOXA 3NZNA 2WGRA 3U6VA 2V1MA 4V2NA 4HEA2 2GSRA 3HYPA 2B5EA 3GKMA 1K3LA 3ERFA 3L9SA 1Z5YE 4XS1A 4QL9A 3IXRA 1TJDA 2F8FA 1THOA 4O92A 2BJXA 3F9UA 3A2VA 1TRUA 3FZ4A 2YWIA 3GIXA 3J7Yb 3M3MA 3ZRDA 3IC8A 1PQNA 2MMNA 1GSEA 2DBCA 3IK7A 5IPHA 1QUWA 1TI3A 1X9WB 2H75A 3KCMA 2CV4A 3WGEA 3LQ7A 2PUKC 2DLXA 3RDWA 6GSXA 2H1DA 1O7UA 1R7HA 5C04A 1EOHA 1XBSA 4HZ4A 4IKHA 3NOFA 1GRXA 3KM6A 1ILOA 3APOA 4Q5NA 3DWVA 3TUEA 2L4QA 1SJIA 2GS3A 4N0ZA 2L5LA 2ALBA 5DBQA 4G2EA 1SK2A 2HXKA 5IMAA 3MYDA 1K0AA 4K8MA 4L8EA 5F0GA 3MDKA 3TRPA 1LU4A 1AUCA 2QA2A 5CRWA 2O7KA 3C71A 2R3XA 2IFQA 1BYEA 4OO4A 4EF0A 3HY2A 3QOUA 2FWFA 2O85A 4EC0A 2PMTA 2RM5A 4MF5A 3VWXA 3M0FA 2KLXA 5F8BA 3CXGA 4D73A 2CAQA 1PSQA 3DYRA 1S3DA 1VF2A 4BPYA 3ERGA 3LXTA 5DCHA 2YN1A 3IOSA 3RHBA 2LS5A 4ACSA 2HLSA 2E0QA 2H6XA 8GSSA 5ID2A 4L5OA 2QA1A 4KDUA 3QAGA 1DE1A 4NV5A 3VLNA 1WOUA 4HUAA 1U6TA 1GTIA 4KGIA 3FZAA 2X49A 3QFBC 3UOMA 2L57A 2OE3A 2OA7A 4KDYA 1FW1A 1TOFA 1V58A 3UAPA 3ME7A 2VUPA 3LW9A 1YF0A 3GURA 1OKTA 1TU7A 3RBTA 3GKKA 1PD21 4FH8A 4V2MA 4IGJA 3ZFBA 1XWKA 2G0FA 4OCEA 1MDKA 4BVYA 3TCOA 1K0DA 1CQHA 4BWQA 3TJJA 1HQOA 1NM3A 4POMA 1BX9A 2GZZA 2XBQA 1SYRA 5D73A 2F3MA 4EIPA 5HR1A 5GSTA 2ZNMA 3F4RA 2H6ZA 3L4NA 2I81A 3QAVA 2R0PA 3ZIVA 1F6MC 5FHIA 1NSWA 4Z2TA 2XPDA 1GL8A 3VWUA 3Q74A 2IMDA 3APSA 1R4WA 4YQMA 2H71A 3TGZA 1DSBA 1Z3EA 4ZB8A 4X1UA 1VGLA 3TDGA 4F9ZA 4WETA 1ZGNA 1TRSA 2K8VA 5G1KA 3GH9A 2MMZA 2PGTA 3TKSC 2ZCTA 4OFTA 2H01A 1OE7A 4F0BA 5JCUA 3HCZA 2I1UA 2VM2A 2K18A 2YZHA 4EDZA 2L4CA 5A4UA 3DVWA 4Q5RA 3DRNA 2V41A 1H75A 2H1GA 3ERWA 4KW6A 3UL3A 2DJ0A 2IL3A 3ME8A 3DKSA 4KX4A 4HDEA 1TP9A 5L71A 1AXDA 4LMVA 1A2LA 3EE2A 3O6TA 4I5QA 2VOCA 4EDYA 4ZB6A 2WS2A 1KEBA 2DMLA 1GH2A 4CW9A 2CX4A 1MDJA 2HT9A 1F3AA 1UC7A 1E6BA 1PRXA 3Q19A 1XWAA 5EL8A 3P7XA 4ID0A 1AQWA 3CYNA 2V6OA 5D8IA 3WT1A 2DJ3A 1ERTA 3CSIA 2PN8A 1VRSD 2EC4A 2GQKA 3GX8A 3HXSA 4MJAA 4JEDA 11GSA 1QQ2A 1UA5A 3I9V2 4IW9A 4N11A 1BEDA 3ED3A 1A0FA 1B48A 4YKFA 1K3YA 2L6DA 2IIYA 4JRRA 1ZZYA 4TR4A 4FYCA 1QFNA 2NDOA 2A4HA 4OO5A 3F4TA 4IS0A 3A3TA 1M2BA 1WWJA 3H79A 4A5PA 3VI7A 3P8WA 3QCPA 4MA9A 2X8CA 1YDKA 5LCZA 5IMZA 5ELAA 1JZRA 2H0HA 3D4TA 1FOVA 1YY7A 1ZCPA 2NTOA 3HDCA 1AAZA 4MJBA 3ISOA 5IM9A 2GSSA 4PTSA 1K0BA 1TTZA 4HU7A 4JZQA 3A2WA 4TR1B 2VL3A 5KN3A 3N5OA 2MYGA 4KCEA 1WJKA 3FZ9A 4TR0A 2CA8A 4JU5A 1YJ6A 1HNCA 2KP1A 1Z9HA 3PINA 4MF7A 1GLQA 1QXHA 5ECLB 4MP4A 4PX1A 4YQUA 1JLWA 1XPVA 3VFIA 2DMMA 2TRCP 2A2PA 3P2AA 1HD2A 5J9BA 2FUG2 2PU9C 3RHCA 2JZSA 2C3NA 1TW9A 2YWMA 1EEMA 1PKWA 3H93A 2H1BA 1PMTA 2FA4A 2RIIA 3KIJA 5J4UA 1Z6NA 2LRNA 4ZBBA 3G7IA 4JR4A 1DUGA 1EV9A 3DEXA 3VI5A 1A2MA 2OE0A 3LEFA 2GSQA 3M9KA 4PUFC 1XZOA 2DSAA 2ON7A 1ZYPA 2G2QA 2ES7A 1MTCA 1M9AA 3KH9A 3EC3A 3HA9A 4WR4A 4BWSA 4KF9A 4WF4A 3VK9A 2PPTA 2V32A 4J56E 3CRTA 4OFNA 2VL2A 2R5GA 1XWBA 4EL1A 4V2LA 1SYXA 2PWJA 2VLVA 1O73A 1I5GA 5IO2A 2YV9A 3O3TA 4CY8A 4PUAA 4F03A 2HYXA 4MDCA 1GUHA 2VLUA 3M9JA 4Q5FA 2WB9A 3PR8A 5GSSA 1G6YA 2R4VA 1SU9A 2C0EA 1T3BA 1YZXA 4E8EA 5FWGA 2H74A 3IDVA 18GSA 2LRCA 3TRXA 3D22A 3CTFA 5EY6A 4KE3A 1X5EA 5H5SA 1XCCA 3R2QA 4X0XA 5ECNB 3IAS2 1V9WA 3LORA 4HJ2A 2E2MA 4GQFA 4WEYA 1X9SB 3UVTA 4XIHA 4ECJA 2IMIA 2FY6A 5ENUA 10GSA 1PL2A 1OYJA 3HVXA 2X8GA 2MMAA 3DVXA 1PKZA 1K0OA 5B6NA 2C3QA 5FT3A 3KH7A 5DJLA 4Z7XA 4AF2A 4IJIA 4CHSA 2AYTA 1U87A 2VL9A 5CYYA 2LSTA 2NBSA 3IA1A 4LL4B 1ERVA 4ZL9A 2IPAA 1B8XA 6GSSA 5IO0A 3VURA 2WULA 5CRHA 2B7KA 5IMFA 4O5QA 1F2EA 4G0IA 4MJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 16GS A;  2H72 A;  2J23 A;  3WGX A;  3MNG A;  3KZQ A;  4HZ2 A;  3ZFL A;  3E9J B;  2JZT A;  4NHW A;  3GHA A;  3IC4 A;  5HFI A;  4LLR A;  4WXT A;  2OAD A;  4HQS A;  4PNG A;  4DSS B;  2J9H A;  1A23 A;  2AUV A;  1OC8 A;  4HOJ A;  1WE0 A;  4G19 A;  4LA1 A;  5ECH B;  1TK8 B;  2O8V B;  2V2G A;  4RI7 A;  4E8H A;  5G31 A;  1A0R P;  1ON4 A;  2RUF A;  1JHB A;  3LWA A;  4MK3 A;  4WR5 A;  2JAC A;  3EUR A;  5J41 A;  1M99 A;  5H5R A;  2PVO C;  2R2J A;  4YH2 A;  1JZW A;  1SK1 A;  1F3B A;  3C1S A;  3VWV A;  4XTS A;  3FR6 A;  4KAE A;  1A2J A;  2H6Y A;  1GNW A;  5LD0 A;  4TXO B;  2GST A;  4NMU A;  1M2D A;  3Q6O A;  4TN8 A;  3KTB A;  3GTU B;  5KEJ A;  1EEJ A;  1GLP A;  5LNK e;  5DQY A;  3ZML A;  1HNA A;  2FGX A;  2H73 A;  2HSH A;  2L59 A;  3P90 A;  4J57 E;  2CVB A;  4AJ7 A;  4EXJ A;  3WD6 A;  1EV4 A;  3TJF A;  3BCI A;  2YCD A;  4I2T A;  4PXO A;  1MEK A;  1I9D A;  1K0N A;  1GSQ A;  4ML6 A;  1U88 A;  1F9M A;  1YKC A;  3M1G A;  1GNE A;  3ZMK A;  1NHY A;  1FB6 A;  4NV2 A;  1TXX A;  1FVJ A;  2CX3 A;  2OKA A;  3C73 A;  1GTA A;  2OBK A;  3QAW A;  2XBI A;  1SL2 B;  12GS A;  3K8N A;  5EVO A;  4MZC A;  5B7C A;  3D4M A;  5GAP D;  3D5J A;  2OAC A;  5JWQ B;  1XWG A;  3GMF A;  3L9U A;  1K3O A;  2B6M A;  4ZIL A;  2B1L A;  3W8J A;  5G5E A;  1GSY A;  2QKE A;  1FO5 A;  4AJ8 A;  3TOT A;  1PL1 A;  1FVK A;  1THX A;  3CBU A;  3HZ4 A;  4XRD A;  4WBJ A;  1TKD B;  1O8W A;  5ECO B;  1TK5 B;  3GL3 A;  4POB A;  1FHE A;  2MZC A;  2C0F A;  1X5C A;  4O32 A;  3MSZ A;  1VF4 A;  4EKZ A;  4Q5Q A;  4GQC A;  9GSS A;  4PQ1 A;  4TR1 A;  3LJR A;  5ECQ B;  3IE3 A;  1SD9 A;  2FCH A;  1K0M A;  4MH2 A;  4HU9 A;  2P5R A;  2L5O A;  3TJB A;  3U5R E;  2XC2 A;  3C1R A;  2B7J A;  5ECI B;  1Z7P A;  2H19 A;  1T8E B;  2P5Q A;  3I69 A;  1RQM A;  5JCG A;  3UMA A;  2K9F A;  5DCG A;  4ZBD A;  1MD3 A;  2YPM A;  2A2R A;  1S3A A;  1V98 A;  2GZY A;  5F05 A;  19GS A;  6GST A;  3KJY A;  2FA8 A;  4GWR A;  5D9V A;  3L9V A;  3TKS E;  1PN9 A;  4MAB A;  3HZ8 A;  4ML1 A;  1B4Q A;  2VCQ A;  3ZTL A;  4JE1 A;  3DGQ A;  2CT6 A;  1X0R A;  5IPG A;  2GT5 A;  2VO4 A;  1NHO A;  1T1V A;  3IBH A;  3H4K A;  1XW6 A;  5A4W A;  3ZRE A;  1U3I A;  3GA4 A;  3L78 A;  1XWC A;  3GV1 A;  3GX0 A;  2H0I A;  4BA7 A;  4NWY A;  1XIY A;  4TXV A;  3EYT A;  5IIZ A;  4HS1 A;  1R26 A;  3KEB A;  2GQM A;  5F07 A;  4NXI A;  4OWY A;  2O87 A;  4ECC A;  1T4Z A;  1AIU A;  2H76 A;  2EIO A;  4EE0 A;  5CAX A;  2GZP A;  5GAN D;  2F9S A;  4GLT A;  1YEP A;  2IMK A;  5JCW A;  3W8S A;  1VF1 A;  5AIX A;  3F3R A;  4IP6 A;  1G0T A;  4DSQ A;  4LMW A;  2HZF A;  3ZZX A;  3TKR A;  1GUL A;  3LXZ A;  1MDI A;  2PER A;  1CQG A;  3BD2 A;  4K1F A;  1O6J A;  3UBK A;  1SJ6 A;  2HRF A;  3HJO A;  2TIR A;  2LQO A;  4POL A;  2GTU A;  2XPE A;  5KN2 A;  3KP8 A;  3BJ5 A;  1BQ7 A;  3FKF A;  3UBL A;  2HRN A;  3TJK A;  1F37 A;  5HFG A;  3PH9 A;  3FHK A;  2X64 A;  2TRX A;  4K0N A;  3IPZ A;  2C0D A;  1YEX A;  2HNL A;  3F4S A;  2FWH A;  1SJZ A;  1OC3 A;  4EUY A;  1GSD A;  4POK A;  3WT2 A;  5DDL A;  5IMV A;  1SKR B;  4GTU A;  4JBB A;  4ULX A;  4K6X A;  2WJU A;  3O76 A;  3A5W A;  5CRE A;  1Q4J A;  1W89 A;  5D93 A;  2RUE A;  4TVE A;  3LG6 A;  1HNB A;  4WF5 A;  3HVS A;  4OMV A;  2YOI A;  3Q18 A;  1V2A A;  3CTG A;  1XXU A;  4ILF A;  2YAN A;  3G9B A;  4DSS A;  1J9B A;  5JWO B;  5HFK A;  1A8L A;  2LJA A;  4K7N A;  1KTE A;  1B9X C;  3IV4 A;  4G10 A;  2EIR A;  1OC9 B;  2OE1 A;  4X43 A;  2RLI A;  2VLT A;  2B5Y A;  3QPM A;  4KSM A;  4TKY A;  4PQI A;  3CMI A;  5D9W A;  4RQR A;  3UJ1 A;  3UEM A;  5KN1 A;  3I43 A;  2AAW A;  4K9Z A;  4KCA A;  3GKX A;  3TJG A;  17GS A;  2P0G A;  2WZ9 A;  4TR3 A;  2LJR A;  1XOB A;  1PA3 A;  22GS A;  4TXO A;  3KXO A;  1SEN A;  1BG5 A;  5ECS A;  2IN3 A;  2VCT A;  3GTU A;  4WKW A;  1XVQ A;  2D2Z A;  2FWE A;  1UVZ A;  5AIV A;  3MAK A;  4ZIJ A;  3ZIT A;  1M2A A;  3SWL A;  3DIE A;  3DML A;  4JR6 A;  3G7Y A;  1KNG A;  3FK8 A;  4WBR D;  1GP1 A;  5DAK B;  2O89 A;  1MD4 A;  2VIM A;  2CQ9 A;  1R5P A;  2KUC A;  3G7J A;  4IN0 A;  4EO3 A;  3D21 A;  2H30 A;  2DJ1 A;  3GRX A;  5D9T A;  5B8B A;  1SL1 B;  1V40 A;  3L0H A;  1OAZ A;  2NVL A;  5IQY A;  5AGY A;  4BL7 A;  2R6K A;  1FB0 A;  4ZBA A;  2FLS A;  3DXB A;  3C8E A;  1Q98 A;  3GUS A;  5E59 A;  1C72 A;  1DE2 A;  1RW1 A;  5C00 A;  1OVN A;  2LUS A;  2E7P A;  3CRU A;  3GSS A;  4PNF A;  3KTL A;  5F06 A;  5CNW A;  1BJX A;  3TOU A;  3F0I A;  2B1K A;  2JL4 A;  2PVQ A;  3SBC A;  2IME A;  3EIN A;  1YKA A;  4L5L A;  1UN2 A;  4MLY A;  5AIS A;  4YQV A;  3QFA C;  4IJ3 A;  2HZE B;  1E2Y A;  3EU4 A;  3QDN A;  4KUN A;  1S3C A;  4G9H A;  1M0U A;  3VWW A;  1WMJ A;  2YWN A;  5KN0 A;  1G7E A;  4GSS A;  5CO3 A;  3KP9 A;  1TU8 A;  3CSH A;  5CRD A;  1VF3 A;  5DAL B;  1NW2 A;  5J5N A;  2LNT A;  3UAR A;  2C3T A;  3HVV A;  3A2X A;  2L6C A;  4EVM A;  2YJ7 A;  1SD8 A;  2VCV A;  5DJM A;  3EWL A;  3BCK A;  3APQ A;  3TKP A;  2LTK A;  3IAM 2;  2GGT A;  1GUK A;  3LGC A;  4MMM A;  2OBI A;  1M7T A;  4XS6 A;  4TRX A;  4YAV A;  3HJM A;  2Z9S A;  2VD0 A;  1H4O A;  4YAP A;  5A4V A;  4K0G A;  3KGK A;  2C8U A;  1XOA A;  1PX6 A;  3D6I A;  20GS A;  1J0F A;  1EP8 A;  3BBY A;  2GT6 A;  2IWT A;  3H8Q A;  5J3R A;  2QSI A;  2JAD A;  2WFC A;  2DJJ A;  5HR3 A;  5DQS A;  3GL5 A;  4KB3 A;  2V6K A;  1WIK A;  2H0G A;  3FZ5 A;  5D9X A;  2H70 A;  5G2Z A;  2K8S A;  2KOK A;  4MCU A;  2GDR A;  1HYU A;  4N30 A;  4KA0 A;  1TRW A;  2H8L A;  2I3Y A;  3I6A A;  4L0U A;  2QC7 A;  4MZW A;  4AGS A;  2KP2 A;  5DVB A;  1GSS A;  3LYK A;  4FO5 A;  5HR0 A;  14GS A;  1T00 A;  1B9Y C;  1Z7R A;  1XW5 A;  2VCW A;  3FEU A;  3IRA A;  2DJK A;  3H1N A;  1ZL9 A;  3ZVJ A;  2C4J A;  1SKW B;  1SK0 A;  2E2G A;  2N5A A;  3US3 A;  3J7Y k;  2KHP A;  1QK8 A;  1IYH A;  1XW9 A;  1T7P B;  4FIW A;  3ZVJ D;  2X99 A;  1EZK A;  2F51 A;  2REM A;  2OJL A;  3KMO A;  4ECI A;  1R5A A;  3F63 A;  1OKD A;  2VCX A;  7GSS A;  1PX7 A;  3FY7 A;  5J9C A;  3C7M A;  2N5B A;  2CZ2 A;  4XRA A;  2FWG A;  1Y25 A;  4OFM A;  2ZUP A;  3TRQ A;  3E3E A;  1XVW A;  3D0Z A;  1QGV A;  2MMO A;  1O81 A;  3GNJ A;  2EIQ A;  4F82 A;  2JSY A;  3TKS A;  4DVC A;  4IEL A;  4ZL7 A;  4HI7 A;  4AJ6 A;  2H66 A;  3IK9 A;  2MBT A;  2YV7 A;  3EMX A;  2LEG A;  2FD3 A;  2VD1 A;  3TB2 A;  1O85 A;  2LKU A;  1ACV A;  3GH6 A;  4IQA A;  4NAX A;  5ECK B;  5ECR B;  1ZMA A;  2M80 A;  4BVX A;  3QMX A;  4TW5 A;  4IP1 A;  6GSV A;  2M46 A;  1YF1 A;  1JLV A;  1K0C A;  1KBN A;  5CRG A;  3VPQ A;  2H1A A;  5ECM B;  2P31 A;  4GF0 A;  4KDX A;  2YZU A;  3QR6 A;  2C1Y A;  5E4W A;  4ZL8 A;  4ZXG A;  2FHE A;  3ZIJ A;  4MPG A;  1SL0 B;  1WRY A;  5H5Q A;  4XS4 A;  4GSN A;  4NHZ A;  1PGT A;  6GSW A;  4GST A;  3HHV A;  1WP0 A;  1XFL A;  4H86 A;  4O7H A;  1OC9 A;  2WDU A;  2GQL A;  4GRF A;  4OCF A;  5ELG A;  1G7O A;  3GYK A;  3MWH A;  1J08 A;  5G1L A;  2HE3 A;  3DD3 A;  2VM1 A;  4MF6 A;  1IYI A;  2YP6 A;  3F8U A;  3IR4 A;  2CZ3 A;  4MPF A;  6GSY A;  5IMC A;  1EGR A;  5IOW A;  4MZB A;  1ST9 A;  1ERU A;  1TRV A;  2RM6 A;  3FR9 A;  4N10 A;  3ZYW A;  3TKQ A;  4I2U A;  4ZB9 A;  2JSZ A;  5GZZ B;  2IFQ B;  1AC1 A;  1EGO A;  1GSF A;  4K7O A;  3RPP A;  5IOX A;  3KD0 A;  4DEJ A;  4MJC A;  3RAZ A;  2DJ2 A;  4IBP A;  1TI1 A;  4D73 B;  3S9F A;  2LV3 A;  3UVH A;  2A4V A;  1YQ1 A;  2AV4 A;  3FYG A;  2AB6 A;  3PGT A;  13GS A;  5DAK A;  1ZYQ B;  2LJK A;  1AW9 A;  2X8H A;  3ZL5 A;  3WGD A;  3GST A;  2NPB A;  1B4P A;  3UIW A;  2LRT A;  3F6D A;  2VCZ A;  4V1A g;  2CAI A;  4HQZ A;  5ID2 B;  2YJH A;  4KSO A;  1JZD A;  1OE8 A;  5HQP A;  4F0C A;  4F2I A;  1TDI A;  3AY8 A;  3E0U A;  1FAA A;  3EMP A;  4ISD A;  1FG4 A;  4IQ1 A;  2JU5 A;  3FR3 A;  5AN1 A;  1GSU A;  3GKN A;  2LNS A;  5D96 A;  4KND A;  2BTO T;  2DC5 A;  1W4V A;  1WPI A;  4XHM A;  5EPF A;  1EOG A;  1GWC A;  1U3A A;  1EWX A;  2YNX A;  1G6W A;  4KH7 A;  2K6V A;  2PBJ A;  2VAF A;  3V1W A;  2HZE A;  4LL1 B;  2C80 A;  3ZLP A;  3BOA A;  1USB A;  2F8A A;  4I8B A;  2GVP A;  1X5D A;  2HFD A;  2YWO A;  1JFU A;  2WRT A;  1A8Y A;  4V1A p;  5DAL A;  3GN3 A;  4XCS A;  1ABA A;  3NIV A;  4O5R A;  1ML6 A;  4I6X A;  1SKS B;  2XHF A;  3M8N A;  3EU3 A;  3KMN A;  2CVD A;  4TOP A;  1EP7 A;  4XS4 B;  3W6G A;  4N0V A;  4L0W A;  2B3S A;  5B6M A;  3HJP A;  2I9H A;  1Z6M A;  2WCI A;  2ON5 A;  1T4Y A;  1LJR A;  1GUM A;  5JWR B;  5COH A;  1QMV A;  3QD9 A;  2BMX A;  2I4A A;  1GTB A;  1X9M B;  6GSU A;  4IVF A;  2MBS A;  4FYU A;  3LSZ A;  4MH3 A;  2B5X A;  4ECB A;  4IHU A;  4J2F A;  2DIZ A;  2N5F A;  3IHQ A;  2GLR A;  3RPN A;  4NPB A;  1N8J A;  2M72 A;  3F6F A;  3WYW A;  1Y6E A;  4RUV A;  2C0G A;  3FRC A;  1A24 A;  3EVI A;  2DIY A;  3F3Q A;  4GCI A;  1AQV A;  2A2S A;  2LQQ A;  4CDO A;  1M9B A;  2FNO A;  3LYP A;  5ECP B;  2JZR A;  3VPT A;  2AJQ B;  1RK4 A;  1AQX A;  2CVK A;  4HJM A;  3LFL A;  1GTU A;  4I97 A;  5INY A;  2IMF A;  2AHE A;  3N9J A;  1O8X A;  1ERW A;  5HR2 A;  3JCM L;  4PGT A;  3CSJ A;  1V57 A;  2IJY A;  4RQX A;  4PQH A;  5IMD A;  5G5F A;  5B8A A;  1ZYE A;  2HI7 A;  4P3Y B;  1TK0 B;  4QQ7 A;  2QGV A;  2R37 A;  4K7I A;  5G30 A;  3GFK A;  4QL7 A;  2HSY A;  1DBY A;  2VL2 C;  4DSR A;  3FW2 A;  4K2D A;  1JZO A;  4OD7 A;  1N2A A;  1BAY A;  1LBK A;  3OR5 A;  5A5K A;  4FYB A;  1URM A;  4RI6 A;  3HD5 A;  4PUR A;  1ZOF A;  5ABR A;  5CP1 A;  4GXZ A;  3HKR A;  3NZN A;  2WGR A;  3U6V A;  2V1M A;  4V2N A;  4HEA 2;  2GSR A;  3HYP A;  2B5E A;  3GKM A;  1K3L A;  3ERF A;  3L9S A;  1Z5Y E;  4XS1 A;  4QL9 A;  3IXR A;  1TJD A;  2F8F A;  1THO A;  4O92 A;  2BJX A;  3F9U A;  3A2V A;  1TRU A;  3FZ4 A;  2YWI A;  3GIX A;  3J7Y b;  3M3M A;  3ZRD A;  1PQN A;  2MMN A;  1GSE A;  2DBC A;  3IK7 A;  5IPH A;  1QUW A;  1TI3 A;  1X9W B;  2H75 A;  3KCM A;  2CV4 A;  3WGE A;  3LQ7 A;  2PUK C;  2DLX A;  3RDW A;  6GSX A;  2H1D A;  1O7U A;  1R7H A;  5C04 A;  1EOH A;  1XBS A;  4HZ4 A;  4IKH A;  3NOF A;  1GRX A;  3KM6 A;  1ILO A;  3APO A;  4Q5N A;  3DWV A;  3TUE A;  2L4Q A;  1SJI A;  2GS3 A;  4N0Z A;  2L5L A;  2ALB A;  5DBQ A;  4G2E A;  1SK2 A;  2HXK A;  5IMA A;  1K0A A;  4K8M A;  4L8E A;  5F0G A;  3MDK A;  3TRP A;  1LU4 A;  1AUC A;  5CRW A;  2O7K A;  3C71 A;  2R3X A;  2IFQ A;  1BYE A;  4OO4 A;  4EF0 A;  3HY2 A;  3QOU A;  2FWF A;  2O85 A;  4EC0 A;  2PMT A;  2RM5 A;  4MF5 A;  3VWX A;  3M0F A;  2KLX A;  5F8B A;  3CXG A;  4D73 A;  2CAQ A;  1PSQ A;  3DYR A;  1S3D A;  1VF2 A;  4BPY A;  3ERG A;  3LXT A;  5DCH A;  2YN1 A;  3IOS A;  3RHB A;  2LS5 A;  4ACS A;  2HLS A;  2E0Q A;  2H6X A;  8GSS A;  5ID2 A;  4L5O A;  4KDU A;  3QAG A;  1DE1 A;  4NV5 A;  3VLN A;  1WOU A;  4HUA A;  1U6T A;  1GTI A;  4KGI A;  3FZA A;  3QFB C;  3UOM A;  2L57 A;  2OE3 A;  2OA7 A;  4KDY A;  1FW1 A;  1TOF A;  1V58 A;  3UAP A;  3ME7 A;  2VUP A;  1YF0 A;  3GUR A;  1OKT A;  1TU7 A;  3RBT A;  3GKK A;  1PD2 1;  4FH8 A;  4V2M A;  4IGJ A;  3ZFB A;  1XWK A;  2G0F A;  4OCE A;  1MDK A;  4BVY A;  3TCO A;  1K0D A;  1CQH A;  4BWQ A;  3TJJ A;  1HQO A;  1NM3 A;  4POM A;  1BX9 A;  2GZZ A;  2XBQ A;  1SYR A;  5D73 A;  2F3M A;  5HR1 A;  5GST A;  2ZNM A;  3F4R A;  2H6Z A;  3L4N A;  2I81 A;  3QAV A;  3ZIV A;  1F6M C;  5FHI A;  1NSW A;  2XPD A;  1GL8 A;  3VWU A;  3Q74 A;  2IMD A;  3APS A;  1R4W A;  4YQM A;  2H71 A;  3TGZ A;  1DSB A;  1Z3E A;  4ZB8 A;  4X1U A;  1VGL A;  3TDG A;  4F9Z A;  4WET A;  1ZGN A;  1TRS A;  2K8V A;  5G1K A;  3GH9 A;  2MMZ A;  2PGT A;  3TKS C;  2ZCT A;  4OFT A;  2H01 A;  1OE7 A;  4F0B A;  5JCU A;  3HCZ A;  2I1U A;  2VM2 A;  2K18 A;  2YZH A;  4EDZ A;  2L4C A;  5A4U A;  3DVW A;  4Q5R A;  3DRN A;  2V41 A;  1H75 A;  2H1G A;  3ERW A;  4KW6 A;  3UL3 A;  2DJ0 A;  2IL3 A;  3ME8 A;  3DKS A;  4KX4 A;  4HDE A;  1TP9 A;  5L71 A;  1AXD A;  4LMV A;  1A2L A;  3EE2 A;  3O6T A;  4I5Q A;  2VOC A;  4EDY A;  4ZB6 A;  2WS2 A;  1KEB A;  2DML A;  1GH2 A;  4CW9 A;  2CX4 A;  1MDJ A;  2HT9 A;  1F3A A;  1UC7 A;  1E6B A;  1PRX A;  3Q19 A;  1XWA A;  5EL8 A;  3P7X A;  4ID0 A;  1AQW A;  3CYN A;  2V6O A;  5D8I A;  3WT1 A;  2DJ3 A;  1ERT A;  3CSI A;  2PN8 A;  1VRS D;  2EC4 A;  2GQK A;  3GX8 A;  3HXS A;  4MJA A;  4JED A;  11GS A;  1QQ2 A;  1UA5 A;  3I9V 2;  4IW9 A;  4N11 A;  1BED A;  3ED3 A;  1A0F A;  1B48 A;  1K3Y A;  2L6D A;  2IIY A;  4JRR A;  1ZZY A;  4TR4 A;  4FYC A;  1QFN A;  2NDO A;  4OO5 A;  3F4T A;  4IS0 A;  3A3T A;  1M2B A;  1WWJ A;  3H79 A;  3VI7 A;  3P8W A;  3QCP A;  4MA9 A;  2X8C A;  1YDK A;  5LCZ A;  5IMZ A;  5ELA A;  1JZR A;  2H0H A;  3D4T A;  1FOV A;  1YY7 A;  1ZCP A;  2NTO A;  3HDC A;  1AAZ A;  4MJB A;  3ISO A;  5IM9 A;  2GSS A;  1K0B A;  1TTZ A;  4HU7 A;  4JZQ A;  3A2W A;  4TR1 B;  2VL3 A;  5KN3 A;  3N5O A;  2MYG A;  4KCE A;  1WJK A;  3FZ9 A;  4TR0 A;  2CA8 A;  4JU5 A;  1YJ6 A;  1HNC A;  2KP1 A;  1Z9H A;  3PIN A;  4MF7 A;  1GLQ A;  1QXH A;  5ECL B;  4MP4 A;  4PX1 A;  4YQU A;  1JLW A;  1XPV A;  3VFI A;  2DMM A;  2TRC P;  3P2A A;  1HD2 A;  5J9B A;  2FUG 2;  2PU9 C;  3RHC A;  2JZS A;  2C3N A;  1TW9 A;  2YWM A;  1EEM A;  1PKW A;  3H93 A;  2H1B A;  1PMT A;  2FA4 A;  2RII A;  3KIJ A;  5J4U A;  1Z6N A;  2LRN A;  4ZBB A;  3G7I A;  4JR4 A;  1DUG A;  1EV9 A;  3DEX A;  3VI5 A;  1A2M A;  2OE0 A;  3LEF A;  2GSQ A;  3M9K A;  4PUF C;  1XZO A;  2DSA A;  2ON7 A;  2G2Q A;  2ES7 A;  1MTC A;  1M9A A;  3KH9 A;  3EC3 A;  3HA9 A;  4WR4 A;  4BWS A;  4WF4 A;  3VK9 A;  2PPT A;  2V32 A;  4J56 E;  3CRT A;  4OFN A;  2VL2 A;  2R5G A;  1XWB A;  4EL1 A;  4V2L A;  1SYX A;  2PWJ A;  2VLV A;  1O73 A;  1I5G A;  5IO2 A;  2YV9 A;  3O3T A;  4PUA A;  4F03 A;  2HYX A;  4MDC A;  1GUH A;  2VLU A;  3M9J A;  4Q5F A;  2WB9 A;  3PR8 A;  5GSS A;  1G6Y A;  2R4V A;  1SU9 A;  2C0E A;  1T3B A;  1YZX A;  4E8E A;  5FWG A;  2H74 A;  3IDV A;  18GS A;  2LRC A;  3TRX A;  3D22 A;  3CTF A;  5EY6 A;  4KE3 A;  1X5E A;  5H5S A;  1XCC A;  3R2Q A;  4X0X A;  5ECN B;  3IAS 2;  1V9W A;  3LOR A;  4HJ2 A;  2E2M A;  4GQF A;  4WEY A;  1X9S B;  3UVT A;  4XIH A;  4ECJ A;  2IMI A;  2FY6 A;  5ENU A;  10GS A;  1PL2 A;  1OYJ A;  3HVX A;  2X8G A;  2MMA A;  3DVX A;  1PKZ A;  1K0O A;  5B6N A;  2C3Q A;  5FT3 A;  3KH7 A;  5DJL A;  4Z7X A;  4AF2 A;  4IJI A;  4CHS A;  2AYT A;  1U87 A;  2VL9 A;  5CYY A;  2LST A;  2NBS A;  3IA1 A;  4LL4 B;  1ERV A;  4ZL9 A;  2IPA A;  1B8X A;  6GSS A;  5IO0 A;  3VUR A;  2WUL A;  5CRH A;  2B7K A;  5IMF A;  1F2E A;  4MJE A; 
#chains in the Genus database with same CATH topology
 16GS A;  2H72 A;  2J23 A;  3WGX A;  3MNG A;  3KZQ A;  4HZ2 A;  3ZFL A;  3E9J B;  2JZT A;  4NHW A;  3GHA A;  3IC4 A;  5HFI A;  4LLR A;  4WXT A;  2OAD A;  4HQS A;  4PNG A;  4DSS B;  2J9H A;  1A23 A;  2AUV A;  1OC8 A;  4HOJ A;  1WE0 A;  4G19 A;  4LA1 A;  5ECH B;  1TK8 B;  2O8V B;  2V2G A;  4RI7 A;  4E8H A;  5G31 A;  1A0R P;  1ON4 A;  2RUF A;  1JHB A;  3LWA A;  4MK3 A;  4WR5 A;  2JAC A;  3EUR A;  5J41 A;  1M99 A;  5H5R A;  2PVO C;  2R2J A;  4YH2 A;  1JZW A;  1SK1 A;  1F3B A;  3C1S A;  3VWV A;  4XTS A;  3FR6 A;  4KAE A;  1A2J A;  2H6Y A;  1GNW A;  5LD0 A;  3A5I A;  2R0G A;  4TXO B;  2GST A;  4NMU A;  1M2D A;  3Q6O A;  4TN8 A;  3KTB A;  3GTU B;  5KEJ A;  1EEJ A;  1GLP A;  5LNK e;  5DQY A;  3ZML A;  1HNA A;  2FGX A;  2H73 A;  4ICY A;  2HSH A;  2L59 A;  3P90 A;  4J57 E;  2CVB A;  4AJ7 A;  4EXJ A;  3WD6 A;  1EV4 A;  3TJF A;  3BCI A;  2YCD A;  4I2T A;  4PXO A;  1MEK A;  1I9D A;  1K0N A;  1GSQ A;  4ML6 A;  1U88 A;  1F9M A;  1YKC A;  3M1G A;  1GNE A;  3ZMK A;  1NHY A;  1FB6 A;  4NV2 A;  1TXX A;  1FVJ A;  2CX3 A;  2OKA A;  3C73 A;  1GTA A;  2OBK A;  3QAW A;  2HRK A;  2XBI A;  3EPT A;  1SL2 B;  4BL7 B;  12GS A;  3K8N A;  5BMU A;  5EVO A;  4MZC A;  5B7C A;  3D4M A;  5GAP D;  3D5J A;  2OAC A;  5JWQ B;  1XWG A;  3GMF A;  3L9U A;  1K3O A;  2B6M A;  4ZIL A;  2B1L A;  3W8J A;  5G5E A;  1GSY A;  2QKE A;  1FO5 A;  4AJ8 A;  3TOT A;  1PL1 A;  1FVK A;  1THX A;  3CBU A;  3HZ4 A;  4XRD A;  4WBJ A;  1TKD B;  1O8W A;  5ECO B;  1TK5 B;  3GL3 A;  4POB A;  1FHE A;  2MZC A;  2C0F A;  1X5C A;  4O32 A;  3MSZ A;  1VF4 A;  4EKZ A;  3R3E A;  4Q5Q A;  4GQC A;  9GSS A;  4PQ1 A;  4TR1 A;  3LJR A;  5ECQ B;  3IE3 A;  1SD9 A;  2FCH A;  1K0M A;  4MH2 A;  4HU9 A;  2P5R A;  2L5O A;  3TJB A;  3U5R E;  2XC2 A;  3C1R A;  2B7J A;  5ECI B;  1Z7P A;  2H19 A;  1T8E B;  2P5Q A;  1FOH A;  3I69 A;  1RQM A;  5JCG A;  2X4A A;  2K9F A;  3UMA A;  5DCG A;  4ZBD A;  1MD3 A;  2YPM A;  2A2R A;  1S3A A;  1V98 A;  2GZY A;  5F05 A;  19GS A;  6GST A;  3KJY A;  2FA8 A;  4GWR A;  5D9V A;  3L9V A;  3TKS E;  1PN9 A;  4YKG A;  4MAB A;  3HZ8 A;  4ML1 A;  1B4Q A;  2VCQ A;  3ZTL A;  4JE1 A;  3DGQ A;  2CT6 A;  1X0R A;  5IPG A;  2GT5 A;  2VO4 A;  1NHO A;  1T1V A;  3IBH A;  3H4K A;  1XW6 A;  5A4W A;  3ZRE A;  1U3I A;  3GA4 A;  3L78 A;  1XWC A;  3GV1 A;  3GX0 A;  2H0I A;  4BA7 A;  4NWY A;  1XIY A;  4TXV A;  3EYT A;  5IIZ A;  4HS1 A;  1R26 A;  3KEB A;  2GQM A;  5F07 A;  4NXI A;  4OWY A;  2O87 A;  4ECC A;  1T4Z A;  1AIU A;  2H76 A;  2EIO A;  4G0K A;  4EE0 A;  5CAX A;  2GZP A;  5GAN D;  2F9S A;  4GLT A;  1YEP A;  2IMK A;  5JCW A;  3W8S A;  3IHG A;  1VF1 A;  5AIX A;  3F3R A;  4IP6 A;  1G0T A;  4DSQ A;  4LMW A;  2HZF A;  3ZZX A;  3TKR A;  1GUL A;  3LXZ A;  1MDI A;  2PER A;  2UZ8 A;  1CQG A;  3BD2 A;  4K1F A;  1O6J A;  3UBK A;  1SJ6 A;  2HRF A;  3HJO A;  2TIR A;  2LQO A;  4POL A;  2GTU A;  2XPE A;  5KN2 A;  3KP8 A;  3BJ5 A;  1BQ7 A;  3FKF A;  3UBL A;  2HRN A;  3TJK A;  1F37 A;  5HFG A;  3PH9 A;  3FHK A;  2X64 A;  2TRX A;  4K0N A;  3IPZ A;  2C0D A;  1YEX A;  2HNL A;  3F4S A;  2FWH A;  1SJZ A;  1OC3 A;  4EUY A;  1GSD A;  4POK A;  3WT2 A;  5DDL A;  5IMV A;  1SKR B;  4GTU A;  4JBB A;  4BVX B;  4Z2U A;  4ULX A;  4K6X A;  2WJU A;  3O76 A;  3A5W A;  5CRE A;  1Q4J A;  1W89 A;  5D93 A;  2RUE A;  4TVE A;  3LG6 A;  1HNB A;  4WF5 A;  3HVS A;  4OMV A;  4EIQ A;  2YOI A;  3Q18 A;  4O5U A;  1V2A A;  3CTG A;  1XXU A;  4ILF A;  2YAN A;  3G9B A;  4DSS A;  1J9B A;  5JWO B;  5HFK A;  1A8L A;  2LJA A;  4K7N A;  5BRT A;  1KTE A;  1B9X C;  3IV4 A;  4G10 A;  2EIR A;  1OC9 B;  2OE1 A;  4X43 A;  2RLI A;  2VLT A;  2B5Y A;  3QPM A;  4KSM A;  4TKY A;  4PQI A;  3CMI A;  5D9W A;  2HSM A;  4RQR A;  3UJ1 A;  3UEM A;  5KN1 A;  4HSC X;  3I43 A;  2AAW A;  4K9Z A;  4KCA A;  3GKX A;  3TJG A;  17GS A;  2P0G A;  2WZ9 A;  4TR3 A;  2LJR A;  1XOB A;  1PA3 A;  22GS A;  4TXO A;  2DKI A;  3KXO A;  1SEN A;  1BG5 A;  5ECS A;  2IN3 A;  2VCT A;  3GTU A;  4WKW A;  1XVQ A;  2D2Z A;  2FWE A;  1UVZ A;  5AIV A;  3MAK A;  4ZIJ A;  3ZIT A;  1M2A A;  3SWL A;  3DIE A;  3DML A;  4JR6 A;  3G7Y A;  1KNG A;  3FK8 A;  4WBR D;  1GP1 A;  5DAK B;  2O89 A;  1MD4 A;  2VIM A;  2CQ9 A;  1R5P A;  1XG8 A;  2KUC A;  3G7J A;  4IN0 A;  4EO3 A;  3D21 A;  2H30 A;  2DJ1 A;  3GRX A;  5D9T A;  5B8B A;  1SL1 B;  1V40 A;  3L0H A;  1OAZ A;  2NVL A;  5IQY A;  5AGY A;  4BL7 A;  2R6K A;  1FB0 A;  4ZBA A;  2FLS A;  3DXB A;  3C8E A;  1Q98 A;  3GUS A;  5E59 A;  1C72 A;  1DE2 A;  4CY6 A;  1RW1 A;  5C00 A;  1OVN A;  2LUS A;  2E7P A;  3CRU A;  3GSS A;  4PNF A;  3KTL A;  5F06 A;  5CNW A;  1BJX A;  3TOU A;  3F0I A;  2B1K A;  2JL4 A;  2PVQ A;  3SBC A;  2IME A;  3EIN A;  1YKA A;  4L5L A;  1UN2 A;  4MLY A;  5AIS A;  4YQV A;  3QFA C;  4IJ3 A;  2HZE B;  1E2Y A;  3EU4 A;  3QDN A;  4KUN A;  1S3C A;  4G9H A;  1M0U A;  3VWW A;  1WMJ A;  2YWN A;  5KN0 A;  1G7E A;  4GSS A;  5CO3 A;  3KP9 A;  1TU8 A;  3CSH A;  5CRD A;  1VF3 A;  5DAL B;  1NW2 A;  5J5N A;  2LNT A;  3UAR A;  2C3T A;  3HVV A;  3A2X A;  2L6C A;  4EVM A;  2YJ7 A;  1SD8 A;  2VCV A;  5DJM A;  3EWL A;  3BCK A;  3APQ A;  3TKP A;  2LTK A;  3IAM 2;  2HRA A;  2GGT A;  1GUK A;  3LGC A;  4MMM A;  2OBI A;  1M7T A;  4XS6 A;  4TRX A;  4YAV A;  3HJM A;  2Z9S A;  2VD0 A;  1H4O A;  4YAP A;  5A4V A;  4K0G A;  3KGK A;  2C8U A;  1XOA A;  1PX6 A;  3D6I A;  20GS A;  1J0F A;  1EP8 A;  3BBY A;  2GT6 A;  2IWT A;  3H8Q A;  5J3R A;  2QSI A;  2JAD A;  2WFC A;  2DJJ A;  5HR3 A;  5DQS A;  3GL5 A;  4KB3 A;  2V6K A;  1WIK A;  2H0G A;  3FZ5 A;  5D9X A;  2H70 A;  5G2Z A;  2K8S A;  2KOK A;  4MCU A;  2GDR A;  1HYU A;  4N30 A;  4KA0 A;  1TRW A;  2H8L A;  2I3Y A;  3I6A A;  4L0U A;  2QC7 A;  4MZW A;  4AGS A;  2KP2 A;  5DVB A;  1GSS A;  3LYK A;  4FO5 A;  5HR0 A;  14GS A;  1T00 A;  1B9Y C;  1Z7R A;  1XW5 A;  2VCW A;  3FEU A;  3IRA A;  5KOW A;  2DJK A;  3H1N A;  1ZL9 A;  3ZVJ A;  2C4J A;  1SKW B;  1SK0 A;  2E2G A;  2N5A A;  3US3 A;  3J7Y k;  4FQU A;  4MNN A;  2KHP A;  1QK8 A;  1IYH A;  1XW9 A;  1T7P B;  4Z2R A;  4FIW A;  3ZVJ D;  2X99 A;  1EZK A;  2F51 A;  2REM A;  2OJL A;  3KMO A;  4ECI A;  1R5A A;  3F63 A;  1OKD A;  2VCX A;  7GSS A;  1PX7 A;  3FY7 A;  5J9C A;  3C7M A;  2DKH A;  2N5B A;  2CZ2 A;  4XRA A;  2FWG A;  1Y25 A;  4OFM A;  2ZUP A;  3TRQ A;  3E3E A;  1XVW A;  3D0Z A;  1QGV A;  2MMO A;  1O81 A;  3GNJ A;  2EIQ A;  4F82 A;  2JSY A;  3TKS A;  4DVC A;  4IEL A;  4ZL7 A;  4HI7 A;  4AJ6 A;  2H66 A;  3IK9 A;  2MBT A;  2YV7 A;  3EMX A;  2LEG A;  2FD3 A;  2VD1 A;  3TB2 A;  1O85 A;  2LKU A;  1ACV A;  3GH6 A;  4IQA A;  4NAX A;  5ECK B;  5ECR B;  1ZMA A;  2M80 A;  4BVX A;  3QMX A;  4TW5 A;  4IP1 A;  6GSV A;  2M46 A;  1YF1 A;  1JLV A;  1K0C A;  1KBN A;  5CRG A;  3VPQ A;  2H1A A;  5ECM B;  2P31 A;  4GF0 A;  4KDX A;  2YZU A;  3QR6 A;  2C1Y A;  5E4W A;  4ZL8 A;  4ZXG A;  2FHE A;  3ZIJ A;  4MPG A;  1SL0 B;  1WRY A;  5H5Q A;  4XS4 A;  3HVN A;  4GSN A;  4NHZ A;  1PGT A;  6GSW A;  4GST A;  3HHV A;  1WP0 A;  1XFL A;  4H86 A;  4O7H A;  1OC9 A;  4USS A;  2WDU A;  2GQL A;  4GRF A;  4OCF A;  5ELG A;  1G7O A;  3GYK A;  3MWH A;  1J08 A;  5G1L A;  2HE3 A;  3DD3 A;  2VM1 A;  4MF6 A;  1IYI A;  2YP6 A;  3F8U A;  3IR4 A;  2CZ3 A;  4MPF A;  6GSY A;  5IMC A;  1EGR A;  4K5S A;  5IOW A;  4MZB A;  1ST9 A;  1ERU A;  1TRV A;  2RM6 A;  3FR9 A;  4N10 A;  3ZYW A;  3TKQ A;  4I2U A;  4ZB9 A;  2JSZ A;  5GZZ B;  2IFQ B;  1AC1 A;  1EGO A;  1GSF A;  4K7O A;  3RPP A;  5IOX A;  3KD0 A;  4DEJ A;  4MJC A;  3RAZ A;  2DJ2 A;  4IBP A;  1TI1 A;  4D73 B;  3S9F A;  2LV3 A;  3UVH A;  2A4V A;  1YQ1 A;  2AV4 A;  3FYG A;  2AB6 A;  3PGT A;  13GS A;  5DAK A;  1ZYQ B;  2LJK A;  1AW9 A;  2X8H A;  3ZL5 A;  3WGD A;  3GST A;  2NPB A;  1B4P A;  3UIW A;  2LRT A;  3F6D A;  2VCZ A;  4V1A g;  2CAI A;  4HQZ A;  5ID2 B;  2YJH A;  4KSO A;  2R0C A;  1JZD A;  1OE8 A;  5HQP A;  4F0C A;  4F2I A;  1TDI A;  3AY8 A;  3E0U A;  1FAA A;  3EMP A;  4ISD A;  1FG4 A;  3PPU A;  4G0L A;  4IQ1 A;  2JU5 A;  3FR3 A;  5AN1 A;  1GSU A;  3GKN A;  2LNS A;  5D96 A;  4KND A;  2BTO T;  2DC5 A;  1W4V A;  1WPI A;  4XHM A;  5EPF A;  1EOG A;  1GWC A;  1U3A A;  1EWX A;  2YNX A;  1G6W A;  4KH7 A;  4BVY B;  2K6V A;  2PBJ A;  2VAF A;  3V1W A;  2HZE A;  4LL1 B;  2C80 A;  3ZLP A;  3BOA A;  1USB A;  2F8A A;  4I8B A;  2GVP A;  1X5D A;  2HFD A;  2YWO A;  1JFU A;  2WRT A;  1A8Y A;  4V1A p;  5DAL A;  3GN3 A;  4XCS A;  1ABA A;  3NIV A;  4O5R A;  1ML6 A;  4K5R A;  4I6X A;  1SKS B;  2XHF A;  3M8N A;  3EU3 A;  3KMN A;  2CVD A;  1ZYN A;  4TOP A;  1EP7 A;  4XS4 B;  3W6G A;  4N0V A;  1PN0 A;  4L0W A;  2B3S A;  4K2X A;  5B6M A;  3HJP A;  2I9H A;  1Z6M A;  2WCI A;  2ON5 A;  1T4Y A;  1LJR A;  1GUM A;  5JWR B;  5COH A;  1QMV A;  3QD9 A;  2BMX A;  2I4A A;  1GTB A;  1X9M B;  6GSU A;  4IVF A;  2MBS A;  4FYU A;  3LSZ A;  4MH3 A;  2B5X A;  4ECB A;  4IHU A;  4J2F A;  2DIZ A;  2N5F A;  3IHQ A;  2GLR A;  3RPN A;  4NPB A;  1N8J A;  2M72 A;  3F6F A;  3WYW A;  1Y6E A;  4RUV A;  2C0G A;  3FRC A;  3MIX A;  1A24 A;  3EVI A;  2DIY A;  3F3Q A;  4GCI A;  1AQV A;  2A2S A;  2LQQ A;  4CDO A;  1M9B A;  2FNO A;  3LYP A;  5ECP B;  2JZR A;  3VPT A;  2AJQ B;  1RK4 A;  1AQX A;  2CVK A;  4HJM A;  3LFL A;  1GTU A;  4I97 A;  5INY A;  2IMF A;  2AHE A;  3N9J A;  1O8X A;  1ERW A;  5HR2 A;  3JCM L;  4PGT A;  3CSJ A;  1V57 A;  2IJY A;  4RQX A;  4PQH A;  5IMD A;  5G5F A;  5B8A A;  1ZYE A;  2HI7 A;  4P3Y B;  1TK0 B;  4QQ7 A;  2QGV A;  2R37 A;  4K7I A;  5G30 A;  3GFK A;  4QL7 A;  2HSY A;  4X4J A;  1DBY A;  2VL2 C;  4DSR A;  3FW2 A;  4K2D A;  1JZO A;  4OD7 A;  1N2A A;  1BAY A;  1LBK A;  3OR5 A;  5A5K A;  4FYB A;  1URM A;  4RI6 A;  3FMW A;  3HD5 A;  1ZOF A;  4PUR A;  5ABR A;  5CP1 A;  4GXZ A;  3HKR A;  5KOX A;  3NZN A;  2WGR A;  3U6V A;  2V1M A;  4V2N A;  4HEA 2;  2GSR A;  3HYP A;  2B5E A;  3GKM A;  1K3L A;  3ERF A;  3L9S A;  1Z5Y E;  4XS1 A;  4QL9 A;  3IXR A;  1TJD A;  2F8F A;  1THO A;  4O92 A;  2BJX A;  3F9U A;  3A2V A;  1TRU A;  3FZ4 A;  2YWI A;  3GIX A;  3J7Y b;  3M3M A;  3ZRD A;  3IC8 A;  1PQN A;  2MMN A;  1GSE A;  2DBC A;  3IK7 A;  5IPH A;  1QUW A;  1TI3 A;  1X9W B;  2H75 A;  3KCM A;  2CV4 A;  3WGE A;  3LQ7 A;  2PUK C;  2DLX A;  3RDW A;  6GSX A;  2H1D A;  1O7U A;  1R7H A;  5C04 A;  1EOH A;  1XBS A;  4HZ4 A;  4IKH A;  1M3J A;  3NOF A;  1GRX A;  3KM6 A;  1ILO A;  3APO A;  4Q5N A;  3DWV A;  3TUE A;  2L4Q A;  1SJI A;  2GS3 A;  4N0Z A;  2L5L A;  2ALB A;  5DBQ A;  4G2E A;  1SK2 A;  1PFO A;  2HXK A;  5IMA A;  3MYD A;  1K0A A;  4K8M A;  4L8E A;  5F0G A;  3MDK A;  3TRP A;  1LU4 A;  1AUC A;  3CQF A;  2QA2 A;  5CRW A;  2O7K A;  3C71 A;  2R3X A;  2IFQ A;  1BYE A;  4OO4 A;  4EF0 A;  3HY2 A;  3QOU A;  2FWF A;  2O85 A;  4EC0 A;  2PMT A;  2RM5 A;  4MF5 A;  3VWX A;  3M0F A;  2KLX A;  5F8B A;  3CXG A;  4D73 A;  2CAQ A;  1PSQ A;  3DYR A;  1S3D A;  1VF2 A;  4BPY A;  3ERG A;  3LXT A;  5DCH A;  2YN1 A;  3IOS A;  3RHB A;  2LS5 A;  4ACS A;  2HLS A;  2E0Q A;  2H6X A;  8GSS A;  5ID2 A;  4L5O A;  2QA1 A;  4KDU A;  3QAG A;  1DE1 A;  4NV5 A;  3VLN A;  1WOU A;  4HUA A;  1U6T A;  1GTI A;  4KGI A;  3FZA A;  2X49 A;  3QFB C;  3UOM A;  2L57 A;  2OE3 A;  2OA7 A;  4KDY A;  1FW1 A;  1TOF A;  1V58 A;  3UAP A;  3ME7 A;  2VUP A;  3LW9 A;  1YF0 A;  3GUR A;  1OKT A;  1TU7 A;  3RBT A;  3GKK A;  1PD2 1;  4FH8 A;  4V2M A;  4IGJ A;  3ZFB A;  1XWK A;  2G0F A;  4OCE A;  1MDK A;  4BVY A;  3TCO A;  1K0D A;  1CQH A;  4BWQ A;  3TJJ A;  1HQO A;  1NM3 A;  4POM A;  1BX9 A;  2GZZ A;  2XBQ A;  1SYR A;  5D73 A;  2F3M A;  4EIP A;  5HR1 A;  5GST A;  2ZNM A;  3F4R A;  2H6Z A;  3L4N A;  2I81 A;  3QAV A;  2R0P A;  3ZIV A;  1F6M C;  5FHI A;  1NSW A;  4Z2T A;  2XPD A;  1GL8 A;  3VWU A;  3Q74 A;  2IMD A;  3APS A;  1R4W A;  4YQM A;  2H71 A;  3TGZ A;  1DSB A;  1Z3E A;  4ZB8 A;  4X1U A;  1VGL A;  3TDG A;  4F9Z A;  4WET A;  1ZGN A;  1TRS A;  2K8V A;  5G1K A;  3GH9 A;  2MMZ A;  2PGT A;  3TKS C;  2ZCT A;  4OFT A;  2H01 A;  1OE7 A;  4F0B A;  5JCU A;  3HCZ A;  2I1U A;  2VM2 A;  2K18 A;  2YZH A;  4EDZ A;  2L4C A;  5A4U A;  3DVW A;  4Q5R A;  3DRN A;  2V41 A;  1H75 A;  2H1G A;  3ERW A;  4KW6 A;  3UL3 A;  2DJ0 A;  2IL3 A;  3ME8 A;  3DKS A;  4KX4 A;  4HDE A;  1TP9 A;  5L71 A;  1AXD A;  4LMV A;  1A2L A;  3EE2 A;  3O6T A;  4I5Q A;  2VOC A;  4EDY A;  4ZB6 A;  2WS2 A;  1KEB A;  2DML A;  1GH2 A;  4CW9 A;  2CX4 A;  1MDJ A;  2HT9 A;  1F3A A;  1UC7 A;  1E6B A;  1PRX A;  3Q19 A;  1XWA A;  5EL8 A;  3P7X A;  4ID0 A;  1AQW A;  3CYN A;  2V6O A;  5D8I A;  3WT1 A;  2DJ3 A;  1ERT A;  3CSI A;  2PN8 A;  1VRS D;  2EC4 A;  2GQK A;  3GX8 A;  3HXS A;  4MJA A;  4JED A;  11GS A;  1QQ2 A;  1UA5 A;  3I9V 2;  4IW9 A;  4N11 A;  1BED A;  3ED3 A;  1A0F A;  1B48 A;  4YKF A;  1K3Y A;  2L6D A;  2IIY A;  4JRR A;  1ZZY A;  4TR4 A;  4FYC A;  1QFN A;  2NDO A;  2A4H A;  4OO5 A;  3F4T A;  4IS0 A;  3A3T A;  1M2B A;  1WWJ A;  3H79 A;  4A5P A;  3VI7 A;  3P8W A;  3QCP A;  4MA9 A;  2X8C A;  1YDK A;  5LCZ A;  1M3I A;  5IMZ A;  5ELA A;  1JZR A;  2H0H A;  3D4T A;  1FOV A;  1YY7 A;  1ZCP A;  2NTO A;  3HDC A;  1AAZ A;  4MJB A;  3ISO A;  5IM9 A;  2GSS A;  4PTS A;  1K0B A;  1TTZ A;  4HU7 A;  4JZQ A;  3A2W A;  4TR1 B;  2VL3 A;  5KN3 A;  3N5O A;  2MYG A;  4KCE A;  1WJK A;  3FZ9 A;  4TR0 A;  2CA8 A;  4JU5 A;  1YJ6 A;  1HNC A;  2KP1 A;  1Z9H A;  3PIN A;  4MF7 A;  1GLQ A;  1QXH A;  5ECL B;  4MP4 A;  4PX1 A;  4YQU A;  1JLW A;  1XPV A;  3VFI A;  2DMM A;  2TRC P;  2A2P A;  3P2A A;  1HD2 A;  5J9B A;  2FUG 2;  4BIK A;  2PU9 C;  3RHC A;  2JZS A;  2C3N A;  1TW9 A;  2YWM A;  1EEM A;  1PKW A;  3H93 A;  2H1B A;  1PMT A;  2FA4 A;  2RII A;  3KIJ A;  5J4U A;  1Z6N A;  2LRN A;  4ZBB A;  3G7I A;  4JR4 A;  1DUG A;  1EV9 A;  3DEX A;  3VI5 A;  1A2M A;  2OE0 A;  3LEF A;  2GSQ A;  3M9K A;  4PUF C;  1XZO A;  2DSA A;  2ON7 A;  1ZYP A;  2G2Q A;  2ES7 A;  1MTC A;  1M9A A;  1S3R A;  3KH9 A;  3EC3 A;  3HA9 A;  4WR4 A;  4BWS A;  4KF9 A;  4WF4 A;  3VK9 A;  2PPT A;  2V32 A;  4J56 E;  3CRT A;  4OFN A;  2VL2 A;  2R5G A;  1XWB A;  4EL1 A;  4V2L A;  1SYX A;  2PWJ A;  2VLV A;  1O73 A;  1I5G A;  5IO2 A;  2YV9 A;  3O3T A;  4CY8 A;  4PUA A;  4F03 A;  2HYX A;  4MDC A;  1GUH A;  2VLU A;  3M9J A;  4Q5F A;  2WB9 A;  3PR8 A;  5GSS A;  1G6Y A;  2R4V A;  1SU9 A;  2C0E A;  1T3B A;  1YZX A;  4E8E A;  5FWG A;  2H74 A;  3IDV A;  18GS A;  2LRC A;  3TRX A;  3D22 A;  3CTF A;  5EY6 A;  4KE3 A;  1X5E A;  5H5S A;  1XCC A;  3R2Q A;  4X0X A;  5ECN B;  3IAS 2;  1V9W A;  3LOR A;  4HJ2 A;  2E2M A;  4GQF A;  4WEY A;  1X9S B;  3UVT A;  4XIH A;  4ECJ A;  2IMI A;  2FY6 A;  5ENU A;  10GS A;  1PL2 A;  1OYJ A;  3HVX A;  2X8G A;  2MMA A;  3DVX A;  1PKZ A;  1K0O A;  5B6N A;  2C3Q A;  5FT3 A;  3KH7 A;  5DJL A;  4Z7X A;  4AF2 A;  4IJI A;  4CHS A;  2AYT A;  1U87 A;  2VL9 A;  5CYY A;  2LST A;  2NBS A;  3IA1 A;  4LL4 B;  1ERV A;  4ZL9 A;  2IPA A;  1B8X A;  6GSS A;  5IO0 A;  3VUR A;  2WUL A;  5CRH A;  2B7K A;  5IMF A;  4O5Q A;  1F2E A;  4G0I A;  4MJE A; 
#chains in the Genus database with same CATH homology
 16GS A;  2H72 A;  2J23 A;  3WGX A;  3MNG A;  3KZQ A;  4HZ2 A;  3ZFL A;  3E9J B;  2JZT A;  4NHW A;  3GHA A;  3IC4 A;  5HFI A;  4LLR A;  4WXT A;  2OAD A;  4HQS A;  4PNG A;  4DSS B;  2J9H A;  1A23 A;  2AUV A;  1OC8 A;  4HOJ A;  1WE0 A;  4G19 A;  4LA1 A;  5ECH B;  1TK8 B;  2O8V B;  2V2G A;  4RI7 A;  4E8H A;  5G31 A;  1A0R P;  1ON4 A;  2RUF A;  1JHB A;  3LWA A;  4MK3 A;  4WR5 A;  2JAC A;  3EUR A;  5J41 A;  1M99 A;  5H5R A;  2PVO C;  2R2J A;  4YH2 A;  1JZW A;  1SK1 A;  1F3B A;  3C1S A;  3VWV A;  4XTS A;  3FR6 A;  4KAE A;  1A2J A;  2H6Y A;  1GNW A;  5LD0 A;  3A5I A;  2R0G A;  4TXO B;  2GST A;  4NMU A;  1M2D A;  3Q6O A;  4TN8 A;  3KTB A;  3GTU B;  5KEJ A;  1EEJ A;  1GLP A;  5LNK e;  5DQY A;  3ZML A;  1HNA A;  2FGX A;  2H73 A;  4ICY A;  2HSH A;  2L59 A;  3P90 A;  4J57 E;  2CVB A;  4AJ7 A;  4EXJ A;  3WD6 A;  1EV4 A;  3TJF A;  3BCI A;  2YCD A;  4I2T A;  4PXO A;  1MEK A;  1I9D A;  1K0N A;  1GSQ A;  4ML6 A;  1U88 A;  1F9M A;  1YKC A;  3M1G A;  1GNE A;  3ZMK A;  1NHY A;  1FB6 A;  4NV2 A;  1TXX A;  1FVJ A;  2CX3 A;  2OKA A;  3C73 A;  1GTA A;  2OBK A;  3QAW A;  2HRK A;  2XBI A;  3EPT A;  1SL2 B;  4BL7 B;  12GS A;  3K8N A;  5BMU A;  5EVO A;  4MZC A;  5B7C A;  3D4M A;  5GAP D;  3D5J A;  2OAC A;  5JWQ B;  1XWG A;  3GMF A;  3L9U A;  1K3O A;  2B6M A;  4ZIL A;  2B1L A;  3W8J A;  5G5E A;  1GSY A;  2QKE A;  1FO5 A;  4AJ8 A;  3TOT A;  1PL1 A;  1FVK A;  1THX A;  3CBU A;  3HZ4 A;  4XRD A;  4WBJ A;  1TKD B;  1O8W A;  5ECO B;  1TK5 B;  3GL3 A;  4POB A;  1FHE A;  2MZC A;  2C0F A;  1X5C A;  4O32 A;  3MSZ A;  1VF4 A;  4EKZ A;  3R3E A;  4Q5Q A;  4GQC A;  9GSS A;  4PQ1 A;  4TR1 A;  3LJR A;  5ECQ B;  3IE3 A;  1SD9 A;  2FCH A;  1K0M A;  4MH2 A;  4HU9 A;  2P5R A;  2L5O A;  3TJB A;  3U5R E;  2XC2 A;  3C1R A;  2B7J A;  5ECI B;  1Z7P A;  2H19 A;  1T8E B;  2P5Q A;  1FOH A;  3I69 A;  1RQM A;  5JCG A;  2X4A A;  2K9F A;  3UMA A;  5DCG A;  4ZBD A;  1MD3 A;  2YPM A;  2A2R A;  1S3A A;  1V98 A;  2GZY A;  5F05 A;  19GS A;  6GST A;  3KJY A;  2FA8 A;  4GWR A;  5D9V A;  3L9V A;  3TKS E;  1PN9 A;  4YKG A;  4MAB A;  3HZ8 A;  4ML1 A;  1B4Q A;  2VCQ A;  3ZTL A;  4JE1 A;  3DGQ A;  2CT6 A;  1X0R A;  5IPG A;  2GT5 A;  2VO4 A;  1NHO A;  1T1V A;  3IBH A;  3H4K A;  1XW6 A;  5A4W A;  3ZRE A;  1U3I A;  3GA4 A;  3L78 A;  1XWC A;  3GV1 A;  3GX0 A;  2H0I A;  4BA7 A;  4NWY A;  1XIY A;  4TXV A;  3EYT A;  5IIZ A;  4HS1 A;  1R26 A;  3KEB A;  2GQM A;  5F07 A;  4NXI A;  4OWY A;  2O87 A;  4ECC A;  1T4Z A;  1AIU A;  2H76 A;  2EIO A;  4G0K A;  4EE0 A;  5CAX A;  2GZP A;  5GAN D;  2F9S A;  4GLT A;  1YEP A;  2IMK A;  5JCW A;  3W8S A;  3IHG A;  1VF1 A;  5AIX A;  3F3R A;  4IP6 A;  1G0T A;  4DSQ A;  4LMW A;  2HZF A;  3ZZX A;  3TKR A;  1GUL A;  3LXZ A;  1MDI A;  2PER A;  2UZ8 A;  1CQG A;  3BD2 A;  4K1F A;  1O6J A;  3UBK A;  1SJ6 A;  2HRF A;  3HJO A;  2TIR A;  2LQO A;  4POL A;  2GTU A;  2XPE A;  5KN2 A;  3KP8 A;  3BJ5 A;  1BQ7 A;  3FKF A;  3UBL A;  2HRN A;  3TJK A;  1F37 A;  5HFG A;  3PH9 A;  3FHK A;  2X64 A;  2TRX A;  4K0N A;  3IPZ A;  2C0D A;  1YEX A;  2HNL A;  3F4S A;  2FWH A;  1SJZ A;  1OC3 A;  4EUY A;  1GSD A;  4POK A;  3WT2 A;  5DDL A;  5IMV A;  1SKR B;  4GTU A;  4JBB A;  4BVX B;  4Z2U A;  4ULX A;  4K6X A;  2WJU A;  3O76 A;  3A5W A;  5CRE A;  1Q4J A;  1W89 A;  5D93 A;  2RUE A;  4TVE A;  3LG6 A;  1HNB A;  4WF5 A;  3HVS A;  4OMV A;  4EIQ A;  2YOI A;  3Q18 A;  4O5U A;  1V2A A;  3CTG A;  1XXU A;  4ILF A;  2YAN A;  3G9B A;  4DSS A;  1J9B A;  5JWO B;  5HFK A;  1A8L A;  2LJA A;  4K7N A;  5BRT A;  1KTE A;  1B9X C;  3IV4 A;  4G10 A;  2EIR A;  1OC9 B;  2OE1 A;  4X43 A;  2RLI A;  2VLT A;  2B5Y A;  3QPM A;  4KSM A;  4TKY A;  4PQI A;  3CMI A;  5D9W A;  2HSM A;  4RQR A;  3UJ1 A;  3UEM A;  5KN1 A;  3I43 A;  2AAW A;  4K9Z A;  4KCA A;  3GKX A;  3TJG A;  17GS A;  2P0G A;  2WZ9 A;  4TR3 A;  2LJR A;  1XOB A;  1PA3 A;  22GS A;  4TXO A;  2DKI A;  3KXO A;  1SEN A;  1BG5 A;  5ECS A;  2IN3 A;  2VCT A;  3GTU A;  4WKW A;  1XVQ A;  2D2Z A;  2FWE A;  1UVZ A;  5AIV A;  3MAK A;  4ZIJ A;  3ZIT A;  1M2A A;  3SWL A;  3DIE A;  3DML A;  4JR6 A;  3G7Y A;  1KNG A;  3FK8 A;  4WBR D;  1GP1 A;  5DAK B;  2O89 A;  1MD4 A;  2VIM A;  2CQ9 A;  1R5P A;  2KUC A;  3G7J A;  4IN0 A;  4EO3 A;  3D21 A;  2H30 A;  2DJ1 A;  3GRX A;  5D9T A;  5B8B A;  1SL1 B;  1V40 A;  3L0H A;  1OAZ A;  2NVL A;  5IQY A;  5AGY A;  4BL7 A;  2R6K A;  1FB0 A;  4ZBA A;  2FLS A;  3DXB A;  3C8E A;  1Q98 A;  3GUS A;  5E59 A;  1C72 A;  1DE2 A;  4CY6 A;  1RW1 A;  5C00 A;  1OVN A;  2LUS A;  2E7P A;  3CRU A;  3GSS A;  4PNF A;  3KTL A;  5F06 A;  5CNW A;  1BJX A;  3TOU A;  3F0I A;  2B1K A;  2JL4 A;  2PVQ A;  3SBC A;  2IME A;  3EIN A;  1YKA A;  4L5L A;  1UN2 A;  4MLY A;  5AIS A;  4YQV A;  3QFA C;  4IJ3 A;  2HZE B;  1E2Y A;  3EU4 A;  3QDN A;  4KUN A;  1S3C A;  4G9H A;  1M0U A;  3VWW A;  1WMJ A;  2YWN A;  5KN0 A;  1G7E A;  4GSS A;  5CO3 A;  3KP9 A;  1TU8 A;  3CSH A;  5CRD A;  1VF3 A;  5DAL B;  1NW2 A;  5J5N A;  2LNT A;  3UAR A;  2C3T A;  3HVV A;  3A2X A;  2L6C A;  4EVM A;  2YJ7 A;  1SD8 A;  2VCV A;  5DJM A;  3EWL A;  3BCK A;  3APQ A;  3TKP A;  2LTK A;  3IAM 2;  2HRA A;  2GGT A;  1GUK A;  3LGC A;  4MMM A;  2OBI A;  1M7T A;  4XS6 A;  4TRX A;  4YAV A;  3HJM A;  2Z9S A;  2VD0 A;  1H4O A;  4YAP A;  5A4V A;  4K0G A;  3KGK A;  2C8U A;  1XOA A;  1PX6 A;  3D6I A;  20GS A;  1J0F A;  1EP8 A;  3BBY A;  2GT6 A;  2IWT A;  3H8Q A;  5J3R A;  2QSI A;  2JAD A;  2WFC A;  2DJJ A;  5HR3 A;  5DQS A;  3GL5 A;  4KB3 A;  2V6K A;  1WIK A;  2H0G A;  3FZ5 A;  5D9X A;  2H70 A;  5G2Z A;  2K8S A;  2KOK A;  4MCU A;  2GDR A;  1HYU A;  4N30 A;  4KA0 A;  1TRW A;  2H8L A;  2I3Y A;  3I6A A;  4L0U A;  2QC7 A;  4MZW A;  4AGS A;  2KP2 A;  5DVB A;  1GSS A;  3LYK A;  4FO5 A;  5HR0 A;  14GS A;  1T00 A;  1B9Y C;  1Z7R A;  1XW5 A;  2VCW A;  3FEU A;  3IRA A;  5KOW A;  2DJK A;  3H1N A;  1ZL9 A;  3ZVJ A;  2C4J A;  1SKW B;  1SK0 A;  2E2G A;  2N5A A;  3US3 A;  3J7Y k;  4FQU A;  4MNN A;  2KHP A;  1QK8 A;  1IYH A;  1XW9 A;  1T7P B;  4Z2R A;  4FIW A;  3ZVJ D;  2X99 A;  1EZK A;  2F51 A;  2REM A;  2OJL A;  3KMO A;  4ECI A;  1R5A A;  3F63 A;  1OKD A;  2VCX A;  7GSS A;  1PX7 A;  3FY7 A;  5J9C A;  3C7M A;  2DKH A;  2N5B A;  2CZ2 A;  4XRA A;  2FWG A;  1Y25 A;  4OFM A;  2ZUP A;  3TRQ A;  3E3E A;  1XVW A;  3D0Z A;  1QGV A;  2MMO A;  1O81 A;  3GNJ A;  2EIQ A;  4F82 A;  2JSY A;  3TKS A;  4DVC A;  4IEL A;  4ZL7 A;  4HI7 A;  4AJ6 A;  2H66 A;  3IK9 A;  2MBT A;  2YV7 A;  3EMX A;  2LEG A;  2FD3 A;  2VD1 A;  3TB2 A;  1O85 A;  2LKU A;  1ACV A;  3GH6 A;  4IQA A;  4NAX A;  5ECK B;  5ECR B;  1ZMA A;  2M80 A;  4BVX A;  3QMX A;  4TW5 A;  4IP1 A;  6GSV A;  2M46 A;  1YF1 A;  1JLV A;  1K0C A;  1KBN A;  5CRG A;  3VPQ A;  2H1A A;  5ECM B;  2P31 A;  4GF0 A;  4KDX A;  2YZU A;  3QR6 A;  2C1Y A;  5E4W A;  4ZL8 A;  4ZXG A;  2FHE A;  3ZIJ A;  4MPG A;  1SL0 B;  1WRY A;  5H5Q A;  4XS4 A;  4GSN A;  4NHZ A;  1PGT A;  6GSW A;  4GST A;  3HHV A;  1WP0 A;  1XFL A;  4H86 A;  4O7H A;  1OC9 A;  4USS A;  2WDU A;  2GQL A;  4GRF A;  4OCF A;  5ELG A;  1G7O A;  3GYK A;  3MWH A;  1J08 A;  5G1L A;  2HE3 A;  3DD3 A;  2VM1 A;  4MF6 A;  1IYI A;  2YP6 A;  3F8U A;  3IR4 A;  2CZ3 A;  4MPF A;  6GSY A;  5IMC A;  1EGR A;  4K5S A;  5IOW A;  4MZB A;  1ST9 A;  1ERU A;  1TRV A;  2RM6 A;  3FR9 A;  4N10 A;  3ZYW A;  3TKQ A;  4I2U A;  4ZB9 A;  2JSZ A;  5GZZ B;  2IFQ B;  1AC1 A;  1EGO A;  1GSF A;  4K7O A;  3RPP A;  5IOX A;  3KD0 A;  4DEJ A;  4MJC A;  3RAZ A;  2DJ2 A;  4IBP A;  1TI1 A;  4D73 B;  3S9F A;  2LV3 A;  3UVH A;  2A4V A;  1YQ1 A;  2AV4 A;  3FYG A;  2AB6 A;  3PGT A;  13GS A;  5DAK A;  1ZYQ B;  2LJK A;  1AW9 A;  2X8H A;  3ZL5 A;  3WGD A;  3GST A;  2NPB A;  1B4P A;  3UIW A;  2LRT A;  3F6D A;  2VCZ A;  4V1A g;  2CAI A;  4HQZ A;  5ID2 B;  2YJH A;  4KSO A;  2R0C A;  1JZD A;  1OE8 A;  5HQP A;  4F0C A;  4F2I A;  1TDI A;  3AY8 A;  3E0U A;  1FAA A;  3EMP A;  4ISD A;  1FG4 A;  3PPU A;  4G0L A;  4IQ1 A;  2JU5 A;  3FR3 A;  5AN1 A;  1GSU A;  3GKN A;  2LNS A;  5D96 A;  4KND A;  2BTO T;  2DC5 A;  1W4V A;  1WPI A;  4XHM A;  5EPF A;  1EOG A;  1GWC A;  1U3A A;  1EWX A;  2YNX A;  1G6W A;  4KH7 A;  4BVY B;  2K6V A;  2PBJ A;  2VAF A;  3V1W A;  2HZE A;  4LL1 B;  2C80 A;  3ZLP A;  3BOA A;  1USB A;  2F8A A;  4I8B A;  2GVP A;  1X5D A;  2HFD A;  2YWO A;  1JFU A;  2WRT A;  1A8Y A;  4V1A p;  5DAL A;  3GN3 A;  4XCS A;  1ABA A;  3NIV A;  4O5R A;  1ML6 A;  4K5R A;  4I6X A;  1SKS B;  2XHF A;  3M8N A;  3EU3 A;  3KMN A;  2CVD A;  1ZYN A;  4TOP A;  1EP7 A;  4XS4 B;  3W6G A;  4N0V A;  1PN0 A;  4L0W A;  2B3S A;  4K2X A;  5B6M A;  3HJP A;  2I9H A;  1Z6M A;  2WCI A;  2ON5 A;  1T4Y A;  1LJR A;  1GUM A;  5JWR B;  5COH A;  1QMV A;  3QD9 A;  2BMX A;  2I4A A;  1GTB A;  1X9M B;  6GSU A;  4IVF A;  2MBS A;  4FYU A;  3LSZ A;  4MH3 A;  2B5X A;  4ECB A;  4IHU A;  4J2F A;  2DIZ A;  2N5F A;  3IHQ A;  2GLR A;  3RPN A;  4NPB A;  1N8J A;  2M72 A;  3F6F A;  3WYW A;  1Y6E A;  4RUV A;  2C0G A;  3FRC A;  3MIX A;  1A24 A;  3EVI A;  2DIY A;  3F3Q A;  4GCI A;  1AQV A;  2A2S A;  2LQQ A;  4CDO A;  1M9B A;  2FNO A;  3LYP A;  5ECP B;  2JZR A;  3VPT A;  2AJQ B;  1RK4 A;  1AQX A;  2CVK A;  4HJM A;  3LFL A;  1GTU A;  4I97 A;  5INY A;  2IMF A;  2AHE A;  3N9J A;  1O8X A;  1ERW A;  5HR2 A;  3JCM L;  4PGT A;  3CSJ A;  1V57 A;  2IJY A;  4RQX A;  4PQH A;  5IMD A;  5G5F A;  5B8A A;  1ZYE A;  2HI7 A;  4P3Y B;  1TK0 B;  4QQ7 A;  2QGV A;  2R37 A;  4K7I A;  5G30 A;  3GFK A;  4QL7 A;  2HSY A;  4X4J A;  1DBY A;  2VL2 C;  4DSR A;  3FW2 A;  4K2D A;  1JZO A;  4OD7 A;  1N2A A;  1BAY A;  1LBK A;  3OR5 A;  5A5K A;  4FYB A;  1URM A;  4RI6 A;  3FMW A;  3HD5 A;  1ZOF A;  4PUR A;  5ABR A;  5CP1 A;  4GXZ A;  3HKR A;  5KOX A;  3NZN A;  2WGR A;  3U6V A;  2V1M A;  4V2N A;  4HEA 2;  2GSR A;  3HYP A;  2B5E A;  3GKM A;  1K3L A;  3ERF A;  3L9S A;  1Z5Y E;  4XS1 A;  4QL9 A;  3IXR A;  1TJD A;  2F8F A;  1THO A;  4O92 A;  2BJX A;  3F9U A;  3A2V A;  1TRU A;  3FZ4 A;  2YWI A;  3GIX A;  3J7Y b;  3M3M A;  3ZRD A;  3IC8 A;  1PQN A;  2MMN A;  1GSE A;  2DBC A;  3IK7 A;  5IPH A;  1QUW A;  1TI3 A;  1X9W B;  2H75 A;  3KCM A;  2CV4 A;  3WGE A;  3LQ7 A;  2PUK C;  2DLX A;  3RDW A;  6GSX A;  2H1D A;  1O7U A;  1R7H A;  5C04 A;  1EOH A;  1XBS A;  4HZ4 A;  4IKH A;  3NOF A;  1GRX A;  3KM6 A;  1ILO A;  3APO A;  4Q5N A;  3DWV A;  3TUE A;  2L4Q A;  1SJI A;  2GS3 A;  4N0Z A;  2L5L A;  2ALB A;  5DBQ A;  4G2E A;  1SK2 A;  2HXK A;  5IMA A;  3MYD A;  1K0A A;  4K8M A;  4L8E A;  5F0G A;  3MDK A;  3TRP A;  1LU4 A;  1AUC A;  2QA2 A;  5CRW A;  2O7K A;  3C71 A;  2R3X A;  2IFQ A;  1BYE A;  4OO4 A;  4EF0 A;  3HY2 A;  3QOU A;  2FWF A;  2O85 A;  4EC0 A;  2PMT A;  2RM5 A;  4MF5 A;  3VWX A;  3M0F A;  2KLX A;  5F8B A;  3CXG A;  4D73 A;  2CAQ A;  1PSQ A;  3DYR A;  1S3D A;  1VF2 A;  4BPY A;  3ERG A;  3LXT A;  5DCH A;  2YN1 A;  3IOS A;  3RHB A;  2LS5 A;  4ACS A;  2HLS A;  2E0Q A;  2H6X A;  8GSS A;  5ID2 A;  4L5O A;  2QA1 A;  4KDU A;  3QAG A;  1DE1 A;  4NV5 A;  3VLN A;  1WOU A;  4HUA A;  1U6T A;  1GTI A;  4KGI A;  3FZA A;  2X49 A;  3QFB C;  3UOM A;  2L57 A;  2OE3 A;  2OA7 A;  4KDY A;  1FW1 A;  1TOF A;  1V58 A;  3UAP A;  3ME7 A;  2VUP A;  3LW9 A;  1YF0 A;  3GUR A;  1OKT A;  1TU7 A;  3RBT A;  3GKK A;  1PD2 1;  4FH8 A;  4V2M A;  4IGJ A;  3ZFB A;  1XWK A;  2G0F A;  4OCE A;  1MDK A;  4BVY A;  3TCO A;  1K0D A;  1CQH A;  4BWQ A;  3TJJ A;  1HQO A;  1NM3 A;  4POM A;  1BX9 A;  2GZZ A;  2XBQ A;  1SYR A;  5D73 A;  2F3M A;  4EIP A;  5HR1 A;  5GST A;  2ZNM A;  3F4R A;  2H6Z A;  3L4N A;  2I81 A;  3QAV A;  2R0P A;  3ZIV A;  1F6M C;  5FHI A;  1NSW A;  4Z2T A;  2XPD A;  1GL8 A;  3VWU A;  3Q74 A;  2IMD A;  3APS A;  1R4W A;  4YQM A;  2H71 A;  3TGZ A;  1DSB A;  1Z3E A;  4ZB8 A;  4X1U A;  1VGL A;  3TDG A;  4F9Z A;  4WET A;  1ZGN A;  1TRS A;  2K8V A;  5G1K A;  3GH9 A;  2MMZ A;  2PGT A;  3TKS C;  2ZCT A;  4OFT A;  2H01 A;  1OE7 A;  4F0B A;  5JCU A;  3HCZ A;  2I1U A;  2VM2 A;  2K18 A;  2YZH A;  4EDZ A;  2L4C A;  5A4U A;  3DVW A;  4Q5R A;  3DRN A;  2V41 A;  1H75 A;  2H1G A;  3ERW A;  4KW6 A;  3UL3 A;  2DJ0 A;  2IL3 A;  3ME8 A;  3DKS A;  4KX4 A;  4HDE A;  1TP9 A;  5L71 A;  1AXD A;  4LMV A;  1A2L A;  3EE2 A;  3O6T A;  4I5Q A;  2VOC A;  4EDY A;  4ZB6 A;  2WS2 A;  1KEB A;  2DML A;  1GH2 A;  4CW9 A;  2CX4 A;  1MDJ A;  2HT9 A;  1F3A A;  1UC7 A;  1E6B A;  1PRX A;  3Q19 A;  1XWA A;  5EL8 A;  3P7X A;  4ID0 A;  1AQW A;  3CYN A;  2V6O A;  5D8I A;  3WT1 A;  2DJ3 A;  1ERT A;  3CSI A;  2PN8 A;  1VRS D;  2EC4 A;  2GQK A;  3GX8 A;  3HXS A;  4MJA A;  4JED A;  11GS A;  1QQ2 A;  1UA5 A;  3I9V 2;  4IW9 A;  4N11 A;  1BED A;  3ED3 A;  1A0F A;  1B48 A;  4YKF A;  1K3Y A;  2L6D A;  2IIY A;  4JRR A;  1ZZY A;  4TR4 A;  4FYC A;  1QFN A;  2NDO A;  2A4H A;  4OO5 A;  3F4T A;  4IS0 A;  3A3T A;  1M2B A;  1WWJ A;  3H79 A;  4A5P A;  3VI7 A;  3P8W A;  3QCP A;  4MA9 A;  2X8C A;  1YDK A;  5LCZ A;  5IMZ A;  5ELA A;  1JZR A;  2H0H A;  3D4T A;  1FOV A;  1YY7 A;  1ZCP A;  2NTO A;  3HDC A;  1AAZ A;  4MJB A;  3ISO A;  5IM9 A;  2GSS A;  4PTS A;  1K0B A;  1TTZ A;  4HU7 A;  4JZQ A;  3A2W A;  4TR1 B;  2VL3 A;  5KN3 A;  3N5O A;  2MYG A;  4KCE A;  1WJK A;  3FZ9 A;  4TR0 A;  2CA8 A;  4JU5 A;  1YJ6 A;  1HNC A;  2KP1 A;  1Z9H A;  3PIN A;  4MF7 A;  1GLQ A;  1QXH A;  5ECL B;  4MP4 A;  4PX1 A;  4YQU A;  1JLW A;  1XPV A;  3VFI A;  2DMM A;  2TRC P;  2A2P A;  3P2A A;  1HD2 A;  5J9B A;  2FUG 2;  2PU9 C;  3RHC A;  2JZS A;  2C3N A;  1TW9 A;  2YWM A;  1EEM A;  1PKW A;  3H93 A;  2H1B A;  1PMT A;  2FA4 A;  2RII A;  3KIJ A;  5J4U A;  1Z6N A;  2LRN A;  4ZBB A;  3G7I A;  4JR4 A;  1DUG A;  1EV9 A;  3DEX A;  3VI5 A;  1A2M A;  2OE0 A;  3LEF A;  2GSQ A;  3M9K A;  4PUF C;  1XZO A;  2DSA A;  2ON7 A;  1ZYP A;  2G2Q A;  2ES7 A;  1MTC A;  1M9A A;  3KH9 A;  3EC3 A;  3HA9 A;  4WR4 A;  4BWS A;  4KF9 A;  4WF4 A;  3VK9 A;  2PPT A;  2V32 A;  4J56 E;  3CRT A;  4OFN A;  2VL2 A;  2R5G A;  1XWB A;  4EL1 A;  4V2L A;  1SYX A;  2PWJ A;  2VLV A;  1O73 A;  1I5G A;  5IO2 A;  2YV9 A;  3O3T A;  4CY8 A;  4PUA A;  4F03 A;  2HYX A;  4MDC A;  1GUH A;  2VLU A;  3M9J A;  4Q5F A;  2WB9 A;  3PR8 A;  5GSS A;  1G6Y A;  2R4V A;  1SU9 A;  2C0E A;  1T3B A;  1YZX A;  4E8E A;  5FWG A;  2H74 A;  3IDV A;  18GS A;  2LRC A;  3TRX A;  3D22 A;  3CTF A;  5EY6 A;  4KE3 A;  1X5E A;  5H5S A;  1XCC A;  3R2Q A;  4X0X A;  5ECN B;  3IAS 2;  1V9W A;  3LOR A;  4HJ2 A;  2E2M A;  4GQF A;  4WEY A;  1X9S B;  3UVT A;  4XIH A;  4ECJ A;  2IMI A;  2FY6 A;  5ENU A;  10GS A;  1PL2 A;  1OYJ A;  3HVX A;  2X8G A;  2MMA A;  3DVX A;  1PKZ A;  1K0O A;  5B6N A;  2C3Q A;  5FT3 A;  3KH7 A;  5DJL A;  4Z7X A;  4AF2 A;  4IJI A;  4CHS A;  2AYT A;  1U87 A;  2VL9 A;  5CYY A;  2LST A;  2NBS A;  3IA1 A;  4LL4 B;  1ERV A;  4ZL9 A;  2IPA A;  1B8X A;  6GSS A;  5IO0 A;  3VUR A;  2WUL A;  5CRH A;  2B7K A;  5IMF A;  4O5Q A;  1F2E A;  4G0I A;  4MJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...