1CQGA

High resolution solution nmr structure of mixed disulfide intermediate between human thioredoxin (c35a, c62a, c69a, c73a) mutant and a 13 residue peptide comprising its target site in human ref-1 (residues 59-71 of the p50 subunit of nfkb), nmr, 31 structures
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPAKMIKPFFHSLSEKYSNVIFLEVDVDDAQDVASEAEVKATPTFQFFKKGQKVGEFSGANKEKLEATINELV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (electron transport/peptide)
molecule keywords THIOREDOXIN
publication title The solution structure of human thioredoxin complexed with its target from Ref-1 reveals peptide chain reversal.
pubmed doi rcsb
source organism Homo sapiens
total genus 23
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1996-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1cqgA00
4ZB9A 1R5PA 1YKAA 1MTCA 4EDYA 1SL0B 2BJXA 2VOCA 5ID2A 4HQZA 1V58A 4KUNA 2LV3A 5KN2A 2B1LA 1IYIA 2H01A 2I1UA 3CTFA 4F2IA 2GSQA 3MDKA 4I2UA 5G31A 4XRDA 4XS1A 5F06A 1YF0A 3GL5A 3MWHA 3QAWA 1HNBA 3TRQA 1A0FA 2OBKA 5DALA 2HT9A 2MBSA 1GSUA 1T3BA 5C04A 2R3XA 1XFLA 4MJAA 2IMIA 4H86A 4DVCA 2R37A 2H76A 1DE1A 4OO5A 1V98A 3W6GA 2WCIA 5DAKA 2GTUA 5A5KA 1GTBA 3EURA 3HJPA 1U3IA 1AQWA 4DEJA 5DJMA 1GSFA 1MD4A 2HZEB 3FZ9A 3BCKA 5D9VA 2X64A 5B6NA 3BD2A 3F6FA 4MH2A 5A4UA 2CX4A 3IHQA 2WFCA 1HNCA 3J7Yk 4CW9A 2FD3A 3DD3A 5DQSA 2H72A 3TUEA 3KMOA 5J41A 1GL8A 1J0FA 4IP6A 1T4ZA 3HKRA 2AUVA 3WGDA 1M7TA 1SJIA 3H8QA 2E2MA 3FZ5A 4POLA 1JZRA 4HU9A 4K1FA 4X43A 3P7XA 4HJMA 4V1Ap 1R7HA 2VLVA 1TRSA 4MA9A 2GQKA 4TXVA 3PR8A 4RI7A 3A5WA 3AY8A 1VRSD 3F3QA 3TJJA 5G5FA 1OVNA 2GZPA 2CA8A 1XPVA 2ZCTA 5JWQB 4J2FA 5G5EA 3LYKA 2VCZA 4HU7A 2B6MA 3I6AA 4IP1A 2ES7A 3HA9A 4XS4A 4IJIA 13GSA 5EL8A 2IN3A 4PGTA 4KH7A 3G7JA 5CRHA 1Z6NA 2H0GA 5GZZB 1A24A 2CV4A 3ZIJA 5COHA 2LJRA 4WXTA 3HZ4A 2AJQB 4NXIA 3P2AA 1SKRB 2XBIA 2EIQA 2XBQA 1JLVA 4LL4B 4RI6A 1GNEA 3N9JA 3LORA 1TOFA 5CAXA 1K3LA 1ZMAA 2FWHA 5ECKB 4F82A 2GSSA 1TRUA 3L4NA 2IJYA 3S9FA 1F9MA 5A4WA 4L8EA 1THOA 4G10A 1TU7A 1J9BA 2H71A 2MZCA 1O8WA 3C71A 3TKRA 3GRXA 4XHMA 3E0UA 4AF2A 4Q5NA 4HZ4A 3A3TA 5ECPB 1X9MB 4NHZA 1S3CA 3ZVJA 1R4WA 1OC3A 5HR0A 2WJUA 2A4VA 1CQGA 4BVYA 2VO4A 3GKXA 1KTEA 1O85A 1URMA 3C8EA 3FZAA 4TN8A 4Q5FA 3NZNA 4ILFA 4WBJA 5EVOA 4KB3A 4ZILA 4YH2A 2DBCA 5JWRB 2HSHA 3A2VA 2B3SA 3GKNA 2XC2A 1SL2B 1XW9A 2YP6A 3LXZA 2GSTA 1O7UA 1USBA 4KGIA 4KA0A 2HFDA 4GTUA 3KM6A 2KP1A 4WR4A 1GTUA 3JCML 3IK9A 4KSOA 5AGYA 2QGVA 2RUEA 3DIEA 3O76A 2IMDA 3DVWA 1HNAA 1GUMA 1SJZA 1EGRA 1RW1A 2H1BA 2LSTA 3QFBC 2H8LA 2OE0A 1E2YA 2L6CA 4G2EA 2CVKA 3QFAC 1MD3A 1K0AA 1NW2A 3O3TA 4FH8A 4EKZA 4OFMA 4E8HA 3HY2A 3VWWA 2TIRA 4XTSA 3LG6A 3FY7A 5JWOB 3HHVA 3UJ1A 1BYEA 1JZWA 3N5OA 1PQNA 2DJ3A 4NV5A 2LRNA 2KUCA 4ZB8A 4DSSA 3IAM2 3ZZXA 3F4SA 4V2LA 1PL2A 4X1UA 2N5FA 1GSYA 3D21A 5ABRA 1ABAA 1H4OA 2LKUA 2DJJA 4K7IA 1YKCA 1SL1B 3US3A 1A23A 3FRCA 1AUCA 4JBBA 3KTBA 2OADA 1YQ1A 1XWGA 4ZXGA 3VWVA 1M2BA 4KCAA 1BQ7A 3G7IA 5DCHA 3FHKA 3VWXA 2VL2A 2FLSA 2CZ2A 4WEYA 4IQ1A 2F3MA 1PMTA 4MZBA 3GH6A 1VF1A 2PVQA 19GSA 1FVJA 3F0IA 4FIWA 1N2AA 4HI7A 1ILOA 1TRWA 3ZITA 4K7NA 1B9YC 1G0TA 5ECQB 1KNGA 1PGTA 2CQ9A 4WBRD 2FWFA 4GQCA 4ZB6A 2AV4A 2VIMA 5F05A 1TK0B 1ZZYA 4D73A 5J4UA 3CRUA 4L0UA 4TR3A 4O92A 5G2ZA 2C3NA 3TB2A 3FR9A 1Y25A 1VF2A 3F4TA 2QSIA 4BWQA 3CMIA 4BPYA 5D9WA 3UAPA 5ECLB 2OJLA 3ME8A 1WOUA 1ZL9A 1TDIA 3I9V2 4I97A 4LLRA 3C1RA 1GSDA 2MBTA 4AJ7A 5CRDA 1CQHA 2B7KA 4N30A 17GSA 4ZL9A 1PSQA 2F8FA 4EO3A 1PRXA 4MH3A 2C4JA 3D22A 3Q19A 3MAKA 3ZYWA 1WE0A 1U87A 1WJKA 3EINA 3ERWA 1XWKA 4NPBA 4JR4A 2DJ2A 3ED3A 1X9SB 5IO0A 4TXOB 2IPAA 4BA7A 1A2LA 1IYHA 3APQA 4F0CA 2X8CA 2VCXA 4K2DA 1PX7A 5F8BA 3FW2A 3DKSA 4Q5QA 2L4CA 1SK1A 1DUGA 3TDGA 2J9HA 5GAND 2VCVA 2DIYA 4JU5A 3LJRA 2C3TA 1V40A 3TGZA 2OA7A 3GNJA 3KEBA 3VI5A 1FW1A 2H66A 5FT3A 2H6YA 2YV7A 2YZUA 2LNSA 1PKWA 3GHAA 1ERUA 4GLTA 4K7OA 2C0DA 2NTOA 1JFUA 2H0IA 2QC7A 4XCSA 5ECMB 2H73A 1FHEA 1PX6A 4GQFA 1TK5B 1YJ6A 3UMAA 4JR6A 3DXBA 6GSYA 3HCZA 3TKSA 1HD2A 2WRTA 1VF4A 1X0RA 2I9HA 5IMCA 2VD1A 3UIWA 2R4VA 1G6YA 1YY7A 2K8SA 1Z3EA 4HJ2A 3TCOA 1ZYQB 3LSZA 3GIXA 3TJGA 1LJRA 5ECSA 4KDXA 4GCIA 2PUKC 1DSBA 3F4RA 2LRTA 1GLPA 3F3RA 3RAZA 1K3OA 3L9UA 1F37A 3L9VA 3D0ZA 3FR6A 5EY6A 7GSSA 2YJHA 4QL7A 4POBA 1TTZA 2ZUPA 3H4KA 2C3QA 2O87A 3W8JA 2LTKA 1EEMA 3Q74A 2NVLA 3QAGA 1X9WB 3GV1A 3TOUA 4K9ZA 5E59A 2FA8A 2O85A 5IOWA 4O5RA 1UVZA 4POKA 3M9KA 1FG4A 2FWGA 2FCHA 2PGTA 1B9XC 5B6MA 2JU5A 1AQVA 1QQ2A 3APOA 5ECHB 1X5DA 4RQXA 3IK7A 1WIKA 4RUVA 5H5SA 5L71A 3E9JB 5DBQA 4NWYA 1QXHA 5CNWA 4EVMA 3LEFA 4MJEA 1NHOA 3FR3A 3GKMA 2AHEA 1M0UA 3GFKA 2H1AA 4ZL8A 5J5NA 2KHPA 3LXTA 1G7OA 1NSWA 4QL9A 1QUWA 2WULA 3ZMLA 4XRAA 2E0QA 3TKSE 1BX9A 1EV4A 4MF7A 2HLSA 1O73A 2GQMA 1TP9A 3KH7A 2B1KA 3VK9A 1Q98A 2H0HA 2VCQA 2FUG2 4GSTA 2CVBA 2B5YA 4TR1B 3M3MA 4WETA 3ZFLA 2X8HA 2L59A 5LD0A 2H19A 2WS2A 1DE2A 1KEBA 5CO3A 1FVKA 2N5BA 1WMJA 2A2RA 4V2MA 2X8GA 1YZXA 3I69A 2GT6A 4IVFA 3DVXA 2Z9SA 1QFNA 5LCZA 4MZCA 4ECBA 5F07A 4IQAA 3J7Yb 4F9ZA 5CYYA 4YAVA 2LS5A 9GSSA 1T7PB 3G7YA 4MPFA 2YPMA 4TOPA 3ZTLA 4OWYA 5AN1A 2LJAA 3FKFA 1WPIA 3QD9A 1Z7PA 4EXJA 2I4AA 2J23A 2VCTA 3GL3A 2CAQA 3ZFBA 3GSSA 2JZSA 2TRCP 2L5LA 4ZIJA 2HZEA 3RHCA 2BMXA 2DLXA 4ZBBA 3KTLA 4MK3A 1PA3A 1XBSA 3GYKA 5JCWA 4PNFA 2WB9A 3M0FA 2P5QA 5IM9A 1K0BA 3C7MA 3KZQA 4EF0A 5IMZA 4N10A 2JZTA 2L6DA 1OC9B 3GN3A 2BTOT 3GX0A 2P31A 4MJCA 1G6WA 2MMAA 5ENUA 5J3RA 2LJKA 4EE0A 3LGCA 3SWLA 1MEKA 4HDEA 3EYTA 3QMXA 1DBYA 2OKAA 1YEPA 1B48A 1U6TA 3BCIA 4HOJA 4N0ZA 2VD0A 2KP2A 1TJDA 2VLUA 5GSTA 5B8BA 10GSA 1RK4A 1S3DA 2R5GA 2OBIA 1MDJA 4POMA 3UL3A 2EIOA 2V6KA 3HXSA 1SKWB 2A2SA 2IWTA 3HVXA 2YOIA 2RUFA 1I5GA 3LQ7A 4TR4A 3ERGA 5D73A 2F9SA 3M9JA 1XCCA 5IQYA 4WR5A 3CSHA 5J9BA 3CRTA 3HVSA 1AQXA 3IDVA 3TKPA 1ZGNA 1YDKA 2L4QA 3OR5A 4JE1A 5IPGA 2K18A 1JHBA 2NDOA 1F3AA 1GSQA 3KJYA 1PL1A 2PN8A 1WWJA 2CAIA 2ON7A 2YWIA 4J57E 4IJ3A 1SK2A 5B7CA 2F8AA 3RBTA 3KP8A 4O7HA 4MF5A 3VURA 4ID0A 3TKQA 3WYWA 2DC5A 3TKSC 5J9CA 4AGSA 4I6XA 1F3BA 2YN1A 2RLIA 1EOGA 3RPPA 1QMVA 3EMXA 4EC0A 2O89A 4MDCA 2FHEA 5ECOB 1O6JA 3NOFA 3WT1A 3O6TA 4MP4A 3GTUB 5HR2A 4MLYA 1GLQA 4BWSA 2HE3A 2JACA 1FB0A 5D93A 2VAFA 1F6MC 2GGTA 1ERWA 4HUAA 2IFQB 3CBUA 1GSEA 3A2XA 1GTAA 3KGKA 4IS0A 3UVHA 2E7PA 1M9AA 1BEDA 3U5RE 2R6KA 2G2QA 3C1SA 2VM1A 22GSA 12GSA 4IW9A 6GSUA 1OYJA 4N11A 5ID2B 2RM5A 1A2JA 1ERTA 1OAZA 3UVTA 1EGOA 2GT5A 2OE1A 2ALBA 2VM2A 2PERA 5HR3A 4AJ8A 6GSXA 3TOTA 2LRCA 1SD8A 1SD9A 2YCDA 5ECNB 2EC4A 1M2AA 3WGXA 2FNOA 5DCGA 4ECIA 5DALB 3EWLA 3IC4A 2VL3A 3QOUA 1TXXA 2YWNA 3KCMA 3DEXA 2GQLA 4FYCA 4I5QA 4V2NA 1ACVA 5DAKB 1OKDA 3D6IA 4XIHA 3TRPA 5IMDA 4I2TA 3D5JA 1F2EA 4PX1A 2DMLA 1XIYA 2C0FA 3UBKA 4DSRA 5B8AA 5IOXA 4KSMA 4ZBDA 2CX3A 4HS1A 2HZFA 4OMVA 5G1KA 2CZ3A 3CYNA 4L5LA 5HFGA 3GKKA 1GUKA 2AB6A 2LEGA 1A2MA 1XVWA 3MNGA 3VFIA 3ZL5A 1EP7A 1O81A 3BBYA 3F63A 3V1WA 3WD6A 1B4PA 3ERFA 1BAYA 3G9BA 3BJ5A 1M2DA 2TRXA 4HQSA 2V2GA 2FY6A 2PMTA 2OACA 1V57A 1JZOA 3IA1A 4GWRA 5GAPD 1FB6A 3VI7A 2YZHA 2HYXA 4Z7XA 4KX4A 4PQHA 3ZREA 1V9WA 3GMFA 2ON5A 4GF0A 4IN0A 5F0GA 1SU9A 5AIXA 2O7KA 3R2QA 3L0HA 4KE3A 2DMMA 4MF6A 3LWAA 3HJOA 2HNLA 1T00A 4OFNA 3FEUA 1E6BA 1B4QA 5IIZA 2G0FA 2IL3A 3H93A 3IRAA 1SYRA 3LFLA 2KOKA 1TI3A 1K0MA 1LBKA 1Z5YE 2DJKA 5HFIA 1TW9A 4CDOA 3PH9A 4XS4B 3VLNA 2EIRA 4NHWA 2DJ0A 2DSAA 1EWXA 4Q5RA 2PPTA 1BG5A 2R2JA 1PKZA 4TKYA 2HRNA 3ZVJD 3IOSA 14GSA 1AIUA 3H1NA 3KIJA 5JCGA 5LNKe 8GSSA 1B8XA 1O8XA 1GRXA 2XPDA 3HZ8A 5KN0A 1ZOFA 4OO4A 4K0GA 2DJ1A 2H70A 4OCFA 4YQUA 4KDYA 4RQRA 5CREA 5EPFA 4E8EA 1W4VA 5KN3A 1MDIA 5IO2A 3IXRA 3APSA 1AXDA 2I3YA 1XVQA 1Z9HA 2FGXA 3Q18A 4N0VA 1FOVA 2PWJA 1K3YA 4K0NA 3TJFA 4MPGA 3TJBA 6GSWA 1Z6MA 1GH2A 1NM3A 1AC1A 4KCEA 4V1Ag 1UN2A 3CTGA 2C80A 1M9BA 1TK8B 5E4WA 4BVXA 5IPHA 6GSVA 3HVVA 4ML1A 1K0CA 3UBLA 1X5EA 4MCUA 1THXA 2VLTA 1R26A 4EL1A 3F8UA 4YQVA 3DRNA 3RPNA 18GSA 4TXOA 3HDCA 1EEJA 1GTIA 1XWAA 1ERVA 3I43A 5CRWA 3FK8A 4TR0A 4XS6A 3TJKA 4F03A 4MZWA 2LQOA 1M99A 4FYBA 3CSIA 3H79A 2PU9C 3D4TA 1A8YA 4HEA2 2CVDA 1FO5A 2P0GA 4GRFA 1N8JA 2VL2C 3UARA 2H75A 3GUSA 3EMPA 2E2GA 1JLWA 1YF1A 2M80A 1Y6EA 1I9DA 2M72A 3UOMA 2I81A 2KLXA 5A4VA 3RDWA 6GSSA 1VF3A 3TRXA 1JZDA 3RHBA 2HRFA 1UC7A 1HYUA 2FWEA 1J08A 4YQMA 3ME7A 2C8UA 5IMVA 2V6OA 4ECJA 4JZQA 3SBCA 4GXZA 4EUYA 2RIIA 1ST9A 4ML6A 3QCPA 1ZYEA 1GSSA 5CP1A 1AW9A 3L78A 2L5OA 4PQ1A 2JSYA 4DSSB 4ECCA 2QKEA 2HSYA 2GZYA 4WF5A 2IIYA 3ZLPA 1U88A 1NHYA 1AAZA 1Q4JA 3IE3A 5ELGA 1SENA 3VPQA 1QK8A 4NAXA 3HJMA 5DJLA 4LL1B 4OD7A 3F9UA 3EC3A 3MSZA 4PXOA 2HI7A 1GUHA 2LNTA 2WZ9A 4GSNA 3W8SA 2M46A 3FYGA 1C72A 3GSTA 1EP8A 5DDLA 1EOHA 4LMWA 5IMAA 3VWUA 4KDUA 3M8NA 3L9SA 3HYPA 5C00A 4MMMA 1YEXA 4G19A 4PUFC 5KN1A 1HQOA 1ON4A 4I8BA 1FAAA 4K6XA 5KEJA 1KBNA 2NPBA 1OE7A 5IMFA 5INYA 2GS3A 16GSA 4K8MA 3DGQA 3KMNA 1OC8A 2MMNA 3QR6A 4L5OA 1X5CA 5DVBA 6GSTA 2YNXA 5AISA 5ECRB 5D9XA 4D73B 2YANA 1TI1A 2YJ7A 3DMLA 1XW5A 2H1GA 5DQYA 11GSA 2LUSA 4OCEA 1BJXA 2OE3A 1ZCPA 1XWCA 4TR1A 2YWMA 3ZMKA 2PBJA 2V41A 2IMEA 2GDRA 1RQMA 1U3AA 1OE8A 5H5QA 2JZRA 4PUAA 4AJ6A 5G30A 3Q6OA 1TU8A 2GZZA 3M1GA 1WP0A 5D96A 1WRYA 2X99A 5H5RA 2XHFA 4NV2A 4ZBAA 2V32A 1OKTA 2H74A 4HZ2A 4L0WA 2B5EA 4TRXA 1Z7RA 2DIZA 2V1MA 3IV4A 4TVEA 4ULXA 1K0DA 5HR1A 3WGEA 4FO5A 2REMA 2IMKA 2MMOA 1ML6A 2C0GA 1LU4A 4IGJA 2MMZA 5FWGA 3PGTA 4NMUA 1XZOA 1TRVA 3P90A 1XOBA 4PQIA 2JSZA 2JADA 4JEDA 4MABA 1T8EB 4F0BA 3DWVA 4CHSA 1PD21 2K8VA 2B7JA 3QDNA 2RM6A 2YWOA 1K0NA 2VUPA 3CSJA 2MYGA 2K6VA 1H75A 5AIVA 1GULA 2VCWA 4EDZA 3CXGA 4KW6A 4LMVA 4PURA 1UA5A 1SKSB 3KD0A 3ZIVA 1OC9A 3GH9A 3NIVA 2C0EA 2H30A 3EU3A 3UEMA 1GWCA 4YAPA 4IBPA 3EE2A 4IKHA 2NBSA 2WGRA 2F51A 4GSSA 2CT6A 1GNWA 1S3AA 4J56E 4IELA 2JL4A 1EV9A 1XW6A 3WT2A 3LYPA 3DYRA 1V2AA 5G1LA 1EZKA 3EVIA 4ISDA 5ECIB 3PINA 4PNGA 2O8VB 2GVPA 2K9FA 3C73A 4MJBA 4DSQA 3VPTA 5ELAA 4JRRA 4P3YB 4O32A 1K0OA 2GLRA 1MDKA 1VGLA 1T1VA 3P8WA 1XXUA 3E3EA 4BL7A 1A0RP 4OFTA 2WDUA 2YV9A 2P5RA 2C1YA 3IBHA 1SYXA 3FZ4A 3ISOA 1QGVA 5D9TA 1A8LA 4WF4A 2LQQA 5D8IA 2H1DA 3GX8A 1TKDB 2D2ZA 5GSSA 2XPEA 2H6ZA 2VL9A 4X0XA 4ACSA 3HD5A 5JCUA 3KH9A 4KAEA 2N5AA 20GSA 4ZL7A 1GP1A 2B5XA 2H6XA 4QQ7A 4WKWA 3F6DA 4IHUA 2IMFA 3GURA 1PN9A 5HFKA 1R5AA 5FHIA 3U6VA 3KXOA 5CRGA 3QPMA 1T4YA 1G7EA 1SK0A 2ZNMA 3IAS2 1W89A 4LA1A 4G9HA 3IR4A 1XOAA 4FYUA 3GTUA 1XWBA 3IPZA 3K8NA 1SJ6A 2AYTA 2FA4A 3BOAA 2IFQA 3QAVA 3ZRDA 2GSRA 3A2WA 4KNDA 4TW5A 2AAWA 2HXKA 2L57A 3EU4A 5HQPA 3GA4A 3D4MA 3KP9A 2PVOC
chains in the Genus database with same CATH superfamily
4ZB9A 1R5PA 1YKAA 1MTCA 4EDYA 1SL0B 2BJXA 2VOCA 5ID2A 4HQZA 1V58A 4KUNA 1M3JA 2DKHA 2LV3A 5KN2A 2B1LA 1IYIA 2H01A 2I1UA 3CTFA 4F2IA 2GSQA 3MDKA 4I2UA 5G31A 4XRDA 4XS1A 5F06A 1YF0A 3GL5A 3MWHA 3QAWA 1HNBA 3TRQA 1A0FA 2OBKA 5DALA 2HT9A 2MBSA 1GSUA 1T3BA 5C04A 2R3XA 1XFLA 4MJAA 2IMIA 4H86A 4DVCA 2R37A 2H76A 1DE1A 4OO5A 1V98A 2R0GA 3W6GA 2WCIA 5DAKA 4K5RA 2GTUA 5A5KA 1GTBA 3EURA 3HJPA 1U3IA 1AQWA 4DEJA 5DJMA 1GSFA 1MD4A 2HZEB 3FZ9A 3BCKA 5D9VA 2X64A 1XG8A 5B6NA 3BD2A 3F6FA 4MH2A 5A4UA 2CX4A 3IHQA 2WFCA 1HNCA 3J7Yk 4CW9A 2FD3A 3DD3A 5DQSA 2H72A 3TUEA 3KMOA 5J41A 1GL8A 1J0FA 4IP6A 1T4ZA 3HKRA 2AUVA 3WGDA 1M7TA 1SJIA 3H8QA 2E2MA 3FZ5A 4POLA 1JZRA 4HU9A 4K1FA 4X43A 3P7XA 4HJMA 4V1Ap 1R7HA 2VLVA 1TRSA 4MA9A 2GQKA 4TXVA 3PR8A 4RI7A 3A5WA 3AY8A 1VRSD 3F3QA 3TJJA 5G5FA 1OVNA 2GZPA 2CA8A 1XPVA 2ZCTA 5JWQB 4J2FA 5G5EA 3LYKA 2VCZA 4KF9A 4HU7A 2B6MA 3I6AA 4IP1A 2ES7A 3HA9A 4XS4A 4IJIA 13GSA 5EL8A 2IN3A 4PGTA 4KH7A 3G7JA 5CRHA 1Z6NA 2H0GA 5GZZB 1A24A 2CV4A 3ZIJA 5COHA 2LJRA 4WXTA 3HZ4A 2AJQB 2UZ8A 4NXIA 3P2AA 1SKRB 2XBIA 2EIQA 2XBQA 1JLVA 4LL4B 4RI6A 1GNEA 3N9JA 3LORA 1TOFA 5CAXA 1K3LA 1ZMAA 2FWHA 5ECKB 4F82A 2GSSA 1TRUA 3L4NA 2IJYA 3S9FA 1F9MA 5A4WA 4L8EA 1THOA 4G10A 1TU7A 1J9BA 2H71A 2MZCA 1O8WA 3C71A 3TKRA 3GRXA 4XHMA 3E0UA 4AF2A 4Q5NA 5BMUA 4HZ4A 3A3TA 5ECPB 1X9MB 4NHZA 1S3CA 3ZVJA 1R4WA 1OC3A 5HR0A 2WJUA 2A4VA 1CQGA 4BVYA 2VO4A 3GKXA 4G0IA 1KTEA 1O85A 1URMA 3C8EA 3FZAA 4TN8A 4Q5FA 3NZNA 4ILFA 4WBJA 5EVOA 4KB3A 4ZILA 4YH2A 2DBCA 5JWRB 2HSHA 3A2VA 2B3SA 3GKNA 2XC2A 1SL2B 1XW9A 2YP6A 3LXZA 2GSTA 1O7UA 1USBA 4KGIA 4KA0A 2HFDA 4GTUA 3KM6A 2KP1A 4WR4A 1GTUA 3JCML 3IK9A 3LW9A 4KSOA 5AGYA 2QGVA 2RUEA 3DIEA 3O76A 2IMDA 3DVWA 1HNAA 1GUMA 1SJZA 1EGRA 1RW1A 2H1BA 2LSTA 3QFBC 2H8LA 2OE0A 1E2YA 5KOXA 2L6CA 4G2EA 2CVKA 3QFAC 1MD3A 1K0AA 1NW2A 3O3TA 4FH8A 4EKZA 4OFMA 4Z2TA 4E8HA 3HY2A 3VWWA 2TIRA 4XTSA 3LG6A 3FY7A 5JWOB 3HHVA 3UJ1A 1BYEA 1JZWA 3N5OA 1PQNA 2DJ3A 4NV5A 2LRNA 2KUCA 4ZB8A 4DSSA 3IAM2 3ZZXA 3F4SA 4V2LA 1PL2A 4X1UA 2N5FA 1GSYA 3D21A 5ABRA 1ABAA 1H4OA 2LKUA 2DJJA 4K7IA 1YKCA 1SL1B 3US3A 1A23A 4EIQA 3FRCA 1AUCA 4JBBA 3KTBA 2OADA 1YQ1A 1XWGA 4ZXGA 3VWVA 1M2BA 4KCAA 1BQ7A 3G7IA 5DCHA 3FHKA 3VWXA 2VL2A 4K2XA 2FLSA 2CZ2A 4WEYA 4IQ1A 2F3MA 1PMTA 4MZBA 3GH6A 1VF1A 2PVQA 19GSA 1FVJA 3PPUA 3F0IA 4FIWA 1N2AA 4HI7A 1ILOA 4YKFA 1TRWA 3ZITA 4K7NA 1B9YC 1G0TA 5ECQB 1KNGA 1PGTA 2CQ9A 4WBRD 2FWFA 4GQCA 4ZB6A 2AV4A 2VIMA 5F05A 1TK0B 1ZZYA 4D73A 5J4UA 3CRUA 4L0UA 4TR3A 2X49A 4O92A 5G2ZA 2C3NA 3TB2A 4FQUA 3FR9A 1Y25A 1VF2A 3F4TA 2QSIA 4BWQA 3CMIA 4BPYA 5D9WA 3UAPA 5ECLB 2OJLA 3ME8A 1WOUA 4X4JA 1ZL9A 1TDIA 2QA2A 3I9V2 4I97A 4LLRA 3C1RA 1GSDA 2MBTA 4AJ7A 5CRDA 1CQHA 2B7KA 4N30A 17GSA 4ZL9A 1PSQA 2F8FA 4EO3A 2R0PA 4BVXB 1PRXA 4MH3A 2C4JA 3D22A 3Q19A 3MAKA 3ZYWA 1WE0A 1U87A 1WJKA 3EINA 3ERWA 1XWKA 4NPBA 4JR4A 2DJ2A 3ED3A 1X9SB 5IO0A 4TXOB 2IPAA 4BA7A 1A2LA 1IYHA 3APQA 4F0CA 2X8CA 2VCXA 4K2DA 1PX7A 5F8BA 3FW2A 3DKSA 4Q5QA 2L4CA 1SK1A 1DUGA 3TDGA 2J9HA 5GAND 2VCVA 2DIYA 4JU5A 3LJRA 2C3TA 1V40A 3TGZA 2OA7A 3GNJA 3KEBA 3VI5A 1FW1A 2H66A 5FT3A 2H6YA 2YV7A 2YZUA 2LNSA 1PKWA 3GHAA 1ERUA 4Z2UA 4GLTA 4K7OA 2C0DA 2NTOA 1JFUA 2H0IA 2QC7A 4XCSA 5ECMB 2H73A 1FHEA 3FMWA 1PX6A 4GQFA 3MIXA 1TK5B 1YJ6A 3UMAA 4JR6A 3DXBA 6GSYA 3HCZA 3TKSA 1HD2A 2WRTA 1VF4A 1X0RA 2I9HA 5IMCA 2VD1A 3UIWA 2R4VA 1G6YA 1YY7A 2K8SA 1Z3EA 4HJ2A 4MNNA 3TCOA 1ZYQB 3LSZA 3GIXA 3TJGA 1LJRA 5ECSA 4KDXA 4GCIA 2PUKC 1DSBA 4K5SA 4BIKA 3F4RA 4YKGA 2LRTA 1GLPA 3F3RA 3RAZA 1K3OA 3L9UA 1F37A 3L9VA 3D0ZA 3FR6A 5EY6A 7GSSA 2YJHA 4QL7A 4POBA 1TTZA 2ZUPA 3H4KA 2C3QA 2O87A 3W8JA 2LTKA 1EEMA 3Q74A 2NVLA 3QAGA 1X9WB 3GV1A 3IC8A 3TOUA 4K9ZA 4G0LA 5E59A 2FA8A 2O85A 5IOWA 4O5RA 1UVZA 4POKA 3M9KA 3A5IA 1FG4A 2FWGA 2FCHA 2PGTA 1B9XC 5B6MA 2JU5A 1AQVA 1QQ2A 3APOA 5ECHB 1X5DA 4CY8A 4RQXA 3IK7A 1WIKA 4RUVA 5H5SA 5L71A 3E9JB 5DBQA 4NWYA 1QXHA 5CNWA 4EVMA 3LEFA 1FOHA 4MJEA 1NHOA 3FR3A 3GKMA 2AHEA 1M0UA 3GFKA 2H1AA 4ZL8A 5J5NA 2KHPA 3LXTA 1G7OA 1NSWA 4QL9A 1QUWA 2WULA 3ZMLA 4XRAA 2E0QA 3TKSE 1BX9A 1EV4A 4MF7A 2HLSA 1O73A 2GQMA 1TP9A 3KH7A 2B1KA 3VK9A 1Q98A 2H0HA 2VCQA 2FUG2 4GSTA 2CVBA 2B5YA 4TR1B 3M3MA 4WETA 3ZFLA 2X8HA 2L59A 5LD0A 2H19A 2WS2A 1DE2A 1KEBA 5CO3A 1FVKA 2N5BA 1WMJA 2A2RA 4V2MA 2X8GA 1PN0A 1YZXA 3I69A 2GT6A 4IVFA 3DVXA 2Z9SA 1QFNA 5LCZA 4MZCA 4ECBA 5F07A 1ZYNA 4IQAA 3J7Yb 4F9ZA 5CYYA 4YAVA 2LS5A 9GSSA 1T7PB 3G7YA 4MPFA 2YPMA 4TOPA 3ZTLA 4OWYA 5AN1A 2LJAA 3FKFA 1WPIA 3QD9A 1Z7PA 4EXJA 2I4AA 2J23A 2VCTA 3GL3A 2CAQA 3ZFBA 3GSSA 2JZSA 2TRCP 2L5LA 4ZIJA 2HZEA 3RHCA 2BMXA 2DLXA 4ZBBA 3KTLA 4MK3A 1PA3A 1XBSA 3GYKA 5JCWA 4PNFA 2WB9A 3M0FA 2P5QA 5IM9A 1K0BA 3C7MA 3KZQA 4EF0A 5IMZA 4N10A 2HRKA 3EPTA 2JZTA 2L6DA 1OC9B 3GN3A 2BTOT 3GX0A 2P31A 4MJCA 1G6WA 2MMAA 5ENUA 5J3RA 2LJKA 4EE0A 3LGCA 3SWLA 1MEKA 4HDEA 3EYTA 3HVNA 3QMXA 1DBYA 2OKAA 1YEPA 1B48A 1U6TA 3BCIA 4HOJA 4N0ZA 2VD0A 2KP2A 1TJDA 2VLUA 5GSTA 5B8BA 10GSA 1RK4A 1S3DA 2R5GA 2OBIA 1MDJA 4POMA 3UL3A 2EIOA 2QA1A 2V6KA 3HXSA 1SKWB 2A2SA 2IWTA 3HVXA 2YOIA 2RUFA 1I5GA 3LQ7A 4TR4A 1PFOA 3ERGA 5D73A 2F9SA 3M9JA 1XCCA 5BRTA 5IQYA 4WR5A 3CSHA 5J9BA 3CRTA 4BL7B 3HVSA 1AQXA 3IDVA 4G0KA 3TKPA 1ZGNA 1YDKA 2L4QA 3OR5A 4JE1A 5IPGA 2K18A 1JHBA 2NDOA 1F3AA 1GSQA 3KJYA 1PL1A 2PN8A 1WWJA 2CAIA 2ON7A 2YWIA 4J57E 4IJ3A 1SK2A 5B7CA 2F8AA 3RBTA 3KP8A 4O7HA 4MF5A 3VURA 4ID0A 3TKQA 3WYWA 2DC5A 3TKSC 5J9CA 4AGSA 4I6XA 1F3BA 3MYDA 2YN1A 2RLIA 1EOGA 3RPPA 1QMVA 3EMXA 4EC0A 2O89A 4MDCA 2FHEA 5ECOB 1O6JA 3NOFA 3WT1A 3O6TA 4MP4A 3GTUB 5HR2A 4MLYA 1GLQA 4BWSA 2HE3A 2JACA 1FB0A 5D93A 2VAFA 1F6MC 2GGTA 1ERWA 4HUAA 2IFQB 3CBUA 1GSEA 3A2XA 1GTAA 3KGKA 4IS0A 3UVHA 2E7PA 1M9AA 1BEDA 3U5RE 2R6KA 2G2QA 3C1SA 2VM1A 22GSA 12GSA 4IW9A 6GSUA 1OYJA 4N11A 5ID2B 2RM5A 1A2JA 1ERTA 1OAZA 3UVTA 1EGOA 2GT5A 2OE1A 2ALBA 4HSCX 2VM2A 2PERA 5HR3A 4AJ8A 6GSXA 3TOTA 2LRCA 2DKIA 1SD8A 1SD9A 2YCDA 5ECNB 2EC4A 1M2AA 3WGXA 2FNOA 5DCGA 4ECIA 5DALB 3EWLA 3IC4A 2VL3A 3QOUA 4PTSA 1TXXA 2YWNA 3KCMA 3DEXA 2GQLA 4FYCA 4I5QA 4V2NA 1ACVA 5DAKB 1OKDA 3D6IA 4XIHA 3TRPA 5IMDA 4I2TA 3D5JA 1F2EA 4PX1A 2DMLA 1XIYA 2C0FA 3UBKA 4DSRA 5B8AA 5IOXA 4KSMA 4ZBDA 2CX3A 4HS1A 2HZFA 4OMVA 5G1KA 2CZ3A 3CYNA 4L5LA 5HFGA 3GKKA 1GUKA 2AB6A 2LEGA 1A2MA 1XVWA 3MNGA 3VFIA 3ZL5A 1EP7A 1O81A 3BBYA 3F63A 3V1WA 3WD6A 1B4PA 3ERFA 1BAYA 3G9BA 3BJ5A 1M2DA 2HRAA 2TRXA 4HQSA 2V2GA 2FY6A 2PMTA 2OACA 1V57A 1JZOA 3IA1A 4GWRA 5GAPD 1FB6A 3VI7A 2YZHA 2HYXA 4Z7XA 4KX4A 4PQHA 3ZREA 1V9WA 3GMFA 2ON5A 4GF0A 4IN0A 5F0GA 1SU9A 5AIXA 2O7KA 3R2QA 3L0HA 4KE3A 2DMMA 4MF6A 1M3IA 3LWAA 3HJOA 2HNLA 1T00A 4OFNA 3FEUA 1E6BA 1B4QA 3R3EA 5IIZA 2G0FA 2IL3A 3H93A 3IRAA 4O5QA 1SYRA 3LFLA 2KOKA 1TI3A 1K0MA 1LBKA 1Z5YE 2DJKA 5HFIA 1TW9A 4CDOA 3PH9A 4XS4B 3VLNA 2EIRA 4NHWA 2DJ0A 2DSAA 1EWXA 4Q5RA 2PPTA 1BG5A 2R2JA 1PKZA 4TKYA 2HRNA 3ZVJD 3IOSA 14GSA 1AIUA 3H1NA 3KIJA 5JCGA 5LNKe 8GSSA 1B8XA 1O8XA 1GRXA 2XPDA 3HZ8A 5KN0A 1ZOFA 4OO4A 4K0GA 2DJ1A 2H70A 4OCFA 4Z2RA 4YQUA 4KDYA 4RQRA 5CREA 5EPFA 4E8EA 1W4VA 5KN3A 1MDIA 5IO2A 3IXRA 3APSA 1AXDA 2I3YA 1XVQA 1Z9HA 2FGXA 3Q18A 4N0VA 1FOVA 2PWJA 1K3YA 4K0NA 3TJFA 4MPGA 3TJBA 6GSWA 1Z6MA 1GH2A 1NM3A 1AC1A 4KCEA 4V1Ag 1UN2A 3CTGA 2C80A 1M9BA 4ICYA 1TK8B 5E4WA 4BVXA 5IPHA 6GSVA 3HVVA 4ML1A 1K0CA 3UBLA 1X5EA 4MCUA 1THXA 2VLTA 1R26A 4EL1A 3F8UA 4BVYB 4YQVA 3DRNA 3RPNA 18GSA 4TXOA 3HDCA 1EEJA 1GTIA 1XWAA 4O5UA 1ERVA 3I43A 5CRWA 3FK8A 4TR0A 4XS6A 3TJKA 4F03A 4MZWA 2LQOA 1M99A 4FYBA 4EIPA 3CSIA 3H79A 2PU9C 3D4TA 1A8YA 4A5PA 4HEA2 2CVDA 1FO5A 2P0GA 4GRFA 2HSMA 5KOWA 1N8JA 2VL2C 3UARA 2H75A 3GUSA 3EMPA 2E2GA 1JLWA 1YF1A 2M80A 1Y6EA 1I9DA 2M72A 3UOMA 2I81A 2KLXA 5A4VA 3RDWA 6GSSA 1VF3A 3TRXA 1JZDA 3RHBA 2HRFA 1UC7A 1HYUA 2FWEA 1J08A 4YQMA 3ME7A 2C8UA 5IMVA 2V6OA 4ECJA 4JZQA 3SBCA 4GXZA 4EUYA 2RIIA 1ST9A 4ML6A 3QCPA 1ZYEA 1GSSA 5CP1A 1AW9A 3L78A 2L5OA 4PQ1A 2JSYA 4DSSB 4ECCA 2QKEA 2HSYA 2GZYA 4WF5A 2IIYA 3ZLPA 1U88A 1NHYA 1AAZA 1Q4JA 3IE3A 4USSA 5ELGA 1SENA 3VPQA 1QK8A 4NAXA 3HJMA 5DJLA 4LL1B 4OD7A 3F9UA 3EC3A 3MSZA 4CY6A 4PXOA 2HI7A 1GUHA 2LNTA 2WZ9A 4GSNA 3W8SA 2M46A 3FYGA 1C72A 3GSTA 1EP8A 5DDLA 1EOHA 4LMWA 5IMAA 3VWUA 4KDUA 3M8NA 3L9SA 3HYPA 5C00A 4MMMA 1YEXA 4G19A 4PUFC 1ZYPA 5KN1A 1HQOA 1ON4A 4I8BA 2A4HA 1FAAA 4K6XA 5KEJA 1KBNA 2NPBA 1OE7A 5IMFA 5INYA 2GS3A 16GSA 4K8MA 3DGQA 3KMNA 1OC8A 2MMNA 3QR6A 4L5OA 1X5CA 5DVBA 6GSTA 2YNXA 2A2PA 5AISA 5ECRB 5D9XA 4D73B 2YANA 1TI1A 2YJ7A 3DMLA 1XW5A 2H1GA 5DQYA 11GSA 2LUSA 4OCEA 1BJXA 2OE3A 1ZCPA 1XWCA 4TR1A 2YWMA 3ZMKA 2PBJA 2V41A 2IMEA 2GDRA 1RQMA 1U3AA 3CQFA 1OE8A 5H5QA 2JZRA 4PUAA 4AJ6A 5G30A 3Q6OA 1TU8A 2GZZA 3M1GA 1WP0A 5D96A 1WRYA 2X99A 5H5RA 2XHFA 4NV2A 4ZBAA 2V32A 1OKTA 2H74A 4HZ2A 4L0WA 2B5EA 4TRXA 1Z7RA 2DIZA 2V1MA 3IV4A 4TVEA 4ULXA 1S3RA 1K0DA 5HR1A 3WGEA 4FO5A 2REMA 2IMKA 2MMOA 1ML6A 2C0GA 1LU4A 4IGJA 2MMZA 5FWGA 3PGTA 4NMUA 1XZOA 1TRVA 3P90A 1XOBA 4PQIA 2JSZA 2JADA 4JEDA 4MABA 1T8EB 4F0BA 3DWVA 4CHSA 1PD21 2K8VA 2B7JA 3QDNA 2RM6A 2YWOA 1K0NA 2VUPA 3CSJA 2MYGA 2K6VA 1H75A 5AIVA 1GULA 2VCWA 4EDZA 3CXGA 4KW6A 4LMVA 4PURA 1UA5A 1SKSB 3IHGA 3KD0A 3ZIVA 1OC9A 3GH9A 3NIVA 2C0EA 2H30A 3EU3A 3UEMA 1GWCA 4YAPA 4IBPA 3EE2A 4IKHA 2NBSA 2WGRA 2F51A 4GSSA 2CT6A 1GNWA 1S3AA 4J56E 4IELA 2JL4A 1EV9A 1XW6A 3WT2A 3LYPA 3DYRA 1V2AA 5G1LA 1EZKA 3EVIA 4ISDA 5ECIB 3PINA 4PNGA 2O8VB 2GVPA 2K9FA 3C73A 4MJBA 4DSQA 3VPTA 5ELAA 4JRRA 4P3YB 4O32A 1K0OA 2GLRA 1MDKA 1VGLA 1T1VA 3P8WA 1XXUA 3E3EA 4BL7A 1A0RP 4OFTA 2WDUA 2YV9A 2P5RA 2C1YA 3IBHA 1SYXA 3FZ4A 3ISOA 1QGVA 5D9TA 1A8LA 4WF4A 2LQQA 5D8IA 2H1DA 3GX8A 1TKDB 2D2ZA 5GSSA 2XPEA 2H6ZA 2VL9A 4X0XA 4ACSA 3HD5A 5JCUA 3KH9A 4KAEA 2N5AA 20GSA 4ZL7A 1GP1A 2B5XA 2H6XA 4QQ7A 4WKWA 3F6DA 4IHUA 2IMFA 3GURA 1PN9A 5HFKA 1R5AA 5FHIA 3U6VA 3KXOA 5CRGA 3QPMA 1T4YA 1G7EA 1SK0A 2ZNMA 2R0CA 1W89A 2X4AA 3IAS2 4LA1A 4G9HA 3IR4A 1XOAA 4FYUA 3GTUA 1XWBA 3IPZA 3K8NA 1SJ6A 2AYTA 2FA4A 3BOAA 2IFQA 3QAVA 3ZRDA 2GSRA 3A2WA 4KNDA 4TW5A 2AAWA 2HXKA 2L57A 3EU4A 5HQPA 3GA4A 3D4MA 3KP9A 2PVOC
chains in the Genus database with same CATH topology
4ZB9A 1R5PA 1YKAA 1MTCA 4EDYA 1SL0B 2BJXA 2VOCA 5ID2A 4HQZA 1V58A 4KUNA 2DKHA 2LV3A 5KN2A 2B1LA 1IYIA 2H01A 2I1UA 3CTFA 4F2IA 2GSQA 3MDKA 4I2UA 5G31A 4XRDA 4XS1A 5F06A 1YF0A 3GL5A 3MWHA 3QAWA 1HNBA 3TRQA 1A0FA 2OBKA 5DALA 2HT9A 2MBSA 1GSUA 1T3BA 5C04A 2R3XA 1XFLA 4MJAA 2IMIA 4H86A 4DVCA 2R37A 2H76A 1DE1A 4OO5A 1V98A 2R0GA 3W6GA 2WCIA 5DAKA 4K5RA 2GTUA 5A5KA 1GTBA 3EURA 3HJPA 1U3IA 1AQWA 4DEJA 5DJMA 1GSFA 1MD4A 2HZEB 3FZ9A 3BCKA 5D9VA 2X64A 5B6NA 3BD2A 3F6FA 4MH2A 5A4UA 2CX4A 3IHQA 2WFCA 1HNCA 3J7Yk 4CW9A 2FD3A 3DD3A 5DQSA 2H72A 3TUEA 3KMOA 5J41A 1GL8A 1J0FA 4IP6A 1T4ZA 3HKRA 2AUVA 3WGDA 1M7TA 1SJIA 3H8QA 2E2MA 3FZ5A 4POLA 1JZRA 4HU9A 4K1FA 4X43A 3P7XA 4HJMA 4V1Ap 1R7HA 2VLVA 1TRSA 4MA9A 2GQKA 4TXVA 3PR8A 4RI7A 3A5WA 3AY8A 1VRSD 3F3QA 3TJJA 5G5FA 1OVNA 2GZPA 2CA8A 1XPVA 2ZCTA 5JWQB 4J2FA 5G5EA 3LYKA 2VCZA 4KF9A 4HU7A 2B6MA 3I6AA 4IP1A 2ES7A 3HA9A 4XS4A 4IJIA 13GSA 5EL8A 2IN3A 4PGTA 4KH7A 3G7JA 5CRHA 1Z6NA 2H0GA 5GZZB 1A24A 2CV4A 3ZIJA 5COHA 2LJRA 4WXTA 3HZ4A 2AJQB 2UZ8A 4NXIA 3P2AA 1SKRB 2XBIA 2EIQA 2XBQA 1JLVA 4LL4B 4RI6A 1GNEA 3N9JA 3LORA 1TOFA 5CAXA 1K3LA 1ZMAA 2FWHA 5ECKB 4F82A 2GSSA 1TRUA 3L4NA 2IJYA 3S9FA 1F9MA 5A4WA 4L8EA 1THOA 4G10A 1TU7A 1J9BA 2H71A 2MZCA 1O8WA 3C71A 3TKRA 3GRXA 4XHMA 3E0UA 4AF2A 4Q5NA 5BMUA 4HZ4A 3A3TA 5ECPB 1X9MB 4NHZA 1S3CA 3ZVJA 1R4WA 1OC3A 5HR0A 2WJUA 2A4VA 1CQGA 4BVYA 2VO4A 3GKXA 4G0IA 1KTEA 1O85A 1URMA 3C8EA 3FZAA 4TN8A 4Q5FA 3NZNA 4ILFA 4WBJA 5EVOA 4KB3A 4ZILA 4YH2A 2DBCA 5JWRB 2HSHA 3A2VA 2B3SA 3GKNA 2XC2A 1SL2B 1XW9A 2YP6A 3LXZA 2GSTA 1O7UA 1USBA 4KGIA 4KA0A 2HFDA 4GTUA 3KM6A 2KP1A 4WR4A 1GTUA 3JCML 3IK9A 3LW9A 4KSOA 5AGYA 2QGVA 2RUEA 3DIEA 3O76A 2IMDA 3DVWA 1HNAA 1GUMA 1SJZA 1EGRA 1RW1A 2H1BA 2LSTA 3QFBC 2H8LA 2OE0A 1E2YA 5KOXA 2L6CA 4G2EA 2CVKA 3QFAC 1MD3A 1K0AA 1NW2A 3O3TA 4FH8A 4EKZA 4OFMA 4Z2TA 4E8HA 3HY2A 3VWWA 2TIRA 4XTSA 3LG6A 3FY7A 5JWOB 3HHVA 3UJ1A 1BYEA 1JZWA 3N5OA 1PQNA 2DJ3A 4NV5A 2LRNA 2KUCA 4ZB8A 4DSSA 3IAM2 3ZZXA 3F4SA 4V2LA 1PL2A 4X1UA 2N5FA 1GSYA 3D21A 5ABRA 1ABAA 1H4OA 2LKUA 2DJJA 4K7IA 1YKCA 1SL1B 3US3A 1A23A 4EIQA 3FRCA 1AUCA 4JBBA 3KTBA 2OADA 1YQ1A 1XWGA 4ZXGA 3VWVA 1M2BA 4KCAA 1BQ7A 3G7IA 5DCHA 3FHKA 3VWXA 2VL2A 4K2XA 2FLSA 2CZ2A 4WEYA 4IQ1A 2F3MA 1PMTA 4MZBA 3GH6A 1VF1A 2PVQA 19GSA 1FVJA 3PPUA 3F0IA 4FIWA 1N2AA 4HI7A 1ILOA 4YKFA 1TRWA 3ZITA 4K7NA 1B9YC 1G0TA 5ECQB 1KNGA 1PGTA 2CQ9A 4WBRD 2FWFA 4GQCA 4ZB6A 2AV4A 2VIMA 5F05A 1TK0B 1ZZYA 4D73A 5J4UA 3CRUA 4L0UA 4TR3A 2X49A 4O92A 5G2ZA 2C3NA 3TB2A 4FQUA 3FR9A 1Y25A 1VF2A 3F4TA 2QSIA 4BWQA 3CMIA 4BPYA 5D9WA 3UAPA 5ECLB 2OJLA 3ME8A 1WOUA 4X4JA 1ZL9A 1TDIA 2QA2A 3I9V2 4I97A 4LLRA 3C1RA 1GSDA 2MBTA 4AJ7A 5CRDA 1CQHA 2B7KA 4N30A 17GSA 4ZL9A 1PSQA 2F8FA 4EO3A 2R0PA 4BVXB 1PRXA 4MH3A 2C4JA 3D22A 3Q19A 3MAKA 3ZYWA 1WE0A 1U87A 1WJKA 3EINA 3ERWA 1XWKA 4NPBA 4JR4A 2DJ2A 3ED3A 1X9SB 5IO0A 4TXOB 2IPAA 4BA7A 1A2LA 1IYHA 3APQA 4F0CA 2X8CA 2VCXA 4K2DA 1PX7A 5F8BA 3FW2A 3DKSA 4Q5QA 2L4CA 1SK1A 1DUGA 3TDGA 2J9HA 5GAND 2VCVA 2DIYA 4JU5A 3LJRA 2C3TA 1V40A 3TGZA 2OA7A 3GNJA 3KEBA 3VI5A 1FW1A 2H66A 5FT3A 2H6YA 2YV7A 2YZUA 2LNSA 1PKWA 3GHAA 1ERUA 4Z2UA 4GLTA 4K7OA 2C0DA 2NTOA 1JFUA 2H0IA 2QC7A 4XCSA 5ECMB 2H73A 1FHEA 3FMWA 1PX6A 4GQFA 3MIXA 1TK5B 1YJ6A 3UMAA 4JR6A 3DXBA 6GSYA 3HCZA 3TKSA 1HD2A 2WRTA 1VF4A 1X0RA 2I9HA 5IMCA 2VD1A 3UIWA 2R4VA 1G6YA 1YY7A 2K8SA 1Z3EA 4HJ2A 4MNNA 3TCOA 1ZYQB 3LSZA 3GIXA 3TJGA 1LJRA 5ECSA 4KDXA 4GCIA 2PUKC 1DSBA 4K5SA 3F4RA 4YKGA 2LRTA 1GLPA 3F3RA 3RAZA 1K3OA 3L9UA 1F37A 3L9VA 3D0ZA 3FR6A 5EY6A 7GSSA 2YJHA 4QL7A 4POBA 1TTZA 2ZUPA 3H4KA 2C3QA 2O87A 3W8JA 2LTKA 1EEMA 3Q74A 2NVLA 3QAGA 1X9WB 3GV1A 3IC8A 3TOUA 4K9ZA 4G0LA 5E59A 2FA8A 2O85A 5IOWA 4O5RA 1UVZA 4POKA 3M9KA 3A5IA 1FG4A 2FWGA 2FCHA 2PGTA 1B9XC 5B6MA 2JU5A 1AQVA 1QQ2A 3APOA 5ECHB 1X5DA 4CY8A 4RQXA 3IK7A 1WIKA 4RUVA 5H5SA 5L71A 3E9JB 5DBQA 4NWYA 1QXHA 5CNWA 4EVMA 3LEFA 1FOHA 4MJEA 1NHOA 3FR3A 3GKMA 2AHEA 1M0UA 3GFKA 2H1AA 4ZL8A 5J5NA 2KHPA 3LXTA 1G7OA 1NSWA 4QL9A 1QUWA 2WULA 3ZMLA 4XRAA 2E0QA 3TKSE 1BX9A 1EV4A 4MF7A 2HLSA 1O73A 2GQMA 1TP9A 3KH7A 2B1KA 3VK9A 1Q98A 2H0HA 2VCQA 2FUG2 4GSTA 2CVBA 2B5YA 4TR1B 3M3MA 4WETA 3ZFLA 2X8HA 2L59A 5LD0A 2H19A 2WS2A 1DE2A 1KEBA 5CO3A 1FVKA 2N5BA 1WMJA 2A2RA 4V2MA 2X8GA 1PN0A 1YZXA 3I69A 2GT6A 4IVFA 3DVXA 2Z9SA 1QFNA 5LCZA 4MZCA 4ECBA 5F07A 1ZYNA 4IQAA 3J7Yb 4F9ZA 5CYYA 4YAVA 2LS5A 9GSSA 1T7PB 3G7YA 4MPFA 2YPMA 4TOPA 3ZTLA 4OWYA 5AN1A 2LJAA 3FKFA 1WPIA 3QD9A 1Z7PA 4EXJA 2I4AA 2J23A 2VCTA 3GL3A 2CAQA 3ZFBA 3GSSA 2JZSA 2TRCP 2L5LA 4ZIJA 2HZEA 3RHCA 2BMXA 2DLXA 4ZBBA 3KTLA 4MK3A 1PA3A 1XBSA 3GYKA 5JCWA 4PNFA 2WB9A 3M0FA 2P5QA 5IM9A 1K0BA 3C7MA 3KZQA 4EF0A 5IMZA 4N10A 2HRKA 3EPTA 2JZTA 2L6DA 1OC9B 3GN3A 2BTOT 3GX0A 2P31A 4MJCA 1G6WA 2MMAA 5ENUA 5J3RA 2LJKA 4EE0A 3LGCA 3SWLA 1MEKA 4HDEA 3EYTA 3QMXA 1DBYA 2OKAA 1YEPA 1B48A 1U6TA 3BCIA 4HOJA 4N0ZA 2VD0A 2KP2A 1TJDA 2VLUA 5GSTA 5B8BA 10GSA 1RK4A 1S3DA 2R5GA 2OBIA 1MDJA 4POMA 3UL3A 2EIOA 2QA1A 2V6KA 3HXSA 1SKWB 2A2SA 2IWTA 3HVXA 2YOIA 2RUFA 1I5GA 3LQ7A 4TR4A 3ERGA 5D73A 2F9SA 3M9JA 1XCCA 5BRTA 5IQYA 4WR5A 3CSHA 5J9BA 3CRTA 4BL7B 3HVSA 1AQXA 3IDVA 4G0KA 3TKPA 1ZGNA 1YDKA 2L4QA 3OR5A 4JE1A 5IPGA 2K18A 1JHBA 2NDOA 1F3AA 1GSQA 3KJYA 1PL1A 2PN8A 1WWJA 2CAIA 2ON7A 2YWIA 4J57E 4IJ3A 1SK2A 5B7CA 2F8AA 3RBTA 3KP8A 4O7HA 4MF5A 3VURA 4ID0A 3TKQA 3WYWA 2DC5A 3TKSC 5J9CA 4AGSA 4I6XA 1F3BA 3MYDA 2YN1A 2RLIA 1EOGA 3RPPA 1QMVA 3EMXA 4EC0A 2O89A 4MDCA 2FHEA 5ECOB 1O6JA 3NOFA 3WT1A 3O6TA 4MP4A 3GTUB 5HR2A 4MLYA 1GLQA 4BWSA 2HE3A 2JACA 1FB0A 5D93A 2VAFA 1F6MC 2GGTA 1ERWA 4HUAA 2IFQB 3CBUA 1GSEA 3A2XA 1GTAA 3KGKA 4IS0A 3UVHA 2E7PA 1M9AA 1BEDA 3U5RE 2R6KA 2G2QA 3C1SA 2VM1A 22GSA 12GSA 4IW9A 6GSUA 1OYJA 4N11A 5ID2B 2RM5A 1A2JA 1ERTA 1OAZA 3UVTA 1EGOA 2GT5A 2OE1A 2ALBA 2VM2A 2PERA 5HR3A 4AJ8A 6GSXA 3TOTA 2LRCA 2DKIA 1SD8A 1SD9A 2YCDA 5ECNB 2EC4A 1M2AA 3WGXA 2FNOA 5DCGA 4ECIA 5DALB 3EWLA 3IC4A 2VL3A 3QOUA 4PTSA 1TXXA 2YWNA 3KCMA 3DEXA 2GQLA 4FYCA 4I5QA 4V2NA 1ACVA 5DAKB 1OKDA 3D6IA 4XIHA 3TRPA 5IMDA 4I2TA 3D5JA 1F2EA 4PX1A 2DMLA 1XIYA 2C0FA 3UBKA 4DSRA 5B8AA 5IOXA 4KSMA 4ZBDA 2CX3A 4HS1A 2HZFA 4OMVA 5G1KA 2CZ3A 3CYNA 4L5LA 5HFGA 3GKKA 1GUKA 2AB6A 2LEGA 1A2MA 1XVWA 3MNGA 3VFIA 3ZL5A 1EP7A 1O81A 3BBYA 3F63A 3V1WA 3WD6A 1B4PA 3ERFA 1BAYA 3G9BA 3BJ5A 1M2DA 2HRAA 2TRXA 4HQSA 2V2GA 2FY6A 2PMTA 2OACA 1V57A 1JZOA 3IA1A 4GWRA 5GAPD 1FB6A 3VI7A 2YZHA 2HYXA 4Z7XA 4KX4A 4PQHA 3ZREA 1V9WA 3GMFA 2ON5A 4GF0A 4IN0A 5F0GA 1SU9A 5AIXA 2O7KA 3R2QA 3L0HA 4KE3A 2DMMA 4MF6A 3LWAA 3HJOA 2HNLA 1T00A 4OFNA 3FEUA 1E6BA 1B4QA 3R3EA 5IIZA 2G0FA 2IL3A 3H93A 3IRAA 4O5QA 1SYRA 3LFLA 2KOKA 1TI3A 1K0MA 1LBKA 1Z5YE 2DJKA 5HFIA 1TW9A 4CDOA 3PH9A 4XS4B 3VLNA 2EIRA 4NHWA 2DJ0A 2DSAA 1EWXA 4Q5RA 2PPTA 1BG5A 2R2JA 1PKZA 4TKYA 2HRNA 3ZVJD 3IOSA 14GSA 1AIUA 3H1NA 3KIJA 5JCGA 5LNKe 8GSSA 1B8XA 1O8XA 1GRXA 2XPDA 3HZ8A 5KN0A 1ZOFA 4OO4A 4K0GA 2DJ1A 2H70A 4OCFA 4Z2RA 4YQUA 4KDYA 4RQRA 5CREA 5EPFA 4E8EA 1W4VA 5KN3A 1MDIA 5IO2A 3IXRA 3APSA 1AXDA 2I3YA 1XVQA 1Z9HA 2FGXA 3Q18A 4N0VA 1FOVA 2PWJA 1K3YA 4K0NA 3TJFA 4MPGA 3TJBA 6GSWA 1Z6MA 1GH2A 1NM3A 1AC1A 4KCEA 4V1Ag 1UN2A 3CTGA 2C80A 1M9BA 4ICYA 1TK8B 5E4WA 4BVXA 5IPHA 6GSVA 3HVVA 4ML1A 1K0CA 3UBLA 1X5EA 4MCUA 1THXA 2VLTA 1R26A 4EL1A 3F8UA 4BVYB 4YQVA 3DRNA 3RPNA 18GSA 4TXOA 3HDCA 1EEJA 1GTIA 1XWAA 4O5UA 1ERVA 3I43A 5CRWA 3FK8A 4TR0A 4XS6A 3TJKA 4F03A 4MZWA 2LQOA 1M99A 4FYBA 4EIPA 3CSIA 3H79A 2PU9C 3D4TA 1A8YA 4A5PA 4HEA2 2CVDA 1FO5A 2P0GA 4GRFA 2HSMA 5KOWA 1N8JA 2VL2C 3UARA 2H75A 3GUSA 3EMPA 2E2GA 1JLWA 1YF1A 2M80A 1Y6EA 1I9DA 2M72A 3UOMA 2I81A 2KLXA 5A4VA 3RDWA 6GSSA 1VF3A 3TRXA 1JZDA 3RHBA 2HRFA 1UC7A 1HYUA 2FWEA 1J08A 4YQMA 3ME7A 2C8UA 5IMVA 2V6OA 4ECJA 4JZQA 3SBCA 4GXZA 4EUYA 2RIIA 1ST9A 4ML6A 3QCPA 1ZYEA 1GSSA 5CP1A 1AW9A 3L78A 2L5OA 4PQ1A 2JSYA 4DSSB 4ECCA 2QKEA 2HSYA 2GZYA 4WF5A 2IIYA 3ZLPA 1U88A 1NHYA 1AAZA 1Q4JA 3IE3A 4USSA 5ELGA 1SENA 3VPQA 1QK8A 4NAXA 3HJMA 5DJLA 4LL1B 4OD7A 3F9UA 3EC3A 3MSZA 4CY6A 4PXOA 2HI7A 1GUHA 2LNTA 2WZ9A 4GSNA 3W8SA 2M46A 3FYGA 1C72A 3GSTA 1EP8A 5DDLA 1EOHA 4LMWA 5IMAA 3VWUA 4KDUA 3M8NA 3L9SA 3HYPA 5C00A 4MMMA 1YEXA 4G19A 4PUFC 1ZYPA 5KN1A 1HQOA 1ON4A 4I8BA 2A4HA 1FAAA 4K6XA 5KEJA 1KBNA 2NPBA 1OE7A 5IMFA 5INYA 2GS3A 16GSA 4K8MA 3DGQA 3KMNA 1OC8A 2MMNA 3QR6A 4L5OA 1X5CA 5DVBA 6GSTA 2YNXA 2A2PA 5AISA 5ECRB 5D9XA 4D73B 2YANA 1TI1A 2YJ7A 3DMLA 1XW5A 2H1GA 5DQYA 11GSA 2LUSA 4OCEA 1BJXA 2OE3A 1ZCPA 1XWCA 4TR1A 2YWMA 3ZMKA 2PBJA 2V41A 2IMEA 2GDRA 1RQMA 1U3AA 1OE8A 5H5QA 2JZRA 4PUAA 4AJ6A 5G30A 3Q6OA 1TU8A 2GZZA 3M1GA 1WP0A 5D96A 1WRYA 2X99A 5H5RA 2XHFA 4NV2A 4ZBAA 2V32A 1OKTA 2H74A 4HZ2A 4L0WA 2B5EA 4TRXA 1Z7RA 2DIZA 2V1MA 3IV4A 4TVEA 4ULXA 1K0DA 5HR1A 3WGEA 4FO5A 2REMA 2IMKA 2MMOA 1ML6A 2C0GA 1LU4A 4IGJA 2MMZA 5FWGA 3PGTA 4NMUA 1XZOA 1TRVA 3P90A 1XOBA 4PQIA 2JSZA 2JADA 4JEDA 4MABA 1T8EB 4F0BA 3DWVA 4CHSA 1PD21 2K8VA 2B7JA 3QDNA 2RM6A 2YWOA 1K0NA 2VUPA 3CSJA 2MYGA 2K6VA 1H75A 5AIVA 1GULA 2VCWA 4EDZA 3CXGA 4KW6A 4LMVA 4PURA 1UA5A 1SKSB 3IHGA 3KD0A 3ZIVA 1OC9A 3GH9A 3NIVA 2C0EA 2H30A 3EU3A 3UEMA 1GWCA 4YAPA 4IBPA 3EE2A 4IKHA 2NBSA 2WGRA 2F51A 4GSSA 2CT6A 1GNWA 1S3AA 4J56E 4IELA 2JL4A 1EV9A 1XW6A 3WT2A 3LYPA 3DYRA 1V2AA 5G1LA 1EZKA 3EVIA 4ISDA 5ECIB 3PINA 4PNGA 2O8VB 2GVPA 2K9FA 3C73A 4MJBA 4DSQA 3VPTA 5ELAA 4JRRA 4P3YB 4O32A 1K0OA 2GLRA 1MDKA 1VGLA 1T1VA 3P8WA 1XXUA 3E3EA 4BL7A 1A0RP 4OFTA 2WDUA 2YV9A 2P5RA 2C1YA 3IBHA 1SYXA 3FZ4A 3ISOA 1QGVA 5D9TA 1A8LA 4WF4A 2LQQA 5D8IA 2H1DA 3GX8A 1TKDB 2D2ZA 5GSSA 2XPEA 2H6ZA 2VL9A 4X0XA 4ACSA 3HD5A 5JCUA 3KH9A 4KAEA 2N5AA 20GSA 4ZL7A 1GP1A 2B5XA 2H6XA 4QQ7A 4WKWA 3F6DA 4IHUA 2IMFA 3GURA 1PN9A 5HFKA 1R5AA 5FHIA 3U6VA 3KXOA 5CRGA 3QPMA 1T4YA 1G7EA 1SK0A 2ZNMA 2R0CA 1W89A 2X4AA 3IAS2 4LA1A 4G9HA 3IR4A 1XOAA 4FYUA 3GTUA 1XWBA 3IPZA 3K8NA 1SJ6A 2AYTA 2FA4A 3BOAA 2IFQA 3QAVA 3ZRDA 2GSRA 3A2WA 4KNDA 4TW5A 2AAWA 2HXKA 2L57A 3EU4A 5HQPA 3GA4A 3D4MA 3KP9A 2PVOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZB9 A;  1R5P A;  1YKA A;  1MTC A;  4EDY A;  1SL0 B;  2BJX A;  2VOC A;  5ID2 A;  4HQZ A;  1V58 A;  4KUN A;  2LV3 A;  5KN2 A;  2B1L A;  1IYI A;  2H01 A;  2I1U A;  3CTF A;  4F2I A;  2GSQ A;  3MDK A;  4I2U A;  5G31 A;  4XRD A;  4XS1 A;  5F06 A;  1YF0 A;  3GL5 A;  3MWH A;  3QAW A;  1HNB A;  3TRQ A;  1A0F A;  2OBK A;  5DAL A;  2HT9 A;  2MBS A;  1GSU A;  1T3B A;  5C04 A;  2R3X A;  1XFL A;  4MJA A;  2IMI A;  4H86 A;  4DVC A;  2R37 A;  2H76 A;  1DE1 A;  4OO5 A;  1V98 A;  3W6G A;  2WCI A;  5DAK A;  2GTU A;  5A5K A;  1GTB A;  3EUR A;  3HJP A;  1U3I A;  1AQW A;  4DEJ A;  5DJM A;  1GSF A;  1MD4 A;  2HZE B;  3FZ9 A;  3BCK A;  5D9V A;  2X64 A;  5B6N A;  3BD2 A;  3F6F A;  4MH2 A;  5A4U A;  2CX4 A;  3IHQ A;  2WFC A;  1HNC A;  3J7Y k;  4CW9 A;  2FD3 A;  3DD3 A;  5DQS A;  2H72 A;  3TUE A;  3KMO A;  5J41 A;  1GL8 A;  1J0F A;  4IP6 A;  1T4Z A;  3HKR A;  2AUV A;  3WGD A;  1M7T A;  1SJI A;  3H8Q A;  2E2M A;  3FZ5 A;  4POL A;  1JZR A;  4HU9 A;  4K1F A;  4X43 A;  3P7X A;  4HJM A;  4V1A p;  1R7H A;  2VLV A;  1TRS A;  4MA9 A;  2GQK A;  4TXV A;  3PR8 A;  4RI7 A;  3A5W A;  3AY8 A;  1VRS D;  3F3Q A;  3TJJ A;  5G5F A;  1OVN A;  2GZP A;  2CA8 A;  1XPV A;  2ZCT A;  5JWQ B;  4J2F A;  5G5E A;  3LYK A;  2VCZ A;  4HU7 A;  2B6M A;  3I6A A;  4IP1 A;  2ES7 A;  3HA9 A;  4XS4 A;  4IJI A;  13GS A;  5EL8 A;  2IN3 A;  4PGT A;  4KH7 A;  3G7J A;  5CRH A;  1Z6N A;  2H0G A;  5GZZ B;  1A24 A;  2CV4 A;  3ZIJ A;  5COH A;  2LJR A;  4WXT A;  3HZ4 A;  2AJQ B;  4NXI A;  3P2A A;  1SKR B;  2XBI A;  2EIQ A;  2XBQ A;  1JLV A;  4LL4 B;  4RI6 A;  1GNE A;  3N9J A;  3LOR A;  1TOF A;  5CAX A;  1K3L A;  1ZMA A;  2FWH A;  5ECK B;  4F82 A;  2GSS A;  1TRU A;  3L4N A;  2IJY A;  3S9F A;  1F9M A;  5A4W A;  4L8E A;  1THO A;  4G10 A;  1TU7 A;  1J9B A;  2H71 A;  2MZC A;  1O8W A;  3C71 A;  3TKR A;  3GRX A;  4XHM A;  3E0U A;  4AF2 A;  4Q5N A;  4HZ4 A;  3A3T A;  5ECP B;  1X9M B;  4NHZ A;  1S3C A;  3ZVJ A;  1R4W A;  1OC3 A;  5HR0 A;  2WJU A;  2A4V A;  1CQG A;  4BVY A;  2VO4 A;  3GKX A;  1KTE A;  1O85 A;  1URM A;  3C8E A;  3FZA A;  4TN8 A;  4Q5F A;  3NZN A;  4ILF A;  4WBJ A;  5EVO A;  4KB3 A;  4ZIL A;  4YH2 A;  2DBC A;  5JWR B;  2HSH A;  3A2V A;  2B3S A;  3GKN A;  2XC2 A;  1SL2 B;  1XW9 A;  2YP6 A;  3LXZ A;  2GST A;  1O7U A;  1USB A;  4KGI A;  4KA0 A;  2HFD A;  4GTU A;  3KM6 A;  2KP1 A;  4WR4 A;  1GTU A;  3JCM L;  3IK9 A;  4KSO A;  5AGY A;  2QGV A;  2RUE A;  3DIE A;  3O76 A;  2IMD A;  3DVW A;  1HNA A;  1GUM A;  1SJZ A;  1EGR A;  1RW1 A;  2H1B A;  2LST A;  3QFB C;  2H8L A;  2OE0 A;  1E2Y A;  2L6C A;  4G2E A;  2CVK A;  3QFA C;  1MD3 A;  1K0A A;  1NW2 A;  3O3T A;  4FH8 A;  4EKZ A;  4OFM A;  4E8H A;  3HY2 A;  3VWW A;  2TIR A;  4XTS A;  3LG6 A;  3FY7 A;  5JWO B;  3HHV A;  3UJ1 A;  1BYE A;  1JZW A;  3N5O A;  1PQN A;  2DJ3 A;  4NV5 A;  2LRN A;  2KUC A;  4ZB8 A;  4DSS A;  3IAM 2;  3ZZX A;  3F4S A;  4V2L A;  1PL2 A;  4X1U A;  2N5F A;  1GSY A;  3D21 A;  5ABR A;  1ABA A;  1H4O A;  2LKU A;  2DJJ A;  4K7I A;  1YKC A;  1SL1 B;  3US3 A;  1A23 A;  3FRC A;  1AUC A;  4JBB A;  3KTB A;  2OAD A;  1YQ1 A;  1XWG A;  4ZXG A;  3VWV A;  1M2B A;  4KCA A;  1BQ7 A;  3G7I A;  5DCH A;  3FHK A;  3VWX A;  2VL2 A;  2FLS A;  2CZ2 A;  4WEY A;  4IQ1 A;  2F3M A;  1PMT A;  4MZB A;  3GH6 A;  1VF1 A;  2PVQ A;  19GS A;  1FVJ A;  3F0I A;  4FIW A;  1N2A A;  4HI7 A;  1ILO A;  1TRW A;  3ZIT A;  4K7N A;  1B9Y C;  1G0T A;  5ECQ B;  1KNG A;  1PGT A;  2CQ9 A;  4WBR D;  2FWF A;  4GQC A;  4ZB6 A;  2AV4 A;  2VIM A;  5F05 A;  1TK0 B;  1ZZY A;  4D73 A;  5J4U A;  3CRU A;  4L0U A;  4TR3 A;  4O92 A;  5G2Z A;  2C3N A;  3TB2 A;  3FR9 A;  1Y25 A;  1VF2 A;  3F4T A;  2QSI A;  4BWQ A;  3CMI A;  4BPY A;  5D9W A;  3UAP A;  5ECL B;  2OJL A;  3ME8 A;  1WOU A;  1ZL9 A;  1TDI A;  3I9V 2;  4I97 A;  4LLR A;  3C1R A;  1GSD A;  2MBT A;  4AJ7 A;  5CRD A;  1CQH A;  2B7K A;  4N30 A;  17GS A;  4ZL9 A;  1PSQ A;  2F8F A;  4EO3 A;  1PRX A;  4MH3 A;  2C4J A;  3D22 A;  3Q19 A;  3MAK A;  3ZYW A;  1WE0 A;  1U87 A;  1WJK A;  3EIN A;  3ERW A;  1XWK A;  4NPB A;  4JR4 A;  2DJ2 A;  3ED3 A;  1X9S B;  5IO0 A;  4TXO B;  2IPA A;  4BA7 A;  1A2L A;  1IYH A;  3APQ A;  4F0C A;  2X8C A;  2VCX A;  4K2D A;  1PX7 A;  5F8B A;  3FW2 A;  3DKS A;  4Q5Q A;  2L4C A;  1SK1 A;  1DUG A;  3TDG A;  2J9H A;  5GAN D;  2VCV A;  2DIY A;  4JU5 A;  3LJR A;  2C3T A;  1V40 A;  3TGZ A;  2OA7 A;  3GNJ A;  3KEB A;  3VI5 A;  1FW1 A;  2H66 A;  5FT3 A;  2H6Y A;  2YV7 A;  2YZU A;  2LNS A;  1PKW A;  3GHA A;  1ERU A;  4GLT A;  4K7O A;  2C0D A;  2NTO A;  1JFU A;  2H0I A;  2QC7 A;  4XCS A;  5ECM B;  2H73 A;  1FHE A;  1PX6 A;  4GQF A;  1TK5 B;  1YJ6 A;  3UMA A;  4JR6 A;  3DXB A;  6GSY A;  3HCZ A;  3TKS A;  1HD2 A;  2WRT A;  1VF4 A;  1X0R A;  2I9H A;  5IMC A;  2VD1 A;  3UIW A;  2R4V A;  1G6Y A;  1YY7 A;  2K8S A;  1Z3E A;  4HJ2 A;  3TCO A;  1ZYQ B;  3LSZ A;  3GIX A;  3TJG A;  1LJR A;  5ECS A;  4KDX A;  4GCI A;  2PUK C;  1DSB A;  3F4R A;  2LRT A;  1GLP A;  3F3R A;  3RAZ A;  1K3O A;  3L9U A;  1F37 A;  3L9V A;  3D0Z A;  3FR6 A;  5EY6 A;  7GSS A;  2YJH A;  4QL7 A;  4POB A;  1TTZ A;  2ZUP A;  3H4K A;  2C3Q A;  2O87 A;  3W8J A;  2LTK A;  1EEM A;  3Q74 A;  2NVL A;  3QAG A;  1X9W B;  3GV1 A;  3TOU A;  4K9Z A;  5E59 A;  2FA8 A;  2O85 A;  5IOW A;  4O5R A;  1UVZ A;  4POK A;  3M9K A;  1FG4 A;  2FWG A;  2FCH A;  2PGT A;  1B9X C;  5B6M A;  2JU5 A;  1AQV A;  1QQ2 A;  3APO A;  5ECH B;  1X5D A;  4RQX A;  3IK7 A;  1WIK A;  4RUV A;  5H5S A;  5L71 A;  3E9J B;  5DBQ A;  4NWY A;  1QXH A;  5CNW A;  4EVM A;  3LEF A;  4MJE A;  1NHO A;  3FR3 A;  3GKM A;  2AHE A;  1M0U A;  3GFK A;  2H1A A;  4ZL8 A;  5J5N A;  2KHP A;  3LXT A;  1G7O A;  1NSW A;  4QL9 A;  1QUW A;  2WUL A;  3ZML A;  4XRA A;  2E0Q A;  3TKS E;  1BX9 A;  1EV4 A;  4MF7 A;  2HLS A;  1O73 A;  2GQM A;  1TP9 A;  3KH7 A;  2B1K A;  3VK9 A;  1Q98 A;  2H0H A;  2VCQ A;  2FUG 2;  4GST A;  2CVB A;  2B5Y A;  4TR1 B;  3M3M A;  4WET A;  3ZFL A;  2X8H A;  2L59 A;  5LD0 A;  2H19 A;  2WS2 A;  1DE2 A;  1KEB A;  5CO3 A;  1FVK A;  2N5B A;  1WMJ A;  2A2R A;  4V2M A;  2X8G A;  1YZX A;  3I69 A;  2GT6 A;  4IVF A;  3DVX A;  2Z9S A;  1QFN A;  5LCZ A;  4MZC A;  4ECB A;  5F07 A;  4IQA A;  3J7Y b;  4F9Z A;  5CYY A;  4YAV A;  2LS5 A;  9GSS A;  1T7P B;  3G7Y A;  4MPF A;  2YPM A;  4TOP A;  3ZTL A;  4OWY A;  5AN1 A;  2LJA A;  3FKF A;  1WPI A;  3QD9 A;  1Z7P A;  4EXJ A;  2I4A A;  2J23 A;  2VCT A;  3GL3 A;  2CAQ A;  3ZFB A;  3GSS A;  2JZS A;  2TRC P;  2L5L A;  4ZIJ A;  2HZE A;  3RHC A;  2BMX A;  2DLX A;  4ZBB A;  3KTL A;  4MK3 A;  1PA3 A;  1XBS A;  3GYK A;  5JCW A;  4PNF A;  2WB9 A;  3M0F A;  2P5Q A;  5IM9 A;  1K0B A;  3C7M A;  3KZQ A;  4EF0 A;  5IMZ A;  4N10 A;  2JZT A;  2L6D A;  1OC9 B;  3GN3 A;  2BTO T;  3GX0 A;  2P31 A;  4MJC A;  1G6W A;  2MMA A;  5ENU A;  5J3R A;  2LJK A;  4EE0 A;  3LGC A;  3SWL A;  1MEK A;  4HDE A;  3EYT A;  3QMX A;  1DBY A;  2OKA A;  1YEP A;  1B48 A;  1U6T A;  3BCI A;  4HOJ A;  4N0Z A;  2VD0 A;  2KP2 A;  1TJD A;  2VLU A;  5GST A;  5B8B A;  10GS A;  1RK4 A;  1S3D A;  2R5G A;  2OBI A;  1MDJ A;  4POM A;  3UL3 A;  2EIO A;  2V6K A;  3HXS A;  1SKW B;  2A2S A;  2IWT A;  3HVX A;  2YOI A;  2RUF A;  1I5G A;  3LQ7 A;  4TR4 A;  3ERG A;  5D73 A;  2F9S A;  3M9J A;  1XCC A;  5IQY A;  4WR5 A;  3CSH A;  5J9B A;  3CRT A;  3HVS A;  1AQX A;  3IDV A;  3TKP A;  1ZGN A;  1YDK A;  2L4Q A;  3OR5 A;  4JE1 A;  5IPG A;  2K18 A;  1JHB A;  2NDO A;  1F3A A;  1GSQ A;  3KJY A;  1PL1 A;  2PN8 A;  1WWJ A;  2CAI A;  2ON7 A;  2YWI A;  4J57 E;  4IJ3 A;  1SK2 A;  5B7C A;  2F8A A;  3RBT A;  3KP8 A;  4O7H A;  4MF5 A;  3VUR A;  4ID0 A;  3TKQ A;  3WYW A;  2DC5 A;  3TKS C;  5J9C A;  4AGS A;  4I6X A;  1F3B A;  2YN1 A;  2RLI A;  1EOG A;  3RPP A;  1QMV A;  3EMX A;  4EC0 A;  2O89 A;  4MDC A;  2FHE A;  5ECO B;  1O6J A;  3NOF A;  3WT1 A;  3O6T A;  4MP4 A;  3GTU B;  5HR2 A;  4MLY A;  1GLQ A;  4BWS A;  2HE3 A;  2JAC A;  1FB0 A;  5D93 A;  2VAF A;  1F6M C;  2GGT A;  1ERW A;  4HUA A;  2IFQ B;  3CBU A;  1GSE A;  3A2X A;  1GTA A;  3KGK A;  4IS0 A;  3UVH A;  2E7P A;  1M9A A;  1BED A;  3U5R E;  2R6K A;  2G2Q A;  3C1S A;  2VM1 A;  22GS A;  12GS A;  4IW9 A;  6GSU A;  1OYJ A;  4N11 A;  5ID2 B;  2RM5 A;  1A2J A;  1ERT A;  1OAZ A;  3UVT A;  1EGO A;  2GT5 A;  2OE1 A;  2ALB A;  2VM2 A;  2PER A;  5HR3 A;  4AJ8 A;  6GSX A;  3TOT A;  2LRC A;  1SD8 A;  1SD9 A;  2YCD A;  5ECN B;  2EC4 A;  1M2A A;  3WGX A;  2FNO A;  5DCG A;  4ECI A;  5DAL B;  3EWL A;  3IC4 A;  2VL3 A;  3QOU A;  1TXX A;  2YWN A;  3KCM A;  3DEX A;  2GQL A;  4FYC A;  4I5Q A;  4V2N A;  1ACV A;  5DAK B;  1OKD A;  3D6I A;  4XIH A;  3TRP A;  5IMD A;  4I2T A;  3D5J A;  1F2E A;  4PX1 A;  2DML A;  1XIY A;  2C0F A;  3UBK A;  4DSR A;  5B8A A;  5IOX A;  4KSM A;  4ZBD A;  2CX3 A;  4HS1 A;  2HZF A;  4OMV A;  5G1K A;  2CZ3 A;  3CYN A;  4L5L A;  5HFG A;  3GKK A;  1GUK A;  2AB6 A;  2LEG A;  1A2M A;  1XVW A;  3MNG A;  3VFI A;  3ZL5 A;  1EP7 A;  1O81 A;  3BBY A;  3F63 A;  3V1W A;  3WD6 A;  1B4P A;  3ERF A;  1BAY A;  3G9B A;  3BJ5 A;  1M2D A;  2TRX A;  4HQS A;  2V2G A;  2FY6 A;  2PMT A;  2OAC A;  1V57 A;  1JZO A;  3IA1 A;  4GWR A;  5GAP D;  1FB6 A;  3VI7 A;  2YZH A;  2HYX A;  4Z7X A;  4KX4 A;  4PQH A;  3ZRE A;  1V9W A;  3GMF A;  2ON5 A;  4GF0 A;  4IN0 A;  5F0G A;  1SU9 A;  5AIX A;  2O7K A;  3R2Q A;  3L0H A;  4KE3 A;  2DMM A;  4MF6 A;  3LWA A;  3HJO A;  2HNL A;  1T00 A;  4OFN A;  3FEU A;  1E6B A;  1B4Q A;  5IIZ A;  2G0F A;  2IL3 A;  3H93 A;  3IRA A;  1SYR A;  3LFL A;  2KOK A;  1TI3 A;  1K0M A;  1LBK A;  1Z5Y E;  2DJK A;  5HFI A;  1TW9 A;  4CDO A;  3PH9 A;  4XS4 B;  3VLN A;  2EIR A;  4NHW A;  2DJ0 A;  2DSA A;  1EWX A;  4Q5R A;  2PPT A;  1BG5 A;  2R2J A;  1PKZ A;  4TKY A;  2HRN A;  3ZVJ D;  3IOS A;  14GS A;  1AIU A;  3H1N A;  3KIJ A;  5JCG A;  5LNK e;  8GSS A;  1B8X A;  1O8X A;  1GRX A;  2XPD A;  3HZ8 A;  5KN0 A;  1ZOF A;  4OO4 A;  4K0G A;  2DJ1 A;  2H70 A;  4OCF A;  4YQU A;  4KDY A;  4RQR A;  5CRE A;  5EPF A;  4E8E A;  1W4V A;  5KN3 A;  1MDI A;  5IO2 A;  3IXR A;  3APS A;  1AXD A;  2I3Y A;  1XVQ A;  1Z9H A;  2FGX A;  3Q18 A;  4N0V A;  1FOV A;  2PWJ A;  1K3Y A;  4K0N A;  3TJF A;  4MPG A;  3TJB A;  6GSW A;  1Z6M A;  1GH2 A;  1NM3 A;  1AC1 A;  4KCE A;  4V1A g;  1UN2 A;  3CTG A;  2C80 A;  1M9B A;  1TK8 B;  5E4W A;  4BVX A;  5IPH A;  6GSV A;  3HVV A;  4ML1 A;  1K0C A;  3UBL A;  1X5E A;  4MCU A;  1THX A;  2VLT A;  1R26 A;  4EL1 A;  3F8U A;  4YQV A;  3DRN A;  3RPN A;  18GS A;  4TXO A;  3HDC A;  1EEJ A;  1GTI A;  1XWA A;  1ERV A;  3I43 A;  5CRW A;  3FK8 A;  4TR0 A;  4XS6 A;  3TJK A;  4F03 A;  4MZW A;  2LQO A;  1M99 A;  4FYB A;  3CSI A;  3H79 A;  2PU9 C;  3D4T A;  1A8Y A;  4HEA 2;  2CVD A;  1FO5 A;  2P0G A;  4GRF A;  1N8J A;  2VL2 C;  3UAR A;  2H75 A;  3GUS A;  3EMP A;  2E2G A;  1JLW A;  1YF1 A;  2M80 A;  1Y6E A;  1I9D A;  2M72 A;  3UOM A;  2I81 A;  2KLX A;  5A4V A;  3RDW A;  6GSS A;  1VF3 A;  3TRX A;  1JZD A;  3RHB A;  2HRF A;  1UC7 A;  1HYU A;  2FWE A;  1J08 A;  4YQM A;  3ME7 A;  2C8U A;  5IMV A;  2V6O A;  4ECJ A;  4JZQ A;  3SBC A;  4GXZ A;  4EUY A;  2RII A;  1ST9 A;  4ML6 A;  3QCP A;  1ZYE A;  1GSS A;  5CP1 A;  1AW9 A;  3L78 A;  2L5O A;  4PQ1 A;  2JSY A;  4DSS B;  4ECC A;  2QKE A;  2HSY A;  2GZY A;  4WF5 A;  2IIY A;  3ZLP A;  1U88 A;  1NHY A;  1AAZ A;  1Q4J A;  3IE3 A;  5ELG A;  1SEN A;  3VPQ A;  1QK8 A;  4NAX A;  3HJM A;  5DJL A;  4LL1 B;  4OD7 A;  3F9U A;  3EC3 A;  3MSZ A;  4PXO A;  2HI7 A;  1GUH A;  2LNT A;  2WZ9 A;  4GSN A;  3W8S A;  2M46 A;  3FYG A;  1C72 A;  3GST A;  1EP8 A;  5DDL A;  1EOH A;  4LMW A;  5IMA A;  3VWU A;  4KDU A;  3M8N A;  3L9S A;  3HYP A;  5C00 A;  4MMM A;  1YEX A;  4G19 A;  4PUF C;  5KN1 A;  1HQO A;  1ON4 A;  4I8B A;  1FAA A;  4K6X A;  5KEJ A;  1KBN A;  2NPB A;  1OE7 A;  5IMF A;  5INY A;  2GS3 A;  16GS A;  4K8M A;  3DGQ A;  3KMN A;  1OC8 A;  2MMN A;  3QR6 A;  4L5O A;  1X5C A;  5DVB A;  6GST A;  2YNX A;  5AIS A;  5ECR B;  5D9X A;  4D73 B;  2YAN A;  1TI1 A;  2YJ7 A;  3DML A;  1XW5 A;  2H1G A;  5DQY A;  11GS A;  2LUS A;  4OCE A;  1BJX A;  2OE3 A;  1ZCP A;  1XWC A;  4TR1 A;  2YWM A;  3ZMK A;  2PBJ A;  2V41 A;  2IME A;  2GDR A;  1RQM A;  1U3A A;  1OE8 A;  5H5Q A;  2JZR A;  4PUA A;  4AJ6 A;  5G30 A;  3Q6O A;  1TU8 A;  2GZZ A;  3M1G A;  1WP0 A;  5D96 A;  1WRY A;  2X99 A;  5H5R A;  2XHF A;  4NV2 A;  4ZBA A;  2V32 A;  1OKT A;  2H74 A;  4HZ2 A;  4L0W A;  2B5E A;  4TRX A;  1Z7R A;  2DIZ A;  2V1M A;  3IV4 A;  4TVE A;  4ULX A;  1K0D A;  5HR1 A;  3WGE A;  4FO5 A;  2REM A;  2IMK A;  2MMO A;  1ML6 A;  2C0G A;  1LU4 A;  4IGJ A;  2MMZ A;  5FWG A;  3PGT A;  4NMU A;  1XZO A;  1TRV A;  3P90 A;  1XOB A;  4PQI A;  2JSZ A;  2JAD A;  4JED A;  4MAB A;  1T8E B;  4F0B A;  3DWV A;  4CHS A;  1PD2 1;  2K8V A;  2B7J A;  3QDN A;  2RM6 A;  2YWO A;  1K0N A;  2VUP A;  3CSJ A;  2MYG A;  2K6V A;  1H75 A;  5AIV A;  1GUL A;  2VCW A;  4EDZ A;  3CXG A;  4KW6 A;  4LMV A;  4PUR A;  1UA5 A;  1SKS B;  3KD0 A;  3ZIV A;  1OC9 A;  3GH9 A;  3NIV A;  2C0E A;  2H30 A;  3EU3 A;  3UEM A;  1GWC A;  4YAP A;  4IBP A;  3EE2 A;  4IKH A;  2NBS A;  2WGR A;  2F51 A;  4GSS A;  2CT6 A;  1GNW A;  1S3A A;  4J56 E;  4IEL A;  2JL4 A;  1EV9 A;  1XW6 A;  3WT2 A;  3LYP A;  3DYR A;  1V2A A;  5G1L A;  1EZK A;  3EVI A;  4ISD A;  5ECI B;  3PIN A;  4PNG A;  2O8V B;  2GVP A;  2K9F A;  3C73 A;  4MJB A;  4DSQ A;  3VPT A;  5ELA A;  4JRR A;  4P3Y B;  4O32 A;  1K0O A;  2GLR A;  1MDK A;  1VGL A;  1T1V A;  3P8W A;  1XXU A;  3E3E A;  4BL7 A;  1A0R P;  4OFT A;  2WDU A;  2YV9 A;  2P5R A;  2C1Y A;  3IBH A;  1SYX A;  3FZ4 A;  3ISO A;  1QGV A;  5D9T A;  1A8L A;  4WF4 A;  2LQQ A;  5D8I A;  2H1D A;  3GX8 A;  1TKD B;  2D2Z A;  5GSS A;  2XPE A;  2H6Z A;  2VL9 A;  4X0X A;  4ACS A;  3HD5 A;  5JCU A;  3KH9 A;  4KAE A;  2N5A A;  20GS A;  4ZL7 A;  1GP1 A;  2B5X A;  2H6X A;  4QQ7 A;  4WKW A;  3F6D A;  4IHU A;  2IMF A;  3GUR A;  1PN9 A;  5HFK A;  1R5A A;  5FHI A;  3U6V A;  3KXO A;  5CRG A;  3QPM A;  1T4Y A;  1G7E A;  1SK0 A;  2ZNM A;  3IAS 2;  1W89 A;  4LA1 A;  4G9H A;  3IR4 A;  1XOA A;  4FYU A;  3GTU A;  1XWB A;  3IPZ A;  3K8N A;  1SJ6 A;  2AYT A;  2FA4 A;  3BOA A;  2IFQ A;  3QAV A;  3ZRD A;  2GSR A;  3A2W A;  4KND A;  4TW5 A;  2AAW A;  2HXK A;  2L57 A;  3EU4 A;  5HQP A;  3GA4 A;  3D4M A;  3KP9 A;  2PVO C; 
#chains in the Genus database with same CATH topology
 4ZB9 A;  1R5P A;  1YKA A;  1MTC A;  4EDY A;  1SL0 B;  2BJX A;  2VOC A;  5ID2 A;  4HQZ A;  1V58 A;  4KUN A;  1M3J A;  2DKH A;  2LV3 A;  5KN2 A;  2B1L A;  1IYI A;  2H01 A;  2I1U A;  3CTF A;  4F2I A;  2GSQ A;  3MDK A;  4I2U A;  5G31 A;  4XRD A;  4XS1 A;  5F06 A;  1YF0 A;  3GL5 A;  3MWH A;  3QAW A;  1HNB A;  3TRQ A;  1A0F A;  2OBK A;  5DAL A;  2HT9 A;  2MBS A;  1GSU A;  1T3B A;  5C04 A;  2R3X A;  1XFL A;  4MJA A;  2IMI A;  4H86 A;  4DVC A;  2R37 A;  2H76 A;  1DE1 A;  4OO5 A;  1V98 A;  2R0G A;  3W6G A;  2WCI A;  5DAK A;  4K5R A;  2GTU A;  5A5K A;  1GTB A;  3EUR A;  3HJP A;  1U3I A;  1AQW A;  4DEJ A;  5DJM A;  1GSF A;  1MD4 A;  2HZE B;  3FZ9 A;  3BCK A;  5D9V A;  2X64 A;  1XG8 A;  5B6N A;  3BD2 A;  3F6F A;  4MH2 A;  5A4U A;  2CX4 A;  3IHQ A;  2WFC A;  1HNC A;  3J7Y k;  4CW9 A;  2FD3 A;  3DD3 A;  5DQS A;  2H72 A;  3TUE A;  3KMO A;  5J41 A;  1GL8 A;  1J0F A;  4IP6 A;  1T4Z A;  3HKR A;  2AUV A;  3WGD A;  1M7T A;  1SJI A;  3H8Q A;  2E2M A;  3FZ5 A;  4POL A;  1JZR A;  4HU9 A;  4K1F A;  4X43 A;  3P7X A;  4HJM A;  4V1A p;  1R7H A;  2VLV A;  1TRS A;  4MA9 A;  2GQK A;  4TXV A;  3PR8 A;  4RI7 A;  3A5W A;  3AY8 A;  1VRS D;  3F3Q A;  3TJJ A;  5G5F A;  1OVN A;  2GZP A;  2CA8 A;  1XPV A;  2ZCT A;  5JWQ B;  4J2F A;  5G5E A;  3LYK A;  2VCZ A;  4KF9 A;  4HU7 A;  2B6M A;  3I6A A;  4IP1 A;  2ES7 A;  3HA9 A;  4XS4 A;  4IJI A;  13GS A;  5EL8 A;  2IN3 A;  4PGT A;  4KH7 A;  3G7J A;  5CRH A;  1Z6N A;  2H0G A;  5GZZ B;  1A24 A;  2CV4 A;  3ZIJ A;  5COH A;  2LJR A;  4WXT A;  3HZ4 A;  2AJQ B;  2UZ8 A;  4NXI A;  3P2A A;  1SKR B;  2XBI A;  2EIQ A;  2XBQ A;  1JLV A;  4LL4 B;  4RI6 A;  1GNE A;  3N9J A;  3LOR A;  1TOF A;  5CAX A;  1K3L A;  1ZMA A;  2FWH A;  5ECK B;  4F82 A;  2GSS A;  1TRU A;  3L4N A;  2IJY A;  3S9F A;  1F9M A;  5A4W A;  4L8E A;  1THO A;  4G10 A;  1TU7 A;  1J9B A;  2H71 A;  2MZC A;  1O8W A;  3C71 A;  3TKR A;  3GRX A;  4XHM A;  3E0U A;  4AF2 A;  4Q5N A;  5BMU A;  4HZ4 A;  3A3T A;  5ECP B;  1X9M B;  4NHZ A;  1S3C A;  3ZVJ A;  1R4W A;  1OC3 A;  5HR0 A;  2WJU A;  2A4V A;  1CQG A;  4BVY A;  2VO4 A;  3GKX A;  4G0I A;  1KTE A;  1O85 A;  1URM A;  3C8E A;  3FZA A;  4TN8 A;  4Q5F A;  3NZN A;  4ILF A;  4WBJ A;  5EVO A;  4KB3 A;  4ZIL A;  4YH2 A;  2DBC A;  5JWR B;  2HSH A;  3A2V A;  2B3S A;  3GKN A;  2XC2 A;  1SL2 B;  1XW9 A;  2YP6 A;  3LXZ A;  2GST A;  1O7U A;  1USB A;  4KGI A;  4KA0 A;  2HFD A;  4GTU A;  3KM6 A;  2KP1 A;  4WR4 A;  1GTU A;  3JCM L;  3IK9 A;  3LW9 A;  4KSO A;  5AGY A;  2QGV A;  2RUE A;  3DIE A;  3O76 A;  2IMD A;  3DVW A;  1HNA A;  1GUM A;  1SJZ A;  1EGR A;  1RW1 A;  2H1B A;  2LST A;  3QFB C;  2H8L A;  2OE0 A;  1E2Y A;  5KOX A;  2L6C A;  4G2E A;  2CVK A;  3QFA C;  1MD3 A;  1K0A A;  1NW2 A;  3O3T A;  4FH8 A;  4EKZ A;  4OFM A;  4Z2T A;  4E8H A;  3HY2 A;  3VWW A;  2TIR A;  4XTS A;  3LG6 A;  3FY7 A;  5JWO B;  3HHV A;  3UJ1 A;  1BYE A;  1JZW A;  3N5O A;  1PQN A;  2DJ3 A;  4NV5 A;  2LRN A;  2KUC A;  4ZB8 A;  4DSS A;  3IAM 2;  3ZZX A;  3F4S A;  4V2L A;  1PL2 A;  4X1U A;  2N5F A;  1GSY A;  3D21 A;  5ABR A;  1ABA A;  1H4O A;  2LKU A;  2DJJ A;  4K7I A;  1YKC A;  1SL1 B;  3US3 A;  1A23 A;  4EIQ A;  3FRC A;  1AUC A;  4JBB A;  3KTB A;  2OAD A;  1YQ1 A;  1XWG A;  4ZXG A;  3VWV A;  1M2B A;  4KCA A;  1BQ7 A;  3G7I A;  5DCH A;  3FHK A;  3VWX A;  2VL2 A;  4K2X A;  2FLS A;  2CZ2 A;  4WEY A;  4IQ1 A;  2F3M A;  1PMT A;  4MZB A;  3GH6 A;  1VF1 A;  2PVQ A;  19GS A;  1FVJ A;  3PPU A;  3F0I A;  4FIW A;  1N2A A;  4HI7 A;  1ILO A;  4YKF A;  1TRW A;  3ZIT A;  4K7N A;  1B9Y C;  1G0T A;  5ECQ B;  1KNG A;  1PGT A;  2CQ9 A;  4WBR D;  2FWF A;  4GQC A;  4ZB6 A;  2AV4 A;  2VIM A;  5F05 A;  1TK0 B;  1ZZY A;  4D73 A;  5J4U A;  3CRU A;  4L0U A;  4TR3 A;  2X49 A;  4O92 A;  5G2Z A;  2C3N A;  3TB2 A;  4FQU A;  3FR9 A;  1Y25 A;  1VF2 A;  3F4T A;  2QSI A;  4BWQ A;  3CMI A;  4BPY A;  5D9W A;  3UAP A;  5ECL B;  2OJL A;  3ME8 A;  1WOU A;  4X4J A;  1ZL9 A;  1TDI A;  2QA2 A;  3I9V 2;  4I97 A;  4LLR A;  3C1R A;  1GSD A;  2MBT A;  4AJ7 A;  5CRD A;  1CQH A;  2B7K A;  4N30 A;  17GS A;  4ZL9 A;  1PSQ A;  2F8F A;  4EO3 A;  2R0P A;  4BVX B;  1PRX A;  4MH3 A;  2C4J A;  3D22 A;  3Q19 A;  3MAK A;  3ZYW A;  1WE0 A;  1U87 A;  1WJK A;  3EIN A;  3ERW A;  1XWK A;  4NPB A;  4JR4 A;  2DJ2 A;  3ED3 A;  1X9S B;  5IO0 A;  4TXO B;  2IPA A;  4BA7 A;  1A2L A;  1IYH A;  3APQ A;  4F0C A;  2X8C A;  2VCX A;  4K2D A;  1PX7 A;  5F8B A;  3FW2 A;  3DKS A;  4Q5Q A;  2L4C A;  1SK1 A;  1DUG A;  3TDG A;  2J9H A;  5GAN D;  2VCV A;  2DIY A;  4JU5 A;  3LJR A;  2C3T A;  1V40 A;  3TGZ A;  2OA7 A;  3GNJ A;  3KEB A;  3VI5 A;  1FW1 A;  2H66 A;  5FT3 A;  2H6Y A;  2YV7 A;  2YZU A;  2LNS A;  1PKW A;  3GHA A;  1ERU A;  4Z2U A;  4GLT A;  4K7O A;  2C0D A;  2NTO A;  1JFU A;  2H0I A;  2QC7 A;  4XCS A;  5ECM B;  2H73 A;  1FHE A;  3FMW A;  1PX6 A;  4GQF A;  3MIX A;  1TK5 B;  1YJ6 A;  3UMA A;  4JR6 A;  3DXB A;  6GSY A;  3HCZ A;  3TKS A;  1HD2 A;  2WRT A;  1VF4 A;  1X0R A;  2I9H A;  5IMC A;  2VD1 A;  3UIW A;  2R4V A;  1G6Y A;  1YY7 A;  2K8S A;  1Z3E A;  4HJ2 A;  4MNN A;  3TCO A;  1ZYQ B;  3LSZ A;  3GIX A;  3TJG A;  1LJR A;  5ECS A;  4KDX A;  4GCI A;  2PUK C;  1DSB A;  4K5S A;  4BIK A;  3F4R A;  4YKG A;  2LRT A;  1GLP A;  3F3R A;  3RAZ A;  1K3O A;  3L9U A;  1F37 A;  3L9V A;  3D0Z A;  3FR6 A;  5EY6 A;  7GSS A;  2YJH A;  4QL7 A;  4POB A;  1TTZ A;  2ZUP A;  3H4K A;  2C3Q A;  2O87 A;  3W8J A;  2LTK A;  1EEM A;  3Q74 A;  2NVL A;  3QAG A;  1X9W B;  3GV1 A;  3IC8 A;  3TOU A;  4K9Z A;  4G0L A;  5E59 A;  2FA8 A;  2O85 A;  5IOW A;  4O5R A;  1UVZ A;  4POK A;  3M9K A;  3A5I A;  1FG4 A;  2FWG A;  2FCH A;  2PGT A;  1B9X C;  5B6M A;  2JU5 A;  1AQV A;  1QQ2 A;  3APO A;  5ECH B;  1X5D A;  4CY8 A;  4RQX A;  3IK7 A;  1WIK A;  4RUV A;  5H5S A;  5L71 A;  3E9J B;  5DBQ A;  4NWY A;  1QXH A;  5CNW A;  4EVM A;  3LEF A;  1FOH A;  4MJE A;  1NHO A;  3FR3 A;  3GKM A;  2AHE A;  1M0U A;  3GFK A;  2H1A A;  4ZL8 A;  5J5N A;  2KHP A;  3LXT A;  1G7O A;  1NSW A;  4QL9 A;  1QUW A;  2WUL A;  3ZML A;  4XRA A;  2E0Q A;  3TKS E;  1BX9 A;  1EV4 A;  4MF7 A;  2HLS A;  1O73 A;  2GQM A;  1TP9 A;  3KH7 A;  2B1K A;  3VK9 A;  1Q98 A;  2H0H A;  2VCQ A;  2FUG 2;  4GST A;  2CVB A;  2B5Y A;  4TR1 B;  3M3M A;  4WET A;  3ZFL A;  2X8H A;  2L59 A;  5LD0 A;  2H19 A;  2WS2 A;  1DE2 A;  1KEB A;  5CO3 A;  1FVK A;  2N5B A;  1WMJ A;  2A2R A;  4V2M A;  2X8G A;  1PN0 A;  1YZX A;  3I69 A;  2GT6 A;  4IVF A;  3DVX A;  2Z9S A;  1QFN A;  5LCZ A;  4MZC A;  4ECB A;  5F07 A;  1ZYN A;  4IQA A;  3J7Y b;  4F9Z A;  5CYY A;  4YAV A;  2LS5 A;  9GSS A;  1T7P B;  3G7Y A;  4MPF A;  2YPM A;  4TOP A;  3ZTL A;  4OWY A;  5AN1 A;  2LJA A;  3FKF A;  1WPI A;  3QD9 A;  1Z7P A;  4EXJ A;  2I4A A;  2J23 A;  2VCT A;  3GL3 A;  2CAQ A;  3ZFB A;  3GSS A;  2JZS A;  2TRC P;  2L5L A;  4ZIJ A;  2HZE A;  3RHC A;  2BMX A;  2DLX A;  4ZBB A;  3KTL A;  4MK3 A;  1PA3 A;  1XBS A;  3GYK A;  5JCW A;  4PNF A;  2WB9 A;  3M0F A;  2P5Q A;  5IM9 A;  1K0B A;  3C7M A;  3KZQ A;  4EF0 A;  5IMZ A;  4N10 A;  2HRK A;  3EPT A;  2JZT A;  2L6D A;  1OC9 B;  3GN3 A;  2BTO T;  3GX0 A;  2P31 A;  4MJC A;  1G6W A;  2MMA A;  5ENU A;  5J3R A;  2LJK A;  4EE0 A;  3LGC A;  3SWL A;  1MEK A;  4HDE A;  3EYT A;  3HVN A;  3QMX A;  1DBY A;  2OKA A;  1YEP A;  1B48 A;  1U6T A;  3BCI A;  4HOJ A;  4N0Z A;  2VD0 A;  2KP2 A;  1TJD A;  2VLU A;  5GST A;  5B8B A;  10GS A;  1RK4 A;  1S3D A;  2R5G A;  2OBI A;  1MDJ A;  4POM A;  3UL3 A;  2EIO A;  2QA1 A;  2V6K A;  3HXS A;  1SKW B;  2A2S A;  2IWT A;  3HVX A;  2YOI A;  2RUF A;  1I5G A;  3LQ7 A;  4TR4 A;  1PFO A;  3ERG A;  5D73 A;  2F9S A;  3M9J A;  1XCC A;  5BRT A;  5IQY A;  4WR5 A;  3CSH A;  5J9B A;  3CRT A;  4BL7 B;  3HVS A;  1AQX A;  3IDV A;  4G0K A;  3TKP A;  1ZGN A;  1YDK A;  2L4Q A;  3OR5 A;  4JE1 A;  5IPG A;  2K18 A;  1JHB A;  2NDO A;  1F3A A;  1GSQ A;  3KJY A;  1PL1 A;  2PN8 A;  1WWJ A;  2CAI A;  2ON7 A;  2YWI A;  4J57 E;  4IJ3 A;  1SK2 A;  5B7C A;  2F8A A;  3RBT A;  3KP8 A;  4O7H A;  4MF5 A;  3VUR A;  4ID0 A;  3TKQ A;  3WYW A;  2DC5 A;  3TKS C;  5J9C A;  4AGS A;  4I6X A;  1F3B A;  3MYD A;  2YN1 A;  2RLI A;  1EOG A;  3RPP A;  1QMV A;  3EMX A;  4EC0 A;  2O89 A;  4MDC A;  2FHE A;  5ECO B;  1O6J A;  3NOF A;  3WT1 A;  3O6T A;  4MP4 A;  3GTU B;  5HR2 A;  4MLY A;  1GLQ A;  4BWS A;  2HE3 A;  2JAC A;  1FB0 A;  5D93 A;  2VAF A;  1F6M C;  2GGT A;  1ERW A;  4HUA A;  2IFQ B;  3CBU A;  1GSE A;  3A2X A;  1GTA A;  3KGK A;  4IS0 A;  3UVH A;  2E7P A;  1M9A A;  1BED A;  3U5R E;  2R6K A;  2G2Q A;  3C1S A;  2VM1 A;  22GS A;  12GS A;  4IW9 A;  6GSU A;  1OYJ A;  4N11 A;  5ID2 B;  2RM5 A;  1A2J A;  1ERT A;  1OAZ A;  3UVT A;  1EGO A;  2GT5 A;  2OE1 A;  2ALB A;  4HSC X;  2VM2 A;  2PER A;  5HR3 A;  4AJ8 A;  6GSX A;  3TOT A;  2LRC A;  2DKI A;  1SD8 A;  1SD9 A;  2YCD A;  5ECN B;  2EC4 A;  1M2A A;  3WGX A;  2FNO A;  5DCG A;  4ECI A;  5DAL B;  3EWL A;  3IC4 A;  2VL3 A;  3QOU A;  4PTS A;  1TXX A;  2YWN A;  3KCM A;  3DEX A;  2GQL A;  4FYC A;  4I5Q A;  4V2N A;  1ACV A;  5DAK B;  1OKD A;  3D6I A;  4XIH A;  3TRP A;  5IMD A;  4I2T A;  3D5J A;  1F2E A;  4PX1 A;  2DML A;  1XIY A;  2C0F A;  3UBK A;  4DSR A;  5B8A A;  5IOX A;  4KSM A;  4ZBD A;  2CX3 A;  4HS1 A;  2HZF A;  4OMV A;  5G1K A;  2CZ3 A;  3CYN A;  4L5L A;  5HFG A;  3GKK A;  1GUK A;  2AB6 A;  2LEG A;  1A2M A;  1XVW A;  3MNG A;  3VFI A;  3ZL5 A;  1EP7 A;  1O81 A;  3BBY A;  3F63 A;  3V1W A;  3WD6 A;  1B4P A;  3ERF A;  1BAY A;  3G9B A;  3BJ5 A;  1M2D A;  2HRA A;  2TRX A;  4HQS A;  2V2G A;  2FY6 A;  2PMT A;  2OAC A;  1V57 A;  1JZO A;  3IA1 A;  4GWR A;  5GAP D;  1FB6 A;  3VI7 A;  2YZH A;  2HYX A;  4Z7X A;  4KX4 A;  4PQH A;  3ZRE A;  1V9W A;  3GMF A;  2ON5 A;  4GF0 A;  4IN0 A;  5F0G A;  1SU9 A;  5AIX A;  2O7K A;  3R2Q A;  3L0H A;  4KE3 A;  2DMM A;  4MF6 A;  1M3I A;  3LWA A;  3HJO A;  2HNL A;  1T00 A;  4OFN A;  3FEU A;  1E6B A;  1B4Q A;  3R3E A;  5IIZ A;  2G0F A;  2IL3 A;  3H93 A;  3IRA A;  4O5Q A;  1SYR A;  3LFL A;  2KOK A;  1TI3 A;  1K0M A;  1LBK A;  1Z5Y E;  2DJK A;  5HFI A;  1TW9 A;  4CDO A;  3PH9 A;  4XS4 B;  3VLN A;  2EIR A;  4NHW A;  2DJ0 A;  2DSA A;  1EWX A;  4Q5R A;  2PPT A;  1BG5 A;  2R2J A;  1PKZ A;  4TKY A;  2HRN A;  3ZVJ D;  3IOS A;  14GS A;  1AIU A;  3H1N A;  3KIJ A;  5JCG A;  5LNK e;  8GSS A;  1B8X A;  1O8X A;  1GRX A;  2XPD A;  3HZ8 A;  5KN0 A;  1ZOF A;  4OO4 A;  4K0G A;  2DJ1 A;  2H70 A;  4OCF A;  4Z2R A;  4YQU A;  4KDY A;  4RQR A;  5CRE A;  5EPF A;  4E8E A;  1W4V A;  5KN3 A;  1MDI A;  5IO2 A;  3IXR A;  3APS A;  1AXD A;  2I3Y A;  1XVQ A;  1Z9H A;  2FGX A;  3Q18 A;  4N0V A;  1FOV A;  2PWJ A;  1K3Y A;  4K0N A;  3TJF A;  4MPG A;  3TJB A;  6GSW A;  1Z6M A;  1GH2 A;  1NM3 A;  1AC1 A;  4KCE A;  4V1A g;  1UN2 A;  3CTG A;  2C80 A;  1M9B A;  4ICY A;  1TK8 B;  5E4W A;  4BVX A;  5IPH A;  6GSV A;  3HVV A;  4ML1 A;  1K0C A;  3UBL A;  1X5E A;  4MCU A;  1THX A;  2VLT A;  1R26 A;  4EL1 A;  3F8U A;  4BVY B;  4YQV A;  3DRN A;  3RPN A;  18GS A;  4TXO A;  3HDC A;  1EEJ A;  1GTI A;  1XWA A;  4O5U A;  1ERV A;  3I43 A;  5CRW A;  3FK8 A;  4TR0 A;  4XS6 A;  3TJK A;  4F03 A;  4MZW A;  2LQO A;  1M99 A;  4FYB A;  4EIP A;  3CSI A;  3H79 A;  2PU9 C;  3D4T A;  1A8Y A;  4A5P A;  4HEA 2;  2CVD A;  1FO5 A;  2P0G A;  4GRF A;  2HSM A;  5KOW A;  1N8J A;  2VL2 C;  3UAR A;  2H75 A;  3GUS A;  3EMP A;  2E2G A;  1JLW A;  1YF1 A;  2M80 A;  1Y6E A;  1I9D A;  2M72 A;  3UOM A;  2I81 A;  2KLX A;  5A4V A;  3RDW A;  6GSS A;  1VF3 A;  3TRX A;  1JZD A;  3RHB A;  2HRF A;  1UC7 A;  1HYU A;  2FWE A;  1J08 A;  4YQM A;  3ME7 A;  2C8U A;  5IMV A;  2V6O A;  4ECJ A;  4JZQ A;  3SBC A;  4GXZ A;  4EUY A;  2RII A;  1ST9 A;  4ML6 A;  3QCP A;  1ZYE A;  1GSS A;  5CP1 A;  1AW9 A;  3L78 A;  2L5O A;  4PQ1 A;  2JSY A;  4DSS B;  4ECC A;  2QKE A;  2HSY A;  2GZY A;  4WF5 A;  2IIY A;  3ZLP A;  1U88 A;  1NHY A;  1AAZ A;  1Q4J A;  3IE3 A;  4USS A;  5ELG A;  1SEN A;  3VPQ A;  1QK8 A;  4NAX A;  3HJM A;  5DJL A;  4LL1 B;  4OD7 A;  3F9U A;  3EC3 A;  3MSZ A;  4CY6 A;  4PXO A;  2HI7 A;  1GUH A;  2LNT A;  2WZ9 A;  4GSN A;  3W8S A;  2M46 A;  3FYG A;  1C72 A;  3GST A;  1EP8 A;  5DDL A;  1EOH A;  4LMW A;  5IMA A;  3VWU A;  4KDU A;  3M8N A;  3L9S A;  3HYP A;  5C00 A;  4MMM A;  1YEX A;  4G19 A;  4PUF C;  1ZYP A;  5KN1 A;  1HQO A;  1ON4 A;  4I8B A;  2A4H A;  1FAA A;  4K6X A;  5KEJ A;  1KBN A;  2NPB A;  1OE7 A;  5IMF A;  5INY A;  2GS3 A;  16GS A;  4K8M A;  3DGQ A;  3KMN A;  1OC8 A;  2MMN A;  3QR6 A;  4L5O A;  1X5C A;  5DVB A;  6GST A;  2YNX A;  2A2P A;  5AIS A;  5ECR B;  5D9X A;  4D73 B;  2YAN A;  1TI1 A;  2YJ7 A;  3DML A;  1XW5 A;  2H1G A;  5DQY A;  11GS A;  2LUS A;  4OCE A;  1BJX A;  2OE3 A;  1ZCP A;  1XWC A;  4TR1 A;  2YWM A;  3ZMK A;  2PBJ A;  2V41 A;  2IME A;  2GDR A;  1RQM A;  1U3A A;  3CQF A;  1OE8 A;  5H5Q A;  2JZR A;  4PUA A;  4AJ6 A;  5G30 A;  3Q6O A;  1TU8 A;  2GZZ A;  3M1G A;  1WP0 A;  5D96 A;  1WRY A;  2X99 A;  5H5R A;  2XHF A;  4NV2 A;  4ZBA A;  2V32 A;  1OKT A;  2H74 A;  4HZ2 A;  4L0W A;  2B5E A;  4TRX A;  1Z7R A;  2DIZ A;  2V1M A;  3IV4 A;  4TVE A;  4ULX A;  1S3R A;  1K0D A;  5HR1 A;  3WGE A;  4FO5 A;  2REM A;  2IMK A;  2MMO A;  1ML6 A;  2C0G A;  1LU4 A;  4IGJ A;  2MMZ A;  5FWG A;  3PGT A;  4NMU A;  1XZO A;  1TRV A;  3P90 A;  1XOB A;  4PQI A;  2JSZ A;  2JAD A;  4JED A;  4MAB A;  1T8E B;  4F0B A;  3DWV A;  4CHS A;  1PD2 1;  2K8V A;  2B7J A;  3QDN A;  2RM6 A;  2YWO A;  1K0N A;  2VUP A;  3CSJ A;  2MYG A;  2K6V A;  1H75 A;  5AIV A;  1GUL A;  2VCW A;  4EDZ A;  3CXG A;  4KW6 A;  4LMV A;  4PUR A;  1UA5 A;  1SKS B;  3IHG A;  3KD0 A;  3ZIV A;  1OC9 A;  3GH9 A;  3NIV A;  2C0E A;  2H30 A;  3EU3 A;  3UEM A;  1GWC A;  4YAP A;  4IBP A;  3EE2 A;  4IKH A;  2NBS A;  2WGR A;  2F51 A;  4GSS A;  2CT6 A;  1GNW A;  1S3A A;  4J56 E;  4IEL A;  2JL4 A;  1EV9 A;  1XW6 A;  3WT2 A;  3LYP A;  3DYR A;  1V2A A;  5G1L A;  1EZK A;  3EVI A;  4ISD A;  5ECI B;  3PIN A;  4PNG A;  2O8V B;  2GVP A;  2K9F A;  3C73 A;  4MJB A;  4DSQ A;  3VPT A;  5ELA A;  4JRR A;  4P3Y B;  4O32 A;  1K0O A;  2GLR A;  1MDK A;  1VGL A;  1T1V A;  3P8W A;  1XXU A;  3E3E A;  4BL7 A;  1A0R P;  4OFT A;  2WDU A;  2YV9 A;  2P5R A;  2C1Y A;  3IBH A;  1SYX A;  3FZ4 A;  3ISO A;  1QGV A;  5D9T A;  1A8L A;  4WF4 A;  2LQQ A;  5D8I A;  2H1D A;  3GX8 A;  1TKD B;  2D2Z A;  5GSS A;  2XPE A;  2H6Z A;  2VL9 A;  4X0X A;  4ACS A;  3HD5 A;  5JCU A;  3KH9 A;  4KAE A;  2N5A A;  20GS A;  4ZL7 A;  1GP1 A;  2B5X A;  2H6X A;  4QQ7 A;  4WKW A;  3F6D A;  4IHU A;  2IMF A;  3GUR A;  1PN9 A;  5HFK A;  1R5A A;  5FHI A;  3U6V A;  3KXO A;  5CRG A;  3QPM A;  1T4Y A;  1G7E A;  1SK0 A;  2ZNM A;  2R0C A;  1W89 A;  2X4A A;  3IAS 2;  4LA1 A;  4G9H A;  3IR4 A;  1XOA A;  4FYU A;  3GTU A;  1XWB A;  3IPZ A;  3K8N A;  1SJ6 A;  2AYT A;  2FA4 A;  3BOA A;  2IFQ A;  3QAV A;  3ZRD A;  2GSR A;  3A2W A;  4KND A;  4TW5 A;  2AAW A;  2HXK A;  2L57 A;  3EU4 A;  5HQP A;  3GA4 A;  3D4M A;  3KP9 A;  2PVO C; 
#chains in the Genus database with same CATH homology
 4ZB9 A;  1R5P A;  1YKA A;  1MTC A;  4EDY A;  1SL0 B;  2BJX A;  2VOC A;  5ID2 A;  4HQZ A;  1V58 A;  4KUN A;  2DKH A;  2LV3 A;  5KN2 A;  2B1L A;  1IYI A;  2H01 A;  2I1U A;  3CTF A;  4F2I A;  2GSQ A;  3MDK A;  4I2U A;  5G31 A;  4XRD A;  4XS1 A;  5F06 A;  1YF0 A;  3GL5 A;  3MWH A;  3QAW A;  1HNB A;  3TRQ A;  1A0F A;  2OBK A;  5DAL A;  2HT9 A;  2MBS A;  1GSU A;  1T3B A;  5C04 A;  2R3X A;  1XFL A;  4MJA A;  2IMI A;  4H86 A;  4DVC A;  2R37 A;  2H76 A;  1DE1 A;  4OO5 A;  1V98 A;  2R0G A;  3W6G A;  2WCI A;  5DAK A;  4K5R A;  2GTU A;  5A5K A;  1GTB A;  3EUR A;  3HJP A;  1U3I A;  1AQW A;  4DEJ A;  5DJM A;  1GSF A;  1MD4 A;  2HZE B;  3FZ9 A;  3BCK A;  5D9V A;  2X64 A;  5B6N A;  3BD2 A;  3F6F A;  4MH2 A;  5A4U A;  2CX4 A;  3IHQ A;  2WFC A;  1HNC A;  3J7Y k;  4CW9 A;  2FD3 A;  3DD3 A;  5DQS A;  2H72 A;  3TUE A;  3KMO A;  5J41 A;  1GL8 A;  1J0F A;  4IP6 A;  1T4Z A;  3HKR A;  2AUV A;  3WGD A;  1M7T A;  1SJI A;  3H8Q A;  2E2M A;  3FZ5 A;  4POL A;  1JZR A;  4HU9 A;  4K1F A;  4X43 A;  3P7X A;  4HJM A;  4V1A p;  1R7H A;  2VLV A;  1TRS A;  4MA9 A;  2GQK A;  4TXV A;  3PR8 A;  4RI7 A;  3A5W A;  3AY8 A;  1VRS D;  3F3Q A;  3TJJ A;  5G5F A;  1OVN A;  2GZP A;  2CA8 A;  1XPV A;  2ZCT A;  5JWQ B;  4J2F A;  5G5E A;  3LYK A;  2VCZ A;  4KF9 A;  4HU7 A;  2B6M A;  3I6A A;  4IP1 A;  2ES7 A;  3HA9 A;  4XS4 A;  4IJI A;  13GS A;  5EL8 A;  2IN3 A;  4PGT A;  4KH7 A;  3G7J A;  5CRH A;  1Z6N A;  2H0G A;  5GZZ B;  1A24 A;  2CV4 A;  3ZIJ A;  5COH A;  2LJR A;  4WXT A;  3HZ4 A;  2AJQ B;  2UZ8 A;  4NXI A;  3P2A A;  1SKR B;  2XBI A;  2EIQ A;  2XBQ A;  1JLV A;  4LL4 B;  4RI6 A;  1GNE A;  3N9J A;  3LOR A;  1TOF A;  5CAX A;  1K3L A;  1ZMA A;  2FWH A;  5ECK B;  4F82 A;  2GSS A;  1TRU A;  3L4N A;  2IJY A;  3S9F A;  1F9M A;  5A4W A;  4L8E A;  1THO A;  4G10 A;  1TU7 A;  1J9B A;  2H71 A;  2MZC A;  1O8W A;  3C71 A;  3TKR A;  3GRX A;  4XHM A;  3E0U A;  4AF2 A;  4Q5N A;  5BMU A;  4HZ4 A;  3A3T A;  5ECP B;  1X9M B;  4NHZ A;  1S3C A;  3ZVJ A;  1R4W A;  1OC3 A;  5HR0 A;  2WJU A;  2A4V A;  1CQG A;  4BVY A;  2VO4 A;  3GKX A;  4G0I A;  1KTE A;  1O85 A;  1URM A;  3C8E A;  3FZA A;  4TN8 A;  4Q5F A;  3NZN A;  4ILF A;  4WBJ A;  5EVO A;  4KB3 A;  4ZIL A;  4YH2 A;  2DBC A;  5JWR B;  2HSH A;  3A2V A;  2B3S A;  3GKN A;  2XC2 A;  1SL2 B;  1XW9 A;  2YP6 A;  3LXZ A;  2GST A;  1O7U A;  1USB A;  4KGI A;  4KA0 A;  2HFD A;  4GTU A;  3KM6 A;  2KP1 A;  4WR4 A;  1GTU A;  3JCM L;  3IK9 A;  3LW9 A;  4KSO A;  5AGY A;  2QGV A;  2RUE A;  3DIE A;  3O76 A;  2IMD A;  3DVW A;  1HNA A;  1GUM A;  1SJZ A;  1EGR A;  1RW1 A;  2H1B A;  2LST A;  3QFB C;  2H8L A;  2OE0 A;  1E2Y A;  5KOX A;  2L6C A;  4G2E A;  2CVK A;  3QFA C;  1MD3 A;  1K0A A;  1NW2 A;  3O3T A;  4FH8 A;  4EKZ A;  4OFM A;  4Z2T A;  4E8H A;  3HY2 A;  3VWW A;  2TIR A;  4XTS A;  3LG6 A;  3FY7 A;  5JWO B;  3HHV A;  3UJ1 A;  1BYE A;  1JZW A;  3N5O A;  1PQN A;  2DJ3 A;  4NV5 A;  2LRN A;  2KUC A;  4ZB8 A;  4DSS A;  3IAM 2;  3ZZX A;  3F4S A;  4V2L A;  1PL2 A;  4X1U A;  2N5F A;  1GSY A;  3D21 A;  5ABR A;  1ABA A;  1H4O A;  2LKU A;  2DJJ A;  4K7I A;  1YKC A;  1SL1 B;  3US3 A;  1A23 A;  4EIQ A;  3FRC A;  1AUC A;  4JBB A;  3KTB A;  2OAD A;  1YQ1 A;  1XWG A;  4ZXG A;  3VWV A;  1M2B A;  4KCA A;  1BQ7 A;  3G7I A;  5DCH A;  3FHK A;  3VWX A;  2VL2 A;  4K2X A;  2FLS A;  2CZ2 A;  4WEY A;  4IQ1 A;  2F3M A;  1PMT A;  4MZB A;  3GH6 A;  1VF1 A;  2PVQ A;  19GS A;  1FVJ A;  3PPU A;  3F0I A;  4FIW A;  1N2A A;  4HI7 A;  1ILO A;  4YKF A;  1TRW A;  3ZIT A;  4K7N A;  1B9Y C;  1G0T A;  5ECQ B;  1KNG A;  1PGT A;  2CQ9 A;  4WBR D;  2FWF A;  4GQC A;  4ZB6 A;  2AV4 A;  2VIM A;  5F05 A;  1TK0 B;  1ZZY A;  4D73 A;  5J4U A;  3CRU A;  4L0U A;  4TR3 A;  2X49 A;  4O92 A;  5G2Z A;  2C3N A;  3TB2 A;  4FQU A;  3FR9 A;  1Y25 A;  1VF2 A;  3F4T A;  2QSI A;  4BWQ A;  3CMI A;  4BPY A;  5D9W A;  3UAP A;  5ECL B;  2OJL A;  3ME8 A;  1WOU A;  4X4J A;  1ZL9 A;  1TDI A;  2QA2 A;  3I9V 2;  4I97 A;  4LLR A;  3C1R A;  1GSD A;  2MBT A;  4AJ7 A;  5CRD A;  1CQH A;  2B7K A;  4N30 A;  17GS A;  4ZL9 A;  1PSQ A;  2F8F A;  4EO3 A;  2R0P A;  4BVX B;  1PRX A;  4MH3 A;  2C4J A;  3D22 A;  3Q19 A;  3MAK A;  3ZYW A;  1WE0 A;  1U87 A;  1WJK A;  3EIN A;  3ERW A;  1XWK A;  4NPB A;  4JR4 A;  2DJ2 A;  3ED3 A;  1X9S B;  5IO0 A;  4TXO B;  2IPA A;  4BA7 A;  1A2L A;  1IYH A;  3APQ A;  4F0C A;  2X8C A;  2VCX A;  4K2D A;  1PX7 A;  5F8B A;  3FW2 A;  3DKS A;  4Q5Q A;  2L4C A;  1SK1 A;  1DUG A;  3TDG A;  2J9H A;  5GAN D;  2VCV A;  2DIY A;  4JU5 A;  3LJR A;  2C3T A;  1V40 A;  3TGZ A;  2OA7 A;  3GNJ A;  3KEB A;  3VI5 A;  1FW1 A;  2H66 A;  5FT3 A;  2H6Y A;  2YV7 A;  2YZU A;  2LNS A;  1PKW A;  3GHA A;  1ERU A;  4Z2U A;  4GLT A;  4K7O A;  2C0D A;  2NTO A;  1JFU A;  2H0I A;  2QC7 A;  4XCS A;  5ECM B;  2H73 A;  1FHE A;  3FMW A;  1PX6 A;  4GQF A;  3MIX A;  1TK5 B;  1YJ6 A;  3UMA A;  4JR6 A;  3DXB A;  6GSY A;  3HCZ A;  3TKS A;  1HD2 A;  2WRT A;  1VF4 A;  1X0R A;  2I9H A;  5IMC A;  2VD1 A;  3UIW A;  2R4V A;  1G6Y A;  1YY7 A;  2K8S A;  1Z3E A;  4HJ2 A;  4MNN A;  3TCO A;  1ZYQ B;  3LSZ A;  3GIX A;  3TJG A;  1LJR A;  5ECS A;  4KDX A;  4GCI A;  2PUK C;  1DSB A;  4K5S A;  3F4R A;  4YKG A;  2LRT A;  1GLP A;  3F3R A;  3RAZ A;  1K3O A;  3L9U A;  1F37 A;  3L9V A;  3D0Z A;  3FR6 A;  5EY6 A;  7GSS A;  2YJH A;  4QL7 A;  4POB A;  1TTZ A;  2ZUP A;  3H4K A;  2C3Q A;  2O87 A;  3W8J A;  2LTK A;  1EEM A;  3Q74 A;  2NVL A;  3QAG A;  1X9W B;  3GV1 A;  3IC8 A;  3TOU A;  4K9Z A;  4G0L A;  5E59 A;  2FA8 A;  2O85 A;  5IOW A;  4O5R A;  1UVZ A;  4POK A;  3M9K A;  3A5I A;  1FG4 A;  2FWG A;  2FCH A;  2PGT A;  1B9X C;  5B6M A;  2JU5 A;  1AQV A;  1QQ2 A;  3APO A;  5ECH B;  1X5D A;  4CY8 A;  4RQX A;  3IK7 A;  1WIK A;  4RUV A;  5H5S A;  5L71 A;  3E9J B;  5DBQ A;  4NWY A;  1QXH A;  5CNW A;  4EVM A;  3LEF A;  1FOH A;  4MJE A;  1NHO A;  3FR3 A;  3GKM A;  2AHE A;  1M0U A;  3GFK A;  2H1A A;  4ZL8 A;  5J5N A;  2KHP A;  3LXT A;  1G7O A;  1NSW A;  4QL9 A;  1QUW A;  2WUL A;  3ZML A;  4XRA A;  2E0Q A;  3TKS E;  1BX9 A;  1EV4 A;  4MF7 A;  2HLS A;  1O73 A;  2GQM A;  1TP9 A;  3KH7 A;  2B1K A;  3VK9 A;  1Q98 A;  2H0H A;  2VCQ A;  2FUG 2;  4GST A;  2CVB A;  2B5Y A;  4TR1 B;  3M3M A;  4WET A;  3ZFL A;  2X8H A;  2L59 A;  5LD0 A;  2H19 A;  2WS2 A;  1DE2 A;  1KEB A;  5CO3 A;  1FVK A;  2N5B A;  1WMJ A;  2A2R A;  4V2M A;  2X8G A;  1PN0 A;  1YZX A;  3I69 A;  2GT6 A;  4IVF A;  3DVX A;  2Z9S A;  1QFN A;  5LCZ A;  4MZC A;  4ECB A;  5F07 A;  1ZYN A;  4IQA A;  3J7Y b;  4F9Z A;  5CYY A;  4YAV A;  2LS5 A;  9GSS A;  1T7P B;  3G7Y A;  4MPF A;  2YPM A;  4TOP A;  3ZTL A;  4OWY A;  5AN1 A;  2LJA A;  3FKF A;  1WPI A;  3QD9 A;  1Z7P A;  4EXJ A;  2I4A A;  2J23 A;  2VCT A;  3GL3 A;  2CAQ A;  3ZFB A;  3GSS A;  2JZS A;  2TRC P;  2L5L A;  4ZIJ A;  2HZE A;  3RHC A;  2BMX A;  2DLX A;  4ZBB A;  3KTL A;  4MK3 A;  1PA3 A;  1XBS A;  3GYK A;  5JCW A;  4PNF A;  2WB9 A;  3M0F A;  2P5Q A;  5IM9 A;  1K0B A;  3C7M A;  3KZQ A;  4EF0 A;  5IMZ A;  4N10 A;  2HRK A;  3EPT A;  2JZT A;  2L6D A;  1OC9 B;  3GN3 A;  2BTO T;  3GX0 A;  2P31 A;  4MJC A;  1G6W A;  2MMA A;  5ENU A;  5J3R A;  2LJK A;  4EE0 A;  3LGC A;  3SWL A;  1MEK A;  4HDE A;  3EYT A;  3QMX A;  1DBY A;  2OKA A;  1YEP A;  1B48 A;  1U6T A;  3BCI A;  4HOJ A;  4N0Z A;  2VD0 A;  2KP2 A;  1TJD A;  2VLU A;  5GST A;  5B8B A;  10GS A;  1RK4 A;  1S3D A;  2R5G A;  2OBI A;  1MDJ A;  4POM A;  3UL3 A;  2EIO A;  2QA1 A;  2V6K A;  3HXS A;  1SKW B;  2A2S A;  2IWT A;  3HVX A;  2YOI A;  2RUF A;  1I5G A;  3LQ7 A;  4TR4 A;  3ERG A;  5D73 A;  2F9S A;  3M9J A;  1XCC A;  5BRT A;  5IQY A;  4WR5 A;  3CSH A;  5J9B A;  3CRT A;  4BL7 B;  3HVS A;  1AQX A;  3IDV A;  4G0K A;  3TKP A;  1ZGN A;  1YDK A;  2L4Q A;  3OR5 A;  4JE1 A;  5IPG A;  2K18 A;  1JHB A;  2NDO A;  1F3A A;  1GSQ A;  3KJY A;  1PL1 A;  2PN8 A;  1WWJ A;  2CAI A;  2ON7 A;  2YWI A;  4J57 E;  4IJ3 A;  1SK2 A;  5B7C A;  2F8A A;  3RBT A;  3KP8 A;  4O7H A;  4MF5 A;  3VUR A;  4ID0 A;  3TKQ A;  3WYW A;  2DC5 A;  3TKS C;  5J9C A;  4AGS A;  4I6X A;  1F3B A;  3MYD A;  2YN1 A;  2RLI A;  1EOG A;  3RPP A;  1QMV A;  3EMX A;  4EC0 A;  2O89 A;  4MDC A;  2FHE A;  5ECO B;  1O6J A;  3NOF A;  3WT1 A;  3O6T A;  4MP4 A;  3GTU B;  5HR2 A;  4MLY A;  1GLQ A;  4BWS A;  2HE3 A;  2JAC A;  1FB0 A;  5D93 A;  2VAF A;  1F6M C;  2GGT A;  1ERW A;  4HUA A;  2IFQ B;  3CBU A;  1GSE A;  3A2X A;  1GTA A;  3KGK A;  4IS0 A;  3UVH A;  2E7P A;  1M9A A;  1BED A;  3U5R E;  2R6K A;  2G2Q A;  3C1S A;  2VM1 A;  22GS A;  12GS A;  4IW9 A;  6GSU A;  1OYJ A;  4N11 A;  5ID2 B;  2RM5 A;  1A2J A;  1ERT A;  1OAZ A;  3UVT A;  1EGO A;  2GT5 A;  2OE1 A;  2ALB A;  2VM2 A;  2PER A;  5HR3 A;  4AJ8 A;  6GSX A;  3TOT A;  2LRC A;  2DKI A;  1SD8 A;  1SD9 A;  2YCD A;  5ECN B;  2EC4 A;  1M2A A;  3WGX A;  2FNO A;  5DCG A;  4ECI A;  5DAL B;  3EWL A;  3IC4 A;  2VL3 A;  3QOU A;  4PTS A;  1TXX A;  2YWN A;  3KCM A;  3DEX A;  2GQL A;  4FYC A;  4I5Q A;  4V2N A;  1ACV A;  5DAK B;  1OKD A;  3D6I A;  4XIH A;  3TRP A;  5IMD A;  4I2T A;  3D5J A;  1F2E A;  4PX1 A;  2DML A;  1XIY A;  2C0F A;  3UBK A;  4DSR A;  5B8A A;  5IOX A;  4KSM A;  4ZBD A;  2CX3 A;  4HS1 A;  2HZF A;  4OMV A;  5G1K A;  2CZ3 A;  3CYN A;  4L5L A;  5HFG A;  3GKK A;  1GUK A;  2AB6 A;  2LEG A;  1A2M A;  1XVW A;  3MNG A;  3VFI A;  3ZL5 A;  1EP7 A;  1O81 A;  3BBY A;  3F63 A;  3V1W A;  3WD6 A;  1B4P A;  3ERF A;  1BAY A;  3G9B A;  3BJ5 A;  1M2D A;  2HRA A;  2TRX A;  4HQS A;  2V2G A;  2FY6 A;  2PMT A;  2OAC A;  1V57 A;  1JZO A;  3IA1 A;  4GWR A;  5GAP D;  1FB6 A;  3VI7 A;  2YZH A;  2HYX A;  4Z7X A;  4KX4 A;  4PQH A;  3ZRE A;  1V9W A;  3GMF A;  2ON5 A;  4GF0 A;  4IN0 A;  5F0G A;  1SU9 A;  5AIX A;  2O7K A;  3R2Q A;  3L0H A;  4KE3 A;  2DMM A;  4MF6 A;  3LWA A;  3HJO A;  2HNL A;  1T00 A;  4OFN A;  3FEU A;  1E6B A;  1B4Q A;  3R3E A;  5IIZ A;  2G0F A;  2IL3 A;  3H93 A;  3IRA A;  4O5Q A;  1SYR A;  3LFL A;  2KOK A;  1TI3 A;  1K0M A;  1LBK A;  1Z5Y E;  2DJK A;  5HFI A;  1TW9 A;  4CDO A;  3PH9 A;  4XS4 B;  3VLN A;  2EIR A;  4NHW A;  2DJ0 A;  2DSA A;  1EWX A;  4Q5R A;  2PPT A;  1BG5 A;  2R2J A;  1PKZ A;  4TKY A;  2HRN A;  3ZVJ D;  3IOS A;  14GS A;  1AIU A;  3H1N A;  3KIJ A;  5JCG A;  5LNK e;  8GSS A;  1B8X A;  1O8X A;  1GRX A;  2XPD A;  3HZ8 A;  5KN0 A;  1ZOF A;  4OO4 A;  4K0G A;  2DJ1 A;  2H70 A;  4OCF A;  4Z2R A;  4YQU A;  4KDY A;  4RQR A;  5CRE A;  5EPF A;  4E8E A;  1W4V A;  5KN3 A;  1MDI A;  5IO2 A;  3IXR A;  3APS A;  1AXD A;  2I3Y A;  1XVQ A;  1Z9H A;  2FGX A;  3Q18 A;  4N0V A;  1FOV A;  2PWJ A;  1K3Y A;  4K0N A;  3TJF A;  4MPG A;  3TJB A;  6GSW A;  1Z6M A;  1GH2 A;  1NM3 A;  1AC1 A;  4KCE A;  4V1A g;  1UN2 A;  3CTG A;  2C80 A;  1M9B A;  4ICY A;  1TK8 B;  5E4W A;  4BVX A;  5IPH A;  6GSV A;  3HVV A;  4ML1 A;  1K0C A;  3UBL A;  1X5E A;  4MCU A;  1THX A;  2VLT A;  1R26 A;  4EL1 A;  3F8U A;  4BVY B;  4YQV A;  3DRN A;  3RPN A;  18GS A;  4TXO A;  3HDC A;  1EEJ A;  1GTI A;  1XWA A;  4O5U A;  1ERV A;  3I43 A;  5CRW A;  3FK8 A;  4TR0 A;  4XS6 A;  3TJK A;  4F03 A;  4MZW A;  2LQO A;  1M99 A;  4FYB A;  4EIP A;  3CSI A;  3H79 A;  2PU9 C;  3D4T A;  1A8Y A;  4A5P A;  4HEA 2;  2CVD A;  1FO5 A;  2P0G A;  4GRF A;  2HSM A;  5KOW A;  1N8J A;  2VL2 C;  3UAR A;  2H75 A;  3GUS A;  3EMP A;  2E2G A;  1JLW A;  1YF1 A;  2M80 A;  1Y6E A;  1I9D A;  2M72 A;  3UOM A;  2I81 A;  2KLX A;  5A4V A;  3RDW A;  6GSS A;  1VF3 A;  3TRX A;  1JZD A;  3RHB A;  2HRF A;  1UC7 A;  1HYU A;  2FWE A;  1J08 A;  4YQM A;  3ME7 A;  2C8U A;  5IMV A;  2V6O A;  4ECJ A;  4JZQ A;  3SBC A;  4GXZ A;  4EUY A;  2RII A;  1ST9 A;  4ML6 A;  3QCP A;  1ZYE A;  1GSS A;  5CP1 A;  1AW9 A;  3L78 A;  2L5O A;  4PQ1 A;  2JSY A;  4DSS B;  4ECC A;  2QKE A;  2HSY A;  2GZY A;  4WF5 A;  2IIY A;  3ZLP A;  1U88 A;  1NHY A;  1AAZ A;  1Q4J A;  3IE3 A;  4USS A;  5ELG A;  1SEN A;  3VPQ A;  1QK8 A;  4NAX A;  3HJM A;  5DJL A;  4LL1 B;  4OD7 A;  3F9U A;  3EC3 A;  3MSZ A;  4CY6 A;  4PXO A;  2HI7 A;  1GUH A;  2LNT A;  2WZ9 A;  4GSN A;  3W8S A;  2M46 A;  3FYG A;  1C72 A;  3GST A;  1EP8 A;  5DDL A;  1EOH A;  4LMW A;  5IMA A;  3VWU A;  4KDU A;  3M8N A;  3L9S A;  3HYP A;  5C00 A;  4MMM A;  1YEX A;  4G19 A;  4PUF C;  1ZYP A;  5KN1 A;  1HQO A;  1ON4 A;  4I8B A;  2A4H A;  1FAA A;  4K6X A;  5KEJ A;  1KBN A;  2NPB A;  1OE7 A;  5IMF A;  5INY A;  2GS3 A;  16GS A;  4K8M A;  3DGQ A;  3KMN A;  1OC8 A;  2MMN A;  3QR6 A;  4L5O A;  1X5C A;  5DVB A;  6GST A;  2YNX A;  2A2P A;  5AIS A;  5ECR B;  5D9X A;  4D73 B;  2YAN A;  1TI1 A;  2YJ7 A;  3DML A;  1XW5 A;  2H1G A;  5DQY A;  11GS A;  2LUS A;  4OCE A;  1BJX A;  2OE3 A;  1ZCP A;  1XWC A;  4TR1 A;  2YWM A;  3ZMK A;  2PBJ A;  2V41 A;  2IME A;  2GDR A;  1RQM A;  1U3A A;  1OE8 A;  5H5Q A;  2JZR A;  4PUA A;  4AJ6 A;  5G30 A;  3Q6O A;  1TU8 A;  2GZZ A;  3M1G A;  1WP0 A;  5D96 A;  1WRY A;  2X99 A;  5H5R A;  2XHF A;  4NV2 A;  4ZBA A;  2V32 A;  1OKT A;  2H74 A;  4HZ2 A;  4L0W A;  2B5E A;  4TRX A;  1Z7R A;  2DIZ A;  2V1M A;  3IV4 A;  4TVE A;  4ULX A;  1K0D A;  5HR1 A;  3WGE A;  4FO5 A;  2REM A;  2IMK A;  2MMO A;  1ML6 A;  2C0G A;  1LU4 A;  4IGJ A;  2MMZ A;  5FWG A;  3PGT A;  4NMU A;  1XZO A;  1TRV A;  3P90 A;  1XOB A;  4PQI A;  2JSZ A;  2JAD A;  4JED A;  4MAB A;  1T8E B;  4F0B A;  3DWV A;  4CHS A;  1PD2 1;  2K8V A;  2B7J A;  3QDN A;  2RM6 A;  2YWO A;  1K0N A;  2VUP A;  3CSJ A;  2MYG A;  2K6V A;  1H75 A;  5AIV A;  1GUL A;  2VCW A;  4EDZ A;  3CXG A;  4KW6 A;  4LMV A;  4PUR A;  1UA5 A;  1SKS B;  3IHG A;  3KD0 A;  3ZIV A;  1OC9 A;  3GH9 A;  3NIV A;  2C0E A;  2H30 A;  3EU3 A;  3UEM A;  1GWC A;  4YAP A;  4IBP A;  3EE2 A;  4IKH A;  2NBS A;  2WGR A;  2F51 A;  4GSS A;  2CT6 A;  1GNW A;  1S3A A;  4J56 E;  4IEL A;  2JL4 A;  1EV9 A;  1XW6 A;  3WT2 A;  3LYP A;  3DYR A;  1V2A A;  5G1L A;  1EZK A;  3EVI A;  4ISD A;  5ECI B;  3PIN A;  4PNG A;  2O8V B;  2GVP A;  2K9F A;  3C73 A;  4MJB A;  4DSQ A;  3VPT A;  5ELA A;  4JRR A;  4P3Y B;  4O32 A;  1K0O A;  2GLR A;  1MDK A;  1VGL A;  1T1V A;  3P8W A;  1XXU A;  3E3E A;  4BL7 A;  1A0R P;  4OFT A;  2WDU A;  2YV9 A;  2P5R A;  2C1Y A;  3IBH A;  1SYX A;  3FZ4 A;  3ISO A;  1QGV A;  5D9T A;  1A8L A;  4WF4 A;  2LQQ A;  5D8I A;  2H1D A;  3GX8 A;  1TKD B;  2D2Z A;  5GSS A;  2XPE A;  2H6Z A;  2VL9 A;  4X0X A;  4ACS A;  3HD5 A;  5JCU A;  3KH9 A;  4KAE A;  2N5A A;  20GS A;  4ZL7 A;  1GP1 A;  2B5X A;  2H6X A;  4QQ7 A;  4WKW A;  3F6D A;  4IHU A;  2IMF A;  3GUR A;  1PN9 A;  5HFK A;  1R5A A;  5FHI A;  3U6V A;  3KXO A;  5CRG A;  3QPM A;  1T4Y A;  1G7E A;  1SK0 A;  2ZNM A;  2R0C A;  1W89 A;  2X4A A;  3IAS 2;  4LA1 A;  4G9H A;  3IR4 A;  1XOA A;  4FYU A;  3GTU A;  1XWB A;  3IPZ A;  3K8N A;  1SJ6 A;  2AYT A;  2FA4 A;  3BOA A;  2IFQ A;  3QAV A;  3ZRD A;  2GSR A;  3A2W A;  4KND A;  4TW5 A;  2AAW A;  2HXK A;  2L57 A;  3EU4 A;  5HQP A;  3GA4 A;  3D4M A;  3KP9 A;  2PVO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...