2MMAA

Nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
107
structure length
107
Chain Sequence
LTPQLKDTLEKLVNSEKVVLFMKGTRDFPMCGFSNTVVQILKNLNVPFEDVNILENEMLRQGLKEYSNWPTFPQLYIGGEFFGGCDITLEAFKTGELQEEVEKAMCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords Monothiol glutaredoxin-S14, chloroplastic
publication title Structural and Spectroscopic Insights into BolA-Glutaredoxin Complexes.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 34
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2mmaA01
3WYWA 5CRDA 1X5EA 1AIUA 1TI1A 3E0UA 4HJ2A 4POKA 1QMVA 1PGTA 2LJAA 1YJ6A 4NHZA 2OJLA 2DJKA 5HR2A 5COHA 3J7Yk 1KEBA 3UAPA 2B1LA 1FG4A 5KN0A 3QFAC 4ECIA 2B5XA 4JR6A 3WGEA 4FH8A 18GSA 2P0GA 4FYBA 1OC3A 14GSA 3DKSA 3US3A 4F0CA 4MDCA 3UOMA 5ABRA 4O7HA 1O8WA 2R6KA 3KZQA 2L4QA 4QL7A 3I69A 4ID0A 4EKZA 3A5WA 1BAYA 5AIXA 2H1AA 3TRXA 1GTUA 4KUNA 3I9V2 2OE3A 2VL2C 1OKTA 3HXSA 2I3YA 1MD4A 1PX6A 5LNKe 2XBIA 4X1UA 1SYRA 1W4VA 5GSSA 5LD0A 3TKSC 2PERA 1TTZA 3ZVJA 4TW5A 4WETA 4DSSB 1I5GA 2VCTA 2ON7A 5AN1A 1VF3A 5DQYA 4Q5FA 1XVQA 5IOWA 2P5QA 1GUHA 4PQHA 1JLVA 3FR6A 5IMDA 4HI7A 4TR3A 1U3IA 1GTIA 2YV7A 2GS3A 3ZLPA 6GSYA 4YQVA 5H5QA 19GSA 3D4TA 1QQ2A 3KD0A 2LQOA 5CRGA 2WB9A 3L9UA 2XHFA 1WOUA 2AHEA 3G7YA 3Q18A 3APQA 5G1LA 3CXGA 2MMOA 4YQMA 4BWSA 2CVBA 3UIWA 3NOFA 3O3TA 1A8LA 1SKRB 5IM9A 5B6MA 1E6BA 3DYRA 3UJ1A 3F4SA 1Z7RA 1X5CA 2H6XA 3IA1A 3QAWA 4O92A 3ZFBA 5B7CA 5HR0A 1T4ZA 3PH9A 2P5RA 2AAWA 3VWVA 1TRSA 3M1GA 2HFDA 2R4VA 3IDVA 11GSA 1SU9A 1GNWA 2H74A 2LJKA 4K2DA 4G10A 2HE3A 2GLRA 5IO0A 1ST9A 1RK4A 1XW5A 4EC0A 4K6XA 2K8VA 1Z3EA 5A5KA 5JWOB 2YWMA 1QXHA 2H72A 4TR4A 4IJIA 4FYCA 5IO2A 1J0FA 2G2QA 1X9WB 2VD1A 4EVMA 3QDNA 4NV2A 1ILOA 1Z9HA 2RUEA 3R2QA 2MYGA 3N5OA 1X9MB 1OE7A 4EDZA 3TJBA 1U6TA 2YP6A 4V1Ap 3D6IA 2M46A 2H1DA 2GVPA 1LJRA 1W89A 4WF5A 4JE1A 4DEJA 3KEBA 1F37A 2DBCA 2PU9C 4MK3A 4ZB8A 4MH2A 3TOUA 1TI3A 2HT9A 5ID2A 2C8UA 1M9BA 5AISA 2VCWA 4EE0A 4L8EA 3RPPA 3VPTA 1SYXA 4I8BA 5CRHA 4PURA 2FWEA 3ZZXA 4MABA 3F4RA 4K0GA 4ACSA 3QD9A 4HZ4A 1ERTA 17GSA 4NV5A 4YAVA 3IR4A 5JCGA 4OFTA 5DDLA 4L0UA 2DSAA 1PN9A 2HLSA 3H79A 4L5LA 4KCEA 1K0DA 2VLUA 2MZCA 4OWYA 1RQMA 2BMXA 1QUWA 4EL1A 4ZL8A 4ZBAA 1OC8A 3QAVA 3WGXA 3HZ4A 2GTUA 3EURA 5DALA 3TRPA 1OAZA 4PNFA 2QGVA 3ZREA 1QK8A 2NBSA 2GSQA 4GSTA 1GUKA 1SK1A 2DMLA 4V2LA 1T1VA 2LTKA 1GSQA 5IPGA 1R7HA 3A3TA 2C3TA 1TDIA 2C3QA 2VCXA 2H30A 1NW2A 5G30A 1PL2A 3VWWA 4J2FA 5F07A 3P8WA 2H70A 2I4AA 3GV1A 2AJQB 3HKRA 2VCQA 1R4WA 3VWUA 3K8NA 3LWAA 1DUGA 1PD21 4ML6A 2FY6A 2LNSA 1VF2A 3S9FA 1ZYEA 5H5RA 5G31A 5HFIA 5D9XA 2FHEA 1EP7A 3V1WA 3IPZA 1R5AA 3GX8A 4EUYA 1ZYQB 5CAXA 2VCZA 2ON5A 1V40A 2CAIA 3TUEA 1BJXA 1EOGA 3DWVA 5ID2B 4D73A 2ALBA 3HZ8A 3KM6A 1XWBA 4K0NA 4LL4B 1F2EA 2PVQA 2GZYA 4XHMA 4OCEA 4YQUA 4IVFA 1JFUA 2LUSA 2QSIA 4MZBA 1A23A 2A4VA 3FKFA 4L5OA 3LORA 1XZOA 1AAZA 3FEUA 4V1Ag 1YF1A 4RI7A 4XRDA 1PQNA 2V6OA 2FWFA 1M7TA 3AY8A 4ZL9A 4LL1B 1X0RA 2BJXA 5ECLB 1Q98A 4IW9A 5DALB 5F8BA 2C0EA 2JSYA 1GSYA 2C0GA 4AF2A 3CMIA 2N5FA 3IAS2 1FVKA 1CQGA 4TOPA 1V9WA 2H1BA 2WULA 2AYTA 5ECNB 1A0FA 1OC9A 5HQPA 5ECRB 2VL3A 1TU8A 5HR1A 3CTGA 1WJKA 1OE8A 4ECCA 4MJAA 3KJYA 1YKCA 2X8HA 5J4UA 4HU7A 4N0ZA 1E2YA 1VF4A 2X99A 1XPVA 3OR5A 2MBTA 1Z6MA 2HZFA 3HY2A 2OACA 2PPTA 1XFLA 2GSRA 3ZTLA 3F3QA 1DE2A 1VRSD 3NIVA 4F9ZA 1XWAA 1G6WA 3HA9A 2JSZA 3FR9A 3F6FA 2E0QA 4EF0A 2L57A 3LQ7A 1ERWA 2D2ZA 2CX4A 4PQ1A 4ZXGA 4OFNA 3MNGA 3EMXA 1EEJA 2H75A 1VF1A 3HJOA 4CW9A 1F3BA 1H4OA 2L6DA 4IQAA 5FHIA 2LNTA 3TCOA 3ZIVA 4KW6A 4OO5A 1KTEA 4GXZA 2VL9A 3UVHA 1M9AA 1XOAA 5KN3A 2O89A 4MP4A 5CO3A 1FVJA 3D5JA 3P2AA 2ES7A 2G0FA 2H01A 2WZ9A 1HQOA 2B7JA 1I9DA 3PINA 1SKSB 1JZWA 5L71A 1ZCPA 1LU4A 1FB0A 5IMVA 1TRUA 1WE0A 1G0TA 5AGYA 3CRUA 2OADA 1SL1B 4NXIA 1OC9B 5IOXA 3Q19A 1XWCA 4KDXA 3UL3A 3DIEA 3G7IA 1UN2A 1B4PA 1THOA 1BYEA 3GL5A 3IC4A 5B6NA 1HD2A 4MPGA 1O73A 2RM6A 3A2XA 1GTBA 5G5EA 2XC2A 1F3AA 2LQQA 1T7PB 3FZ9A 3DVWA 1KBNA 1T8EB 2EIRA 3LYKA 2B5EA 1YEXA 3H4KA 1YZXA 1TP9A 1FW1A 5LCZA 1A2LA 5J9BA 1N2AA 2NTOA 3L78A 1U88A 1EGRA 3ZRDA 2CVKA 5ECPB 5FT3A 4HQSA 4N10A 1ON4A 1GSDA 3RDWA 2GDRA 2H6ZA 4TRXA 3VURA 2R5GA 4DSQA 1HNCA 2H1GA 2MMNA 2JU5A 2K9FA 2QKEA 1ZL9A 2IMFA 1SK0A 2RUFA 3FR3A 4BA7A 4G9HA 3GSSA 2GT6A 1XXUA 1FO5A 1S3AA 3IV4A 1K3LA 2AB6A 3I43A 4GTUA 3F3RA 2I9HA 1GSEA 2AV4A 3GN3A 4P3YB 2K6VA 2F9SA 2R37A 4N30A 2H73A 3IK7A 3HHVA 3CYNA 2CX3A 4MA9A 3M3MA 1T4YA 4ZILA 3HVVA 1FHEA 1AQVA 2DIYA 5D9TA 3GH6A 1V58A 4JEDA 1M0UA 4XS6A 4IBPA 2K18A 5EVOA 3RBTA 1WPIA 2C0FA 2TIRA 1EV9A 1UC7A 4BL7A 1DBYA 4HZ2A 4MPFA 9GSSA 2MMAA 3CBUA 2KP1A 4HU9A 3TJKA 1C72A 1IYHA 3GH9A 1Q4JA 2WS2A 4KSOA 3BCKA 1X9SB 3H1NA 4HUAA 4RQRA 3ZIJA 1PA3A 2CVDA 5INYA 1F6MC 4QQ7A 1PKZA 4POLA 5ELGA 3DMLA 4O5RA 2CV4A 1MDJA 1DE1A 2GSSA 2KHPA 1TJDA 3GIXA 4KCAA 1JLWA 5B8BA 4AJ8A 1S3DA 2IMKA 3TDGA 2J9HA 3C7MA 5CP1A 2CA8A 2B6MA 1JZRA 2X64A 4RQXA 2OKAA 4TR0A 4TR1A 1GH2A 3IOSA 3LEFA 1Y6EA 1EV4A 3ISOA 1XVWA 2WGRA 4NMUA 2E2GA 5D9WA 4MJCA 1ACVA 1SD9A 2DJ2A 4J57E 2Z9SA 3D0ZA 3VK9A 1M99A 3GNJA 2JACA 5ECHB 3RHBA 5JWQB 2H66A 2VO4A 1UVZA 3SWLA 3DEXA 1BEDA 2GQLA 4AJ6A 3O6TA 4HEA2 2C3NA 4KDYA 4KDUA 7GSSA 3PGTA 2IFQA 2DJ3A 1XCCA 1THXA 3UVTA 3IRAA 1TW9A 2H0HA 3H8QA 1ZZYA 3VWXA 2K8SA 20GSA 2YWNA 4BPYA 4EO3A 3PR8A 5CRWA 1SD8A 2YZUA 4LMWA 1GULA 2H19A 3UBKA 2IMIA 1A2MA 3GL3A 3TB2A 1Z6NA 4IS0A 4GCIA 1TK8B 3QR6A 1K0MA 4GF0A 4I97A 1XWGA 4AJ7A 3ZMKA 1ABAA 1WP0A 4IQ1A 4ZB6A 4Q5QA 1NHOA 2YNXA 3IHQA 1SJ6A 1O6JA 6GSUA 4FYUA 3LG6A 1BX9A 3MSZA 4GRFA 5D9VA 3EE2A 4IGJA 1SL0B 3GKXA 4IHUA 2H76A 2GQMA 3ZFLA 3CRTA 1PSQA 2O7KA 1JZOA 2V1MA 4JZQA 16GSA 2L59A 2VUPA 2GGTA 4TR1B 4WR5A 4ECBA 4JR4A 2DJ0A 3TRQA 5DQSA 4KSMA 2VL2A 3F4TA 4NWYA 4ZBDA 2MMZA 3L0HA 5EPFA 2JZTA 3F6DA 3I6AA 2YJHA 2FGXA 4V2NA 4GLTA 5FWGA 3KIJA 1AW9A 3C73A 4EXJA 3D22A 2FA4A 3LJRA 4OMVA 6GSVA 3IK9A 5JCUA 2VM2A 2IFQB 2B5YA 2VOCA 3IE3A 5A4VA 2OBIA 2FWHA 3HD5A 4JBBA 3KMNA 4XS4A 1USBA 2C80A 3KGKA 2KP2A 2WFCA 1YQ1A 1HNBA 3IXRA 3LXTA 4KA0A 2HRNA 5KEJA 4RI6A 4YAPA 3UBLA 3TOTA 4NPBA 2FD3A 3EVIA 2YPMA 3O76A 1ZMAA 2R2JA 1EZKA 2WRTA 1AC1A 5J3RA 3DGQA 2ZNMA 1O7UA 1B9YC 1B9XC 4LMVA 3EINA 2RLIA 3EU3A 4MF7A 1SJZA 2JZRA 2WDUA 2JADA 1TRWA 4MF5A 3TKQA 4OO4A 2B7KA 1UA5A 2E7PA 2EC4A 2XPDA 1J08A 4HJMA 2L6CA 3ERFA 4MZWA 3UEMA 3ED3A 12GSA 2B3SA 2IPAA 4I2UA 4DVCA 3BJ5A 5D93A 4I2TA 3HVSA 3LXZA 3BD2A 4PUFC 1X5DA 1U3AA 2IN3A 4IP1A 4MH3A 3ERGA 3CSHA 3M8NA 2LEGA 4WEYA 2F51A 2YN1A 1XWKA 4K7NA 3GTUA 3FHKA 2PVOC 4GQCA 3ME7A 2FA8A 5B8AA 3HDCA 5DJLA 1TK0B 3GMFA 2CT6A 3FZ4A 5D96A 4XS1A 4L0WA 5ECSA 2CZ2A 5HFGA 5D8IA 4XS4B 4GQFA 4GSNA 3A2WA 1MDKA 1A24A 3QOUA 1B48A 2IMDA 5DCGA 1XOBA 4JU5A 1OVNA 5G5FA 2KLXA 4MZCA 3GHAA 2PMTA 3QAGA 4V2MA 4TKYA 4KH7A 1R5PA 1YDKA 3UARA 1NM3A 2VD0A 3FW2A 2JZSA 6GSSA 1K0CA 2GT5A 4FIWA 2HSYA 3C8EA 1WIKA 2H71A 4IKHA 2KOKA 1ZOFA 2NPBA 3VI5A 1ML6A 2H0IA 1SL2B 2HZEA 2VLTA 2IIYA 4MLYA 4H86A 2YZHA 1O81A 1FAAA 5GZZB 4MJEA 2H8LA 3GSTA 3EMPA 4X43A 6GSWA 4TXOA 1FB6A 2YOIA 3GFKA 4F2IA 2QC7A 4MMMA 1PKWA 4E8HA 4PNGA 1K0BA 3ZITA 4KB3A 1GTAA 2L4CA 4F03A 3U6VA 4HQZA 1JHBA 5ECOB 5JCWA 1BQ7A 5HFKA 2LRNA 1OYJA 4ZL7A 3GTUB 1GNEA 2YANA 3TKRA 1PX7A 1ERUA 4MJBA 2A2SA 4XIHA 5GSTA 2GZZA 2CAQA 3KMOA 3F8UA 2NDOA 1XW9A 4AGSA 1YF0A 5F05A 2IL3A 1XIYA 2XPEA 5CREA 4ISDA 2IJYA 3GX0A 2FWGA 1T3BA 4GSSA 5GAND 3WD6A 2HXKA 4Z7XA 2DJ1A 4X0XA 3FY7A 3TKSE 5DBQA 2V2GA 1MTCA 5J41A 2H0GA 2O85A 2V41A 3N9JA 4HS1A 3M0FA 1TU7A 5C00A 2VCVA 4QL9A 5G1KA 4TXVA 3LYPA 1U87A 1V98A 3DXBA 5CNWA 3F63A 3UMAA 5ECQB 1N8JA 3GRXA 1AQWA 1O85A 1K3YA 3APSA 2HZEB 2FLSA 4PX1A 1AQXA 5E4WA 4GWRA 1XW6A 4E8EA 4BVYA 4IP6A 5DAKA 2MBSA 13GSA 2A2RA 3VFIA 2DMMA 4WBRD 2OA7A 2X8GA 1IYIA 1YEPA 1TXXA 2YWIA 3QMXA 1CQHA 3GKMA 2CZ3A 4TXOB 4IJ3A 2N5BA 4WF4A 3DRNA 3IBHA 4OFMA 5KN2A 2LRTA 5A4UA 1F9MA 1GLPA 2N5AA 4KNDA 6GSXA 1GSUA 4PGTA 1HYUA 2FCHA 2E2MA 2I81A 1GLQA 5C04A 4XRAA 2M72A 5JWRB 4N11A 1R26A 3GKKA 4WR4A 3VPQA 3ZMLA 2C4JA 1K0AA 2JL4A 2TRCP 3LGCA 3CTFA 1TOFA 5ECIB 1PL1A 4BVXA 1G7OA 1B8XA 2DIZA 2TRXA 2IWTA 3P90A 4ULXA 4ECJA 2LSTA 5GAPD 1VGLA 2YCDA 2J23A 1M2DA 3EWLA 4KX4A 2ZUPA 2X8CA 2HI7A 3EYTA 2P31A 2GQKA 1B4QA 4NHWA 2V6KA 1EP8A 1SK2A 3TKPA 1ERVA 2DC5A 5G2ZA 3VI7A 4K1FA 3L9VA 1YY7A 4I6XA 1RW1A 2YWOA 3EU4A 4CHSA 8GSSA 4CDOA 5ENUA 2LJRA 2OE0A 4K7OA 2I1UA 3E3EA 3DD3A 3RAZA 5IQYA 3WT2A 2L5LA 2LRCA 4ILFA 2HNLA 3W8SA 3WT1A 3G9BA 5DAKB 3IAM2 1T00A 2PUKC 4PQIA 5H5SA 4XTSA 3BBYA 3M9KA 1J9BA 4K9ZA 1AUCA 5J9CA 3D21A 1FOVA 3ZYWA 4DSRA 2RM5A 3WGDA 2B1KA 4IELA 1M2BA 1GUMA 4LLRA 3U5RE 1QFNA 3GKNA 1NHYA 5AIVA 2FNOA 5A4WA 3FRCA 3E9JB 3KP9A 4TVEA 4EDYA 1GWCA 5IMCA 2HRFA 1WWJA 2EIQA 3GA4A 3HJMA 4KAEA 1Z7PA 4HDEA 3APOA 4XCSA 4F0BA 3KP8A 3HJPA 3DVXA 1TK5B 1SJIA 3LSZA 2GSTA 4TN8A 5KN1A 3P7XA 2PBJA 3QCPA 4WXTA 3BCIA 1O8XA 2R3XA 4G19A 2F8FA 1M2AA 1MDIA 2LS5A 3VLNA 1EOHA 3H93A 2WCIA 4YH2A 4K7IA 4ML1A 4PUAA 3MDKA 4G2EA 4K8MA 1A0RP 2O87A 4ZBBA 3TJJA 2IMEA 2LV3A 1ZGNA 4F82A 1HNAA 1TKDB 2C0DA 3KH9A 5F0GA 3JCML 2VIMA 4WBJA 3KXOA 2YV9A 3GYKA 5IMFA 3TKSA 4LA1A 2O8VB 3L4NA 4JRRA 1GSSA 1S3CA 5DJMA 3FZ5A 5EY6A 1G7EA 5IPHA 4Q5NA 2PN8A 1XBSA 3HYPA 1PRXA 4MCUA 2PGTA 1WRYA 2H6YA 1V2AA 3CSJA 2PWJA 3QPMA 3QFBC 1LBKA 1OKDA 1A8YA 3CSIA 3FZAA 2KUCA 3L9SA 2V32A 1SENA 1QGVA 3LFLA 4ZIJA 3FYGA 2DJJA 1GP1A 3GURA 4WKWA 3J7Yb 4BWQA 2F8AA 3G7JA 1K0NA 3ZVJD 1G6YA 1K3OA 4O32A 4POMA 1GL8A 3C1RA 2WJUA 2BTOT 1DSBA 3MAKA 1EGOA 4I5QA 3TJFA 22GSA 5ELAA 1JZDA 3ME8A 2OBKA 4Q5RA 3FK8A 1URMA 3TGZA 5J5NA 3HCZA 3KTLA 2CQ9A 1PMTA 3W6GA 4RUVA 4FO5A 3MWHA 3BOAA 1EEMA 3GUSA 4KGIA 1MEKA 2XBQA 2HSHA 2DLXA 10GSA 2VAFA 4NAXA 1KNGA 4POBA 5DCHA 3W8JA 1H75A 3HVXA 2LKUA 5CYYA 1EWXA 5EL8A 1YKAA 4MF6A 2AUVA 2M80A 1Z5YE 5ECKB 5IIZA 3C71A 4IN0A 1TRVA 1BG5A 3RHCA 3KH7A 2L5OA 2VLVA 3Q6OA 4N0VA 2EIOA 2YJ7A 3RPNA 5ECMB 2F3MA 1A2JA 4KE3A 1SKWB 5IMZA 2OE1A 2HYXA 1V57A 3TJGA 4OD7A 5D73A 4ZB9A 2GZPA 4D73B 3NZNA 2REMA 6GSTA 3F0IA 1AXDA 2C1YA 1Y25A 3SBCA 2VM1A 1GRXA 2ZCTA 4OCFA 1K0OA 2FUG2 3D4MA 4PXOA 1NSWA 3F9UA 3KTBA 1GSFA 5HR3A 5IMAA 3ZL5A 5F06A 3M9JA 3A2VA 4J56E 2RIIA 1WMJA 4DSSA 4HOJA 5E59A 3Q74A 3ERWA 3C1SA 1MD3A 2NVLA 3KCMA 3EC3A 5DVBA
chains in the Genus database with same CATH superfamily
3WYWA 5CRDA 1X5EA 1AIUA 1TI1A 3E0UA 4HJ2A 4POKA 1QMVA 4K2XA 1PGTA 2LJAA 1YJ6A 4NHZA 2OJLA 2DJKA 5HR2A 5COHA 3J7Yk 4MNNA 1KEBA 3UAPA 2B1LA 1FG4A 5KN0A 3QFAC 4ECIA 2B5XA 4JR6A 3WGEA 4FH8A 18GSA 2P0GA 4FYBA 1OC3A 3CQFA 14GSA 3DKSA 3US3A 4F0CA 4MDCA 3UOMA 5ABRA 4O7HA 1O8WA 2R6KA 3KZQA 2L4QA 4QL7A 3I69A 4ID0A 1PFOA 4EKZA 3A5WA 4Z2TA 1BAYA 5AIXA 2H1AA 3TRXA 1GTUA 4KUNA 3I9V2 2OE3A 2VL2C 1OKTA 3HXSA 2I3YA 1MD4A 1PX6A 5LNKe 2XBIA 4X1UA 1SYRA 1W4VA 5GSSA 5LD0A 2X49A 3TKSC 3EPTA 2PERA 1TTZA 3ZVJA 4TW5A 4WETA 4DSSB 1I5GA 2VCTA 2ON7A 5AN1A 1VF3A 5DQYA 4Q5FA 1XVQA 5IOWA 2P5QA 1GUHA 4PQHA 1JLVA 3FR6A 5IMDA 4HI7A 4TR3A 3R3EA 1U3IA 1GTIA 2YV7A 2GS3A 3ZLPA 6GSYA 4YQVA 5H5QA 19GSA 3D4TA 1QQ2A 3KD0A 2LQOA 5CRGA 3IC8A 2WB9A 3L9UA 2XHFA 4K5SA 1WOUA 2AHEA 3G7YA 3Q18A 3APQA 5G1LA 3CXGA 2MMOA 4YQMA 4BWSA 2CVBA 3UIWA 3NOFA 3O3TA 1A8LA 1SKRB 5IM9A 5B6MA 1E6BA 3DYRA 3UJ1A 3MYDA 3F4SA 1Z7RA 1X5CA 2H6XA 3IA1A 3QAWA 4O92A 3ZFBA 5B7CA 5HR0A 1T4ZA 3PH9A 2P5RA 2AAWA 3VWVA 1TRSA 3M1GA 4G0LA 2HFDA 2R4VA 3IDVA 11GSA 3IHGA 1SU9A 1GNWA 2H74A 2LJKA 4K2DA 4USSA 4G10A 2HE3A 2GLRA 5IO0A 1ST9A 1RK4A 1XW5A 4EC0A 4K6XA 2K8VA 1Z3EA 5A5KA 5JWOB 2YWMA 1QXHA 2H72A 4TR4A 4IJIA 4FYCA 5IO2A 1J0FA 2G2QA 1X9WB 5BMUA 2VD1A 4EVMA 3QDNA 4NV2A 1ILOA 1Z9HA 2RUEA 3R2QA 2MYGA 3N5OA 1X9MB 1OE7A 4EDZA 3TJBA 1U6TA 2YP6A 4V1Ap 3D6IA 2M46A 2H1DA 2GVPA 1LJRA 1W89A 4WF5A 4JE1A 4DEJA 3KEBA 1F37A 2DBCA 2PU9C 4MK3A 4ZB8A 4MH2A 3TOUA 1TI3A 2HT9A 5ID2A 2C8UA 1M9BA 5AISA 2VCWA 4EE0A 4L8EA 3RPPA 3VPTA 1SYXA 4I8BA 5CRHA 4PURA 2FWEA 3ZZXA 4MABA 4CY8A 4G0KA 3F4RA 4K0GA 4ACSA 3QD9A 4HZ4A 1ERTA 17GSA 4NV5A 4YAVA 3IR4A 5JCGA 4OFTA 5DDLA 4L0UA 2DSAA 1PN9A 2HLSA 3H79A 4L5LA 4KCEA 1K0DA 2VLUA 2MZCA 4OWYA 1RQMA 2BMXA 1QUWA 4EL1A 4ZL8A 4ZBAA 1OC8A 3QAVA 3WGXA 3HZ4A 2GTUA 3EURA 5DALA 3TRPA 1OAZA 4PNFA 2QGVA 3ZREA 1QK8A 2NBSA 2GSQA 4GSTA 1GUKA 2R0CA 1SK1A 2DMLA 4V2LA 1T1VA 2LTKA 1GSQA 5IPGA 1R7HA 2DKHA 3A3TA 2C3TA 1TDIA 2C3QA 2VCXA 2H30A 1NW2A 5G30A 1PL2A 3VWWA 4J2FA 5F07A 3P8WA 2H70A 2I4AA 3GV1A 2AJQB 3HKRA 2VCQA 1R4WA 3VWUA 3K8NA 3LWAA 1DUGA 1PD21 4ML6A 2FY6A 2LNSA 1VF2A 3S9FA 1ZYEA 5H5RA 5G31A 5HFIA 5D9XA 2FHEA 1EP7A 3V1WA 3IPZA 1R5AA 3GX8A 4EUYA 1ZYQB 5CAXA 2VCZA 2ON5A 1V40A 2CAIA 3TUEA 1BJXA 1EOGA 3DWVA 5ID2B 4D73A 2ALBA 3HZ8A 3KM6A 1XWBA 4K0NA 4LL4B 1F2EA 2PVQA 2GZYA 4XHMA 4OCEA 4YQUA 4IVFA 1JFUA 2LUSA 2QSIA 4MZBA 1A23A 2A4VA 3FKFA 4L5OA 3LORA 1XZOA 1AAZA 3FEUA 4V1Ag 1YF1A 4RI7A 4XRDA 1PQNA 2V6OA 2FWFA 1M7TA 3AY8A 4ZL9A 4LL1B 1X0RA 1M3JA 2BJXA 5ECLB 1Q98A 4IW9A 5DALB 5F8BA 2C0EA 2JSYA 1GSYA 2C0GA 4AF2A 3CMIA 2N5FA 3IAS2 1FVKA 1CQGA 4TOPA 1V9WA 2H1BA 2WULA 2AYTA 5ECNB 1A0FA 1OC9A 5HQPA 5ECRB 2VL3A 1TU8A 5HR1A 3CTGA 1WJKA 1OE8A 4ECCA 4MJAA 3KJYA 1YKCA 2X8HA 4FQUA 5J4UA 4HU7A 4N0ZA 1E2YA 1VF4A 2X99A 1XPVA 2A4HA 3OR5A 2MBTA 1Z6MA 2HZFA 3HY2A 2OACA 2PPTA 2X4AA 1XFLA 2GSRA 3ZTLA 3F3QA 1DE2A 1VRSD 3NIVA 4F9ZA 1XWAA 1G6WA 3HA9A 2JSZA 3FR9A 3F6FA 2E0QA 4EF0A 2L57A 3LQ7A 1ERWA 2D2ZA 2CX4A 4PQ1A 4ZXGA 4OFNA 3MNGA 3EMXA 1EEJA 2H75A 1VF1A 3HJOA 4CW9A 1F3BA 1H4OA 2L6DA 4IQAA 5FHIA 3MIXA 2LNTA 3TCOA 3ZIVA 4KW6A 4OO5A 1KTEA 4GXZA 2VL9A 3UVHA 1M9AA 1XOAA 5KN3A 2O89A 4MP4A 5CO3A 1FVJA 3D5JA 3P2AA 2ES7A 2G0FA 2H01A 3A5IA 2WZ9A 1HQOA 2B7JA 1I9DA 3PINA 1SKSB 1JZWA 4G0IA 5L71A 1ZCPA 1LU4A 1FB0A 5IMVA 1TRUA 1WE0A 1G0TA 5AGYA 3CRUA 2OADA 1SL1B 4NXIA 1OC9B 2QA1A 5IOXA 3Q19A 1XWCA 4KDXA 3UL3A 3DIEA 3G7IA 1UN2A 1B4PA 1THOA 1BYEA 3GL5A 3IC4A 5B6NA 1HD2A 4MPGA 1O73A 2RM6A 3A2XA 1GTBA 5G5EA 2XC2A 4ICYA 1F3AA 2LQQA 1T7PB 3FZ9A 3DVWA 1KBNA 1T8EB 2EIRA 3LYKA 2B5EA 1YEXA 3H4KA 1YZXA 1TP9A 1FW1A 5LCZA 1A2LA 5J9BA 1N2AA 2NTOA 3L78A 1U88A 1EGRA 3ZRDA 2CVKA 4HSCX 5ECPB 5FT3A 4HQSA 4N10A 1ON4A 1GSDA 1M3IA 3RDWA 2GDRA 2H6ZA 4TRXA 3VURA 2R5GA 4DSQA 1HNCA 2H1GA 2MMNA 2JU5A 2K9FA 2QKEA 1ZL9A 2IMFA 1SK0A 2RUFA 3FR3A 4BA7A 4G9HA 3GSSA 2GT6A 1XXUA 1FO5A 1S3AA 1S3RA 3IV4A 1K3LA 2AB6A 3I43A 4GTUA 3F3RA 2I9HA 1GSEA 2AV4A 3GN3A 4P3YB 2K6VA 2F9SA 2R37A 4N30A 2H73A 3IK7A 3HHVA 3CYNA 2CX3A 4MA9A 3M3MA 1T4YA 4ZILA 3HVVA 1FHEA 1AQVA 2DIYA 5D9TA 3GH6A 1V58A 4JEDA 1M0UA 4XS6A 4IBPA 2K18A 5EVOA 3RBTA 1WPIA 2C0FA 2TIRA 1EV9A 1UC7A 4BL7A 1DBYA 4HZ2A 4MPFA 9GSSA 2MMAA 3CBUA 2KP1A 4HU9A 3TJKA 1C72A 1IYHA 3GH9A 1Q4JA 2WS2A 4KSOA 3BCKA 1X9SB 3H1NA 4HUAA 4RQRA 3ZIJA 1PA3A 2CVDA 5INYA 1F6MC 4QQ7A 1PKZA 4POLA 5ELGA 3DMLA 4O5RA 2CV4A 1MDJA 1DE1A 2GSSA 3HVNA 2KHPA 1TJDA 3GIXA 4KCAA 1JLWA 5B8BA 4AJ8A 1S3DA 2IMKA 3TDGA 2J9HA 3C7MA 5CP1A 2CA8A 4PTSA 2B6MA 1JZRA 2X64A 4RQXA 2OKAA 4TR0A 4TR1A 1GH2A 3IOSA 3LEFA 1Y6EA 1EV4A 3ISOA 1XVWA 2WGRA 4NMUA 2E2GA 5D9WA 4MJCA 1ACVA 1SD9A 2DJ2A 4J57E 2Z9SA 3D0ZA 3VK9A 1M99A 3GNJA 2JACA 5ECHB 3RHBA 5JWQB 2H66A 2VO4A 1UVZA 3SWLA 3DEXA 1BEDA 2GQLA 4AJ6A 3O6TA 4HEA2 2C3NA 4KDYA 4KDUA 7GSSA 3PGTA 2IFQA 2DJ3A 1XCCA 1THXA 3UVTA 3IRAA 1TW9A 2H0HA 3H8QA 1ZZYA 3VWXA 2K8SA 20GSA 2YWNA 4BPYA 4EO3A 3PR8A 5CRWA 1SD8A 2YZUA 4LMWA 1GULA 2H19A 4BL7B 3UBKA 2IMIA 1A2MA 3GL3A 3TB2A 1Z6NA 4IS0A 4GCIA 1TK8B 3QR6A 1K0MA 4GF0A 4I97A 1XWGA 4AJ7A 5BRTA 3ZMKA 1ABAA 1WP0A 4IQ1A 4ZB6A 4Q5QA 1NHOA 2YNXA 3IHQA 1SJ6A 1O6JA 6GSUA 4FYUA 3LG6A 1BX9A 3MSZA 4A5PA 4GRFA 5D9VA 3EE2A 4IGJA 1SL0B 3GKXA 4IHUA 2H76A 2GQMA 3ZFLA 3CRTA 1PSQA 5KOXA 2O7KA 1JZOA 2V1MA 4JZQA 16GSA 2L59A 2VUPA 2GGTA 4TR1B 3PPUA 4WR5A 4ECBA 4JR4A 2DJ0A 3TRQA 3FMWA 5DQSA 4KSMA 2VL2A 4YKFA 3F4TA 4NWYA 4ZBDA 2MMZA 3L0HA 5EPFA 4KF9A 2JZTA 3F6DA 3I6AA 2YJHA 2FGXA 4V2NA 4GLTA 5FWGA 3KIJA 1AW9A 3C73A 4EXJA 3D22A 2FA4A 3LJRA 4OMVA 6GSVA 3IK9A 5JCUA 2VM2A 2IFQB 2B5YA 2VOCA 3IE3A 2A2PA 4Z2UA 5A4VA 2OBIA 2FWHA 3HD5A 4JBBA 3KMNA 4XS4A 1USBA 2C80A 3KGKA 2KP2A 2WFCA 1YQ1A 1HNBA 3IXRA 3LXTA 4KA0A 2HRNA 5KEJA 4RI6A 4YAPA 3UBLA 3TOTA 4NPBA 2FD3A 3EVIA 2YPMA 3O76A 1ZMAA 2R2JA 1EZKA 2WRTA 1AC1A 5J3RA 3DGQA 2ZNMA 1O7UA 1B9YC 1B9XC 4LMVA 3EINA 2RLIA 3EU3A 4MF7A 1SJZA 2JZRA 2WDUA 2JADA 1TRWA 4MF5A 3TKQA 4OO4A 2B7KA 1UA5A 2E7PA 2EC4A 2XPDA 1J08A 4HJMA 2L6CA 3ERFA 4MZWA 3UEMA 3ED3A 12GSA 2B3SA 2IPAA 4I2UA 4DVCA 3BJ5A 5D93A 4I2TA 3HVSA 3LXZA 3BD2A 4PUFC 1X5DA 1U3AA 2IN3A 4IP1A 4MH3A 3ERGA 3CSHA 3M8NA 2LEGA 4WEYA 4K5RA 2F51A 2YN1A 1XWKA 4K7NA 3GTUA 3FHKA 2PVOC 4GQCA 3ME7A 2FA8A 5B8AA 3HDCA 5DJLA 1TK0B 3GMFA 4EIQA 2CT6A 3FZ4A 5D96A 4XS1A 4L0WA 5ECSA 2CZ2A 5HFGA 5D8IA 4XS4B 4GQFA 4GSNA 4O5QA 3A2WA 1MDKA 1A24A 3QOUA 1B48A 2IMDA 5DCGA 1XOBA 4JU5A 2R0GA 1OVNA 5G5FA 2KLXA 4MZCA 3GHAA 2PMTA 3QAGA 4V2MA 4TKYA 4KH7A 1R5PA 1YDKA 3UARA 1NM3A 2VD0A 3FW2A 2JZSA 6GSSA 1K0CA 2GT5A 4FIWA 2HSYA 3C8EA 1WIKA 2H71A 4IKHA 2KOKA 1ZOFA 2NPBA 3VI5A 1ML6A 2H0IA 1SL2B 2HZEA 2VLTA 2IIYA 4MLYA 4H86A 2YZHA 2UZ8A 1O81A 1FAAA 5GZZB 4MJEA 2H8LA 3GSTA 3EMPA 4X43A 6GSWA 4TXOA 1FB6A 2YOIA 3GFKA 4F2IA 2QC7A 4MMMA 1PKWA 4E8HA 4PNGA 1K0BA 3ZITA 4KB3A 1GTAA 2L4CA 4F03A 3U6VA 4HQZA 1JHBA 5ECOB 5JCWA 1BQ7A 5HFKA 2LRNA 1OYJA 4ZL7A 3GTUB 1GNEA 2YANA 3TKRA 1PX7A 1ERUA 4MJBA 2A2SA 3LW9A 4XIHA 5GSTA 2GZZA 2CAQA 3KMOA 3F8UA 4EIPA 2NDOA 1XW9A 4AGSA 1YF0A 5F05A 2IL3A 2QA2A 1XIYA 2XPEA 5CREA 4ISDA 2IJYA 3GX0A 2FWGA 1T3BA 4GSSA 2DKIA 5GAND 2HRKA 3WD6A 2HXKA 4Z7XA 2DJ1A 4X0XA 3FY7A 3TKSE 5DBQA 2V2GA 1MTCA 5J41A 2H0GA 2O85A 2V41A 3N9JA 4HS1A 3M0FA 1TU7A 5C00A 2VCVA 4QL9A 5G1KA 4TXVA 3LYPA 1U87A 1V98A 3DXBA 5CNWA 3F63A 3UMAA 5ECQB 1N8JA 3GRXA 1AQWA 1O85A 1K3YA 3APSA 2HZEB 2FLSA 4PX1A 1AQXA 5E4WA 4GWRA 1XW6A 4E8EA 4BVYA 4IP6A 5DAKA 2MBSA 13GSA 2A2RA 3VFIA 2DMMA 4WBRD 2OA7A 2X8GA 1IYIA 1YEPA 1TXXA 2YWIA 3QMXA 1CQHA 3GKMA 2CZ3A 4TXOB 4IJ3A 2N5BA 4WF4A 3DRNA 3IBHA 4OFMA 5KN2A 2LRTA 5A4UA 1F9MA 1GLPA 2N5AA 4KNDA 6GSXA 1GSUA 4PGTA 1HYUA 2FCHA 2E2MA 1PN0A 2I81A 1GLQA 5C04A 4XRAA 2M72A 5JWRB 4N11A 1R26A 3GKKA 4WR4A 3VPQA 3ZMLA 2C4JA 1K0AA 2JL4A 2TRCP 3LGCA 3CTFA 1TOFA 5ECIB 1PL1A 4BVXA 1G7OA 1B8XA 2DIZA 2TRXA 2IWTA 3P90A 4ULXA 4ECJA 2LSTA 5GAPD 1VGLA 2YCDA 2J23A 1M2DA 3EWLA 4KX4A 2ZUPA 2X8CA 2HI7A 3EYTA 2P31A 2GQKA 1B4QA 4NHWA 2V6KA 1EP8A 1SK2A 3TKPA 1ERVA 2DC5A 5G2ZA 3VI7A 4K1FA 3L9VA 1YY7A 4I6XA 1RW1A 2YWOA 3EU4A 4CHSA 8GSSA 4CDOA 5ENUA 2LJRA 2OE0A 4K7OA 2I1UA 3E3EA 3DD3A 3RAZA 5IQYA 3WT2A 2L5LA 2LRCA 4ILFA 2HNLA 3W8SA 3WT1A 4BVYB 3G9BA 5DAKB 3IAM2 1T00A 2PUKC 4PQIA 5H5SA 4XTSA 3BBYA 3M9KA 1J9BA 4K9ZA 1AUCA 5J9CA 3D21A 1FOVA 3ZYWA 4DSRA 2RM5A 4BIKA 3WGDA 2B1KA 4IELA 1M2BA 1GUMA 4LLRA 3U5RE 1QFNA 3GKNA 1NHYA 2HSMA 5AIVA 2FNOA 5A4WA 3FRCA 3E9JB 3KP9A 4TVEA 4EDYA 1GWCA 5IMCA 2HRFA 1WWJA 2EIQA 3GA4A 3HJMA 4KAEA 1Z7PA 4HDEA 3APOA 4XCSA 4F0BA 3KP8A 3HJPA 3DVXA 1TK5B 1SJIA 3LSZA 4BVXB 2GSTA 4TN8A 5KN1A 3P7XA 2PBJA 3QCPA 4WXTA 3BCIA 1O8XA 2R3XA 4G19A 2F8FA 1M2AA 1MDIA 2LS5A 3VLNA 1EOHA 3H93A 2WCIA 4YH2A 4K7IA 4ML1A 4PUAA 3MDKA 4G2EA 4K8MA 1A0RP 2O87A 4ZBBA 3TJJA 5KOWA 2IMEA 2LV3A 1ZGNA 4F82A 1ZYNA 1HNAA 1TKDB 2C0DA 3KH9A 5F0GA 3JCML 2VIMA 4WBJA 3KXOA 2YV9A 3GYKA 5IMFA 3TKSA 4LA1A 2O8VB 3L4NA 4JRRA 1GSSA 1S3CA 5DJMA 3FZ5A 5EY6A 1G7EA 5IPHA 4Q5NA 2PN8A 1XBSA 3HYPA 1PRXA 4MCUA 2PGTA 1WRYA 2H6YA 1V2AA 3CSJA 4Z2RA 2PWJA 3QPMA 3QFBC 1LBKA 1OKDA 1A8YA 3CSIA 3FZAA 2KUCA 3L9SA 2V32A 1SENA 1QGVA 3LFLA 4ZIJA 3FYGA 2DJJA 1GP1A 3GURA 4CY6A 4WKWA 1FOHA 3J7Yb 4BWQA 2F8AA 3G7JA 1K0NA 3ZVJD 4X4JA 1G6YA 1K3OA 1ZYPA 4O32A 4POMA 1GL8A 3C1RA 2WJUA 2BTOT 1DSBA 3MAKA 1EGOA 4I5QA 3TJFA 22GSA 5ELAA 2R0PA 1JZDA 3ME8A 2OBKA 4Q5RA 3FK8A 1URMA 3TGZA 5J5NA 3HCZA 3KTLA 2CQ9A 1PMTA 3W6GA 4RUVA 4FO5A 3MWHA 3BOAA 1EEMA 3GUSA 4KGIA 1MEKA 2XBQA 2HSHA 2DLXA 10GSA 2VAFA 4NAXA 1KNGA 4POBA 5DCHA 3W8JA 1H75A 3HVXA 2LKUA 5CYYA 1EWXA 5EL8A 1YKAA 4MF6A 2AUVA 2M80A 1Z5YE 5ECKB 5IIZA 3C71A 4IN0A 1TRVA 1BG5A 3RHCA 3KH7A 2L5OA 4O5UA 2VLVA 3Q6OA 4N0VA 2EIOA 2YJ7A 4YKGA 3RPNA 5ECMB 2F3MA 1A2JA 4KE3A 1SKWB 5IMZA 2OE1A 2HYXA 1V57A 3TJGA 2HRAA 4OD7A 5D73A 4ZB9A 2GZPA 4D73B 3NZNA 2REMA 6GSTA 3F0IA 1AXDA 2C1YA 1Y25A 3SBCA 2VM1A 1GRXA 2ZCTA 4OCFA 1K0OA 2FUG2 3D4MA 4PXOA 1NSWA 3F9UA 3KTBA 1GSFA 5HR3A 5IMAA 3ZL5A 5F06A 3M9JA 3A2VA 4J56E 2RIIA 1WMJA 4DSSA 4HOJA 5E59A 3Q74A 3ERWA 3C1SA 1MD3A 2NVLA 1XG8A 3KCMA 3EC3A 5DVBA
chains in the Genus database with same CATH topology
3WYWA 5CRDA 1X5EA 1AIUA 1TI1A 3E0UA 4HJ2A 4POKA 1QMVA 4K2XA 1PGTA 2LJAA 1YJ6A 4NHZA 2OJLA 2DJKA 5HR2A 5COHA 3J7Yk 4MNNA 1KEBA 3UAPA 2B1LA 1FG4A 5KN0A 3QFAC 4ECIA 2B5XA 4JR6A 3WGEA 4FH8A 18GSA 2P0GA 4FYBA 1OC3A 14GSA 3DKSA 3US3A 4F0CA 4MDCA 3UOMA 5ABRA 4O7HA 1O8WA 2R6KA 3KZQA 2L4QA 4QL7A 3I69A 4ID0A 4EKZA 3A5WA 4Z2TA 1BAYA 5AIXA 2H1AA 3TRXA 1GTUA 4KUNA 3I9V2 2OE3A 2VL2C 1OKTA 3HXSA 2I3YA 1MD4A 1PX6A 5LNKe 2XBIA 4X1UA 1SYRA 1W4VA 5GSSA 5LD0A 2X49A 3TKSC 3EPTA 2PERA 1TTZA 3ZVJA 4TW5A 4WETA 4DSSB 1I5GA 2VCTA 2ON7A 5AN1A 1VF3A 5DQYA 4Q5FA 1XVQA 5IOWA 2P5QA 1GUHA 4PQHA 1JLVA 3FR6A 5IMDA 4HI7A 4TR3A 3R3EA 1U3IA 1GTIA 2YV7A 2GS3A 3ZLPA 6GSYA 4YQVA 5H5QA 19GSA 3D4TA 1QQ2A 3KD0A 2LQOA 5CRGA 3IC8A 2WB9A 3L9UA 2XHFA 4K5SA 1WOUA 2AHEA 3G7YA 3Q18A 3APQA 5G1LA 3CXGA 2MMOA 4YQMA 4BWSA 2CVBA 3UIWA 3NOFA 3O3TA 1A8LA 1SKRB 5IM9A 5B6MA 1E6BA 3DYRA 3UJ1A 3MYDA 3F4SA 1Z7RA 1X5CA 2H6XA 3IA1A 3QAWA 4O92A 3ZFBA 5B7CA 5HR0A 1T4ZA 3PH9A 2P5RA 2AAWA 3VWVA 1TRSA 3M1GA 4G0LA 2HFDA 2R4VA 3IDVA 11GSA 3IHGA 1SU9A 1GNWA 2H74A 2LJKA 4K2DA 4USSA 4G10A 2HE3A 2GLRA 5IO0A 1ST9A 1RK4A 1XW5A 4EC0A 4K6XA 2K8VA 1Z3EA 5A5KA 5JWOB 2YWMA 1QXHA 2H72A 4TR4A 4IJIA 4FYCA 5IO2A 1J0FA 2G2QA 1X9WB 5BMUA 2VD1A 4EVMA 3QDNA 4NV2A 1ILOA 1Z9HA 2RUEA 3R2QA 2MYGA 3N5OA 1X9MB 1OE7A 4EDZA 3TJBA 1U6TA 2YP6A 4V1Ap 3D6IA 2M46A 2H1DA 2GVPA 1LJRA 1W89A 4WF5A 4JE1A 4DEJA 3KEBA 1F37A 2DBCA 2PU9C 4MK3A 4ZB8A 4MH2A 3TOUA 1TI3A 2HT9A 5ID2A 2C8UA 1M9BA 5AISA 2VCWA 4EE0A 4L8EA 3RPPA 3VPTA 1SYXA 4I8BA 5CRHA 4PURA 2FWEA 3ZZXA 4MABA 4CY8A 4G0KA 3F4RA 4K0GA 4ACSA 3QD9A 4HZ4A 1ERTA 17GSA 4NV5A 4YAVA 3IR4A 5JCGA 4OFTA 5DDLA 4L0UA 2DSAA 1PN9A 2HLSA 3H79A 4L5LA 4KCEA 1K0DA 2VLUA 2MZCA 4OWYA 1RQMA 2BMXA 1QUWA 4EL1A 4ZL8A 4ZBAA 1OC8A 3QAVA 3WGXA 3HZ4A 2GTUA 3EURA 5DALA 3TRPA 1OAZA 4PNFA 2QGVA 3ZREA 1QK8A 2NBSA 2GSQA 4GSTA 1GUKA 2R0CA 1SK1A 2DMLA 4V2LA 1T1VA 2LTKA 1GSQA 5IPGA 1R7HA 2DKHA 3A3TA 2C3TA 1TDIA 2C3QA 2VCXA 2H30A 1NW2A 5G30A 1PL2A 3VWWA 4J2FA 5F07A 3P8WA 2H70A 2I4AA 3GV1A 2AJQB 3HKRA 2VCQA 1R4WA 3VWUA 3K8NA 3LWAA 1DUGA 1PD21 4ML6A 2FY6A 2LNSA 1VF2A 3S9FA 1ZYEA 5H5RA 5G31A 5HFIA 5D9XA 2FHEA 1EP7A 3V1WA 3IPZA 1R5AA 3GX8A 4EUYA 1ZYQB 5CAXA 2VCZA 2ON5A 1V40A 2CAIA 3TUEA 1BJXA 1EOGA 3DWVA 5ID2B 4D73A 2ALBA 3HZ8A 3KM6A 1XWBA 4K0NA 4LL4B 1F2EA 2PVQA 2GZYA 4XHMA 4OCEA 4YQUA 4IVFA 1JFUA 2LUSA 2QSIA 4MZBA 1A23A 2A4VA 3FKFA 4L5OA 3LORA 1XZOA 1AAZA 3FEUA 4V1Ag 1YF1A 4RI7A 4XRDA 1PQNA 2V6OA 2FWFA 1M7TA 3AY8A 4ZL9A 4LL1B 1X0RA 2BJXA 5ECLB 1Q98A 4IW9A 5DALB 5F8BA 2C0EA 2JSYA 1GSYA 2C0GA 4AF2A 3CMIA 2N5FA 3IAS2 1FVKA 1CQGA 4TOPA 1V9WA 2H1BA 2WULA 2AYTA 5ECNB 1A0FA 1OC9A 5HQPA 5ECRB 2VL3A 1TU8A 5HR1A 3CTGA 1WJKA 1OE8A 4ECCA 4MJAA 3KJYA 1YKCA 2X8HA 4FQUA 5J4UA 4HU7A 4N0ZA 1E2YA 1VF4A 2X99A 1XPVA 2A4HA 3OR5A 2MBTA 1Z6MA 2HZFA 3HY2A 2OACA 2PPTA 2X4AA 1XFLA 2GSRA 3ZTLA 3F3QA 1DE2A 1VRSD 3NIVA 4F9ZA 1XWAA 1G6WA 3HA9A 2JSZA 3FR9A 3F6FA 2E0QA 4EF0A 2L57A 3LQ7A 1ERWA 2D2ZA 2CX4A 4PQ1A 4ZXGA 4OFNA 3MNGA 3EMXA 1EEJA 2H75A 1VF1A 3HJOA 4CW9A 1F3BA 1H4OA 2L6DA 4IQAA 5FHIA 3MIXA 2LNTA 3TCOA 3ZIVA 4KW6A 4OO5A 1KTEA 4GXZA 2VL9A 3UVHA 1M9AA 1XOAA 5KN3A 2O89A 4MP4A 5CO3A 1FVJA 3D5JA 3P2AA 2ES7A 2G0FA 2H01A 3A5IA 2WZ9A 1HQOA 2B7JA 1I9DA 3PINA 1SKSB 1JZWA 4G0IA 5L71A 1ZCPA 1LU4A 1FB0A 5IMVA 1TRUA 1WE0A 1G0TA 5AGYA 3CRUA 2OADA 1SL1B 4NXIA 1OC9B 2QA1A 5IOXA 3Q19A 1XWCA 4KDXA 3UL3A 3DIEA 3G7IA 1UN2A 1B4PA 1THOA 1BYEA 3GL5A 3IC4A 5B6NA 1HD2A 4MPGA 1O73A 2RM6A 3A2XA 1GTBA 5G5EA 2XC2A 4ICYA 1F3AA 2LQQA 1T7PB 3FZ9A 3DVWA 1KBNA 1T8EB 2EIRA 3LYKA 2B5EA 1YEXA 3H4KA 1YZXA 1TP9A 1FW1A 5LCZA 1A2LA 5J9BA 1N2AA 2NTOA 3L78A 1U88A 1EGRA 3ZRDA 2CVKA 5ECPB 5FT3A 4HQSA 4N10A 1ON4A 1GSDA 3RDWA 2GDRA 2H6ZA 4TRXA 3VURA 2R5GA 4DSQA 1HNCA 2H1GA 2MMNA 2JU5A 2K9FA 2QKEA 1ZL9A 2IMFA 1SK0A 2RUFA 3FR3A 4BA7A 4G9HA 3GSSA 2GT6A 1XXUA 1FO5A 1S3AA 3IV4A 1K3LA 2AB6A 3I43A 4GTUA 3F3RA 2I9HA 1GSEA 2AV4A 3GN3A 4P3YB 2K6VA 2F9SA 2R37A 4N30A 2H73A 3IK7A 3HHVA 3CYNA 2CX3A 4MA9A 3M3MA 1T4YA 4ZILA 3HVVA 1FHEA 1AQVA 2DIYA 5D9TA 3GH6A 1V58A 4JEDA 1M0UA 4XS6A 4IBPA 2K18A 5EVOA 3RBTA 1WPIA 2C0FA 2TIRA 1EV9A 1UC7A 4BL7A 1DBYA 4HZ2A 4MPFA 9GSSA 2MMAA 3CBUA 2KP1A 4HU9A 3TJKA 1C72A 1IYHA 3GH9A 1Q4JA 2WS2A 4KSOA 3BCKA 1X9SB 3H1NA 4HUAA 4RQRA 3ZIJA 1PA3A 2CVDA 5INYA 1F6MC 4QQ7A 1PKZA 4POLA 5ELGA 3DMLA 4O5RA 2CV4A 1MDJA 1DE1A 2GSSA 2KHPA 1TJDA 3GIXA 4KCAA 1JLWA 5B8BA 4AJ8A 1S3DA 2IMKA 3TDGA 2J9HA 3C7MA 5CP1A 2CA8A 4PTSA 2B6MA 1JZRA 2X64A 4RQXA 2OKAA 4TR0A 4TR1A 1GH2A 3IOSA 3LEFA 1Y6EA 1EV4A 3ISOA 1XVWA 2WGRA 4NMUA 2E2GA 5D9WA 4MJCA 1ACVA 1SD9A 2DJ2A 4J57E 2Z9SA 3D0ZA 3VK9A 1M99A 3GNJA 2JACA 5ECHB 3RHBA 5JWQB 2H66A 2VO4A 1UVZA 3SWLA 3DEXA 1BEDA 2GQLA 4AJ6A 3O6TA 4HEA2 2C3NA 4KDYA 4KDUA 7GSSA 3PGTA 2IFQA 2DJ3A 1XCCA 1THXA 3UVTA 3IRAA 1TW9A 2H0HA 3H8QA 1ZZYA 3VWXA 2K8SA 20GSA 2YWNA 4BPYA 4EO3A 3PR8A 5CRWA 1SD8A 2YZUA 4LMWA 1GULA 2H19A 4BL7B 3UBKA 2IMIA 1A2MA 3GL3A 3TB2A 1Z6NA 4IS0A 4GCIA 1TK8B 3QR6A 1K0MA 4GF0A 4I97A 1XWGA 4AJ7A 5BRTA 3ZMKA 1ABAA 1WP0A 4IQ1A 4ZB6A 4Q5QA 1NHOA 2YNXA 3IHQA 1SJ6A 1O6JA 6GSUA 4FYUA 3LG6A 1BX9A 3MSZA 4A5PA 4GRFA 5D9VA 3EE2A 4IGJA 1SL0B 3GKXA 4IHUA 2H76A 2GQMA 3ZFLA 3CRTA 1PSQA 5KOXA 2O7KA 1JZOA 2V1MA 4JZQA 16GSA 2L59A 2VUPA 2GGTA 4TR1B 3PPUA 4WR5A 4ECBA 4JR4A 2DJ0A 3TRQA 3FMWA 5DQSA 4KSMA 2VL2A 4YKFA 3F4TA 4NWYA 4ZBDA 2MMZA 3L0HA 5EPFA 4KF9A 2JZTA 3F6DA 3I6AA 2YJHA 2FGXA 4V2NA 4GLTA 5FWGA 3KIJA 1AW9A 3C73A 4EXJA 3D22A 2FA4A 3LJRA 4OMVA 6GSVA 3IK9A 5JCUA 2VM2A 2IFQB 2B5YA 2VOCA 3IE3A 2A2PA 4Z2UA 5A4VA 2OBIA 2FWHA 3HD5A 4JBBA 3KMNA 4XS4A 1USBA 2C80A 3KGKA 2KP2A 2WFCA 1YQ1A 1HNBA 3IXRA 3LXTA 4KA0A 2HRNA 5KEJA 4RI6A 4YAPA 3UBLA 3TOTA 4NPBA 2FD3A 3EVIA 2YPMA 3O76A 1ZMAA 2R2JA 1EZKA 2WRTA 1AC1A 5J3RA 3DGQA 2ZNMA 1O7UA 1B9YC 1B9XC 4LMVA 3EINA 2RLIA 3EU3A 4MF7A 1SJZA 2JZRA 2WDUA 2JADA 1TRWA 4MF5A 3TKQA 4OO4A 2B7KA 1UA5A 2E7PA 2EC4A 2XPDA 1J08A 4HJMA 2L6CA 3ERFA 4MZWA 3UEMA 3ED3A 12GSA 2B3SA 2IPAA 4I2UA 4DVCA 3BJ5A 5D93A 4I2TA 3HVSA 3LXZA 3BD2A 4PUFC 1X5DA 1U3AA 2IN3A 4IP1A 4MH3A 3ERGA 3CSHA 3M8NA 2LEGA 4WEYA 4K5RA 2F51A 2YN1A 1XWKA 4K7NA 3GTUA 3FHKA 2PVOC 4GQCA 3ME7A 2FA8A 5B8AA 3HDCA 5DJLA 1TK0B 3GMFA 4EIQA 2CT6A 3FZ4A 5D96A 4XS1A 4L0WA 5ECSA 2CZ2A 5HFGA 5D8IA 4XS4B 4GQFA 4GSNA 4O5QA 3A2WA 1MDKA 1A24A 3QOUA 1B48A 2IMDA 5DCGA 1XOBA 4JU5A 2R0GA 1OVNA 5G5FA 2KLXA 4MZCA 3GHAA 2PMTA 3QAGA 4V2MA 4TKYA 4KH7A 1R5PA 1YDKA 3UARA 1NM3A 2VD0A 3FW2A 2JZSA 6GSSA 1K0CA 2GT5A 4FIWA 2HSYA 3C8EA 1WIKA 2H71A 4IKHA 2KOKA 1ZOFA 2NPBA 3VI5A 1ML6A 2H0IA 1SL2B 2HZEA 2VLTA 2IIYA 4MLYA 4H86A 2YZHA 2UZ8A 1O81A 1FAAA 5GZZB 4MJEA 2H8LA 3GSTA 3EMPA 4X43A 6GSWA 4TXOA 1FB6A 2YOIA 3GFKA 4F2IA 2QC7A 4MMMA 1PKWA 4E8HA 4PNGA 1K0BA 3ZITA 4KB3A 1GTAA 2L4CA 4F03A 3U6VA 4HQZA 1JHBA 5ECOB 5JCWA 1BQ7A 5HFKA 2LRNA 1OYJA 4ZL7A 3GTUB 1GNEA 2YANA 3TKRA 1PX7A 1ERUA 4MJBA 2A2SA 3LW9A 4XIHA 5GSTA 2GZZA 2CAQA 3KMOA 3F8UA 4EIPA 2NDOA 1XW9A 4AGSA 1YF0A 5F05A 2IL3A 2QA2A 1XIYA 2XPEA 5CREA 4ISDA 2IJYA 3GX0A 2FWGA 1T3BA 4GSSA 2DKIA 5GAND 2HRKA 3WD6A 2HXKA 4Z7XA 2DJ1A 4X0XA 3FY7A 3TKSE 5DBQA 2V2GA 1MTCA 5J41A 2H0GA 2O85A 2V41A 3N9JA 4HS1A 3M0FA 1TU7A 5C00A 2VCVA 4QL9A 5G1KA 4TXVA 3LYPA 1U87A 1V98A 3DXBA 5CNWA 3F63A 3UMAA 5ECQB 1N8JA 3GRXA 1AQWA 1O85A 1K3YA 3APSA 2HZEB 2FLSA 4PX1A 1AQXA 5E4WA 4GWRA 1XW6A 4E8EA 4BVYA 4IP6A 5DAKA 2MBSA 13GSA 2A2RA 3VFIA 2DMMA 4WBRD 2OA7A 2X8GA 1IYIA 1YEPA 1TXXA 2YWIA 3QMXA 1CQHA 3GKMA 2CZ3A 4TXOB 4IJ3A 2N5BA 4WF4A 3DRNA 3IBHA 4OFMA 5KN2A 2LRTA 5A4UA 1F9MA 1GLPA 2N5AA 4KNDA 6GSXA 1GSUA 4PGTA 1HYUA 2FCHA 2E2MA 1PN0A 2I81A 1GLQA 5C04A 4XRAA 2M72A 5JWRB 4N11A 1R26A 3GKKA 4WR4A 3VPQA 3ZMLA 2C4JA 1K0AA 2JL4A 2TRCP 3LGCA 3CTFA 1TOFA 5ECIB 1PL1A 4BVXA 1G7OA 1B8XA 2DIZA 2TRXA 2IWTA 3P90A 4ULXA 4ECJA 2LSTA 5GAPD 1VGLA 2YCDA 2J23A 1M2DA 3EWLA 4KX4A 2ZUPA 2X8CA 2HI7A 3EYTA 2P31A 2GQKA 1B4QA 4NHWA 2V6KA 1EP8A 1SK2A 3TKPA 1ERVA 2DC5A 5G2ZA 3VI7A 4K1FA 3L9VA 1YY7A 4I6XA 1RW1A 2YWOA 3EU4A 4CHSA 8GSSA 4CDOA 5ENUA 2LJRA 2OE0A 4K7OA 2I1UA 3E3EA 3DD3A 3RAZA 5IQYA 3WT2A 2L5LA 2LRCA 4ILFA 2HNLA 3W8SA 3WT1A 4BVYB 3G9BA 5DAKB 3IAM2 1T00A 2PUKC 4PQIA 5H5SA 4XTSA 3BBYA 3M9KA 1J9BA 4K9ZA 1AUCA 5J9CA 3D21A 1FOVA 3ZYWA 4DSRA 2RM5A 3WGDA 2B1KA 4IELA 1M2BA 1GUMA 4LLRA 3U5RE 1QFNA 3GKNA 1NHYA 2HSMA 5AIVA 2FNOA 5A4WA 3FRCA 3E9JB 3KP9A 4TVEA 4EDYA 1GWCA 5IMCA 2HRFA 1WWJA 2EIQA 3GA4A 3HJMA 4KAEA 1Z7PA 4HDEA 3APOA 4XCSA 4F0BA 3KP8A 3HJPA 3DVXA 1TK5B 1SJIA 3LSZA 4BVXB 2GSTA 4TN8A 5KN1A 3P7XA 2PBJA 3QCPA 4WXTA 3BCIA 1O8XA 2R3XA 4G19A 2F8FA 1M2AA 1MDIA 2LS5A 3VLNA 1EOHA 3H93A 2WCIA 4YH2A 4K7IA 4ML1A 4PUAA 3MDKA 4G2EA 4K8MA 1A0RP 2O87A 4ZBBA 3TJJA 5KOWA 2IMEA 2LV3A 1ZGNA 4F82A 1ZYNA 1HNAA 1TKDB 2C0DA 3KH9A 5F0GA 3JCML 2VIMA 4WBJA 3KXOA 2YV9A 3GYKA 5IMFA 3TKSA 4LA1A 2O8VB 3L4NA 4JRRA 1GSSA 1S3CA 5DJMA 3FZ5A 5EY6A 1G7EA 5IPHA 4Q5NA 2PN8A 1XBSA 3HYPA 1PRXA 4MCUA 2PGTA 1WRYA 2H6YA 1V2AA 3CSJA 4Z2RA 2PWJA 3QPMA 3QFBC 1LBKA 1OKDA 1A8YA 3CSIA 3FZAA 2KUCA 3L9SA 2V32A 1SENA 1QGVA 3LFLA 4ZIJA 3FYGA 2DJJA 1GP1A 3GURA 4CY6A 4WKWA 1FOHA 3J7Yb 4BWQA 2F8AA 3G7JA 1K0NA 3ZVJD 4X4JA 1G6YA 1K3OA 1ZYPA 4O32A 4POMA 1GL8A 3C1RA 2WJUA 2BTOT 1DSBA 3MAKA 1EGOA 4I5QA 3TJFA 22GSA 5ELAA 2R0PA 1JZDA 3ME8A 2OBKA 4Q5RA 3FK8A 1URMA 3TGZA 5J5NA 3HCZA 3KTLA 2CQ9A 1PMTA 3W6GA 4RUVA 4FO5A 3MWHA 3BOAA 1EEMA 3GUSA 4KGIA 1MEKA 2XBQA 2HSHA 2DLXA 10GSA 2VAFA 4NAXA 1KNGA 4POBA 5DCHA 3W8JA 1H75A 3HVXA 2LKUA 5CYYA 1EWXA 5EL8A 1YKAA 4MF6A 2AUVA 2M80A 1Z5YE 5ECKB 5IIZA 3C71A 4IN0A 1TRVA 1BG5A 3RHCA 3KH7A 2L5OA 4O5UA 2VLVA 3Q6OA 4N0VA 2EIOA 2YJ7A 4YKGA 3RPNA 5ECMB 2F3MA 1A2JA 4KE3A 1SKWB 5IMZA 2OE1A 2HYXA 1V57A 3TJGA 2HRAA 4OD7A 5D73A 4ZB9A 2GZPA 4D73B 3NZNA 2REMA 6GSTA 3F0IA 1AXDA 2C1YA 1Y25A 3SBCA 2VM1A 1GRXA 2ZCTA 4OCFA 1K0OA 2FUG2 3D4MA 4PXOA 1NSWA 3F9UA 3KTBA 1GSFA 5HR3A 5IMAA 3ZL5A 5F06A 3M9JA 3A2VA 4J56E 2RIIA 1WMJA 4DSSA 4HOJA 5E59A 3Q74A 3ERWA 3C1SA 1MD3A 2NVLA 3KCMA 3EC3A 5DVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WYW A;  5CRD A;  1X5E A;  1AIU A;  1TI1 A;  3E0U A;  4HJ2 A;  4POK A;  1QMV A;  1PGT A;  2LJA A;  1YJ6 A;  4NHZ A;  2OJL A;  2DJK A;  5HR2 A;  5COH A;  3J7Y k;  1KEB A;  3UAP A;  2B1L A;  1FG4 A;  5KN0 A;  3QFA C;  4ECI A;  2B5X A;  4JR6 A;  3WGE A;  4FH8 A;  18GS A;  2P0G A;  4FYB A;  1OC3 A;  14GS A;  3DKS A;  3US3 A;  4F0C A;  4MDC A;  3UOM A;  5ABR A;  4O7H A;  1O8W A;  2R6K A;  3KZQ A;  2L4Q A;  4QL7 A;  3I69 A;  4ID0 A;  4EKZ A;  3A5W A;  1BAY A;  5AIX A;  2H1A A;  3TRX A;  1GTU A;  4KUN A;  3I9V 2;  2OE3 A;  2VL2 C;  1OKT A;  3HXS A;  2I3Y A;  1MD4 A;  1PX6 A;  5LNK e;  2XBI A;  4X1U A;  1SYR A;  1W4V A;  5GSS A;  5LD0 A;  3TKS C;  2PER A;  1TTZ A;  3ZVJ A;  4TW5 A;  4WET A;  4DSS B;  1I5G A;  2VCT A;  2ON7 A;  5AN1 A;  1VF3 A;  5DQY A;  4Q5F A;  1XVQ A;  5IOW A;  2P5Q A;  1GUH A;  4PQH A;  1JLV A;  3FR6 A;  5IMD A;  4HI7 A;  4TR3 A;  1U3I A;  1GTI A;  2YV7 A;  2GS3 A;  3ZLP A;  6GSY A;  4YQV A;  5H5Q A;  19GS A;  3D4T A;  1QQ2 A;  3KD0 A;  2LQO A;  5CRG A;  2WB9 A;  3L9U A;  2XHF A;  1WOU A;  2AHE A;  3G7Y A;  3Q18 A;  3APQ A;  5G1L A;  3CXG A;  2MMO A;  4YQM A;  4BWS A;  2CVB A;  3UIW A;  3NOF A;  3O3T A;  1A8L A;  1SKR B;  5IM9 A;  5B6M A;  1E6B A;  3DYR A;  3UJ1 A;  3F4S A;  1Z7R A;  1X5C A;  2H6X A;  3IA1 A;  3QAW A;  4O92 A;  3ZFB A;  5B7C A;  5HR0 A;  1T4Z A;  3PH9 A;  2P5R A;  2AAW A;  3VWV A;  1TRS A;  3M1G A;  2HFD A;  2R4V A;  3IDV A;  11GS A;  1SU9 A;  1GNW A;  2H74 A;  2LJK A;  4K2D A;  4G10 A;  2HE3 A;  2GLR A;  5IO0 A;  1ST9 A;  1RK4 A;  1XW5 A;  4EC0 A;  4K6X A;  2K8V A;  1Z3E A;  5A5K A;  5JWO B;  2YWM A;  1QXH A;  2H72 A;  4TR4 A;  4IJI A;  4FYC A;  5IO2 A;  1J0F A;  2G2Q A;  1X9W B;  2VD1 A;  4EVM A;  3QDN A;  4NV2 A;  1ILO A;  1Z9H A;  2RUE A;  3R2Q A;  2MYG A;  3N5O A;  1X9M B;  1OE7 A;  4EDZ A;  3TJB A;  1U6T A;  2YP6 A;  4V1A p;  3D6I A;  2M46 A;  2H1D A;  2GVP A;  1LJR A;  1W89 A;  4WF5 A;  4JE1 A;  4DEJ A;  3KEB A;  1F37 A;  2DBC A;  2PU9 C;  4MK3 A;  4ZB8 A;  4MH2 A;  3TOU A;  1TI3 A;  2HT9 A;  5ID2 A;  2C8U A;  1M9B A;  5AIS A;  2VCW A;  4EE0 A;  4L8E A;  3RPP A;  3VPT A;  1SYX A;  4I8B A;  5CRH A;  4PUR A;  2FWE A;  3ZZX A;  4MAB A;  3F4R A;  4K0G A;  4ACS A;  3QD9 A;  4HZ4 A;  1ERT A;  17GS A;  4NV5 A;  4YAV A;  3IR4 A;  5JCG A;  4OFT A;  5DDL A;  4L0U A;  2DSA A;  1PN9 A;  2HLS A;  3H79 A;  4L5L A;  4KCE A;  1K0D A;  2VLU A;  2MZC A;  4OWY A;  1RQM A;  2BMX A;  1QUW A;  4EL1 A;  4ZL8 A;  4ZBA A;  1OC8 A;  3QAV A;  3WGX A;  3HZ4 A;  2GTU A;  3EUR A;  5DAL A;  3TRP A;  1OAZ A;  4PNF A;  2QGV A;  3ZRE A;  1QK8 A;  2NBS A;  2GSQ A;  4GST A;  1GUK A;  1SK1 A;  2DML A;  4V2L A;  1T1V A;  2LTK A;  1GSQ A;  5IPG A;  1R7H A;  3A3T A;  2C3T A;  1TDI A;  2C3Q A;  2VCX A;  2H30 A;  1NW2 A;  5G30 A;  1PL2 A;  3VWW A;  4J2F A;  5F07 A;  3P8W A;  2H70 A;  2I4A A;  3GV1 A;  2AJQ B;  3HKR A;  2VCQ A;  1R4W A;  3VWU A;  3K8N A;  3LWA A;  1DUG A;  1PD2 1;  4ML6 A;  2FY6 A;  2LNS A;  1VF2 A;  3S9F A;  1ZYE A;  5H5R A;  5G31 A;  5HFI A;  5D9X A;  2FHE A;  1EP7 A;  3V1W A;  3IPZ A;  1R5A A;  3GX8 A;  4EUY A;  1ZYQ B;  5CAX A;  2VCZ A;  2ON5 A;  1V40 A;  2CAI A;  3TUE A;  1BJX A;  1EOG A;  3DWV A;  5ID2 B;  4D73 A;  2ALB A;  3HZ8 A;  3KM6 A;  1XWB A;  4K0N A;  4LL4 B;  1F2E A;  2PVQ A;  2GZY A;  4XHM A;  4OCE A;  4YQU A;  4IVF A;  1JFU A;  2LUS A;  2QSI A;  4MZB A;  1A23 A;  2A4V A;  3FKF A;  4L5O A;  3LOR A;  1XZO A;  1AAZ A;  3FEU A;  4V1A g;  1YF1 A;  4RI7 A;  4XRD A;  1PQN A;  2V6O A;  2FWF A;  1M7T A;  3AY8 A;  4ZL9 A;  4LL1 B;  1X0R A;  2BJX A;  5ECL B;  1Q98 A;  4IW9 A;  5DAL B;  5F8B A;  2C0E A;  2JSY A;  1GSY A;  2C0G A;  4AF2 A;  3CMI A;  2N5F A;  3IAS 2;  1FVK A;  1CQG A;  4TOP A;  1V9W A;  2H1B A;  2WUL A;  2AYT A;  5ECN B;  1A0F A;  1OC9 A;  5HQP A;  5ECR B;  2VL3 A;  1TU8 A;  5HR1 A;  3CTG A;  1WJK A;  1OE8 A;  4ECC A;  4MJA A;  3KJY A;  1YKC A;  2X8H A;  5J4U A;  4HU7 A;  4N0Z A;  1E2Y A;  1VF4 A;  2X99 A;  1XPV A;  3OR5 A;  2MBT A;  1Z6M A;  2HZF A;  3HY2 A;  2OAC A;  2PPT A;  1XFL A;  2GSR A;  3ZTL A;  3F3Q A;  1DE2 A;  1VRS D;  3NIV A;  4F9Z A;  1XWA A;  1G6W A;  3HA9 A;  2JSZ A;  3FR9 A;  3F6F A;  2E0Q A;  4EF0 A;  2L57 A;  3LQ7 A;  1ERW A;  2D2Z A;  2CX4 A;  4PQ1 A;  4ZXG A;  4OFN A;  3MNG A;  3EMX A;  1EEJ A;  2H75 A;  1VF1 A;  3HJO A;  4CW9 A;  1F3B A;  1H4O A;  2L6D A;  4IQA A;  5FHI A;  2LNT A;  3TCO A;  3ZIV A;  4KW6 A;  4OO5 A;  1KTE A;  4GXZ A;  2VL9 A;  3UVH A;  1M9A A;  1XOA A;  5KN3 A;  2O89 A;  4MP4 A;  5CO3 A;  1FVJ A;  3D5J A;  3P2A A;  2ES7 A;  2G0F A;  2H01 A;  2WZ9 A;  1HQO A;  2B7J A;  1I9D A;  3PIN A;  1SKS B;  1JZW A;  5L71 A;  1ZCP A;  1LU4 A;  1FB0 A;  5IMV A;  1TRU A;  1WE0 A;  1G0T A;  5AGY A;  3CRU A;  2OAD A;  1SL1 B;  4NXI A;  1OC9 B;  5IOX A;  3Q19 A;  1XWC A;  4KDX A;  3UL3 A;  3DIE A;  3G7I A;  1UN2 A;  1B4P A;  1THO A;  1BYE A;  3GL5 A;  3IC4 A;  5B6N A;  1HD2 A;  4MPG A;  1O73 A;  2RM6 A;  3A2X A;  1GTB A;  5G5E A;  2XC2 A;  1F3A A;  2LQQ A;  1T7P B;  3FZ9 A;  3DVW A;  1KBN A;  1T8E B;  2EIR A;  3LYK A;  2B5E A;  1YEX A;  3H4K A;  1YZX A;  1TP9 A;  1FW1 A;  5LCZ A;  1A2L A;  5J9B A;  1N2A A;  2NTO A;  3L78 A;  1U88 A;  1EGR A;  3ZRD A;  2CVK A;  5ECP B;  5FT3 A;  4HQS A;  4N10 A;  1ON4 A;  1GSD A;  3RDW A;  2GDR A;  2H6Z A;  4TRX A;  3VUR A;  2R5G A;  4DSQ A;  1HNC A;  2H1G A;  2MMN A;  2JU5 A;  2K9F A;  2QKE A;  1ZL9 A;  2IMF A;  1SK0 A;  2RUF A;  3FR3 A;  4BA7 A;  4G9H A;  3GSS A;  2GT6 A;  1XXU A;  1FO5 A;  1S3A A;  3IV4 A;  1K3L A;  2AB6 A;  3I43 A;  4GTU A;  3F3R A;  2I9H A;  1GSE A;  2AV4 A;  3GN3 A;  4P3Y B;  2K6V A;  2F9S A;  2R37 A;  4N30 A;  2H73 A;  3IK7 A;  3HHV A;  3CYN A;  2CX3 A;  4MA9 A;  3M3M A;  1T4Y A;  4ZIL A;  3HVV A;  1FHE A;  1AQV A;  2DIY A;  5D9T A;  3GH6 A;  1V58 A;  4JED A;  1M0U A;  4XS6 A;  4IBP A;  2K18 A;  5EVO A;  3RBT A;  1WPI A;  2C0F A;  2TIR A;  1EV9 A;  1UC7 A;  4BL7 A;  1DBY A;  4HZ2 A;  4MPF A;  9GSS A;  2MMA A;  3CBU A;  2KP1 A;  4HU9 A;  3TJK A;  1C72 A;  1IYH A;  3GH9 A;  1Q4J A;  2WS2 A;  4KSO A;  3BCK A;  1X9S B;  3H1N A;  4HUA A;  4RQR A;  3ZIJ A;  1PA3 A;  2CVD A;  5INY A;  1F6M C;  4QQ7 A;  1PKZ A;  4POL A;  5ELG A;  3DML A;  4O5R A;  2CV4 A;  1MDJ A;  1DE1 A;  2GSS A;  2KHP A;  1TJD A;  3GIX A;  4KCA A;  1JLW A;  5B8B A;  4AJ8 A;  1S3D A;  2IMK A;  3TDG A;  2J9H A;  3C7M A;  5CP1 A;  2CA8 A;  2B6M A;  1JZR A;  2X64 A;  4RQX A;  2OKA A;  4TR0 A;  4TR1 A;  1GH2 A;  3IOS A;  3LEF A;  1Y6E A;  1EV4 A;  3ISO A;  1XVW A;  2WGR A;  4NMU A;  2E2G A;  5D9W A;  4MJC A;  1ACV A;  1SD9 A;  2DJ2 A;  4J57 E;  2Z9S A;  3D0Z A;  3VK9 A;  1M99 A;  3GNJ A;  2JAC A;  5ECH B;  3RHB A;  5JWQ B;  2H66 A;  2VO4 A;  1UVZ A;  3SWL A;  3DEX A;  1BED A;  2GQL A;  4AJ6 A;  3O6T A;  4HEA 2;  2C3N A;  4KDY A;  4KDU A;  7GSS A;  3PGT A;  2IFQ A;  2DJ3 A;  1XCC A;  1THX A;  3UVT A;  3IRA A;  1TW9 A;  2H0H A;  3H8Q A;  1ZZY A;  3VWX A;  2K8S A;  20GS A;  2YWN A;  4BPY A;  4EO3 A;  3PR8 A;  5CRW A;  1SD8 A;  2YZU A;  4LMW A;  1GUL A;  2H19 A;  3UBK A;  2IMI A;  1A2M A;  3GL3 A;  3TB2 A;  1Z6N A;  4IS0 A;  4GCI A;  1TK8 B;  3QR6 A;  1K0M A;  4GF0 A;  4I97 A;  1XWG A;  4AJ7 A;  3ZMK A;  1ABA A;  1WP0 A;  4IQ1 A;  4ZB6 A;  4Q5Q A;  1NHO A;  2YNX A;  3IHQ A;  1SJ6 A;  1O6J A;  6GSU A;  4FYU A;  3LG6 A;  1BX9 A;  3MSZ A;  4GRF A;  5D9V A;  3EE2 A;  4IGJ A;  1SL0 B;  3GKX A;  4IHU A;  2H76 A;  2GQM A;  3ZFL A;  3CRT A;  1PSQ A;  2O7K A;  1JZO A;  2V1M A;  4JZQ A;  16GS A;  2L59 A;  2VUP A;  2GGT A;  4TR1 B;  4WR5 A;  4ECB A;  4JR4 A;  2DJ0 A;  3TRQ A;  5DQS A;  4KSM A;  2VL2 A;  3F4T A;  4NWY A;  4ZBD A;  2MMZ A;  3L0H A;  5EPF A;  2JZT A;  3F6D A;  3I6A A;  2YJH A;  2FGX A;  4V2N A;  4GLT A;  5FWG A;  3KIJ A;  1AW9 A;  3C73 A;  4EXJ A;  3D22 A;  2FA4 A;  3LJR A;  4OMV A;  6GSV A;  3IK9 A;  5JCU A;  2VM2 A;  2IFQ B;  2B5Y A;  2VOC A;  3IE3 A;  5A4V A;  2OBI A;  2FWH A;  3HD5 A;  4JBB A;  3KMN A;  4XS4 A;  1USB A;  2C80 A;  3KGK A;  2KP2 A;  2WFC A;  1YQ1 A;  1HNB A;  3IXR A;  3LXT A;  4KA0 A;  2HRN A;  5KEJ A;  4RI6 A;  4YAP A;  3UBL A;  3TOT A;  4NPB A;  2FD3 A;  3EVI A;  2YPM A;  3O76 A;  1ZMA A;  2R2J A;  1EZK A;  2WRT A;  1AC1 A;  5J3R A;  3DGQ A;  2ZNM A;  1O7U A;  1B9Y C;  1B9X C;  4LMV A;  3EIN A;  2RLI A;  3EU3 A;  4MF7 A;  1SJZ A;  2JZR A;  2WDU A;  2JAD A;  1TRW A;  4MF5 A;  3TKQ A;  4OO4 A;  2B7K A;  1UA5 A;  2E7P A;  2EC4 A;  2XPD A;  1J08 A;  4HJM A;  2L6C A;  3ERF A;  4MZW A;  3UEM A;  3ED3 A;  12GS A;  2B3S A;  2IPA A;  4I2U A;  4DVC A;  3BJ5 A;  5D93 A;  4I2T A;  3HVS A;  3LXZ A;  3BD2 A;  4PUF C;  1X5D A;  1U3A A;  2IN3 A;  4IP1 A;  4MH3 A;  3ERG A;  3CSH A;  3M8N A;  2LEG A;  4WEY A;  2F51 A;  2YN1 A;  1XWK A;  4K7N A;  3GTU A;  3FHK A;  2PVO C;  4GQC A;  3ME7 A;  2FA8 A;  5B8A A;  3HDC A;  5DJL A;  1TK0 B;  3GMF A;  2CT6 A;  3FZ4 A;  5D96 A;  4XS1 A;  4L0W A;  5ECS A;  2CZ2 A;  5HFG A;  5D8I A;  4XS4 B;  4GQF A;  4GSN A;  3A2W A;  1MDK A;  1A24 A;  3QOU A;  1B48 A;  2IMD A;  5DCG A;  1XOB A;  4JU5 A;  1OVN A;  5G5F A;  2KLX A;  4MZC A;  3GHA A;  2PMT A;  3QAG A;  4V2M A;  4TKY A;  4KH7 A;  1R5P A;  1YDK A;  3UAR A;  1NM3 A;  2VD0 A;  3FW2 A;  2JZS A;  6GSS A;  1K0C A;  2GT5 A;  4FIW A;  2HSY A;  3C8E A;  1WIK A;  2H71 A;  4IKH A;  2KOK A;  1ZOF A;  2NPB A;  3VI5 A;  1ML6 A;  2H0I A;  1SL2 B;  2HZE A;  2VLT A;  2IIY A;  4MLY A;  4H86 A;  2YZH A;  1O81 A;  1FAA A;  5GZZ B;  4MJE A;  2H8L A;  3GST A;  3EMP A;  4X43 A;  6GSW A;  4TXO A;  1FB6 A;  2YOI A;  3GFK A;  4F2I A;  2QC7 A;  4MMM A;  1PKW A;  4E8H A;  4PNG A;  1K0B A;  3ZIT A;  4KB3 A;  1GTA A;  2L4C A;  4F03 A;  3U6V A;  4HQZ A;  1JHB A;  5ECO B;  5JCW A;  1BQ7 A;  5HFK A;  2LRN A;  1OYJ A;  4ZL7 A;  3GTU B;  1GNE A;  2YAN A;  3TKR A;  1PX7 A;  1ERU A;  4MJB A;  2A2S A;  4XIH A;  5GST A;  2GZZ A;  2CAQ A;  3KMO A;  3F8U A;  2NDO A;  1XW9 A;  4AGS A;  1YF0 A;  5F05 A;  2IL3 A;  1XIY A;  2XPE A;  5CRE A;  4ISD A;  2IJY A;  3GX0 A;  2FWG A;  1T3B A;  4GSS A;  5GAN D;  3WD6 A;  2HXK A;  4Z7X A;  2DJ1 A;  4X0X A;  3FY7 A;  3TKS E;  5DBQ A;  2V2G A;  1MTC A;  5J41 A;  2H0G A;  2O85 A;  2V41 A;  3N9J A;  4HS1 A;  3M0F A;  1TU7 A;  5C00 A;  2VCV A;  4QL9 A;  5G1K A;  4TXV A;  3LYP A;  1U87 A;  1V98 A;  3DXB A;  5CNW A;  3F63 A;  3UMA A;  5ECQ B;  1N8J A;  3GRX A;  1AQW A;  1O85 A;  1K3Y A;  3APS A;  2HZE B;  2FLS A;  4PX1 A;  1AQX A;  5E4W A;  4GWR A;  1XW6 A;  4E8E A;  4BVY A;  4IP6 A;  5DAK A;  2MBS A;  13GS A;  2A2R A;  3VFI A;  2DMM A;  4WBR D;  2OA7 A;  2X8G A;  1IYI A;  1YEP A;  1TXX A;  2YWI A;  3QMX A;  1CQH A;  3GKM A;  2CZ3 A;  4TXO B;  4IJ3 A;  2N5B A;  4WF4 A;  3DRN A;  3IBH A;  4OFM A;  5KN2 A;  2LRT A;  5A4U A;  1F9M A;  1GLP A;  2N5A A;  4KND A;  6GSX A;  1GSU A;  4PGT A;  1HYU A;  2FCH A;  2E2M A;  2I81 A;  1GLQ A;  5C04 A;  4XRA A;  2M72 A;  5JWR B;  4N11 A;  1R26 A;  3GKK A;  4WR4 A;  3VPQ A;  3ZML A;  2C4J A;  1K0A A;  2JL4 A;  2TRC P;  3LGC A;  3CTF A;  1TOF A;  5ECI B;  1PL1 A;  4BVX A;  1G7O A;  1B8X A;  2DIZ A;  2TRX A;  2IWT A;  3P90 A;  4ULX A;  4ECJ A;  2LST A;  5GAP D;  1VGL A;  2YCD A;  2J23 A;  1M2D A;  3EWL A;  4KX4 A;  2ZUP A;  2X8C A;  2HI7 A;  3EYT A;  2P31 A;  2GQK A;  1B4Q A;  4NHW A;  2V6K A;  1EP8 A;  1SK2 A;  3TKP A;  1ERV A;  2DC5 A;  5G2Z A;  3VI7 A;  4K1F A;  3L9V A;  1YY7 A;  4I6X A;  1RW1 A;  2YWO A;  3EU4 A;  4CHS A;  8GSS A;  4CDO A;  5ENU A;  2LJR A;  2OE0 A;  4K7O A;  2I1U A;  3E3E A;  3DD3 A;  3RAZ A;  5IQY A;  3WT2 A;  2L5L A;  2LRC A;  4ILF A;  2HNL A;  3W8S A;  3WT1 A;  3G9B A;  5DAK B;  3IAM 2;  1T00 A;  2PUK C;  4PQI A;  5H5S A;  4XTS A;  3BBY A;  3M9K A;  1J9B A;  4K9Z A;  1AUC A;  5J9C A;  3D21 A;  1FOV A;  3ZYW A;  4DSR A;  2RM5 A;  3WGD A;  2B1K A;  4IEL A;  1M2B A;  1GUM A;  4LLR A;  3U5R E;  1QFN A;  3GKN A;  1NHY A;  5AIV A;  2FNO A;  5A4W A;  3FRC A;  3E9J B;  3KP9 A;  4TVE A;  4EDY A;  1GWC A;  5IMC A;  2HRF A;  1WWJ A;  2EIQ A;  3GA4 A;  3HJM A;  4KAE A;  1Z7P A;  4HDE A;  3APO A;  4XCS A;  4F0B A;  3KP8 A;  3HJP A;  3DVX A;  1TK5 B;  1SJI A;  3LSZ A;  2GST A;  4TN8 A;  5KN1 A;  3P7X A;  2PBJ A;  3QCP A;  4WXT A;  3BCI A;  1O8X A;  2R3X A;  4G19 A;  2F8F A;  1M2A A;  1MDI A;  2LS5 A;  3VLN A;  1EOH A;  3H93 A;  2WCI A;  4YH2 A;  4K7I A;  4ML1 A;  4PUA A;  3MDK A;  4G2E A;  4K8M A;  1A0R P;  2O87 A;  4ZBB A;  3TJJ A;  2IME A;  2LV3 A;  1ZGN A;  4F82 A;  1HNA A;  1TKD B;  2C0D A;  3KH9 A;  5F0G A;  3JCM L;  2VIM A;  4WBJ A;  3KXO A;  2YV9 A;  3GYK A;  5IMF A;  3TKS A;  4LA1 A;  2O8V B;  3L4N A;  4JRR A;  1GSS A;  1S3C A;  5DJM A;  3FZ5 A;  5EY6 A;  1G7E A;  5IPH A;  4Q5N A;  2PN8 A;  1XBS A;  3HYP A;  1PRX A;  4MCU A;  2PGT A;  1WRY A;  2H6Y A;  1V2A A;  3CSJ A;  2PWJ A;  3QPM A;  3QFB C;  1LBK A;  1OKD A;  1A8Y A;  3CSI A;  3FZA A;  2KUC A;  3L9S A;  2V32 A;  1SEN A;  1QGV A;  3LFL A;  4ZIJ A;  3FYG A;  2DJJ A;  1GP1 A;  3GUR A;  4WKW A;  3J7Y b;  4BWQ A;  2F8A A;  3G7J A;  1K0N A;  3ZVJ D;  1G6Y A;  1K3O A;  4O32 A;  4POM A;  1GL8 A;  3C1R A;  2WJU A;  2BTO T;  1DSB A;  3MAK A;  1EGO A;  4I5Q A;  3TJF A;  22GS A;  5ELA A;  1JZD A;  3ME8 A;  2OBK A;  4Q5R A;  3FK8 A;  1URM A;  3TGZ A;  5J5N A;  3HCZ A;  3KTL A;  2CQ9 A;  1PMT A;  3W6G A;  4RUV A;  4FO5 A;  3MWH A;  3BOA A;  1EEM A;  3GUS A;  4KGI A;  1MEK A;  2XBQ A;  2HSH A;  2DLX A;  10GS A;  2VAF A;  4NAX A;  1KNG A;  4POB A;  5DCH A;  3W8J A;  1H75 A;  3HVX A;  2LKU A;  5CYY A;  1EWX A;  5EL8 A;  1YKA A;  4MF6 A;  2AUV A;  2M80 A;  1Z5Y E;  5ECK B;  5IIZ A;  3C71 A;  4IN0 A;  1TRV A;  1BG5 A;  3RHC A;  3KH7 A;  2L5O A;  2VLV A;  3Q6O A;  4N0V A;  2EIO A;  2YJ7 A;  3RPN A;  5ECM B;  2F3M A;  1A2J A;  4KE3 A;  1SKW B;  5IMZ A;  2OE1 A;  2HYX A;  1V57 A;  3TJG A;  4OD7 A;  5D73 A;  4ZB9 A;  2GZP A;  4D73 B;  3NZN A;  2REM A;  6GST A;  3F0I A;  1AXD A;  2C1Y A;  1Y25 A;  3SBC A;  2VM1 A;  1GRX A;  2ZCT A;  4OCF A;  1K0O A;  2FUG 2;  3D4M A;  4PXO A;  1NSW A;  3F9U A;  3KTB A;  1GSF A;  5HR3 A;  5IMA A;  3ZL5 A;  5F06 A;  3M9J A;  3A2V A;  4J56 E;  2RII A;  1WMJ A;  4DSS A;  4HOJ A;  5E59 A;  3Q74 A;  3ERW A;  3C1S A;  1MD3 A;  2NVL A;  3KCM A;  3EC3 A;  5DVB A; 
#chains in the Genus database with same CATH topology
 3WYW A;  5CRD A;  1X5E A;  1AIU A;  1TI1 A;  3E0U A;  4HJ2 A;  4POK A;  1QMV A;  4K2X A;  1PGT A;  2LJA A;  1YJ6 A;  4NHZ A;  2OJL A;  2DJK A;  5HR2 A;  5COH A;  3J7Y k;  4MNN A;  1KEB A;  3UAP A;  2B1L A;  1FG4 A;  5KN0 A;  3QFA C;  4ECI A;  2B5X A;  4JR6 A;  3WGE A;  4FH8 A;  18GS A;  2P0G A;  4FYB A;  1OC3 A;  3CQF A;  14GS A;  3DKS A;  3US3 A;  4F0C A;  4MDC A;  3UOM A;  5ABR A;  4O7H A;  1O8W A;  2R6K A;  3KZQ A;  2L4Q A;  4QL7 A;  3I69 A;  4ID0 A;  1PFO A;  4EKZ A;  3A5W A;  4Z2T A;  1BAY A;  5AIX A;  2H1A A;  3TRX A;  1GTU A;  4KUN A;  3I9V 2;  2OE3 A;  2VL2 C;  1OKT A;  3HXS A;  2I3Y A;  1MD4 A;  1PX6 A;  5LNK e;  2XBI A;  4X1U A;  1SYR A;  1W4V A;  5GSS A;  5LD0 A;  2X49 A;  3TKS C;  3EPT A;  2PER A;  1TTZ A;  3ZVJ A;  4TW5 A;  4WET A;  4DSS B;  1I5G A;  2VCT A;  2ON7 A;  5AN1 A;  1VF3 A;  5DQY A;  4Q5F A;  1XVQ A;  5IOW A;  2P5Q A;  1GUH A;  4PQH A;  1JLV A;  3FR6 A;  5IMD A;  4HI7 A;  4TR3 A;  3R3E A;  1U3I A;  1GTI A;  2YV7 A;  2GS3 A;  3ZLP A;  6GSY A;  4YQV A;  5H5Q A;  19GS A;  3D4T A;  1QQ2 A;  3KD0 A;  2LQO A;  5CRG A;  3IC8 A;  2WB9 A;  3L9U A;  2XHF A;  4K5S A;  1WOU A;  2AHE A;  3G7Y A;  3Q18 A;  3APQ A;  5G1L A;  3CXG A;  2MMO A;  4YQM A;  4BWS A;  2CVB A;  3UIW A;  3NOF A;  3O3T A;  1A8L A;  1SKR B;  5IM9 A;  5B6M A;  1E6B A;  3DYR A;  3UJ1 A;  3MYD A;  3F4S A;  1Z7R A;  1X5C A;  2H6X A;  3IA1 A;  3QAW A;  4O92 A;  3ZFB A;  5B7C A;  5HR0 A;  1T4Z A;  3PH9 A;  2P5R A;  2AAW A;  3VWV A;  1TRS A;  3M1G A;  4G0L A;  2HFD A;  2R4V A;  3IDV A;  11GS A;  3IHG A;  1SU9 A;  1GNW A;  2H74 A;  2LJK A;  4K2D A;  4USS A;  4G10 A;  2HE3 A;  2GLR A;  5IO0 A;  1ST9 A;  1RK4 A;  1XW5 A;  4EC0 A;  4K6X A;  2K8V A;  1Z3E A;  5A5K A;  5JWO B;  2YWM A;  1QXH A;  2H72 A;  4TR4 A;  4IJI A;  4FYC A;  5IO2 A;  1J0F A;  2G2Q A;  1X9W B;  5BMU A;  2VD1 A;  4EVM A;  3QDN A;  4NV2 A;  1ILO A;  1Z9H A;  2RUE A;  3R2Q A;  2MYG A;  3N5O A;  1X9M B;  1OE7 A;  4EDZ A;  3TJB A;  1U6T A;  2YP6 A;  4V1A p;  3D6I A;  2M46 A;  2H1D A;  2GVP A;  1LJR A;  1W89 A;  4WF5 A;  4JE1 A;  4DEJ A;  3KEB A;  1F37 A;  2DBC A;  2PU9 C;  4MK3 A;  4ZB8 A;  4MH2 A;  3TOU A;  1TI3 A;  2HT9 A;  5ID2 A;  2C8U A;  1M9B A;  5AIS A;  2VCW A;  4EE0 A;  4L8E A;  3RPP A;  3VPT A;  1SYX A;  4I8B A;  5CRH A;  4PUR A;  2FWE A;  3ZZX A;  4MAB A;  4CY8 A;  4G0K A;  3F4R A;  4K0G A;  4ACS A;  3QD9 A;  4HZ4 A;  1ERT A;  17GS A;  4NV5 A;  4YAV A;  3IR4 A;  5JCG A;  4OFT A;  5DDL A;  4L0U A;  2DSA A;  1PN9 A;  2HLS A;  3H79 A;  4L5L A;  4KCE A;  1K0D A;  2VLU A;  2MZC A;  4OWY A;  1RQM A;  2BMX A;  1QUW A;  4EL1 A;  4ZL8 A;  4ZBA A;  1OC8 A;  3QAV A;  3WGX A;  3HZ4 A;  2GTU A;  3EUR A;  5DAL A;  3TRP A;  1OAZ A;  4PNF A;  2QGV A;  3ZRE A;  1QK8 A;  2NBS A;  2GSQ A;  4GST A;  1GUK A;  2R0C A;  1SK1 A;  2DML A;  4V2L A;  1T1V A;  2LTK A;  1GSQ A;  5IPG A;  1R7H A;  2DKH A;  3A3T A;  2C3T A;  1TDI A;  2C3Q A;  2VCX A;  2H30 A;  1NW2 A;  5G30 A;  1PL2 A;  3VWW A;  4J2F A;  5F07 A;  3P8W A;  2H70 A;  2I4A A;  3GV1 A;  2AJQ B;  3HKR A;  2VCQ A;  1R4W A;  3VWU A;  3K8N A;  3LWA A;  1DUG A;  1PD2 1;  4ML6 A;  2FY6 A;  2LNS A;  1VF2 A;  3S9F A;  1ZYE A;  5H5R A;  5G31 A;  5HFI A;  5D9X A;  2FHE A;  1EP7 A;  3V1W A;  3IPZ A;  1R5A A;  3GX8 A;  4EUY A;  1ZYQ B;  5CAX A;  2VCZ A;  2ON5 A;  1V40 A;  2CAI A;  3TUE A;  1BJX A;  1EOG A;  3DWV A;  5ID2 B;  4D73 A;  2ALB A;  3HZ8 A;  3KM6 A;  1XWB A;  4K0N A;  4LL4 B;  1F2E A;  2PVQ A;  2GZY A;  4XHM A;  4OCE A;  4YQU A;  4IVF A;  1JFU A;  2LUS A;  2QSI A;  4MZB A;  1A23 A;  2A4V A;  3FKF A;  4L5O A;  3LOR A;  1XZO A;  1AAZ A;  3FEU A;  4V1A g;  1YF1 A;  4RI7 A;  4XRD A;  1PQN A;  2V6O A;  2FWF A;  1M7T A;  3AY8 A;  4ZL9 A;  4LL1 B;  1X0R A;  1M3J A;  2BJX A;  5ECL B;  1Q98 A;  4IW9 A;  5DAL B;  5F8B A;  2C0E A;  2JSY A;  1GSY A;  2C0G A;  4AF2 A;  3CMI A;  2N5F A;  3IAS 2;  1FVK A;  1CQG A;  4TOP A;  1V9W A;  2H1B A;  2WUL A;  2AYT A;  5ECN B;  1A0F A;  1OC9 A;  5HQP A;  5ECR B;  2VL3 A;  1TU8 A;  5HR1 A;  3CTG A;  1WJK A;  1OE8 A;  4ECC A;  4MJA A;  3KJY A;  1YKC A;  2X8H A;  4FQU A;  5J4U A;  4HU7 A;  4N0Z A;  1E2Y A;  1VF4 A;  2X99 A;  1XPV A;  2A4H A;  3OR5 A;  2MBT A;  1Z6M A;  2HZF A;  3HY2 A;  2OAC A;  2PPT A;  2X4A A;  1XFL A;  2GSR A;  3ZTL A;  3F3Q A;  1DE2 A;  1VRS D;  3NIV A;  4F9Z A;  1XWA A;  1G6W A;  3HA9 A;  2JSZ A;  3FR9 A;  3F6F A;  2E0Q A;  4EF0 A;  2L57 A;  3LQ7 A;  1ERW A;  2D2Z A;  2CX4 A;  4PQ1 A;  4ZXG A;  4OFN A;  3MNG A;  3EMX A;  1EEJ A;  2H75 A;  1VF1 A;  3HJO A;  4CW9 A;  1F3B A;  1H4O A;  2L6D A;  4IQA A;  5FHI A;  3MIX A;  2LNT A;  3TCO A;  3ZIV A;  4KW6 A;  4OO5 A;  1KTE A;  4GXZ A;  2VL9 A;  3UVH A;  1M9A A;  1XOA A;  5KN3 A;  2O89 A;  4MP4 A;  5CO3 A;  1FVJ A;  3D5J A;  3P2A A;  2ES7 A;  2G0F A;  2H01 A;  3A5I A;  2WZ9 A;  1HQO A;  2B7J A;  1I9D A;  3PIN A;  1SKS B;  1JZW A;  4G0I A;  5L71 A;  1ZCP A;  1LU4 A;  1FB0 A;  5IMV A;  1TRU A;  1WE0 A;  1G0T A;  5AGY A;  3CRU A;  2OAD A;  1SL1 B;  4NXI A;  1OC9 B;  2QA1 A;  5IOX A;  3Q19 A;  1XWC A;  4KDX A;  3UL3 A;  3DIE A;  3G7I A;  1UN2 A;  1B4P A;  1THO A;  1BYE A;  3GL5 A;  3IC4 A;  5B6N A;  1HD2 A;  4MPG A;  1O73 A;  2RM6 A;  3A2X A;  1GTB A;  5G5E A;  2XC2 A;  4ICY A;  1F3A A;  2LQQ A;  1T7P B;  3FZ9 A;  3DVW A;  1KBN A;  1T8E B;  2EIR A;  3LYK A;  2B5E A;  1YEX A;  3H4K A;  1YZX A;  1TP9 A;  1FW1 A;  5LCZ A;  1A2L A;  5J9B A;  1N2A A;  2NTO A;  3L78 A;  1U88 A;  1EGR A;  3ZRD A;  2CVK A;  4HSC X;  5ECP B;  5FT3 A;  4HQS A;  4N10 A;  1ON4 A;  1GSD A;  1M3I A;  3RDW A;  2GDR A;  2H6Z A;  4TRX A;  3VUR A;  2R5G A;  4DSQ A;  1HNC A;  2H1G A;  2MMN A;  2JU5 A;  2K9F A;  2QKE A;  1ZL9 A;  2IMF A;  1SK0 A;  2RUF A;  3FR3 A;  4BA7 A;  4G9H A;  3GSS A;  2GT6 A;  1XXU A;  1FO5 A;  1S3A A;  1S3R A;  3IV4 A;  1K3L A;  2AB6 A;  3I43 A;  4GTU A;  3F3R A;  2I9H A;  1GSE A;  2AV4 A;  3GN3 A;  4P3Y B;  2K6V A;  2F9S A;  2R37 A;  4N30 A;  2H73 A;  3IK7 A;  3HHV A;  3CYN A;  2CX3 A;  4MA9 A;  3M3M A;  1T4Y A;  4ZIL A;  3HVV A;  1FHE A;  1AQV A;  2DIY A;  5D9T A;  3GH6 A;  1V58 A;  4JED A;  1M0U A;  4XS6 A;  4IBP A;  2K18 A;  5EVO A;  3RBT A;  1WPI A;  2C0F A;  2TIR A;  1EV9 A;  1UC7 A;  4BL7 A;  1DBY A;  4HZ2 A;  4MPF A;  9GSS A;  2MMA A;  3CBU A;  2KP1 A;  4HU9 A;  3TJK A;  1C72 A;  1IYH A;  3GH9 A;  1Q4J A;  2WS2 A;  4KSO A;  3BCK A;  1X9S B;  3H1N A;  4HUA A;  4RQR A;  3ZIJ A;  1PA3 A;  2CVD A;  5INY A;  1F6M C;  4QQ7 A;  1PKZ A;  4POL A;  5ELG A;  3DML A;  4O5R A;  2CV4 A;  1MDJ A;  1DE1 A;  2GSS A;  3HVN A;  2KHP A;  1TJD A;  3GIX A;  4KCA A;  1JLW A;  5B8B A;  4AJ8 A;  1S3D A;  2IMK A;  3TDG A;  2J9H A;  3C7M A;  5CP1 A;  2CA8 A;  4PTS A;  2B6M A;  1JZR A;  2X64 A;  4RQX A;  2OKA A;  4TR0 A;  4TR1 A;  1GH2 A;  3IOS A;  3LEF A;  1Y6E A;  1EV4 A;  3ISO A;  1XVW A;  2WGR A;  4NMU A;  2E2G A;  5D9W A;  4MJC A;  1ACV A;  1SD9 A;  2DJ2 A;  4J57 E;  2Z9S A;  3D0Z A;  3VK9 A;  1M99 A;  3GNJ A;  2JAC A;  5ECH B;  3RHB A;  5JWQ B;  2H66 A;  2VO4 A;  1UVZ A;  3SWL A;  3DEX A;  1BED A;  2GQL A;  4AJ6 A;  3O6T A;  4HEA 2;  2C3N A;  4KDY A;  4KDU A;  7GSS A;  3PGT A;  2IFQ A;  2DJ3 A;  1XCC A;  1THX A;  3UVT A;  3IRA A;  1TW9 A;  2H0H A;  3H8Q A;  1ZZY A;  3VWX A;  2K8S A;  20GS A;  2YWN A;  4BPY A;  4EO3 A;  3PR8 A;  5CRW A;  1SD8 A;  2YZU A;  4LMW A;  1GUL A;  2H19 A;  4BL7 B;  3UBK A;  2IMI A;  1A2M A;  3GL3 A;  3TB2 A;  1Z6N A;  4IS0 A;  4GCI A;  1TK8 B;  3QR6 A;  1K0M A;  4GF0 A;  4I97 A;  1XWG A;  4AJ7 A;  5BRT A;  3ZMK A;  1ABA A;  1WP0 A;  4IQ1 A;  4ZB6 A;  4Q5Q A;  1NHO A;  2YNX A;  3IHQ A;  1SJ6 A;  1O6J A;  6GSU A;  4FYU A;  3LG6 A;  1BX9 A;  3MSZ A;  4A5P A;  4GRF A;  5D9V A;  3EE2 A;  4IGJ A;  1SL0 B;  3GKX A;  4IHU A;  2H76 A;  2GQM A;  3ZFL A;  3CRT A;  1PSQ A;  5KOX A;  2O7K A;  1JZO A;  2V1M A;  4JZQ A;  16GS A;  2L59 A;  2VUP A;  2GGT A;  4TR1 B;  3PPU A;  4WR5 A;  4ECB A;  4JR4 A;  2DJ0 A;  3TRQ A;  3FMW A;  5DQS A;  4KSM A;  2VL2 A;  4YKF A;  3F4T A;  4NWY A;  4ZBD A;  2MMZ A;  3L0H A;  5EPF A;  4KF9 A;  2JZT A;  3F6D A;  3I6A A;  2YJH A;  2FGX A;  4V2N A;  4GLT A;  5FWG A;  3KIJ A;  1AW9 A;  3C73 A;  4EXJ A;  3D22 A;  2FA4 A;  3LJR A;  4OMV A;  6GSV A;  3IK9 A;  5JCU A;  2VM2 A;  2IFQ B;  2B5Y A;  2VOC A;  3IE3 A;  2A2P A;  4Z2U A;  5A4V A;  2OBI A;  2FWH A;  3HD5 A;  4JBB A;  3KMN A;  4XS4 A;  1USB A;  2C80 A;  3KGK A;  2KP2 A;  2WFC A;  1YQ1 A;  1HNB A;  3IXR A;  3LXT A;  4KA0 A;  2HRN A;  5KEJ A;  4RI6 A;  4YAP A;  3UBL A;  3TOT A;  4NPB A;  2FD3 A;  3EVI A;  2YPM A;  3O76 A;  1ZMA A;  2R2J A;  1EZK A;  2WRT A;  1AC1 A;  5J3R A;  3DGQ A;  2ZNM A;  1O7U A;  1B9Y C;  1B9X C;  4LMV A;  3EIN A;  2RLI A;  3EU3 A;  4MF7 A;  1SJZ A;  2JZR A;  2WDU A;  2JAD A;  1TRW A;  4MF5 A;  3TKQ A;  4OO4 A;  2B7K A;  1UA5 A;  2E7P A;  2EC4 A;  2XPD A;  1J08 A;  4HJM A;  2L6C A;  3ERF A;  4MZW A;  3UEM A;  3ED3 A;  12GS A;  2B3S A;  2IPA A;  4I2U A;  4DVC A;  3BJ5 A;  5D93 A;  4I2T A;  3HVS A;  3LXZ A;  3BD2 A;  4PUF C;  1X5D A;  1U3A A;  2IN3 A;  4IP1 A;  4MH3 A;  3ERG A;  3CSH A;  3M8N A;  2LEG A;  4WEY A;  4K5R A;  2F51 A;  2YN1 A;  1XWK A;  4K7N A;  3GTU A;  3FHK A;  2PVO C;  4GQC A;  3ME7 A;  2FA8 A;  5B8A A;  3HDC A;  5DJL A;  1TK0 B;  3GMF A;  4EIQ A;  2CT6 A;  3FZ4 A;  5D96 A;  4XS1 A;  4L0W A;  5ECS A;  2CZ2 A;  5HFG A;  5D8I A;  4XS4 B;  4GQF A;  4GSN A;  4O5Q A;  3A2W A;  1MDK A;  1A24 A;  3QOU A;  1B48 A;  2IMD A;  5DCG A;  1XOB A;  4JU5 A;  2R0G A;  1OVN A;  5G5F A;  2KLX A;  4MZC A;  3GHA A;  2PMT A;  3QAG A;  4V2M A;  4TKY A;  4KH7 A;  1R5P A;  1YDK A;  3UAR A;  1NM3 A;  2VD0 A;  3FW2 A;  2JZS A;  6GSS A;  1K0C A;  2GT5 A;  4FIW A;  2HSY A;  3C8E A;  1WIK A;  2H71 A;  4IKH A;  2KOK A;  1ZOF A;  2NPB A;  3VI5 A;  1ML6 A;  2H0I A;  1SL2 B;  2HZE A;  2VLT A;  2IIY A;  4MLY A;  4H86 A;  2YZH A;  2UZ8 A;  1O81 A;  1FAA A;  5GZZ B;  4MJE A;  2H8L A;  3GST A;  3EMP A;  4X43 A;  6GSW A;  4TXO A;  1FB6 A;  2YOI A;  3GFK A;  4F2I A;  2QC7 A;  4MMM A;  1PKW A;  4E8H A;  4PNG A;  1K0B A;  3ZIT A;  4KB3 A;  1GTA A;  2L4C A;  4F03 A;  3U6V A;  4HQZ A;  1JHB A;  5ECO B;  5JCW A;  1BQ7 A;  5HFK A;  2LRN A;  1OYJ A;  4ZL7 A;  3GTU B;  1GNE A;  2YAN A;  3TKR A;  1PX7 A;  1ERU A;  4MJB A;  2A2S A;  3LW9 A;  4XIH A;  5GST A;  2GZZ A;  2CAQ A;  3KMO A;  3F8U A;  4EIP A;  2NDO A;  1XW9 A;  4AGS A;  1YF0 A;  5F05 A;  2IL3 A;  2QA2 A;  1XIY A;  2XPE A;  5CRE A;  4ISD A;  2IJY A;  3GX0 A;  2FWG A;  1T3B A;  4GSS A;  2DKI A;  5GAN D;  2HRK A;  3WD6 A;  2HXK A;  4Z7X A;  2DJ1 A;  4X0X A;  3FY7 A;  3TKS E;  5DBQ A;  2V2G A;  1MTC A;  5J41 A;  2H0G A;  2O85 A;  2V41 A;  3N9J A;  4HS1 A;  3M0F A;  1TU7 A;  5C00 A;  2VCV A;  4QL9 A;  5G1K A;  4TXV A;  3LYP A;  1U87 A;  1V98 A;  3DXB A;  5CNW A;  3F63 A;  3UMA A;  5ECQ B;  1N8J A;  3GRX A;  1AQW A;  1O85 A;  1K3Y A;  3APS A;  2HZE B;  2FLS A;  4PX1 A;  1AQX A;  5E4W A;  4GWR A;  1XW6 A;  4E8E A;  4BVY A;  4IP6 A;  5DAK A;  2MBS A;  13GS A;  2A2R A;  3VFI A;  2DMM A;  4WBR D;  2OA7 A;  2X8G A;  1IYI A;  1YEP A;  1TXX A;  2YWI A;  3QMX A;  1CQH A;  3GKM A;  2CZ3 A;  4TXO B;  4IJ3 A;  2N5B A;  4WF4 A;  3DRN A;  3IBH A;  4OFM A;  5KN2 A;  2LRT A;  5A4U A;  1F9M A;  1GLP A;  2N5A A;  4KND A;  6GSX A;  1GSU A;  4PGT A;  1HYU A;  2FCH A;  2E2M A;  1PN0 A;  2I81 A;  1GLQ A;  5C04 A;  4XRA A;  2M72 A;  5JWR B;  4N11 A;  1R26 A;  3GKK A;  4WR4 A;  3VPQ A;  3ZML A;  2C4J A;  1K0A A;  2JL4 A;  2TRC P;  3LGC A;  3CTF A;  1TOF A;  5ECI B;  1PL1 A;  4BVX A;  1G7O A;  1B8X A;  2DIZ A;  2TRX A;  2IWT A;  3P90 A;  4ULX A;  4ECJ A;  2LST A;  5GAP D;  1VGL A;  2YCD A;  2J23 A;  1M2D A;  3EWL A;  4KX4 A;  2ZUP A;  2X8C A;  2HI7 A;  3EYT A;  2P31 A;  2GQK A;  1B4Q A;  4NHW A;  2V6K A;  1EP8 A;  1SK2 A;  3TKP A;  1ERV A;  2DC5 A;  5G2Z A;  3VI7 A;  4K1F A;  3L9V A;  1YY7 A;  4I6X A;  1RW1 A;  2YWO A;  3EU4 A;  4CHS A;  8GSS A;  4CDO A;  5ENU A;  2LJR A;  2OE0 A;  4K7O A;  2I1U A;  3E3E A;  3DD3 A;  3RAZ A;  5IQY A;  3WT2 A;  2L5L A;  2LRC A;  4ILF A;  2HNL A;  3W8S A;  3WT1 A;  4BVY B;  3G9B A;  5DAK B;  3IAM 2;  1T00 A;  2PUK C;  4PQI A;  5H5S A;  4XTS A;  3BBY A;  3M9K A;  1J9B A;  4K9Z A;  1AUC A;  5J9C A;  3D21 A;  1FOV A;  3ZYW A;  4DSR A;  2RM5 A;  4BIK A;  3WGD A;  2B1K A;  4IEL A;  1M2B A;  1GUM A;  4LLR A;  3U5R E;  1QFN A;  3GKN A;  1NHY A;  2HSM A;  5AIV A;  2FNO A;  5A4W A;  3FRC A;  3E9J B;  3KP9 A;  4TVE A;  4EDY A;  1GWC A;  5IMC A;  2HRF A;  1WWJ A;  2EIQ A;  3GA4 A;  3HJM A;  4KAE A;  1Z7P A;  4HDE A;  3APO A;  4XCS A;  4F0B A;  3KP8 A;  3HJP A;  3DVX A;  1TK5 B;  1SJI A;  3LSZ A;  4BVX B;  2GST A;  4TN8 A;  5KN1 A;  3P7X A;  2PBJ A;  3QCP A;  4WXT A;  3BCI A;  1O8X A;  2R3X A;  4G19 A;  2F8F A;  1M2A A;  1MDI A;  2LS5 A;  3VLN A;  1EOH A;  3H93 A;  2WCI A;  4YH2 A;  4K7I A;  4ML1 A;  4PUA A;  3MDK A;  4G2E A;  4K8M A;  1A0R P;  2O87 A;  4ZBB A;  3TJJ A;  5KOW A;  2IME A;  2LV3 A;  1ZGN A;  4F82 A;  1ZYN A;  1HNA A;  1TKD B;  2C0D A;  3KH9 A;  5F0G A;  3JCM L;  2VIM A;  4WBJ A;  3KXO A;  2YV9 A;  3GYK A;  5IMF A;  3TKS A;  4LA1 A;  2O8V B;  3L4N A;  4JRR A;  1GSS A;  1S3C A;  5DJM A;  3FZ5 A;  5EY6 A;  1G7E A;  5IPH A;  4Q5N A;  2PN8 A;  1XBS A;  3HYP A;  1PRX A;  4MCU A;  2PGT A;  1WRY A;  2H6Y A;  1V2A A;  3CSJ A;  4Z2R A;  2PWJ A;  3QPM A;  3QFB C;  1LBK A;  1OKD A;  1A8Y A;  3CSI A;  3FZA A;  2KUC A;  3L9S A;  2V32 A;  1SEN A;  1QGV A;  3LFL A;  4ZIJ A;  3FYG A;  2DJJ A;  1GP1 A;  3GUR A;  4CY6 A;  4WKW A;  1FOH A;  3J7Y b;  4BWQ A;  2F8A A;  3G7J A;  1K0N A;  3ZVJ D;  4X4J A;  1G6Y A;  1K3O A;  1ZYP A;  4O32 A;  4POM A;  1GL8 A;  3C1R A;  2WJU A;  2BTO T;  1DSB A;  3MAK A;  1EGO A;  4I5Q A;  3TJF A;  22GS A;  5ELA A;  2R0P A;  1JZD A;  3ME8 A;  2OBK A;  4Q5R A;  3FK8 A;  1URM A;  3TGZ A;  5J5N A;  3HCZ A;  3KTL A;  2CQ9 A;  1PMT A;  3W6G A;  4RUV A;  4FO5 A;  3MWH A;  3BOA A;  1EEM A;  3GUS A;  4KGI A;  1MEK A;  2XBQ A;  2HSH A;  2DLX A;  10GS A;  2VAF A;  4NAX A;  1KNG A;  4POB A;  5DCH A;  3W8J A;  1H75 A;  3HVX A;  2LKU A;  5CYY A;  1EWX A;  5EL8 A;  1YKA A;  4MF6 A;  2AUV A;  2M80 A;  1Z5Y E;  5ECK B;  5IIZ A;  3C71 A;  4IN0 A;  1TRV A;  1BG5 A;  3RHC A;  3KH7 A;  2L5O A;  4O5U A;  2VLV A;  3Q6O A;  4N0V A;  2EIO A;  2YJ7 A;  4YKG A;  3RPN A;  5ECM B;  2F3M A;  1A2J A;  4KE3 A;  1SKW B;  5IMZ A;  2OE1 A;  2HYX A;  1V57 A;  3TJG A;  2HRA A;  4OD7 A;  5D73 A;  4ZB9 A;  2GZP A;  4D73 B;  3NZN A;  2REM A;  6GST A;  3F0I A;  1AXD A;  2C1Y A;  1Y25 A;  3SBC A;  2VM1 A;  1GRX A;  2ZCT A;  4OCF A;  1K0O A;  2FUG 2;  3D4M A;  4PXO A;  1NSW A;  3F9U A;  3KTB A;  1GSF A;  5HR3 A;  5IMA A;  3ZL5 A;  5F06 A;  3M9J A;  3A2V A;  4J56 E;  2RII A;  1WMJ A;  4DSS A;  4HOJ A;  5E59 A;  3Q74 A;  3ERW A;  3C1S A;  1MD3 A;  2NVL A;  1XG8 A;  3KCM A;  3EC3 A;  5DVB A; 
#chains in the Genus database with same CATH homology
 3WYW A;  5CRD A;  1X5E A;  1AIU A;  1TI1 A;  3E0U A;  4HJ2 A;  4POK A;  1QMV A;  4K2X A;  1PGT A;  2LJA A;  1YJ6 A;  4NHZ A;  2OJL A;  2DJK A;  5HR2 A;  5COH A;  3J7Y k;  4MNN A;  1KEB A;  3UAP A;  2B1L A;  1FG4 A;  5KN0 A;  3QFA C;  4ECI A;  2B5X A;  4JR6 A;  3WGE A;  4FH8 A;  18GS A;  2P0G A;  4FYB A;  1OC3 A;  14GS A;  3DKS A;  3US3 A;  4F0C A;  4MDC A;  3UOM A;  5ABR A;  4O7H A;  1O8W A;  2R6K A;  3KZQ A;  2L4Q A;  4QL7 A;  3I69 A;  4ID0 A;  4EKZ A;  3A5W A;  4Z2T A;  1BAY A;  5AIX A;  2H1A A;  3TRX A;  1GTU A;  4KUN A;  3I9V 2;  2OE3 A;  2VL2 C;  1OKT A;  3HXS A;  2I3Y A;  1MD4 A;  1PX6 A;  5LNK e;  2XBI A;  4X1U A;  1SYR A;  1W4V A;  5GSS A;  5LD0 A;  2X49 A;  3TKS C;  3EPT A;  2PER A;  1TTZ A;  3ZVJ A;  4TW5 A;  4WET A;  4DSS B;  1I5G A;  2VCT A;  2ON7 A;  5AN1 A;  1VF3 A;  5DQY A;  4Q5F A;  1XVQ A;  5IOW A;  2P5Q A;  1GUH A;  4PQH A;  1JLV A;  3FR6 A;  5IMD A;  4HI7 A;  4TR3 A;  3R3E A;  1U3I A;  1GTI A;  2YV7 A;  2GS3 A;  3ZLP A;  6GSY A;  4YQV A;  5H5Q A;  19GS A;  3D4T A;  1QQ2 A;  3KD0 A;  2LQO A;  5CRG A;  3IC8 A;  2WB9 A;  3L9U A;  2XHF A;  4K5S A;  1WOU A;  2AHE A;  3G7Y A;  3Q18 A;  3APQ A;  5G1L A;  3CXG A;  2MMO A;  4YQM A;  4BWS A;  2CVB A;  3UIW A;  3NOF A;  3O3T A;  1A8L A;  1SKR B;  5IM9 A;  5B6M A;  1E6B A;  3DYR A;  3UJ1 A;  3MYD A;  3F4S A;  1Z7R A;  1X5C A;  2H6X A;  3IA1 A;  3QAW A;  4O92 A;  3ZFB A;  5B7C A;  5HR0 A;  1T4Z A;  3PH9 A;  2P5R A;  2AAW A;  3VWV A;  1TRS A;  3M1G A;  4G0L A;  2HFD A;  2R4V A;  3IDV A;  11GS A;  3IHG A;  1SU9 A;  1GNW A;  2H74 A;  2LJK A;  4K2D A;  4USS A;  4G10 A;  2HE3 A;  2GLR A;  5IO0 A;  1ST9 A;  1RK4 A;  1XW5 A;  4EC0 A;  4K6X A;  2K8V A;  1Z3E A;  5A5K A;  5JWO B;  2YWM A;  1QXH A;  2H72 A;  4TR4 A;  4IJI A;  4FYC A;  5IO2 A;  1J0F A;  2G2Q A;  1X9W B;  5BMU A;  2VD1 A;  4EVM A;  3QDN A;  4NV2 A;  1ILO A;  1Z9H A;  2RUE A;  3R2Q A;  2MYG A;  3N5O A;  1X9M B;  1OE7 A;  4EDZ A;  3TJB A;  1U6T A;  2YP6 A;  4V1A p;  3D6I A;  2M46 A;  2H1D A;  2GVP A;  1LJR A;  1W89 A;  4WF5 A;  4JE1 A;  4DEJ A;  3KEB A;  1F37 A;  2DBC A;  2PU9 C;  4MK3 A;  4ZB8 A;  4MH2 A;  3TOU A;  1TI3 A;  2HT9 A;  5ID2 A;  2C8U A;  1M9B A;  5AIS A;  2VCW A;  4EE0 A;  4L8E A;  3RPP A;  3VPT A;  1SYX A;  4I8B A;  5CRH A;  4PUR A;  2FWE A;  3ZZX A;  4MAB A;  4CY8 A;  4G0K A;  3F4R A;  4K0G A;  4ACS A;  3QD9 A;  4HZ4 A;  1ERT A;  17GS A;  4NV5 A;  4YAV A;  3IR4 A;  5JCG A;  4OFT A;  5DDL A;  4L0U A;  2DSA A;  1PN9 A;  2HLS A;  3H79 A;  4L5L A;  4KCE A;  1K0D A;  2VLU A;  2MZC A;  4OWY A;  1RQM A;  2BMX A;  1QUW A;  4EL1 A;  4ZL8 A;  4ZBA A;  1OC8 A;  3QAV A;  3WGX A;  3HZ4 A;  2GTU A;  3EUR A;  5DAL A;  3TRP A;  1OAZ A;  4PNF A;  2QGV A;  3ZRE A;  1QK8 A;  2NBS A;  2GSQ A;  4GST A;  1GUK A;  2R0C A;  1SK1 A;  2DML A;  4V2L A;  1T1V A;  2LTK A;  1GSQ A;  5IPG A;  1R7H A;  2DKH A;  3A3T A;  2C3T A;  1TDI A;  2C3Q A;  2VCX A;  2H30 A;  1NW2 A;  5G30 A;  1PL2 A;  3VWW A;  4J2F A;  5F07 A;  3P8W A;  2H70 A;  2I4A A;  3GV1 A;  2AJQ B;  3HKR A;  2VCQ A;  1R4W A;  3VWU A;  3K8N A;  3LWA A;  1DUG A;  1PD2 1;  4ML6 A;  2FY6 A;  2LNS A;  1VF2 A;  3S9F A;  1ZYE A;  5H5R A;  5G31 A;  5HFI A;  5D9X A;  2FHE A;  1EP7 A;  3V1W A;  3IPZ A;  1R5A A;  3GX8 A;  4EUY A;  1ZYQ B;  5CAX A;  2VCZ A;  2ON5 A;  1V40 A;  2CAI A;  3TUE A;  1BJX A;  1EOG A;  3DWV A;  5ID2 B;  4D73 A;  2ALB A;  3HZ8 A;  3KM6 A;  1XWB A;  4K0N A;  4LL4 B;  1F2E A;  2PVQ A;  2GZY A;  4XHM A;  4OCE A;  4YQU A;  4IVF A;  1JFU A;  2LUS A;  2QSI A;  4MZB A;  1A23 A;  2A4V A;  3FKF A;  4L5O A;  3LOR A;  1XZO A;  1AAZ A;  3FEU A;  4V1A g;  1YF1 A;  4RI7 A;  4XRD A;  1PQN A;  2V6O A;  2FWF A;  1M7T A;  3AY8 A;  4ZL9 A;  4LL1 B;  1X0R A;  2BJX A;  5ECL B;  1Q98 A;  4IW9 A;  5DAL B;  5F8B A;  2C0E A;  2JSY A;  1GSY A;  2C0G A;  4AF2 A;  3CMI A;  2N5F A;  3IAS 2;  1FVK A;  1CQG A;  4TOP A;  1V9W A;  2H1B A;  2WUL A;  2AYT A;  5ECN B;  1A0F A;  1OC9 A;  5HQP A;  5ECR B;  2VL3 A;  1TU8 A;  5HR1 A;  3CTG A;  1WJK A;  1OE8 A;  4ECC A;  4MJA A;  3KJY A;  1YKC A;  2X8H A;  4FQU A;  5J4U A;  4HU7 A;  4N0Z A;  1E2Y A;  1VF4 A;  2X99 A;  1XPV A;  2A4H A;  3OR5 A;  2MBT A;  1Z6M A;  2HZF A;  3HY2 A;  2OAC A;  2PPT A;  2X4A A;  1XFL A;  2GSR A;  3ZTL A;  3F3Q A;  1DE2 A;  1VRS D;  3NIV A;  4F9Z A;  1XWA A;  1G6W A;  3HA9 A;  2JSZ A;  3FR9 A;  3F6F A;  2E0Q A;  4EF0 A;  2L57 A;  3LQ7 A;  1ERW A;  2D2Z A;  2CX4 A;  4PQ1 A;  4ZXG A;  4OFN A;  3MNG A;  3EMX A;  1EEJ A;  2H75 A;  1VF1 A;  3HJO A;  4CW9 A;  1F3B A;  1H4O A;  2L6D A;  4IQA A;  5FHI A;  3MIX A;  2LNT A;  3TCO A;  3ZIV A;  4KW6 A;  4OO5 A;  1KTE A;  4GXZ A;  2VL9 A;  3UVH A;  1M9A A;  1XOA A;  5KN3 A;  2O89 A;  4MP4 A;  5CO3 A;  1FVJ A;  3D5J A;  3P2A A;  2ES7 A;  2G0F A;  2H01 A;  3A5I A;  2WZ9 A;  1HQO A;  2B7J A;  1I9D A;  3PIN A;  1SKS B;  1JZW A;  4G0I A;  5L71 A;  1ZCP A;  1LU4 A;  1FB0 A;  5IMV A;  1TRU A;  1WE0 A;  1G0T A;  5AGY A;  3CRU A;  2OAD A;  1SL1 B;  4NXI A;  1OC9 B;  2QA1 A;  5IOX A;  3Q19 A;  1XWC A;  4KDX A;  3UL3 A;  3DIE A;  3G7I A;  1UN2 A;  1B4P A;  1THO A;  1BYE A;  3GL5 A;  3IC4 A;  5B6N A;  1HD2 A;  4MPG A;  1O73 A;  2RM6 A;  3A2X A;  1GTB A;  5G5E A;  2XC2 A;  4ICY A;  1F3A A;  2LQQ A;  1T7P B;  3FZ9 A;  3DVW A;  1KBN A;  1T8E B;  2EIR A;  3LYK A;  2B5E A;  1YEX A;  3H4K A;  1YZX A;  1TP9 A;  1FW1 A;  5LCZ A;  1A2L A;  5J9B A;  1N2A A;  2NTO A;  3L78 A;  1U88 A;  1EGR A;  3ZRD A;  2CVK A;  5ECP B;  5FT3 A;  4HQS A;  4N10 A;  1ON4 A;  1GSD A;  3RDW A;  2GDR A;  2H6Z A;  4TRX A;  3VUR A;  2R5G A;  4DSQ A;  1HNC A;  2H1G A;  2MMN A;  2JU5 A;  2K9F A;  2QKE A;  1ZL9 A;  2IMF A;  1SK0 A;  2RUF A;  3FR3 A;  4BA7 A;  4G9H A;  3GSS A;  2GT6 A;  1XXU A;  1FO5 A;  1S3A A;  3IV4 A;  1K3L A;  2AB6 A;  3I43 A;  4GTU A;  3F3R A;  2I9H A;  1GSE A;  2AV4 A;  3GN3 A;  4P3Y B;  2K6V A;  2F9S A;  2R37 A;  4N30 A;  2H73 A;  3IK7 A;  3HHV A;  3CYN A;  2CX3 A;  4MA9 A;  3M3M A;  1T4Y A;  4ZIL A;  3HVV A;  1FHE A;  1AQV A;  2DIY A;  5D9T A;  3GH6 A;  1V58 A;  4JED A;  1M0U A;  4XS6 A;  4IBP A;  2K18 A;  5EVO A;  3RBT A;  1WPI A;  2C0F A;  2TIR A;  1EV9 A;  1UC7 A;  4BL7 A;  1DBY A;  4HZ2 A;  4MPF A;  9GSS A;  2MMA A;  3CBU A;  2KP1 A;  4HU9 A;  3TJK A;  1C72 A;  1IYH A;  3GH9 A;  1Q4J A;  2WS2 A;  4KSO A;  3BCK A;  1X9S B;  3H1N A;  4HUA A;  4RQR A;  3ZIJ A;  1PA3 A;  2CVD A;  5INY A;  1F6M C;  4QQ7 A;  1PKZ A;  4POL A;  5ELG A;  3DML A;  4O5R A;  2CV4 A;  1MDJ A;  1DE1 A;  2GSS A;  2KHP A;  1TJD A;  3GIX A;  4KCA A;  1JLW A;  5B8B A;  4AJ8 A;  1S3D A;  2IMK A;  3TDG A;  2J9H A;  3C7M A;  5CP1 A;  2CA8 A;  4PTS A;  2B6M A;  1JZR A;  2X64 A;  4RQX A;  2OKA A;  4TR0 A;  4TR1 A;  1GH2 A;  3IOS A;  3LEF A;  1Y6E A;  1EV4 A;  3ISO A;  1XVW A;  2WGR A;  4NMU A;  2E2G A;  5D9W A;  4MJC A;  1ACV A;  1SD9 A;  2DJ2 A;  4J57 E;  2Z9S A;  3D0Z A;  3VK9 A;  1M99 A;  3GNJ A;  2JAC A;  5ECH B;  3RHB A;  5JWQ B;  2H66 A;  2VO4 A;  1UVZ A;  3SWL A;  3DEX A;  1BED A;  2GQL A;  4AJ6 A;  3O6T A;  4HEA 2;  2C3N A;  4KDY A;  4KDU A;  7GSS A;  3PGT A;  2IFQ A;  2DJ3 A;  1XCC A;  1THX A;  3UVT A;  3IRA A;  1TW9 A;  2H0H A;  3H8Q A;  1ZZY A;  3VWX A;  2K8S A;  20GS A;  2YWN A;  4BPY A;  4EO3 A;  3PR8 A;  5CRW A;  1SD8 A;  2YZU A;  4LMW A;  1GUL A;  2H19 A;  4BL7 B;  3UBK A;  2IMI A;  1A2M A;  3GL3 A;  3TB2 A;  1Z6N A;  4IS0 A;  4GCI A;  1TK8 B;  3QR6 A;  1K0M A;  4GF0 A;  4I97 A;  1XWG A;  4AJ7 A;  5BRT A;  3ZMK A;  1ABA A;  1WP0 A;  4IQ1 A;  4ZB6 A;  4Q5Q A;  1NHO A;  2YNX A;  3IHQ A;  1SJ6 A;  1O6J A;  6GSU A;  4FYU A;  3LG6 A;  1BX9 A;  3MSZ A;  4A5P A;  4GRF A;  5D9V A;  3EE2 A;  4IGJ A;  1SL0 B;  3GKX A;  4IHU A;  2H76 A;  2GQM A;  3ZFL A;  3CRT A;  1PSQ A;  5KOX A;  2O7K A;  1JZO A;  2V1M A;  4JZQ A;  16GS A;  2L59 A;  2VUP A;  2GGT A;  4TR1 B;  3PPU A;  4WR5 A;  4ECB A;  4JR4 A;  2DJ0 A;  3TRQ A;  3FMW A;  5DQS A;  4KSM A;  2VL2 A;  4YKF A;  3F4T A;  4NWY A;  4ZBD A;  2MMZ A;  3L0H A;  5EPF A;  4KF9 A;  2JZT A;  3F6D A;  3I6A A;  2YJH A;  2FGX A;  4V2N A;  4GLT A;  5FWG A;  3KIJ A;  1AW9 A;  3C73 A;  4EXJ A;  3D22 A;  2FA4 A;  3LJR A;  4OMV A;  6GSV A;  3IK9 A;  5JCU A;  2VM2 A;  2IFQ B;  2B5Y A;  2VOC A;  3IE3 A;  2A2P A;  4Z2U A;  5A4V A;  2OBI A;  2FWH A;  3HD5 A;  4JBB A;  3KMN A;  4XS4 A;  1USB A;  2C80 A;  3KGK A;  2KP2 A;  2WFC A;  1YQ1 A;  1HNB A;  3IXR A;  3LXT A;  4KA0 A;  2HRN A;  5KEJ A;  4RI6 A;  4YAP A;  3UBL A;  3TOT A;  4NPB A;  2FD3 A;  3EVI A;  2YPM A;  3O76 A;  1ZMA A;  2R2J A;  1EZK A;  2WRT A;  1AC1 A;  5J3R A;  3DGQ A;  2ZNM A;  1O7U A;  1B9Y C;  1B9X C;  4LMV A;  3EIN A;  2RLI A;  3EU3 A;  4MF7 A;  1SJZ A;  2JZR A;  2WDU A;  2JAD A;  1TRW A;  4MF5 A;  3TKQ A;  4OO4 A;  2B7K A;  1UA5 A;  2E7P A;  2EC4 A;  2XPD A;  1J08 A;  4HJM A;  2L6C A;  3ERF A;  4MZW A;  3UEM A;  3ED3 A;  12GS A;  2B3S A;  2IPA A;  4I2U A;  4DVC A;  3BJ5 A;  5D93 A;  4I2T A;  3HVS A;  3LXZ A;  3BD2 A;  4PUF C;  1X5D A;  1U3A A;  2IN3 A;  4IP1 A;  4MH3 A;  3ERG A;  3CSH A;  3M8N A;  2LEG A;  4WEY A;  4K5R A;  2F51 A;  2YN1 A;  1XWK A;  4K7N A;  3GTU A;  3FHK A;  2PVO C;  4GQC A;  3ME7 A;  2FA8 A;  5B8A A;  3HDC A;  5DJL A;  1TK0 B;  3GMF A;  4EIQ A;  2CT6 A;  3FZ4 A;  5D96 A;  4XS1 A;  4L0W A;  5ECS A;  2CZ2 A;  5HFG A;  5D8I A;  4XS4 B;  4GQF A;  4GSN A;  4O5Q A;  3A2W A;  1MDK A;  1A24 A;  3QOU A;  1B48 A;  2IMD A;  5DCG A;  1XOB A;  4JU5 A;  2R0G A;  1OVN A;  5G5F A;  2KLX A;  4MZC A;  3GHA A;  2PMT A;  3QAG A;  4V2M A;  4TKY A;  4KH7 A;  1R5P A;  1YDK A;  3UAR A;  1NM3 A;  2VD0 A;  3FW2 A;  2JZS A;  6GSS A;  1K0C A;  2GT5 A;  4FIW A;  2HSY A;  3C8E A;  1WIK A;  2H71 A;  4IKH A;  2KOK A;  1ZOF A;  2NPB A;  3VI5 A;  1ML6 A;  2H0I A;  1SL2 B;  2HZE A;  2VLT A;  2IIY A;  4MLY A;  4H86 A;  2YZH A;  2UZ8 A;  1O81 A;  1FAA A;  5GZZ B;  4MJE A;  2H8L A;  3GST A;  3EMP A;  4X43 A;  6GSW A;  4TXO A;  1FB6 A;  2YOI A;  3GFK A;  4F2I A;  2QC7 A;  4MMM A;  1PKW A;  4E8H A;  4PNG A;  1K0B A;  3ZIT A;  4KB3 A;  1GTA A;  2L4C A;  4F03 A;  3U6V A;  4HQZ A;  1JHB A;  5ECO B;  5JCW A;  1BQ7 A;  5HFK A;  2LRN A;  1OYJ A;  4ZL7 A;  3GTU B;  1GNE A;  2YAN A;  3TKR A;  1PX7 A;  1ERU A;  4MJB A;  2A2S A;  3LW9 A;  4XIH A;  5GST A;  2GZZ A;  2CAQ A;  3KMO A;  3F8U A;  4EIP A;  2NDO A;  1XW9 A;  4AGS A;  1YF0 A;  5F05 A;  2IL3 A;  2QA2 A;  1XIY A;  2XPE A;  5CRE A;  4ISD A;  2IJY A;  3GX0 A;  2FWG A;  1T3B A;  4GSS A;  2DKI A;  5GAN D;  2HRK A;  3WD6 A;  2HXK A;  4Z7X A;  2DJ1 A;  4X0X A;  3FY7 A;  3TKS E;  5DBQ A;  2V2G A;  1MTC A;  5J41 A;  2H0G A;  2O85 A;  2V41 A;  3N9J A;  4HS1 A;  3M0F A;  1TU7 A;  5C00 A;  2VCV A;  4QL9 A;  5G1K A;  4TXV A;  3LYP A;  1U87 A;  1V98 A;  3DXB A;  5CNW A;  3F63 A;  3UMA A;  5ECQ B;  1N8J A;  3GRX A;  1AQW A;  1O85 A;  1K3Y A;  3APS A;  2HZE B;  2FLS A;  4PX1 A;  1AQX A;  5E4W A;  4GWR A;  1XW6 A;  4E8E A;  4BVY A;  4IP6 A;  5DAK A;  2MBS A;  13GS A;  2A2R A;  3VFI A;  2DMM A;  4WBR D;  2OA7 A;  2X8G A;  1IYI A;  1YEP A;  1TXX A;  2YWI A;  3QMX A;  1CQH A;  3GKM A;  2CZ3 A;  4TXO B;  4IJ3 A;  2N5B A;  4WF4 A;  3DRN A;  3IBH A;  4OFM A;  5KN2 A;  2LRT A;  5A4U A;  1F9M A;  1GLP A;  2N5A A;  4KND A;  6GSX A;  1GSU A;  4PGT A;  1HYU A;  2FCH A;  2E2M A;  1PN0 A;  2I81 A;  1GLQ A;  5C04 A;  4XRA A;  2M72 A;  5JWR B;  4N11 A;  1R26 A;  3GKK A;  4WR4 A;  3VPQ A;  3ZML A;  2C4J A;  1K0A A;  2JL4 A;  2TRC P;  3LGC A;  3CTF A;  1TOF A;  5ECI B;  1PL1 A;  4BVX A;  1G7O A;  1B8X A;  2DIZ A;  2TRX A;  2IWT A;  3P90 A;  4ULX A;  4ECJ A;  2LST A;  5GAP D;  1VGL A;  2YCD A;  2J23 A;  1M2D A;  3EWL A;  4KX4 A;  2ZUP A;  2X8C A;  2HI7 A;  3EYT A;  2P31 A;  2GQK A;  1B4Q A;  4NHW A;  2V6K A;  1EP8 A;  1SK2 A;  3TKP A;  1ERV A;  2DC5 A;  5G2Z A;  3VI7 A;  4K1F A;  3L9V A;  1YY7 A;  4I6X A;  1RW1 A;  2YWO A;  3EU4 A;  4CHS A;  8GSS A;  4CDO A;  5ENU A;  2LJR A;  2OE0 A;  4K7O A;  2I1U A;  3E3E A;  3DD3 A;  3RAZ A;  5IQY A;  3WT2 A;  2L5L A;  2LRC A;  4ILF A;  2HNL A;  3W8S A;  3WT1 A;  4BVY B;  3G9B A;  5DAK B;  3IAM 2;  1T00 A;  2PUK C;  4PQI A;  5H5S A;  4XTS A;  3BBY A;  3M9K A;  1J9B A;  4K9Z A;  1AUC A;  5J9C A;  3D21 A;  1FOV A;  3ZYW A;  4DSR A;  2RM5 A;  3WGD A;  2B1K A;  4IEL A;  1M2B A;  1GUM A;  4LLR A;  3U5R E;  1QFN A;  3GKN A;  1NHY A;  2HSM A;  5AIV A;  2FNO A;  5A4W A;  3FRC A;  3E9J B;  3KP9 A;  4TVE A;  4EDY A;  1GWC A;  5IMC A;  2HRF A;  1WWJ A;  2EIQ A;  3GA4 A;  3HJM A;  4KAE A;  1Z7P A;  4HDE A;  3APO A;  4XCS A;  4F0B A;  3KP8 A;  3HJP A;  3DVX A;  1TK5 B;  1SJI A;  3LSZ A;  4BVX B;  2GST A;  4TN8 A;  5KN1 A;  3P7X A;  2PBJ A;  3QCP A;  4WXT A;  3BCI A;  1O8X A;  2R3X A;  4G19 A;  2F8F A;  1M2A A;  1MDI A;  2LS5 A;  3VLN A;  1EOH A;  3H93 A;  2WCI A;  4YH2 A;  4K7I A;  4ML1 A;  4PUA A;  3MDK A;  4G2E A;  4K8M A;  1A0R P;  2O87 A;  4ZBB A;  3TJJ A;  5KOW A;  2IME A;  2LV3 A;  1ZGN A;  4F82 A;  1ZYN A;  1HNA A;  1TKD B;  2C0D A;  3KH9 A;  5F0G A;  3JCM L;  2VIM A;  4WBJ A;  3KXO A;  2YV9 A;  3GYK A;  5IMF A;  3TKS A;  4LA1 A;  2O8V B;  3L4N A;  4JRR A;  1GSS A;  1S3C A;  5DJM A;  3FZ5 A;  5EY6 A;  1G7E A;  5IPH A;  4Q5N A;  2PN8 A;  1XBS A;  3HYP A;  1PRX A;  4MCU A;  2PGT A;  1WRY A;  2H6Y A;  1V2A A;  3CSJ A;  4Z2R A;  2PWJ A;  3QPM A;  3QFB C;  1LBK A;  1OKD A;  1A8Y A;  3CSI A;  3FZA A;  2KUC A;  3L9S A;  2V32 A;  1SEN A;  1QGV A;  3LFL A;  4ZIJ A;  3FYG A;  2DJJ A;  1GP1 A;  3GUR A;  4CY6 A;  4WKW A;  1FOH A;  3J7Y b;  4BWQ A;  2F8A A;  3G7J A;  1K0N A;  3ZVJ D;  4X4J A;  1G6Y A;  1K3O A;  1ZYP A;  4O32 A;  4POM A;  1GL8 A;  3C1R A;  2WJU A;  2BTO T;  1DSB A;  3MAK A;  1EGO A;  4I5Q A;  3TJF A;  22GS A;  5ELA A;  2R0P A;  1JZD A;  3ME8 A;  2OBK A;  4Q5R A;  3FK8 A;  1URM A;  3TGZ A;  5J5N A;  3HCZ A;  3KTL A;  2CQ9 A;  1PMT A;  3W6G A;  4RUV A;  4FO5 A;  3MWH A;  3BOA A;  1EEM A;  3GUS A;  4KGI A;  1MEK A;  2XBQ A;  2HSH A;  2DLX A;  10GS A;  2VAF A;  4NAX A;  1KNG A;  4POB A;  5DCH A;  3W8J A;  1H75 A;  3HVX A;  2LKU A;  5CYY A;  1EWX A;  5EL8 A;  1YKA A;  4MF6 A;  2AUV A;  2M80 A;  1Z5Y E;  5ECK B;  5IIZ A;  3C71 A;  4IN0 A;  1TRV A;  1BG5 A;  3RHC A;  3KH7 A;  2L5O A;  4O5U A;  2VLV A;  3Q6O A;  4N0V A;  2EIO A;  2YJ7 A;  4YKG A;  3RPN A;  5ECM B;  2F3M A;  1A2J A;  4KE3 A;  1SKW B;  5IMZ A;  2OE1 A;  2HYX A;  1V57 A;  3TJG A;  2HRA A;  4OD7 A;  5D73 A;  4ZB9 A;  2GZP A;  4D73 B;  3NZN A;  2REM A;  6GST A;  3F0I A;  1AXD A;  2C1Y A;  1Y25 A;  3SBC A;  2VM1 A;  1GRX A;  2ZCT A;  4OCF A;  1K0O A;  2FUG 2;  3D4M A;  4PXO A;  1NSW A;  3F9U A;  3KTB A;  1GSF A;  5HR3 A;  5IMA A;  3ZL5 A;  5F06 A;  3M9J A;  3A2V A;  4J56 E;  2RII A;  1WMJ A;  4DSS A;  4HOJ A;  5E59 A;  3Q74 A;  3ERW A;  3C1S A;  1MD3 A;  2NVL A;  3KCM A;  3EC3 A;  5DVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...