2MMAA

Nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
107
structure length
107
Chain Sequence
b'LTPQLKDTLEKLVNSEKVVLFMKGTRDFPMCGFSNTVVQILKNLNVPFEDVNILENEMLRQGLKEYSNWPTFPQLYIGGEFFGGCDITLEAFKTGELQEEVEKAMCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monothiol glutaredoxin-S14, chloroplastic
publication title Structural and Spectroscopic Insights into BolA-Glutaredoxin Complexes.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Gene regulation
total genus 34
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2014-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00462 Glutaredoxin Glutaredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2mmaA01
1BX9A 3W8SA 2IMEA 3MWHA 2JSZA 3VWVA 2I1UA 4JE1A 4MK3A 1OC8A 3ZMKA 4J2FA 4MCUA 5EVOA 22GSA 1R5AA 4TVEA 1K0CA 3QAVA 4K6XA 5D9WA 5A4WA 4IP1A 1PX7A 3EVIA 3ED3A 4MPFA 2NDOA 1Z7PA 1X0RA 2H0GA 2VCXA 3FEUA 1EZKA 4IJIA 1R5PA 1E6BA 3BBYA 2G2QA 2AUVA 3KH7A 1V58A 1THXA 1TRUA 2H1AA 2AV4A 1ZOFA 4WR5A 3QFAC 3HZ4A 3NIVA 4BPYA 5FT3A 2WJUA 2VCVA 1HYUA 3ZYWA 3UVHA 5CRGA 1TOFA 2D2ZA 2PVQA 4IP6A 3GL3A 4G10A 2L4CA 2JACA 2B6MA 4DSSA 1OE7A 5ECOB 1PMTA 5H5QA 1HNBA 4MF6A 3M9JA 1EGRA 2NBSA 3HY2A 3TJKA 2CQ9A 1M9AA 1M99A 1A2LA 4FYUA 4E8HA 2IWTA 3I43A 1OYJA 4MJBA 4QL9A 1OAZA 1UN2A 4DEJA 4TXVA 5CO3A 2XHFA 4HUAA 4E8EA 5J3RA 1ST9A 3H8QA 1ACVA 4PNFA 2YJHA 1GLPA 1A2JA 1KTEA 3H79A 4OO5A 3K8NA 4ECBA 5F0GA 4XS4A 7GSSA 2R37A 3ZIJA 4ECJA 5F8BA 1G6WA 1DBYA 5IMCA 3VI7A 1T00A 1WRYA 2DMMA 1HQOA 3D4TA 1Z5YE 3WT1A 3QPMA 3TRQA 2K9FA 3ERWA 5CYYA 2HSHA 2LTKA 4Q5FA 5A4UA 2XC2A 8GSSA 1M9BA 2VM2A 1Z9HA 2F9SA 1EEMA 4KUNA 2C3TA 2VO4A 3O6TA 2FGXA 2YZHA 2EIRA 3R2QA 1A8LA 2DIYA 4CHSA 4KSMA 3IA1A 5CRWA 1A23A 3G7JA 3KTBA 4HOJA 5DJLA 1W4VA 2JADA 9GSSA 4I2TA 4ECCA 4PQIA 3IR4A 2OADA 1TDIA 2KUCA 2WRTA 1YZXA 3E0UA 2RUEA 3EYTA 2LQOA 5JWRB 3GIXA 4IJ3A 5IMZA 5COHA 3CTFA 2MMOA 5J9CA 5G1LA 3L9VA 3G7IA 6GSWA 3UBKA 2B5YA 4POMA 3VFIA 4XRDA 4NHZA 2GQKA 5H5RA 4X0XA 4V2LA 1AUCA 3L9UA 2WDUA 1WMJA 1PRXA 4NAXA 3VI5A 4AJ7A 3HD5A 1X5CA 5DCHA 1XWCA 4OFMA 2GDRA 1YJ6A 2IFQB 2LS5A 4MZBA 2LUSA 2YNXA 3F9UA 3MAKA 1TJDA 5ECSA 4LLRA 4POKA 4KCAA 2O8VB 2B3SA 2DJ2A 1JHBA 3F4RA 2PERA 2H1DA 1HNCA 1A8YA 2IJYA 4I8BA 2PBJA 3F63A 1QK8A 3ZVJA 1SK1A 1I5GA 2TRCP 4NV5A 2HZFA 4WEYA 3LXZA 2PGTA 3FZ5A 2DJKA 2F8AA 1UA5A 5DBQA 1XPVA 4JEDA 5C00A 2JZSA 3FK8A 4O92A 4OFTA 2CAQA 4YQUA 2V6OA 4GRFA 2HLSA 3QR6A 3UVTA 1EEJA 1BEDA 1SYRA 3MDKA 1XWBA 3TGZA 2RUFA 2P0GA 4POBA 3HDCA 2H19A 2J23A 3ME8A 2A4VA 4RQRA 1ZMAA 1AQWA 5A4VA 3ERGA 4N0ZA 3CSJA 2HT9A 3HHVA 3F3QA 2H66A 5GZZB 3H4KA 2L57A 1AQXA 4XS1A 4MP4A 5CP1A 2GVPA 6GSSA 2CX4A 4GSNA 1A2MA 5HFIA 5CAXA 3DYRA 3Q6OA 5IO0A 2AAWA 2JU5A 5ECMB 3V1WA 2GTUA 3FYGA 1O81A 5IMVA 5DVBA 1B9XC 3LXTA 5ECIB 2BMXA 2YN1A 3D22A 4GF0A 4F82A 1AXDA 3F4SA 5E4WA 1S3AA 1ZCPA 5KN2A 2FWGA 2ZCTA 1M2BA 2CZ2A 4NPBA 1FOVA 4KE3A 2PPTA 3KCMA 4QQ7A 2H76A 2WULA 3IV4A 3IBHA 2B7JA 5J4UA 1VF4A 5A5KA 4V1Ag 1X9WB 5D96A 1MD3A 2VL2C 1Q4JA 2QC7A 3UJ1A 2FWFA 2H1GA 1XVWA 1YDKA 2DC5A 2PVOC 4O5RA 3HJPA 4L5LA 1V98A 1YF0A 3QD9A 2MYGA 4ZBDA 4MF5A 1GSDA 2VUPA 1KEBA 5D9XA 3CTGA 4ISDA 4K7IA 2WCIA 4LA1A 1OC9B 1XW6A 4AF2A 1SJIA 1F9MA 4K9ZA 4JU5A 2C1YA 4L0WA 1B4QA 3FW2A 2H6XA 6GSVA 3RPPA 1DE1A 4HZ2A 5KN0A 1K0AA 1DSBA 3UARA 1B9YC 5D9VA 2M72A 1ZYEA 3KZQA 1WE0A 2C80A 3KIJA 1ABAA 1T8EB 2B7KA 2YZUA 1O73A 2HRFA 2P5QA 3CMIA 1XVQA 2CZ3A 3VPTA 5CREA 3HCZA 5LNKe 2RIIA 3RPNA 2MMNA 1MEKA 2VIMA 3ZREA 4X1UA 2E2MA 2N5BA 3MNGA 2GS3A 2H72A 2E0QA 3GHAA 3P7XA 2GT6A 5DCGA 1AIUA 5D93A 1KNGA 3APSA 5FWGA 1GSEA 2YP6A 4X43A 4FIWA 2JSYA 3KGKA 2LJAA 3EMPA 5DQSA 3N9JA 4TN8A 2LQQA 4MJCA 4PX1A 2EC4A 2OA7A 5C04A 2L59A 4F0CA 3FR9A 5AIXA 1I9DA 2V41A 1XFLA 1Z3EA 1K0NA 1HNAA 3PGTA 4MF7A 14GSA 4WKWA 5EPFA 3EU3A 1GSUA 5G31A 4PUAA 2H01A 2IN3A 2AB6A 2C0DA 3LGCA 1FW1A 4MH2A 4MZWA 1VRSD 3KTLA 1GUKA 1W89A 1RW1A 4TRXA 3TJFA 2IL3A 1GH2A 2KP2A 3ZZXA 4K0NA 5KN3A 1DE2A 2B5EA 2GZYA 2DJ0A 1A0RP 4K0GA 3A2WA 1FHEA 1PL1A 3TKSA 2GGTA 4ACSA 1NW2A 3I6AA 5HR1A 2CA8A 5DQYA 4OFNA 3CXGA 2FNOA 3GFKA 4MDCA 1F37A 2WS2A 4N0VA 13GSA 3E3EA 2BTOT 5JWQB 2R5GA 5G5FA 4ZIJA 3NOFA 3DVWA 1ILOA 2I9HA 1MDIA 19GSA 4EXJA 2LV3A 1PN9A 3PH9A 4MABA 1Z6MA 3A3TA 2GZZA 2B1LA 3HJOA 3EURA 2H8LA 4XIHA 5HFKA 3GTUB 3E9JB 1ON4A 3IC4A 3DVXA 5GSTA 4ZL7A 1ML6A 1K0MA 3I9V2 4KSOA 2YPMA 4F9ZA 5EY6A 3LSZA 3D0ZA 1GSQA 3A2XA 1SKSB 1U88A 1J08A 2DSAA 1FB0A 3GKNA 3EINA 12GSA 1AAZA 2KLXA 1VF1A 3L9SA 1PD21 3VLNA 4HU7A 2H73A 2A2SA 3O76A 4FYBA 3VPQA 2LRTA 4H86A 1SENA 1X5DA 2HI7A 4GQCA 4K7NA 4EL1A 2H1BA 2B1KA 3LWAA 1K3LA 3J7Yk 4LMVA 2LKUA 3O3TA 1UVZA 5B6NA 4HJ2A 2H0IA 2QSIA 2PMTA 5ECLB 3IAS2 4Q5NA 2HNLA 1ZYQB 4WETA 1JZDA 4TKYA 5F07A 2L4QA 3H93A 5IMAA 1PGTA 1GNWA 4NHWA 3IK9A 1X5EA 4IELA 4DSSB 1AQVA 3KMOA 5KEJA 1IYHA 1E2YA 2CVDA 1F6MC 2GT5A 2EIOA 4EDZA 2FLSA 3I69A 1Y6EA 1XW9A 1ZGNA 2JL4A 3D5JA 3M1GA 2AJQB 2NVLA 1MDJA 3JCML 2M46A 5JCGA 4Z7XA 3KP9A 3GNJA 4EUYA 6GSXA 2YWMA 1VGLA 1JZRA 3FKFA 4GQFA 3M8NA 4RQXA 1SK0A 3DEXA 1XWKA 2MMAA 3EWLA 2CV4A 3A5WA 2IPAA 1A24A 4XS4B 6GSYA 4PNGA 2YJ7A 5HR0A 4LL4B 4GWRA 3IDVA 4JR6A 1GTUA 4WXTA 2R4VA 1WOUA 1XXUA 2C8UA 4N11A 1NHYA 4RI7A 3F8UA 2K8SA 1K3OA 5IIZA 4EKZA 2FCHA 5DALA 3ZRDA 4PURA 1T7PB 1TRVA 3DXBA 3FRCA 3F6DA 1ZZYA 4K7OA 1K0DA 1S3DA 5B8AA 2IIYA 1WIKA 4MLYA 4ZBAA 4PUFC 5IPGA 5ELGA 3APOA 1GNEA 1G6YA 4TR1A 1K0BA 3ERFA 5D73A 2H6ZA 4DSQA 2HXKA 4G9HA 5L71A 3GKKA 2R2JA 3IE3A 3RBTA 4NXIA 3VWXA 2WB9A 3GRXA 2FD3A 1TKDB 1LU4A 4IGJA 5GAND 2AYTA 1Z7RA 3U6VA 3DIEA 1XWAA 1PL2A 1R7HA 6GSTA 2X8CA 1H75A 3LORA 4MZCA 10GSA 3ME7A 3QFBC 4KCEA 5G5EA 2YWNA 4OMVA 1RQMA 3J7Yb 1TU7A 2R3XA 3KP8A 1YEPA 1H4OA 1ERVA 3HJMA 3GUSA 5ENUA 5J41A 3W6GA 1PA3A 3ZIVA 1O7UA 2OJLA 3IHQA 4YAVA 2O85A 1S3CA 1XOAA 3M9KA 4EVMA 5CNWA 2L6DA 2ALBA 1SD9A 1GUMA 3IAM2 3EC3A 1OKTA 2XBQA 3APQA 2GLRA 4L0UA 2YOIA 5KN1A 1U87A 2IMKA 2VM1A 3TOUA 1FVJA 2LEGA 4BWSA 2X8GA 4EE0A 4I6XA 2PU9C 1AC1A 2LSTA 3ZL5A 1VF3A 1Z6NA 3L4NA 5INYA 1F3BA 5AN1A 2X64A 3KMNA 1V40A 2R6KA 3EE2A 4TR4A 3BCKA 4XCSA 2I3YA 5DAKA 3QOUA 4AGSA 3QAWA 3ISOA 4DVCA 4G19A 3GURA 2ES7A 3KEBA 1LJRA 3C71A 4OWYA 2LRNA 20GSA 2VL9A 2OE1A 2CX3A 5ECRB 3GKMA 1YKCA 3S9FA 4FYCA 1MTCA 4D73A 3HYPA 4N10A 2WZ9A 1U3AA 2YV9A 1M0UA 1XZOA 3F6FA 3SBCA 4XTSA 4TXOA 2VLUA 1SU9A 1SD8A 1T3BA 2ON5A 2HZEA 5J5NA 1CQHA 2GSRA 5B7CA 3C73A 2DJ1A 3HVSA 4ML6A 4WBJA 2K8VA 2C0GA 2WGRA 2NPBA 3UEMA 4EC0A 1K0OA 3GH6A 2TRXA 4BL7A 1WP0A 3CSIA 1QUWA 1YF1A 1X9MB 1CQGA 4YH2A 3WGDA 4PXOA 5H5SA 4QL7A 1MD4A 1LBKA 2VOCA 3P90A 2QGVA 4KDYA 3GL5A 4KH7A 5IMDA 3HZ8A 2F8FA 4ZL8A 1JLWA 1QXHA 3CRTA 3F4TA 6GSUA 4I5QA 1WJKA 2DJJA 2CT6A 3LQ7A 1YQ1A 3IXRA 1T1VA 3LFLA 3TB2A 1BAYA 1GWCA 4PQHA 4MH3A 1B4PA 5DAKB 3C1SA 3GMFA 4ZB8A 3QMXA 1JZOA 1EP7A 1ERWA 3FR3A 4HQZA 4ILFA 4HS1A 4ULXA 2L5OA 5DDLA 4XHMA 4GLTA 3U5RE 3KD0A 4KGIA 4MJAA 3PINA 5G2ZA 4HDEA 3VWWA 3HXSA 5HFGA 3GSSA 4TR0A 1QQ2A 4CW9A 2I4AA 4IW9A 1JZWA 5HR3A 1T4ZA 3LEFA 1O8XA 3FY7A 1AW9A 1N8JA 3BCIA 5D8IA 3TKSE 1NHOA 3WGEA 3BJ5A 3TKSC 2RM5A 2CAIA 4JRRA 3SWLA 3CRUA 1A0FA 3RDWA 4F2IA 1PKWA 3MSZA 4ZBBA 3VURA 4EDYA 3NZNA 1J0FA 4FH8A 1BG5A 2XPEA 2PWJA 4Q5RA 5G1KA 1PKZA 1N2AA 3VK9A 3UMAA 1TRSA 18GSA 3GN3A 1ERTA 2IMDA 3LYPA 1GSFA 4V2MA 2FA4A 1F2EA 2B5XA 5JCWA 1EP8A 5CRHA 5ECKB 4KW6A 4AJ8A 3G7YA 1TK0B 2DJ3A 3RAZA 2PN8A 1V2AA 1FO5A 4GXZA 2VL3A 1GP1A 2OKAA 1FVKA 2MMZA 3ZMLA 1TP9A 17GSA 2H71A 2K6VA 3BOAA 1FAAA 5DJMA 4WR4A 2FWEA 3P2AA 3FHKA 2RLIA 2DLXA 1THOA 1VF2A 4ZXGA 1GTBA 3DMLA 2HE3A 3F3RA 4O32A 4JZQA 3UBLA 1B48A 5IM9A 2WFCA 2GSQA 1OE8A 1HD2A 3TJJA 2X99A 4ZB9A 2Z9SA 3KXOA 3WYWA 11GSA 2H6YA 2L5LA 2VCTA 1FB6A 2VAFA 1JLVA 2VLVA 3PR8A 4BWQA 4Q5QA 3TKRA 2IMIA 4OCFA 1URMA 4J57E 2HSYA 2GSSA 3FZ9A 4TOPA 5G30A 4HQSA 3TJBA 2FUG2 3TOTA 3TDGA 4YQVA 3DKSA 1BYEA 3RHCA 4ML1A 2MBSA 1GL8A 2C4JA 1G7EA 1J9BA 1KBNA 4YAPA 2EIQA 1GSYA 2GQLA 2N5FA 2E2GA 3Q18A 1SJ6A 4KDUA 2IFQA 2C0FA 4ECIA 1U3IA 3ZFLA 1U6TA 2V32A 3N5OA 3UOMA 4GCIA 1R4WA 2KHPA 1OC3A 3GYKA 4HI7A 5HQPA 1EV4A 3FZAA 3D4MA 5ID2A 4LL1B 4V1Ap 1M7TA 3EMXA 4JBBA 4PGTA 3C8EA 4O7HA 5ELAA 1YY7A 4MA9A 2FHEA 1UC7A 2MBTA 4EO3A 1PQNA 1USBA 1XW5A 3P8WA 2PUKC 5GSSA 1PSQA 2YWIA 3US3A 1EGOA 4IQAA 3TRXA 1ERUA 2DMLA 1GUHA 2GZPA 3DRNA 4KDXA 1GSSA 5ABRA 1TK8B 2CVBA 1EOGA 4NV2A 4I2UA 2CVKA 4CDOA 3C1RA 4TW5A 4AJ6A 2DBCA 1XBSA 3DD3A 1O8WA 4NWYA 2F3MA 4GSSA 1TI3A 3WD6A 3DWVA 3ZTLA 4IN0A 2J9HA 2QKEA 5ECQB 4POLA 1GRXA 2AHEA 2VCQA 2X8HA 4IKHA 4V2NA 1G0TA 1WWJA 5ECPB 4P3YB 3HA9A 3IRAA 3LJRA 3M3MA 1SYXA 1DUGA 4K1FA 2F51A 1F3AA 3GSTA 1BJXA 4MJEA 2HYXA 2C3NA 1V9WA 4BVXA 1SKRB 1FG4A 5D9TA 3GX0A 3M0FA 3VWUA 4LMWA 2FY6A 3KJYA 2O7KA 5ID2B 3GX8A 3OR5A 1XIYA 1SKWB 2YV7A 1RK4A 5IOXA 2NTOA 4RUVA 4ZL9A 3BD2A 3H1NA 3CYNA 3ZITA 5HR2A 4IHUA 4OD7A 1NSWA 3ZLPA 4ID0A 1TXXA 4RI6A 1Y25A 5IO2A 1EV9A 5ECHB 3D6IA 3Q74A 5IOWA 2V6KA 3UIWA 2K18A 4KA0A 4JR4A 2YANA 3QDNA 4PQ1A 2ON7A 3C7MA 3W8JA 1WPIA 2KP1A 2GSTA 1GTAA 4OO4A 2V2GA 4HZ4A 2IMFA 1TK5B 1TU8A 3GV1A 4F0BA 4MPGA 2FWHA 4TR3A 1NM3A 1O85A 4K2DA 3GKXA 5GAPD 3TJGA 2LRCA 1QGVA 1QFNA 1JFUA 2H0HA 2M80A 3FR6A 3QCPA 2O87A 2OBKA 2A2RA 3HVXA 4FO5A 3DGQA 2OE0A 4G2EA 2ZNMA 1OC9A 1GTIA 1SL1B 1V57A 2LNTA 5B8BA 5DALB 2VCZA 3QAGA 4L5OA 4OCEA 3TRPA 1G7OA 4HU9A 3HKRA 2DIZA 4BA7A 4J56E 2VD0A 5IMFA 3UL3A 2HFDA 3CSHA 1SJZA 3A2VA 4TR1B 3F0IA 1QMVA 2FA8A 4BVYA 2O89A 4L8EA 1Q98A 2GQMA 3LYKA 5JCUA 1SK2A 5E59A 1SL0B 5AISA 1R26A 1XOBA 4GSTA 4IBPA 2OACA 4KB3A 1EOHA 2LJKA 3TUEA 5IPHA 4HEA2 1IYIA 5B6MA 5JWOB 2LJRA 1ZL9A 1BQ7A 3IK7A 3KM6A 2BJXA 3AY8A 2JZRA 5LCZA 2LNSA 3G9BA 1TRWA 5J9BA 2H30A 1XWGA 3ZVJD 2YWOA 1M2AA 3WT2A 1YKAA 5CRDA 4F03A 4WF5A 3D21A 1XCCA 1C72A 2XBIA 2JZTA 1GLQA 4XRAA 3UAPA 4I97A 3L0HA 1GULA 5AIVA 3CBUA 4WF4A 2P5RA 1B8XA 4HJMA 1EWXA 2MZCA 2ZUPA 5LD0A 3GH9A 1SL2B 2VD1A 3GA4A 2C3QA 3FZ4A 3IPZA 1MDKA 4K8MA 3L78A 3Q19A 1TI1A 1M2DA 1OKDA 2XPDA 4N30A 2H75A 4ZILA 1TTZA 3TKQA 2VL2A 4GTUA 4WBRD 4IQ1A 2N5AA 5EL8A 2H70A 3WGXA 4KNDA 1YEXA 2REMA 3IOSA 1OVNA 3KH9A 5F06A 1TW9A 2H74A 5FHIA 4DSRA 1O6JA 2HRNA 4IVFA 3HVVA 3TCOA 2VLTA 2RM6A 2TIRA 2OBIA 5AGYA 2L6CA 2E7PA 2P31A 3EU4A 5IQYA 3RHBA 4MMMA 4KAEA 16GSA 4D73B 4EF0A 2V1MA 1PX6A 2I81A 5ECNB 1X9SB 5F05A 2OE3A 4ZB6A 3TKPA 2C0EA 3LG6A 2KOKA 4IS0A 4TXOB 1K3YA 2G0FA 3GTUA 4XS6A 4YQMA 2HZEB 4NMUA 1T4YA 2VCWA 3ZFBA 2YCDA 4KX4A
chains in the Genus database with same CATH superfamily
1BX9A 3W8SA 2IMEA 3MWHA 2JSZA 3VWVA 2I1UA 4JE1A 4MK3A 1OC8A 4BL7B 3ZMKA 4J2FA 4MCUA 5EVOA 22GSA 1R5AA 4TVEA 1K0CA 3QAVA 4K6XA 5D9WA 5A4WA 4IP1A 1PX7A 3EVIA 3ED3A 4MPFA 2NDOA 1Z7PA 1X0RA 2H0GA 2VCXA 3FEUA 1EZKA 4IJIA 1R5PA 1E6BA 3BBYA 2G2QA 2AUVA 3KH7A 1V58A 1THXA 1TRUA 2H1AA 2AV4A 1ZOFA 4WR5A 3QFAC 3HZ4A 3NIVA 4BPYA 5FT3A 2WJUA 2VCVA 1HYUA 3ZYWA 3UVHA 5CRGA 1TOFA 2D2ZA 2PVQA 4IP6A 3GL3A 4G10A 2L4CA 2JACA 2B6MA 4DSSA 1OE7A 5ECOB 1PMTA 5H5QA 1HNBA 4MF6A 3M9JA 1EGRA 2NBSA 3HY2A 3TJKA 2CQ9A 1M9AA 1M99A 1A2LA 4FYUA 4E8HA 2IWTA 3I43A 1OYJA 4MJBA 4QL9A 1OAZA 1UN2A 4DEJA 4TXVA 5CO3A 2XHFA 4HUAA 4E8EA 5J3RA 1ST9A 3H8QA 1ACVA 4PNFA 2YJHA 1GLPA 1A2JA 1KTEA 3H79A 4OO5A 3K8NA 4ECBA 5F0GA 4XS4A 7GSSA 2R37A 3ZIJA 4ECJA 5F8BA 1G6WA 1DBYA 5IMCA 3VI7A 1T00A 1WRYA 2DMMA 1HQOA 3D4TA 1Z5YE 3WT1A 3QPMA 3TRQA 2K9FA 3ERWA 5CYYA 2HSHA 2LTKA 4Q5FA 5A4UA 2XC2A 8GSSA 1M9BA 2VM2A 1Z9HA 2F9SA 1EEMA 4KUNA 2C3TA 2VO4A 3O6TA 2FGXA 2YZHA 2EIRA 3R2QA 1A8LA 2DIYA 4CHSA 4KSMA 3IA1A 5CRWA 1A23A 3G7JA 3KTBA 4HOJA 5DJLA 1W4VA 2JADA 9GSSA 4I2TA 4ECCA 4PQIA 3IR4A 2OADA 1TDIA 2KUCA 2WRTA 1YZXA 1PN0A 3E0UA 2RUEA 3EYTA 2LQOA 5JWRB 3GIXA 4IJ3A 5IMZA 5COHA 3CTFA 2MMOA 5J9CA 5G1LA 3L9VA 3G7IA 6GSWA 3UBKA 2B5YA 4POMA 3VFIA 4XRDA 1FOHA 4NHZA 2GQKA 4O5UA 5H5RA 4X0XA 4V2LA 1AUCA 3L9UA 2WDUA 1WMJA 1PRXA 3FMWA 4NAXA 3VI5A 4AJ7A 3HD5A 1X5CA 5DCHA 1XWCA 4OFMA 4MNNA 2GDRA 1YJ6A 2IFQB 2LS5A 3IHGA 4MZBA 2LUSA 2YNXA 3F9UA 3MAKA 1TJDA 5ECSA 4LLRA 4POKA 4KCAA 2O8VB 2B3SA 2DJ2A 1JHBA 3F4RA 2PERA 2H1DA 1HNCA 1A8YA 2IJYA 4I8BA 2PBJA 3F63A 1QK8A 3ZVJA 1SK1A 1I5GA 2TRCP 4NV5A 2HZFA 4WEYA 3LXZA 2PGTA 3FZ5A 2DJKA 2F8AA 1UA5A 5DBQA 1XPVA 4JEDA 5C00A 2JZSA 3FK8A 4O92A 4OFTA 2CAQA 4YQUA 2V6OA 4GRFA 1ZYNA 2HLSA 3QR6A 3UVTA 1EEJA 1BEDA 1SYRA 3MDKA 1XWBA 3TGZA 2RUFA 2P0GA 4POBA 3HDCA 2H19A 2J23A 3ME8A 2A4VA 4RQRA 1ZMAA 1AQWA 5A4VA 3ERGA 3IC8A 4N0ZA 3CSJA 2HT9A 4G0IA 3HHVA 3F3QA 2H66A 5GZZB 3A5IA 3H4KA 2L57A 1AQXA 4XS1A 4MP4A 5CP1A 4USSA 2GVPA 6GSSA 2CX4A 4GSNA 1A2MA 5HFIA 5CAXA 3DYRA 3Q6OA 5IO0A 1ZYPA 2AAWA 2JU5A 5ECMB 3V1WA 2GTUA 3FYGA 1O81A 5IMVA 5DVBA 1B9XC 3LXTA 5ECIB 2BMXA 2YN1A 3D22A 4GF0A 4F82A 1AXDA 3F4SA 5E4WA 1S3AA 1ZCPA 5KN2A 2FWGA 2ZCTA 1M2BA 2CZ2A 4NPBA 1FOVA 4KE3A 2PPTA 3KCMA 4QQ7A 2H76A 2WULA 3IV4A 3IBHA 2B7JA 5J4UA 1VF4A 5A5KA 4V1Ag 1X9WB 5D96A 1MD3A 2VL2C 1Q4JA 2QC7A 3UJ1A 2FWFA 2H1GA 1XVWA 1YDKA 2DC5A 2PVOC 4O5RA 3HJPA 4L5LA 1V98A 1YF0A 3QD9A 2MYGA 4ZBDA 4MF5A 1GSDA 2VUPA 1KEBA 5D9XA 3CTGA 4ISDA 4K7IA 2WCIA 4LA1A 1OC9B 1XW6A 4AF2A 1SJIA 1F9MA 4K9ZA 4JU5A 2C1YA 4L0WA 1B4QA 3FW2A 2H6XA 6GSVA 3RPPA 1DE1A 4HZ2A 5KN0A 1K0AA 1PFOA 1DSBA 3UARA 1B9YC 5D9VA 2M72A 1ZYEA 3KZQA 1WE0A 4BVYB 2C80A 3KIJA 1ABAA 1T8EB 2B7KA 2YZUA 1O73A 2HRFA 2P5QA 3CMIA 1XVQA 2CZ3A 3VPTA 4G0KA 5CREA 3HCZA 5LNKe 2RIIA 3RPNA 2MMNA 1MEKA 2VIMA 3ZREA 4X1UA 2E2MA 2N5BA 3MNGA 2GS3A 2H72A 2E0QA 3GHAA 3P7XA 2GT6A 5DCGA 1AIUA 5D93A 1KNGA 3APSA 5FWGA 1GSEA 2YP6A 4X43A 4FIWA 2A4HA 2JSYA 3KGKA 2LJAA 2R0PA 4Z2TA 3EMPA 5DQSA 3N9JA 4TN8A 2LQQA 4MJCA 4PX1A 2EC4A 2OA7A 5C04A 2L59A 4F0CA 3FR9A 5AIXA 1I9DA 2V41A 1XFLA 1Z3EA 1K0NA 1HNAA 3PGTA 4MF7A 14GSA 4WKWA 5EPFA 3EU3A 1GSUA 5G31A 4PUAA 2H01A 2IN3A 2AB6A 2C0DA 3LGCA 1FW1A 4MH2A 4MZWA 1VRSD 3KTLA 1GUKA 1W89A 1RW1A 4TRXA 3TJFA 2IL3A 1GH2A 2KP2A 3ZZXA 4K0NA 4A5PA 5KN3A 1DE2A 2B5EA 2GZYA 2DJ0A 1A0RP 4K0GA 3A2WA 1FHEA 1PL1A 3TKSA 2GGTA 4ACSA 1NW2A 3I6AA 5HR1A 2CA8A 5DQYA 4OFNA 3CXGA 2FNOA 3GFKA 4MDCA 1F37A 2WS2A 4N0VA 13GSA 3E3EA 2BTOT 5JWQB 2R5GA 5G5FA 4ZIJA 3NOFA 5KOWA 3DVWA 1ILOA 2I9HA 1MDIA 19GSA 4EXJA 2LV3A 1PN9A 3PH9A 4MABA 1Z6MA 3A3TA 3R3EA 2GZZA 2B1LA 3HJOA 3EURA 2H8LA 4XIHA 5HFKA 3GTUB 3E9JB 1ON4A 3IC4A 3DVXA 5GSTA 4ZL7A 1ML6A 1K0MA 3I9V2 4KSOA 2YPMA 4F9ZA 5EY6A 3LSZA 3D0ZA 1GSQA 3A2XA 1SKSB 1U88A 2DKHA 1J08A 2DSAA 1FB0A 3GKNA 3EINA 12GSA 1AAZA 2KLXA 1VF1A 3L9SA 1PD21 3VLNA 4HU7A 2H73A 2A2SA 3O76A 4FYBA 3VPQA 2LRTA 4H86A 1SENA 1X5DA 2HI7A 4GQCA 4K7NA 4CY6A 4EL1A 2H1BA 2B1KA 3LWAA 1K3LA 3J7Yk 4LMVA 2LKUA 3O3TA 1UVZA 5B6NA 4HJ2A 2H0IA 2QSIA 2PMTA 5ECLB 3IAS2 4Q5NA 2HNLA 1ZYQB 4WETA 1JZDA 4TKYA 5F07A 2L4QA 3H93A 5IMAA 1PGTA 1GNWA 4NHWA 3IK9A 1X5EA 4IELA 4DSSB 1AQVA 3KMOA 5KEJA 1IYHA 1E2YA 2CVDA 1F6MC 2GT5A 2EIOA 4EDZA 2FLSA 3I69A 1Y6EA 1XW9A 1ZGNA 2JL4A 3D5JA 3M1GA 2AJQB 2NVLA 1MDJA 3JCML 2M46A 5JCGA 4Z7XA 3KP9A 3GNJA 4EUYA 6GSXA 2YWMA 1VGLA 1JZRA 3FKFA 4GQFA 3HVNA 3M8NA 4RQXA 1SK0A 3DEXA 1XWKA 5BRTA 2MMAA 3EWLA 2CV4A 3A5WA 2IPAA 1A24A 4XS4B 6GSYA 4PNGA 2YJ7A 5HR0A 4LL4B 4GWRA 3IDVA 4JR6A 1GTUA 4WXTA 2R4VA 1WOUA 1XXUA 2C8UA 4N11A 1NHYA 4RI7A 3F8UA 2K8SA 1K3OA 5IIZA 4EKZA 1S3RA 2FCHA 5DALA 3ZRDA 4PURA 1T7PB 1TRVA 3DXBA 3FRCA 3F6DA 1ZZYA 4K7OA 1K0DA 1S3DA 5B8AA 2IIYA 1WIKA 4MLYA 4ICYA 4ZBAA 4PUFC 5IPGA 5ELGA 3APOA 1GNEA 1G6YA 4TR1A 1K0BA 3ERFA 5D73A 2H6ZA 4DSQA 2HXKA 4G9HA 5L71A 3GKKA 2R2JA 3IE3A 3RBTA 4NXIA 3VWXA 2WB9A 3GRXA 2FD3A 2HRKA 1TKDB 1LU4A 4IGJA 5GAND 2AYTA 1Z7RA 3U6VA 3DIEA 1XWAA 1PL2A 1R7HA 6GSTA 2X8CA 1H75A 3LORA 4MZCA 10GSA 3ME7A 3QFBC 4KCEA 5G5EA 2YWNA 4OMVA 1RQMA 3J7Yb 1TU7A 2R3XA 3KP8A 1YEPA 1H4OA 1ERVA 3HJMA 3GUSA 5ENUA 5J41A 3W6GA 1PA3A 3ZIVA 4EIQA 1O7UA 2OJLA 3IHQA 4YAVA 2O85A 1S3CA 1XOAA 3M9KA 4EVMA 5CNWA 2L6DA 2ALBA 1SD9A 1GUMA 3IAM2 3EC3A 1OKTA 2XBQA 3APQA 2GLRA 4L0UA 2YOIA 5KN1A 1U87A 2IMKA 2VM1A 3TOUA 1FVJA 2LEGA 4BWSA 2X8GA 4EE0A 4I6XA 2PU9C 1AC1A 2LSTA 3ZL5A 1VF3A 1Z6NA 3L4NA 5INYA 1F3BA 5AN1A 2X64A 3KMNA 1V40A 2R6KA 3EE2A 4TR4A 3BCKA 4XCSA 2I3YA 5DAKA 3QOUA 4CY8A 4AGSA 3QAWA 3ISOA 4DVCA 4G19A 3GURA 2ES7A 3KEBA 1LJRA 3C71A 4OWYA 2LRNA 20GSA 2VL9A 3MIXA 2OE1A 2CX3A 5ECRB 3GKMA 1YKCA 3S9FA 4FYCA 1MTCA 4D73A 3HYPA 4N10A 2WZ9A 1U3AA 2YV9A 1M0UA 1XZOA 3F6FA 3SBCA 4XTSA 4TXOA 2VLUA 1SU9A 1SD8A 1T3BA 2ON5A 2HZEA 5J5NA 1CQHA 2GSRA 5B7CA 3C73A 2QA1A 2DJ1A 3HVSA 4ML6A 4WBJA 2K8VA 2C0GA 2WGRA 2NPBA 3UEMA 4EC0A 1K0OA 3GH6A 2TRXA 4BL7A 1WP0A 3CSIA 1QUWA 1YF1A 1X9MB 1CQGA 4YH2A 3WGDA 4PXOA 5H5SA 4QL7A 1MD4A 1LBKA 4K2XA 2VOCA 3P90A 2QGVA 4KDYA 3GL5A 4KH7A 5IMDA 3HZ8A 2F8FA 4K5SA 4ZL8A 1JLWA 1QXHA 3CRTA 3F4TA 6GSUA 4I5QA 1WJKA 2DJJA 2CT6A 3LQ7A 1YQ1A 3IXRA 1T1VA 3LFLA 3TB2A 1BAYA 1GWCA 4PQHA 4MH3A 1B4PA 5DAKB 3C1SA 3GMFA 4ZB8A 3QMXA 1JZOA 1EP7A 1ERWA 3FR3A 4HQZA 4ILFA 4HS1A 4ULXA 2R0CA 2L5OA 4Z2RA 5DDLA 4XHMA 4GLTA 2HSMA 3U5RE 3KD0A 4KGIA 4MJAA 3PINA 2QA2A 5G2ZA 4HDEA 3VWWA 4BIKA 3HXSA 5HFGA 3GSSA 4TR0A 1QQ2A 4CW9A 2HRAA 2I4AA 4IW9A 1JZWA 5HR3A 1T4ZA 3LEFA 1O8XA 3FY7A 1AW9A 1N8JA 3BCIA 5D8IA 3TKSE 1NHOA 3WGEA 3BJ5A 3TKSC 2RM5A 2CAIA 4JRRA 3SWLA 3CRUA 1A0FA 2X4AA 3RDWA 4F2IA 1PKWA 3MSZA 4ZBBA 3VURA 4EDYA 3NZNA 1J0FA 4FH8A 1BG5A 2XPEA 2PWJA 4Q5RA 5G1KA 1PKZA 1N2AA 3VK9A 3UMAA 1TRSA 18GSA 3GN3A 1ERTA 2IMDA 3LYPA 1GSFA 4V2MA 3LW9A 2FA4A 1F2EA 2B5XA 5JCWA 1EP8A 5CRHA 5ECKB 4KW6A 4AJ8A 3G7YA 1TK0B 2DJ3A 3RAZA 2PN8A 1V2AA 1FO5A 4GXZA 2VL3A 1GP1A 2OKAA 1FVKA 2MMZA 3ZMLA 1TP9A 17GSA 2H71A 2K6VA 3BOAA 1FAAA 5DJMA 4WR4A 2FWEA 3P2AA 3FHKA 2RLIA 2DLXA 1THOA 1VF2A 4ZXGA 1GTBA 3DMLA 2HE3A 3F3RA 4O32A 4JZQA 3UBLA 2UZ8A 1B48A 5IM9A 2WFCA 2GSQA 1OE8A 1HD2A 3TJJA 2X99A 4ZB9A 2Z9SA 3KXOA 3WYWA 11GSA 2H6YA 2L5LA 2VCTA 1FB6A 2VAFA 4Z2UA 1JLVA 2VLVA 3PR8A 4BWQA 4Q5QA 3TKRA 2IMIA 4OCFA 1URMA 4J57E 4K5RA 2HSYA 2GSSA 3FZ9A 4TOPA 5G30A 4HQSA 3TJBA 2FUG2 3TOTA 4EIPA 3TDGA 4YQVA 3DKSA 1BYEA 3RHCA 4ML1A 2MBSA 1GL8A 2C4JA 1G7EA 1J9BA 1KBNA 4YAPA 1XG8A 2EIQA 1GSYA 5BMUA 2GQLA 2N5FA 2E2GA 3Q18A 1SJ6A 4KDUA 2IFQA 2C0FA 4ECIA 1U3IA 3ZFLA 1U6TA 2V32A 3N5OA 3UOMA 4GCIA 1R4WA 2KHPA 1OC3A 3GYKA 4HI7A 5HQPA 1EV4A 3FZAA 3D4MA 5ID2A 4LL1B 4V1Ap 1M7TA 3EMXA 4JBBA 4PGTA 3C8EA 4O7HA 5ELAA 1YY7A 4MA9A 2FHEA 1UC7A 2MBTA 4EO3A 1PQNA 1USBA 1XW5A 3P8WA 2PUKC 5GSSA 1PSQA 2YWIA 3US3A 1EGOA 4IQAA 3TRXA 1ERUA 2DMLA 1GUHA 2GZPA 3DRNA 4KDXA 1GSSA 5ABRA 1TK8B 2CVBA 1EOGA 4NV2A 4I2UA 2CVKA 4CDOA 3C1RA 4TW5A 4AJ6A 2DBCA 1XBSA 3DD3A 1O8WA 4NWYA 2F3MA 4GSSA 1TI3A 3WD6A 3DWVA 3ZTLA 4IN0A 2J9HA 2QKEA 5ECQB 4POLA 1GRXA 2AHEA 2VCQA 2X8HA 4IKHA 4V2NA 5KOXA 4YKGA 1G0TA 1WWJA 5ECPB 4P3YB 3HA9A 3IRAA 3LJRA 3M3MA 1SYXA 1DUGA 4K1FA 2F51A 1F3AA 3GSTA 1BJXA 4MJEA 2HYXA 4KF9A 2C3NA 1V9WA 4BVXA 1SKRB 1FG4A 4PTSA 5D9TA 3GX0A 3M0FA 3VWUA 4LMWA 2FY6A 3KJYA 2O7KA 5ID2B 3GX8A 3OR5A 1XIYA 1SKWB 2YV7A 2DKIA 1RK4A 5IOXA 2NTOA 4RUVA 4HSCX 4ZL9A 3BD2A 3H1NA 3CYNA 3ZITA 5HR2A 4IHUA 4OD7A 1NSWA 3ZLPA 4ID0A 1TXXA 4RI6A 1Y25A 5IO2A 1EV9A 5ECHB 3D6IA 3Q74A 5IOWA 2V6KA 3UIWA 2K18A 4KA0A 4JR4A 2X49A 2YANA 3QDNA 4PQ1A 2ON7A 3C7MA 3W8JA 1WPIA 3PPUA 2KP1A 2GSTA 1GTAA 4OO4A 2V2GA 4HZ4A 2IMFA 1TK5B 1TU8A 3GV1A 4F0BA 4MPGA 2FWHA 4TR3A 1NM3A 1O85A 4K2DA 3GKXA 5GAPD 3TJGA 2LRCA 1QGVA 1QFNA 1JFUA 2H0HA 2M80A 3FR6A 3QCPA 2O87A 2OBKA 2A2RA 4X4JA 3HVXA 4FO5A 3DGQA 2OE0A 4G2EA 2ZNMA 1OC9A 1GTIA 1SL1B 1V57A 1M3JA 2LNTA 5B8BA 5DALB 2VCZA 3QAGA 4L5OA 4OCEA 3TRPA 1G7OA 4HU9A 3HKRA 2DIZA 4BA7A 4J56E 2VD0A 5IMFA 3UL3A 4BVXB 2HFDA 3CSHA 1SJZA 3A2VA 4TR1B 3F0IA 1QMVA 2FA8A 4BVYA 2O89A 4L8EA 1Q98A 2GQMA 3LYKA 5JCUA 1SK2A 5E59A 1SL0B 5AISA 1R26A 1XOBA 4GSTA 4IBPA 2OACA 4KB3A 1EOHA 2LJKA 3TUEA 5IPHA 4HEA2 1IYIA 5B6MA 5JWOB 2LJRA 1ZL9A 1BQ7A 3IK7A 3KM6A 2BJXA 3AY8A 2JZRA 5LCZA 2LNSA 3G9BA 1TRWA 5J9BA 2H30A 1XWGA 3ZVJD 4FQUA 2YWOA 1M2AA 3WT2A 1YKAA 5CRDA 4F03A 1M3IA 4G0LA 4WF5A 3D21A 1XCCA 1C72A 2XBIA 2JZTA 1GLQA 4XRAA 3UAPA 4I97A 3L0HA 1GULA 5AIVA 3CBUA 4O5QA 4WF4A 2P5RA 1B8XA 4HJMA 1EWXA 2MZCA 2ZUPA 5LD0A 3GH9A 1SL2B 3CQFA 2VD1A 3GA4A 2C3QA 3FZ4A 3IPZA 1MDKA 4K8MA 3L78A 3Q19A 1TI1A 1M2DA 1OKDA 2XPDA 4N30A 2H75A 4ZILA 1TTZA 3TKQA 2VL2A 4GTUA 4WBRD 4IQ1A 2N5AA 5EL8A 2H70A 3WGXA 4KNDA 1YEXA 2REMA 3MYDA 3IOSA 1OVNA 3KH9A 5F06A 1TW9A 2H74A 5FHIA 4DSRA 1O6JA 2HRNA 4IVFA 3HVVA 3TCOA 2VLTA 2RM6A 2TIRA 2OBIA 5AGYA 2L6CA 2E7PA 2P31A 3EU4A 5IQYA 3RHBA 4MMMA 2R0GA 4KAEA 2A2PA 16GSA 4D73B 4EF0A 2V1MA 1PX6A 2I81A 4YKFA 5ECNB 1X9SB 3EPTA 5F05A 2OE3A 4ZB6A 3TKPA 2C0EA 3LG6A 2KOKA 4IS0A 4TXOB 1K3YA 2G0FA 3GTUA 4XS6A 4YQMA 2HZEB 4NMUA 1T4YA 2VCWA 3ZFBA 2YCDA 4KX4A
chains in the Genus database with same CATH topology
1BX9A 3W8SA 2IMEA 3MWHA 2JSZA 3VWVA 2I1UA 4JE1A 4MK3A 1OC8A 4BL7B 3ZMKA 4J2FA 4MCUA 5EVOA 22GSA 1R5AA 4TVEA 1K0CA 3QAVA 4K6XA 5D9WA 5A4WA 4IP1A 1PX7A 3EVIA 3ED3A 4MPFA 2NDOA 1Z7PA 1X0RA 2H0GA 2VCXA 3FEUA 1EZKA 4IJIA 1R5PA 1E6BA 3BBYA 2G2QA 2AUVA 3KH7A 1V58A 1THXA 1TRUA 2H1AA 2AV4A 1ZOFA 4WR5A 3QFAC 3HZ4A 3NIVA 4BPYA 5FT3A 2WJUA 2VCVA 1HYUA 3ZYWA 3UVHA 5CRGA 1TOFA 2D2ZA 2PVQA 4IP6A 3GL3A 4G10A 2L4CA 2JACA 2B6MA 4DSSA 1OE7A 5ECOB 1PMTA 5H5QA 1HNBA 4MF6A 3M9JA 1EGRA 2NBSA 3HY2A 3TJKA 2CQ9A 1M9AA 1M99A 1A2LA 4FYUA 4E8HA 2IWTA 3I43A 1OYJA 4MJBA 4QL9A 1OAZA 1UN2A 4DEJA 4TXVA 5CO3A 2XHFA 4HUAA 4E8EA 5J3RA 1ST9A 3H8QA 1ACVA 4PNFA 2YJHA 1GLPA 1A2JA 1KTEA 3H79A 4OO5A 3K8NA 4ECBA 5F0GA 4XS4A 7GSSA 2R37A 3ZIJA 4ECJA 5F8BA 1G6WA 1DBYA 5IMCA 3VI7A 1T00A 1WRYA 2DMMA 1HQOA 3D4TA 1Z5YE 3WT1A 3QPMA 3TRQA 2K9FA 3ERWA 5CYYA 2HSHA 2LTKA 4Q5FA 5A4UA 2XC2A 8GSSA 1M9BA 2VM2A 1Z9HA 2F9SA 1EEMA 4KUNA 2C3TA 2VO4A 3O6TA 2FGXA 2YZHA 2EIRA 3R2QA 1A8LA 2DIYA 4CHSA 4KSMA 3IA1A 5CRWA 1A23A 3G7JA 3KTBA 4HOJA 5DJLA 1W4VA 2JADA 9GSSA 4I2TA 4ECCA 4PQIA 3IR4A 2OADA 1TDIA 2KUCA 2WRTA 1YZXA 1PN0A 3E0UA 2RUEA 3EYTA 2LQOA 5JWRB 3GIXA 4IJ3A 5IMZA 5COHA 3CTFA 2MMOA 5J9CA 5G1LA 3L9VA 3G7IA 6GSWA 3UBKA 2B5YA 4POMA 3VFIA 4XRDA 1FOHA 4NHZA 2GQKA 4O5UA 5H5RA 4X0XA 4V2LA 1AUCA 3L9UA 2WDUA 1WMJA 1PRXA 3FMWA 4NAXA 3VI5A 4AJ7A 3HD5A 1X5CA 5DCHA 1XWCA 4OFMA 4MNNA 2GDRA 1YJ6A 2IFQB 2LS5A 3IHGA 4MZBA 2LUSA 2YNXA 3F9UA 3MAKA 1TJDA 5ECSA 4LLRA 4POKA 4KCAA 2O8VB 2B3SA 2DJ2A 1JHBA 3F4RA 2PERA 2H1DA 1HNCA 1A8YA 2IJYA 4I8BA 2PBJA 3F63A 1QK8A 3ZVJA 1SK1A 1I5GA 2TRCP 4NV5A 2HZFA 4WEYA 3LXZA 2PGTA 3FZ5A 2DJKA 2F8AA 1UA5A 5DBQA 1XPVA 4JEDA 5C00A 2JZSA 3FK8A 4O92A 4OFTA 2CAQA 4YQUA 2V6OA 4GRFA 1ZYNA 2HLSA 3QR6A 3UVTA 1EEJA 1BEDA 1SYRA 3MDKA 1XWBA 3TGZA 2RUFA 2P0GA 4POBA 3HDCA 2H19A 2J23A 3ME8A 2A4VA 4RQRA 1ZMAA 1AQWA 5A4VA 3ERGA 3IC8A 4N0ZA 3CSJA 2HT9A 4G0IA 3HHVA 3F3QA 2H66A 5GZZB 3A5IA 3H4KA 2L57A 1AQXA 4XS1A 4MP4A 5CP1A 4USSA 2GVPA 6GSSA 2CX4A 4GSNA 1A2MA 5HFIA 5CAXA 3DYRA 3Q6OA 5IO0A 1ZYPA 2AAWA 2JU5A 5ECMB 3V1WA 2GTUA 3FYGA 1O81A 5IMVA 5DVBA 1B9XC 3LXTA 5ECIB 2BMXA 2YN1A 3D22A 4GF0A 4F82A 1AXDA 3F4SA 5E4WA 1S3AA 1ZCPA 5KN2A 2FWGA 2ZCTA 1M2BA 2CZ2A 4NPBA 1FOVA 4KE3A 2PPTA 3KCMA 4QQ7A 2H76A 2WULA 3IV4A 3IBHA 2B7JA 5J4UA 1VF4A 5A5KA 4V1Ag 1X9WB 5D96A 1MD3A 2VL2C 1Q4JA 2QC7A 3UJ1A 2FWFA 2H1GA 1XVWA 1YDKA 2DC5A 2PVOC 4O5RA 3HJPA 4L5LA 1V98A 1YF0A 3QD9A 2MYGA 4ZBDA 4MF5A 1GSDA 2VUPA 1KEBA 5D9XA 3CTGA 4ISDA 4K7IA 2WCIA 4LA1A 1OC9B 1XW6A 4AF2A 1SJIA 1F9MA 4K9ZA 4JU5A 2C1YA 4L0WA 1B4QA 3FW2A 2H6XA 6GSVA 3RPPA 1DE1A 4HZ2A 5KN0A 1K0AA 1DSBA 3UARA 1B9YC 5D9VA 2M72A 1ZYEA 3KZQA 1WE0A 4BVYB 2C80A 3KIJA 1ABAA 1T8EB 2B7KA 2YZUA 1O73A 2HRFA 2P5QA 3CMIA 1XVQA 2CZ3A 3VPTA 4G0KA 5CREA 3HCZA 5LNKe 2RIIA 3RPNA 2MMNA 1MEKA 2VIMA 3ZREA 4X1UA 2E2MA 2N5BA 3MNGA 2GS3A 2H72A 2E0QA 3GHAA 3P7XA 2GT6A 5DCGA 1AIUA 5D93A 1KNGA 3APSA 5FWGA 1GSEA 2YP6A 4X43A 4FIWA 2A4HA 2JSYA 3KGKA 2LJAA 2R0PA 4Z2TA 3EMPA 5DQSA 3N9JA 4TN8A 2LQQA 4MJCA 4PX1A 2EC4A 2OA7A 5C04A 2L59A 4F0CA 3FR9A 5AIXA 1I9DA 2V41A 1XFLA 1Z3EA 1K0NA 1HNAA 3PGTA 4MF7A 14GSA 4WKWA 5EPFA 3EU3A 1GSUA 5G31A 4PUAA 2H01A 2IN3A 2AB6A 2C0DA 3LGCA 1FW1A 4MH2A 4MZWA 1VRSD 3KTLA 1GUKA 1W89A 1RW1A 4TRXA 3TJFA 2IL3A 1GH2A 2KP2A 3ZZXA 4K0NA 4A5PA 5KN3A 1DE2A 2B5EA 2GZYA 2DJ0A 1A0RP 4K0GA 3A2WA 1FHEA 1PL1A 3TKSA 2GGTA 4ACSA 1NW2A 3I6AA 5HR1A 2CA8A 5DQYA 4OFNA 3CXGA 2FNOA 3GFKA 4MDCA 1F37A 2WS2A 4N0VA 13GSA 3E3EA 2BTOT 5JWQB 2R5GA 5G5FA 4ZIJA 3NOFA 5KOWA 3DVWA 1ILOA 2I9HA 1MDIA 19GSA 4EXJA 2LV3A 1PN9A 3PH9A 4MABA 1Z6MA 3A3TA 3R3EA 2GZZA 2B1LA 3HJOA 3EURA 2H8LA 4XIHA 5HFKA 3GTUB 3E9JB 1ON4A 3IC4A 3DVXA 5GSTA 4ZL7A 1ML6A 1K0MA 3I9V2 4KSOA 2YPMA 4F9ZA 5EY6A 3LSZA 3D0ZA 1GSQA 3A2XA 1SKSB 1U88A 2DKHA 1J08A 2DSAA 1FB0A 3GKNA 3EINA 12GSA 1AAZA 2KLXA 1VF1A 3L9SA 1PD21 3VLNA 4HU7A 2H73A 2A2SA 3O76A 4FYBA 3VPQA 2LRTA 4H86A 1SENA 1X5DA 2HI7A 4GQCA 4K7NA 4CY6A 4EL1A 2H1BA 2B1KA 3LWAA 1K3LA 3J7Yk 4LMVA 2LKUA 3O3TA 1UVZA 5B6NA 4HJ2A 2H0IA 2QSIA 2PMTA 5ECLB 3IAS2 4Q5NA 2HNLA 1ZYQB 4WETA 1JZDA 4TKYA 5F07A 2L4QA 3H93A 5IMAA 1PGTA 1GNWA 4NHWA 3IK9A 1X5EA 4IELA 4DSSB 1AQVA 3KMOA 5KEJA 1IYHA 1E2YA 2CVDA 1F6MC 2GT5A 2EIOA 4EDZA 2FLSA 3I69A 1Y6EA 1XW9A 1ZGNA 2JL4A 3D5JA 3M1GA 2AJQB 2NVLA 1MDJA 3JCML 2M46A 5JCGA 4Z7XA 3KP9A 3GNJA 4EUYA 6GSXA 2YWMA 1VGLA 1JZRA 3FKFA 4GQFA 3M8NA 4RQXA 1SK0A 3DEXA 1XWKA 5BRTA 2MMAA 3EWLA 2CV4A 3A5WA 2IPAA 1A24A 4XS4B 6GSYA 4PNGA 2YJ7A 5HR0A 4LL4B 4GWRA 3IDVA 4JR6A 1GTUA 4WXTA 2R4VA 1WOUA 1XXUA 2C8UA 4N11A 1NHYA 4RI7A 3F8UA 2K8SA 1K3OA 5IIZA 4EKZA 2FCHA 5DALA 3ZRDA 4PURA 1T7PB 1TRVA 3DXBA 3FRCA 3F6DA 1ZZYA 4K7OA 1K0DA 1S3DA 5B8AA 2IIYA 1WIKA 4MLYA 4ICYA 4ZBAA 4PUFC 5IPGA 5ELGA 3APOA 1GNEA 1G6YA 4TR1A 1K0BA 3ERFA 5D73A 2H6ZA 4DSQA 2HXKA 4G9HA 5L71A 3GKKA 2R2JA 3IE3A 3RBTA 4NXIA 3VWXA 2WB9A 3GRXA 2FD3A 2HRKA 1TKDB 1LU4A 4IGJA 5GAND 2AYTA 1Z7RA 3U6VA 3DIEA 1XWAA 1PL2A 1R7HA 6GSTA 2X8CA 1H75A 3LORA 4MZCA 10GSA 3ME7A 3QFBC 4KCEA 5G5EA 2YWNA 4OMVA 1RQMA 3J7Yb 1TU7A 2R3XA 3KP8A 1YEPA 1H4OA 1ERVA 3HJMA 3GUSA 5ENUA 5J41A 3W6GA 1PA3A 3ZIVA 4EIQA 1O7UA 2OJLA 3IHQA 4YAVA 2O85A 1S3CA 1XOAA 3M9KA 4EVMA 5CNWA 2L6DA 2ALBA 1SD9A 1GUMA 3IAM2 3EC3A 1OKTA 2XBQA 3APQA 2GLRA 4L0UA 2YOIA 5KN1A 1U87A 2IMKA 2VM1A 3TOUA 1FVJA 2LEGA 4BWSA 2X8GA 4EE0A 4I6XA 2PU9C 1AC1A 2LSTA 3ZL5A 1VF3A 1Z6NA 3L4NA 5INYA 1F3BA 5AN1A 2X64A 3KMNA 1V40A 2R6KA 3EE2A 4TR4A 3BCKA 4XCSA 2I3YA 5DAKA 3QOUA 4CY8A 4AGSA 3QAWA 3ISOA 4DVCA 4G19A 3GURA 2ES7A 3KEBA 1LJRA 3C71A 4OWYA 2LRNA 20GSA 2VL9A 3MIXA 2OE1A 2CX3A 5ECRB 3GKMA 1YKCA 3S9FA 4FYCA 1MTCA 4D73A 3HYPA 4N10A 2WZ9A 1U3AA 2YV9A 1M0UA 1XZOA 3F6FA 3SBCA 4XTSA 4TXOA 2VLUA 1SU9A 1SD8A 1T3BA 2ON5A 2HZEA 5J5NA 1CQHA 2GSRA 5B7CA 3C73A 2QA1A 2DJ1A 3HVSA 4ML6A 4WBJA 2K8VA 2C0GA 2WGRA 2NPBA 3UEMA 4EC0A 1K0OA 3GH6A 2TRXA 4BL7A 1WP0A 3CSIA 1QUWA 1YF1A 1X9MB 1CQGA 4YH2A 3WGDA 4PXOA 5H5SA 4QL7A 1MD4A 1LBKA 4K2XA 2VOCA 3P90A 2QGVA 4KDYA 3GL5A 4KH7A 5IMDA 3HZ8A 2F8FA 4K5SA 4ZL8A 1JLWA 1QXHA 3CRTA 3F4TA 6GSUA 4I5QA 1WJKA 2DJJA 2CT6A 3LQ7A 1YQ1A 3IXRA 1T1VA 3LFLA 3TB2A 1BAYA 1GWCA 4PQHA 4MH3A 1B4PA 5DAKB 3C1SA 3GMFA 4ZB8A 3QMXA 1JZOA 1EP7A 1ERWA 3FR3A 4HQZA 4ILFA 4HS1A 4ULXA 2R0CA 2L5OA 4Z2RA 5DDLA 4XHMA 4GLTA 2HSMA 3U5RE 3KD0A 4KGIA 4MJAA 3PINA 2QA2A 5G2ZA 4HDEA 3VWWA 3HXSA 5HFGA 3GSSA 4TR0A 1QQ2A 4CW9A 2HRAA 2I4AA 4IW9A 1JZWA 5HR3A 1T4ZA 3LEFA 1O8XA 3FY7A 1AW9A 1N8JA 3BCIA 5D8IA 3TKSE 1NHOA 3WGEA 3BJ5A 3TKSC 2RM5A 2CAIA 4JRRA 3SWLA 3CRUA 1A0FA 2X4AA 3RDWA 4F2IA 1PKWA 3MSZA 4ZBBA 3VURA 4EDYA 3NZNA 1J0FA 4FH8A 1BG5A 2XPEA 2PWJA 4Q5RA 5G1KA 1PKZA 1N2AA 3VK9A 3UMAA 1TRSA 18GSA 3GN3A 1ERTA 2IMDA 3LYPA 1GSFA 4V2MA 3LW9A 2FA4A 1F2EA 2B5XA 5JCWA 1EP8A 5CRHA 5ECKB 4KW6A 4AJ8A 3G7YA 1TK0B 2DJ3A 3RAZA 2PN8A 1V2AA 1FO5A 4GXZA 2VL3A 1GP1A 2OKAA 1FVKA 2MMZA 3ZMLA 1TP9A 17GSA 2H71A 2K6VA 3BOAA 1FAAA 5DJMA 4WR4A 2FWEA 3P2AA 3FHKA 2RLIA 2DLXA 1THOA 1VF2A 4ZXGA 1GTBA 3DMLA 2HE3A 3F3RA 4O32A 4JZQA 3UBLA 2UZ8A 1B48A 5IM9A 2WFCA 2GSQA 1OE8A 1HD2A 3TJJA 2X99A 4ZB9A 2Z9SA 3KXOA 3WYWA 11GSA 2H6YA 2L5LA 2VCTA 1FB6A 2VAFA 4Z2UA 1JLVA 2VLVA 3PR8A 4BWQA 4Q5QA 3TKRA 2IMIA 4OCFA 1URMA 4J57E 4K5RA 2HSYA 2GSSA 3FZ9A 4TOPA 5G30A 4HQSA 3TJBA 2FUG2 3TOTA 4EIPA 3TDGA 4YQVA 3DKSA 1BYEA 3RHCA 4ML1A 2MBSA 1GL8A 2C4JA 1G7EA 1J9BA 1KBNA 4YAPA 2EIQA 1GSYA 5BMUA 2GQLA 2N5FA 2E2GA 3Q18A 1SJ6A 4KDUA 2IFQA 2C0FA 4ECIA 1U3IA 3ZFLA 1U6TA 2V32A 3N5OA 3UOMA 4GCIA 1R4WA 2KHPA 1OC3A 3GYKA 4HI7A 5HQPA 1EV4A 3FZAA 3D4MA 5ID2A 4LL1B 4V1Ap 1M7TA 3EMXA 4JBBA 4PGTA 3C8EA 4O7HA 5ELAA 1YY7A 4MA9A 2FHEA 1UC7A 2MBTA 4EO3A 1PQNA 1USBA 1XW5A 3P8WA 2PUKC 5GSSA 1PSQA 2YWIA 3US3A 1EGOA 4IQAA 3TRXA 1ERUA 2DMLA 1GUHA 2GZPA 3DRNA 4KDXA 1GSSA 5ABRA 1TK8B 2CVBA 1EOGA 4NV2A 4I2UA 2CVKA 4CDOA 3C1RA 4TW5A 4AJ6A 2DBCA 1XBSA 3DD3A 1O8WA 4NWYA 2F3MA 4GSSA 1TI3A 3WD6A 3DWVA 3ZTLA 4IN0A 2J9HA 2QKEA 5ECQB 4POLA 1GRXA 2AHEA 2VCQA 2X8HA 4IKHA 4V2NA 5KOXA 4YKGA 1G0TA 1WWJA 5ECPB 4P3YB 3HA9A 3IRAA 3LJRA 3M3MA 1SYXA 1DUGA 4K1FA 2F51A 1F3AA 3GSTA 1BJXA 4MJEA 2HYXA 4KF9A 2C3NA 1V9WA 4BVXA 1SKRB 1FG4A 4PTSA 5D9TA 3GX0A 3M0FA 3VWUA 4LMWA 2FY6A 3KJYA 2O7KA 5ID2B 3GX8A 3OR5A 1XIYA 1SKWB 2YV7A 2DKIA 1RK4A 5IOXA 2NTOA 4RUVA 4ZL9A 3BD2A 3H1NA 3CYNA 3ZITA 5HR2A 4IHUA 4OD7A 1NSWA 3ZLPA 4ID0A 1TXXA 4RI6A 1Y25A 5IO2A 1EV9A 5ECHB 3D6IA 3Q74A 5IOWA 2V6KA 3UIWA 2K18A 4KA0A 4JR4A 2X49A 2YANA 3QDNA 4PQ1A 2ON7A 3C7MA 3W8JA 1WPIA 3PPUA 2KP1A 2GSTA 1GTAA 4OO4A 2V2GA 4HZ4A 2IMFA 1TK5B 1TU8A 3GV1A 4F0BA 4MPGA 2FWHA 4TR3A 1NM3A 1O85A 4K2DA 3GKXA 5GAPD 3TJGA 2LRCA 1QGVA 1QFNA 1JFUA 2H0HA 2M80A 3FR6A 3QCPA 2O87A 2OBKA 2A2RA 4X4JA 3HVXA 4FO5A 3DGQA 2OE0A 4G2EA 2ZNMA 1OC9A 1GTIA 1SL1B 1V57A 2LNTA 5B8BA 5DALB 2VCZA 3QAGA 4L5OA 4OCEA 3TRPA 1G7OA 4HU9A 3HKRA 2DIZA 4BA7A 4J56E 2VD0A 5IMFA 3UL3A 4BVXB 2HFDA 3CSHA 1SJZA 3A2VA 4TR1B 3F0IA 1QMVA 2FA8A 4BVYA 2O89A 4L8EA 1Q98A 2GQMA 3LYKA 5JCUA 1SK2A 5E59A 1SL0B 5AISA 1R26A 1XOBA 4GSTA 4IBPA 2OACA 4KB3A 1EOHA 2LJKA 3TUEA 5IPHA 4HEA2 1IYIA 5B6MA 5JWOB 2LJRA 1ZL9A 1BQ7A 3IK7A 3KM6A 2BJXA 3AY8A 2JZRA 5LCZA 2LNSA 3G9BA 1TRWA 5J9BA 2H30A 1XWGA 3ZVJD 4FQUA 2YWOA 1M2AA 3WT2A 1YKAA 5CRDA 4F03A 4G0LA 4WF5A 3D21A 1XCCA 1C72A 2XBIA 2JZTA 1GLQA 4XRAA 3UAPA 4I97A 3L0HA 1GULA 5AIVA 3CBUA 4O5QA 4WF4A 2P5RA 1B8XA 4HJMA 1EWXA 2MZCA 2ZUPA 5LD0A 3GH9A 1SL2B 2VD1A 3GA4A 2C3QA 3FZ4A 3IPZA 1MDKA 4K8MA 3L78A 3Q19A 1TI1A 1M2DA 1OKDA 2XPDA 4N30A 2H75A 4ZILA 1TTZA 3TKQA 2VL2A 4GTUA 4WBRD 4IQ1A 2N5AA 5EL8A 2H70A 3WGXA 4KNDA 1YEXA 2REMA 3MYDA 3IOSA 1OVNA 3KH9A 5F06A 1TW9A 2H74A 5FHIA 4DSRA 1O6JA 2HRNA 4IVFA 3HVVA 3TCOA 2VLTA 2RM6A 2TIRA 2OBIA 5AGYA 2L6CA 2E7PA 2P31A 3EU4A 5IQYA 3RHBA 4MMMA 2R0GA 4KAEA 2A2PA 16GSA 4D73B 4EF0A 2V1MA 1PX6A 2I81A 4YKFA 5ECNB 1X9SB 3EPTA 5F05A 2OE3A 4ZB6A 3TKPA 2C0EA 3LG6A 2KOKA 4IS0A 4TXOB 1K3YA 2G0FA 3GTUA 4XS6A 4YQMA 2HZEB 4NMUA 1T4YA 2VCWA 3ZFBA 2YCDA 4KX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BX9 A;  3W8S A;  2IME A;  3MWH A;  2JSZ A;  3VWV A;  2I1U A;  4JE1 A;  4MK3 A;  1OC8 A;  3ZMK A;  4J2F A;  4MCU A;  5EVO A;  22GS A;  1R5A A;  4TVE A;  1K0C A;  3QAV A;  4K6X A;  5D9W A;  5A4W A;  4IP1 A;  1PX7 A;  3EVI A;  3ED3 A;  4MPF A;  2NDO A;  1Z7P A;  1X0R A;  2H0G A;  2VCX A;  3FEU A;  1EZK A;  4IJI A;  1R5P A;  1E6B A;  3BBY A;  2G2Q A;  2AUV A;  3KH7 A;  1V58 A;  1THX A;  1TRU A;  2H1A A;  2AV4 A;  1ZOF A;  4WR5 A;  3QFA C;  3HZ4 A;  3NIV A;  4BPY A;  5FT3 A;  2WJU A;  2VCV A;  1HYU A;  3ZYW A;  3UVH A;  5CRG A;  1TOF A;  2D2Z A;  2PVQ A;  4IP6 A;  3GL3 A;  4G10 A;  2L4C A;  2JAC A;  2B6M A;  4DSS A;  1OE7 A;  5ECO B;  1PMT A;  5H5Q A;  1HNB A;  4MF6 A;  3M9J A;  1EGR A;  2NBS A;  3HY2 A;  3TJK A;  2CQ9 A;  1M9A A;  1M99 A;  1A2L A;  4FYU A;  4E8H A;  2IWT A;  3I43 A;  1OYJ A;  4MJB A;  4QL9 A;  1OAZ A;  1UN2 A;  4DEJ A;  4TXV A;  5CO3 A;  2XHF A;  4HUA A;  4E8E A;  5J3R A;  1ST9 A;  3H8Q A;  1ACV A;  4PNF A;  2YJH A;  1GLP A;  1A2J A;  1KTE A;  3H79 A;  4OO5 A;  3K8N A;  4ECB A;  5F0G A;  4XS4 A;  7GSS A;  2R37 A;  3ZIJ A;  4ECJ A;  5F8B A;  1G6W A;  1DBY A;  5IMC A;  3VI7 A;  1T00 A;  1WRY A;  2DMM A;  1HQO A;  3D4T A;  1Z5Y E;  3WT1 A;  3QPM A;  3TRQ A;  2K9F A;  3ERW A;  5CYY A;  2HSH A;  2LTK A;  4Q5F A;  5A4U A;  2XC2 A;  8GSS A;  1M9B A;  2VM2 A;  1Z9H A;  2F9S A;  1EEM A;  4KUN A;  2C3T A;  2VO4 A;  3O6T A;  2FGX A;  2YZH A;  2EIR A;  3R2Q A;  1A8L A;  2DIY A;  4CHS A;  4KSM A;  3IA1 A;  5CRW A;  1A23 A;  3G7J A;  3KTB A;  4HOJ A;  5DJL A;  1W4V A;  2JAD A;  9GSS A;  4I2T A;  4ECC A;  4PQI A;  3IR4 A;  2OAD A;  1TDI A;  2KUC A;  2WRT A;  1YZX A;  3E0U A;  2RUE A;  3EYT A;  2LQO A;  5JWR B;  3GIX A;  4IJ3 A;  5IMZ A;  5COH A;  3CTF A;  2MMO A;  5J9C A;  5G1L A;  3L9V A;  3G7I A;  6GSW A;  3UBK A;  2B5Y A;  4POM A;  3VFI A;  4XRD A;  4NHZ A;  2GQK A;  5H5R A;  4X0X A;  4V2L A;  1AUC A;  3L9U A;  2WDU A;  1WMJ A;  1PRX A;  4NAX A;  3VI5 A;  4AJ7 A;  3HD5 A;  1X5C A;  5DCH A;  1XWC A;  4OFM A;  2GDR A;  1YJ6 A;  2IFQ B;  2LS5 A;  4MZB A;  2LUS A;  2YNX A;  3F9U A;  3MAK A;  1TJD A;  5ECS A;  4LLR A;  4POK A;  4KCA A;  2O8V B;  2B3S A;  2DJ2 A;  1JHB A;  3F4R A;  2PER A;  2H1D A;  1HNC A;  1A8Y A;  2IJY A;  4I8B A;  2PBJ A;  3F63 A;  1QK8 A;  3ZVJ A;  1SK1 A;  1I5G A;  2TRC P;  4NV5 A;  2HZF A;  4WEY A;  3LXZ A;  2PGT A;  3FZ5 A;  2DJK A;  2F8A A;  1UA5 A;  5DBQ A;  1XPV A;  4JED A;  5C00 A;  2JZS A;  3FK8 A;  4O92 A;  4OFT A;  2CAQ A;  4YQU A;  2V6O A;  4GRF A;  2HLS A;  3QR6 A;  3UVT A;  1EEJ A;  1BED A;  1SYR A;  3MDK A;  1XWB A;  3TGZ A;  2RUF A;  2P0G A;  4POB A;  3HDC A;  2H19 A;  2J23 A;  3ME8 A;  2A4V A;  4RQR A;  1ZMA A;  1AQW A;  5A4V A;  3ERG A;  4N0Z A;  3CSJ A;  2HT9 A;  3HHV A;  3F3Q A;  2H66 A;  5GZZ B;  3H4K A;  2L57 A;  1AQX A;  4XS1 A;  4MP4 A;  5CP1 A;  2GVP A;  6GSS A;  2CX4 A;  4GSN A;  1A2M A;  5HFI A;  5CAX A;  3DYR A;  3Q6O A;  5IO0 A;  2AAW A;  2JU5 A;  5ECM B;  3V1W A;  2GTU A;  3FYG A;  1O81 A;  5IMV A;  5DVB A;  1B9X C;  3LXT A;  5ECI B;  2BMX A;  2YN1 A;  3D22 A;  4GF0 A;  4F82 A;  1AXD A;  3F4S A;  5E4W A;  1S3A A;  1ZCP A;  5KN2 A;  2FWG A;  2ZCT A;  1M2B A;  2CZ2 A;  4NPB A;  1FOV A;  4KE3 A;  2PPT A;  3KCM A;  4QQ7 A;  2H76 A;  2WUL A;  3IV4 A;  3IBH A;  2B7J A;  5J4U A;  1VF4 A;  5A5K A;  4V1A g;  1X9W B;  5D96 A;  1MD3 A;  2VL2 C;  1Q4J A;  2QC7 A;  3UJ1 A;  2FWF A;  2H1G A;  1XVW A;  1YDK A;  2DC5 A;  2PVO C;  4O5R A;  3HJP A;  4L5L A;  1V98 A;  1YF0 A;  3QD9 A;  2MYG A;  4ZBD A;  4MF5 A;  1GSD A;  2VUP A;  1KEB A;  5D9X A;  3CTG A;  4ISD A;  4K7I A;  2WCI A;  4LA1 A;  1OC9 B;  1XW6 A;  4AF2 A;  1SJI A;  1F9M A;  4K9Z A;  4JU5 A;  2C1Y A;  4L0W A;  1B4Q A;  3FW2 A;  2H6X A;  6GSV A;  3RPP A;  1DE1 A;  4HZ2 A;  5KN0 A;  1K0A A;  1DSB A;  3UAR A;  1B9Y C;  5D9V A;  2M72 A;  1ZYE A;  3KZQ A;  1WE0 A;  2C80 A;  3KIJ A;  1ABA A;  1T8E B;  2B7K A;  2YZU A;  1O73 A;  2HRF A;  2P5Q A;  3CMI A;  1XVQ A;  2CZ3 A;  3VPT A;  5CRE A;  3HCZ A;  5LNK e;  2RII A;  3RPN A;  2MMN A;  1MEK A;  2VIM A;  3ZRE A;  4X1U A;  2E2M A;  2N5B A;  3MNG A;  2GS3 A;  2H72 A;  2E0Q A;  3GHA A;  3P7X A;  2GT6 A;  5DCG A;  1AIU A;  5D93 A;  1KNG A;  3APS A;  5FWG A;  1GSE A;  2YP6 A;  4X43 A;  4FIW A;  2JSY A;  3KGK A;  2LJA A;  3EMP A;  5DQS A;  3N9J A;  4TN8 A;  2LQQ A;  4MJC A;  4PX1 A;  2EC4 A;  2OA7 A;  5C04 A;  2L59 A;  4F0C A;  3FR9 A;  5AIX A;  1I9D A;  2V41 A;  1XFL A;  1Z3E A;  1K0N A;  1HNA A;  3PGT A;  4MF7 A;  14GS A;  4WKW A;  5EPF A;  3EU3 A;  1GSU A;  5G31 A;  4PUA A;  2H01 A;  2IN3 A;  2AB6 A;  2C0D A;  3LGC A;  1FW1 A;  4MH2 A;  4MZW A;  1VRS D;  3KTL A;  1GUK A;  1W89 A;  1RW1 A;  4TRX A;  3TJF A;  2IL3 A;  1GH2 A;  2KP2 A;  3ZZX A;  4K0N A;  5KN3 A;  1DE2 A;  2B5E A;  2GZY A;  2DJ0 A;  1A0R P;  4K0G A;  3A2W A;  1FHE A;  1PL1 A;  3TKS A;  2GGT A;  4ACS A;  1NW2 A;  3I6A A;  5HR1 A;  2CA8 A;  5DQY A;  4OFN A;  3CXG A;  2FNO A;  3GFK A;  4MDC A;  1F37 A;  2WS2 A;  4N0V A;  13GS A;  3E3E A;  2BTO T;  5JWQ B;  2R5G A;  5G5F A;  4ZIJ A;  3NOF A;  3DVW A;  1ILO A;  2I9H A;  1MDI A;  19GS A;  4EXJ A;  2LV3 A;  1PN9 A;  3PH9 A;  4MAB A;  1Z6M A;  3A3T A;  2GZZ A;  2B1L A;  3HJO A;  3EUR A;  2H8L A;  4XIH A;  5HFK A;  3GTU B;  3E9J B;  1ON4 A;  3IC4 A;  3DVX A;  5GST A;  4ZL7 A;  1ML6 A;  1K0M A;  3I9V 2;  4KSO A;  2YPM A;  4F9Z A;  5EY6 A;  3LSZ A;  3D0Z A;  1GSQ A;  3A2X A;  1SKS B;  1U88 A;  1J08 A;  2DSA A;  1FB0 A;  3GKN A;  3EIN A;  12GS A;  1AAZ A;  2KLX A;  1VF1 A;  3L9S A;  1PD2 1;  3VLN A;  4HU7 A;  2H73 A;  2A2S A;  3O76 A;  4FYB A;  3VPQ A;  2LRT A;  4H86 A;  1SEN A;  1X5D A;  2HI7 A;  4GQC A;  4K7N A;  4EL1 A;  2H1B A;  2B1K A;  3LWA A;  1K3L A;  3J7Y k;  4LMV A;  2LKU A;  3O3T A;  1UVZ A;  5B6N A;  4HJ2 A;  2H0I A;  2QSI A;  2PMT A;  5ECL B;  3IAS 2;  4Q5N A;  2HNL A;  1ZYQ B;  4WET A;  1JZD A;  4TKY A;  5F07 A;  2L4Q A;  3H93 A;  5IMA A;  1PGT A;  1GNW A;  4NHW A;  3IK9 A;  1X5E A;  4IEL A;  4DSS B;  1AQV A;  3KMO A;  5KEJ A;  1IYH A;  1E2Y A;  2CVD A;  1F6M C;  2GT5 A;  2EIO A;  4EDZ A;  2FLS A;  3I69 A;  1Y6E A;  1XW9 A;  1ZGN A;  2JL4 A;  3D5J A;  3M1G A;  2AJQ B;  2NVL A;  1MDJ A;  3JCM L;  2M46 A;  5JCG A;  4Z7X A;  3KP9 A;  3GNJ A;  4EUY A;  6GSX A;  2YWM A;  1VGL A;  1JZR A;  3FKF A;  4GQF A;  3M8N A;  4RQX A;  1SK0 A;  3DEX A;  1XWK A;  2MMA A;  3EWL A;  2CV4 A;  3A5W A;  2IPA A;  1A24 A;  4XS4 B;  6GSY A;  4PNG A;  2YJ7 A;  5HR0 A;  4LL4 B;  4GWR A;  3IDV A;  4JR6 A;  1GTU A;  4WXT A;  2R4V A;  1WOU A;  1XXU A;  2C8U A;  4N11 A;  1NHY A;  4RI7 A;  3F8U A;  2K8S A;  1K3O A;  5IIZ A;  4EKZ A;  2FCH A;  5DAL A;  3ZRD A;  4PUR A;  1T7P B;  1TRV A;  3DXB A;  3FRC A;  3F6D A;  1ZZY A;  4K7O A;  1K0D A;  1S3D A;  5B8A A;  2IIY A;  1WIK A;  4MLY A;  4ZBA A;  4PUF C;  5IPG A;  5ELG A;  3APO A;  1GNE A;  1G6Y A;  4TR1 A;  1K0B A;  3ERF A;  5D73 A;  2H6Z A;  4DSQ A;  2HXK A;  4G9H A;  5L71 A;  3GKK A;  2R2J A;  3IE3 A;  3RBT A;  4NXI A;  3VWX A;  2WB9 A;  3GRX A;  2FD3 A;  1TKD B;  1LU4 A;  4IGJ A;  5GAN D;  2AYT A;  1Z7R A;  3U6V A;  3DIE A;  1XWA A;  1PL2 A;  1R7H A;  6GST A;  2X8C A;  1H75 A;  3LOR A;  4MZC A;  10GS A;  3ME7 A;  3QFB C;  4KCE A;  5G5E A;  2YWN A;  4OMV A;  1RQM A;  3J7Y b;  1TU7 A;  2R3X A;  3KP8 A;  1YEP A;  1H4O A;  1ERV A;  3HJM A;  3GUS A;  5ENU A;  5J41 A;  3W6G A;  1PA3 A;  3ZIV A;  1O7U A;  2OJL A;  3IHQ A;  4YAV A;  2O85 A;  1S3C A;  1XOA A;  3M9K A;  4EVM A;  5CNW A;  2L6D A;  2ALB A;  1SD9 A;  1GUM A;  3IAM 2;  3EC3 A;  1OKT A;  2XBQ A;  3APQ A;  2GLR A;  4L0U A;  2YOI A;  5KN1 A;  1U87 A;  2IMK A;  2VM1 A;  3TOU A;  1FVJ A;  2LEG A;  4BWS A;  2X8G A;  4EE0 A;  4I6X A;  2PU9 C;  1AC1 A;  2LST A;  3ZL5 A;  1VF3 A;  1Z6N A;  3L4N A;  5INY A;  1F3B A;  5AN1 A;  2X64 A;  3KMN A;  1V40 A;  2R6K A;  3EE2 A;  4TR4 A;  3BCK A;  4XCS A;  2I3Y A;  5DAK A;  3QOU A;  4AGS A;  3QAW A;  3ISO A;  4DVC A;  4G19 A;  3GUR A;  2ES7 A;  3KEB A;  1LJR A;  3C71 A;  4OWY A;  2LRN A;  20GS A;  2VL9 A;  2OE1 A;  2CX3 A;  5ECR B;  3GKM A;  1YKC A;  3S9F A;  4FYC A;  1MTC A;  4D73 A;  3HYP A;  4N10 A;  2WZ9 A;  1U3A A;  2YV9 A;  1M0U A;  1XZO A;  3F6F A;  3SBC A;  4XTS A;  4TXO A;  2VLU A;  1SU9 A;  1SD8 A;  1T3B A;  2ON5 A;  2HZE A;  5J5N A;  1CQH A;  2GSR A;  5B7C A;  3C73 A;  2DJ1 A;  3HVS A;  4ML6 A;  4WBJ A;  2K8V A;  2C0G A;  2WGR A;  2NPB A;  3UEM A;  4EC0 A;  1K0O A;  3GH6 A;  2TRX A;  4BL7 A;  1WP0 A;  3CSI A;  1QUW A;  1YF1 A;  1X9M B;  1CQG A;  4YH2 A;  3WGD A;  4PXO A;  5H5S A;  4QL7 A;  1MD4 A;  1LBK A;  2VOC A;  3P90 A;  2QGV A;  4KDY A;  3GL5 A;  4KH7 A;  5IMD A;  3HZ8 A;  2F8F A;  4ZL8 A;  1JLW A;  1QXH A;  3CRT A;  3F4T A;  6GSU A;  4I5Q A;  1WJK A;  2DJJ A;  2CT6 A;  3LQ7 A;  1YQ1 A;  3IXR A;  1T1V A;  3LFL A;  3TB2 A;  1BAY A;  1GWC A;  4PQH A;  4MH3 A;  1B4P A;  5DAK B;  3C1S A;  3GMF A;  4ZB8 A;  3QMX A;  1JZO A;  1EP7 A;  1ERW A;  3FR3 A;  4HQZ A;  4ILF A;  4HS1 A;  4ULX A;  2L5O A;  5DDL A;  4XHM A;  4GLT A;  3U5R E;  3KD0 A;  4KGI A;  4MJA A;  3PIN A;  5G2Z A;  4HDE A;  3VWW A;  3HXS A;  5HFG A;  3GSS A;  4TR0 A;  1QQ2 A;  4CW9 A;  2I4A A;  4IW9 A;  1JZW A;  5HR3 A;  1T4Z A;  3LEF A;  1O8X A;  3FY7 A;  1AW9 A;  1N8J A;  3BCI A;  5D8I A;  3TKS E;  1NHO A;  3WGE A;  3BJ5 A;  3TKS C;  2RM5 A;  2CAI A;  4JRR A;  3SWL A;  3CRU A;  1A0F A;  3RDW A;  4F2I A;  1PKW A;  3MSZ A;  4ZBB A;  3VUR A;  4EDY A;  3NZN A;  1J0F A;  4FH8 A;  1BG5 A;  2XPE A;  2PWJ A;  4Q5R A;  5G1K A;  1PKZ A;  1N2A A;  3VK9 A;  3UMA A;  1TRS A;  18GS A;  3GN3 A;  1ERT A;  2IMD A;  3LYP A;  1GSF A;  4V2M A;  2FA4 A;  1F2E A;  2B5X A;  5JCW A;  1EP8 A;  5CRH A;  5ECK B;  4KW6 A;  4AJ8 A;  3G7Y A;  1TK0 B;  2DJ3 A;  3RAZ A;  2PN8 A;  1V2A A;  1FO5 A;  4GXZ A;  2VL3 A;  1GP1 A;  2OKA A;  1FVK A;  2MMZ A;  3ZML A;  1TP9 A;  17GS A;  2H71 A;  2K6V A;  3BOA A;  1FAA A;  5DJM A;  4WR4 A;  2FWE A;  3P2A A;  3FHK A;  2RLI A;  2DLX A;  1THO A;  1VF2 A;  4ZXG A;  1GTB A;  3DML A;  2HE3 A;  3F3R A;  4O32 A;  4JZQ A;  3UBL A;  1B48 A;  5IM9 A;  2WFC A;  2GSQ A;  1OE8 A;  1HD2 A;  3TJJ A;  2X99 A;  4ZB9 A;  2Z9S A;  3KXO A;  3WYW A;  11GS A;  2H6Y A;  2L5L A;  2VCT A;  1FB6 A;  2VAF A;  1JLV A;  2VLV A;  3PR8 A;  4BWQ A;  4Q5Q A;  3TKR A;  2IMI A;  4OCF A;  1URM A;  4J57 E;  2HSY A;  2GSS A;  3FZ9 A;  4TOP A;  5G30 A;  4HQS A;  3TJB A;  2FUG 2;  3TOT A;  3TDG A;  4YQV A;  3DKS A;  1BYE A;  3RHC A;  4ML1 A;  2MBS A;  1GL8 A;  2C4J A;  1G7E A;  1J9B A;  1KBN A;  4YAP A;  2EIQ A;  1GSY A;  2GQL A;  2N5F A;  2E2G A;  3Q18 A;  1SJ6 A;  4KDU A;  2IFQ A;  2C0F A;  4ECI A;  1U3I A;  3ZFL A;  1U6T A;  2V32 A;  3N5O A;  3UOM A;  4GCI A;  1R4W A;  2KHP A;  1OC3 A;  3GYK A;  4HI7 A;  5HQP A;  1EV4 A;  3FZA A;  3D4M A;  5ID2 A;  4LL1 B;  4V1A p;  1M7T A;  3EMX A;  4JBB A;  4PGT A;  3C8E A;  4O7H A;  5ELA A;  1YY7 A;  4MA9 A;  2FHE A;  1UC7 A;  2MBT A;  4EO3 A;  1PQN A;  1USB A;  1XW5 A;  3P8W A;  2PUK C;  5GSS A;  1PSQ A;  2YWI A;  3US3 A;  1EGO A;  4IQA A;  3TRX A;  1ERU A;  2DML A;  1GUH A;  2GZP A;  3DRN A;  4KDX A;  1GSS A;  5ABR A;  1TK8 B;  2CVB A;  1EOG A;  4NV2 A;  4I2U A;  2CVK A;  4CDO A;  3C1R A;  4TW5 A;  4AJ6 A;  2DBC A;  1XBS A;  3DD3 A;  1O8W A;  4NWY A;  2F3M A;  4GSS A;  1TI3 A;  3WD6 A;  3DWV A;  3ZTL A;  4IN0 A;  2J9H A;  2QKE A;  5ECQ B;  4POL A;  1GRX A;  2AHE A;  2VCQ A;  2X8H A;  4IKH A;  4V2N A;  1G0T A;  1WWJ A;  5ECP B;  4P3Y B;  3HA9 A;  3IRA A;  3LJR A;  3M3M A;  1SYX A;  1DUG A;  4K1F A;  2F51 A;  1F3A A;  3GST A;  1BJX A;  4MJE A;  2HYX A;  2C3N A;  1V9W A;  4BVX A;  1SKR B;  1FG4 A;  5D9T A;  3GX0 A;  3M0F A;  3VWU A;  4LMW A;  2FY6 A;  3KJY A;  2O7K A;  5ID2 B;  3GX8 A;  3OR5 A;  1XIY A;  1SKW B;  2YV7 A;  1RK4 A;  5IOX A;  2NTO A;  4RUV A;  4ZL9 A;  3BD2 A;  3H1N A;  3CYN A;  3ZIT A;  5HR2 A;  4IHU A;  4OD7 A;  1NSW A;  3ZLP A;  4ID0 A;  1TXX A;  4RI6 A;  1Y25 A;  5IO2 A;  1EV9 A;  5ECH B;  3D6I A;  3Q74 A;  5IOW A;  2V6K A;  3UIW A;  2K18 A;  4KA0 A;  4JR4 A;  2YAN A;  3QDN A;  4PQ1 A;  2ON7 A;  3C7M A;  3W8J A;  1WPI A;  2KP1 A;  2GST A;  1GTA A;  4OO4 A;  2V2G A;  4HZ4 A;  2IMF A;  1TK5 B;  1TU8 A;  3GV1 A;  4F0B A;  4MPG A;  2FWH A;  4TR3 A;  1NM3 A;  1O85 A;  4K2D A;  3GKX A;  5GAP D;  3TJG A;  2LRC A;  1QGV A;  1QFN A;  1JFU A;  2H0H A;  2M80 A;  3FR6 A;  3QCP A;  2O87 A;  2OBK A;  2A2R A;  3HVX A;  4FO5 A;  3DGQ A;  2OE0 A;  4G2E A;  2ZNM A;  1OC9 A;  1GTI A;  1SL1 B;  1V57 A;  2LNT A;  5B8B A;  5DAL B;  2VCZ A;  3QAG A;  4L5O A;  4OCE A;  3TRP A;  1G7O A;  4HU9 A;  3HKR A;  2DIZ A;  4BA7 A;  4J56 E;  2VD0 A;  5IMF A;  3UL3 A;  2HFD A;  3CSH A;  1SJZ A;  3A2V A;  4TR1 B;  3F0I A;  1QMV A;  2FA8 A;  4BVY A;  2O89 A;  4L8E A;  1Q98 A;  2GQM A;  3LYK A;  5JCU A;  1SK2 A;  5E59 A;  1SL0 B;  5AIS A;  1R26 A;  1XOB A;  4GST A;  4IBP A;  2OAC A;  4KB3 A;  1EOH A;  2LJK A;  3TUE A;  5IPH A;  4HEA 2;  1IYI A;  5B6M A;  5JWO B;  2LJR A;  1ZL9 A;  1BQ7 A;  3IK7 A;  3KM6 A;  2BJX A;  3AY8 A;  2JZR A;  5LCZ A;  2LNS A;  3G9B A;  1TRW A;  5J9B A;  2H30 A;  1XWG A;  3ZVJ D;  2YWO A;  1M2A A;  3WT2 A;  1YKA A;  5CRD A;  4F03 A;  4WF5 A;  3D21 A;  1XCC A;  1C72 A;  2XBI A;  2JZT A;  1GLQ A;  4XRA A;  3UAP A;  4I97 A;  3L0H A;  1GUL A;  5AIV A;  3CBU A;  4WF4 A;  2P5R A;  1B8X A;  4HJM A;  1EWX A;  2MZC A;  2ZUP A;  5LD0 A;  3GH9 A;  1SL2 B;  2VD1 A;  3GA4 A;  2C3Q A;  3FZ4 A;  3IPZ A;  1MDK A;  4K8M A;  3L78 A;  3Q19 A;  1TI1 A;  1M2D A;  1OKD A;  2XPD A;  4N30 A;  2H75 A;  4ZIL A;  1TTZ A;  3TKQ A;  2VL2 A;  4GTU A;  4WBR D;  4IQ1 A;  2N5A A;  5EL8 A;  2H70 A;  3WGX A;  4KND A;  1YEX A;  2REM A;  3IOS A;  1OVN A;  3KH9 A;  5F06 A;  1TW9 A;  2H74 A;  5FHI A;  4DSR A;  1O6J A;  2HRN A;  4IVF A;  3HVV A;  3TCO A;  2VLT A;  2RM6 A;  2TIR A;  2OBI A;  5AGY A;  2L6C A;  2E7P A;  2P31 A;  3EU4 A;  5IQY A;  3RHB A;  4MMM A;  4KAE A;  16GS A;  4D73 B;  4EF0 A;  2V1M A;  1PX6 A;  2I81 A;  5ECN B;  1X9S B;  5F05 A;  2OE3 A;  4ZB6 A;  3TKP A;  2C0E A;  3LG6 A;  2KOK A;  4IS0 A;  4TXO B;  1K3Y A;  2G0F A;  3GTU A;  4XS6 A;  4YQM A;  2HZE B;  4NMU A;  1T4Y A;  2VCW A;  3ZFB A;  2YCD A;  4KX4 A; 
#chains in the Genus database with same CATH topology
 1BX9 A;  3W8S A;  2IME A;  3MWH A;  2JSZ A;  3VWV A;  2I1U A;  4JE1 A;  4MK3 A;  1OC8 A;  4BL7 B;  3ZMK A;  4J2F A;  4MCU A;  5EVO A;  22GS A;  1R5A A;  4TVE A;  1K0C A;  3QAV A;  4K6X A;  5D9W A;  5A4W A;  4IP1 A;  1PX7 A;  3EVI A;  3ED3 A;  4MPF A;  2NDO A;  1Z7P A;  1X0R A;  2H0G A;  2VCX A;  3FEU A;  1EZK A;  4IJI A;  1R5P A;  1E6B A;  3BBY A;  2G2Q A;  2AUV A;  3KH7 A;  1V58 A;  1THX A;  1TRU A;  2H1A A;  2AV4 A;  1ZOF A;  4WR5 A;  3QFA C;  3HZ4 A;  3NIV A;  4BPY A;  5FT3 A;  2WJU A;  2VCV A;  1HYU A;  3ZYW A;  3UVH A;  5CRG A;  1TOF A;  2D2Z A;  2PVQ A;  4IP6 A;  3GL3 A;  4G10 A;  2L4C A;  2JAC A;  2B6M A;  4DSS A;  1OE7 A;  5ECO B;  1PMT A;  5H5Q A;  1HNB A;  4MF6 A;  3M9J A;  1EGR A;  2NBS A;  3HY2 A;  3TJK A;  2CQ9 A;  1M9A A;  1M99 A;  1A2L A;  4FYU A;  4E8H A;  2IWT A;  3I43 A;  1OYJ A;  4MJB A;  4QL9 A;  1OAZ A;  1UN2 A;  4DEJ A;  4TXV A;  5CO3 A;  2XHF A;  4HUA A;  4E8E A;  5J3R A;  1ST9 A;  3H8Q A;  1ACV A;  4PNF A;  2YJH A;  1GLP A;  1A2J A;  1KTE A;  3H79 A;  4OO5 A;  3K8N A;  4ECB A;  5F0G A;  4XS4 A;  7GSS A;  2R37 A;  3ZIJ A;  4ECJ A;  5F8B A;  1G6W A;  1DBY A;  5IMC A;  3VI7 A;  1T00 A;  1WRY A;  2DMM A;  1HQO A;  3D4T A;  1Z5Y E;  3WT1 A;  3QPM A;  3TRQ A;  2K9F A;  3ERW A;  5CYY A;  2HSH A;  2LTK A;  4Q5F A;  5A4U A;  2XC2 A;  8GSS A;  1M9B A;  2VM2 A;  1Z9H A;  2F9S A;  1EEM A;  4KUN A;  2C3T A;  2VO4 A;  3O6T A;  2FGX A;  2YZH A;  2EIR A;  3R2Q A;  1A8L A;  2DIY A;  4CHS A;  4KSM A;  3IA1 A;  5CRW A;  1A23 A;  3G7J A;  3KTB A;  4HOJ A;  5DJL A;  1W4V A;  2JAD A;  9GSS A;  4I2T A;  4ECC A;  4PQI A;  3IR4 A;  2OAD A;  1TDI A;  2KUC A;  2WRT A;  1YZX A;  1PN0 A;  3E0U A;  2RUE A;  3EYT A;  2LQO A;  5JWR B;  3GIX A;  4IJ3 A;  5IMZ A;  5COH A;  3CTF A;  2MMO A;  5J9C A;  5G1L A;  3L9V A;  3G7I A;  6GSW A;  3UBK A;  2B5Y A;  4POM A;  3VFI A;  4XRD A;  1FOH A;  4NHZ A;  2GQK A;  4O5U A;  5H5R A;  4X0X A;  4V2L A;  1AUC A;  3L9U A;  2WDU A;  1WMJ A;  1PRX A;  3FMW A;  4NAX A;  3VI5 A;  4AJ7 A;  3HD5 A;  1X5C A;  5DCH A;  1XWC A;  4OFM A;  4MNN A;  2GDR A;  1YJ6 A;  2IFQ B;  2LS5 A;  3IHG A;  4MZB A;  2LUS A;  2YNX A;  3F9U A;  3MAK A;  1TJD A;  5ECS A;  4LLR A;  4POK A;  4KCA A;  2O8V B;  2B3S A;  2DJ2 A;  1JHB A;  3F4R A;  2PER A;  2H1D A;  1HNC A;  1A8Y A;  2IJY A;  4I8B A;  2PBJ A;  3F63 A;  1QK8 A;  3ZVJ A;  1SK1 A;  1I5G A;  2TRC P;  4NV5 A;  2HZF A;  4WEY A;  3LXZ A;  2PGT A;  3FZ5 A;  2DJK A;  2F8A A;  1UA5 A;  5DBQ A;  1XPV A;  4JED A;  5C00 A;  2JZS A;  3FK8 A;  4O92 A;  4OFT A;  2CAQ A;  4YQU A;  2V6O A;  4GRF A;  1ZYN A;  2HLS A;  3QR6 A;  3UVT A;  1EEJ A;  1BED A;  1SYR A;  3MDK A;  1XWB A;  3TGZ A;  2RUF A;  2P0G A;  4POB A;  3HDC A;  2H19 A;  2J23 A;  3ME8 A;  2A4V A;  4RQR A;  1ZMA A;  1AQW A;  5A4V A;  3ERG A;  3IC8 A;  4N0Z A;  3CSJ A;  2HT9 A;  4G0I A;  3HHV A;  3F3Q A;  2H66 A;  5GZZ B;  3A5I A;  3H4K A;  2L57 A;  1AQX A;  4XS1 A;  4MP4 A;  5CP1 A;  4USS A;  2GVP A;  6GSS A;  2CX4 A;  4GSN A;  1A2M A;  5HFI A;  5CAX A;  3DYR A;  3Q6O A;  5IO0 A;  1ZYP A;  2AAW A;  2JU5 A;  5ECM B;  3V1W A;  2GTU A;  3FYG A;  1O81 A;  5IMV A;  5DVB A;  1B9X C;  3LXT A;  5ECI B;  2BMX A;  2YN1 A;  3D22 A;  4GF0 A;  4F82 A;  1AXD A;  3F4S A;  5E4W A;  1S3A A;  1ZCP A;  5KN2 A;  2FWG A;  2ZCT A;  1M2B A;  2CZ2 A;  4NPB A;  1FOV A;  4KE3 A;  2PPT A;  3KCM A;  4QQ7 A;  2H76 A;  2WUL A;  3IV4 A;  3IBH A;  2B7J A;  5J4U A;  1VF4 A;  5A5K A;  4V1A g;  1X9W B;  5D96 A;  1MD3 A;  2VL2 C;  1Q4J A;  2QC7 A;  3UJ1 A;  2FWF A;  2H1G A;  1XVW A;  1YDK A;  2DC5 A;  2PVO C;  4O5R A;  3HJP A;  4L5L A;  1V98 A;  1YF0 A;  3QD9 A;  2MYG A;  4ZBD A;  4MF5 A;  1GSD A;  2VUP A;  1KEB A;  5D9X A;  3CTG A;  4ISD A;  4K7I A;  2WCI A;  4LA1 A;  1OC9 B;  1XW6 A;  4AF2 A;  1SJI A;  1F9M A;  4K9Z A;  4JU5 A;  2C1Y A;  4L0W A;  1B4Q A;  3FW2 A;  2H6X A;  6GSV A;  3RPP A;  1DE1 A;  4HZ2 A;  5KN0 A;  1K0A A;  1PFO A;  1DSB A;  3UAR A;  1B9Y C;  5D9V A;  2M72 A;  1ZYE A;  3KZQ A;  1WE0 A;  4BVY B;  2C80 A;  3KIJ A;  1ABA A;  1T8E B;  2B7K A;  2YZU A;  1O73 A;  2HRF A;  2P5Q A;  3CMI A;  1XVQ A;  2CZ3 A;  3VPT A;  4G0K A;  5CRE A;  3HCZ A;  5LNK e;  2RII A;  3RPN A;  2MMN A;  1MEK A;  2VIM A;  3ZRE A;  4X1U A;  2E2M A;  2N5B A;  3MNG A;  2GS3 A;  2H72 A;  2E0Q A;  3GHA A;  3P7X A;  2GT6 A;  5DCG A;  1AIU A;  5D93 A;  1KNG A;  3APS A;  5FWG A;  1GSE A;  2YP6 A;  4X43 A;  4FIW A;  2A4H A;  2JSY A;  3KGK A;  2LJA A;  2R0P A;  4Z2T A;  3EMP A;  5DQS A;  3N9J A;  4TN8 A;  2LQQ A;  4MJC A;  4PX1 A;  2EC4 A;  2OA7 A;  5C04 A;  2L59 A;  4F0C A;  3FR9 A;  5AIX A;  1I9D A;  2V41 A;  1XFL A;  1Z3E A;  1K0N A;  1HNA A;  3PGT A;  4MF7 A;  14GS A;  4WKW A;  5EPF A;  3EU3 A;  1GSU A;  5G31 A;  4PUA A;  2H01 A;  2IN3 A;  2AB6 A;  2C0D A;  3LGC A;  1FW1 A;  4MH2 A;  4MZW A;  1VRS D;  3KTL A;  1GUK A;  1W89 A;  1RW1 A;  4TRX A;  3TJF A;  2IL3 A;  1GH2 A;  2KP2 A;  3ZZX A;  4K0N A;  4A5P A;  5KN3 A;  1DE2 A;  2B5E A;  2GZY A;  2DJ0 A;  1A0R P;  4K0G A;  3A2W A;  1FHE A;  1PL1 A;  3TKS A;  2GGT A;  4ACS A;  1NW2 A;  3I6A A;  5HR1 A;  2CA8 A;  5DQY A;  4OFN A;  3CXG A;  2FNO A;  3GFK A;  4MDC A;  1F37 A;  2WS2 A;  4N0V A;  13GS A;  3E3E A;  2BTO T;  5JWQ B;  2R5G A;  5G5F A;  4ZIJ A;  3NOF A;  5KOW A;  3DVW A;  1ILO A;  2I9H A;  1MDI A;  19GS A;  4EXJ A;  2LV3 A;  1PN9 A;  3PH9 A;  4MAB A;  1Z6M A;  3A3T A;  3R3E A;  2GZZ A;  2B1L A;  3HJO A;  3EUR A;  2H8L A;  4XIH A;  5HFK A;  3GTU B;  3E9J B;  1ON4 A;  3IC4 A;  3DVX A;  5GST A;  4ZL7 A;  1ML6 A;  1K0M A;  3I9V 2;  4KSO A;  2YPM A;  4F9Z A;  5EY6 A;  3LSZ A;  3D0Z A;  1GSQ A;  3A2X A;  1SKS B;  1U88 A;  2DKH A;  1J08 A;  2DSA A;  1FB0 A;  3GKN A;  3EIN A;  12GS A;  1AAZ A;  2KLX A;  1VF1 A;  3L9S A;  1PD2 1;  3VLN A;  4HU7 A;  2H73 A;  2A2S A;  3O76 A;  4FYB A;  3VPQ A;  2LRT A;  4H86 A;  1SEN A;  1X5D A;  2HI7 A;  4GQC A;  4K7N A;  4CY6 A;  4EL1 A;  2H1B A;  2B1K A;  3LWA A;  1K3L A;  3J7Y k;  4LMV A;  2LKU A;  3O3T A;  1UVZ A;  5B6N A;  4HJ2 A;  2H0I A;  2QSI A;  2PMT A;  5ECL B;  3IAS 2;  4Q5N A;  2HNL A;  1ZYQ B;  4WET A;  1JZD A;  4TKY A;  5F07 A;  2L4Q A;  3H93 A;  5IMA A;  1PGT A;  1GNW A;  4NHW A;  3IK9 A;  1X5E A;  4IEL A;  4DSS B;  1AQV A;  3KMO A;  5KEJ A;  1IYH A;  1E2Y A;  2CVD A;  1F6M C;  2GT5 A;  2EIO A;  4EDZ A;  2FLS A;  3I69 A;  1Y6E A;  1XW9 A;  1ZGN A;  2JL4 A;  3D5J A;  3M1G A;  2AJQ B;  2NVL A;  1MDJ A;  3JCM L;  2M46 A;  5JCG A;  4Z7X A;  3KP9 A;  3GNJ A;  4EUY A;  6GSX A;  2YWM A;  1VGL A;  1JZR A;  3FKF A;  4GQF A;  3HVN A;  3M8N A;  4RQX A;  1SK0 A;  3DEX A;  1XWK A;  5BRT A;  2MMA A;  3EWL A;  2CV4 A;  3A5W A;  2IPA A;  1A24 A;  4XS4 B;  6GSY A;  4PNG A;  2YJ7 A;  5HR0 A;  4LL4 B;  4GWR A;  3IDV A;  4JR6 A;  1GTU A;  4WXT A;  2R4V A;  1WOU A;  1XXU A;  2C8U A;  4N11 A;  1NHY A;  4RI7 A;  3F8U A;  2K8S A;  1K3O A;  5IIZ A;  4EKZ A;  1S3R A;  2FCH A;  5DAL A;  3ZRD A;  4PUR A;  1T7P B;  1TRV A;  3DXB A;  3FRC A;  3F6D A;  1ZZY A;  4K7O A;  1K0D A;  1S3D A;  5B8A A;  2IIY A;  1WIK A;  4MLY A;  4ICY A;  4ZBA A;  4PUF C;  5IPG A;  5ELG A;  3APO A;  1GNE A;  1G6Y A;  4TR1 A;  1K0B A;  3ERF A;  5D73 A;  2H6Z A;  4DSQ A;  2HXK A;  4G9H A;  5L71 A;  3GKK A;  2R2J A;  3IE3 A;  3RBT A;  4NXI A;  3VWX A;  2WB9 A;  3GRX A;  2FD3 A;  2HRK A;  1TKD B;  1LU4 A;  4IGJ A;  5GAN D;  2AYT A;  1Z7R A;  3U6V A;  3DIE A;  1XWA A;  1PL2 A;  1R7H A;  6GST A;  2X8C A;  1H75 A;  3LOR A;  4MZC A;  10GS A;  3ME7 A;  3QFB C;  4KCE A;  5G5E A;  2YWN A;  4OMV A;  1RQM A;  3J7Y b;  1TU7 A;  2R3X A;  3KP8 A;  1YEP A;  1H4O A;  1ERV A;  3HJM A;  3GUS A;  5ENU A;  5J41 A;  3W6G A;  1PA3 A;  3ZIV A;  4EIQ A;  1O7U A;  2OJL A;  3IHQ A;  4YAV A;  2O85 A;  1S3C A;  1XOA A;  3M9K A;  4EVM A;  5CNW A;  2L6D A;  2ALB A;  1SD9 A;  1GUM A;  3IAM 2;  3EC3 A;  1OKT A;  2XBQ A;  3APQ A;  2GLR A;  4L0U A;  2YOI A;  5KN1 A;  1U87 A;  2IMK A;  2VM1 A;  3TOU A;  1FVJ A;  2LEG A;  4BWS A;  2X8G A;  4EE0 A;  4I6X A;  2PU9 C;  1AC1 A;  2LST A;  3ZL5 A;  1VF3 A;  1Z6N A;  3L4N A;  5INY A;  1F3B A;  5AN1 A;  2X64 A;  3KMN A;  1V40 A;  2R6K A;  3EE2 A;  4TR4 A;  3BCK A;  4XCS A;  2I3Y A;  5DAK A;  3QOU A;  4CY8 A;  4AGS A;  3QAW A;  3ISO A;  4DVC A;  4G19 A;  3GUR A;  2ES7 A;  3KEB A;  1LJR A;  3C71 A;  4OWY A;  2LRN A;  20GS A;  2VL9 A;  3MIX A;  2OE1 A;  2CX3 A;  5ECR B;  3GKM A;  1YKC A;  3S9F A;  4FYC A;  1MTC A;  4D73 A;  3HYP A;  4N10 A;  2WZ9 A;  1U3A A;  2YV9 A;  1M0U A;  1XZO A;  3F6F A;  3SBC A;  4XTS A;  4TXO A;  2VLU A;  1SU9 A;  1SD8 A;  1T3B A;  2ON5 A;  2HZE A;  5J5N A;  1CQH A;  2GSR A;  5B7C A;  3C73 A;  2QA1 A;  2DJ1 A;  3HVS A;  4ML6 A;  4WBJ A;  2K8V A;  2C0G A;  2WGR A;  2NPB A;  3UEM A;  4EC0 A;  1K0O A;  3GH6 A;  2TRX A;  4BL7 A;  1WP0 A;  3CSI A;  1QUW A;  1YF1 A;  1X9M B;  1CQG A;  4YH2 A;  3WGD A;  4PXO A;  5H5S A;  4QL7 A;  1MD4 A;  1LBK A;  4K2X A;  2VOC A;  3P90 A;  2QGV A;  4KDY A;  3GL5 A;  4KH7 A;  5IMD A;  3HZ8 A;  2F8F A;  4K5S A;  4ZL8 A;  1JLW A;  1QXH A;  3CRT A;  3F4T A;  6GSU A;  4I5Q A;  1WJK A;  2DJJ A;  2CT6 A;  3LQ7 A;  1YQ1 A;  3IXR A;  1T1V A;  3LFL A;  3TB2 A;  1BAY A;  1GWC A;  4PQH A;  4MH3 A;  1B4P A;  5DAK B;  3C1S A;  3GMF A;  4ZB8 A;  3QMX A;  1JZO A;  1EP7 A;  1ERW A;  3FR3 A;  4HQZ A;  4ILF A;  4HS1 A;  4ULX A;  2R0C A;  2L5O A;  4Z2R A;  5DDL A;  4XHM A;  4GLT A;  2HSM A;  3U5R E;  3KD0 A;  4KGI A;  4MJA A;  3PIN A;  2QA2 A;  5G2Z A;  4HDE A;  3VWW A;  4BIK A;  3HXS A;  5HFG A;  3GSS A;  4TR0 A;  1QQ2 A;  4CW9 A;  2HRA A;  2I4A A;  4IW9 A;  1JZW A;  5HR3 A;  1T4Z A;  3LEF A;  1O8X A;  3FY7 A;  1AW9 A;  1N8J A;  3BCI A;  5D8I A;  3TKS E;  1NHO A;  3WGE A;  3BJ5 A;  3TKS C;  2RM5 A;  2CAI A;  4JRR A;  3SWL A;  3CRU A;  1A0F A;  2X4A A;  3RDW A;  4F2I A;  1PKW A;  3MSZ A;  4ZBB A;  3VUR A;  4EDY A;  3NZN A;  1J0F A;  4FH8 A;  1BG5 A;  2XPE A;  2PWJ A;  4Q5R A;  5G1K A;  1PKZ A;  1N2A A;  3VK9 A;  3UMA A;  1TRS A;  18GS A;  3GN3 A;  1ERT A;  2IMD A;  3LYP A;  1GSF A;  4V2M A;  3LW9 A;  2FA4 A;  1F2E A;  2B5X A;  5JCW A;  1EP8 A;  5CRH A;  5ECK B;  4KW6 A;  4AJ8 A;  3G7Y A;  1TK0 B;  2DJ3 A;  3RAZ A;  2PN8 A;  1V2A A;  1FO5 A;  4GXZ A;  2VL3 A;  1GP1 A;  2OKA A;  1FVK A;  2MMZ A;  3ZML A;  1TP9 A;  17GS A;  2H71 A;  2K6V A;  3BOA A;  1FAA A;  5DJM A;  4WR4 A;  2FWE A;  3P2A A;  3FHK A;  2RLI A;  2DLX A;  1THO A;  1VF2 A;  4ZXG A;  1GTB A;  3DML A;  2HE3 A;  3F3R A;  4O32 A;  4JZQ A;  3UBL A;  2UZ8 A;  1B48 A;  5IM9 A;  2WFC A;  2GSQ A;  1OE8 A;  1HD2 A;  3TJJ A;  2X99 A;  4ZB9 A;  2Z9S A;  3KXO A;  3WYW A;  11GS A;  2H6Y A;  2L5L A;  2VCT A;  1FB6 A;  2VAF A;  4Z2U A;  1JLV A;  2VLV A;  3PR8 A;  4BWQ A;  4Q5Q A;  3TKR A;  2IMI A;  4OCF A;  1URM A;  4J57 E;  4K5R A;  2HSY A;  2GSS A;  3FZ9 A;  4TOP A;  5G30 A;  4HQS A;  3TJB A;  2FUG 2;  3TOT A;  4EIP A;  3TDG A;  4YQV A;  3DKS A;  1BYE A;  3RHC A;  4ML1 A;  2MBS A;  1GL8 A;  2C4J A;  1G7E A;  1J9B A;  1KBN A;  4YAP A;  1XG8 A;  2EIQ A;  1GSY A;  5BMU A;  2GQL A;  2N5F A;  2E2G A;  3Q18 A;  1SJ6 A;  4KDU A;  2IFQ A;  2C0F A;  4ECI A;  1U3I A;  3ZFL A;  1U6T A;  2V32 A;  3N5O A;  3UOM A;  4GCI A;  1R4W A;  2KHP A;  1OC3 A;  3GYK A;  4HI7 A;  5HQP A;  1EV4 A;  3FZA A;  3D4M A;  5ID2 A;  4LL1 B;  4V1A p;  1M7T A;  3EMX A;  4JBB A;  4PGT A;  3C8E A;  4O7H A;  5ELA A;  1YY7 A;  4MA9 A;  2FHE A;  1UC7 A;  2MBT A;  4EO3 A;  1PQN A;  1USB A;  1XW5 A;  3P8W A;  2PUK C;  5GSS A;  1PSQ A;  2YWI A;  3US3 A;  1EGO A;  4IQA A;  3TRX A;  1ERU A;  2DML A;  1GUH A;  2GZP A;  3DRN A;  4KDX A;  1GSS A;  5ABR A;  1TK8 B;  2CVB A;  1EOG A;  4NV2 A;  4I2U A;  2CVK A;  4CDO A;  3C1R A;  4TW5 A;  4AJ6 A;  2DBC A;  1XBS A;  3DD3 A;  1O8W A;  4NWY A;  2F3M A;  4GSS A;  1TI3 A;  3WD6 A;  3DWV A;  3ZTL A;  4IN0 A;  2J9H A;  2QKE A;  5ECQ B;  4POL A;  1GRX A;  2AHE A;  2VCQ A;  2X8H A;  4IKH A;  4V2N A;  5KOX A;  4YKG A;  1G0T A;  1WWJ A;  5ECP B;  4P3Y B;  3HA9 A;  3IRA A;  3LJR A;  3M3M A;  1SYX A;  1DUG A;  4K1F A;  2F51 A;  1F3A A;  3GST A;  1BJX A;  4MJE A;  2HYX A;  4KF9 A;  2C3N A;  1V9W A;  4BVX A;  1SKR B;  1FG4 A;  4PTS A;  5D9T A;  3GX0 A;  3M0F A;  3VWU A;  4LMW A;  2FY6 A;  3KJY A;  2O7K A;  5ID2 B;  3GX8 A;  3OR5 A;  1XIY A;  1SKW B;  2YV7 A;  2DKI A;  1RK4 A;  5IOX A;  2NTO A;  4RUV A;  4HSC X;  4ZL9 A;  3BD2 A;  3H1N A;  3CYN A;  3ZIT A;  5HR2 A;  4IHU A;  4OD7 A;  1NSW A;  3ZLP A;  4ID0 A;  1TXX A;  4RI6 A;  1Y25 A;  5IO2 A;  1EV9 A;  5ECH B;  3D6I A;  3Q74 A;  5IOW A;  2V6K A;  3UIW A;  2K18 A;  4KA0 A;  4JR4 A;  2X49 A;  2YAN A;  3QDN A;  4PQ1 A;  2ON7 A;  3C7M A;  3W8J A;  1WPI A;  3PPU A;  2KP1 A;  2GST A;  1GTA A;  4OO4 A;  2V2G A;  4HZ4 A;  2IMF A;  1TK5 B;  1TU8 A;  3GV1 A;  4F0B A;  4MPG A;  2FWH A;  4TR3 A;  1NM3 A;  1O85 A;  4K2D A;  3GKX A;  5GAP D;  3TJG A;  2LRC A;  1QGV A;  1QFN A;  1JFU A;  2H0H A;  2M80 A;  3FR6 A;  3QCP A;  2O87 A;  2OBK A;  2A2R A;  4X4J A;  3HVX A;  4FO5 A;  3DGQ A;  2OE0 A;  4G2E A;  2ZNM A;  1OC9 A;  1GTI A;  1SL1 B;  1V57 A;  1M3J A;  2LNT A;  5B8B A;  5DAL B;  2VCZ A;  3QAG A;  4L5O A;  4OCE A;  3TRP A;  1G7O A;  4HU9 A;  3HKR A;  2DIZ A;  4BA7 A;  4J56 E;  2VD0 A;  5IMF A;  3UL3 A;  4BVX B;  2HFD A;  3CSH A;  1SJZ A;  3A2V A;  4TR1 B;  3F0I A;  1QMV A;  2FA8 A;  4BVY A;  2O89 A;  4L8E A;  1Q98 A;  2GQM A;  3LYK A;  5JCU A;  1SK2 A;  5E59 A;  1SL0 B;  5AIS A;  1R26 A;  1XOB A;  4GST A;  4IBP A;  2OAC A;  4KB3 A;  1EOH A;  2LJK A;  3TUE A;  5IPH A;  4HEA 2;  1IYI A;  5B6M A;  5JWO B;  2LJR A;  1ZL9 A;  1BQ7 A;  3IK7 A;  3KM6 A;  2BJX A;  3AY8 A;  2JZR A;  5LCZ A;  2LNS A;  3G9B A;  1TRW A;  5J9B A;  2H30 A;  1XWG A;  3ZVJ D;  4FQU A;  2YWO A;  1M2A A;  3WT2 A;  1YKA A;  5CRD A;  4F03 A;  1M3I A;  4G0L A;  4WF5 A;  3D21 A;  1XCC A;  1C72 A;  2XBI A;  2JZT A;  1GLQ A;  4XRA A;  3UAP A;  4I97 A;  3L0H A;  1GUL A;  5AIV A;  3CBU A;  4O5Q A;  4WF4 A;  2P5R A;  1B8X A;  4HJM A;  1EWX A;  2MZC A;  2ZUP A;  5LD0 A;  3GH9 A;  1SL2 B;  3CQF A;  2VD1 A;  3GA4 A;  2C3Q A;  3FZ4 A;  3IPZ A;  1MDK A;  4K8M A;  3L78 A;  3Q19 A;  1TI1 A;  1M2D A;  1OKD A;  2XPD A;  4N30 A;  2H75 A;  4ZIL A;  1TTZ A;  3TKQ A;  2VL2 A;  4GTU A;  4WBR D;  4IQ1 A;  2N5A A;  5EL8 A;  2H70 A;  3WGX A;  4KND A;  1YEX A;  2REM A;  3MYD A;  3IOS A;  1OVN A;  3KH9 A;  5F06 A;  1TW9 A;  2H74 A;  5FHI A;  4DSR A;  1O6J A;  2HRN A;  4IVF A;  3HVV A;  3TCO A;  2VLT A;  2RM6 A;  2TIR A;  2OBI A;  5AGY A;  2L6C A;  2E7P A;  2P31 A;  3EU4 A;  5IQY A;  3RHB A;  4MMM A;  2R0G A;  4KAE A;  2A2P A;  16GS A;  4D73 B;  4EF0 A;  2V1M A;  1PX6 A;  2I81 A;  4YKF A;  5ECN B;  1X9S B;  3EPT A;  5F05 A;  2OE3 A;  4ZB6 A;  3TKP A;  2C0E A;  3LG6 A;  2KOK A;  4IS0 A;  4TXO B;  1K3Y A;  2G0F A;  3GTU A;  4XS6 A;  4YQM A;  2HZE B;  4NMU A;  1T4Y A;  2VCW A;  3ZFB A;  2YCD A;  4KX4 A; 
#chains in the Genus database with same CATH homology
 1BX9 A;  3W8S A;  2IME A;  3MWH A;  2JSZ A;  3VWV A;  2I1U A;  4JE1 A;  4MK3 A;  1OC8 A;  4BL7 B;  3ZMK A;  4J2F A;  4MCU A;  5EVO A;  22GS A;  1R5A A;  4TVE A;  1K0C A;  3QAV A;  4K6X A;  5D9W A;  5A4W A;  4IP1 A;  1PX7 A;  3EVI A;  3ED3 A;  4MPF A;  2NDO A;  1Z7P A;  1X0R A;  2H0G A;  2VCX A;  3FEU A;  1EZK A;  4IJI A;  1R5P A;  1E6B A;  3BBY A;  2G2Q A;  2AUV A;  3KH7 A;  1V58 A;  1THX A;  1TRU A;  2H1A A;  2AV4 A;  1ZOF A;  4WR5 A;  3QFA C;  3HZ4 A;  3NIV A;  4BPY A;  5FT3 A;  2WJU A;  2VCV A;  1HYU A;  3ZYW A;  3UVH A;  5CRG A;  1TOF A;  2D2Z A;  2PVQ A;  4IP6 A;  3GL3 A;  4G10 A;  2L4C A;  2JAC A;  2B6M A;  4DSS A;  1OE7 A;  5ECO B;  1PMT A;  5H5Q A;  1HNB A;  4MF6 A;  3M9J A;  1EGR A;  2NBS A;  3HY2 A;  3TJK A;  2CQ9 A;  1M9A A;  1M99 A;  1A2L A;  4FYU A;  4E8H A;  2IWT A;  3I43 A;  1OYJ A;  4MJB A;  4QL9 A;  1OAZ A;  1UN2 A;  4DEJ A;  4TXV A;  5CO3 A;  2XHF A;  4HUA A;  4E8E A;  5J3R A;  1ST9 A;  3H8Q A;  1ACV A;  4PNF A;  2YJH A;  1GLP A;  1A2J A;  1KTE A;  3H79 A;  4OO5 A;  3K8N A;  4ECB A;  5F0G A;  4XS4 A;  7GSS A;  2R37 A;  3ZIJ A;  4ECJ A;  5F8B A;  1G6W A;  1DBY A;  5IMC A;  3VI7 A;  1T00 A;  1WRY A;  2DMM A;  1HQO A;  3D4T A;  1Z5Y E;  3WT1 A;  3QPM A;  3TRQ A;  2K9F A;  3ERW A;  5CYY A;  2HSH A;  2LTK A;  4Q5F A;  5A4U A;  2XC2 A;  8GSS A;  1M9B A;  2VM2 A;  1Z9H A;  2F9S A;  1EEM A;  4KUN A;  2C3T A;  2VO4 A;  3O6T A;  2FGX A;  2YZH A;  2EIR A;  3R2Q A;  1A8L A;  2DIY A;  4CHS A;  4KSM A;  3IA1 A;  5CRW A;  1A23 A;  3G7J A;  3KTB A;  4HOJ A;  5DJL A;  1W4V A;  2JAD A;  9GSS A;  4I2T A;  4ECC A;  4PQI A;  3IR4 A;  2OAD A;  1TDI A;  2KUC A;  2WRT A;  1YZX A;  1PN0 A;  3E0U A;  2RUE A;  3EYT A;  2LQO A;  5JWR B;  3GIX A;  4IJ3 A;  5IMZ A;  5COH A;  3CTF A;  2MMO A;  5J9C A;  5G1L A;  3L9V A;  3G7I A;  6GSW A;  3UBK A;  2B5Y A;  4POM A;  3VFI A;  4XRD A;  1FOH A;  4NHZ A;  2GQK A;  4O5U A;  5H5R A;  4X0X A;  4V2L A;  1AUC A;  3L9U A;  2WDU A;  1WMJ A;  1PRX A;  3FMW A;  4NAX A;  3VI5 A;  4AJ7 A;  3HD5 A;  1X5C A;  5DCH A;  1XWC A;  4OFM A;  4MNN A;  2GDR A;  1YJ6 A;  2IFQ B;  2LS5 A;  3IHG A;  4MZB A;  2LUS A;  2YNX A;  3F9U A;  3MAK A;  1TJD A;  5ECS A;  4LLR A;  4POK A;  4KCA A;  2O8V B;  2B3S A;  2DJ2 A;  1JHB A;  3F4R A;  2PER A;  2H1D A;  1HNC A;  1A8Y A;  2IJY A;  4I8B A;  2PBJ A;  3F63 A;  1QK8 A;  3ZVJ A;  1SK1 A;  1I5G A;  2TRC P;  4NV5 A;  2HZF A;  4WEY A;  3LXZ A;  2PGT A;  3FZ5 A;  2DJK A;  2F8A A;  1UA5 A;  5DBQ A;  1XPV A;  4JED A;  5C00 A;  2JZS A;  3FK8 A;  4O92 A;  4OFT A;  2CAQ A;  4YQU A;  2V6O A;  4GRF A;  1ZYN A;  2HLS A;  3QR6 A;  3UVT A;  1EEJ A;  1BED A;  1SYR A;  3MDK A;  1XWB A;  3TGZ A;  2RUF A;  2P0G A;  4POB A;  3HDC A;  2H19 A;  2J23 A;  3ME8 A;  2A4V A;  4RQR A;  1ZMA A;  1AQW A;  5A4V A;  3ERG A;  3IC8 A;  4N0Z A;  3CSJ A;  2HT9 A;  4G0I A;  3HHV A;  3F3Q A;  2H66 A;  5GZZ B;  3A5I A;  3H4K A;  2L57 A;  1AQX A;  4XS1 A;  4MP4 A;  5CP1 A;  4USS A;  2GVP A;  6GSS A;  2CX4 A;  4GSN A;  1A2M A;  5HFI A;  5CAX A;  3DYR A;  3Q6O A;  5IO0 A;  1ZYP A;  2AAW A;  2JU5 A;  5ECM B;  3V1W A;  2GTU A;  3FYG A;  1O81 A;  5IMV A;  5DVB A;  1B9X C;  3LXT A;  5ECI B;  2BMX A;  2YN1 A;  3D22 A;  4GF0 A;  4F82 A;  1AXD A;  3F4S A;  5E4W A;  1S3A A;  1ZCP A;  5KN2 A;  2FWG A;  2ZCT A;  1M2B A;  2CZ2 A;  4NPB A;  1FOV A;  4KE3 A;  2PPT A;  3KCM A;  4QQ7 A;  2H76 A;  2WUL A;  3IV4 A;  3IBH A;  2B7J A;  5J4U A;  1VF4 A;  5A5K A;  4V1A g;  1X9W B;  5D96 A;  1MD3 A;  2VL2 C;  1Q4J A;  2QC7 A;  3UJ1 A;  2FWF A;  2H1G A;  1XVW A;  1YDK A;  2DC5 A;  2PVO C;  4O5R A;  3HJP A;  4L5L A;  1V98 A;  1YF0 A;  3QD9 A;  2MYG A;  4ZBD A;  4MF5 A;  1GSD A;  2VUP A;  1KEB A;  5D9X A;  3CTG A;  4ISD A;  4K7I A;  2WCI A;  4LA1 A;  1OC9 B;  1XW6 A;  4AF2 A;  1SJI A;  1F9M A;  4K9Z A;  4JU5 A;  2C1Y A;  4L0W A;  1B4Q A;  3FW2 A;  2H6X A;  6GSV A;  3RPP A;  1DE1 A;  4HZ2 A;  5KN0 A;  1K0A A;  1DSB A;  3UAR A;  1B9Y C;  5D9V A;  2M72 A;  1ZYE A;  3KZQ A;  1WE0 A;  4BVY B;  2C80 A;  3KIJ A;  1ABA A;  1T8E B;  2B7K A;  2YZU A;  1O73 A;  2HRF A;  2P5Q A;  3CMI A;  1XVQ A;  2CZ3 A;  3VPT A;  4G0K A;  5CRE A;  3HCZ A;  5LNK e;  2RII A;  3RPN A;  2MMN A;  1MEK A;  2VIM A;  3ZRE A;  4X1U A;  2E2M A;  2N5B A;  3MNG A;  2GS3 A;  2H72 A;  2E0Q A;  3GHA A;  3P7X A;  2GT6 A;  5DCG A;  1AIU A;  5D93 A;  1KNG A;  3APS A;  5FWG A;  1GSE A;  2YP6 A;  4X43 A;  4FIW A;  2A4H A;  2JSY A;  3KGK A;  2LJA A;  2R0P A;  4Z2T A;  3EMP A;  5DQS A;  3N9J A;  4TN8 A;  2LQQ A;  4MJC A;  4PX1 A;  2EC4 A;  2OA7 A;  5C04 A;  2L59 A;  4F0C A;  3FR9 A;  5AIX A;  1I9D A;  2V41 A;  1XFL A;  1Z3E A;  1K0N A;  1HNA A;  3PGT A;  4MF7 A;  14GS A;  4WKW A;  5EPF A;  3EU3 A;  1GSU A;  5G31 A;  4PUA A;  2H01 A;  2IN3 A;  2AB6 A;  2C0D A;  3LGC A;  1FW1 A;  4MH2 A;  4MZW A;  1VRS D;  3KTL A;  1GUK A;  1W89 A;  1RW1 A;  4TRX A;  3TJF A;  2IL3 A;  1GH2 A;  2KP2 A;  3ZZX A;  4K0N A;  4A5P A;  5KN3 A;  1DE2 A;  2B5E A;  2GZY A;  2DJ0 A;  1A0R P;  4K0G A;  3A2W A;  1FHE A;  1PL1 A;  3TKS A;  2GGT A;  4ACS A;  1NW2 A;  3I6A A;  5HR1 A;  2CA8 A;  5DQY A;  4OFN A;  3CXG A;  2FNO A;  3GFK A;  4MDC A;  1F37 A;  2WS2 A;  4N0V A;  13GS A;  3E3E A;  2BTO T;  5JWQ B;  2R5G A;  5G5F A;  4ZIJ A;  3NOF A;  5KOW A;  3DVW A;  1ILO A;  2I9H A;  1MDI A;  19GS A;  4EXJ A;  2LV3 A;  1PN9 A;  3PH9 A;  4MAB A;  1Z6M A;  3A3T A;  3R3E A;  2GZZ A;  2B1L A;  3HJO A;  3EUR A;  2H8L A;  4XIH A;  5HFK A;  3GTU B;  3E9J B;  1ON4 A;  3IC4 A;  3DVX A;  5GST A;  4ZL7 A;  1ML6 A;  1K0M A;  3I9V 2;  4KSO A;  2YPM A;  4F9Z A;  5EY6 A;  3LSZ A;  3D0Z A;  1GSQ A;  3A2X A;  1SKS B;  1U88 A;  2DKH A;  1J08 A;  2DSA A;  1FB0 A;  3GKN A;  3EIN A;  12GS A;  1AAZ A;  2KLX A;  1VF1 A;  3L9S A;  1PD2 1;  3VLN A;  4HU7 A;  2H73 A;  2A2S A;  3O76 A;  4FYB A;  3VPQ A;  2LRT A;  4H86 A;  1SEN A;  1X5D A;  2HI7 A;  4GQC A;  4K7N A;  4CY6 A;  4EL1 A;  2H1B A;  2B1K A;  3LWA A;  1K3L A;  3J7Y k;  4LMV A;  2LKU A;  3O3T A;  1UVZ A;  5B6N A;  4HJ2 A;  2H0I A;  2QSI A;  2PMT A;  5ECL B;  3IAS 2;  4Q5N A;  2HNL A;  1ZYQ B;  4WET A;  1JZD A;  4TKY A;  5F07 A;  2L4Q A;  3H93 A;  5IMA A;  1PGT A;  1GNW A;  4NHW A;  3IK9 A;  1X5E A;  4IEL A;  4DSS B;  1AQV A;  3KMO A;  5KEJ A;  1IYH A;  1E2Y A;  2CVD A;  1F6M C;  2GT5 A;  2EIO A;  4EDZ A;  2FLS A;  3I69 A;  1Y6E A;  1XW9 A;  1ZGN A;  2JL4 A;  3D5J A;  3M1G A;  2AJQ B;  2NVL A;  1MDJ A;  3JCM L;  2M46 A;  5JCG A;  4Z7X A;  3KP9 A;  3GNJ A;  4EUY A;  6GSX A;  2YWM A;  1VGL A;  1JZR A;  3FKF A;  4GQF A;  3M8N A;  4RQX A;  1SK0 A;  3DEX A;  1XWK A;  5BRT A;  2MMA A;  3EWL A;  2CV4 A;  3A5W A;  2IPA A;  1A24 A;  4XS4 B;  6GSY A;  4PNG A;  2YJ7 A;  5HR0 A;  4LL4 B;  4GWR A;  3IDV A;  4JR6 A;  1GTU A;  4WXT A;  2R4V A;  1WOU A;  1XXU A;  2C8U A;  4N11 A;  1NHY A;  4RI7 A;  3F8U A;  2K8S A;  1K3O A;  5IIZ A;  4EKZ A;  2FCH A;  5DAL A;  3ZRD A;  4PUR A;  1T7P B;  1TRV A;  3DXB A;  3FRC A;  3F6D A;  1ZZY A;  4K7O A;  1K0D A;  1S3D A;  5B8A A;  2IIY A;  1WIK A;  4MLY A;  4ICY A;  4ZBA A;  4PUF C;  5IPG A;  5ELG A;  3APO A;  1GNE A;  1G6Y A;  4TR1 A;  1K0B A;  3ERF A;  5D73 A;  2H6Z A;  4DSQ A;  2HXK A;  4G9H A;  5L71 A;  3GKK A;  2R2J A;  3IE3 A;  3RBT A;  4NXI A;  3VWX A;  2WB9 A;  3GRX A;  2FD3 A;  2HRK A;  1TKD B;  1LU4 A;  4IGJ A;  5GAN D;  2AYT A;  1Z7R A;  3U6V A;  3DIE A;  1XWA A;  1PL2 A;  1R7H A;  6GST A;  2X8C A;  1H75 A;  3LOR A;  4MZC A;  10GS A;  3ME7 A;  3QFB C;  4KCE A;  5G5E A;  2YWN A;  4OMV A;  1RQM A;  3J7Y b;  1TU7 A;  2R3X A;  3KP8 A;  1YEP A;  1H4O A;  1ERV A;  3HJM A;  3GUS A;  5ENU A;  5J41 A;  3W6G A;  1PA3 A;  3ZIV A;  4EIQ A;  1O7U A;  2OJL A;  3IHQ A;  4YAV A;  2O85 A;  1S3C A;  1XOA A;  3M9K A;  4EVM A;  5CNW A;  2L6D A;  2ALB A;  1SD9 A;  1GUM A;  3IAM 2;  3EC3 A;  1OKT A;  2XBQ A;  3APQ A;  2GLR A;  4L0U A;  2YOI A;  5KN1 A;  1U87 A;  2IMK A;  2VM1 A;  3TOU A;  1FVJ A;  2LEG A;  4BWS A;  2X8G A;  4EE0 A;  4I6X A;  2PU9 C;  1AC1 A;  2LST A;  3ZL5 A;  1VF3 A;  1Z6N A;  3L4N A;  5INY A;  1F3B A;  5AN1 A;  2X64 A;  3KMN A;  1V40 A;  2R6K A;  3EE2 A;  4TR4 A;  3BCK A;  4XCS A;  2I3Y A;  5DAK A;  3QOU A;  4CY8 A;  4AGS A;  3QAW A;  3ISO A;  4DVC A;  4G19 A;  3GUR A;  2ES7 A;  3KEB A;  1LJR A;  3C71 A;  4OWY A;  2LRN A;  20GS A;  2VL9 A;  3MIX A;  2OE1 A;  2CX3 A;  5ECR B;  3GKM A;  1YKC A;  3S9F A;  4FYC A;  1MTC A;  4D73 A;  3HYP A;  4N10 A;  2WZ9 A;  1U3A A;  2YV9 A;  1M0U A;  1XZO A;  3F6F A;  3SBC A;  4XTS A;  4TXO A;  2VLU A;  1SU9 A;  1SD8 A;  1T3B A;  2ON5 A;  2HZE A;  5J5N A;  1CQH A;  2GSR A;  5B7C A;  3C73 A;  2QA1 A;  2DJ1 A;  3HVS A;  4ML6 A;  4WBJ A;  2K8V A;  2C0G A;  2WGR A;  2NPB A;  3UEM A;  4EC0 A;  1K0O A;  3GH6 A;  2TRX A;  4BL7 A;  1WP0 A;  3CSI A;  1QUW A;  1YF1 A;  1X9M B;  1CQG A;  4YH2 A;  3WGD A;  4PXO A;  5H5S A;  4QL7 A;  1MD4 A;  1LBK A;  4K2X A;  2VOC A;  3P90 A;  2QGV A;  4KDY A;  3GL5 A;  4KH7 A;  5IMD A;  3HZ8 A;  2F8F A;  4K5S A;  4ZL8 A;  1JLW A;  1QXH A;  3CRT A;  3F4T A;  6GSU A;  4I5Q A;  1WJK A;  2DJJ A;  2CT6 A;  3LQ7 A;  1YQ1 A;  3IXR A;  1T1V A;  3LFL A;  3TB2 A;  1BAY A;  1GWC A;  4PQH A;  4MH3 A;  1B4P A;  5DAK B;  3C1S A;  3GMF A;  4ZB8 A;  3QMX A;  1JZO A;  1EP7 A;  1ERW A;  3FR3 A;  4HQZ A;  4ILF A;  4HS1 A;  4ULX A;  2R0C A;  2L5O A;  4Z2R A;  5DDL A;  4XHM A;  4GLT A;  2HSM A;  3U5R E;  3KD0 A;  4KGI A;  4MJA A;  3PIN A;  2QA2 A;  5G2Z A;  4HDE A;  3VWW A;  3HXS A;  5HFG A;  3GSS A;  4TR0 A;  1QQ2 A;  4CW9 A;  2HRA A;  2I4A A;  4IW9 A;  1JZW A;  5HR3 A;  1T4Z A;  3LEF A;  1O8X A;  3FY7 A;  1AW9 A;  1N8J A;  3BCI A;  5D8I A;  3TKS E;  1NHO A;  3WGE A;  3BJ5 A;  3TKS C;  2RM5 A;  2CAI A;  4JRR A;  3SWL A;  3CRU A;  1A0F A;  2X4A A;  3RDW A;  4F2I A;  1PKW A;  3MSZ A;  4ZBB A;  3VUR A;  4EDY A;  3NZN A;  1J0F A;  4FH8 A;  1BG5 A;  2XPE A;  2PWJ A;  4Q5R A;  5G1K A;  1PKZ A;  1N2A A;  3VK9 A;  3UMA A;  1TRS A;  18GS A;  3GN3 A;  1ERT A;  2IMD A;  3LYP A;  1GSF A;  4V2M A;  3LW9 A;  2FA4 A;  1F2E A;  2B5X A;  5JCW A;  1EP8 A;  5CRH A;  5ECK B;  4KW6 A;  4AJ8 A;  3G7Y A;  1TK0 B;  2DJ3 A;  3RAZ A;  2PN8 A;  1V2A A;  1FO5 A;  4GXZ A;  2VL3 A;  1GP1 A;  2OKA A;  1FVK A;  2MMZ A;  3ZML A;  1TP9 A;  17GS A;  2H71 A;  2K6V A;  3BOA A;  1FAA A;  5DJM A;  4WR4 A;  2FWE A;  3P2A A;  3FHK A;  2RLI A;  2DLX A;  1THO A;  1VF2 A;  4ZXG A;  1GTB A;  3DML A;  2HE3 A;  3F3R A;  4O32 A;  4JZQ A;  3UBL A;  2UZ8 A;  1B48 A;  5IM9 A;  2WFC A;  2GSQ A;  1OE8 A;  1HD2 A;  3TJJ A;  2X99 A;  4ZB9 A;  2Z9S A;  3KXO A;  3WYW A;  11GS A;  2H6Y A;  2L5L A;  2VCT A;  1FB6 A;  2VAF A;  4Z2U A;  1JLV A;  2VLV A;  3PR8 A;  4BWQ A;  4Q5Q A;  3TKR A;  2IMI A;  4OCF A;  1URM A;  4J57 E;  4K5R A;  2HSY A;  2GSS A;  3FZ9 A;  4TOP A;  5G30 A;  4HQS A;  3TJB A;  2FUG 2;  3TOT A;  4EIP A;  3TDG A;  4YQV A;  3DKS A;  1BYE A;  3RHC A;  4ML1 A;  2MBS A;  1GL8 A;  2C4J A;  1G7E A;  1J9B A;  1KBN A;  4YAP A;  2EIQ A;  1GSY A;  5BMU A;  2GQL A;  2N5F A;  2E2G A;  3Q18 A;  1SJ6 A;  4KDU A;  2IFQ A;  2C0F A;  4ECI A;  1U3I A;  3ZFL A;  1U6T A;  2V32 A;  3N5O A;  3UOM A;  4GCI A;  1R4W A;  2KHP A;  1OC3 A;  3GYK A;  4HI7 A;  5HQP A;  1EV4 A;  3FZA A;  3D4M A;  5ID2 A;  4LL1 B;  4V1A p;  1M7T A;  3EMX A;  4JBB A;  4PGT A;  3C8E A;  4O7H A;  5ELA A;  1YY7 A;  4MA9 A;  2FHE A;  1UC7 A;  2MBT A;  4EO3 A;  1PQN A;  1USB A;  1XW5 A;  3P8W A;  2PUK C;  5GSS A;  1PSQ A;  2YWI A;  3US3 A;  1EGO A;  4IQA A;  3TRX A;  1ERU A;  2DML A;  1GUH A;  2GZP A;  3DRN A;  4KDX A;  1GSS A;  5ABR A;  1TK8 B;  2CVB A;  1EOG A;  4NV2 A;  4I2U A;  2CVK A;  4CDO A;  3C1R A;  4TW5 A;  4AJ6 A;  2DBC A;  1XBS A;  3DD3 A;  1O8W A;  4NWY A;  2F3M A;  4GSS A;  1TI3 A;  3WD6 A;  3DWV A;  3ZTL A;  4IN0 A;  2J9H A;  2QKE A;  5ECQ B;  4POL A;  1GRX A;  2AHE A;  2VCQ A;  2X8H A;  4IKH A;  4V2N A;  5KOX A;  4YKG A;  1G0T A;  1WWJ A;  5ECP B;  4P3Y B;  3HA9 A;  3IRA A;  3LJR A;  3M3M A;  1SYX A;  1DUG A;  4K1F A;  2F51 A;  1F3A A;  3GST A;  1BJX A;  4MJE A;  2HYX A;  4KF9 A;  2C3N A;  1V9W A;  4BVX A;  1SKR B;  1FG4 A;  4PTS A;  5D9T A;  3GX0 A;  3M0F A;  3VWU A;  4LMW A;  2FY6 A;  3KJY A;  2O7K A;  5ID2 B;  3GX8 A;  3OR5 A;  1XIY A;  1SKW B;  2YV7 A;  2DKI A;  1RK4 A;  5IOX A;  2NTO A;  4RUV A;  4ZL9 A;  3BD2 A;  3H1N A;  3CYN A;  3ZIT A;  5HR2 A;  4IHU A;  4OD7 A;  1NSW A;  3ZLP A;  4ID0 A;  1TXX A;  4RI6 A;  1Y25 A;  5IO2 A;  1EV9 A;  5ECH B;  3D6I A;  3Q74 A;  5IOW A;  2V6K A;  3UIW A;  2K18 A;  4KA0 A;  4JR4 A;  2X49 A;  2YAN A;  3QDN A;  4PQ1 A;  2ON7 A;  3C7M A;  3W8J A;  1WPI A;  3PPU A;  2KP1 A;  2GST A;  1GTA A;  4OO4 A;  2V2G A;  4HZ4 A;  2IMF A;  1TK5 B;  1TU8 A;  3GV1 A;  4F0B A;  4MPG A;  2FWH A;  4TR3 A;  1NM3 A;  1O85 A;  4K2D A;  3GKX A;  5GAP D;  3TJG A;  2LRC A;  1QGV A;  1QFN A;  1JFU A;  2H0H A;  2M80 A;  3FR6 A;  3QCP A;  2O87 A;  2OBK A;  2A2R A;  4X4J A;  3HVX A;  4FO5 A;  3DGQ A;  2OE0 A;  4G2E A;  2ZNM A;  1OC9 A;  1GTI A;  1SL1 B;  1V57 A;  2LNT A;  5B8B A;  5DAL B;  2VCZ A;  3QAG A;  4L5O A;  4OCE A;  3TRP A;  1G7O A;  4HU9 A;  3HKR A;  2DIZ A;  4BA7 A;  4J56 E;  2VD0 A;  5IMF A;  3UL3 A;  4BVX B;  2HFD A;  3CSH A;  1SJZ A;  3A2V A;  4TR1 B;  3F0I A;  1QMV A;  2FA8 A;  4BVY A;  2O89 A;  4L8E A;  1Q98 A;  2GQM A;  3LYK A;  5JCU A;  1SK2 A;  5E59 A;  1SL0 B;  5AIS A;  1R26 A;  1XOB A;  4GST A;  4IBP A;  2OAC A;  4KB3 A;  1EOH A;  2LJK A;  3TUE A;  5IPH A;  4HEA 2;  1IYI A;  5B6M A;  5JWO B;  2LJR A;  1ZL9 A;  1BQ7 A;  3IK7 A;  3KM6 A;  2BJX A;  3AY8 A;  2JZR A;  5LCZ A;  2LNS A;  3G9B A;  1TRW A;  5J9B A;  2H30 A;  1XWG A;  3ZVJ D;  4FQU A;  2YWO A;  1M2A A;  3WT2 A;  1YKA A;  5CRD A;  4F03 A;  4G0L A;  4WF5 A;  3D21 A;  1XCC A;  1C72 A;  2XBI A;  2JZT A;  1GLQ A;  4XRA A;  3UAP A;  4I97 A;  3L0H A;  1GUL A;  5AIV A;  3CBU A;  4O5Q A;  4WF4 A;  2P5R A;  1B8X A;  4HJM A;  1EWX A;  2MZC A;  2ZUP A;  5LD0 A;  3GH9 A;  1SL2 B;  2VD1 A;  3GA4 A;  2C3Q A;  3FZ4 A;  3IPZ A;  1MDK A;  4K8M A;  3L78 A;  3Q19 A;  1TI1 A;  1M2D A;  1OKD A;  2XPD A;  4N30 A;  2H75 A;  4ZIL A;  1TTZ A;  3TKQ A;  2VL2 A;  4GTU A;  4WBR D;  4IQ1 A;  2N5A A;  5EL8 A;  2H70 A;  3WGX A;  4KND A;  1YEX A;  2REM A;  3MYD A;  3IOS A;  1OVN A;  3KH9 A;  5F06 A;  1TW9 A;  2H74 A;  5FHI A;  4DSR A;  1O6J A;  2HRN A;  4IVF A;  3HVV A;  3TCO A;  2VLT A;  2RM6 A;  2TIR A;  2OBI A;  5AGY A;  2L6C A;  2E7P A;  2P31 A;  3EU4 A;  5IQY A;  3RHB A;  4MMM A;  2R0G A;  4KAE A;  2A2P A;  16GS A;  4D73 B;  4EF0 A;  2V1M A;  1PX6 A;  2I81 A;  4YKF A;  5ECN B;  1X9S B;  3EPT A;  5F05 A;  2OE3 A;  4ZB6 A;  3TKP A;  2C0E A;  3LG6 A;  2KOK A;  4IS0 A;  4TXO B;  1K3Y A;  2G0F A;  3GTU A;  4XS6 A;  4YQM A;  2HZE B;  4NMU A;  1T4Y A;  2VCW A;  3ZFB A;  2YCD A;  4KX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...