2LRTA

Solution structure of the uncharacterized thioredoxin-like protein bvu_1432 from bacteroides vulgatus
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
152
structure length
152
Chain Sequence
MSLEIPEDKIKEASIIDIQLKDLKGNTRSLTDLKGKVVLIDFTVYNNAMSAAHNLALRELYNKYASQGFEIYQISLDGDEHFWKTSADNLPWVCVRDANGAYSSYISLYNVTNLPSVFLVNRNNELSARGENIKDLDEAIKKLLEGHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Uncharacterized protein
publication title Solution structure of the uncharacterized thioredoxin-like protein BVU_1432 from Bacteroides vulgatus
rcsb
source organism Bacteroides vulgatus
total genus 45
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2012-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13905 Thioredoxin_8 Thioredoxin-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2lrtA00
1KNGA 1HYUA 5B8BA 1RQMA 5FHIA 4ZL9A 4HI7A 2LRCA 4TR1B 1G0TA 3SWLA 1MDJA 4MDCA 1B4PA 2H8LA 4BWQA 2LSTA 4L5OA 3RDWA 3GTUA 3TKRA 1IYHA 4IP6A 4RI6A 1SJ6A 3CRUA 2MMZA 4GQCA 1PX7A 2L5OA 3WYWA 1Z6MA 3BCIA 3C1RA 2YCDA 4X1UA 4JBBA 1OKDA 4K9ZA 2GZYA 2CZ3A 5A4UA 3NIVA 3IHQA 3VWWA 4ECCA 5IPGA 4ECBA 1EGRA 2VLVA 3VI5A 3M0FA 3NOFA 3KXOA 5AIXA 1O8WA 2KUCA 1RW1A 4PXOA 2V1MA 2XHFA 1FOVA 4AF2A 1X9SB 1PKZA 1Z3EA 1DBYA 1HNAA 1QXHA 1H75A 2F51A 5IMDA 2GVPA 1X5EA 4PQ1A 1H4OA 3GNJA 1EZKA 1X5DA 4WXTA 3ED3A 5A4WA 4L8EA 4WEYA 3ZIJA 1JZOA 3H79A 4F2IA 2E0QA 1GRXA 2GQKA 2HI7A 12GSA 2LJRA 2I3YA 4V1Ap 2I9HA 2WGRA 3EMXA 3CSJA 1WPIA 3P7XA 5ECRB 5ELGA 4I6XA 3O3TA 1ZYEA 2K18A 1OE7A 9GSSA 2R3XA 2P0GA 2GTUA 2NVLA 3LYKA 1SD9A 2RUEA 5G5FA 5IOWA 1PA3A 3FZ9A 1WE0A 4BA7A 2CAQA 3HZ8A 3ISOA 3F4RA 4KAEA 2RM5A 4MZWA 5D9XA 3M3MA 4K7OA 5CRWA 1LBKA 2H19A 1CQGA 5DAKB 3W6GA 2VAFA 2H01A 3QR6A 1ZYQB 4HJ2A 1NSWA 4PNGA 1T7PB 2GQMA 2HXKA 3TUEA 4ACSA 3J7Yk 4AJ8A 1J08A 4YQVA 2N5BA 6GSTA 1PX6A 1ZL9A 2LNTA 1AW9A 3QDNA 3VWVA 1XWAA 2DLXA 2LJKA 3HZ4A 3I6AA 4ZBDA 1GP1A 4TR0A 4AJ6A 5EPFA 3HVVA 2GLRA 3QAGA 3LXZA 4OO5A 4DSSB 2R37A 2VCQA 3F4SA 2IIYA 3KH9A 3KD0A 5CP1A 2X64A 2X8HA 2GSSA 2HLSA 1TRUA 2YZUA 4JR6A 3F6FA 2REMA 4ZIJA 1YF0A 5KN1A 1A8LA 2H76A 1B9YC 4TN8A 2ZCTA 5KN0A 1U87A 3HDCA 2F9SA 2A4VA 1V2AA 2V41A 1XXUA 2R6KA 3FR6A 1SK2A 3ZVJD 1DE1A 2RLIA 2B1KA 2IN3A 2V2GA 5JCGA 2O87A 3Q74A 2IWTA 5KEJA 4MF5A 2N5AA 3M9KA 3PINA 3EYTA 1AAZA 3F9UA 4POKA 1GSFA 5IPHA 4I97A 1VF2A 4EKZA 3A2XA 4GSNA 3A5WA 3UBLA 1Y6EA 4K7NA 3I43A 1TXXA 3D22A 1AQXA 1JLVA 3RHCA 2XPDA 5IMVA 5B8AA 2R4VA 1S3CA 1RK4A 5GAND 1YEPA 1XW9A 4BWSA 8GSSA 1ZCPA 1QUWA 4EL1A 2OKAA 1GSYA 2B1LA 1A2MA 3HKRA 3FR9A 1XCCA 3GRXA 2DJ1A 1SD8A 1GH2A 1K0DA 4MF6A 4MA9A 4RQRA 3ZVJA 3TKSE 5J9CA 1GNWA 5ECIB 4KX4A 2H1BA 20GSA 1HNBA 4KUNA 4KSOA 3DYRA 3MDKA 2J23A 5DDLA 1A23A 5J41A 2OJLA 4TR1A 2H71A 4ZB6A 5HFIA 1YF1A 2O8VB 5DALB 3IDVA 1FB6A 5C00A 4DEJA 3EU4A 1ERTA 5G2ZA 2DJ0A 1B8XA 5D9VA 2JL4A 3M9JA 1ACVA 3KIJA 1AIUA 5A4VA 4MPFA 3D5JA 1MDKA 4NAXA 4EF0A 2YJ7A 1XIYA 1V98A 5EY6A 2XBQA 2TRCP 1FW1A 3U5RE 5F05A 4K7IA 3DD3A 1M9AA 5CRHA 1GSQA 4X0XA 3H93A 5G1KA 1OVNA 3HCZA 2HT9A 5IMFA 2CV4A 1SK0A 3F4TA 2FY6A 5H5SA 1XFLA 2ALBA 1FVJA 1TRSA 3L9VA 2WS2A 2VLUA 2OADA 2BTOT 2FNOA 4TKYA 3DIEA 3RPPA 1ON4A 4OD7A 3WGDA 4DSRA 2VOCA 1BEDA 2C80A 6GSYA 3APQA 3KZQA 4MF7A 3ME7A 5HR0A 2LS5A 1GTIA 3RBTA 3IAM2 3D6IA 3WGEA 4NV2A 2GT6A 4GWRA 4OO4A 4XHMA 1E2YA 2CVBA 4EDZA 4ECIA 1K3YA 5D73A 1XWGA 3OR5A 1WWJA 3W8SA 3F6DA 2H74A 4HU9A 5IO0A 2OE3A 5L71A 1YKCA 5GZZB 1R4WA 2VL2C 4X43A 2AB6A 4HQSA 1V57A 2YPMA 3CTGA 5A5KA 4RQXA 1J9BA 2M46A 1T8EB 4JR4A 5F07A 1BQ7A 3VWUA 2N5FA 2AYTA 3KJYA 4HZ2A 1A8YA 4ZILA 3DGQA 4JZQA 2CQ9A 3CTFA 3LGCA 3TKSA 4MABA 1EOGA 4JEDA 1PRXA 4OMVA 4V2NA 4ILFA 1GNEA 1KTEA 1F3BA 1O81A 3TKQA 5DVBA 3UIWA 3LSZA 5DAKA 1Q98A 3FHKA 2OA7A 4LMVA 2F3MA 2VCTA 3VPQA 2WDUA 2GZPA 2MBTA 1GUMA 3V1WA 4N30A 4NHWA 5ECPB 1O8XA 3LFLA 2C3NA 2KLXA 4FYBA 2JU5A 2OBIA 3QPMA 2VCXA 2H6ZA 5ECNB 2LEGA 3RPNA 4HS1A 1Y25A 3LXTA 4ZB9A 1BJXA 2QSIA 3ZMLA 4ML1A 4HQZA 2GT5A 2RM6A 2O7KA 4K8MA 5CREA 2A2SA 2C0EA 2HRFA 4DSSA 3UBKA 1TK5B 2DIYA 4GCIA 3VWXA 2FD3A 1PGTA 3U6VA 4IKHA 3A2WA 1M2AA 3KEBA 3GSSA 2G2QA 2VD1A 3BBYA 4IS0A 5HR3A 5ELAA 3EWLA 1DUGA 4XS4B 4Z7XA 3VI7A 5HR2A 3TCOA 4MK3A 4POMA 5GSSA 2G0FA 2B7JA 4CW9A 4EC0A 4Q5FA 3FW2A 4L5LA 1M9BA 2JZSA 2LRTA 3VFIA 1SK1A 3LYPA 4I8BA 1GWCA 1HD2A 2H72A 2K8VA 3FYGA 5C04A 6GSXA 2PUKC 4MP4A 3DEXA 1N2AA 3RAZA 4MH3A 1ST9A 5D9TA 4KSMA 2H0GA 2XPEA 3HD5A 1URMA 3APSA 5G5EA 1JZWA 2OBKA 2H75A 1YQ1A 2DJJA 3RHBA 2LQOA 5ECOB 1XBSA 1U3IA 2C3TA 2BJXA 4LA1A 2RUFA 17GSA 2DJKA 4TXOB 1TDIA 1PKWA 4H86A 1XWBA 1FVKA 1MD3A 2CZ2A 1MEKA 2IMIA 4LL1B 1B48A 13GSA 2H66A 5CNWA 4KGIA 2LRNA 3GH9A 4NV5A 4V1Ag 4NPBA 1X5CA 2YWIA 4NHZA 1CQHA 5B6NA 4GSSA 5E4WA 3WGXA 1X0RA 1PQNA 5ENUA 1FO5A 1K0MA 5CO3A 1ZZYA 4OFMA 1TU7A 3FR3A 1TRVA 2R5GA 2PVOC 1WIKA 1GL8A 4YQMA 2VUPA 5KN2A 5DALA 1W4VA 1ABAA 1WMJA 3GHAA 3GFKA 2VD0A 4AGSA 4O5RA 1GLPA 1OAZA 3QAVA 1ZMAA 4QL9A 4L0WA 1VGLA 1YKAA 3IOSA 2L57A 1ERUA 3UMAA 4KCAA 2PBJA 5IQYA 2MMOA 2GQLA 2HSYA 2CVDA 1EP8A 1TRWA 1U6TA 4HOJA 2EIRA 4MZCA 4WBRD 3GA4A 5D8IA 3LG6A 4KW6A 1PL1A 1YY7A 4K6XA 5F8BA 1N8JA 4FYUA 1XZOA 5EVOA 2I1UA 1BAYA 1E6BA 2LTKA 3I9V2 5LNKe 3FY7A 2YWOA 3LEFA 2IMEA 3IR4A 4N10A 1I5GA 4K0GA 2L6CA 2HE3A 4Q5NA 3KTLA 4G2EA 3MWHA 1EOHA 3C8EA 3C73A 3J7Yb 4ZB8A 4O7HA 3QAWA 2OACA 5D93A 3GKXA 5DQYA 1O6JA 5FT3A 1VF3A 4HDEA 4YQUA 2FA8A 2EIQA 1JZDA 2B6MA 1FAAA 2H6YA 3UOMA 4V2MA 16GSA 6GSUA 3CXGA 2P5RA 2HSHA 2YNXA 5ECLB 2LQQA 1VF4A 1R26A 5DCHA 1YDKA 5ID2B 4MMMA 3D21A 4MJAA 3QFAC 1XVWA 3IXRA 1VRSD 3H1NA 3ERFA 2H1DA 1MD4A 1WRYA 2VM2A 3L0HA 3EU3A 2C0GA 4GLTA 4O92A 2FHEA 2M72A 3ZLPA 3US3A 4IVFA 1A0FA 4GF0A 5CYYA 1UA5A 3DKSA 3HJMA 10GSA 5JWQB 2X8CA 3EMPA 6GSSA 4CDOA 4ID0A 3DVXA 4TR4A 2F8FA 4RUVA 1USBA 4RI7A 4IELA 4Q5RA 1V40A 2I81A 4XRAA 1EV9A 3IE3A 4MLYA 4XS6A 4TR3A 3IRAA 2C8UA 4KH7A 2JSYA 1UN2A 4OWYA 4XCSA 3APOA 2GS3A 1ML6A 6GSVA 4OCFA 5IIZA 1F3AA 1M7TA 4WETA 2KP2A 2C0FA 4GRFA 1JLWA 4OFNA 2MYGA 3FZAA 5B6MA 2NPBA 4HU7A 1SYRA 3UEMA 2DMLA 2FWFA 1TI3A 4EUYA 3ZITA 3IPZA 2HNLA 1EEJA 1JFUA 1TW9A 2DC5A 2FLSA 3L9SA 2LNSA 4XS1A 6GSWA 1A0RP 5IMAA 5IM9A 1SKRB 2OE1A 3BCKA 4KNDA 5IO2A 3EC3A 1OC9B 4FO5A 3W8JA 4IHUA 4XS4A 3GV1A 1XW5A 1A24A 2HYXA 2PMTA 1TK0B 3TRPA 3QMXA 3TJGA 1GSUA 3GMFA 3HXSA 1V58A 4HJMA 4EVMA 2WB9A 5ECKB 3ME8A 5G1LA 3ZFBA 1O7UA 2H30A 2C0DA 2H0HA 3C7MA 3M8NA 1T00A 1U3AA 2V6OA 1WOUA 4XRDA 2YANA 3ZREA 2IMFA 3QCPA 4ULXA 1GTAA 5DCGA 3IA1A 2R2JA 2FWEA 5HFKA 1SL0B 4PX1A 3ZL5A 3O6TA 1I9DA 2AJQB 3PH9A 1BG5A 4TXOA 1KEBA 3S9FA 2E2GA 4FIWA 1AXDA 5GSTA 3MAKA 3DWVA 1K3OA 4F0CA 4ZBAA 4JE1A 2E2MA 1X9WB 2FUG2 2AUVA 2ZUPA 2LUSA 3EE2A 2LKUA 1G6WA 1TOFA 4KDXA 4XIHA 3NZNA 4KDYA 11GSA 1XOAA 1EP7A 3HA9A 3H4KA 3TRQA 2Z9SA 2YJHA 2GSQA 4IQ1A 3ZFLA 2K6VA 5AIVA 4IJ3A 5J9BA 3FKFA 1K0CA 3ZMKA 2DIZA 2B5EA 2AV4A 4YH2A 2VL9A 1HQOA 2YP6A 2CAIA 2HZEB 2PERA 1GUKA 3HVXA 4MH2A 3GN3A 3TKPA 2PGTA 4ZL8A 5CRGA 4ZXGA 2TIRA 1THOA 4F9ZA 4F82A 1X9MB 1ERVA 4MPGA 1EGOA 2CX3A 3GKKA 1NHOA 3IBHA 2QKEA 1A2LA 1PD21 2A2RA 1TJDA 1PSQA 4TW5A 3ZIVA 3CBUA 2HFDA 2X99A 3G7IA 3KCMA 5JWOB 1G6YA 3F0IA 4PQIA 4D73B 5INYA 4XTSA 3GSTA 3TOUA 7GSSA 2GGTA 1TKDB 3MNGA 4TOPA 1NW2A 2JACA 3PGTA 4WR5A 1MDIA 3LQ7A 4J2FA 2MZCA 5KN3A 4J57E 4BVXA 5EL8A 3C1SA 3F3QA 2L6DA 3L4NA 4L0UA 2HZFA 4I2TA 3CSIA 2K8SA 5ECQB 4KB3A 4E8EA 1HNCA 1XWKA 3KH7A 3TGZA 4KDUA 5H5QA 4V2LA 2FCHA 3UL3A 3D4MA 2ON5A 4OCEA 4Q5QA 4TXVA 3IV4A 2DSAA 2YV9A 2YWMA 1ILOA 3IC4A 4K2DA 2FWHA 4J56E 3ZYWA 5GAPD 3CRTA 2F8AA 3TKSC 4PQHA 4EXJA 4ZL7A 2ZNMA 3GL3A 1G7EA 5ID2A 4EDYA 3TJKA 4BVYA 3LWAA 4G19A 4N0VA 3Q19A 1FG4A 3G9BA 2VO4A 3FK8A 3ZZXA 1QMVA 2PVQA 4I5QA 3QFBC 3BD2A 2L5LA 1F37A 1GLQA 1YEXA 4N11A 2AAWA 3DRNA 1UVZA 3F3RA 1B4QA 4EO3A 4LL4B 1ERWA 5AISA 3KMNA 3D4TA 3BOAA 2WRTA 2OE0A 2O85A 2ON7A 5F06A 2MBSA 1EEMA 1UC7A 1NM3A 2IFQB 4PNFA 3F63A 1TU8A 1S3DA 4PURA 1XOBA 4IQAA 2GSTA 3KP8A 3GIXA 3PR8A 4CHSA 2B3SA 4DSQA 2YN1A 3HJPA 1EV4A 2ES7A 3QOUA 2L59A 2H0IA 2D2ZA 2IPAA 2JADA 1GUHA 3GH6A 1VF1A 5F0GA 3IK9A 1Z6NA 2CX4A 4YAVA 2XBIA 5LCZA 1GSSA 3GURA 4GSTA 1XVQA 4BPYA 1Z5YE 1O73A 4POBA 4IW9A 2CT6A 1R5PA 4MZBA 1IYIA 3O76A 14GSA 5JWRB 2NDOA 3CSHA 3GL5A 4LMWA 2VLTA 1K0AA 1SL1B 1SKSB 1K0NA 1FB0A 4F0BA 2L4QA 1Z7PA 1KBNA 2WULA 5IOXA 5E59A 1Z9HA 3AY8A 3ZTLA 18GSA 1LJRA 1OC9A 19GSA 2MMNA 4PGTA 2C1YA 3CMIA 3LORA 1FHEA 4NXIA 2IMKA 1F2EA 5COHA 1GSDA 3L9UA 4F03A 3P2AA 4ZBBA 2CA8A 3E0UA 3EINA 1OYJA 3JCML 1TP9A 4IJIA 5ECMB 4O32A 3HVSA 3UVTA 1O85A 2FWGA 5JCWA 2PPTA 4HZ4A 1XWCA 4NMUA 1SL2B 3HHVA 3F8UA 4FH8A 2KP1A 3L78A 2JSZA 1J0FA 4GTUA 2KOKA 3ERGA 3TDGA 2GSRA 5HR1A 2WCIA 3G7YA 4HEA2 3EURA 4IN0A 2H73A 4MJBA 2QC7A 4IBPA 1R7HA 2IL3A 3DXBA 2AHEA 5J4UA 1K3LA 3GTUB 2EIOA 1THXA 4NWYA 2P5QA 4QL7A 5CAXA 1XPVA 2KHPA 1B9XC 4G9HA 1AUCA 5ECHB 2WZ9A 1PMTA 4K1FA 4PUFC 1NHYA 2FGXA 1C72A 3LJRA 1F6MC 3N5OA 2IJYA 1A2JA 2H1AA 2V32A 3D0ZA 1W89A 2DBCA 3R2QA 2LV3A 4ISDA 2X8GA 2B7KA 3KMOA 4TVEA 4WR4A 3G7JA 5B7CA 2HZEA 4IP1A 1OC8A 5J5NA 1YZXA 3DVWA 1Q4JA 4JU5A 4DVCA 1T4ZA 1K0BA 3TB2A 5D9WA 2DJ3A 5D96A 2NTOA 1PN9A 2VIMA 2K9FA 1K0OA 4GXZA 2C4JA 1SENA 1GTUA 3C71A 4MJCA 4AJ7A 2XC2A 5H5RA 3GUSA 3FRCA 3GYKA 3A3TA 3GX0A 2BMXA 1U88A 4D73A 4POLA 5DJLA 1M2BA 4LLRA 3MSZA 2E7PA 3N9JA 22GSA 5AGYA 1AC1A 3FZ5A 4FYCA 2VL3A 2B5YA 3TOTA 5IMCA 1SKWB 1QFNA 2PWJA 5G30A 1ZOFA 1M2DA 2EC4A 2WFCA 5HQPA 3P90A 2HRNA 2PN8A 2JZTA 3GKMA 3ERWA 1PL2A 2DMMA 2J9HA 2CVKA 3UVHA 5ABRA 1LU4A 1DSBA 1M99A 3HYPA 1TTZA 3VPTA 5DQSA 4MJEA 4EE0A 2B5XA 3BJ5A 4ML6A 5CRDA 3FEUA 2VL2A 1OKTA 1T1VA 2QGVA 4WKWA 4IGJA 2GDRA 1YJ6A 2PU9C 3SBCA 3UARA 3A2VA 1BYEA 1QK8A 2H6XA 1F9MA 1AQVA 2H1GA 4TRXA 3H8QA 5G31A 4BL7A 2VCVA 1ZGNA 1MTCA 3GKNA 1OE8A 5ECSA 3I69A 1SJIA 1EWXA 3UJ1A 3Q6OA 3UAPA 2IFQA 5IMZA 3Q18A 3M1GA 3EVIA 1T4YA 1JZRA 2I4AA 2GZZA 5JCUA 3KGKA 1XW6A 3ZRDA 4YAPA 1OC3A 2L4CA 3WT2A 2MMAA 3TJJA 4N0ZA 1QQ2A 1SJZA 4HUAA 3VLNA 1DE2A 1SYXA 3TJBA 3IK7A 2TRXA 3WD6A 3CYNA 2VM1A 2M80A 4OFTA 2YOIA 4QQ7A 2IMDA 1WP0A 1G7OA 1Z7RA 5LD0A 3TJFA 2JZRA 3VURA 1TK8B 4P3YB 3P8WA 4JRRA 1AQWA 5DJMA 2H70A 3WT1A 1V9WA 3K8NA 2O89A 1R5AA 3KP9A 1GULA 4E8HA 3VK9A 1T3BA 5AN1A 3QD9A 2C3QA 2VCZA 3IAS2 5HFGA 4MCUA 3KTBA 3HY2A 3FZ4A 2YV7A 4ECJA 1QGVA 2WJUA 3HJOA 4WBJA 2V6KA 3GX8A 1TI1A 2NBSA 4KCEA 5J3RA 2YZHA 1GTBA 1S3AA 2YWNA 2RIIA 1WJKA 2DJ2A 4K0NA 1M0UA 2LJAA 1BX9A 3DMLA 3TRXA 3KM6A 3E9JB 1GSEA 4WF5A 2VCWA 4I2UA 2FA4A 4KE3A 5FWGA 1JHBA 4GQFA 4G10A 4KA0A 3E3EA 2P31A 1SU9A 4PUAA 5DBQA 4WF4A
chains in the Genus database with same CATH superfamily
4ICYA 1KNGA 1HYUA 5B8BA 1RQMA 5FHIA 4ZL9A 4HI7A 2LRCA 4TR1B 1G0TA 3SWLA 1MDJA 4MDCA 1B4PA 2H8LA 4BWQA 2LSTA 4L5OA 3RDWA 3GTUA 3TKRA 1IYHA 4IP6A 4RI6A 1SJ6A 3CRUA 2MMZA 1ZYPA 4GQCA 1PX7A 2L5OA 3WYWA 1Z6MA 3BCIA 2X4AA 2DKIA 3C1RA 2YCDA 4X1UA 4JBBA 1OKDA 1ZYNA 4K9ZA 2GZYA 2CZ3A 5A4UA 3NIVA 3IHQA 3VWWA 4ECCA 5IPGA 4ECBA 1EGRA 2VLVA 3VI5A 3M0FA 3NOFA 3KXOA 4MNNA 5AIXA 1O8WA 2KUCA 1RW1A 4PXOA 2V1MA 2XHFA 1FOVA 4AF2A 1X9SB 1PKZA 1Z3EA 1DBYA 1HNAA 1QXHA 1H75A 2F51A 5IMDA 2GVPA 1X5EA 4PQ1A 1H4OA 3GNJA 1EZKA 1X5DA 4WXTA 2R0PA 3ED3A 5A4WA 4L8EA 4WEYA 3ZIJA 1JZOA 3H79A 4F2IA 2E0QA 1GRXA 2GQKA 2HI7A 12GSA 2LJRA 2I3YA 4V1Ap 2I9HA 2WGRA 3EMXA 3CSJA 1WPIA 3P7XA 5ECRB 5ELGA 4I6XA 3O3TA 1ZYEA 2K18A 1OE7A 9GSSA 2R3XA 2P0GA 2GTUA 2NVLA 3LYKA 1SD9A 2RUEA 5G5FA 5IOWA 1PA3A 3FZ9A 1WE0A 4BA7A 2CAQA 3HZ8A 1S3RA 3ISOA 3F4RA 4KAEA 2RM5A 4MZWA 5D9XA 3M3MA 4K7OA 5CRWA 3FMWA 1LBKA 2H19A 1CQGA 1PN0A 5DAKB 3W6GA 2VAFA 2H01A 3QR6A 1ZYQB 4HJ2A 1NSWA 4PNGA 1T7PB 2GQMA 2HXKA 3TUEA 4ACSA 3J7Yk 4AJ8A 1J08A 4YQVA 2N5BA 6GSTA 1PX6A 1ZL9A 2LNTA 1AW9A 3QDNA 3VWVA 1XWAA 2DLXA 2LJKA 3HZ4A 3I6AA 4ZBDA 1GP1A 4TR0A 4AJ6A 5EPFA 3HVVA 2GLRA 3QAGA 3LXZA 4OO5A 4DSSB 2R37A 2VCQA 3F4SA 2IIYA 3KH9A 3KD0A 5CP1A 2X64A 2R0CA 2X8HA 2GSSA 2HLSA 1TRUA 2YZUA 4JR6A 3F6FA 2REMA 4ZIJA 1YF0A 5KN1A 1A8LA 2H76A 1B9YC 4TN8A 2ZCTA 5KN0A 1U87A 3HDCA 2F9SA 2A4VA 1V2AA 2V41A 1XXUA 2R6KA 3FR6A 1SK2A 3ZVJD 1DE1A 2RLIA 2B1KA 2IN3A 2V2GA 5JCGA 2O87A 3Q74A 2IWTA 5KEJA 4MF5A 2N5AA 2QA2A 3M9KA 3PINA 3EYTA 1AAZA 3F9UA 4POKA 1GSFA 5IPHA 4I97A 1VF2A 4EKZA 3A2XA 4GSNA 3A5WA 3UBLA 1Y6EA 4K7NA 3I43A 1TXXA 3D22A 1AQXA 1JLVA 3RHCA 2XPDA 1PFOA 5IMVA 5B8AA 2R4VA 1S3CA 1RK4A 5GAND 1YEPA 1XW9A 4BWSA 8GSSA 1ZCPA 1QUWA 4EL1A 4K2XA 2OKAA 1GSYA 2B1LA 1A2MA 3HKRA 3FR9A 1XCCA 3GRXA 2DJ1A 1SD8A 1GH2A 1K0DA 4MF6A 4MA9A 4RQRA 3ZVJA 3TKSE 5J9CA 1GNWA 5ECIB 4KX4A 2H1BA 20GSA 1HNBA 4KUNA 4KSOA 3DYRA 3MDKA 2J23A 5DDLA 1A23A 5J41A 2OJLA 4TR1A 2H71A 4ZB6A 5HFIA 1YF1A 2O8VB 5DALB 3IDVA 1FB6A 5C00A 4DEJA 3EU4A 1ERTA 5G2ZA 2DJ0A 1B8XA 5D9VA 2JL4A 3M9JA 1ACVA 3KIJA 1XG8A 1AIUA 5A4VA 4MPFA 3D5JA 1MDKA 4NAXA 4EF0A 2YJ7A 1XIYA 1V98A 5EY6A 2XBQA 2TRCP 1FW1A 3MYDA 3U5RE 5F05A 4K7IA 3DD3A 1M9AA 5CRHA 1GSQA 4X0XA 3H93A 3HVNA 5G1KA 1OVNA 3HCZA 2HT9A 5IMFA 2CV4A 1SK0A 3F4TA 3R3EA 2FY6A 5H5SA 1XFLA 4PTSA 2ALBA 1FVJA 1TRSA 3L9VA 2WS2A 2VLUA 2OADA 2BTOT 2FNOA 4TKYA 3DIEA 3RPPA 1M3JA 4FQUA 1ON4A 4OD7A 3WGDA 4DSRA 2VOCA 1BEDA 2C80A 6GSYA 3APQA 3KZQA 4MF7A 3ME7A 5HR0A 2LS5A 1GTIA 3RBTA 3IAM2 3D6IA 3WGEA 4NV2A 2GT6A 4GWRA 4OO4A 2HRAA 4XHMA 1E2YA 2CVBA 4EDZA 4ECIA 1K3YA 5D73A 1XWGA 3OR5A 1WWJA 3W8SA 3F6DA 2H74A 4HU9A 5IO0A 2OE3A 5L71A 1YKCA 5GZZB 1R4WA 2VL2C 4X43A 2AB6A 4HQSA 1V57A 2YPMA 3CTGA 5A5KA 4RQXA 1J9BA 2M46A 1T8EB 4JR4A 5F07A 1BQ7A 3VWUA 2N5FA 2AYTA 3KJYA 4HZ2A 1A8YA 4ZILA 3DGQA 4JZQA 2CQ9A 3CTFA 3LGCA 3TKSA 4MABA 1EOGA 4JEDA 1PRXA 4OMVA 4V2NA 4ILFA 1GNEA 1KTEA 1F3BA 1O81A 3TKQA 5DVBA 3UIWA 3LSZA 5DAKA 1Q98A 3FHKA 3CQFA 2OA7A 4LMVA 2F3MA 2VCTA 3VPQA 2WDUA 2GZPA 2MBTA 1GUMA 3V1WA 4N30A 4NHWA 5ECPB 1O8XA 3LFLA 2C3NA 2KLXA 4FYBA 2JU5A 2OBIA 3QPMA 2VCXA 2H6ZA 5ECNB 2LEGA 3RPNA 4HS1A 1Y25A 3LXTA 4ZB9A 1BJXA 2QSIA 3ZMLA 4ML1A 4HQZA 2GT5A 2RM6A 2O7KA 4K8MA 5CREA 2A2SA 2C0EA 2HRFA 4DSSA 3UBKA 1TK5B 2DIYA 4GCIA 3VWXA 2FD3A 1PGTA 3U6VA 4IKHA 3A2WA 1M2AA 3KEBA 3GSSA 2G2QA 2VD1A 3BBYA 4IS0A 5HR3A 5ELAA 3EWLA 1DUGA 4XS4B 4Z7XA 3VI7A 5HR2A 3TCOA 4MK3A 4POMA 5GSSA 2G0FA 2B7JA 4CW9A 4EC0A 4Q5FA 3FW2A 4L5LA 1M9BA 2JZSA 2LRTA 3VFIA 1SK1A 3LYPA 4I8BA 1GWCA 1HD2A 2H72A 2K8VA 3FYGA 5C04A 6GSXA 2PUKC 4MP4A 3DEXA 1N2AA 3RAZA 4MH3A 1ST9A 5D9TA 4KSMA 2H0GA 2XPEA 3HD5A 2HSMA 1URMA 3APSA 5G5EA 1JZWA 2OBKA 5BRTA 2H75A 1YQ1A 2DJJA 3RHBA 2LQOA 5ECOB 1XBSA 1U3IA 2C3TA 2BJXA 4LA1A 2RUFA 17GSA 2DJKA 4TXOB 1TDIA 1PKWA 4H86A 1XWBA 1FVKA 1MD3A 2CZ2A 1MEKA 2IMIA 4LL1B 1B48A 13GSA 2H66A 5CNWA 4KGIA 2LRNA 3GH9A 4NV5A 4V1Ag 4NPBA 1X5CA 2YWIA 4NHZA 1CQHA 5B6NA 4GSSA 5E4WA 3WGXA 1X0RA 1PQNA 5ENUA 1FO5A 1K0MA 5CO3A 1ZZYA 4OFMA 1TU7A 3FR3A 1TRVA 2R5GA 2PVOC 1WIKA 1GL8A 4YQMA 2VUPA 5KN2A 5DALA 1W4VA 1ABAA 1WMJA 3GHAA 3GFKA 2VD0A 4AGSA 4O5RA 1GLPA 1OAZA 3QAVA 1ZMAA 4QL9A 4L0WA 1VGLA 1YKAA 3IOSA 2L57A 1ERUA 3UMAA 4KCAA 2PBJA 5IQYA 2MMOA 2GQLA 2HSYA 2CVDA 1EP8A 2UZ8A 1TRWA 1U6TA 4HOJA 2EIRA 4MZCA 4WBRD 3GA4A 5D8IA 3LG6A 4KW6A 1PL1A 1YY7A 3PPUA 4K6XA 5F8BA 1N8JA 4FYUA 1XZOA 5EVOA 2I1UA 1BAYA 1E6BA 2LTKA 3I9V2 5LNKe 3FY7A 2YWOA 3LEFA 2IMEA 3IR4A 4N10A 4BVXB 1I5GA 4K0GA 2L6CA 2HE3A 4Q5NA 3KTLA 4G2EA 3MWHA 1EOHA 3C8EA 3C73A 3J7Yb 4ZB8A 4O7HA 3QAWA 2OACA 5D93A 3GKXA 5DQYA 1O6JA 5FT3A 1VF3A 4HDEA 4YQUA 2FA8A 2EIQA 1JZDA 2B6MA 1FAAA 2H6YA 3UOMA 4V2MA 16GSA 6GSUA 2DKHA 3CXGA 2P5RA 2HSHA 2YNXA 5ECLB 2LQQA 1VF4A 1R26A 5DCHA 1YDKA 5ID2B 4MMMA 4BVYB 3D21A 4MJAA 3QFAC 1XVWA 3IXRA 1VRSD 3H1NA 3ERFA 2H1DA 1FOHA 1MD4A 4EIQA 1WRYA 2VM2A 3L0HA 3EU3A 2C0GA 4GLTA 4O92A 2FHEA 2M72A 3ZLPA 3US3A 4IVFA 1A0FA 4GF0A 5CYYA 1UA5A 3DKSA 3HJMA 10GSA 5JWQB 2X8CA 3EMPA 6GSSA 4CDOA 2A4HA 4ID0A 3DVXA 4TR4A 2F8FA 4RUVA 1USBA 4RI7A 4IELA 4Q5RA 1V40A 2I81A 4XRAA 1EV9A 3IE3A 4MLYA 4XS6A 4TR3A 3IRAA 2C8UA 4KH7A 2JSYA 1UN2A 4OWYA 4XCSA 3APOA 2GS3A 1ML6A 6GSVA 4OCFA 5IIZA 1F3AA 1M7TA 4WETA 2KP2A 2C0FA 4GRFA 1JLWA 4OFNA 2MYGA 3FZAA 5B6MA 2NPBA 4HU7A 1SYRA 3UEMA 2DMLA 2FWFA 1TI3A 4EUYA 2X49A 4A5PA 3ZITA 4USSA 3IPZA 2HNLA 1EEJA 1JFUA 1TW9A 2DC5A 2FLSA 3L9SA 2LNSA 4XS1A 6GSWA 1A0RP 5IMAA 5IM9A 1SKRB 2OE1A 3BCKA 4K5SA 4KNDA 5IO2A 3EC3A 4Z2RA 1OC9B 4FO5A 3W8JA 4IHUA 4XS4A 3GV1A 1XW5A 1A24A 2HYXA 2PMTA 1TK0B 3TRPA 3QMXA 3TJGA 1GSUA 3GMFA 3HXSA 1V58A 4HJMA 4EVMA 2WB9A 5ECKB 3ME8A 5G1LA 3ZFBA 1O7UA 2H30A 2C0DA 2H0HA 3C7MA 3M8NA 1T00A 1U3AA 2V6OA 1WOUA 4XRDA 2YANA 3ZREA 2IMFA 3QCPA 4ULXA 1GTAA 5DCGA 3IA1A 2R2JA 2FWEA 5HFKA 1SL0B 4PX1A 3ZL5A 3O6TA 1I9DA 2AJQB 3PH9A 1BG5A 4TXOA 1KEBA 3S9FA 2E2GA 4FIWA 1AXDA 5GSTA 3MAKA 5KOXA 3A5IA 3DWVA 1K3OA 4F0CA 4ZBAA 4JE1A 2E2MA 1X9WB 2FUG2 2AUVA 2ZUPA 3LW9A 2LUSA 3EE2A 2LKUA 1G6WA 1TOFA 4KDXA 4XIHA 3NZNA 4KDYA 11GSA 1XOAA 3MIXA 1EP7A 3HA9A 3H4KA 3TRQA 2Z9SA 2YJHA 2GSQA 4IQ1A 3ZFLA 2K6VA 3IHGA 5AIVA 4IJ3A 5J9BA 3FKFA 1K0CA 3ZMKA 2DIZA 2B5EA 2AV4A 4YH2A 2VL9A 1HQOA 2YP6A 2CAIA 2HZEB 2PERA 1GUKA 3HVXA 4MH2A 3GN3A 3TKPA 2PGTA 4ZL8A 5CRGA 4ZXGA 2TIRA 1THOA 4F9ZA 4F82A 1X9MB 1ERVA 4MPGA 1EGOA 2CX3A 3GKKA 1NHOA 3IBHA 2QKEA 1A2LA 1PD21 2A2RA 1TJDA 4KF9A 1PSQA 4TW5A 3ZIVA 3CBUA 2HFDA 2X99A 3G7IA 3KCMA 5JWOB 1G6YA 3F0IA 4PQIA 4D73B 5INYA 4XTSA 3GSTA 3TOUA 7GSSA 2GGTA 1TKDB 3MNGA 4TOPA 1NW2A 2JACA 3PGTA 4WR5A 1MDIA 3LQ7A 4J2FA 2MZCA 2HRKA 5KN3A 4J57E 4BVXA 5EL8A 3C1SA 3F3QA 2L6DA 3L4NA 4L0UA 2HZFA 4I2TA 3CSIA 2K8SA 5ECQB 4KB3A 4E8EA 1HNCA 1XWKA 3KH7A 3TGZA 4KDUA 5H5QA 4V2LA 2FCHA 3UL3A 3D4MA 4EIPA 2ON5A 4OCEA 4Q5QA 4TXVA 3IV4A 2DSAA 2YV9A 2YWMA 1ILOA 3IC4A 4K2DA 2FWHA 4HSCX 4J56E 3ZYWA 5GAPD 3CRTA 2F8AA 3TKSC 4PQHA 4EXJA 4ZL7A 2ZNMA 3GL3A 1G7EA 5ID2A 4EDYA 3TJKA 4BVYA 3LWAA 4G19A 4N0VA 4Z2TA 3Q19A 1FG4A 3G9BA 2VO4A 3FK8A 3ZZXA 1QMVA 2PVQA 4I5QA 3QFBC 3BD2A 2L5LA 1F37A 1GLQA 1YEXA 4N11A 2AAWA 3DRNA 1UVZA 3F3RA 1B4QA 4BL7B 4EO3A 4LL4B 1ERWA 5AISA 3KMNA 3D4TA 3BOAA 2WRTA 2OE0A 2O85A 4YKFA 2ON7A 5F06A 2MBSA 1EEMA 1UC7A 1NM3A 2IFQB 4PNFA 3F63A 4O5QA 1TU8A 1S3DA 4PURA 1XOBA 4IQAA 2GSTA 3KP8A 3GIXA 2R0GA 3PR8A 4CHSA 2B3SA 4DSQA 2YN1A 3HJPA 1EV4A 2ES7A 3QOUA 2L59A 2H0IA 2D2ZA 2IPAA 2JADA 1GUHA 4G0LA 3GH6A 1VF1A 5F0GA 3IK9A 1Z6NA 5KOWA 2CX4A 4YAVA 2XBIA 5LCZA 1GSSA 3GURA 4GSTA 1XVQA 4BPYA 1Z5YE 1O73A 4POBA 4IW9A 2CT6A 3EPTA 1R5PA 4MZBA 1IYIA 3O76A 14GSA 5JWRB 2NDOA 3CSHA 3GL5A 4G0KA 4LMWA 2VLTA 1K0AA 1SL1B 1SKSB 1K0NA 1FB0A 4F0BA 2L4QA 1Z7PA 1KBNA 2WULA 5IOXA 5E59A 1Z9HA 3AY8A 3ZTLA 18GSA 1LJRA 1OC9A 19GSA 2MMNA 4PGTA 2C1YA 3CMIA 3LORA 1FHEA 4NXIA 2IMKA 1F2EA 5COHA 1GSDA 3L9UA 4F03A 3P2AA 4ZBBA 2CA8A 3E0UA 3EINA 1OYJA 3JCML 1TP9A 4IJIA 5ECMB 4O32A 3HVSA 3UVTA 1O85A 2FWGA 4YKGA 5JCWA 2PPTA 4HZ4A 1XWCA 4NMUA 1SL2B 3HHVA 3F8UA 4FH8A 2KP1A 3L78A 2JSZA 1J0FA 4GTUA 2KOKA 3ERGA 3TDGA 2GSRA 5HR1A 2WCIA 3G7YA 4HEA2 3EURA 4IN0A 2H73A 2QA1A 4G0IA 4MJBA 2QC7A 4IBPA 1R7HA 2IL3A 3DXBA 2AHEA 5J4UA 1K3LA 3GTUB 2EIOA 1THXA 4NWYA 2P5QA 4QL7A 5CAXA 1XPVA 2KHPA 1B9XC 4G9HA 1AUCA 5ECHB 2WZ9A 1PMTA 4K1FA 4PUFC 1NHYA 2FGXA 1C72A 3LJRA 1F6MC 3N5OA 2IJYA 1A2JA 2H1AA 2V32A 3D0ZA 1W89A 2DBCA 3R2QA 2LV3A 4ISDA 2X8GA 2B7KA 3KMOA 4TVEA 4WR4A 3G7JA 5B7CA 2A2PA 2HZEA 4IP1A 4X4JA 1OC8A 5J5NA 1YZXA 3DVWA 1Q4JA 4JU5A 4DVCA 1T4ZA 1K0BA 3TB2A 5D9WA 2DJ3A 5D96A 2NTOA 1PN9A 2VIMA 2K9FA 1K0OA 4GXZA 2C4JA 1SENA 1GTUA 3C71A 4MJCA 4AJ7A 2XC2A 5H5RA 3GUSA 3FRCA 3GYKA 3A3TA 3GX0A 2BMXA 1U88A 4D73A 4POLA 5DJLA 1M2BA 4CY6A 4LLRA 3MSZA 2E7PA 3N9JA 22GSA 5AGYA 1AC1A 3FZ5A 4FYCA 2VL3A 2B5YA 3TOTA 5IMCA 1SKWB 1QFNA 2PWJA 5G30A 1ZOFA 1M2DA 4K5RA 2EC4A 2WFCA 5HQPA 3P90A 2HRNA 2PN8A 2JZTA 3GKMA 3ERWA 1PL2A 2DMMA 2J9HA 2CVKA 3UVHA 5ABRA 1LU4A 1DSBA 1M99A 3HYPA 4CY8A 1TTZA 3VPTA 5DQSA 4MJEA 4EE0A 2B5XA 3BJ5A 4ML6A 5CRDA 3FEUA 2VL2A 1OKTA 1T1VA 2QGVA 4WKWA 4IGJA 2GDRA 1YJ6A 2PU9C 3SBCA 3UARA 3A2VA 1BYEA 1QK8A 2H6XA 1F9MA 1AQVA 2H1GA 4TRXA 3H8QA 5G31A 4BL7A 2VCVA 1ZGNA 1MTCA 3GKNA 1OE8A 5ECSA 3I69A 1SJIA 1EWXA 3UJ1A 3Q6OA 3UAPA 2IFQA 5IMZA 3Q18A 3M1GA 3EVIA 1T4YA 1JZRA 2I4AA 2GZZA 5JCUA 3KGKA 1XW6A 3ZRDA 4YAPA 1OC3A 2L4CA 3WT2A 2MMAA 1M3IA 3TJJA 4N0ZA 1QQ2A 1SJZA 4HUAA 4O5UA 3VLNA 1DE2A 1SYXA 3TJBA 3IK7A 2TRXA 3WD6A 3CYNA 2VM1A 2M80A 4OFTA 2YOIA 4QQ7A 2IMDA 1WP0A 1G7OA 1Z7RA 5LD0A 3TJFA 2JZRA 3VURA 1TK8B 4P3YB 5BMUA 3P8WA 4JRRA 1AQWA 5DJMA 2H70A 3WT1A 1V9WA 3K8NA 2O89A 1R5AA 4BIKA 3KP9A 1GULA 4E8HA 3VK9A 1T3BA 5AN1A 3QD9A 2C3QA 2VCZA 3IAS2 5HFGA 4MCUA 3KTBA 3IC8A 3HY2A 3FZ4A 2YV7A 4ECJA 4Z2UA 1QGVA 2WJUA 3HJOA 4WBJA 2V6KA 3GX8A 1TI1A 2NBSA 4KCEA 5J3RA 2YZHA 1GTBA 1S3AA 2YWNA 2RIIA 1WJKA 2DJ2A 4K0NA 1M0UA 2LJAA 1BX9A 3DMLA 3TRXA 3KM6A 3E9JB 1GSEA 4WF5A 2VCWA 4I2UA 2FA4A 4KE3A 5FWGA 1JHBA 4GQFA 4G10A 4KA0A 3E3EA 2P31A 1SU9A 4PUAA 5DBQA 4WF4A
chains in the Genus database with same CATH topology
4ICYA 1KNGA 1HYUA 5B8BA 1RQMA 5FHIA 4ZL9A 4HI7A 2LRCA 4TR1B 1G0TA 3SWLA 1MDJA 4MDCA 1B4PA 2H8LA 4BWQA 2LSTA 4L5OA 3RDWA 3GTUA 3TKRA 1IYHA 4IP6A 4RI6A 1SJ6A 3CRUA 2MMZA 1ZYPA 4GQCA 1PX7A 2L5OA 3WYWA 1Z6MA 3BCIA 2X4AA 2DKIA 3C1RA 2YCDA 4X1UA 4JBBA 1OKDA 1ZYNA 4K9ZA 2GZYA 2CZ3A 5A4UA 3NIVA 3IHQA 3VWWA 4ECCA 5IPGA 4ECBA 1EGRA 2VLVA 3VI5A 3M0FA 3NOFA 3KXOA 4MNNA 5AIXA 1O8WA 2KUCA 1RW1A 4PXOA 2V1MA 2XHFA 1FOVA 4AF2A 1X9SB 1PKZA 1Z3EA 1DBYA 1HNAA 1QXHA 1H75A 2F51A 5IMDA 2GVPA 1X5EA 4PQ1A 1H4OA 3GNJA 1EZKA 1X5DA 4WXTA 2R0PA 3ED3A 5A4WA 4L8EA 4WEYA 3ZIJA 1JZOA 3H79A 4F2IA 2E0QA 1GRXA 2GQKA 2HI7A 12GSA 2LJRA 2I3YA 4V1Ap 2I9HA 2WGRA 3EMXA 3CSJA 1WPIA 3P7XA 5ECRB 5ELGA 4I6XA 3O3TA 1ZYEA 2K18A 1OE7A 9GSSA 2R3XA 2P0GA 2GTUA 2NVLA 3LYKA 1SD9A 2RUEA 5G5FA 5IOWA 1PA3A 3FZ9A 1WE0A 4BA7A 2CAQA 3HZ8A 3ISOA 3F4RA 4KAEA 2RM5A 4MZWA 5D9XA 3M3MA 4K7OA 5CRWA 3FMWA 1LBKA 2H19A 1CQGA 1PN0A 5DAKB 3W6GA 2VAFA 2H01A 3QR6A 1ZYQB 4HJ2A 1NSWA 4PNGA 1T7PB 2GQMA 2HXKA 3TUEA 4ACSA 3J7Yk 4AJ8A 1J08A 4YQVA 2N5BA 6GSTA 1PX6A 1ZL9A 2LNTA 1AW9A 3QDNA 3VWVA 1XWAA 2DLXA 2LJKA 3HZ4A 3I6AA 4ZBDA 1GP1A 4TR0A 4AJ6A 5EPFA 3HVVA 2GLRA 3QAGA 3LXZA 4OO5A 4DSSB 2R37A 2VCQA 3F4SA 2IIYA 3KH9A 3KD0A 5CP1A 2X64A 2R0CA 2X8HA 2GSSA 2HLSA 1TRUA 2YZUA 4JR6A 3F6FA 2REMA 4ZIJA 1YF0A 5KN1A 1A8LA 2H76A 1B9YC 4TN8A 2ZCTA 5KN0A 1U87A 3HDCA 2F9SA 2A4VA 1V2AA 2V41A 1XXUA 2R6KA 3FR6A 1SK2A 3ZVJD 1DE1A 2RLIA 2B1KA 2IN3A 2V2GA 5JCGA 2O87A 3Q74A 2IWTA 5KEJA 4MF5A 2N5AA 2QA2A 3M9KA 3PINA 3EYTA 1AAZA 3F9UA 4POKA 1GSFA 5IPHA 4I97A 1VF2A 4EKZA 3A2XA 4GSNA 3A5WA 3UBLA 1Y6EA 4K7NA 3I43A 1TXXA 3D22A 1AQXA 1JLVA 3RHCA 2XPDA 5IMVA 5B8AA 2R4VA 1S3CA 1RK4A 5GAND 1YEPA 1XW9A 4BWSA 8GSSA 1ZCPA 1QUWA 4EL1A 4K2XA 2OKAA 1GSYA 2B1LA 1A2MA 3HKRA 3FR9A 1XCCA 3GRXA 2DJ1A 1SD8A 1GH2A 1K0DA 4MF6A 4MA9A 4RQRA 3ZVJA 3TKSE 5J9CA 1GNWA 5ECIB 4KX4A 2H1BA 20GSA 1HNBA 4KUNA 4KSOA 3DYRA 3MDKA 2J23A 5DDLA 1A23A 5J41A 2OJLA 4TR1A 2H71A 4ZB6A 5HFIA 1YF1A 2O8VB 5DALB 3IDVA 1FB6A 5C00A 4DEJA 3EU4A 1ERTA 5G2ZA 2DJ0A 1B8XA 5D9VA 2JL4A 3M9JA 1ACVA 3KIJA 1AIUA 5A4VA 4MPFA 3D5JA 1MDKA 4NAXA 4EF0A 2YJ7A 1XIYA 1V98A 5EY6A 2XBQA 2TRCP 1FW1A 3MYDA 3U5RE 5F05A 4K7IA 3DD3A 1M9AA 5CRHA 1GSQA 4X0XA 3H93A 5G1KA 1OVNA 3HCZA 2HT9A 5IMFA 2CV4A 1SK0A 3F4TA 3R3EA 2FY6A 5H5SA 1XFLA 4PTSA 2ALBA 1FVJA 1TRSA 3L9VA 2WS2A 2VLUA 2OADA 2BTOT 2FNOA 4TKYA 3DIEA 3RPPA 4FQUA 1ON4A 4OD7A 3WGDA 4DSRA 2VOCA 1BEDA 2C80A 6GSYA 3APQA 3KZQA 4MF7A 3ME7A 5HR0A 2LS5A 1GTIA 3RBTA 3IAM2 3D6IA 3WGEA 4NV2A 2GT6A 4GWRA 4OO4A 2HRAA 4XHMA 1E2YA 2CVBA 4EDZA 4ECIA 1K3YA 5D73A 1XWGA 3OR5A 1WWJA 3W8SA 3F6DA 2H74A 4HU9A 5IO0A 2OE3A 5L71A 1YKCA 5GZZB 1R4WA 2VL2C 4X43A 2AB6A 4HQSA 1V57A 2YPMA 3CTGA 5A5KA 4RQXA 1J9BA 2M46A 1T8EB 4JR4A 5F07A 1BQ7A 3VWUA 2N5FA 2AYTA 3KJYA 4HZ2A 1A8YA 4ZILA 3DGQA 4JZQA 2CQ9A 3CTFA 3LGCA 3TKSA 4MABA 1EOGA 4JEDA 1PRXA 4OMVA 4V2NA 4ILFA 1GNEA 1KTEA 1F3BA 1O81A 3TKQA 5DVBA 3UIWA 3LSZA 5DAKA 1Q98A 3FHKA 2OA7A 4LMVA 2F3MA 2VCTA 3VPQA 2WDUA 2GZPA 2MBTA 1GUMA 3V1WA 4N30A 4NHWA 5ECPB 1O8XA 3LFLA 2C3NA 2KLXA 4FYBA 2JU5A 2OBIA 3QPMA 2VCXA 2H6ZA 5ECNB 2LEGA 3RPNA 4HS1A 1Y25A 3LXTA 4ZB9A 1BJXA 2QSIA 3ZMLA 4ML1A 4HQZA 2GT5A 2RM6A 2O7KA 4K8MA 5CREA 2A2SA 2C0EA 2HRFA 4DSSA 3UBKA 1TK5B 2DIYA 4GCIA 3VWXA 2FD3A 1PGTA 3U6VA 4IKHA 3A2WA 1M2AA 3KEBA 3GSSA 2G2QA 2VD1A 3BBYA 4IS0A 5HR3A 5ELAA 3EWLA 1DUGA 4XS4B 4Z7XA 3VI7A 5HR2A 3TCOA 4MK3A 4POMA 5GSSA 2G0FA 2B7JA 4CW9A 4EC0A 4Q5FA 3FW2A 4L5LA 1M9BA 2JZSA 2LRTA 3VFIA 1SK1A 3LYPA 4I8BA 1GWCA 1HD2A 2H72A 2K8VA 3FYGA 5C04A 6GSXA 2PUKC 4MP4A 3DEXA 1N2AA 3RAZA 4MH3A 1ST9A 5D9TA 4KSMA 2H0GA 2XPEA 3HD5A 2HSMA 1URMA 3APSA 5G5EA 1JZWA 2OBKA 5BRTA 2H75A 1YQ1A 2DJJA 3RHBA 2LQOA 5ECOB 1XBSA 1U3IA 2C3TA 2BJXA 4LA1A 2RUFA 17GSA 2DJKA 4TXOB 1TDIA 1PKWA 4H86A 1XWBA 1FVKA 1MD3A 2CZ2A 1MEKA 2IMIA 4LL1B 1B48A 13GSA 2H66A 5CNWA 4KGIA 2LRNA 3GH9A 4NV5A 4V1Ag 4NPBA 1X5CA 2YWIA 4NHZA 1CQHA 5B6NA 4GSSA 5E4WA 3WGXA 1X0RA 1PQNA 5ENUA 1FO5A 1K0MA 5CO3A 1ZZYA 4OFMA 1TU7A 3FR3A 1TRVA 2R5GA 2PVOC 1WIKA 1GL8A 4YQMA 2VUPA 5KN2A 5DALA 1W4VA 1ABAA 1WMJA 3GHAA 3GFKA 2VD0A 4AGSA 4O5RA 1GLPA 1OAZA 3QAVA 1ZMAA 4QL9A 4L0WA 1VGLA 1YKAA 3IOSA 2L57A 1ERUA 3UMAA 4KCAA 2PBJA 5IQYA 2MMOA 2GQLA 2HSYA 2CVDA 1EP8A 2UZ8A 1TRWA 1U6TA 4HOJA 2EIRA 4MZCA 4WBRD 3GA4A 5D8IA 3LG6A 4KW6A 1PL1A 1YY7A 3PPUA 4K6XA 5F8BA 1N8JA 4FYUA 1XZOA 5EVOA 2I1UA 1BAYA 1E6BA 2LTKA 3I9V2 5LNKe 3FY7A 2YWOA 3LEFA 2IMEA 3IR4A 4N10A 4BVXB 1I5GA 4K0GA 2L6CA 2HE3A 4Q5NA 3KTLA 4G2EA 3MWHA 1EOHA 3C8EA 3C73A 3J7Yb 4ZB8A 4O7HA 3QAWA 2OACA 5D93A 3GKXA 5DQYA 1O6JA 5FT3A 1VF3A 4HDEA 4YQUA 2FA8A 2EIQA 1JZDA 2B6MA 1FAAA 2H6YA 3UOMA 4V2MA 16GSA 6GSUA 2DKHA 3CXGA 2P5RA 2HSHA 2YNXA 5ECLB 2LQQA 1VF4A 1R26A 5DCHA 1YDKA 5ID2B 4MMMA 4BVYB 3D21A 4MJAA 3QFAC 1XVWA 3IXRA 1VRSD 3H1NA 3ERFA 2H1DA 1FOHA 1MD4A 4EIQA 1WRYA 2VM2A 3L0HA 3EU3A 2C0GA 4GLTA 4O92A 2FHEA 2M72A 3ZLPA 3US3A 4IVFA 1A0FA 4GF0A 5CYYA 1UA5A 3DKSA 3HJMA 10GSA 5JWQB 2X8CA 3EMPA 6GSSA 4CDOA 2A4HA 4ID0A 3DVXA 4TR4A 2F8FA 4RUVA 1USBA 4RI7A 4IELA 4Q5RA 1V40A 2I81A 4XRAA 1EV9A 3IE3A 4MLYA 4XS6A 4TR3A 3IRAA 2C8UA 4KH7A 2JSYA 1UN2A 4OWYA 4XCSA 3APOA 2GS3A 1ML6A 6GSVA 4OCFA 5IIZA 1F3AA 1M7TA 4WETA 2KP2A 2C0FA 4GRFA 1JLWA 4OFNA 2MYGA 3FZAA 5B6MA 2NPBA 4HU7A 1SYRA 3UEMA 2DMLA 2FWFA 1TI3A 4EUYA 2X49A 4A5PA 3ZITA 4USSA 3IPZA 2HNLA 1EEJA 1JFUA 1TW9A 2DC5A 2FLSA 3L9SA 2LNSA 4XS1A 6GSWA 1A0RP 5IMAA 5IM9A 1SKRB 2OE1A 3BCKA 4K5SA 4KNDA 5IO2A 3EC3A 4Z2RA 1OC9B 4FO5A 3W8JA 4IHUA 4XS4A 3GV1A 1XW5A 1A24A 2HYXA 2PMTA 1TK0B 3TRPA 3QMXA 3TJGA 1GSUA 3GMFA 3HXSA 1V58A 4HJMA 4EVMA 2WB9A 5ECKB 3ME8A 5G1LA 3ZFBA 1O7UA 2H30A 2C0DA 2H0HA 3C7MA 3M8NA 1T00A 1U3AA 2V6OA 1WOUA 4XRDA 2YANA 3ZREA 2IMFA 3QCPA 4ULXA 1GTAA 5DCGA 3IA1A 2R2JA 2FWEA 5HFKA 1SL0B 4PX1A 3ZL5A 3O6TA 1I9DA 2AJQB 3PH9A 1BG5A 4TXOA 1KEBA 3S9FA 2E2GA 4FIWA 1AXDA 5GSTA 3MAKA 5KOXA 3A5IA 3DWVA 1K3OA 4F0CA 4ZBAA 4JE1A 2E2MA 1X9WB 2FUG2 2AUVA 2ZUPA 3LW9A 2LUSA 3EE2A 2LKUA 1G6WA 1TOFA 4KDXA 4XIHA 3NZNA 4KDYA 11GSA 1XOAA 3MIXA 1EP7A 3HA9A 3H4KA 3TRQA 2Z9SA 2YJHA 2GSQA 4IQ1A 3ZFLA 2K6VA 3IHGA 5AIVA 4IJ3A 5J9BA 3FKFA 1K0CA 3ZMKA 2DIZA 2B5EA 2AV4A 4YH2A 2VL9A 1HQOA 2YP6A 2CAIA 2HZEB 2PERA 1GUKA 3HVXA 4MH2A 3GN3A 3TKPA 2PGTA 4ZL8A 5CRGA 4ZXGA 2TIRA 1THOA 4F9ZA 4F82A 1X9MB 1ERVA 4MPGA 1EGOA 2CX3A 3GKKA 1NHOA 3IBHA 2QKEA 1A2LA 1PD21 2A2RA 1TJDA 4KF9A 1PSQA 4TW5A 3ZIVA 3CBUA 2HFDA 2X99A 3G7IA 3KCMA 5JWOB 1G6YA 3F0IA 4PQIA 4D73B 5INYA 4XTSA 3GSTA 3TOUA 7GSSA 2GGTA 1TKDB 3MNGA 4TOPA 1NW2A 2JACA 3PGTA 4WR5A 1MDIA 3LQ7A 4J2FA 2MZCA 2HRKA 5KN3A 4J57E 4BVXA 5EL8A 3C1SA 3F3QA 2L6DA 3L4NA 4L0UA 2HZFA 4I2TA 3CSIA 2K8SA 5ECQB 4KB3A 4E8EA 1HNCA 1XWKA 3KH7A 3TGZA 4KDUA 5H5QA 4V2LA 2FCHA 3UL3A 3D4MA 4EIPA 2ON5A 4OCEA 4Q5QA 4TXVA 3IV4A 2DSAA 2YV9A 2YWMA 1ILOA 3IC4A 4K2DA 2FWHA 4J56E 3ZYWA 5GAPD 3CRTA 2F8AA 3TKSC 4PQHA 4EXJA 4ZL7A 2ZNMA 3GL3A 1G7EA 5ID2A 4EDYA 3TJKA 4BVYA 3LWAA 4G19A 4N0VA 4Z2TA 3Q19A 1FG4A 3G9BA 2VO4A 3FK8A 3ZZXA 1QMVA 2PVQA 4I5QA 3QFBC 3BD2A 2L5LA 1F37A 1GLQA 1YEXA 4N11A 2AAWA 3DRNA 1UVZA 3F3RA 1B4QA 4BL7B 4EO3A 4LL4B 1ERWA 5AISA 3KMNA 3D4TA 3BOAA 2WRTA 2OE0A 2O85A 4YKFA 2ON7A 5F06A 2MBSA 1EEMA 1UC7A 1NM3A 2IFQB 4PNFA 3F63A 4O5QA 1TU8A 1S3DA 4PURA 1XOBA 4IQAA 2GSTA 3KP8A 3GIXA 2R0GA 3PR8A 4CHSA 2B3SA 4DSQA 2YN1A 3HJPA 1EV4A 2ES7A 3QOUA 2L59A 2H0IA 2D2ZA 2IPAA 2JADA 1GUHA 4G0LA 3GH6A 1VF1A 5F0GA 3IK9A 1Z6NA 5KOWA 2CX4A 4YAVA 2XBIA 5LCZA 1GSSA 3GURA 4GSTA 1XVQA 4BPYA 1Z5YE 1O73A 4POBA 4IW9A 2CT6A 3EPTA 1R5PA 4MZBA 1IYIA 3O76A 14GSA 5JWRB 2NDOA 3CSHA 3GL5A 4G0KA 4LMWA 2VLTA 1K0AA 1SL1B 1SKSB 1K0NA 1FB0A 4F0BA 2L4QA 1Z7PA 1KBNA 2WULA 5IOXA 5E59A 1Z9HA 3AY8A 3ZTLA 18GSA 1LJRA 1OC9A 19GSA 2MMNA 4PGTA 2C1YA 3CMIA 3LORA 1FHEA 4NXIA 2IMKA 1F2EA 5COHA 1GSDA 3L9UA 4F03A 3P2AA 4ZBBA 2CA8A 3E0UA 3EINA 1OYJA 3JCML 1TP9A 4IJIA 5ECMB 4O32A 3HVSA 3UVTA 1O85A 2FWGA 4YKGA 5JCWA 2PPTA 4HZ4A 1XWCA 4NMUA 1SL2B 3HHVA 3F8UA 4FH8A 2KP1A 3L78A 2JSZA 1J0FA 4GTUA 2KOKA 3ERGA 3TDGA 2GSRA 5HR1A 2WCIA 3G7YA 4HEA2 3EURA 4IN0A 2H73A 2QA1A 4G0IA 4MJBA 2QC7A 4IBPA 1R7HA 2IL3A 3DXBA 2AHEA 5J4UA 1K3LA 3GTUB 2EIOA 1THXA 4NWYA 2P5QA 4QL7A 5CAXA 1XPVA 2KHPA 1B9XC 4G9HA 1AUCA 5ECHB 2WZ9A 1PMTA 4K1FA 4PUFC 1NHYA 2FGXA 1C72A 3LJRA 1F6MC 3N5OA 2IJYA 1A2JA 2H1AA 2V32A 3D0ZA 1W89A 2DBCA 3R2QA 2LV3A 4ISDA 2X8GA 2B7KA 3KMOA 4TVEA 4WR4A 3G7JA 5B7CA 2A2PA 2HZEA 4IP1A 4X4JA 1OC8A 5J5NA 1YZXA 3DVWA 1Q4JA 4JU5A 4DVCA 1T4ZA 1K0BA 3TB2A 5D9WA 2DJ3A 5D96A 2NTOA 1PN9A 2VIMA 2K9FA 1K0OA 4GXZA 2C4JA 1SENA 1GTUA 3C71A 4MJCA 4AJ7A 2XC2A 5H5RA 3GUSA 3FRCA 3GYKA 3A3TA 3GX0A 2BMXA 1U88A 4D73A 4POLA 5DJLA 1M2BA 4CY6A 4LLRA 3MSZA 2E7PA 3N9JA 22GSA 5AGYA 1AC1A 3FZ5A 4FYCA 2VL3A 2B5YA 3TOTA 5IMCA 1SKWB 1QFNA 2PWJA 5G30A 1ZOFA 1M2DA 4K5RA 2EC4A 2WFCA 5HQPA 3P90A 2HRNA 2PN8A 2JZTA 3GKMA 3ERWA 1PL2A 2DMMA 2J9HA 2CVKA 3UVHA 5ABRA 1LU4A 1DSBA 1M99A 3HYPA 4CY8A 1TTZA 3VPTA 5DQSA 4MJEA 4EE0A 2B5XA 3BJ5A 4ML6A 5CRDA 3FEUA 2VL2A 1OKTA 1T1VA 2QGVA 4WKWA 4IGJA 2GDRA 1YJ6A 2PU9C 3SBCA 3UARA 3A2VA 1BYEA 1QK8A 2H6XA 1F9MA 1AQVA 2H1GA 4TRXA 3H8QA 5G31A 4BL7A 2VCVA 1ZGNA 1MTCA 3GKNA 1OE8A 5ECSA 3I69A 1SJIA 1EWXA 3UJ1A 3Q6OA 3UAPA 2IFQA 5IMZA 3Q18A 3M1GA 3EVIA 1T4YA 1JZRA 2I4AA 2GZZA 5JCUA 3KGKA 1XW6A 3ZRDA 4YAPA 1OC3A 2L4CA 3WT2A 2MMAA 3TJJA 4N0ZA 1QQ2A 1SJZA 4HUAA 4O5UA 3VLNA 1DE2A 1SYXA 3TJBA 3IK7A 2TRXA 3WD6A 3CYNA 2VM1A 2M80A 4OFTA 2YOIA 4QQ7A 2IMDA 1WP0A 1G7OA 1Z7RA 5LD0A 3TJFA 2JZRA 3VURA 1TK8B 4P3YB 5BMUA 3P8WA 4JRRA 1AQWA 5DJMA 2H70A 3WT1A 1V9WA 3K8NA 2O89A 1R5AA 3KP9A 1GULA 4E8HA 3VK9A 1T3BA 5AN1A 3QD9A 2C3QA 2VCZA 3IAS2 5HFGA 4MCUA 3KTBA 3IC8A 3HY2A 3FZ4A 2YV7A 4ECJA 4Z2UA 1QGVA 2WJUA 3HJOA 4WBJA 2V6KA 3GX8A 1TI1A 2NBSA 4KCEA 5J3RA 2YZHA 1GTBA 1S3AA 2YWNA 2RIIA 1WJKA 2DJ2A 4K0NA 1M0UA 2LJAA 1BX9A 3DMLA 3TRXA 3KM6A 3E9JB 1GSEA 4WF5A 2VCWA 4I2UA 2FA4A 4KE3A 5FWGA 1JHBA 4GQFA 4G10A 4KA0A 3E3EA 2P31A 1SU9A 4PUAA 5DBQA 4WF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNG A;  1HYU A;  5B8B A;  1RQM A;  5FHI A;  4ZL9 A;  4HI7 A;  2LRC A;  4TR1 B;  1G0T A;  3SWL A;  1MDJ A;  4MDC A;  1B4P A;  2H8L A;  4BWQ A;  2LST A;  4L5O A;  3RDW A;  3GTU A;  3TKR A;  1IYH A;  4IP6 A;  4RI6 A;  1SJ6 A;  3CRU A;  2MMZ A;  4GQC A;  1PX7 A;  2L5O A;  3WYW A;  1Z6M A;  3BCI A;  3C1R A;  2YCD A;  4X1U A;  4JBB A;  1OKD A;  4K9Z A;  2GZY A;  2CZ3 A;  5A4U A;  3NIV A;  3IHQ A;  3VWW A;  4ECC A;  5IPG A;  4ECB A;  1EGR A;  2VLV A;  3VI5 A;  3M0F A;  3NOF A;  3KXO A;  5AIX A;  1O8W A;  2KUC A;  1RW1 A;  4PXO A;  2V1M A;  2XHF A;  1FOV A;  4AF2 A;  1X9S B;  1PKZ A;  1Z3E A;  1DBY A;  1HNA A;  1QXH A;  1H75 A;  2F51 A;  5IMD A;  2GVP A;  1X5E A;  4PQ1 A;  1H4O A;  3GNJ A;  1EZK A;  1X5D A;  4WXT A;  3ED3 A;  5A4W A;  4L8E A;  4WEY A;  3ZIJ A;  1JZO A;  3H79 A;  4F2I A;  2E0Q A;  1GRX A;  2GQK A;  2HI7 A;  12GS A;  2LJR A;  2I3Y A;  4V1A p;  2I9H A;  2WGR A;  3EMX A;  3CSJ A;  1WPI A;  3P7X A;  5ECR B;  5ELG A;  4I6X A;  3O3T A;  1ZYE A;  2K18 A;  1OE7 A;  9GSS A;  2R3X A;  2P0G A;  2GTU A;  2NVL A;  3LYK A;  1SD9 A;  2RUE A;  5G5F A;  5IOW A;  1PA3 A;  3FZ9 A;  1WE0 A;  4BA7 A;  2CAQ A;  3HZ8 A;  3ISO A;  3F4R A;  4KAE A;  2RM5 A;  4MZW A;  5D9X A;  3M3M A;  4K7O A;  5CRW A;  1LBK A;  2H19 A;  1CQG A;  5DAK B;  3W6G A;  2VAF A;  2H01 A;  3QR6 A;  1ZYQ B;  4HJ2 A;  1NSW A;  4PNG A;  1T7P B;  2GQM A;  2HXK A;  3TUE A;  4ACS A;  3J7Y k;  4AJ8 A;  1J08 A;  4YQV A;  2N5B A;  6GST A;  1PX6 A;  1ZL9 A;  2LNT A;  1AW9 A;  3QDN A;  3VWV A;  1XWA A;  2DLX A;  2LJK A;  3HZ4 A;  3I6A A;  4ZBD A;  1GP1 A;  4TR0 A;  4AJ6 A;  5EPF A;  3HVV A;  2GLR A;  3QAG A;  3LXZ A;  4OO5 A;  4DSS B;  2R37 A;  2VCQ A;  3F4S A;  2IIY A;  3KH9 A;  3KD0 A;  5CP1 A;  2X64 A;  2X8H A;  2GSS A;  2HLS A;  1TRU A;  2YZU A;  4JR6 A;  3F6F A;  2REM A;  4ZIJ A;  1YF0 A;  5KN1 A;  1A8L A;  2H76 A;  1B9Y C;  4TN8 A;  2ZCT A;  5KN0 A;  1U87 A;  3HDC A;  2F9S A;  2A4V A;  1V2A A;  2V41 A;  1XXU A;  2R6K A;  3FR6 A;  1SK2 A;  3ZVJ D;  1DE1 A;  2RLI A;  2B1K A;  2IN3 A;  2V2G A;  5JCG A;  2O87 A;  3Q74 A;  2IWT A;  5KEJ A;  4MF5 A;  2N5A A;  3M9K A;  3PIN A;  3EYT A;  1AAZ A;  3F9U A;  4POK A;  1GSF A;  5IPH A;  4I97 A;  1VF2 A;  4EKZ A;  3A2X A;  4GSN A;  3A5W A;  3UBL A;  1Y6E A;  4K7N A;  3I43 A;  1TXX A;  3D22 A;  1AQX A;  1JLV A;  3RHC A;  2XPD A;  5IMV A;  5B8A A;  2R4V A;  1S3C A;  1RK4 A;  5GAN D;  1YEP A;  1XW9 A;  4BWS A;  8GSS A;  1ZCP A;  1QUW A;  4EL1 A;  2OKA A;  1GSY A;  2B1L A;  1A2M A;  3HKR A;  3FR9 A;  1XCC A;  3GRX A;  2DJ1 A;  1SD8 A;  1GH2 A;  1K0D A;  4MF6 A;  4MA9 A;  4RQR A;  3ZVJ A;  3TKS E;  5J9C A;  1GNW A;  5ECI B;  4KX4 A;  2H1B A;  20GS A;  1HNB A;  4KUN A;  4KSO A;  3DYR A;  3MDK A;  2J23 A;  5DDL A;  1A23 A;  5J41 A;  2OJL A;  4TR1 A;  2H71 A;  4ZB6 A;  5HFI A;  1YF1 A;  2O8V B;  5DAL B;  3IDV A;  1FB6 A;  5C00 A;  4DEJ A;  3EU4 A;  1ERT A;  5G2Z A;  2DJ0 A;  1B8X A;  5D9V A;  2JL4 A;  3M9J A;  1ACV A;  3KIJ A;  1AIU A;  5A4V A;  4MPF A;  3D5J A;  1MDK A;  4NAX A;  4EF0 A;  2YJ7 A;  1XIY A;  1V98 A;  5EY6 A;  2XBQ A;  2TRC P;  1FW1 A;  3U5R E;  5F05 A;  4K7I A;  3DD3 A;  1M9A A;  5CRH A;  1GSQ A;  4X0X A;  3H93 A;  5G1K A;  1OVN A;  3HCZ A;  2HT9 A;  5IMF A;  2CV4 A;  1SK0 A;  3F4T A;  2FY6 A;  5H5S A;  1XFL A;  2ALB A;  1FVJ A;  1TRS A;  3L9V A;  2WS2 A;  2VLU A;  2OAD A;  2BTO T;  2FNO A;  4TKY A;  3DIE A;  3RPP A;  1ON4 A;  4OD7 A;  3WGD A;  4DSR A;  2VOC A;  1BED A;  2C80 A;  6GSY A;  3APQ A;  3KZQ A;  4MF7 A;  3ME7 A;  5HR0 A;  2LS5 A;  1GTI A;  3RBT A;  3IAM 2;  3D6I A;  3WGE A;  4NV2 A;  2GT6 A;  4GWR A;  4OO4 A;  4XHM A;  1E2Y A;  2CVB A;  4EDZ A;  4ECI A;  1K3Y A;  5D73 A;  1XWG A;  3OR5 A;  1WWJ A;  3W8S A;  3F6D A;  2H74 A;  4HU9 A;  5IO0 A;  2OE3 A;  5L71 A;  1YKC A;  5GZZ B;  1R4W A;  2VL2 C;  4X43 A;  2AB6 A;  4HQS A;  1V57 A;  2YPM A;  3CTG A;  5A5K A;  4RQX A;  1J9B A;  2M46 A;  1T8E B;  4JR4 A;  5F07 A;  1BQ7 A;  3VWU A;  2N5F A;  2AYT A;  3KJY A;  4HZ2 A;  1A8Y A;  4ZIL A;  3DGQ A;  4JZQ A;  2CQ9 A;  3CTF A;  3LGC A;  3TKS A;  4MAB A;  1EOG A;  4JED A;  1PRX A;  4OMV A;  4V2N A;  4ILF A;  1GNE A;  1KTE A;  1F3B A;  1O81 A;  3TKQ A;  5DVB A;  3UIW A;  3LSZ A;  5DAK A;  1Q98 A;  3FHK A;  2OA7 A;  4LMV A;  2F3M A;  2VCT A;  3VPQ A;  2WDU A;  2GZP A;  2MBT A;  1GUM A;  3V1W A;  4N30 A;  4NHW A;  5ECP B;  1O8X A;  3LFL A;  2C3N A;  2KLX A;  4FYB A;  2JU5 A;  2OBI A;  3QPM A;  2VCX A;  2H6Z A;  5ECN B;  2LEG A;  3RPN A;  4HS1 A;  1Y25 A;  3LXT A;  4ZB9 A;  1BJX A;  2QSI A;  3ZML A;  4ML1 A;  4HQZ A;  2GT5 A;  2RM6 A;  2O7K A;  4K8M A;  5CRE A;  2A2S A;  2C0E A;  2HRF A;  4DSS A;  3UBK A;  1TK5 B;  2DIY A;  4GCI A;  3VWX A;  2FD3 A;  1PGT A;  3U6V A;  4IKH A;  3A2W A;  1M2A A;  3KEB A;  3GSS A;  2G2Q A;  2VD1 A;  3BBY A;  4IS0 A;  5HR3 A;  5ELA A;  3EWL A;  1DUG A;  4XS4 B;  4Z7X A;  3VI7 A;  5HR2 A;  3TCO A;  4MK3 A;  4POM A;  5GSS A;  2G0F A;  2B7J A;  4CW9 A;  4EC0 A;  4Q5F A;  3FW2 A;  4L5L A;  1M9B A;  2JZS A;  2LRT A;  3VFI A;  1SK1 A;  3LYP A;  4I8B A;  1GWC A;  1HD2 A;  2H72 A;  2K8V A;  3FYG A;  5C04 A;  6GSX A;  2PUK C;  4MP4 A;  3DEX A;  1N2A A;  3RAZ A;  4MH3 A;  1ST9 A;  5D9T A;  4KSM A;  2H0G A;  2XPE A;  3HD5 A;  1URM A;  3APS A;  5G5E A;  1JZW A;  2OBK A;  2H75 A;  1YQ1 A;  2DJJ A;  3RHB A;  2LQO A;  5ECO B;  1XBS A;  1U3I A;  2C3T A;  2BJX A;  4LA1 A;  2RUF A;  17GS A;  2DJK A;  4TXO B;  1TDI A;  1PKW A;  4H86 A;  1XWB A;  1FVK A;  1MD3 A;  2CZ2 A;  1MEK A;  2IMI A;  4LL1 B;  1B48 A;  13GS A;  2H66 A;  5CNW A;  4KGI A;  2LRN A;  3GH9 A;  4NV5 A;  4V1A g;  4NPB A;  1X5C A;  2YWI A;  4NHZ A;  1CQH A;  5B6N A;  4GSS A;  5E4W A;  3WGX A;  1X0R A;  1PQN A;  5ENU A;  1FO5 A;  1K0M A;  5CO3 A;  1ZZY A;  4OFM A;  1TU7 A;  3FR3 A;  1TRV A;  2R5G A;  2PVO C;  1WIK A;  1GL8 A;  4YQM A;  2VUP A;  5KN2 A;  5DAL A;  1W4V A;  1ABA A;  1WMJ A;  3GHA A;  3GFK A;  2VD0 A;  4AGS A;  4O5R A;  1GLP A;  1OAZ A;  3QAV A;  1ZMA A;  4QL9 A;  4L0W A;  1VGL A;  1YKA A;  3IOS A;  2L57 A;  1ERU A;  3UMA A;  4KCA A;  2PBJ A;  5IQY A;  2MMO A;  2GQL A;  2HSY A;  2CVD A;  1EP8 A;  1TRW A;  1U6T A;  4HOJ A;  2EIR A;  4MZC A;  4WBR D;  3GA4 A;  5D8I A;  3LG6 A;  4KW6 A;  1PL1 A;  1YY7 A;  4K6X A;  5F8B A;  1N8J A;  4FYU A;  1XZO A;  5EVO A;  2I1U A;  1BAY A;  1E6B A;  2LTK A;  3I9V 2;  5LNK e;  3FY7 A;  2YWO A;  3LEF A;  2IME A;  3IR4 A;  4N10 A;  1I5G A;  4K0G A;  2L6C A;  2HE3 A;  4Q5N A;  3KTL A;  4G2E A;  3MWH A;  1EOH A;  3C8E A;  3C73 A;  3J7Y b;  4ZB8 A;  4O7H A;  3QAW A;  2OAC A;  5D93 A;  3GKX A;  5DQY A;  1O6J A;  5FT3 A;  1VF3 A;  4HDE A;  4YQU A;  2FA8 A;  2EIQ A;  1JZD A;  2B6M A;  1FAA A;  2H6Y A;  3UOM A;  4V2M A;  16GS A;  6GSU A;  3CXG A;  2P5R A;  2HSH A;  2YNX A;  5ECL B;  2LQQ A;  1VF4 A;  1R26 A;  5DCH A;  1YDK A;  5ID2 B;  4MMM A;  3D21 A;  4MJA A;  3QFA C;  1XVW A;  3IXR A;  1VRS D;  3H1N A;  3ERF A;  2H1D A;  1MD4 A;  1WRY A;  2VM2 A;  3L0H A;  3EU3 A;  2C0G A;  4GLT A;  4O92 A;  2FHE A;  2M72 A;  3ZLP A;  3US3 A;  4IVF A;  1A0F A;  4GF0 A;  5CYY A;  1UA5 A;  3DKS A;  3HJM A;  10GS A;  5JWQ B;  2X8C A;  3EMP A;  6GSS A;  4CDO A;  4ID0 A;  3DVX A;  4TR4 A;  2F8F A;  4RUV A;  1USB A;  4RI7 A;  4IEL A;  4Q5R A;  1V40 A;  2I81 A;  4XRA A;  1EV9 A;  3IE3 A;  4MLY A;  4XS6 A;  4TR3 A;  3IRA A;  2C8U A;  4KH7 A;  2JSY A;  1UN2 A;  4OWY A;  4XCS A;  3APO A;  2GS3 A;  1ML6 A;  6GSV A;  4OCF A;  5IIZ A;  1F3A A;  1M7T A;  4WET A;  2KP2 A;  2C0F A;  4GRF A;  1JLW A;  4OFN A;  2MYG A;  3FZA A;  5B6M A;  2NPB A;  4HU7 A;  1SYR A;  3UEM A;  2DML A;  2FWF A;  1TI3 A;  4EUY A;  3ZIT A;  3IPZ A;  2HNL A;  1EEJ A;  1JFU A;  1TW9 A;  2DC5 A;  2FLS A;  3L9S A;  2LNS A;  4XS1 A;  6GSW A;  1A0R P;  5IMA A;  5IM9 A;  1SKR B;  2OE1 A;  3BCK A;  4KND A;  5IO2 A;  3EC3 A;  1OC9 B;  4FO5 A;  3W8J A;  4IHU A;  4XS4 A;  3GV1 A;  1XW5 A;  1A24 A;  2HYX A;  2PMT A;  1TK0 B;  3TRP A;  3QMX A;  3TJG A;  1GSU A;  3GMF A;  3HXS A;  1V58 A;  4HJM A;  4EVM A;  2WB9 A;  5ECK B;  3ME8 A;  5G1L A;  3ZFB A;  1O7U A;  2H30 A;  2C0D A;  2H0H A;  3C7M A;  3M8N A;  1T00 A;  1U3A A;  2V6O A;  1WOU A;  4XRD A;  2YAN A;  3ZRE A;  2IMF A;  3QCP A;  4ULX A;  1GTA A;  5DCG A;  3IA1 A;  2R2J A;  2FWE A;  5HFK A;  1SL0 B;  4PX1 A;  3ZL5 A;  3O6T A;  1I9D A;  2AJQ B;  3PH9 A;  1BG5 A;  4TXO A;  1KEB A;  3S9F A;  2E2G A;  4FIW A;  1AXD A;  5GST A;  3MAK A;  3DWV A;  1K3O A;  4F0C A;  4ZBA A;  4JE1 A;  2E2M A;  1X9W B;  2FUG 2;  2AUV A;  2ZUP A;  2LUS A;  3EE2 A;  2LKU A;  1G6W A;  1TOF A;  4KDX A;  4XIH A;  3NZN A;  4KDY A;  11GS A;  1XOA A;  1EP7 A;  3HA9 A;  3H4K A;  3TRQ A;  2Z9S A;  2YJH A;  2GSQ A;  4IQ1 A;  3ZFL A;  2K6V A;  5AIV A;  4IJ3 A;  5J9B A;  3FKF A;  1K0C A;  3ZMK A;  2DIZ A;  2B5E A;  2AV4 A;  4YH2 A;  2VL9 A;  1HQO A;  2YP6 A;  2CAI A;  2HZE B;  2PER A;  1GUK A;  3HVX A;  4MH2 A;  3GN3 A;  3TKP A;  2PGT A;  4ZL8 A;  5CRG A;  4ZXG A;  2TIR A;  1THO A;  4F9Z A;  4F82 A;  1X9M B;  1ERV A;  4MPG A;  1EGO A;  2CX3 A;  3GKK A;  1NHO A;  3IBH A;  2QKE A;  1A2L A;  1PD2 1;  2A2R A;  1TJD A;  1PSQ A;  4TW5 A;  3ZIV A;  3CBU A;  2HFD A;  2X99 A;  3G7I A;  3KCM A;  5JWO B;  1G6Y A;  3F0I A;  4PQI A;  4D73 B;  5INY A;  4XTS A;  3GST A;  3TOU A;  7GSS A;  2GGT A;  1TKD B;  3MNG A;  4TOP A;  1NW2 A;  2JAC A;  3PGT A;  4WR5 A;  1MDI A;  3LQ7 A;  4J2F A;  2MZC A;  5KN3 A;  4J57 E;  4BVX A;  5EL8 A;  3C1S A;  3F3Q A;  2L6D A;  3L4N A;  4L0U A;  2HZF A;  4I2T A;  3CSI A;  2K8S A;  5ECQ B;  4KB3 A;  4E8E A;  1HNC A;  1XWK A;  3KH7 A;  3TGZ A;  4KDU A;  5H5Q A;  4V2L A;  2FCH A;  3UL3 A;  3D4M A;  2ON5 A;  4OCE A;  4Q5Q A;  4TXV A;  3IV4 A;  2DSA A;  2YV9 A;  2YWM A;  1ILO A;  3IC4 A;  4K2D A;  2FWH A;  4J56 E;  3ZYW A;  5GAP D;  3CRT A;  2F8A A;  3TKS C;  4PQH A;  4EXJ A;  4ZL7 A;  2ZNM A;  3GL3 A;  1G7E A;  5ID2 A;  4EDY A;  3TJK A;  4BVY A;  3LWA A;  4G19 A;  4N0V A;  3Q19 A;  1FG4 A;  3G9B A;  2VO4 A;  3FK8 A;  3ZZX A;  1QMV A;  2PVQ A;  4I5Q A;  3QFB C;  3BD2 A;  2L5L A;  1F37 A;  1GLQ A;  1YEX A;  4N11 A;  2AAW A;  3DRN A;  1UVZ A;  3F3R A;  1B4Q A;  4EO3 A;  4LL4 B;  1ERW A;  5AIS A;  3KMN A;  3D4T A;  3BOA A;  2WRT A;  2OE0 A;  2O85 A;  2ON7 A;  5F06 A;  2MBS A;  1EEM A;  1UC7 A;  1NM3 A;  2IFQ B;  4PNF A;  3F63 A;  1TU8 A;  1S3D A;  4PUR A;  1XOB A;  4IQA A;  2GST A;  3KP8 A;  3GIX A;  3PR8 A;  4CHS A;  2B3S A;  4DSQ A;  2YN1 A;  3HJP A;  1EV4 A;  2ES7 A;  3QOU A;  2L59 A;  2H0I A;  2D2Z A;  2IPA A;  2JAD A;  1GUH A;  3GH6 A;  1VF1 A;  5F0G A;  3IK9 A;  1Z6N A;  2CX4 A;  4YAV A;  2XBI A;  5LCZ A;  1GSS A;  3GUR A;  4GST A;  1XVQ A;  4BPY A;  1Z5Y E;  1O73 A;  4POB A;  4IW9 A;  2CT6 A;  1R5P A;  4MZB A;  1IYI A;  3O76 A;  14GS A;  5JWR B;  2NDO A;  3CSH A;  3GL5 A;  4LMW A;  2VLT A;  1K0A A;  1SL1 B;  1SKS B;  1K0N A;  1FB0 A;  4F0B A;  2L4Q A;  1Z7P A;  1KBN A;  2WUL A;  5IOX A;  5E59 A;  1Z9H A;  3AY8 A;  3ZTL A;  18GS A;  1LJR A;  1OC9 A;  19GS A;  2MMN A;  4PGT A;  2C1Y A;  3CMI A;  3LOR A;  1FHE A;  4NXI A;  2IMK A;  1F2E A;  5COH A;  1GSD A;  3L9U A;  4F03 A;  3P2A A;  4ZBB A;  2CA8 A;  3E0U A;  3EIN A;  1OYJ A;  3JCM L;  1TP9 A;  4IJI A;  5ECM B;  4O32 A;  3HVS A;  3UVT A;  1O85 A;  2FWG A;  5JCW A;  2PPT A;  4HZ4 A;  1XWC A;  4NMU A;  1SL2 B;  3HHV A;  3F8U A;  4FH8 A;  2KP1 A;  3L78 A;  2JSZ A;  1J0F A;  4GTU A;  2KOK A;  3ERG A;  3TDG A;  2GSR A;  5HR1 A;  2WCI A;  3G7Y A;  4HEA 2;  3EUR A;  4IN0 A;  2H73 A;  4MJB A;  2QC7 A;  4IBP A;  1R7H A;  2IL3 A;  3DXB A;  2AHE A;  5J4U A;  1K3L A;  3GTU B;  2EIO A;  1THX A;  4NWY A;  2P5Q A;  4QL7 A;  5CAX A;  1XPV A;  2KHP A;  1B9X C;  4G9H A;  1AUC A;  5ECH B;  2WZ9 A;  1PMT A;  4K1F A;  4PUF C;  1NHY A;  2FGX A;  1C72 A;  3LJR A;  1F6M C;  3N5O A;  2IJY A;  1A2J A;  2H1A A;  2V32 A;  3D0Z A;  1W89 A;  2DBC A;  3R2Q A;  2LV3 A;  4ISD A;  2X8G A;  2B7K A;  3KMO A;  4TVE A;  4WR4 A;  3G7J A;  5B7C A;  2HZE A;  4IP1 A;  1OC8 A;  5J5N A;  1YZX A;  3DVW A;  1Q4J A;  4JU5 A;  4DVC A;  1T4Z A;  1K0B A;  3TB2 A;  5D9W A;  2DJ3 A;  5D96 A;  2NTO A;  1PN9 A;  2VIM A;  2K9F A;  1K0O A;  4GXZ A;  2C4J A;  1SEN A;  1GTU A;  3C71 A;  4MJC A;  4AJ7 A;  2XC2 A;  5H5R A;  3GUS A;  3FRC A;  3GYK A;  3A3T A;  3GX0 A;  2BMX A;  1U88 A;  4D73 A;  4POL A;  5DJL A;  1M2B A;  4LLR A;  3MSZ A;  2E7P A;  3N9J A;  22GS A;  5AGY A;  1AC1 A;  3FZ5 A;  4FYC A;  2VL3 A;  2B5Y A;  3TOT A;  5IMC A;  1SKW B;  1QFN A;  2PWJ A;  5G30 A;  1ZOF A;  1M2D A;  2EC4 A;  2WFC A;  5HQP A;  3P90 A;  2HRN A;  2PN8 A;  2JZT A;  3GKM A;  3ERW A;  1PL2 A;  2DMM A;  2J9H A;  2CVK A;  3UVH A;  5ABR A;  1LU4 A;  1DSB A;  1M99 A;  3HYP A;  1TTZ A;  3VPT A;  5DQS A;  4MJE A;  4EE0 A;  2B5X A;  3BJ5 A;  4ML6 A;  5CRD A;  3FEU A;  2VL2 A;  1OKT A;  1T1V A;  2QGV A;  4WKW A;  4IGJ A;  2GDR A;  1YJ6 A;  2PU9 C;  3SBC A;  3UAR A;  3A2V A;  1BYE A;  1QK8 A;  2H6X A;  1F9M A;  1AQV A;  2H1G A;  4TRX A;  3H8Q A;  5G31 A;  4BL7 A;  2VCV A;  1ZGN A;  1MTC A;  3GKN A;  1OE8 A;  5ECS A;  3I69 A;  1SJI A;  1EWX A;  3UJ1 A;  3Q6O A;  3UAP A;  2IFQ A;  5IMZ A;  3Q18 A;  3M1G A;  3EVI A;  1T4Y A;  1JZR A;  2I4A A;  2GZZ A;  5JCU A;  3KGK A;  1XW6 A;  3ZRD A;  4YAP A;  1OC3 A;  2L4C A;  3WT2 A;  2MMA A;  3TJJ A;  4N0Z A;  1QQ2 A;  1SJZ A;  4HUA A;  3VLN A;  1DE2 A;  1SYX A;  3TJB A;  3IK7 A;  2TRX A;  3WD6 A;  3CYN A;  2VM1 A;  2M80 A;  4OFT A;  2YOI A;  4QQ7 A;  2IMD A;  1WP0 A;  1G7O A;  1Z7R A;  5LD0 A;  3TJF A;  2JZR A;  3VUR A;  1TK8 B;  4P3Y B;  3P8W A;  4JRR A;  1AQW A;  5DJM A;  2H70 A;  3WT1 A;  1V9W A;  3K8N A;  2O89 A;  1R5A A;  3KP9 A;  1GUL A;  4E8H A;  3VK9 A;  1T3B A;  5AN1 A;  3QD9 A;  2C3Q A;  2VCZ A;  3IAS 2;  5HFG A;  4MCU A;  3KTB A;  3HY2 A;  3FZ4 A;  2YV7 A;  4ECJ A;  1QGV A;  2WJU A;  3HJO A;  4WBJ A;  2V6K A;  3GX8 A;  1TI1 A;  2NBS A;  4KCE A;  5J3R A;  2YZH A;  1GTB A;  1S3A A;  2YWN A;  2RII A;  1WJK A;  2DJ2 A;  4K0N A;  1M0U A;  2LJA A;  1BX9 A;  3DML A;  3TRX A;  3KM6 A;  3E9J B;  1GSE A;  4WF5 A;  2VCW A;  4I2U A;  2FA4 A;  4KE3 A;  5FWG A;  1JHB A;  4GQF A;  4G10 A;  4KA0 A;  3E3E A;  2P31 A;  1SU9 A;  4PUA A;  5DBQ A;  4WF4 A; 
#chains in the Genus database with same CATH topology
 4ICY A;  1KNG A;  1HYU A;  5B8B A;  1RQM A;  5FHI A;  4ZL9 A;  4HI7 A;  2LRC A;  4TR1 B;  1G0T A;  3SWL A;  1MDJ A;  4MDC A;  1B4P A;  2H8L A;  4BWQ A;  2LST A;  4L5O A;  3RDW A;  3GTU A;  3TKR A;  1IYH A;  4IP6 A;  4RI6 A;  1SJ6 A;  3CRU A;  2MMZ A;  1ZYP A;  4GQC A;  1PX7 A;  2L5O A;  3WYW A;  1Z6M A;  3BCI A;  2X4A A;  2DKI A;  3C1R A;  2YCD A;  4X1U A;  4JBB A;  1OKD A;  1ZYN A;  4K9Z A;  2GZY A;  2CZ3 A;  5A4U A;  3NIV A;  3IHQ A;  3VWW A;  4ECC A;  5IPG A;  4ECB A;  1EGR A;  2VLV A;  3VI5 A;  3M0F A;  3NOF A;  3KXO A;  4MNN A;  5AIX A;  1O8W A;  2KUC A;  1RW1 A;  4PXO A;  2V1M A;  2XHF A;  1FOV A;  4AF2 A;  1X9S B;  1PKZ A;  1Z3E A;  1DBY A;  1HNA A;  1QXH A;  1H75 A;  2F51 A;  5IMD A;  2GVP A;  1X5E A;  4PQ1 A;  1H4O A;  3GNJ A;  1EZK A;  1X5D A;  4WXT A;  2R0P A;  3ED3 A;  5A4W A;  4L8E A;  4WEY A;  3ZIJ A;  1JZO A;  3H79 A;  4F2I A;  2E0Q A;  1GRX A;  2GQK A;  2HI7 A;  12GS A;  2LJR A;  2I3Y A;  4V1A p;  2I9H A;  2WGR A;  3EMX A;  3CSJ A;  1WPI A;  3P7X A;  5ECR B;  5ELG A;  4I6X A;  3O3T A;  1ZYE A;  2K18 A;  1OE7 A;  9GSS A;  2R3X A;  2P0G A;  2GTU A;  2NVL A;  3LYK A;  1SD9 A;  2RUE A;  5G5F A;  5IOW A;  1PA3 A;  3FZ9 A;  1WE0 A;  4BA7 A;  2CAQ A;  3HZ8 A;  1S3R A;  3ISO A;  3F4R A;  4KAE A;  2RM5 A;  4MZW A;  5D9X A;  3M3M A;  4K7O A;  5CRW A;  3FMW A;  1LBK A;  2H19 A;  1CQG A;  1PN0 A;  5DAK B;  3W6G A;  2VAF A;  2H01 A;  3QR6 A;  1ZYQ B;  4HJ2 A;  1NSW A;  4PNG A;  1T7P B;  2GQM A;  2HXK A;  3TUE A;  4ACS A;  3J7Y k;  4AJ8 A;  1J08 A;  4YQV A;  2N5B A;  6GST A;  1PX6 A;  1ZL9 A;  2LNT A;  1AW9 A;  3QDN A;  3VWV A;  1XWA A;  2DLX A;  2LJK A;  3HZ4 A;  3I6A A;  4ZBD A;  1GP1 A;  4TR0 A;  4AJ6 A;  5EPF A;  3HVV A;  2GLR A;  3QAG A;  3LXZ A;  4OO5 A;  4DSS B;  2R37 A;  2VCQ A;  3F4S A;  2IIY A;  3KH9 A;  3KD0 A;  5CP1 A;  2X64 A;  2R0C A;  2X8H A;  2GSS A;  2HLS A;  1TRU A;  2YZU A;  4JR6 A;  3F6F A;  2REM A;  4ZIJ A;  1YF0 A;  5KN1 A;  1A8L A;  2H76 A;  1B9Y C;  4TN8 A;  2ZCT A;  5KN0 A;  1U87 A;  3HDC A;  2F9S A;  2A4V A;  1V2A A;  2V41 A;  1XXU A;  2R6K A;  3FR6 A;  1SK2 A;  3ZVJ D;  1DE1 A;  2RLI A;  2B1K A;  2IN3 A;  2V2G A;  5JCG A;  2O87 A;  3Q74 A;  2IWT A;  5KEJ A;  4MF5 A;  2N5A A;  2QA2 A;  3M9K A;  3PIN A;  3EYT A;  1AAZ A;  3F9U A;  4POK A;  1GSF A;  5IPH A;  4I97 A;  1VF2 A;  4EKZ A;  3A2X A;  4GSN A;  3A5W A;  3UBL A;  1Y6E A;  4K7N A;  3I43 A;  1TXX A;  3D22 A;  1AQX A;  1JLV A;  3RHC A;  2XPD A;  1PFO A;  5IMV A;  5B8A A;  2R4V A;  1S3C A;  1RK4 A;  5GAN D;  1YEP A;  1XW9 A;  4BWS A;  8GSS A;  1ZCP A;  1QUW A;  4EL1 A;  4K2X A;  2OKA A;  1GSY A;  2B1L A;  1A2M A;  3HKR A;  3FR9 A;  1XCC A;  3GRX A;  2DJ1 A;  1SD8 A;  1GH2 A;  1K0D A;  4MF6 A;  4MA9 A;  4RQR A;  3ZVJ A;  3TKS E;  5J9C A;  1GNW A;  5ECI B;  4KX4 A;  2H1B A;  20GS A;  1HNB A;  4KUN A;  4KSO A;  3DYR A;  3MDK A;  2J23 A;  5DDL A;  1A23 A;  5J41 A;  2OJL A;  4TR1 A;  2H71 A;  4ZB6 A;  5HFI A;  1YF1 A;  2O8V B;  5DAL B;  3IDV A;  1FB6 A;  5C00 A;  4DEJ A;  3EU4 A;  1ERT A;  5G2Z A;  2DJ0 A;  1B8X A;  5D9V A;  2JL4 A;  3M9J A;  1ACV A;  3KIJ A;  1XG8 A;  1AIU A;  5A4V A;  4MPF A;  3D5J A;  1MDK A;  4NAX A;  4EF0 A;  2YJ7 A;  1XIY A;  1V98 A;  5EY6 A;  2XBQ A;  2TRC P;  1FW1 A;  3MYD A;  3U5R E;  5F05 A;  4K7I A;  3DD3 A;  1M9A A;  5CRH A;  1GSQ A;  4X0X A;  3H93 A;  3HVN A;  5G1K A;  1OVN A;  3HCZ A;  2HT9 A;  5IMF A;  2CV4 A;  1SK0 A;  3F4T A;  3R3E A;  2FY6 A;  5H5S A;  1XFL A;  4PTS A;  2ALB A;  1FVJ A;  1TRS A;  3L9V A;  2WS2 A;  2VLU A;  2OAD A;  2BTO T;  2FNO A;  4TKY A;  3DIE A;  3RPP A;  1M3J A;  4FQU A;  1ON4 A;  4OD7 A;  3WGD A;  4DSR A;  2VOC A;  1BED A;  2C80 A;  6GSY A;  3APQ A;  3KZQ A;  4MF7 A;  3ME7 A;  5HR0 A;  2LS5 A;  1GTI A;  3RBT A;  3IAM 2;  3D6I A;  3WGE A;  4NV2 A;  2GT6 A;  4GWR A;  4OO4 A;  2HRA A;  4XHM A;  1E2Y A;  2CVB A;  4EDZ A;  4ECI A;  1K3Y A;  5D73 A;  1XWG A;  3OR5 A;  1WWJ A;  3W8S A;  3F6D A;  2H74 A;  4HU9 A;  5IO0 A;  2OE3 A;  5L71 A;  1YKC A;  5GZZ B;  1R4W A;  2VL2 C;  4X43 A;  2AB6 A;  4HQS A;  1V57 A;  2YPM A;  3CTG A;  5A5K A;  4RQX A;  1J9B A;  2M46 A;  1T8E B;  4JR4 A;  5F07 A;  1BQ7 A;  3VWU A;  2N5F A;  2AYT A;  3KJY A;  4HZ2 A;  1A8Y A;  4ZIL A;  3DGQ A;  4JZQ A;  2CQ9 A;  3CTF A;  3LGC A;  3TKS A;  4MAB A;  1EOG A;  4JED A;  1PRX A;  4OMV A;  4V2N A;  4ILF A;  1GNE A;  1KTE A;  1F3B A;  1O81 A;  3TKQ A;  5DVB A;  3UIW A;  3LSZ A;  5DAK A;  1Q98 A;  3FHK A;  3CQF A;  2OA7 A;  4LMV A;  2F3M A;  2VCT A;  3VPQ A;  2WDU A;  2GZP A;  2MBT A;  1GUM A;  3V1W A;  4N30 A;  4NHW A;  5ECP B;  1O8X A;  3LFL A;  2C3N A;  2KLX A;  4FYB A;  2JU5 A;  2OBI A;  3QPM A;  2VCX A;  2H6Z A;  5ECN B;  2LEG A;  3RPN A;  4HS1 A;  1Y25 A;  3LXT A;  4ZB9 A;  1BJX A;  2QSI A;  3ZML A;  4ML1 A;  4HQZ A;  2GT5 A;  2RM6 A;  2O7K A;  4K8M A;  5CRE A;  2A2S A;  2C0E A;  2HRF A;  4DSS A;  3UBK A;  1TK5 B;  2DIY A;  4GCI A;  3VWX A;  2FD3 A;  1PGT A;  3U6V A;  4IKH A;  3A2W A;  1M2A A;  3KEB A;  3GSS A;  2G2Q A;  2VD1 A;  3BBY A;  4IS0 A;  5HR3 A;  5ELA A;  3EWL A;  1DUG A;  4XS4 B;  4Z7X A;  3VI7 A;  5HR2 A;  3TCO A;  4MK3 A;  4POM A;  5GSS A;  2G0F A;  2B7J A;  4CW9 A;  4EC0 A;  4Q5F A;  3FW2 A;  4L5L A;  1M9B A;  2JZS A;  2LRT A;  3VFI A;  1SK1 A;  3LYP A;  4I8B A;  1GWC A;  1HD2 A;  2H72 A;  2K8V A;  3FYG A;  5C04 A;  6GSX A;  2PUK C;  4MP4 A;  3DEX A;  1N2A A;  3RAZ A;  4MH3 A;  1ST9 A;  5D9T A;  4KSM A;  2H0G A;  2XPE A;  3HD5 A;  2HSM A;  1URM A;  3APS A;  5G5E A;  1JZW A;  2OBK A;  5BRT A;  2H75 A;  1YQ1 A;  2DJJ A;  3RHB A;  2LQO A;  5ECO B;  1XBS A;  1U3I A;  2C3T A;  2BJX A;  4LA1 A;  2RUF A;  17GS A;  2DJK A;  4TXO B;  1TDI A;  1PKW A;  4H86 A;  1XWB A;  1FVK A;  1MD3 A;  2CZ2 A;  1MEK A;  2IMI A;  4LL1 B;  1B48 A;  13GS A;  2H66 A;  5CNW A;  4KGI A;  2LRN A;  3GH9 A;  4NV5 A;  4V1A g;  4NPB A;  1X5C A;  2YWI A;  4NHZ A;  1CQH A;  5B6N A;  4GSS A;  5E4W A;  3WGX A;  1X0R A;  1PQN A;  5ENU A;  1FO5 A;  1K0M A;  5CO3 A;  1ZZY A;  4OFM A;  1TU7 A;  3FR3 A;  1TRV A;  2R5G A;  2PVO C;  1WIK A;  1GL8 A;  4YQM A;  2VUP A;  5KN2 A;  5DAL A;  1W4V A;  1ABA A;  1WMJ A;  3GHA A;  3GFK A;  2VD0 A;  4AGS A;  4O5R A;  1GLP A;  1OAZ A;  3QAV A;  1ZMA A;  4QL9 A;  4L0W A;  1VGL A;  1YKA A;  3IOS A;  2L57 A;  1ERU A;  3UMA A;  4KCA A;  2PBJ A;  5IQY A;  2MMO A;  2GQL A;  2HSY A;  2CVD A;  1EP8 A;  2UZ8 A;  1TRW A;  1U6T A;  4HOJ A;  2EIR A;  4MZC A;  4WBR D;  3GA4 A;  5D8I A;  3LG6 A;  4KW6 A;  1PL1 A;  1YY7 A;  3PPU A;  4K6X A;  5F8B A;  1N8J A;  4FYU A;  1XZO A;  5EVO A;  2I1U A;  1BAY A;  1E6B A;  2LTK A;  3I9V 2;  5LNK e;  3FY7 A;  2YWO A;  3LEF A;  2IME A;  3IR4 A;  4N10 A;  4BVX B;  1I5G A;  4K0G A;  2L6C A;  2HE3 A;  4Q5N A;  3KTL A;  4G2E A;  3MWH A;  1EOH A;  3C8E A;  3C73 A;  3J7Y b;  4ZB8 A;  4O7H A;  3QAW A;  2OAC A;  5D93 A;  3GKX A;  5DQY A;  1O6J A;  5FT3 A;  1VF3 A;  4HDE A;  4YQU A;  2FA8 A;  2EIQ A;  1JZD A;  2B6M A;  1FAA A;  2H6Y A;  3UOM A;  4V2M A;  16GS A;  6GSU A;  2DKH A;  3CXG A;  2P5R A;  2HSH A;  2YNX A;  5ECL B;  2LQQ A;  1VF4 A;  1R26 A;  5DCH A;  1YDK A;  5ID2 B;  4MMM A;  4BVY B;  3D21 A;  4MJA A;  3QFA C;  1XVW A;  3IXR A;  1VRS D;  3H1N A;  3ERF A;  2H1D A;  1FOH A;  1MD4 A;  4EIQ A;  1WRY A;  2VM2 A;  3L0H A;  3EU3 A;  2C0G A;  4GLT A;  4O92 A;  2FHE A;  2M72 A;  3ZLP A;  3US3 A;  4IVF A;  1A0F A;  4GF0 A;  5CYY A;  1UA5 A;  3DKS A;  3HJM A;  10GS A;  5JWQ B;  2X8C A;  3EMP A;  6GSS A;  4CDO A;  2A4H A;  4ID0 A;  3DVX A;  4TR4 A;  2F8F A;  4RUV A;  1USB A;  4RI7 A;  4IEL A;  4Q5R A;  1V40 A;  2I81 A;  4XRA A;  1EV9 A;  3IE3 A;  4MLY A;  4XS6 A;  4TR3 A;  3IRA A;  2C8U A;  4KH7 A;  2JSY A;  1UN2 A;  4OWY A;  4XCS A;  3APO A;  2GS3 A;  1ML6 A;  6GSV A;  4OCF A;  5IIZ A;  1F3A A;  1M7T A;  4WET A;  2KP2 A;  2C0F A;  4GRF A;  1JLW A;  4OFN A;  2MYG A;  3FZA A;  5B6M A;  2NPB A;  4HU7 A;  1SYR A;  3UEM A;  2DML A;  2FWF A;  1TI3 A;  4EUY A;  2X49 A;  4A5P A;  3ZIT A;  4USS A;  3IPZ A;  2HNL A;  1EEJ A;  1JFU A;  1TW9 A;  2DC5 A;  2FLS A;  3L9S A;  2LNS A;  4XS1 A;  6GSW A;  1A0R P;  5IMA A;  5IM9 A;  1SKR B;  2OE1 A;  3BCK A;  4K5S A;  4KND A;  5IO2 A;  3EC3 A;  4Z2R A;  1OC9 B;  4FO5 A;  3W8J A;  4IHU A;  4XS4 A;  3GV1 A;  1XW5 A;  1A24 A;  2HYX A;  2PMT A;  1TK0 B;  3TRP A;  3QMX A;  3TJG A;  1GSU A;  3GMF A;  3HXS A;  1V58 A;  4HJM A;  4EVM A;  2WB9 A;  5ECK B;  3ME8 A;  5G1L A;  3ZFB A;  1O7U A;  2H30 A;  2C0D A;  2H0H A;  3C7M A;  3M8N A;  1T00 A;  1U3A A;  2V6O A;  1WOU A;  4XRD A;  2YAN A;  3ZRE A;  2IMF A;  3QCP A;  4ULX A;  1GTA A;  5DCG A;  3IA1 A;  2R2J A;  2FWE A;  5HFK A;  1SL0 B;  4PX1 A;  3ZL5 A;  3O6T A;  1I9D A;  2AJQ B;  3PH9 A;  1BG5 A;  4TXO A;  1KEB A;  3S9F A;  2E2G A;  4FIW A;  1AXD A;  5GST A;  3MAK A;  5KOX A;  3A5I A;  3DWV A;  1K3O A;  4F0C A;  4ZBA A;  4JE1 A;  2E2M A;  1X9W B;  2FUG 2;  2AUV A;  2ZUP A;  3LW9 A;  2LUS A;  3EE2 A;  2LKU A;  1G6W A;  1TOF A;  4KDX A;  4XIH A;  3NZN A;  4KDY A;  11GS A;  1XOA A;  3MIX A;  1EP7 A;  3HA9 A;  3H4K A;  3TRQ A;  2Z9S A;  2YJH A;  2GSQ A;  4IQ1 A;  3ZFL A;  2K6V A;  3IHG A;  5AIV A;  4IJ3 A;  5J9B A;  3FKF A;  1K0C A;  3ZMK A;  2DIZ A;  2B5E A;  2AV4 A;  4YH2 A;  2VL9 A;  1HQO A;  2YP6 A;  2CAI A;  2HZE B;  2PER A;  1GUK A;  3HVX A;  4MH2 A;  3GN3 A;  3TKP A;  2PGT A;  4ZL8 A;  5CRG A;  4ZXG A;  2TIR A;  1THO A;  4F9Z A;  4F82 A;  1X9M B;  1ERV A;  4MPG A;  1EGO A;  2CX3 A;  3GKK A;  1NHO A;  3IBH A;  2QKE A;  1A2L A;  1PD2 1;  2A2R A;  1TJD A;  4KF9 A;  1PSQ A;  4TW5 A;  3ZIV A;  3CBU A;  2HFD A;  2X99 A;  3G7I A;  3KCM A;  5JWO B;  1G6Y A;  3F0I A;  4PQI A;  4D73 B;  5INY A;  4XTS A;  3GST A;  3TOU A;  7GSS A;  2GGT A;  1TKD B;  3MNG A;  4TOP A;  1NW2 A;  2JAC A;  3PGT A;  4WR5 A;  1MDI A;  3LQ7 A;  4J2F A;  2MZC A;  2HRK A;  5KN3 A;  4J57 E;  4BVX A;  5EL8 A;  3C1S A;  3F3Q A;  2L6D A;  3L4N A;  4L0U A;  2HZF A;  4I2T A;  3CSI A;  2K8S A;  5ECQ B;  4KB3 A;  4E8E A;  1HNC A;  1XWK A;  3KH7 A;  3TGZ A;  4KDU A;  5H5Q A;  4V2L A;  2FCH A;  3UL3 A;  3D4M A;  4EIP A;  2ON5 A;  4OCE A;  4Q5Q A;  4TXV A;  3IV4 A;  2DSA A;  2YV9 A;  2YWM A;  1ILO A;  3IC4 A;  4K2D A;  2FWH A;  4HSC X;  4J56 E;  3ZYW A;  5GAP D;  3CRT A;  2F8A A;  3TKS C;  4PQH A;  4EXJ A;  4ZL7 A;  2ZNM A;  3GL3 A;  1G7E A;  5ID2 A;  4EDY A;  3TJK A;  4BVY A;  3LWA A;  4G19 A;  4N0V A;  4Z2T A;  3Q19 A;  1FG4 A;  3G9B A;  2VO4 A;  3FK8 A;  3ZZX A;  1QMV A;  2PVQ A;  4I5Q A;  3QFB C;  3BD2 A;  2L5L A;  1F37 A;  1GLQ A;  1YEX A;  4N11 A;  2AAW A;  3DRN A;  1UVZ A;  3F3R A;  1B4Q A;  4BL7 B;  4EO3 A;  4LL4 B;  1ERW A;  5AIS A;  3KMN A;  3D4T A;  3BOA A;  2WRT A;  2OE0 A;  2O85 A;  4YKF A;  2ON7 A;  5F06 A;  2MBS A;  1EEM A;  1UC7 A;  1NM3 A;  2IFQ B;  4PNF A;  3F63 A;  4O5Q A;  1TU8 A;  1S3D A;  4PUR A;  1XOB A;  4IQA A;  2GST A;  3KP8 A;  3GIX A;  2R0G A;  3PR8 A;  4CHS A;  2B3S A;  4DSQ A;  2YN1 A;  3HJP A;  1EV4 A;  2ES7 A;  3QOU A;  2L59 A;  2H0I A;  2D2Z A;  2IPA A;  2JAD A;  1GUH A;  4G0L A;  3GH6 A;  1VF1 A;  5F0G A;  3IK9 A;  1Z6N A;  5KOW A;  2CX4 A;  4YAV A;  2XBI A;  5LCZ A;  1GSS A;  3GUR A;  4GST A;  1XVQ A;  4BPY A;  1Z5Y E;  1O73 A;  4POB A;  4IW9 A;  2CT6 A;  3EPT A;  1R5P A;  4MZB A;  1IYI A;  3O76 A;  14GS A;  5JWR B;  2NDO A;  3CSH A;  3GL5 A;  4G0K A;  4LMW A;  2VLT A;  1K0A A;  1SL1 B;  1SKS B;  1K0N A;  1FB0 A;  4F0B A;  2L4Q A;  1Z7P A;  1KBN A;  2WUL A;  5IOX A;  5E59 A;  1Z9H A;  3AY8 A;  3ZTL A;  18GS A;  1LJR A;  1OC9 A;  19GS A;  2MMN A;  4PGT A;  2C1Y A;  3CMI A;  3LOR A;  1FHE A;  4NXI A;  2IMK A;  1F2E A;  5COH A;  1GSD A;  3L9U A;  4F03 A;  3P2A A;  4ZBB A;  2CA8 A;  3E0U A;  3EIN A;  1OYJ A;  3JCM L;  1TP9 A;  4IJI A;  5ECM B;  4O32 A;  3HVS A;  3UVT A;  1O85 A;  2FWG A;  4YKG A;  5JCW A;  2PPT A;  4HZ4 A;  1XWC A;  4NMU A;  1SL2 B;  3HHV A;  3F8U A;  4FH8 A;  2KP1 A;  3L78 A;  2JSZ A;  1J0F A;  4GTU A;  2KOK A;  3ERG A;  3TDG A;  2GSR A;  5HR1 A;  2WCI A;  3G7Y A;  4HEA 2;  3EUR A;  4IN0 A;  2H73 A;  2QA1 A;  4G0I A;  4MJB A;  2QC7 A;  4IBP A;  1R7H A;  2IL3 A;  3DXB A;  2AHE A;  5J4U A;  1K3L A;  3GTU B;  2EIO A;  1THX A;  4NWY A;  2P5Q A;  4QL7 A;  5CAX A;  1XPV A;  2KHP A;  1B9X C;  4G9H A;  1AUC A;  5ECH B;  2WZ9 A;  1PMT A;  4K1F A;  4PUF C;  1NHY A;  2FGX A;  1C72 A;  3LJR A;  1F6M C;  3N5O A;  2IJY A;  1A2J A;  2H1A A;  2V32 A;  3D0Z A;  1W89 A;  2DBC A;  3R2Q A;  2LV3 A;  4ISD A;  2X8G A;  2B7K A;  3KMO A;  4TVE A;  4WR4 A;  3G7J A;  5B7C A;  2A2P A;  2HZE A;  4IP1 A;  4X4J A;  1OC8 A;  5J5N A;  1YZX A;  3DVW A;  1Q4J A;  4JU5 A;  4DVC A;  1T4Z A;  1K0B A;  3TB2 A;  5D9W A;  2DJ3 A;  5D96 A;  2NTO A;  1PN9 A;  2VIM A;  2K9F A;  1K0O A;  4GXZ A;  2C4J A;  1SEN A;  1GTU A;  3C71 A;  4MJC A;  4AJ7 A;  2XC2 A;  5H5R A;  3GUS A;  3FRC A;  3GYK A;  3A3T A;  3GX0 A;  2BMX A;  1U88 A;  4D73 A;  4POL A;  5DJL A;  1M2B A;  4CY6 A;  4LLR A;  3MSZ A;  2E7P A;  3N9J A;  22GS A;  5AGY A;  1AC1 A;  3FZ5 A;  4FYC A;  2VL3 A;  2B5Y A;  3TOT A;  5IMC A;  1SKW B;  1QFN A;  2PWJ A;  5G30 A;  1ZOF A;  1M2D A;  4K5R A;  2EC4 A;  2WFC A;  5HQP A;  3P90 A;  2HRN A;  2PN8 A;  2JZT A;  3GKM A;  3ERW A;  1PL2 A;  2DMM A;  2J9H A;  2CVK A;  3UVH A;  5ABR A;  1LU4 A;  1DSB A;  1M99 A;  3HYP A;  4CY8 A;  1TTZ A;  3VPT A;  5DQS A;  4MJE A;  4EE0 A;  2B5X A;  3BJ5 A;  4ML6 A;  5CRD A;  3FEU A;  2VL2 A;  1OKT A;  1T1V A;  2QGV A;  4WKW A;  4IGJ A;  2GDR A;  1YJ6 A;  2PU9 C;  3SBC A;  3UAR A;  3A2V A;  1BYE A;  1QK8 A;  2H6X A;  1F9M A;  1AQV A;  2H1G A;  4TRX A;  3H8Q A;  5G31 A;  4BL7 A;  2VCV A;  1ZGN A;  1MTC A;  3GKN A;  1OE8 A;  5ECS A;  3I69 A;  1SJI A;  1EWX A;  3UJ1 A;  3Q6O A;  3UAP A;  2IFQ A;  5IMZ A;  3Q18 A;  3M1G A;  3EVI A;  1T4Y A;  1JZR A;  2I4A A;  2GZZ A;  5JCU A;  3KGK A;  1XW6 A;  3ZRD A;  4YAP A;  1OC3 A;  2L4C A;  3WT2 A;  2MMA A;  1M3I A;  3TJJ A;  4N0Z A;  1QQ2 A;  1SJZ A;  4HUA A;  4O5U A;  3VLN A;  1DE2 A;  1SYX A;  3TJB A;  3IK7 A;  2TRX A;  3WD6 A;  3CYN A;  2VM1 A;  2M80 A;  4OFT A;  2YOI A;  4QQ7 A;  2IMD A;  1WP0 A;  1G7O A;  1Z7R A;  5LD0 A;  3TJF A;  2JZR A;  3VUR A;  1TK8 B;  4P3Y B;  5BMU A;  3P8W A;  4JRR A;  1AQW A;  5DJM A;  2H70 A;  3WT1 A;  1V9W A;  3K8N A;  2O89 A;  1R5A A;  4BIK A;  3KP9 A;  1GUL A;  4E8H A;  3VK9 A;  1T3B A;  5AN1 A;  3QD9 A;  2C3Q A;  2VCZ A;  3IAS 2;  5HFG A;  4MCU A;  3KTB A;  3IC8 A;  3HY2 A;  3FZ4 A;  2YV7 A;  4ECJ A;  4Z2U A;  1QGV A;  2WJU A;  3HJO A;  4WBJ A;  2V6K A;  3GX8 A;  1TI1 A;  2NBS A;  4KCE A;  5J3R A;  2YZH A;  1GTB A;  1S3A A;  2YWN A;  2RII A;  1WJK A;  2DJ2 A;  4K0N A;  1M0U A;  2LJA A;  1BX9 A;  3DML A;  3TRX A;  3KM6 A;  3E9J B;  1GSE A;  4WF5 A;  2VCW A;  4I2U A;  2FA4 A;  4KE3 A;  5FWG A;  1JHB A;  4GQF A;  4G10 A;  4KA0 A;  3E3E A;  2P31 A;  1SU9 A;  4PUA A;  5DBQ A;  4WF4 A; 
#chains in the Genus database with same CATH homology
 4ICY A;  1KNG A;  1HYU A;  5B8B A;  1RQM A;  5FHI A;  4ZL9 A;  4HI7 A;  2LRC A;  4TR1 B;  1G0T A;  3SWL A;  1MDJ A;  4MDC A;  1B4P A;  2H8L A;  4BWQ A;  2LST A;  4L5O A;  3RDW A;  3GTU A;  3TKR A;  1IYH A;  4IP6 A;  4RI6 A;  1SJ6 A;  3CRU A;  2MMZ A;  1ZYP A;  4GQC A;  1PX7 A;  2L5O A;  3WYW A;  1Z6M A;  3BCI A;  2X4A A;  2DKI A;  3C1R A;  2YCD A;  4X1U A;  4JBB A;  1OKD A;  1ZYN A;  4K9Z A;  2GZY A;  2CZ3 A;  5A4U A;  3NIV A;  3IHQ A;  3VWW A;  4ECC A;  5IPG A;  4ECB A;  1EGR A;  2VLV A;  3VI5 A;  3M0F A;  3NOF A;  3KXO A;  4MNN A;  5AIX A;  1O8W A;  2KUC A;  1RW1 A;  4PXO A;  2V1M A;  2XHF A;  1FOV A;  4AF2 A;  1X9S B;  1PKZ A;  1Z3E A;  1DBY A;  1HNA A;  1QXH A;  1H75 A;  2F51 A;  5IMD A;  2GVP A;  1X5E A;  4PQ1 A;  1H4O A;  3GNJ A;  1EZK A;  1X5D A;  4WXT A;  2R0P A;  3ED3 A;  5A4W A;  4L8E A;  4WEY A;  3ZIJ A;  1JZO A;  3H79 A;  4F2I A;  2E0Q A;  1GRX A;  2GQK A;  2HI7 A;  12GS A;  2LJR A;  2I3Y A;  4V1A p;  2I9H A;  2WGR A;  3EMX A;  3CSJ A;  1WPI A;  3P7X A;  5ECR B;  5ELG A;  4I6X A;  3O3T A;  1ZYE A;  2K18 A;  1OE7 A;  9GSS A;  2R3X A;  2P0G A;  2GTU A;  2NVL A;  3LYK A;  1SD9 A;  2RUE A;  5G5F A;  5IOW A;  1PA3 A;  3FZ9 A;  1WE0 A;  4BA7 A;  2CAQ A;  3HZ8 A;  3ISO A;  3F4R A;  4KAE A;  2RM5 A;  4MZW A;  5D9X A;  3M3M A;  4K7O A;  5CRW A;  3FMW A;  1LBK A;  2H19 A;  1CQG A;  1PN0 A;  5DAK B;  3W6G A;  2VAF A;  2H01 A;  3QR6 A;  1ZYQ B;  4HJ2 A;  1NSW A;  4PNG A;  1T7P B;  2GQM A;  2HXK A;  3TUE A;  4ACS A;  3J7Y k;  4AJ8 A;  1J08 A;  4YQV A;  2N5B A;  6GST A;  1PX6 A;  1ZL9 A;  2LNT A;  1AW9 A;  3QDN A;  3VWV A;  1XWA A;  2DLX A;  2LJK A;  3HZ4 A;  3I6A A;  4ZBD A;  1GP1 A;  4TR0 A;  4AJ6 A;  5EPF A;  3HVV A;  2GLR A;  3QAG A;  3LXZ A;  4OO5 A;  4DSS B;  2R37 A;  2VCQ A;  3F4S A;  2IIY A;  3KH9 A;  3KD0 A;  5CP1 A;  2X64 A;  2R0C A;  2X8H A;  2GSS A;  2HLS A;  1TRU A;  2YZU A;  4JR6 A;  3F6F A;  2REM A;  4ZIJ A;  1YF0 A;  5KN1 A;  1A8L A;  2H76 A;  1B9Y C;  4TN8 A;  2ZCT A;  5KN0 A;  1U87 A;  3HDC A;  2F9S A;  2A4V A;  1V2A A;  2V41 A;  1XXU A;  2R6K A;  3FR6 A;  1SK2 A;  3ZVJ D;  1DE1 A;  2RLI A;  2B1K A;  2IN3 A;  2V2G A;  5JCG A;  2O87 A;  3Q74 A;  2IWT A;  5KEJ A;  4MF5 A;  2N5A A;  2QA2 A;  3M9K A;  3PIN A;  3EYT A;  1AAZ A;  3F9U A;  4POK A;  1GSF A;  5IPH A;  4I97 A;  1VF2 A;  4EKZ A;  3A2X A;  4GSN A;  3A5W A;  3UBL A;  1Y6E A;  4K7N A;  3I43 A;  1TXX A;  3D22 A;  1AQX A;  1JLV A;  3RHC A;  2XPD A;  5IMV A;  5B8A A;  2R4V A;  1S3C A;  1RK4 A;  5GAN D;  1YEP A;  1XW9 A;  4BWS A;  8GSS A;  1ZCP A;  1QUW A;  4EL1 A;  4K2X A;  2OKA A;  1GSY A;  2B1L A;  1A2M A;  3HKR A;  3FR9 A;  1XCC A;  3GRX A;  2DJ1 A;  1SD8 A;  1GH2 A;  1K0D A;  4MF6 A;  4MA9 A;  4RQR A;  3ZVJ A;  3TKS E;  5J9C A;  1GNW A;  5ECI B;  4KX4 A;  2H1B A;  20GS A;  1HNB A;  4KUN A;  4KSO A;  3DYR A;  3MDK A;  2J23 A;  5DDL A;  1A23 A;  5J41 A;  2OJL A;  4TR1 A;  2H71 A;  4ZB6 A;  5HFI A;  1YF1 A;  2O8V B;  5DAL B;  3IDV A;  1FB6 A;  5C00 A;  4DEJ A;  3EU4 A;  1ERT A;  5G2Z A;  2DJ0 A;  1B8X A;  5D9V A;  2JL4 A;  3M9J A;  1ACV A;  3KIJ A;  1AIU A;  5A4V A;  4MPF A;  3D5J A;  1MDK A;  4NAX A;  4EF0 A;  2YJ7 A;  1XIY A;  1V98 A;  5EY6 A;  2XBQ A;  2TRC P;  1FW1 A;  3MYD A;  3U5R E;  5F05 A;  4K7I A;  3DD3 A;  1M9A A;  5CRH A;  1GSQ A;  4X0X A;  3H93 A;  5G1K A;  1OVN A;  3HCZ A;  2HT9 A;  5IMF A;  2CV4 A;  1SK0 A;  3F4T A;  3R3E A;  2FY6 A;  5H5S A;  1XFL A;  4PTS A;  2ALB A;  1FVJ A;  1TRS A;  3L9V A;  2WS2 A;  2VLU A;  2OAD A;  2BTO T;  2FNO A;  4TKY A;  3DIE A;  3RPP A;  4FQU A;  1ON4 A;  4OD7 A;  3WGD A;  4DSR A;  2VOC A;  1BED A;  2C80 A;  6GSY A;  3APQ A;  3KZQ A;  4MF7 A;  3ME7 A;  5HR0 A;  2LS5 A;  1GTI A;  3RBT A;  3IAM 2;  3D6I A;  3WGE A;  4NV2 A;  2GT6 A;  4GWR A;  4OO4 A;  2HRA A;  4XHM A;  1E2Y A;  2CVB A;  4EDZ A;  4ECI A;  1K3Y A;  5D73 A;  1XWG A;  3OR5 A;  1WWJ A;  3W8S A;  3F6D A;  2H74 A;  4HU9 A;  5IO0 A;  2OE3 A;  5L71 A;  1YKC A;  5GZZ B;  1R4W A;  2VL2 C;  4X43 A;  2AB6 A;  4HQS A;  1V57 A;  2YPM A;  3CTG A;  5A5K A;  4RQX A;  1J9B A;  2M46 A;  1T8E B;  4JR4 A;  5F07 A;  1BQ7 A;  3VWU A;  2N5F A;  2AYT A;  3KJY A;  4HZ2 A;  1A8Y A;  4ZIL A;  3DGQ A;  4JZQ A;  2CQ9 A;  3CTF A;  3LGC A;  3TKS A;  4MAB A;  1EOG A;  4JED A;  1PRX A;  4OMV A;  4V2N A;  4ILF A;  1GNE A;  1KTE A;  1F3B A;  1O81 A;  3TKQ A;  5DVB A;  3UIW A;  3LSZ A;  5DAK A;  1Q98 A;  3FHK A;  2OA7 A;  4LMV A;  2F3M A;  2VCT A;  3VPQ A;  2WDU A;  2GZP A;  2MBT A;  1GUM A;  3V1W A;  4N30 A;  4NHW A;  5ECP B;  1O8X A;  3LFL A;  2C3N A;  2KLX A;  4FYB A;  2JU5 A;  2OBI A;  3QPM A;  2VCX A;  2H6Z A;  5ECN B;  2LEG A;  3RPN A;  4HS1 A;  1Y25 A;  3LXT A;  4ZB9 A;  1BJX A;  2QSI A;  3ZML A;  4ML1 A;  4HQZ A;  2GT5 A;  2RM6 A;  2O7K A;  4K8M A;  5CRE A;  2A2S A;  2C0E A;  2HRF A;  4DSS A;  3UBK A;  1TK5 B;  2DIY A;  4GCI A;  3VWX A;  2FD3 A;  1PGT A;  3U6V A;  4IKH A;  3A2W A;  1M2A A;  3KEB A;  3GSS A;  2G2Q A;  2VD1 A;  3BBY A;  4IS0 A;  5HR3 A;  5ELA A;  3EWL A;  1DUG A;  4XS4 B;  4Z7X A;  3VI7 A;  5HR2 A;  3TCO A;  4MK3 A;  4POM A;  5GSS A;  2G0F A;  2B7J A;  4CW9 A;  4EC0 A;  4Q5F A;  3FW2 A;  4L5L A;  1M9B A;  2JZS A;  2LRT A;  3VFI A;  1SK1 A;  3LYP A;  4I8B A;  1GWC A;  1HD2 A;  2H72 A;  2K8V A;  3FYG A;  5C04 A;  6GSX A;  2PUK C;  4MP4 A;  3DEX A;  1N2A A;  3RAZ A;  4MH3 A;  1ST9 A;  5D9T A;  4KSM A;  2H0G A;  2XPE A;  3HD5 A;  2HSM A;  1URM A;  3APS A;  5G5E A;  1JZW A;  2OBK A;  5BRT A;  2H75 A;  1YQ1 A;  2DJJ A;  3RHB A;  2LQO A;  5ECO B;  1XBS A;  1U3I A;  2C3T A;  2BJX A;  4LA1 A;  2RUF A;  17GS A;  2DJK A;  4TXO B;  1TDI A;  1PKW A;  4H86 A;  1XWB A;  1FVK A;  1MD3 A;  2CZ2 A;  1MEK A;  2IMI A;  4LL1 B;  1B48 A;  13GS A;  2H66 A;  5CNW A;  4KGI A;  2LRN A;  3GH9 A;  4NV5 A;  4V1A g;  4NPB A;  1X5C A;  2YWI A;  4NHZ A;  1CQH A;  5B6N A;  4GSS A;  5E4W A;  3WGX A;  1X0R A;  1PQN A;  5ENU A;  1FO5 A;  1K0M A;  5CO3 A;  1ZZY A;  4OFM A;  1TU7 A;  3FR3 A;  1TRV A;  2R5G A;  2PVO C;  1WIK A;  1GL8 A;  4YQM A;  2VUP A;  5KN2 A;  5DAL A;  1W4V A;  1ABA A;  1WMJ A;  3GHA A;  3GFK A;  2VD0 A;  4AGS A;  4O5R A;  1GLP A;  1OAZ A;  3QAV A;  1ZMA A;  4QL9 A;  4L0W A;  1VGL A;  1YKA A;  3IOS A;  2L57 A;  1ERU A;  3UMA A;  4KCA A;  2PBJ A;  5IQY A;  2MMO A;  2GQL A;  2HSY A;  2CVD A;  1EP8 A;  2UZ8 A;  1TRW A;  1U6T A;  4HOJ A;  2EIR A;  4MZC A;  4WBR D;  3GA4 A;  5D8I A;  3LG6 A;  4KW6 A;  1PL1 A;  1YY7 A;  3PPU A;  4K6X A;  5F8B A;  1N8J A;  4FYU A;  1XZO A;  5EVO A;  2I1U A;  1BAY A;  1E6B A;  2LTK A;  3I9V 2;  5LNK e;  3FY7 A;  2YWO A;  3LEF A;  2IME A;  3IR4 A;  4N10 A;  4BVX B;  1I5G A;  4K0G A;  2L6C A;  2HE3 A;  4Q5N A;  3KTL A;  4G2E A;  3MWH A;  1EOH A;  3C8E A;  3C73 A;  3J7Y b;  4ZB8 A;  4O7H A;  3QAW A;  2OAC A;  5D93 A;  3GKX A;  5DQY A;  1O6J A;  5FT3 A;  1VF3 A;  4HDE A;  4YQU A;  2FA8 A;  2EIQ A;  1JZD A;  2B6M A;  1FAA A;  2H6Y A;  3UOM A;  4V2M A;  16GS A;  6GSU A;  2DKH A;  3CXG A;  2P5R A;  2HSH A;  2YNX A;  5ECL B;  2LQQ A;  1VF4 A;  1R26 A;  5DCH A;  1YDK A;  5ID2 B;  4MMM A;  4BVY B;  3D21 A;  4MJA A;  3QFA C;  1XVW A;  3IXR A;  1VRS D;  3H1N A;  3ERF A;  2H1D A;  1FOH A;  1MD4 A;  4EIQ A;  1WRY A;  2VM2 A;  3L0H A;  3EU3 A;  2C0G A;  4GLT A;  4O92 A;  2FHE A;  2M72 A;  3ZLP A;  3US3 A;  4IVF A;  1A0F A;  4GF0 A;  5CYY A;  1UA5 A;  3DKS A;  3HJM A;  10GS A;  5JWQ B;  2X8C A;  3EMP A;  6GSS A;  4CDO A;  2A4H A;  4ID0 A;  3DVX A;  4TR4 A;  2F8F A;  4RUV A;  1USB A;  4RI7 A;  4IEL A;  4Q5R A;  1V40 A;  2I81 A;  4XRA A;  1EV9 A;  3IE3 A;  4MLY A;  4XS6 A;  4TR3 A;  3IRA A;  2C8U A;  4KH7 A;  2JSY A;  1UN2 A;  4OWY A;  4XCS A;  3APO A;  2GS3 A;  1ML6 A;  6GSV A;  4OCF A;  5IIZ A;  1F3A A;  1M7T A;  4WET A;  2KP2 A;  2C0F A;  4GRF A;  1JLW A;  4OFN A;  2MYG A;  3FZA A;  5B6M A;  2NPB A;  4HU7 A;  1SYR A;  3UEM A;  2DML A;  2FWF A;  1TI3 A;  4EUY A;  2X49 A;  4A5P A;  3ZIT A;  4USS A;  3IPZ A;  2HNL A;  1EEJ A;  1JFU A;  1TW9 A;  2DC5 A;  2FLS A;  3L9S A;  2LNS A;  4XS1 A;  6GSW A;  1A0R P;  5IMA A;  5IM9 A;  1SKR B;  2OE1 A;  3BCK A;  4K5S A;  4KND A;  5IO2 A;  3EC3 A;  4Z2R A;  1OC9 B;  4FO5 A;  3W8J A;  4IHU A;  4XS4 A;  3GV1 A;  1XW5 A;  1A24 A;  2HYX A;  2PMT A;  1TK0 B;  3TRP A;  3QMX A;  3TJG A;  1GSU A;  3GMF A;  3HXS A;  1V58 A;  4HJM A;  4EVM A;  2WB9 A;  5ECK B;  3ME8 A;  5G1L A;  3ZFB A;  1O7U A;  2H30 A;  2C0D A;  2H0H A;  3C7M A;  3M8N A;  1T00 A;  1U3A A;  2V6O A;  1WOU A;  4XRD A;  2YAN A;  3ZRE A;  2IMF A;  3QCP A;  4ULX A;  1GTA A;  5DCG A;  3IA1 A;  2R2J A;  2FWE A;  5HFK A;  1SL0 B;  4PX1 A;  3ZL5 A;  3O6T A;  1I9D A;  2AJQ B;  3PH9 A;  1BG5 A;  4TXO A;  1KEB A;  3S9F A;  2E2G A;  4FIW A;  1AXD A;  5GST A;  3MAK A;  5KOX A;  3A5I A;  3DWV A;  1K3O A;  4F0C A;  4ZBA A;  4JE1 A;  2E2M A;  1X9W B;  2FUG 2;  2AUV A;  2ZUP A;  3LW9 A;  2LUS A;  3EE2 A;  2LKU A;  1G6W A;  1TOF A;  4KDX A;  4XIH A;  3NZN A;  4KDY A;  11GS A;  1XOA A;  3MIX A;  1EP7 A;  3HA9 A;  3H4K A;  3TRQ A;  2Z9S A;  2YJH A;  2GSQ A;  4IQ1 A;  3ZFL A;  2K6V A;  3IHG A;  5AIV A;  4IJ3 A;  5J9B A;  3FKF A;  1K0C A;  3ZMK A;  2DIZ A;  2B5E A;  2AV4 A;  4YH2 A;  2VL9 A;  1HQO A;  2YP6 A;  2CAI A;  2HZE B;  2PER A;  1GUK A;  3HVX A;  4MH2 A;  3GN3 A;  3TKP A;  2PGT A;  4ZL8 A;  5CRG A;  4ZXG A;  2TIR A;  1THO A;  4F9Z A;  4F82 A;  1X9M B;  1ERV A;  4MPG A;  1EGO A;  2CX3 A;  3GKK A;  1NHO A;  3IBH A;  2QKE A;  1A2L A;  1PD2 1;  2A2R A;  1TJD A;  4KF9 A;  1PSQ A;  4TW5 A;  3ZIV A;  3CBU A;  2HFD A;  2X99 A;  3G7I A;  3KCM A;  5JWO B;  1G6Y A;  3F0I A;  4PQI A;  4D73 B;  5INY A;  4XTS A;  3GST A;  3TOU A;  7GSS A;  2GGT A;  1TKD B;  3MNG A;  4TOP A;  1NW2 A;  2JAC A;  3PGT A;  4WR5 A;  1MDI A;  3LQ7 A;  4J2F A;  2MZC A;  2HRK A;  5KN3 A;  4J57 E;  4BVX A;  5EL8 A;  3C1S A;  3F3Q A;  2L6D A;  3L4N A;  4L0U A;  2HZF A;  4I2T A;  3CSI A;  2K8S A;  5ECQ B;  4KB3 A;  4E8E A;  1HNC A;  1XWK A;  3KH7 A;  3TGZ A;  4KDU A;  5H5Q A;  4V2L A;  2FCH A;  3UL3 A;  3D4M A;  4EIP A;  2ON5 A;  4OCE A;  4Q5Q A;  4TXV A;  3IV4 A;  2DSA A;  2YV9 A;  2YWM A;  1ILO A;  3IC4 A;  4K2D A;  2FWH A;  4J56 E;  3ZYW A;  5GAP D;  3CRT A;  2F8A A;  3TKS C;  4PQH A;  4EXJ A;  4ZL7 A;  2ZNM A;  3GL3 A;  1G7E A;  5ID2 A;  4EDY A;  3TJK A;  4BVY A;  3LWA A;  4G19 A;  4N0V A;  4Z2T A;  3Q19 A;  1FG4 A;  3G9B A;  2VO4 A;  3FK8 A;  3ZZX A;  1QMV A;  2PVQ A;  4I5Q A;  3QFB C;  3BD2 A;  2L5L A;  1F37 A;  1GLQ A;  1YEX A;  4N11 A;  2AAW A;  3DRN A;  1UVZ A;  3F3R A;  1B4Q A;  4BL7 B;  4EO3 A;  4LL4 B;  1ERW A;  5AIS A;  3KMN A;  3D4T A;  3BOA A;  2WRT A;  2OE0 A;  2O85 A;  4YKF A;  2ON7 A;  5F06 A;  2MBS A;  1EEM A;  1UC7 A;  1NM3 A;  2IFQ B;  4PNF A;  3F63 A;  4O5Q A;  1TU8 A;  1S3D A;  4PUR A;  1XOB A;  4IQA A;  2GST A;  3KP8 A;  3GIX A;  2R0G A;  3PR8 A;  4CHS A;  2B3S A;  4DSQ A;  2YN1 A;  3HJP A;  1EV4 A;  2ES7 A;  3QOU A;  2L59 A;  2H0I A;  2D2Z A;  2IPA A;  2JAD A;  1GUH A;  4G0L A;  3GH6 A;  1VF1 A;  5F0G A;  3IK9 A;  1Z6N A;  5KOW A;  2CX4 A;  4YAV A;  2XBI A;  5LCZ A;  1GSS A;  3GUR A;  4GST A;  1XVQ A;  4BPY A;  1Z5Y E;  1O73 A;  4POB A;  4IW9 A;  2CT6 A;  3EPT A;  1R5P A;  4MZB A;  1IYI A;  3O76 A;  14GS A;  5JWR B;  2NDO A;  3CSH A;  3GL5 A;  4G0K A;  4LMW A;  2VLT A;  1K0A A;  1SL1 B;  1SKS B;  1K0N A;  1FB0 A;  4F0B A;  2L4Q A;  1Z7P A;  1KBN A;  2WUL A;  5IOX A;  5E59 A;  1Z9H A;  3AY8 A;  3ZTL A;  18GS A;  1LJR A;  1OC9 A;  19GS A;  2MMN A;  4PGT A;  2C1Y A;  3CMI A;  3LOR A;  1FHE A;  4NXI A;  2IMK A;  1F2E A;  5COH A;  1GSD A;  3L9U A;  4F03 A;  3P2A A;  4ZBB A;  2CA8 A;  3E0U A;  3EIN A;  1OYJ A;  3JCM L;  1TP9 A;  4IJI A;  5ECM B;  4O32 A;  3HVS A;  3UVT A;  1O85 A;  2FWG A;  4YKG A;  5JCW A;  2PPT A;  4HZ4 A;  1XWC A;  4NMU A;  1SL2 B;  3HHV A;  3F8U A;  4FH8 A;  2KP1 A;  3L78 A;  2JSZ A;  1J0F A;  4GTU A;  2KOK A;  3ERG A;  3TDG A;  2GSR A;  5HR1 A;  2WCI A;  3G7Y A;  4HEA 2;  3EUR A;  4IN0 A;  2H73 A;  2QA1 A;  4G0I A;  4MJB A;  2QC7 A;  4IBP A;  1R7H A;  2IL3 A;  3DXB A;  2AHE A;  5J4U A;  1K3L A;  3GTU B;  2EIO A;  1THX A;  4NWY A;  2P5Q A;  4QL7 A;  5CAX A;  1XPV A;  2KHP A;  1B9X C;  4G9H A;  1AUC A;  5ECH B;  2WZ9 A;  1PMT A;  4K1F A;  4PUF C;  1NHY A;  2FGX A;  1C72 A;  3LJR A;  1F6M C;  3N5O A;  2IJY A;  1A2J A;  2H1A A;  2V32 A;  3D0Z A;  1W89 A;  2DBC A;  3R2Q A;  2LV3 A;  4ISD A;  2X8G A;  2B7K A;  3KMO A;  4TVE A;  4WR4 A;  3G7J A;  5B7C A;  2A2P A;  2HZE A;  4IP1 A;  4X4J A;  1OC8 A;  5J5N A;  1YZX A;  3DVW A;  1Q4J A;  4JU5 A;  4DVC A;  1T4Z A;  1K0B A;  3TB2 A;  5D9W A;  2DJ3 A;  5D96 A;  2NTO A;  1PN9 A;  2VIM A;  2K9F A;  1K0O A;  4GXZ A;  2C4J A;  1SEN A;  1GTU A;  3C71 A;  4MJC A;  4AJ7 A;  2XC2 A;  5H5R A;  3GUS A;  3FRC A;  3GYK A;  3A3T A;  3GX0 A;  2BMX A;  1U88 A;  4D73 A;  4POL A;  5DJL A;  1M2B A;  4CY6 A;  4LLR A;  3MSZ A;  2E7P A;  3N9J A;  22GS A;  5AGY A;  1AC1 A;  3FZ5 A;  4FYC A;  2VL3 A;  2B5Y A;  3TOT A;  5IMC A;  1SKW B;  1QFN A;  2PWJ A;  5G30 A;  1ZOF A;  1M2D A;  4K5R A;  2EC4 A;  2WFC A;  5HQP A;  3P90 A;  2HRN A;  2PN8 A;  2JZT A;  3GKM A;  3ERW A;  1PL2 A;  2DMM A;  2J9H A;  2CVK A;  3UVH A;  5ABR A;  1LU4 A;  1DSB A;  1M99 A;  3HYP A;  4CY8 A;  1TTZ A;  3VPT A;  5DQS A;  4MJE A;  4EE0 A;  2B5X A;  3BJ5 A;  4ML6 A;  5CRD A;  3FEU A;  2VL2 A;  1OKT A;  1T1V A;  2QGV A;  4WKW A;  4IGJ A;  2GDR A;  1YJ6 A;  2PU9 C;  3SBC A;  3UAR A;  3A2V A;  1BYE A;  1QK8 A;  2H6X A;  1F9M A;  1AQV A;  2H1G A;  4TRX A;  3H8Q A;  5G31 A;  4BL7 A;  2VCV A;  1ZGN A;  1MTC A;  3GKN A;  1OE8 A;  5ECS A;  3I69 A;  1SJI A;  1EWX A;  3UJ1 A;  3Q6O A;  3UAP A;  2IFQ A;  5IMZ A;  3Q18 A;  3M1G A;  3EVI A;  1T4Y A;  1JZR A;  2I4A A;  2GZZ A;  5JCU A;  3KGK A;  1XW6 A;  3ZRD A;  4YAP A;  1OC3 A;  2L4C A;  3WT2 A;  2MMA A;  3TJJ A;  4N0Z A;  1QQ2 A;  1SJZ A;  4HUA A;  4O5U A;  3VLN A;  1DE2 A;  1SYX A;  3TJB A;  3IK7 A;  2TRX A;  3WD6 A;  3CYN A;  2VM1 A;  2M80 A;  4OFT A;  2YOI A;  4QQ7 A;  2IMD A;  1WP0 A;  1G7O A;  1Z7R A;  5LD0 A;  3TJF A;  2JZR A;  3VUR A;  1TK8 B;  4P3Y B;  5BMU A;  3P8W A;  4JRR A;  1AQW A;  5DJM A;  2H70 A;  3WT1 A;  1V9W A;  3K8N A;  2O89 A;  1R5A A;  3KP9 A;  1GUL A;  4E8H A;  3VK9 A;  1T3B A;  5AN1 A;  3QD9 A;  2C3Q A;  2VCZ A;  3IAS 2;  5HFG A;  4MCU A;  3KTB A;  3IC8 A;  3HY2 A;  3FZ4 A;  2YV7 A;  4ECJ A;  4Z2U A;  1QGV A;  2WJU A;  3HJO A;  4WBJ A;  2V6K A;  3GX8 A;  1TI1 A;  2NBS A;  4KCE A;  5J3R A;  2YZH A;  1GTB A;  1S3A A;  2YWN A;  2RII A;  1WJK A;  2DJ2 A;  4K0N A;  1M0U A;  2LJA A;  1BX9 A;  3DML A;  3TRX A;  3KM6 A;  3E9J B;  1GSE A;  4WF5 A;  2VCW A;  4I2U A;  2FA4 A;  4KE3 A;  5FWG A;  1JHB A;  4GQF A;  4G10 A;  4KA0 A;  3E3E A;  2P31 A;  1SU9 A;  4PUA A;  5DBQ A;  4WF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...