2YPMA

Crystal structure of ancestral thioredoxin relative to last animal and fungi common ancestor (lafca) from the precambrian period
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
105
structure length
105
Chain Sequence
MVIQVTNKDEFESILSEADKLVVVDFTATWCGPCKMIAPKFEELSEEYPDNVVFLKVDVDEVEDVAAEYGISAMPTFQFFKNGKKVDELTGANQEKLKAMIKKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords LAFCA THIOREDOXIN
publication title Conservation of Protein Structure Over Four Billion Years
pubmed doi rcsb
source organism Synthetic construct
total genus 32
structure length 105
sequence length 105
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2012-10-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ypmA00
1MDJA 3HZ4A 2K9FA 1BQ7A 2L6CA 1VF1A 5B8BA 3WYWA 5CRWA 4N11A 2HZFA 4K6XA 3C1RA 3QR6A 5HR2A 1GSQA 3HYPA 1YJ6A 4KCEA 3G7YA 2GSSA 1AXDA 2RM5A 5ECMB 6GSWA 4EL1A 4DVCA 1TTZA 3F8UA 3GNJA 2LS5A 4ZL8A 1SKRB 4F82A 4HS1A 2LRTA 3OR5A 2CT6A 3LEFA 2VD0A 3GSSA 5ABRA 4HZ4A 2LUSA 4GSNA 2E0QA 1ILOA 4PQHA 2HNLA 1IYHA 4KB3A 5EVOA 1M2DA 2HE3A 4ML6A 4L8EA 5ECPB 2VLTA 3KH7A 2KHPA 4GRFA 3UBKA 2KUCA 4V2MA 4L0WA 3DXBA 3D4TA 2HRFA 3CMIA 11GSA 2VCZA 2WCIA 1UN2A 6GSVA 1YF1A 4POMA 3TKSC 1TKDB 2DJJA 2LRNA 3QD9A 4QL7A 3ZIVA 4XS4B 3WD6A 1EGOA 2YV9A 5ECKB 2DIYA 14GSA 2FNOA 2GLRA 2H0GA 4MPGA 2E7PA 2I1UA 4Q5NA 3K8NA 1USBA 1G7EA 5GAND 1NSWA 2R2JA 3M9KA 3TOUA 4DSSB 1G0TA 1XPVA 2Z9SA 4L0UA 3TJKA 1LU4A 4MP4A 3GKNA 3IV4A 4OWYA 1U3AA 2HLSA 2JSZA 3LYKA 4IP1A 1EOGA 4EF0A 3BCKA 4RQRA 1GNWA 3DKSA 1J0FA 2FWHA 3D21A 2YV7A 1YEPA 2IMIA 2K8VA 2H30A 2MMNA 4DSRA 5DCGA 3SWLA 4X0XA 3U6VA 5E59A 5G1KA 2V6KA 3TB2A 3DYRA 3IK7A 3GKKA 3F4RA 5ID2B 3N9JA 3QFBC 4EVMA 1PX6A 1DE2A 5DBQA 1OYJA 3FEUA 4XRAA 2H71A 3IC4A 1GLPA 3TJFA 3GA4A 17GSA 3EVIA 3HVXA 3KCMA 5J9CA 5IO2A 3CYNA 2RM6A 3EC3A 1SD8A 2QSIA 2P5QA 2JZRA 1BG5A 3UVHA 2R5GA 1GUMA 5FHIA 4OFTA 4O92A 6GSSA 2MBSA 2NDOA 4OFMA 1T7PB 5DALA 5F0GA 3GYKA 5AN1A 2G2QA 3GMFA 1NHOA 2IL3A 3US3A 1M2BA 1QQ2A 2GZZA 4AF2A 3LFLA 1TXXA 3GHAA 4MJEA 1R5PA 3I9V2 2F8FA 2OADA 1XWCA 4KUNA 3L9VA 3H4KA 5IMAA 3VWXA 1VF3A 5DAKA 3HCZA 4ID0A 3KD0A 3H79A 3I43A 5AGYA 5D9VA 2WULA 1HD2A 2C0GA 2JACA 10GSA 1PRXA 3DD3A 3KJYA 4NHZA 2F8AA 4IQAA 3BJ5A 5H5RA 1TOFA 4OD7A 2DMMA 2B3SA 18GSA 1HNAA 4D73A 3QPMA 2OBKA 1FVJA 2BTOT 3HVVA 3MDKA 3Q74A 5B7CA 4HDEA 1HYUA 4IELA 1G6YA 3L0HA 3RDWA 4IGJA 5HFGA 2J23A 1YZXA 1OKDA 1W89A 1SL1B 3ME7A 1TRVA 1TK5B 4FYBA 2WZ9A 2AAWA 4RI6A 5D8IA 4NV2A 4LLRA 2GSQA 3IDVA 1K0BA 3DEXA 4IHUA 1SYRA 1SL2B 5IM9A 4LMVA 3NOFA 4POKA 2DJ0A 5CO3A 4GWRA 4QQ7A 2X8HA 2RIIA 16GSA 1OC3A 4Z7XA 3F9UA 2PVOC 2RUEA 3L4NA 5D9WA 1K3LA 4MF5A 3MNGA 2EC4A 2IWTA 3HA9A 1XXUA 1AW9A 4TR3A 1SKSB 4NV5A 3VPTA 3UOMA 3A2XA 1BYEA 3GH9A 1GSEA 2LSTA 2V2GA 1MD4A 1WE0A 2LKUA 3VK9A 4MH2A 3GTUA 3VPQA 1OC8A 5CRGA 3DVXA 1PD21 4G19A 3HXSA 1G6WA 3DMLA 2LJAA 4KX4A 2DBCA 5ECNB 4NWYA 2FLSA 2LV3A 2LQOA 2R37A 2GQMA 2GGTA 4X1UA 2YWIA 1I9DA 5COHA 3H1NA 1AC1A 3ISOA 3ZVJA 3RAZA 4IQ1A 4TVEA 1XIYA 4YQMA 2CX3A 2VL2C 5ECOB 1XCCA 2GSTA 4AJ6A 4BA7A 1EWXA 3LJRA 5J41A 4BPYA 1K0DA 1LJRA 1AQWA 1BX9A 3KP8A 3M1GA 2HXKA 4L5OA 1BAYA 2OE0A 4V2LA 2YANA 3LQ7A 5H5QA 4K7IA 1FW1A 1DUGA 3UIWA 4TR1A 1VF2A 4KGIA 2XC2A 4YQUA 4BWQA 4MDCA 3FRCA 3N5OA 5FWGA 1T00A 1AIUA 4EC0A 1A24A 1B48A 2R4VA 1X0RA 3FZ5A 2YJHA 5IOWA 1F6MC 1THOA 4EE0A 4JZQA 5B6NA 2CZ3A 4KSMA 4HU9A 3TRQA 1MEKA 2RUFA 3DRNA 2LNTA 5H5SA 3BOAA 3D4MA 4ZXGA 1WJKA 1XW6A 5KN3A 5LCZA 2GSRA 2VCTA 3ZRDA 2JSYA 2BJXA 3M8NA 5FT3A 1LBKA 4YAVA 3GKXA 2CAQA 2H1GA 3EINA 1Z7PA 1EEJA 1XWBA 4GTUA 2I3YA 1HNCA 2VLVA 5C00A 1R4WA 1YF0A 1E6BA 3TGZA 2K8SA 1PA3A 3KM6A 1WWJA 2KOKA 2V41A 2I4AA 4PURA 2OACA 2AUVA 2C80A 2M80A 4GQFA 4XS1A 1X5CA 1FG4A 2H6YA 4G2EA 2FCHA 1MTCA 5IMFA 4IKHA 2FD3A 4XIHA 4ZILA 5HFKA 2DC5A 5GSTA 5HFIA 3QDNA 2IJYA 1PGTA 3FZ9A 1V98A 3GH6A 4KW6A 1V2AA 2VM2A 2CVKA 3KMNA 5D96A 1M99A 2H74A 5F05A 4GCIA 3RPNA 1ZYQB 5GSSA 1B9XC 2L5LA 1YY7A 3CTFA 2GTUA 3DVWA 4OFNA 2V32A 2DMLA 2JZSA 1V57A 3TCOA 4Q5RA 4QL9A 2GQKA 5D9TA 4BVXA 2H76A 1NHYA 4TR4A 5DALB 1EP8A 4MK3A 4CW9A 2H19A 1ML6A 1T4YA 4MZBA 1K0CA 2F9SA 1I5GA 2HZEA 2E2GA 2AYTA 3S9FA 1B4PA 2TRCP 1TRSA 5D9XA 2HYXA 2CVDA 3TKSE 1FO5A 4KNDA 4TXOA 5DAKB 2VM1A 4ML1A 1NW2A 1AAZA 4IJ3A 1TW9A 2MZCA 4GXZA 3TKPA 3RBTA 3Q6OA 3FR9A 2PVQA 3ERWA 2C0EA 2FUG2 3APQA 3E0UA 5DVBA 4XHMA 3GSTA 2IMFA 3IAS2 4HOJA 2FWGA 3LXZA 1AQVA 3TDGA 4MF7A 4D73B 4OO5A 2JZTA 2K18A 1UA5A 3L9UA 4NXIA 3ZITA 4MJAA 3QAVA 1GNEA 4ISDA 1AUCA 2G0FA 5ELAA 2IFQA 4WF4A 1ZCPA 2D2ZA 2OJLA 4WR5A 2F3MA 2CAIA 4WEYA 1S3CA 1FB6A 4J56E 1Z6NA 4CHSA 3VWWA 1U87A 3RHCA 2AV4A 3TRXA 2XPEA 1M0UA 1GTUA 5DJLA 3M3MA 4EKZA 1TP9A 4P3YB 5IMZA 1FAAA 2X8GA 1QGVA 2YZHA 1GTBA 2VUPA 4K1FA 1XOAA 4FIWA 1MDIA 2PGTA 3ED3A 4MLYA 1FB0A 3IK9A 3TJJA 4WF5A 2VAFA 1SJIA 3GTUB 4HEA2 4OCEA 5IMVA 1FVKA 2L6DA 2JL4A 4I6XA 3HJMA 2OKAA 5F8BA 1YDKA 2JU5A 3F4SA 4TW5A 22GSA 4MZCA 3QAWA 3HHVA 1XOBA 3IOSA 4I2TA 2VD1A 3TKQA 3ERFA 2LNSA 3ZIJA 3F4TA 5G2ZA 4KA0A 1Q4JA 1C72A 2C8UA 5A4UA 4F0CA 3FK8A 3FHKA 2VLUA 5CRDA 3FKFA 3CSHA 4MZWA 1ON4A 1TI1A 3KTBA 4MJCA 4L5LA 1FHEA 1JZWA 4AJ7A 2CX4A 4IP6A 2OBIA 2WFCA 3QFAC 5F07A 4BWSA 3D0ZA 5E4WA 4V1Ag 3MAKA 1O81A 4YAPA 2XHFA 1XWGA 4MPFA 3F6DA 2H72A 3KIJA 4JRRA 5KEJA 1F2EA 2A2RA 4POBA 1PX7A 4FYUA 1VGLA 2OE1A 5HR0A 3P8WA 4K9ZA 4I5QA 3CXGA 1GH2A 5JWOB 1F3AA 4ZB9A 1T3BA 4H86A 2MYGA 3CTGA 4TR1B 19GSA 3O3TA 12GSA 2ES7A 1K0MA 2I81A 5J4UA 1PN9A 7GSSA 1Z3EA 4F03A 1X5DA 2HT9A 4MMMA 4TOPA 2YWNA 4K7NA 2WDUA 3KGKA 1GL8A 4GF0A 2GT6A 1DBYA 1QUWA 4GLTA 2NTOA 1O85A 3TJBA 1K3OA 3ZVJD 4F9ZA 2A2SA 1PKZA 2KLXA 1PL1A 2HSHA 4ACSA 2L4QA 3IR4A 1DE1A 2V1MA 3GIXA 1YKCA 1A8YA 3KTLA 4IBPA 3M0FA 2YCDA 4TN8A 3QMXA 2KP2A 4MJBA 1U6TA 4G9HA 2WB9A 5G5EA 4JU5A 1RW1A 2VCXA 3J7Yk 6GSYA 3QCPA 6GSTA 3U5RE 2YWMA 3VWUA 3VI7A 3O6TA 5GAPD 2YN1A 1GLQA 2PN8A 1G7OA 2LQQA 3CBUA 4ULXA 1UC7A 4RI7A 4EUYA 3TKSA 4RUVA 3BCIA 2O8VB 3H93A 2CV4A 2IMEA 2H75A 3VURA 2E2MA 3KXOA 4O32A 6GSXA 3KMOA 5ECQB 1ABAA 1UVZA 4AGSA 2DLXA 1XVQA 3GKMA 3D6IA 2IIYA 4WETA 2H6ZA 4PX1A 2GDRA 1XWKA 1XFLA 3PR8A 3DGQA 4TXVA 1XZOA 5ECSA 4LA1A 4PUFC 5CP1A 4K8MA 3UBLA 1OVNA 4NMUA 2WJUA 3GRXA 5IO0A 3A3TA 1PL2A 1AQXA 4PQIA 2TRXA 2H0IA 4HZ2A 1OKTA 3HJOA 1O6JA 1H4OA 4ECCA 1H75A 1HQOA 3F0IA 5GZZB 4TKYA 1T8EB 5KN0A 3GN3A 1ZOFA 3HKRA 3F3RA 3VWVA 2DSAA 1YQ1A 2R6KA 2X99A 1BEDA 1S3DA 3PGTA 4N0VA 1XVWA 1W4VA 4MH3A 1MD3A 2J9HA 4HI7A 4XS6A 2WRTA 1GSFA 1R7HA 2YWOA 1J9BA 1KBNA 5DJMA 1TK0B 4GSSA 3I6AA 4JBBA 2VL9A 3H8QA 1GUKA 5G1LA 3ZTLA 5IIZA 1GWCA 5KN1A 1GTAA 2IPAA 4F2IA 1EZKA 1IYIA 4IW9A 1R5AA 2N5BA 3UARA 2BMXA 2N5AA 5ECLB 1A2LA 2HZEB 4IS0A 1Z6MA 3WGXA 4OMVA 1PQNA 1SENA 1YEXA 3G9BA 2PU9C 4NHWA 3P90A 2LEGA 2YOIA 4TXOB 2ZNMA 3W6GA 2OE3A 3UVTA 3GV1A 2GT5A 3IPZA 3P2AA 1XBSA 1T1VA 5L71A 1SJZA 3C8EA 4PUAA 1V9WA 3M9JA 3DIEA 3EU3A 4BL7A 3NIVA 6GSUA 2M72A 5IMDA 4K0NA 1ERTA 3C73A 3VI5A 3RHBA 2YNXA 5A4WA 4PXOA 3LXTA 1F3BA 1A2JA 3ME8A 4K0GA 2IFQB 4O7HA 1EP7A 3FZ4A 2CVBA 2GS3A 1O8XA 2IMDA 1GUHA 4Q5QA 4MCUA 5JCWA 4IJIA 2XBIA 5CYYA 2B5YA 1B4QA 1EOHA 5IQYA 4YQVA 3D22A 1QMVA 2PERA 2VL3A 2H1BA 1CQGA 2B7JA 1GSUA 3L78A 4N0ZA 3I69A 2L59A 1F9MA 13GSA 1HNBA 2FY6A 2IMKA 1GSDA 2H01A 3F6FA 2MMZA 2YP6A 1GRXA 1Z5YE 4XCSA 1YKAA 2VO4A 1SKWB 1B9YC 3Q18A 3VFIA 2C3TA 1XW9A 1TK8B 4ZBBA 1B8XA 2NPBA 1JHBA 4FO5A 5D93A 2OA7A 5C04A 4O5RA 1KNGA 3GUSA 1ST9A 2VOCA 3IA1A 2REMA 2HFDA 2MMAA 1ZMAA 2NBSA 1PSQA 3ZL5A 4JR6A 2ZUPA 1N2AA 1FOVA 4E8EA 3EMXA 2HI7A 4OO4A 2WS2A 3UL3A 4F0BA 2CA8A 5CREA 4LL4B 4KDUA 1TDIA 4N10A 4AJ8A 2YZUA 2ZCTA 3W8JA 2L57A 2C3NA 1SK2A 3TOTA 3KH9A 3UJ1A 4ZB6A 1XWAA 2DJ3A 1ACVA 3IXRA 2B7KA 2VCVA 4WBRD 3WT2A 3G7JA 3LSZA 5G30A 2EIOA 2XBQA 1CQHA 1URMA 3HD5A 3EWLA 3IAM2 5INYA 1JFUA 1GSYA 1GULA 1WOUA 3WGEA 2PBJA 2CZ2A 2RLIA 2PMTA 2C3QA 3EURA 3CRUA 3TKRA 3L9SA 3QOUA 2LRCA 1TJDA 5B6MA 5EY6A 2R3XA 2P0GA 2B5XA 5G31A 3ZFLA 5CAXA 3GL5A 4JEDA 3C1SA 2NVLA 2O85A 4XTSA 3FYGA 2X8CA 1OC9A 3ZLPA 2VL2A 3V1WA 1V40A 3A2VA 1PKWA 1OAZA 3HJPA 1A8LA 5EPFA 3UEMA 3SBCA 2KP1A 3J7Yb 2HRNA 3JCML 2IN3A 4ECBA 1JLWA 3ZMLA 3DWVA 2AB6A 4CDOA 2DIZA 1ZYEA 1TRWA 1JZOA 3BD2A 3TRPA 1SK0A 4ZBAA 3EYTA 2O89A 1K3YA 3HY2A 2F51A 1E2YA 1X9MB 3NZNA 3ZZXA 5AIVA 1M9BA 1N8JA 1QK8A 1SU9A 5DQSA 3FZAA 2H0HA 4ECJA 2EIRA 1ERVA 3BBYA 4ZIJA 4J2FA 4KDYA 1K0OA 3GFKA 5D73A 5DCHA 2L5OA 5ECIB 3FW2A 2B1KA 5JWQB 2VIMA 1PMTA 5LD0A 3FR3A 3EE2A 4HUAA 3C7MA 1A0RP 2FWFA 1J08A 2H70A 3E9JB 2DJ2A 2ON7A 1KEBA 1EGRA 3P7XA 2PPTA 2TIRA 1M9AA 4J57E 5AISA 5KN2A 3WGDA 2HSYA 4ZL9A 2K6VA 3Q19A 1X9SB 1U3IA 3GX8A 3APSA 4Q5FA 1V58A 2B6MA 3RPPA 1TI3A 1NM3A 4WKWA 3C71A 3PINA 4FYCA 2I9HA 3AY8A 2QKEA 3ZMKA 2M46A 4XS4A 4EO3A 4N30A 4ZB8A 4KSOA 1QXHA 1ERWA 1RQMA 4HJMA 3HDCA 3EMPA 4K2DA 4LMWA 5J3RA 1T4ZA 3GURA 2AJQB 1QFNA 1KTEA 5HR1A 2A4VA 4DSSA 4DEJA 3KP9A 4KE3A 4ECIA 1Y6EA 3IRAA 1S3AA 3CRTA 5A4VA 4WBJA 5JCGA 3CSJA 1JZRA 3TJGA 5F06A 5G5FA 2FA8A 3G7IA 2H1AA 1VRSD 4FH8A 5IPHA 2H8LA 2MBTA 3O76A 4EXJA 20GSA 4JR4A 1SD9A 2C4JA 1RK4A 1THXA 2C1YA 4DSQA 3UMAA 1K0NA 3E3EA 1X5EA 4HJ2A 1XW5A 2MMOA 4GSTA 4YH2A 3F63A 5IMCA 4TR0A 4G10A 1X9WB 4EDYA 4PNGA 5DQYA 2P5RA 1TU7A 2C0DA 5JWRB 3MSZA 5IOXA 1O73A 1JZDA 5JCUA 2X64A 1WPIA 5AIXA 2FA4A 2GZPA 5ID2A 1WIKA 4EDZA 4RQXA 5IPGA 1BJXA 4KAEA 2QGVA 3W8SA 9GSSA 2ALBA 2QC7A 1M2AA 2B1LA 4NAXA 2FWEA 2V6OA 2GQLA 2AHEA 5EL8A 1TU8A 2C0FA 1WP0A 1SK1A 3F3QA 4TRXA 2CQ9A 1GP1A 2N5FA 3CSIA 2H73A 1SYXA 3EU4A 4I97A 1EEMA 4HQSA 1VF4A 4GQCA 3ERGA 4E8HA 2VCWA 1ZGNA 1JLVA 5A5KA 4KH7A 4PGTA 4HQZA 5ECHB 3VLNA 3PH9A 1WMJA 5HQPA 1ERUA 2JADA 3ZYWA 3KZQA 1A0FA 1GSSA 4X43A 3D5JA 2YJ7A 2FGXA 2GVPA 1O8WA 2DJ1A 1Y25A 3IE3A 1GTIA 2PWJA 4I2UA 1WRYA 4KCAA 3LGCA 4KDXA 4ILFA 4LL1B 1SL0B 2P31A 1M7TA 4MA9A 4K7OA 4WXTA 2EIQA 3HVSA 4ZBDA 2H66A 3FY7A 3HZ8A 1Z9HA 5B8AA 1U88A 2WGRA 3MWHA 3ZFBA 1TRUA 4BVYA 3IHQA 3WT1A 3UAPA 3QAGA 2H1DA 2O87A 4POLA 3A5WA 4PNFA 2LJKA 5HR3A 3KEBA 3LYPA 5J9BA 4IVFA 2XPDA 4IN0A 4XRDA 2FHEA 3FR6A 4V2NA 1OE8A 4V1Ap 4HU7A 3LWAA 5CRHA 3GX0A 2LJRA 1MDKA 4JE1A 2YPMA 1O7UA 2O7KA 1A2MA 1EV4A 3LG6A 1OE7A 2DJKA 3ZREA 5CNWA 2VCQA 5ELGA 5DDLA 5ENUA 1Z7RA 4NPBA 3IBHA 2H6XA 2GZYA 3LORA 4ZL7A 4PQ1A 4I8BA 1OC9B 4WR4A 4OCFA 2B5EA 2ON5A 5LNKe 1R26A 3GL3A 1ZL9A 3APOA 4MABA 5J5NA 1DSBA 1ZZYA 4MF6A 2PUKC 8GSSA 1SJ6A 3A2WA 3R2QA 2L4CA 3TUEA 1F37A 1K0AA 1A23A 2LTKA 1Q98A 1EV9A 5ECRB
chains in the Genus database with same CATH superfamily
1MDJA 3HZ4A 2K9FA 1BQ7A 2L6CA 1VF1A 5B8BA 3WYWA 5CRWA 4N11A 2HZFA 4K6XA 1S3RA 3C1RA 3QR6A 5HR2A 2UZ8A 1GSQA 3HYPA 1YJ6A 4KCEA 3G7YA 2GSSA 1AXDA 2RM5A 5ECMB 6GSWA 4EL1A 4DVCA 1TTZA 3F8UA 3GNJA 2LS5A 4ZL8A 1SKRB 4F82A 4HS1A 2LRTA 3OR5A 2CT6A 3LEFA 2VD0A 3GSSA 5ABRA 4HZ4A 2LUSA 4GSNA 2E0QA 1ILOA 4PQHA 2A4HA 1IYHA 2HNLA 4KB3A 5EVOA 1M2DA 2HE3A 4ML6A 4L8EA 2VLTA 5ECPB 3KH7A 2KHPA 4GRFA 3UBKA 2KUCA 4V2MA 4L0WA 4PTSA 3DXBA 3D4TA 2HRFA 3CMIA 11GSA 2VCZA 2WCIA 1UN2A 6GSVA 1YF1A 4POMA 3TKSC 1TKDB 2DJJA 2LRNA 3QD9A 4QL7A 3ZIVA 4XS4B 3WD6A 2QA2A 1EGOA 2YV9A 5ECKB 2DIYA 14GSA 2FNOA 2GLRA 2H0GA 4MPGA 2E7PA 2I1UA 4Q5NA 3K8NA 1USBA 1G7EA 5GAND 1NSWA 2R2JA 3M9KA 4CY6A 3TOUA 4DSSB 1G0TA 1XPVA 2Z9SA 4L0UA 3TJKA 4ICYA 1LU4A 4MP4A 3GKNA 3IV4A 4OWYA 3MIXA 4KF9A 1U3AA 2HLSA 2JSZA 3LYKA 4IP1A 1EOGA 4EF0A 3BCKA 4RQRA 1GNWA 3DKSA 1J0FA 2FWHA 3D21A 2YV7A 1YEPA 2IMIA 2K8VA 2H30A 2MMNA 4DSRA 5DCGA 3SWLA 4X0XA 3U6VA 5E59A 5G1KA 2V6KA 3TB2A 3DYRA 3IK7A 3GKKA 3F4RA 5ID2B 3N9JA 3QFBC 4EVMA 1PX6A 1DE2A 5DBQA 1OYJA 3FEUA 4XRAA 2H71A 3IC4A 1GLPA 3TJFA 3GA4A 17GSA 3EVIA 3HVXA 3KCMA 5J9CA 5IO2A 3CYNA 2RM6A 3EC3A 1SD8A 2QSIA 2P5QA 2JZRA 1BG5A 3UVHA 3IC8A 2R5GA 1GUMA 5FHIA 4OFTA 4O92A 6GSSA 2MBSA 2NDOA 4OFMA 1T7PB 5DALA 5F0GA 3GYKA 5AN1A 2G2QA 3GMFA 1NHOA 2IL3A 3US3A 1M2BA 1QQ2A 2GZZA 4AF2A 3LFLA 1TXXA 3GHAA 4MJEA 1R5PA 3I9V2 2F8FA 2OADA 1XWCA 4KUNA 2DKHA 3L9VA 3H4KA 5IMAA 3VWXA 1VF3A 5DAKA 3HCZA 4ID0A 3KD0A 3H79A 3I43A 5AGYA 5D9VA 2WULA 1HD2A 2C0GA 2JACA 10GSA 1PRXA 3DD3A 3KJYA 4NHZA 2F8AA 4IQAA 3BJ5A 5H5RA 1TOFA 4OD7A 2DMMA 2B3SA 18GSA 1HNAA 4D73A 3QPMA 2OBKA 1FVJA 2BTOT 3HVVA 3MDKA 3Q74A 5B7CA 4HDEA 4Z2UA 1HYUA 4IELA 1G6YA 3L0HA 3RDWA 4K5SA 4IGJA 4Z2RA 5HFGA 2J23A 1YZXA 1OKDA 1W89A 1SL1B 3ME7A 1TRVA 1TK5B 4FYBA 2WZ9A 2AAWA 4RI6A 4NV2A 5D8IA 4LLRA 2GSQA 3IDVA 1K0BA 3DEXA 4IHUA 1SYRA 1SL2B 5IM9A 4LMVA 3NOFA 4POKA 2DJ0A 5CO3A 3EPTA 4GWRA 4QQ7A 2X8HA 2RIIA 16GSA 1OC3A 4Z7XA 3F9UA 2PVOC 2RUEA 3L4NA 5D9WA 1K3LA 4MF5A 3MNGA 2EC4A 2IWTA 3HA9A 1XXUA 1AW9A 4TR3A 1SKSB 4NV5A 3VPTA 3UOMA 3A2XA 1BYEA 3GH9A 1GSEA 2LSTA 2V2GA 1MD4A 1WE0A 2LKUA 3VK9A 4MH2A 3GTUA 3VPQA 1OC8A 5CRGA 3DVXA 1PD21 4G19A 3HXSA 1G6WA 3DMLA 2LJAA 4KX4A 2DBCA 5ECNB 2X4AA 4NWYA 2FLSA 2LV3A 2LQOA 2R37A 2GQMA 2GGTA 4X1UA 2YWIA 1I9DA 2R0GA 5COHA 3H1NA 1AC1A 2QA1A 3ISOA 3ZVJA 3RAZA 4IQ1A 4TVEA 1XIYA 4YQMA 2CX3A 2VL2C 5ECOB 1XCCA 2GSTA 4AJ6A 4BA7A 1EWXA 3LJRA 5J41A 4BPYA 1K0DA 1LJRA 1AQWA 1BX9A 3KP8A 3M1GA 2HXKA 4L5OA 1BAYA 2OE0A 4V2LA 2YANA 3LQ7A 5H5QA 4K7IA 1FW1A 1DUGA 3UIWA 4TR1A 3A5IA 1VF2A 4KGIA 2XC2A 4YQUA 4BWQA 4MDCA 3FRCA 3N5OA 5FWGA 1T00A 1AIUA 4EC0A 1A24A 1B48A 2R4VA 1X0RA 3FZ5A 2YJHA 5IOWA 1F6MC 1THOA 4EE0A 4JZQA 5B6NA 2CZ3A 4KSMA 4HU9A 3TRQA 1MEKA 2RUFA 3DRNA 2LNTA 5H5SA 3BOAA 3D4MA 4ZXGA 1WJKA 1XW6A 5KN3A 5LCZA 2GSRA 2VCTA 3ZRDA 2JSYA 2BJXA 3M8NA 5FT3A 1LBKA 4YAVA 3GKXA 2CAQA 2H1GA 3EINA 1Z7PA 1EEJA 1XWBA 4GTUA 2I3YA 1HNCA 2VLVA 5C00A 1R4WA 1YF0A 1E6BA 3TGZA 2K8SA 1PA3A 3KM6A 1WWJA 2KOKA 2V41A 2I4AA 4PURA 2OACA 2AUVA 2C80A 2M80A 4GQFA 4XS1A 1X5CA 1FG4A 2H6YA 4G2EA 2FCHA 1MTCA 5IMFA 4IKHA 2FD3A 4XIHA 4ZILA 5HFKA 2DC5A 5GSTA 5HFIA 3QDNA 2IJYA 1PGTA 3FZ9A 1V98A 3GH6A 4KW6A 1V2AA 2VM2A 2CVKA 3KMNA 5D96A 1M99A 2H74A 5F05A 4GCIA 2X49A 3RPNA 1ZYQB 5GSSA 1B9XC 2L5LA 1YY7A 3CTFA 2GTUA 3DVWA 4OFNA 2V32A 2DMLA 2JZSA 1V57A 3TCOA 4Q5RA 4QL9A 2GQKA 5D9TA 4BVXA 2H76A 1NHYA 4TR4A 5DALB 1EP8A 4MK3A 4CW9A 2H19A 1ML6A 1T4YA 4MZBA 1K0CA 2F9SA 1I5GA 2HZEA 2E2GA 2AYTA 3S9FA 1B4PA 2TRCP 1TRSA 5D9XA 2HYXA 2CVDA 3TKSE 1FO5A 4KNDA 4TXOA 5DAKB 2VM1A 4ML1A 1NW2A 1AAZA 4IJ3A 1TW9A 2MZCA 4GXZA 3TKPA 3RBTA 3Q6OA 3FR9A 2PVQA 3ERWA 2C0EA 2FUG2 3APQA 3E0UA 5DVBA 4XHMA 3GSTA 2IMFA 3IAS2 4HOJA 2FWGA 3LXZA 1AQVA 3TDGA 4MF7A 4D73B 2A2PA 4OO5A 2JZTA 2K18A 1UA5A 3L9UA 4NXIA 3ZITA 4MJAA 3QAVA 1GNEA 4ISDA 1AUCA 2G0FA 5ELAA 2IFQA 4WF4A 2HRKA 1ZCPA 2D2ZA 4HSCX 2OJLA 4WR5A 2F3MA 2CAIA 4WEYA 1S3CA 1FB6A 4J56E 1Z6NA 4CHSA 3VWWA 1U87A 3RHCA 2AV4A 3TRXA 2XPEA 1M0UA 1GTUA 5DJLA 3M3MA 4EKZA 4O5UA 1TP9A 4P3YB 5IMZA 1FAAA 2X8GA 1QGVA 2YZHA 1GTBA 2VUPA 4K1FA 1XOAA 4FIWA 1MDIA 2PGTA 3ED3A 4MLYA 1FB0A 3IK9A 2R0CA 3TJJA 4WF5A 2VAFA 1SJIA 3GTUB 4HEA2 4OCEA 5IMVA 1FVKA 3CQFA 2L6DA 2JL4A 4I6XA 3HJMA 2OKAA 5F8BA 1YDKA 2JU5A 3F4SA 4TW5A 22GSA 4MZCA 3QAWA 3HHVA 1XOBA 3IOSA 4I2TA 2VD1A 3TKQA 3ERFA 2LNSA 3ZIJA 3F4TA 5G2ZA 4KA0A 4FQUA 1Q4JA 1C72A 2C8UA 5A4UA 4F0CA 3FK8A 3FHKA 2VLUA 5CRDA 3FKFA 3CSHA 4MZWA 1ON4A 1TI1A 3KTBA 4MJCA 4L5LA 1FHEA 1JZWA 4AJ7A 2CX4A 4IP6A 2OBIA 2WFCA 3QFAC 5F07A 4BWSA 3D0ZA 5E4WA 4V1Ag 3MAKA 1O81A 4BVYB 4YAPA 2XHFA 1XWGA 4MPFA 3F6DA 2H72A 3KIJA 4JRRA 5KEJA 3HVNA 1F2EA 1M3JA 2A2RA 4POBA 1PX7A 4FYUA 1VGLA 2OE1A 5HR0A 3P8WA 4K9ZA 4I5QA 3CXGA 1GH2A 5JWOB 1F3AA 4ZB9A 1T3BA 4H86A 2MYGA 3CTGA 4TR1B 19GSA 3O3TA 12GSA 2ES7A 1K0MA 2I81A 5J4UA 1PN9A 7GSSA 1Z3EA 4F03A 1X5DA 2HT9A 4MMMA 4TOPA 2YWNA 4K7NA 2WDUA 3KGKA 1GL8A 4GF0A 2GT6A 1DBYA 1QUWA 4GLTA 2NTOA 1O85A 3TJBA 1K3OA 3ZVJD 4F9ZA 2A2SA 1PKZA 2KLXA 4USSA 1FOHA 1PL1A 2HSHA 4ACSA 2L4QA 3IR4A 1DE1A 2V1MA 3GIXA 1YKCA 1A8YA 3KTLA 4IBPA 3M0FA 2YCDA 4TN8A 3QMXA 5KOWA 2KP2A 4MJBA 1U6TA 4G9HA 2WB9A 5G5EA 4JU5A 1RW1A 2VCXA 3J7Yk 6GSYA 3QCPA 6GSTA 3U5RE 2YWMA 3VWUA 3VI7A 5BMUA 3O6TA 5GAPD 2YN1A 1GLQA 2PN8A 1G7OA 2LQQA 3CBUA 4ULXA 1UC7A 4RI7A 4EUYA 3TKSA 4RUVA 3BCIA 2O8VB 3H93A 2CV4A 2IMEA 2H75A 3VURA 2E2MA 3KXOA 5KOXA 4O32A 6GSXA 3KMOA 5ECQB 4K5RA 1ABAA 1UVZA 4AGSA 2DLXA 1XVQA 4EIPA 3GKMA 3D6IA 2IIYA 4WETA 2H6ZA 4PX1A 2GDRA 1XWKA 1XFLA 3PR8A 3DGQA 4TXVA 1XZOA 5ECSA 4LA1A 4PUFC 5CP1A 4K8MA 3UBLA 1OVNA 4NMUA 2WJUA 3GRXA 5IO0A 3A3TA 1PL2A 1AQXA 4PQIA 2TRXA 2H0IA 4HZ2A 1OKTA 3HJOA 1O6JA 1H4OA 4ECCA 1H75A 1HQOA 3F0IA 5GZZB 4TKYA 1T8EB 5KN0A 4G0KA 3GN3A 1ZOFA 3HKRA 3F3RA 3VWVA 2DSAA 1YQ1A 2R6KA 2X99A 1BEDA 1S3DA 3PGTA 4N0VA 1XVWA 1W4VA 4MH3A 1MD3A 2J9HA 3MYDA 4HI7A 4XS6A 2WRTA 1GSFA 1R7HA 2YWOA 1J9BA 1KBNA 5DJMA 1TK0B 4GSSA 3I6AA 4JBBA 2VL9A 3H8QA 1GUKA 5G1LA 4BVXB 3ZTLA 5IIZA 1GWCA 5KN1A 1GTAA 2IPAA 4F2IA 1EZKA 4A5PA 1IYIA 4IW9A 1R5AA 2N5BA 3UARA 2BMXA 2N5AA 5ECLB 1A2LA 2HZEB 4IS0A 1Z6MA 3WGXA 4OMVA 1PQNA 4X4JA 1SENA 1YEXA 3G9BA 2PU9C 4NHWA 3P90A 2LEGA 2YOIA 4TXOB 2ZNMA 3W6GA 2OE3A 3UVTA 3GV1A 2R0PA 2GT5A 3IPZA 3P2AA 1XBSA 1T1VA 5L71A 1SJZA 3C8EA 4PUAA 1V9WA 3M9JA 3DIEA 3EU3A 4BL7A 4EIQA 3NIVA 6GSUA 2M72A 5IMDA 4K0NA 1ERTA 3C73A 3VI5A 3RHBA 2YNXA 5A4WA 1PN0A 4PXOA 3LXTA 1F3BA 1A2JA 3ME8A 4K0GA 2IFQB 4O7HA 1EP7A 3FZ4A 2CVBA 2GS3A 1O8XA 2IMDA 1GUHA 4Q5QA 4MCUA 5JCWA 4IJIA 2XBIA 5CYYA 2B5YA 1B4QA 1EOHA 5IQYA 4YQVA 3D22A 1QMVA 2PERA 2VL3A 2H1BA 1CQGA 2B7JA 1GSUA 3L78A 4N0ZA 3I69A 2L59A 1F9MA 13GSA 1HNBA 2FY6A 2IMKA 1GSDA 2H01A 3F6FA 1ZYPA 2MMZA 2YP6A 1GRXA 1Z5YE 4XCSA 1YKAA 2VO4A 1SKWB 1B9YC 3FMWA 3Q18A 3VFIA 2C3TA 1XW9A 1TK8B 4ZBBA 1B8XA 2NPBA 1JHBA 4FO5A 3IHGA 5D93A 2OA7A 5C04A 4O5RA 1KNGA 3GUSA 1XG8A 1ST9A 2VOCA 3IA1A 2REMA 2HFDA 2MMAA 1ZMAA 2NBSA 1PSQA 3ZL5A 4JR6A 2ZUPA 1N2AA 1FOVA 4E8EA 3EMXA 2HI7A 4OO4A 2WS2A 3UL3A 4F0BA 2CA8A 5CREA 4LL4B 4KDUA 1TDIA 4N10A 4AJ8A 2YZUA 2ZCTA 3W8JA 2L57A 2C3NA 1SK2A 3TOTA 3KH9A 3UJ1A 4ZB6A 1XWAA 2DJ3A 1ACVA 3IXRA 2B7KA 2VCVA 4WBRD 3WT2A 3G7JA 3LSZA 5G30A 2EIOA 2XBQA 1CQHA 1URMA 3HD5A 3EWLA 3IAM2 5INYA 1JFUA 1GSYA 1GULA 1WOUA 3WGEA 2HRAA 2PBJA 2CZ2A 2RLIA 2PMTA 2C3QA 3EURA 3CRUA 3TKRA 3L9SA 3QOUA 4O5QA 2LRCA 1TJDA 5B6MA 5EY6A 2R3XA 2P0GA 4Z2TA 2B5XA 5G31A 3ZFLA 5CAXA 3GL5A 4JEDA 3C1SA 2NVLA 2O85A 4XTSA 3FYGA 2X8CA 1OC9A 3ZLPA 2VL2A 3V1WA 1V40A 3A2VA 1PKWA 1OAZA 3HJPA 1A8LA 5EPFA 3UEMA 3SBCA 2KP1A 3J7Yb 2HRNA 3JCML 2IN3A 4ECBA 1JLWA 3ZMLA 3DWVA 2AB6A 4CDOA 2DIZA 1ZYEA 1TRWA 1JZOA 3BD2A 3TRPA 1SK0A 4ZBAA 3EYTA 2O89A 1K3YA 3HY2A 2F51A 1E2YA 3LW9A 1X9MB 3NZNA 3ZZXA 5AIVA 1M9BA 1N8JA 1QK8A 1SU9A 5DQSA 3FZAA 2H0HA 4ECJA 2EIRA 1ERVA 3BBYA 4BIKA 4ZIJA 4J2FA 4KDYA 1K0OA 3GFKA 5D73A 5DCHA 2L5OA 5ECIB 3FW2A 2B1KA 5JWQB 2VIMA 1PMTA 5LD0A 3FR3A 3EE2A 4HUAA 3C7MA 1A0RP 2FWFA 1J08A 2H70A 3E9JB 2DJ2A 2ON7A 1KEBA 1EGRA 3P7XA 2PPTA 2TIRA 1M9AA 4J57E 5AISA 5KN2A 3WGDA 2HSYA 4ZL9A 2K6VA 3Q19A 1X9SB 1U3IA 3GX8A 3APSA 4Q5FA 1V58A 2B6MA 3RPPA 1TI3A 3R3EA 1NM3A 4WKWA 3C71A 3PINA 4FYCA 2I9HA 3AY8A 2QKEA 3ZMKA 2M46A 4XS4A 4G0LA 4EO3A 4N30A 4ZB8A 4KSOA 1QXHA 1ERWA 1RQMA 4HJMA 3HDCA 3EMPA 4K2DA 4LMWA 5J3RA 1T4ZA 3GURA 2AJQB 1QFNA 1KTEA 5HR1A 2A4VA 4DSSA 4DEJA 3KP9A 4KE3A 4ECIA 1Y6EA 3IRAA 1S3AA 3CRTA 5A4VA 4WBJA 5JCGA 3CSJA 1JZRA 3TJGA 5F06A 5G5FA 2FA8A 3G7IA 2H1AA 1VRSD 4FH8A 5IPHA 2H8LA 2MBTA 3O76A 4EXJA 20GSA 4JR4A 1SD9A 2C4JA 1RK4A 1THXA 2C1YA 4DSQA 3UMAA 1K0NA 3E3EA 1X5EA 4HJ2A 1XW5A 2MMOA 4GSTA 4YH2A 3F63A 5IMCA 4TR0A 4G10A 1ZYNA 1X9WB 4BL7B 4EDYA 4PNGA 5DQYA 2P5RA 1TU7A 2C0DA 5JWRB 3MSZA 5IOXA 1O73A 1JZDA 4YKGA 5JCUA 2X64A 1WPIA 5AIXA 2FA4A 2DKIA 2GZPA 5ID2A 1WIKA 4EDZA 4RQXA 5IPGA 1BJXA 4KAEA 2QGVA 3W8SA 9GSSA 2ALBA 2QC7A 1M2AA 2B1LA 4NAXA 4CY8A 2FWEA 2V6OA 2GQLA 2AHEA 5EL8A 1TU8A 2C0FA 1WP0A 1SK1A 3F3QA 4TRXA 2CQ9A 1GP1A 2N5FA 3CSIA 2H73A 1SYXA 3EU4A 4I97A 1EEMA 4HQSA 1VF4A 4GQCA 3ERGA 4E8HA 4G0IA 2VCWA 1ZGNA 1JLVA 5A5KA 4KH7A 4PGTA 4HQZA 5ECHB 3VLNA 3PH9A 1WMJA 5HQPA 1ERUA 2JADA 3ZYWA 3KZQA 1A0FA 1GSSA 4X43A 3D5JA 2YJ7A 2FGXA 2GVPA 1O8WA 2DJ1A 1Y25A 3IE3A 1GTIA 2PWJA 4I2UA 1WRYA 4KCAA 3LGCA 4KDXA 4ILFA 4LL1B 1SL0B 2P31A 1M7TA 1PFOA 4MA9A 2HSMA 4K7OA 4WXTA 5BRTA 2EIQA 3HVSA 4ZBDA 2H66A 3FY7A 3HZ8A 1Z9HA 5B8AA 1U88A 2WGRA 3MWHA 3ZFBA 1TRUA 4BVYA 3IHQA 3WT1A 3UAPA 3QAGA 2H1DA 2O87A 4POLA 3A5WA 4PNFA 2LJKA 5HR3A 3KEBA 3LYPA 5J9BA 4IVFA 2XPDA 4IN0A 4XRDA 2FHEA 3FR6A 4YKFA 4MNNA 4V2NA 1OE8A 4V1Ap 4HU7A 3LWAA 5CRHA 3GX0A 2LJRA 1MDKA 4JE1A 2YPMA 1O7UA 2O7KA 1A2MA 1EV4A 3LG6A 1OE7A 2DJKA 3ZREA 5CNWA 2VCQA 5ELGA 5DDLA 5ENUA 1Z7RA 4NPBA 3IBHA 2H6XA 2GZYA 3LORA 4ZL7A 4PQ1A 4I8BA 1OC9B 4WR4A 4OCFA 2B5EA 2ON5A 5LNKe 1R26A 3GL3A 1ZL9A 3APOA 4MABA 5J5NA 1DSBA 1ZZYA 4MF6A 4K2XA 2PUKC 8GSSA 1SJ6A 3A2WA 3PPUA 3R2QA 2L4CA 3TUEA 1F37A 1K0AA 1A23A 2LTKA 1Q98A 1EV9A 1M3IA 5ECRB
chains in the Genus database with same CATH topology
1MDJA 3HZ4A 2K9FA 1BQ7A 2L6CA 1VF1A 5B8BA 3WYWA 5CRWA 4N11A 2HZFA 4K6XA 3C1RA 3QR6A 5HR2A 2UZ8A 1GSQA 3HYPA 1YJ6A 4KCEA 3G7YA 2GSSA 1AXDA 2RM5A 5ECMB 6GSWA 4EL1A 4DVCA 1TTZA 3F8UA 3GNJA 2LS5A 4ZL8A 1SKRB 4F82A 4HS1A 2LRTA 3OR5A 2CT6A 3LEFA 2VD0A 3GSSA 5ABRA 4HZ4A 2LUSA 4GSNA 2E0QA 1ILOA 4PQHA 2A4HA 1IYHA 2HNLA 4KB3A 5EVOA 1M2DA 2HE3A 4ML6A 4L8EA 2VLTA 5ECPB 3KH7A 2KHPA 4GRFA 3UBKA 2KUCA 4V2MA 4L0WA 4PTSA 3DXBA 3D4TA 2HRFA 3CMIA 11GSA 2VCZA 2WCIA 1UN2A 6GSVA 1YF1A 4POMA 3TKSC 1TKDB 2DJJA 2LRNA 3QD9A 4QL7A 3ZIVA 4XS4B 3WD6A 2QA2A 1EGOA 2YV9A 5ECKB 2DIYA 14GSA 2FNOA 2GLRA 2H0GA 4MPGA 2E7PA 2I1UA 4Q5NA 3K8NA 1USBA 1G7EA 5GAND 1NSWA 2R2JA 3M9KA 4CY6A 3TOUA 4DSSB 1G0TA 1XPVA 2Z9SA 4L0UA 3TJKA 4ICYA 1LU4A 4MP4A 3GKNA 3IV4A 4OWYA 3MIXA 4KF9A 1U3AA 2HLSA 2JSZA 3LYKA 4IP1A 1EOGA 4EF0A 3BCKA 4RQRA 1GNWA 3DKSA 1J0FA 2FWHA 3D21A 2YV7A 1YEPA 2IMIA 2K8VA 2H30A 2MMNA 4DSRA 5DCGA 3SWLA 4X0XA 3U6VA 5E59A 5G1KA 2V6KA 3TB2A 3DYRA 3IK7A 3GKKA 3F4RA 5ID2B 3N9JA 3QFBC 4EVMA 1PX6A 1DE2A 5DBQA 1OYJA 3FEUA 4XRAA 2H71A 3IC4A 1GLPA 3TJFA 3GA4A 17GSA 3EVIA 3HVXA 3KCMA 5J9CA 5IO2A 3CYNA 2RM6A 3EC3A 1SD8A 2QSIA 2P5QA 2JZRA 1BG5A 3UVHA 3IC8A 2R5GA 1GUMA 5FHIA 4OFTA 4O92A 6GSSA 2MBSA 2NDOA 4OFMA 1T7PB 5DALA 5F0GA 3GYKA 5AN1A 2G2QA 3GMFA 1NHOA 2IL3A 3US3A 1M2BA 1QQ2A 2GZZA 4AF2A 3LFLA 1TXXA 3GHAA 4MJEA 1R5PA 3I9V2 2F8FA 2OADA 1XWCA 4KUNA 2DKHA 3L9VA 3H4KA 5IMAA 3VWXA 1VF3A 5DAKA 3HCZA 4ID0A 3KD0A 3H79A 3I43A 5AGYA 5D9VA 2WULA 1HD2A 2C0GA 2JACA 10GSA 1PRXA 3DD3A 3KJYA 4NHZA 2F8AA 4IQAA 3BJ5A 5H5RA 1TOFA 4OD7A 2DMMA 2B3SA 18GSA 1HNAA 4D73A 3QPMA 2OBKA 1FVJA 2BTOT 3HVVA 3MDKA 3Q74A 5B7CA 4HDEA 4Z2UA 1HYUA 4IELA 1G6YA 3L0HA 3RDWA 4K5SA 4IGJA 4Z2RA 5HFGA 2J23A 1YZXA 1OKDA 1W89A 1SL1B 3ME7A 1TRVA 1TK5B 4FYBA 2WZ9A 2AAWA 4RI6A 4NV2A 5D8IA 4LLRA 2GSQA 3IDVA 1K0BA 3DEXA 4IHUA 1SYRA 1SL2B 5IM9A 4LMVA 3NOFA 4POKA 2DJ0A 5CO3A 3EPTA 4GWRA 4QQ7A 2X8HA 2RIIA 16GSA 1OC3A 4Z7XA 3F9UA 2PVOC 2RUEA 3L4NA 5D9WA 1K3LA 4MF5A 3MNGA 2EC4A 2IWTA 3HA9A 1XXUA 1AW9A 4TR3A 1SKSB 4NV5A 3VPTA 3UOMA 3A2XA 1BYEA 3GH9A 1GSEA 2LSTA 2V2GA 1MD4A 1WE0A 2LKUA 3VK9A 4MH2A 3GTUA 3VPQA 1OC8A 5CRGA 3DVXA 1PD21 4G19A 3HXSA 1G6WA 3DMLA 2LJAA 4KX4A 2DBCA 5ECNB 2X4AA 4NWYA 2FLSA 2LV3A 2LQOA 2R37A 2GQMA 2GGTA 4X1UA 2YWIA 1I9DA 2R0GA 5COHA 3H1NA 1AC1A 2QA1A 3ISOA 3ZVJA 3RAZA 4IQ1A 4TVEA 1XIYA 4YQMA 2CX3A 2VL2C 5ECOB 1XCCA 2GSTA 4AJ6A 4BA7A 1EWXA 3LJRA 5J41A 4BPYA 1K0DA 1LJRA 1AQWA 1BX9A 3KP8A 3M1GA 2HXKA 4L5OA 1BAYA 2OE0A 4V2LA 2YANA 3LQ7A 5H5QA 4K7IA 1FW1A 1DUGA 3UIWA 4TR1A 3A5IA 1VF2A 4KGIA 2XC2A 4YQUA 4BWQA 4MDCA 3FRCA 3N5OA 5FWGA 1T00A 1AIUA 4EC0A 1A24A 1B48A 2R4VA 1X0RA 3FZ5A 2YJHA 5IOWA 1F6MC 1THOA 4EE0A 4JZQA 5B6NA 2CZ3A 4KSMA 4HU9A 3TRQA 1MEKA 2RUFA 3DRNA 2LNTA 5H5SA 3BOAA 3D4MA 4ZXGA 1WJKA 1XW6A 5KN3A 5LCZA 2GSRA 2VCTA 3ZRDA 2JSYA 2BJXA 3M8NA 5FT3A 1LBKA 4YAVA 3GKXA 2CAQA 2H1GA 3EINA 1Z7PA 1EEJA 1XWBA 4GTUA 2I3YA 1HNCA 2VLVA 5C00A 1R4WA 1YF0A 1E6BA 3TGZA 2K8SA 1PA3A 3KM6A 1WWJA 2KOKA 2V41A 2I4AA 4PURA 2OACA 2AUVA 2C80A 2M80A 4GQFA 4XS1A 1X5CA 1FG4A 2H6YA 4G2EA 2FCHA 1MTCA 5IMFA 4IKHA 2FD3A 4XIHA 4ZILA 5HFKA 2DC5A 5GSTA 5HFIA 3QDNA 2IJYA 1PGTA 3FZ9A 1V98A 3GH6A 4KW6A 1V2AA 2VM2A 2CVKA 3KMNA 5D96A 1M99A 2H74A 5F05A 4GCIA 2X49A 3RPNA 1ZYQB 5GSSA 1B9XC 2L5LA 1YY7A 3CTFA 2GTUA 3DVWA 4OFNA 2V32A 2DMLA 2JZSA 1V57A 3TCOA 4Q5RA 4QL9A 2GQKA 5D9TA 4BVXA 2H76A 1NHYA 4TR4A 5DALB 1EP8A 4MK3A 4CW9A 2H19A 1ML6A 1T4YA 4MZBA 1K0CA 2F9SA 1I5GA 2HZEA 2E2GA 2AYTA 3S9FA 1B4PA 2TRCP 1TRSA 5D9XA 2HYXA 2CVDA 3TKSE 1FO5A 4KNDA 4TXOA 5DAKB 2VM1A 4ML1A 1NW2A 1AAZA 4IJ3A 1TW9A 2MZCA 4GXZA 3TKPA 3RBTA 3Q6OA 3FR9A 2PVQA 3ERWA 2C0EA 2FUG2 3APQA 3E0UA 5DVBA 4XHMA 3GSTA 2IMFA 3IAS2 4HOJA 2FWGA 3LXZA 1AQVA 3TDGA 4MF7A 4D73B 2A2PA 4OO5A 2JZTA 2K18A 1UA5A 3L9UA 4NXIA 3ZITA 4MJAA 3QAVA 1GNEA 4ISDA 1AUCA 2G0FA 5ELAA 2IFQA 4WF4A 2HRKA 1ZCPA 2D2ZA 2OJLA 4WR5A 2F3MA 2CAIA 4WEYA 1S3CA 1FB6A 4J56E 1Z6NA 4CHSA 3VWWA 1U87A 3RHCA 2AV4A 3TRXA 2XPEA 1M0UA 1GTUA 5DJLA 3M3MA 4EKZA 4O5UA 1TP9A 4P3YB 5IMZA 1FAAA 2X8GA 1QGVA 2YZHA 1GTBA 2VUPA 4K1FA 1XOAA 4FIWA 1MDIA 2PGTA 3ED3A 4MLYA 1FB0A 3IK9A 2R0CA 3TJJA 4WF5A 2VAFA 1SJIA 3GTUB 4HEA2 4OCEA 5IMVA 1FVKA 2L6DA 2JL4A 4I6XA 3HJMA 2OKAA 5F8BA 1YDKA 2JU5A 3F4SA 4TW5A 22GSA 4MZCA 3QAWA 3HHVA 1XOBA 3IOSA 4I2TA 2VD1A 3TKQA 3ERFA 2LNSA 3ZIJA 3F4TA 5G2ZA 4KA0A 4FQUA 1Q4JA 1C72A 2C8UA 5A4UA 4F0CA 3FK8A 3FHKA 2VLUA 5CRDA 3FKFA 3CSHA 4MZWA 1ON4A 1TI1A 3KTBA 4MJCA 4L5LA 1FHEA 1JZWA 4AJ7A 2CX4A 4IP6A 2OBIA 2WFCA 3QFAC 5F07A 4BWSA 3D0ZA 5E4WA 4V1Ag 3MAKA 1O81A 4BVYB 4YAPA 2XHFA 1XWGA 4MPFA 3F6DA 2H72A 3KIJA 4JRRA 5KEJA 1F2EA 2A2RA 4POBA 1PX7A 4FYUA 1VGLA 2OE1A 5HR0A 3P8WA 4K9ZA 4I5QA 3CXGA 1GH2A 5JWOB 1F3AA 4ZB9A 1T3BA 4H86A 2MYGA 3CTGA 4TR1B 19GSA 3O3TA 12GSA 2ES7A 1K0MA 2I81A 5J4UA 1PN9A 7GSSA 1Z3EA 4F03A 1X5DA 2HT9A 4MMMA 4TOPA 2YWNA 4K7NA 2WDUA 3KGKA 1GL8A 4GF0A 2GT6A 1DBYA 1QUWA 4GLTA 2NTOA 1O85A 3TJBA 1K3OA 3ZVJD 4F9ZA 2A2SA 1PKZA 2KLXA 4USSA 1FOHA 1PL1A 2HSHA 4ACSA 2L4QA 3IR4A 1DE1A 2V1MA 3GIXA 1YKCA 1A8YA 3KTLA 4IBPA 3M0FA 2YCDA 4TN8A 3QMXA 5KOWA 2KP2A 4MJBA 1U6TA 4G9HA 2WB9A 5G5EA 4JU5A 1RW1A 2VCXA 3J7Yk 6GSYA 3QCPA 6GSTA 3U5RE 2YWMA 3VWUA 3VI7A 5BMUA 3O6TA 5GAPD 2YN1A 1GLQA 2PN8A 1G7OA 2LQQA 3CBUA 4ULXA 1UC7A 4RI7A 4EUYA 3TKSA 4RUVA 3BCIA 2O8VB 3H93A 2CV4A 2IMEA 2H75A 3VURA 2E2MA 3KXOA 5KOXA 4O32A 6GSXA 3KMOA 5ECQB 4K5RA 1ABAA 1UVZA 4AGSA 2DLXA 1XVQA 4EIPA 3GKMA 3D6IA 2IIYA 4WETA 2H6ZA 4PX1A 2GDRA 1XWKA 1XFLA 3PR8A 3DGQA 4TXVA 1XZOA 5ECSA 4LA1A 4PUFC 5CP1A 4K8MA 3UBLA 1OVNA 4NMUA 2WJUA 3GRXA 5IO0A 3A3TA 1PL2A 1AQXA 4PQIA 2TRXA 2H0IA 4HZ2A 1OKTA 3HJOA 1O6JA 1H4OA 4ECCA 1H75A 1HQOA 3F0IA 5GZZB 4TKYA 1T8EB 5KN0A 4G0KA 3GN3A 1ZOFA 3HKRA 3F3RA 3VWVA 2DSAA 1YQ1A 2R6KA 2X99A 1BEDA 1S3DA 3PGTA 4N0VA 1XVWA 1W4VA 4MH3A 1MD3A 2J9HA 3MYDA 4HI7A 4XS6A 2WRTA 1GSFA 1R7HA 2YWOA 1J9BA 1KBNA 5DJMA 1TK0B 4GSSA 3I6AA 4JBBA 2VL9A 3H8QA 1GUKA 5G1LA 4BVXB 3ZTLA 5IIZA 1GWCA 5KN1A 1GTAA 2IPAA 4F2IA 1EZKA 4A5PA 1IYIA 4IW9A 1R5AA 2N5BA 3UARA 2BMXA 2N5AA 5ECLB 1A2LA 2HZEB 4IS0A 1Z6MA 3WGXA 4OMVA 1PQNA 4X4JA 1SENA 1YEXA 3G9BA 2PU9C 4NHWA 3P90A 2LEGA 2YOIA 4TXOB 2ZNMA 3W6GA 2OE3A 3UVTA 3GV1A 2R0PA 2GT5A 3IPZA 3P2AA 1XBSA 1T1VA 5L71A 1SJZA 3C8EA 4PUAA 1V9WA 3M9JA 3DIEA 3EU3A 4BL7A 4EIQA 3NIVA 6GSUA 2M72A 5IMDA 4K0NA 1ERTA 3C73A 3VI5A 3RHBA 2YNXA 5A4WA 1PN0A 4PXOA 3LXTA 1F3BA 1A2JA 3ME8A 4K0GA 2IFQB 4O7HA 1EP7A 3FZ4A 2CVBA 2GS3A 1O8XA 2IMDA 1GUHA 4Q5QA 4MCUA 5JCWA 4IJIA 2XBIA 5CYYA 2B5YA 1B4QA 1EOHA 5IQYA 4YQVA 3D22A 1QMVA 2PERA 2VL3A 2H1BA 1CQGA 2B7JA 1GSUA 3L78A 4N0ZA 3I69A 2L59A 1F9MA 13GSA 1HNBA 2FY6A 2IMKA 1GSDA 2H01A 3F6FA 1ZYPA 2MMZA 2YP6A 1GRXA 1Z5YE 4XCSA 1YKAA 2VO4A 1SKWB 1B9YC 3FMWA 3Q18A 3VFIA 2C3TA 1XW9A 1TK8B 4ZBBA 1B8XA 2NPBA 1JHBA 4FO5A 3IHGA 5D93A 2OA7A 5C04A 4O5RA 1KNGA 3GUSA 1ST9A 2VOCA 3IA1A 2REMA 2HFDA 2MMAA 1ZMAA 2NBSA 1PSQA 3ZL5A 4JR6A 2ZUPA 1N2AA 1FOVA 4E8EA 3EMXA 2HI7A 4OO4A 2WS2A 3UL3A 4F0BA 2CA8A 5CREA 4LL4B 4KDUA 1TDIA 4N10A 4AJ8A 2YZUA 2ZCTA 3W8JA 2L57A 2C3NA 1SK2A 3TOTA 3KH9A 3UJ1A 4ZB6A 1XWAA 2DJ3A 1ACVA 3IXRA 2B7KA 2VCVA 4WBRD 3WT2A 3G7JA 3LSZA 5G30A 2EIOA 2XBQA 1CQHA 1URMA 3HD5A 3EWLA 3IAM2 5INYA 1JFUA 1GSYA 1GULA 1WOUA 3WGEA 2HRAA 2PBJA 2CZ2A 2RLIA 2PMTA 2C3QA 3EURA 3CRUA 3TKRA 3L9SA 3QOUA 4O5QA 2LRCA 1TJDA 5B6MA 5EY6A 2R3XA 2P0GA 4Z2TA 2B5XA 5G31A 3ZFLA 5CAXA 3GL5A 4JEDA 3C1SA 2NVLA 2O85A 4XTSA 3FYGA 2X8CA 1OC9A 3ZLPA 2VL2A 3V1WA 1V40A 3A2VA 1PKWA 1OAZA 3HJPA 1A8LA 5EPFA 3UEMA 3SBCA 2KP1A 3J7Yb 2HRNA 3JCML 2IN3A 4ECBA 1JLWA 3ZMLA 3DWVA 2AB6A 4CDOA 2DIZA 1ZYEA 1TRWA 1JZOA 3BD2A 3TRPA 1SK0A 4ZBAA 3EYTA 2O89A 1K3YA 3HY2A 2F51A 1E2YA 3LW9A 1X9MB 3NZNA 3ZZXA 5AIVA 1M9BA 1N8JA 1QK8A 1SU9A 5DQSA 3FZAA 2H0HA 4ECJA 2EIRA 1ERVA 3BBYA 4ZIJA 4J2FA 4KDYA 1K0OA 3GFKA 5D73A 5DCHA 2L5OA 5ECIB 3FW2A 2B1KA 5JWQB 2VIMA 1PMTA 5LD0A 3FR3A 3EE2A 4HUAA 3C7MA 1A0RP 2FWFA 1J08A 2H70A 3E9JB 2DJ2A 2ON7A 1KEBA 1EGRA 3P7XA 2PPTA 2TIRA 1M9AA 4J57E 5AISA 5KN2A 3WGDA 2HSYA 4ZL9A 2K6VA 3Q19A 1X9SB 1U3IA 3GX8A 3APSA 4Q5FA 1V58A 2B6MA 3RPPA 1TI3A 3R3EA 1NM3A 4WKWA 3C71A 3PINA 4FYCA 2I9HA 3AY8A 2QKEA 3ZMKA 2M46A 4XS4A 4G0LA 4EO3A 4N30A 4ZB8A 4KSOA 1QXHA 1ERWA 1RQMA 4HJMA 3HDCA 3EMPA 4K2DA 4LMWA 5J3RA 1T4ZA 3GURA 2AJQB 1QFNA 1KTEA 5HR1A 2A4VA 4DSSA 4DEJA 3KP9A 4KE3A 4ECIA 1Y6EA 3IRAA 1S3AA 3CRTA 5A4VA 4WBJA 5JCGA 3CSJA 1JZRA 3TJGA 5F06A 5G5FA 2FA8A 3G7IA 2H1AA 1VRSD 4FH8A 5IPHA 2H8LA 2MBTA 3O76A 4EXJA 20GSA 4JR4A 1SD9A 2C4JA 1RK4A 1THXA 2C1YA 4DSQA 3UMAA 1K0NA 3E3EA 1X5EA 4HJ2A 1XW5A 2MMOA 4GSTA 4YH2A 3F63A 5IMCA 4TR0A 4G10A 1ZYNA 1X9WB 4BL7B 4EDYA 4PNGA 5DQYA 2P5RA 1TU7A 2C0DA 5JWRB 3MSZA 5IOXA 1O73A 1JZDA 4YKGA 5JCUA 2X64A 1WPIA 5AIXA 2FA4A 2DKIA 2GZPA 5ID2A 1WIKA 4EDZA 4RQXA 5IPGA 1BJXA 4KAEA 2QGVA 3W8SA 9GSSA 2ALBA 2QC7A 1M2AA 2B1LA 4NAXA 4CY8A 2FWEA 2V6OA 2GQLA 2AHEA 5EL8A 1TU8A 2C0FA 1WP0A 1SK1A 3F3QA 4TRXA 2CQ9A 1GP1A 2N5FA 3CSIA 2H73A 1SYXA 3EU4A 4I97A 1EEMA 4HQSA 1VF4A 4GQCA 3ERGA 4E8HA 4G0IA 2VCWA 1ZGNA 1JLVA 5A5KA 4KH7A 4PGTA 4HQZA 5ECHB 3VLNA 3PH9A 1WMJA 5HQPA 1ERUA 2JADA 3ZYWA 3KZQA 1A0FA 1GSSA 4X43A 3D5JA 2YJ7A 2FGXA 2GVPA 1O8WA 2DJ1A 1Y25A 3IE3A 1GTIA 2PWJA 4I2UA 1WRYA 4KCAA 3LGCA 4KDXA 4ILFA 4LL1B 1SL0B 2P31A 1M7TA 4MA9A 2HSMA 4K7OA 4WXTA 5BRTA 2EIQA 3HVSA 4ZBDA 2H66A 3FY7A 3HZ8A 1Z9HA 5B8AA 1U88A 2WGRA 3MWHA 3ZFBA 1TRUA 4BVYA 3IHQA 3WT1A 3UAPA 3QAGA 2H1DA 2O87A 4POLA 3A5WA 4PNFA 2LJKA 5HR3A 3KEBA 3LYPA 5J9BA 4IVFA 2XPDA 4IN0A 4XRDA 2FHEA 3FR6A 4YKFA 4MNNA 4V2NA 1OE8A 4V1Ap 4HU7A 3LWAA 5CRHA 3GX0A 2LJRA 1MDKA 4JE1A 2YPMA 1O7UA 2O7KA 1A2MA 1EV4A 3LG6A 1OE7A 2DJKA 3ZREA 5CNWA 2VCQA 5ELGA 5DDLA 5ENUA 1Z7RA 4NPBA 3IBHA 2H6XA 2GZYA 3LORA 4ZL7A 4PQ1A 4I8BA 1OC9B 4WR4A 4OCFA 2B5EA 2ON5A 5LNKe 1R26A 3GL3A 1ZL9A 3APOA 4MABA 5J5NA 1DSBA 1ZZYA 4MF6A 4K2XA 2PUKC 8GSSA 1SJ6A 3A2WA 3PPUA 3R2QA 2L4CA 3TUEA 1F37A 1K0AA 1A23A 2LTKA 1Q98A 1EV9A 5ECRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDJ A;  3HZ4 A;  2K9F A;  1BQ7 A;  2L6C A;  1VF1 A;  5B8B A;  3WYW A;  5CRW A;  4N11 A;  2HZF A;  4K6X A;  3C1R A;  3QR6 A;  5HR2 A;  1GSQ A;  3HYP A;  1YJ6 A;  4KCE A;  3G7Y A;  2GSS A;  1AXD A;  2RM5 A;  5ECM B;  6GSW A;  4EL1 A;  4DVC A;  1TTZ A;  3F8U A;  3GNJ A;  2LS5 A;  4ZL8 A;  1SKR B;  4F82 A;  4HS1 A;  2LRT A;  3OR5 A;  2CT6 A;  3LEF A;  2VD0 A;  3GSS A;  5ABR A;  4HZ4 A;  2LUS A;  4GSN A;  2E0Q A;  1ILO A;  4PQH A;  2HNL A;  1IYH A;  4KB3 A;  5EVO A;  1M2D A;  2HE3 A;  4ML6 A;  4L8E A;  5ECP B;  2VLT A;  3KH7 A;  2KHP A;  4GRF A;  3UBK A;  2KUC A;  4V2M A;  4L0W A;  3DXB A;  3D4T A;  2HRF A;  3CMI A;  11GS A;  2VCZ A;  2WCI A;  1UN2 A;  6GSV A;  1YF1 A;  4POM A;  3TKS C;  1TKD B;  2DJJ A;  2LRN A;  3QD9 A;  4QL7 A;  3ZIV A;  4XS4 B;  3WD6 A;  1EGO A;  2YV9 A;  5ECK B;  2DIY A;  14GS A;  2FNO A;  2GLR A;  2H0G A;  4MPG A;  2E7P A;  2I1U A;  4Q5N A;  3K8N A;  1USB A;  1G7E A;  5GAN D;  1NSW A;  2R2J A;  3M9K A;  3TOU A;  4DSS B;  1G0T A;  1XPV A;  2Z9S A;  4L0U A;  3TJK A;  1LU4 A;  4MP4 A;  3GKN A;  3IV4 A;  4OWY A;  1U3A A;  2HLS A;  2JSZ A;  3LYK A;  4IP1 A;  1EOG A;  4EF0 A;  3BCK A;  4RQR A;  1GNW A;  3DKS A;  1J0F A;  2FWH A;  3D21 A;  2YV7 A;  1YEP A;  2IMI A;  2K8V A;  2H30 A;  2MMN A;  4DSR A;  5DCG A;  3SWL A;  4X0X A;  3U6V A;  5E59 A;  5G1K A;  2V6K A;  3TB2 A;  3DYR A;  3IK7 A;  3GKK A;  3F4R A;  5ID2 B;  3N9J A;  3QFB C;  4EVM A;  1PX6 A;  1DE2 A;  5DBQ A;  1OYJ A;  3FEU A;  4XRA A;  2H71 A;  3IC4 A;  1GLP A;  3TJF A;  3GA4 A;  17GS A;  3EVI A;  3HVX A;  3KCM A;  5J9C A;  5IO2 A;  3CYN A;  2RM6 A;  3EC3 A;  1SD8 A;  2QSI A;  2P5Q A;  2JZR A;  1BG5 A;  3UVH A;  2R5G A;  1GUM A;  5FHI A;  4OFT A;  4O92 A;  6GSS A;  2MBS A;  2NDO A;  4OFM A;  1T7P B;  5DAL A;  5F0G A;  3GYK A;  5AN1 A;  2G2Q A;  3GMF A;  1NHO A;  2IL3 A;  3US3 A;  1M2B A;  1QQ2 A;  2GZZ A;  4AF2 A;  3LFL A;  1TXX A;  3GHA A;  4MJE A;  1R5P A;  3I9V 2;  2F8F A;  2OAD A;  1XWC A;  4KUN A;  3L9V A;  3H4K A;  5IMA A;  3VWX A;  1VF3 A;  5DAK A;  3HCZ A;  4ID0 A;  3KD0 A;  3H79 A;  3I43 A;  5AGY A;  5D9V A;  2WUL A;  1HD2 A;  2C0G A;  2JAC A;  10GS A;  1PRX A;  3DD3 A;  3KJY A;  4NHZ A;  2F8A A;  4IQA A;  3BJ5 A;  5H5R A;  1TOF A;  4OD7 A;  2DMM A;  2B3S A;  18GS A;  1HNA A;  4D73 A;  3QPM A;  2OBK A;  1FVJ A;  2BTO T;  3HVV A;  3MDK A;  3Q74 A;  5B7C A;  4HDE A;  1HYU A;  4IEL A;  1G6Y A;  3L0H A;  3RDW A;  4IGJ A;  5HFG A;  2J23 A;  1YZX A;  1OKD A;  1W89 A;  1SL1 B;  3ME7 A;  1TRV A;  1TK5 B;  4FYB A;  2WZ9 A;  2AAW A;  4RI6 A;  5D8I A;  4NV2 A;  4LLR A;  2GSQ A;  3IDV A;  1K0B A;  3DEX A;  4IHU A;  1SYR A;  1SL2 B;  5IM9 A;  4LMV A;  3NOF A;  4POK A;  2DJ0 A;  5CO3 A;  4GWR A;  4QQ7 A;  2X8H A;  2RII A;  16GS A;  1OC3 A;  4Z7X A;  3F9U A;  2PVO C;  2RUE A;  3L4N A;  5D9W A;  1K3L A;  4MF5 A;  3MNG A;  2EC4 A;  2IWT A;  3HA9 A;  1XXU A;  1AW9 A;  4TR3 A;  1SKS B;  4NV5 A;  3VPT A;  3UOM A;  3A2X A;  1BYE A;  3GH9 A;  1GSE A;  2LST A;  2V2G A;  1MD4 A;  1WE0 A;  2LKU A;  3VK9 A;  4MH2 A;  3GTU A;  3VPQ A;  1OC8 A;  5CRG A;  3DVX A;  1PD2 1;  4G19 A;  3HXS A;  1G6W A;  3DML A;  2LJA A;  4KX4 A;  2DBC A;  5ECN B;  4NWY A;  2FLS A;  2LV3 A;  2LQO A;  2R37 A;  2GQM A;  2GGT A;  4X1U A;  2YWI A;  1I9D A;  5COH A;  3H1N A;  1AC1 A;  3ISO A;  3ZVJ A;  3RAZ A;  4IQ1 A;  4TVE A;  1XIY A;  4YQM A;  2CX3 A;  2VL2 C;  5ECO B;  1XCC A;  2GST A;  4AJ6 A;  4BA7 A;  1EWX A;  3LJR A;  5J41 A;  4BPY A;  1K0D A;  1LJR A;  1AQW A;  1BX9 A;  3KP8 A;  3M1G A;  2HXK A;  4L5O A;  1BAY A;  2OE0 A;  4V2L A;  2YAN A;  3LQ7 A;  5H5Q A;  4K7I A;  1FW1 A;  1DUG A;  3UIW A;  4TR1 A;  1VF2 A;  4KGI A;  2XC2 A;  4YQU A;  4BWQ A;  4MDC A;  3FRC A;  3N5O A;  5FWG A;  1T00 A;  1AIU A;  4EC0 A;  1A24 A;  1B48 A;  2R4V A;  1X0R A;  3FZ5 A;  2YJH A;  5IOW A;  1F6M C;  1THO A;  4EE0 A;  4JZQ A;  5B6N A;  2CZ3 A;  4KSM A;  4HU9 A;  3TRQ A;  1MEK A;  2RUF A;  3DRN A;  2LNT A;  5H5S A;  3BOA A;  3D4M A;  4ZXG A;  1WJK A;  1XW6 A;  5KN3 A;  5LCZ A;  2GSR A;  2VCT A;  3ZRD A;  2JSY A;  2BJX A;  3M8N A;  5FT3 A;  1LBK A;  4YAV A;  3GKX A;  2CAQ A;  2H1G A;  3EIN A;  1Z7P A;  1EEJ A;  1XWB A;  4GTU A;  2I3Y A;  1HNC A;  2VLV A;  5C00 A;  1R4W A;  1YF0 A;  1E6B A;  3TGZ A;  2K8S A;  1PA3 A;  3KM6 A;  1WWJ A;  2KOK A;  2V41 A;  2I4A A;  4PUR A;  2OAC A;  2AUV A;  2C80 A;  2M80 A;  4GQF A;  4XS1 A;  1X5C A;  1FG4 A;  2H6Y A;  4G2E A;  2FCH A;  1MTC A;  5IMF A;  4IKH A;  2FD3 A;  4XIH A;  4ZIL A;  5HFK A;  2DC5 A;  5GST A;  5HFI A;  3QDN A;  2IJY A;  1PGT A;  3FZ9 A;  1V98 A;  3GH6 A;  4KW6 A;  1V2A A;  2VM2 A;  2CVK A;  3KMN A;  5D96 A;  1M99 A;  2H74 A;  5F05 A;  4GCI A;  3RPN A;  1ZYQ B;  5GSS A;  1B9X C;  2L5L A;  1YY7 A;  3CTF A;  2GTU A;  3DVW A;  4OFN A;  2V32 A;  2DML A;  2JZS A;  1V57 A;  3TCO A;  4Q5R A;  4QL9 A;  2GQK A;  5D9T A;  4BVX A;  2H76 A;  1NHY A;  4TR4 A;  5DAL B;  1EP8 A;  4MK3 A;  4CW9 A;  2H19 A;  1ML6 A;  1T4Y A;  4MZB A;  1K0C A;  2F9S A;  1I5G A;  2HZE A;  2E2G A;  2AYT A;  3S9F A;  1B4P A;  2TRC P;  1TRS A;  5D9X A;  2HYX A;  2CVD A;  3TKS E;  1FO5 A;  4KND A;  4TXO A;  5DAK B;  2VM1 A;  4ML1 A;  1NW2 A;  1AAZ A;  4IJ3 A;  1TW9 A;  2MZC A;  4GXZ A;  3TKP A;  3RBT A;  3Q6O A;  3FR9 A;  2PVQ A;  3ERW A;  2C0E A;  2FUG 2;  3APQ A;  3E0U A;  5DVB A;  4XHM A;  3GST A;  2IMF A;  3IAS 2;  4HOJ A;  2FWG A;  3LXZ A;  1AQV A;  3TDG A;  4MF7 A;  4D73 B;  4OO5 A;  2JZT A;  2K18 A;  1UA5 A;  3L9U A;  4NXI A;  3ZIT A;  4MJA A;  3QAV A;  1GNE A;  4ISD A;  1AUC A;  2G0F A;  5ELA A;  2IFQ A;  4WF4 A;  1ZCP A;  2D2Z A;  2OJL A;  4WR5 A;  2F3M A;  2CAI A;  4WEY A;  1S3C A;  1FB6 A;  4J56 E;  1Z6N A;  4CHS A;  3VWW A;  1U87 A;  3RHC A;  2AV4 A;  3TRX A;  2XPE A;  1M0U A;  1GTU A;  5DJL A;  3M3M A;  4EKZ A;  1TP9 A;  4P3Y B;  5IMZ A;  1FAA A;  2X8G A;  1QGV A;  2YZH A;  1GTB A;  2VUP A;  4K1F A;  1XOA A;  4FIW A;  1MDI A;  2PGT A;  3ED3 A;  4MLY A;  1FB0 A;  3IK9 A;  3TJJ A;  4WF5 A;  2VAF A;  1SJI A;  3GTU B;  4HEA 2;  4OCE A;  5IMV A;  1FVK A;  2L6D A;  2JL4 A;  4I6X A;  3HJM A;  2OKA A;  5F8B A;  1YDK A;  2JU5 A;  3F4S A;  4TW5 A;  22GS A;  4MZC A;  3QAW A;  3HHV A;  1XOB A;  3IOS A;  4I2T A;  2VD1 A;  3TKQ A;  3ERF A;  2LNS A;  3ZIJ A;  3F4T A;  5G2Z A;  4KA0 A;  1Q4J A;  1C72 A;  2C8U A;  5A4U A;  4F0C A;  3FK8 A;  3FHK A;  2VLU A;  5CRD A;  3FKF A;  3CSH A;  4MZW A;  1ON4 A;  1TI1 A;  3KTB A;  4MJC A;  4L5L A;  1FHE A;  1JZW A;  4AJ7 A;  2CX4 A;  4IP6 A;  2OBI A;  2WFC A;  3QFA C;  5F07 A;  4BWS A;  3D0Z A;  5E4W A;  4V1A g;  3MAK A;  1O81 A;  4YAP A;  2XHF A;  1XWG A;  4MPF A;  3F6D A;  2H72 A;  3KIJ A;  4JRR A;  5KEJ A;  1F2E A;  2A2R A;  4POB A;  1PX7 A;  4FYU A;  1VGL A;  2OE1 A;  5HR0 A;  3P8W A;  4K9Z A;  4I5Q A;  3CXG A;  1GH2 A;  5JWO B;  1F3A A;  4ZB9 A;  1T3B A;  4H86 A;  2MYG A;  3CTG A;  4TR1 B;  19GS A;  3O3T A;  12GS A;  2ES7 A;  1K0M A;  2I81 A;  5J4U A;  1PN9 A;  7GSS A;  1Z3E A;  4F03 A;  1X5D A;  2HT9 A;  4MMM A;  4TOP A;  2YWN A;  4K7N A;  2WDU A;  3KGK A;  1GL8 A;  4GF0 A;  2GT6 A;  1DBY A;  1QUW A;  4GLT A;  2NTO A;  1O85 A;  3TJB A;  1K3O A;  3ZVJ D;  4F9Z A;  2A2S A;  1PKZ A;  2KLX A;  1PL1 A;  2HSH A;  4ACS A;  2L4Q A;  3IR4 A;  1DE1 A;  2V1M A;  3GIX A;  1YKC A;  1A8Y A;  3KTL A;  4IBP A;  3M0F A;  2YCD A;  4TN8 A;  3QMX A;  2KP2 A;  4MJB A;  1U6T A;  4G9H A;  2WB9 A;  5G5E A;  4JU5 A;  1RW1 A;  2VCX A;  3J7Y k;  6GSY A;  3QCP A;  6GST A;  3U5R E;  2YWM A;  3VWU A;  3VI7 A;  3O6T A;  5GAP D;  2YN1 A;  1GLQ A;  2PN8 A;  1G7O A;  2LQQ A;  3CBU A;  4ULX A;  1UC7 A;  4RI7 A;  4EUY A;  3TKS A;  4RUV A;  3BCI A;  2O8V B;  3H93 A;  2CV4 A;  2IME A;  2H75 A;  3VUR A;  2E2M A;  3KXO A;  4O32 A;  6GSX A;  3KMO A;  5ECQ B;  1ABA A;  1UVZ A;  4AGS A;  2DLX A;  1XVQ A;  3GKM A;  3D6I A;  2IIY A;  4WET A;  2H6Z A;  4PX1 A;  2GDR A;  1XWK A;  1XFL A;  3PR8 A;  3DGQ A;  4TXV A;  1XZO A;  5ECS A;  4LA1 A;  4PUF C;  5CP1 A;  4K8M A;  3UBL A;  1OVN A;  4NMU A;  2WJU A;  3GRX A;  5IO0 A;  3A3T A;  1PL2 A;  1AQX A;  4PQI A;  2TRX A;  2H0I A;  4HZ2 A;  1OKT A;  3HJO A;  1O6J A;  1H4O A;  4ECC A;  1H75 A;  1HQO A;  3F0I A;  5GZZ B;  4TKY A;  1T8E B;  5KN0 A;  3GN3 A;  1ZOF A;  3HKR A;  3F3R A;  3VWV A;  2DSA A;  1YQ1 A;  2R6K A;  2X99 A;  1BED A;  1S3D A;  3PGT A;  4N0V A;  1XVW A;  1W4V A;  4MH3 A;  1MD3 A;  2J9H A;  4HI7 A;  4XS6 A;  2WRT A;  1GSF A;  1R7H A;  2YWO A;  1J9B A;  1KBN A;  5DJM A;  1TK0 B;  4GSS A;  3I6A A;  4JBB A;  2VL9 A;  3H8Q A;  1GUK A;  5G1L A;  3ZTL A;  5IIZ A;  1GWC A;  5KN1 A;  1GTA A;  2IPA A;  4F2I A;  1EZK A;  1IYI A;  4IW9 A;  1R5A A;  2N5B A;  3UAR A;  2BMX A;  2N5A A;  5ECL B;  1A2L A;  2HZE B;  4IS0 A;  1Z6M A;  3WGX A;  4OMV A;  1PQN A;  1SEN A;  1YEX A;  3G9B A;  2PU9 C;  4NHW A;  3P90 A;  2LEG A;  2YOI A;  4TXO B;  2ZNM A;  3W6G A;  2OE3 A;  3UVT A;  3GV1 A;  2GT5 A;  3IPZ A;  3P2A A;  1XBS A;  1T1V A;  5L71 A;  1SJZ A;  3C8E A;  4PUA A;  1V9W A;  3M9J A;  3DIE A;  3EU3 A;  4BL7 A;  3NIV A;  6GSU A;  2M72 A;  5IMD A;  4K0N A;  1ERT A;  3C73 A;  3VI5 A;  3RHB A;  2YNX A;  5A4W A;  4PXO A;  3LXT A;  1F3B A;  1A2J A;  3ME8 A;  4K0G A;  2IFQ B;  4O7H A;  1EP7 A;  3FZ4 A;  2CVB A;  2GS3 A;  1O8X A;  2IMD A;  1GUH A;  4Q5Q A;  4MCU A;  5JCW A;  4IJI A;  2XBI A;  5CYY A;  2B5Y A;  1B4Q A;  1EOH A;  5IQY A;  4YQV A;  3D22 A;  1QMV A;  2PER A;  2VL3 A;  2H1B A;  1CQG A;  2B7J A;  1GSU A;  3L78 A;  4N0Z A;  3I69 A;  2L59 A;  1F9M A;  13GS A;  1HNB A;  2FY6 A;  2IMK A;  1GSD A;  2H01 A;  3F6F A;  2MMZ A;  2YP6 A;  1GRX A;  1Z5Y E;  4XCS A;  1YKA A;  2VO4 A;  1SKW B;  1B9Y C;  3Q18 A;  3VFI A;  2C3T A;  1XW9 A;  1TK8 B;  4ZBB A;  1B8X A;  2NPB A;  1JHB A;  4FO5 A;  5D93 A;  2OA7 A;  5C04 A;  4O5R A;  1KNG A;  3GUS A;  1ST9 A;  2VOC A;  3IA1 A;  2REM A;  2HFD A;  2MMA A;  1ZMA A;  2NBS A;  1PSQ A;  3ZL5 A;  4JR6 A;  2ZUP A;  1N2A A;  1FOV A;  4E8E A;  3EMX A;  2HI7 A;  4OO4 A;  2WS2 A;  3UL3 A;  4F0B A;  2CA8 A;  5CRE A;  4LL4 B;  4KDU A;  1TDI A;  4N10 A;  4AJ8 A;  2YZU A;  2ZCT A;  3W8J A;  2L57 A;  2C3N A;  1SK2 A;  3TOT A;  3KH9 A;  3UJ1 A;  4ZB6 A;  1XWA A;  2DJ3 A;  1ACV A;  3IXR A;  2B7K A;  2VCV A;  4WBR D;  3WT2 A;  3G7J A;  3LSZ A;  5G30 A;  2EIO A;  2XBQ A;  1CQH A;  1URM A;  3HD5 A;  3EWL A;  3IAM 2;  5INY A;  1JFU A;  1GSY A;  1GUL A;  1WOU A;  3WGE A;  2PBJ A;  2CZ2 A;  2RLI A;  2PMT A;  2C3Q A;  3EUR A;  3CRU A;  3TKR A;  3L9S A;  3QOU A;  2LRC A;  1TJD A;  5B6M A;  5EY6 A;  2R3X A;  2P0G A;  2B5X A;  5G31 A;  3ZFL A;  5CAX A;  3GL5 A;  4JED A;  3C1S A;  2NVL A;  2O85 A;  4XTS A;  3FYG A;  2X8C A;  1OC9 A;  3ZLP A;  2VL2 A;  3V1W A;  1V40 A;  3A2V A;  1PKW A;  1OAZ A;  3HJP A;  1A8L A;  5EPF A;  3UEM A;  3SBC A;  2KP1 A;  3J7Y b;  2HRN A;  3JCM L;  2IN3 A;  4ECB A;  1JLW A;  3ZML A;  3DWV A;  2AB6 A;  4CDO A;  2DIZ A;  1ZYE A;  1TRW A;  1JZO A;  3BD2 A;  3TRP A;  1SK0 A;  4ZBA A;  3EYT A;  2O89 A;  1K3Y A;  3HY2 A;  2F51 A;  1E2Y A;  1X9M B;  3NZN A;  3ZZX A;  5AIV A;  1M9B A;  1N8J A;  1QK8 A;  1SU9 A;  5DQS A;  3FZA A;  2H0H A;  4ECJ A;  2EIR A;  1ERV A;  3BBY A;  4ZIJ A;  4J2F A;  4KDY A;  1K0O A;  3GFK A;  5D73 A;  5DCH A;  2L5O A;  5ECI B;  3FW2 A;  2B1K A;  5JWQ B;  2VIM A;  1PMT A;  5LD0 A;  3FR3 A;  3EE2 A;  4HUA A;  3C7M A;  1A0R P;  2FWF A;  1J08 A;  2H70 A;  3E9J B;  2DJ2 A;  2ON7 A;  1KEB A;  1EGR A;  3P7X A;  2PPT A;  2TIR A;  1M9A A;  4J57 E;  5AIS A;  5KN2 A;  3WGD A;  2HSY A;  4ZL9 A;  2K6V A;  3Q19 A;  1X9S B;  1U3I A;  3GX8 A;  3APS A;  4Q5F A;  1V58 A;  2B6M A;  3RPP A;  1TI3 A;  1NM3 A;  4WKW A;  3C71 A;  3PIN A;  4FYC A;  2I9H A;  3AY8 A;  2QKE A;  3ZMK A;  2M46 A;  4XS4 A;  4EO3 A;  4N30 A;  4ZB8 A;  4KSO A;  1QXH A;  1ERW A;  1RQM A;  4HJM A;  3HDC A;  3EMP A;  4K2D A;  4LMW A;  5J3R A;  1T4Z A;  3GUR A;  2AJQ B;  1QFN A;  1KTE A;  5HR1 A;  2A4V A;  4DSS A;  4DEJ A;  3KP9 A;  4KE3 A;  4ECI A;  1Y6E A;  3IRA A;  1S3A A;  3CRT A;  5A4V A;  4WBJ A;  5JCG A;  3CSJ A;  1JZR A;  3TJG A;  5F06 A;  5G5F A;  2FA8 A;  3G7I A;  2H1A A;  1VRS D;  4FH8 A;  5IPH A;  2H8L A;  2MBT A;  3O76 A;  4EXJ A;  20GS A;  4JR4 A;  1SD9 A;  2C4J A;  1RK4 A;  1THX A;  2C1Y A;  4DSQ A;  3UMA A;  1K0N A;  3E3E A;  1X5E A;  4HJ2 A;  1XW5 A;  2MMO A;  4GST A;  4YH2 A;  3F63 A;  5IMC A;  4TR0 A;  4G10 A;  1X9W B;  4EDY A;  4PNG A;  5DQY A;  2P5R A;  1TU7 A;  2C0D A;  5JWR B;  3MSZ A;  5IOX A;  1O73 A;  1JZD A;  5JCU A;  2X64 A;  1WPI A;  5AIX A;  2FA4 A;  2GZP A;  5ID2 A;  1WIK A;  4EDZ A;  4RQX A;  5IPG A;  1BJX A;  4KAE A;  2QGV A;  3W8S A;  9GSS A;  2ALB A;  2QC7 A;  1M2A A;  2B1L A;  4NAX A;  2FWE A;  2V6O A;  2GQL A;  2AHE A;  5EL8 A;  1TU8 A;  2C0F A;  1WP0 A;  1SK1 A;  3F3Q A;  4TRX A;  2CQ9 A;  1GP1 A;  2N5F A;  3CSI A;  2H73 A;  1SYX A;  3EU4 A;  4I97 A;  1EEM A;  4HQS A;  1VF4 A;  4GQC A;  3ERG A;  4E8H A;  2VCW A;  1ZGN A;  1JLV A;  5A5K A;  4KH7 A;  4PGT A;  4HQZ A;  5ECH B;  3VLN A;  3PH9 A;  1WMJ A;  5HQP A;  1ERU A;  2JAD A;  3ZYW A;  3KZQ A;  1A0F A;  1GSS A;  4X43 A;  3D5J A;  2YJ7 A;  2FGX A;  2GVP A;  1O8W A;  2DJ1 A;  1Y25 A;  3IE3 A;  1GTI A;  2PWJ A;  4I2U A;  1WRY A;  4KCA A;  3LGC A;  4KDX A;  4ILF A;  4LL1 B;  1SL0 B;  2P31 A;  1M7T A;  4MA9 A;  4K7O A;  4WXT A;  2EIQ A;  3HVS A;  4ZBD A;  2H66 A;  3FY7 A;  3HZ8 A;  1Z9H A;  5B8A A;  1U88 A;  2WGR A;  3MWH A;  3ZFB A;  1TRU A;  4BVY A;  3IHQ A;  3WT1 A;  3UAP A;  3QAG A;  2H1D A;  2O87 A;  4POL A;  3A5W A;  4PNF A;  2LJK A;  5HR3 A;  3KEB A;  3LYP A;  5J9B A;  4IVF A;  2XPD A;  4IN0 A;  4XRD A;  2FHE A;  3FR6 A;  4V2N A;  1OE8 A;  4V1A p;  4HU7 A;  3LWA A;  5CRH A;  3GX0 A;  2LJR A;  1MDK A;  4JE1 A;  2YPM A;  1O7U A;  2O7K A;  1A2M A;  1EV4 A;  3LG6 A;  1OE7 A;  2DJK A;  3ZRE A;  5CNW A;  2VCQ A;  5ELG A;  5DDL A;  5ENU A;  1Z7R A;  4NPB A;  3IBH A;  2H6X A;  2GZY A;  3LOR A;  4ZL7 A;  4PQ1 A;  4I8B A;  1OC9 B;  4WR4 A;  4OCF A;  2B5E A;  2ON5 A;  5LNK e;  1R26 A;  3GL3 A;  1ZL9 A;  3APO A;  4MAB A;  5J5N A;  1DSB A;  1ZZY A;  4MF6 A;  2PUK C;  8GSS A;  1SJ6 A;  3A2W A;  3R2Q A;  2L4C A;  3TUE A;  1F37 A;  1K0A A;  1A23 A;  2LTK A;  1Q98 A;  1EV9 A;  5ECR B; 
#chains in the Genus database with same CATH topology
 1MDJ A;  3HZ4 A;  2K9F A;  1BQ7 A;  2L6C A;  1VF1 A;  5B8B A;  3WYW A;  5CRW A;  4N11 A;  2HZF A;  4K6X A;  1S3R A;  3C1R A;  3QR6 A;  5HR2 A;  2UZ8 A;  1GSQ A;  3HYP A;  1YJ6 A;  4KCE A;  3G7Y A;  2GSS A;  1AXD A;  2RM5 A;  5ECM B;  6GSW A;  4EL1 A;  4DVC A;  1TTZ A;  3F8U A;  3GNJ A;  2LS5 A;  4ZL8 A;  1SKR B;  4F82 A;  4HS1 A;  2LRT A;  3OR5 A;  2CT6 A;  3LEF A;  2VD0 A;  3GSS A;  5ABR A;  4HZ4 A;  2LUS A;  4GSN A;  2E0Q A;  1ILO A;  4PQH A;  2A4H A;  1IYH A;  2HNL A;  4KB3 A;  5EVO A;  1M2D A;  2HE3 A;  4ML6 A;  4L8E A;  2VLT A;  5ECP B;  3KH7 A;  2KHP A;  4GRF A;  3UBK A;  2KUC A;  4V2M A;  4L0W A;  4PTS A;  3DXB A;  3D4T A;  2HRF A;  3CMI A;  11GS A;  2VCZ A;  2WCI A;  1UN2 A;  6GSV A;  1YF1 A;  4POM A;  3TKS C;  1TKD B;  2DJJ A;  2LRN A;  3QD9 A;  4QL7 A;  3ZIV A;  4XS4 B;  3WD6 A;  2QA2 A;  1EGO A;  2YV9 A;  5ECK B;  2DIY A;  14GS A;  2FNO A;  2GLR A;  2H0G A;  4MPG A;  2E7P A;  2I1U A;  4Q5N A;  3K8N A;  1USB A;  1G7E A;  5GAN D;  1NSW A;  2R2J A;  3M9K A;  4CY6 A;  3TOU A;  4DSS B;  1G0T A;  1XPV A;  2Z9S A;  4L0U A;  3TJK A;  4ICY A;  1LU4 A;  4MP4 A;  3GKN A;  3IV4 A;  4OWY A;  3MIX A;  4KF9 A;  1U3A A;  2HLS A;  2JSZ A;  3LYK A;  4IP1 A;  1EOG A;  4EF0 A;  3BCK A;  4RQR A;  1GNW A;  3DKS A;  1J0F A;  2FWH A;  3D21 A;  2YV7 A;  1YEP A;  2IMI A;  2K8V A;  2H30 A;  2MMN A;  4DSR A;  5DCG A;  3SWL A;  4X0X A;  3U6V A;  5E59 A;  5G1K A;  2V6K A;  3TB2 A;  3DYR A;  3IK7 A;  3GKK A;  3F4R A;  5ID2 B;  3N9J A;  3QFB C;  4EVM A;  1PX6 A;  1DE2 A;  5DBQ A;  1OYJ A;  3FEU A;  4XRA A;  2H71 A;  3IC4 A;  1GLP A;  3TJF A;  3GA4 A;  17GS A;  3EVI A;  3HVX A;  3KCM A;  5J9C A;  5IO2 A;  3CYN A;  2RM6 A;  3EC3 A;  1SD8 A;  2QSI A;  2P5Q A;  2JZR A;  1BG5 A;  3UVH A;  3IC8 A;  2R5G A;  1GUM A;  5FHI A;  4OFT A;  4O92 A;  6GSS A;  2MBS A;  2NDO A;  4OFM A;  1T7P B;  5DAL A;  5F0G A;  3GYK A;  5AN1 A;  2G2Q A;  3GMF A;  1NHO A;  2IL3 A;  3US3 A;  1M2B A;  1QQ2 A;  2GZZ A;  4AF2 A;  3LFL A;  1TXX A;  3GHA A;  4MJE A;  1R5P A;  3I9V 2;  2F8F A;  2OAD A;  1XWC A;  4KUN A;  2DKH A;  3L9V A;  3H4K A;  5IMA A;  3VWX A;  1VF3 A;  5DAK A;  3HCZ A;  4ID0 A;  3KD0 A;  3H79 A;  3I43 A;  5AGY A;  5D9V A;  2WUL A;  1HD2 A;  2C0G A;  2JAC A;  10GS A;  1PRX A;  3DD3 A;  3KJY A;  4NHZ A;  2F8A A;  4IQA A;  3BJ5 A;  5H5R A;  1TOF A;  4OD7 A;  2DMM A;  2B3S A;  18GS A;  1HNA A;  4D73 A;  3QPM A;  2OBK A;  1FVJ A;  2BTO T;  3HVV A;  3MDK A;  3Q74 A;  5B7C A;  4HDE A;  4Z2U A;  1HYU A;  4IEL A;  1G6Y A;  3L0H A;  3RDW A;  4K5S A;  4IGJ A;  4Z2R A;  5HFG A;  2J23 A;  1YZX A;  1OKD A;  1W89 A;  1SL1 B;  3ME7 A;  1TRV A;  1TK5 B;  4FYB A;  2WZ9 A;  2AAW A;  4RI6 A;  4NV2 A;  5D8I A;  4LLR A;  2GSQ A;  3IDV A;  1K0B A;  3DEX A;  4IHU A;  1SYR A;  1SL2 B;  5IM9 A;  4LMV A;  3NOF A;  4POK A;  2DJ0 A;  5CO3 A;  3EPT A;  4GWR A;  4QQ7 A;  2X8H A;  2RII A;  16GS A;  1OC3 A;  4Z7X A;  3F9U A;  2PVO C;  2RUE A;  3L4N A;  5D9W A;  1K3L A;  4MF5 A;  3MNG A;  2EC4 A;  2IWT A;  3HA9 A;  1XXU A;  1AW9 A;  4TR3 A;  1SKS B;  4NV5 A;  3VPT A;  3UOM A;  3A2X A;  1BYE A;  3GH9 A;  1GSE A;  2LST A;  2V2G A;  1MD4 A;  1WE0 A;  2LKU A;  3VK9 A;  4MH2 A;  3GTU A;  3VPQ A;  1OC8 A;  5CRG A;  3DVX A;  1PD2 1;  4G19 A;  3HXS A;  1G6W A;  3DML A;  2LJA A;  4KX4 A;  2DBC A;  5ECN B;  2X4A A;  4NWY A;  2FLS A;  2LV3 A;  2LQO A;  2R37 A;  2GQM A;  2GGT A;  4X1U A;  2YWI A;  1I9D A;  2R0G A;  5COH A;  3H1N A;  1AC1 A;  2QA1 A;  3ISO A;  3ZVJ A;  3RAZ A;  4IQ1 A;  4TVE A;  1XIY A;  4YQM A;  2CX3 A;  2VL2 C;  5ECO B;  1XCC A;  2GST A;  4AJ6 A;  4BA7 A;  1EWX A;  3LJR A;  5J41 A;  4BPY A;  1K0D A;  1LJR A;  1AQW A;  1BX9 A;  3KP8 A;  3M1G A;  2HXK A;  4L5O A;  1BAY A;  2OE0 A;  4V2L A;  2YAN A;  3LQ7 A;  5H5Q A;  4K7I A;  1FW1 A;  1DUG A;  3UIW A;  4TR1 A;  3A5I A;  1VF2 A;  4KGI A;  2XC2 A;  4YQU A;  4BWQ A;  4MDC A;  3FRC A;  3N5O A;  5FWG A;  1T00 A;  1AIU A;  4EC0 A;  1A24 A;  1B48 A;  2R4V A;  1X0R A;  3FZ5 A;  2YJH A;  5IOW A;  1F6M C;  1THO A;  4EE0 A;  4JZQ A;  5B6N A;  2CZ3 A;  4KSM A;  4HU9 A;  3TRQ A;  1MEK A;  2RUF A;  3DRN A;  2LNT A;  5H5S A;  3BOA A;  3D4M A;  4ZXG A;  1WJK A;  1XW6 A;  5KN3 A;  5LCZ A;  2GSR A;  2VCT A;  3ZRD A;  2JSY A;  2BJX A;  3M8N A;  5FT3 A;  1LBK A;  4YAV A;  3GKX A;  2CAQ A;  2H1G A;  3EIN A;  1Z7P A;  1EEJ A;  1XWB A;  4GTU A;  2I3Y A;  1HNC A;  2VLV A;  5C00 A;  1R4W A;  1YF0 A;  1E6B A;  3TGZ A;  2K8S A;  1PA3 A;  3KM6 A;  1WWJ A;  2KOK A;  2V41 A;  2I4A A;  4PUR A;  2OAC A;  2AUV A;  2C80 A;  2M80 A;  4GQF A;  4XS1 A;  1X5C A;  1FG4 A;  2H6Y A;  4G2E A;  2FCH A;  1MTC A;  5IMF A;  4IKH A;  2FD3 A;  4XIH A;  4ZIL A;  5HFK A;  2DC5 A;  5GST A;  5HFI A;  3QDN A;  2IJY A;  1PGT A;  3FZ9 A;  1V98 A;  3GH6 A;  4KW6 A;  1V2A A;  2VM2 A;  2CVK A;  3KMN A;  5D96 A;  1M99 A;  2H74 A;  5F05 A;  4GCI A;  2X49 A;  3RPN A;  1ZYQ B;  5GSS A;  1B9X C;  2L5L A;  1YY7 A;  3CTF A;  2GTU A;  3DVW A;  4OFN A;  2V32 A;  2DML A;  2JZS A;  1V57 A;  3TCO A;  4Q5R A;  4QL9 A;  2GQK A;  5D9T A;  4BVX A;  2H76 A;  1NHY A;  4TR4 A;  5DAL B;  1EP8 A;  4MK3 A;  4CW9 A;  2H19 A;  1ML6 A;  1T4Y A;  4MZB A;  1K0C A;  2F9S A;  1I5G A;  2HZE A;  2E2G A;  2AYT A;  3S9F A;  1B4P A;  2TRC P;  1TRS A;  5D9X A;  2HYX A;  2CVD A;  3TKS E;  1FO5 A;  4KND A;  4TXO A;  5DAK B;  2VM1 A;  4ML1 A;  1NW2 A;  1AAZ A;  4IJ3 A;  1TW9 A;  2MZC A;  4GXZ A;  3TKP A;  3RBT A;  3Q6O A;  3FR9 A;  2PVQ A;  3ERW A;  2C0E A;  2FUG 2;  3APQ A;  3E0U A;  5DVB A;  4XHM A;  3GST A;  2IMF A;  3IAS 2;  4HOJ A;  2FWG A;  3LXZ A;  1AQV A;  3TDG A;  4MF7 A;  4D73 B;  2A2P A;  4OO5 A;  2JZT A;  2K18 A;  1UA5 A;  3L9U A;  4NXI A;  3ZIT A;  4MJA A;  3QAV A;  1GNE A;  4ISD A;  1AUC A;  2G0F A;  5ELA A;  2IFQ A;  4WF4 A;  2HRK A;  1ZCP A;  2D2Z A;  4HSC X;  2OJL A;  4WR5 A;  2F3M A;  2CAI A;  4WEY A;  1S3C A;  1FB6 A;  4J56 E;  1Z6N A;  4CHS A;  3VWW A;  1U87 A;  3RHC A;  2AV4 A;  3TRX A;  2XPE A;  1M0U A;  1GTU A;  5DJL A;  3M3M A;  4EKZ A;  4O5U A;  1TP9 A;  4P3Y B;  5IMZ A;  1FAA A;  2X8G A;  1QGV A;  2YZH A;  1GTB A;  2VUP A;  4K1F A;  1XOA A;  4FIW A;  1MDI A;  2PGT A;  3ED3 A;  4MLY A;  1FB0 A;  3IK9 A;  2R0C A;  3TJJ A;  4WF5 A;  2VAF A;  1SJI A;  3GTU B;  4HEA 2;  4OCE A;  5IMV A;  1FVK A;  3CQF A;  2L6D A;  2JL4 A;  4I6X A;  3HJM A;  2OKA A;  5F8B A;  1YDK A;  2JU5 A;  3F4S A;  4TW5 A;  22GS A;  4MZC A;  3QAW A;  3HHV A;  1XOB A;  3IOS A;  4I2T A;  2VD1 A;  3TKQ A;  3ERF A;  2LNS A;  3ZIJ A;  3F4T A;  5G2Z A;  4KA0 A;  4FQU A;  1Q4J A;  1C72 A;  2C8U A;  5A4U A;  4F0C A;  3FK8 A;  3FHK A;  2VLU A;  5CRD A;  3FKF A;  3CSH A;  4MZW A;  1ON4 A;  1TI1 A;  3KTB A;  4MJC A;  4L5L A;  1FHE A;  1JZW A;  4AJ7 A;  2CX4 A;  4IP6 A;  2OBI A;  2WFC A;  3QFA C;  5F07 A;  4BWS A;  3D0Z A;  5E4W A;  4V1A g;  3MAK A;  1O81 A;  4BVY B;  4YAP A;  2XHF A;  1XWG A;  4MPF A;  3F6D A;  2H72 A;  3KIJ A;  4JRR A;  5KEJ A;  3HVN A;  1F2E A;  1M3J A;  2A2R A;  4POB A;  1PX7 A;  4FYU A;  1VGL A;  2OE1 A;  5HR0 A;  3P8W A;  4K9Z A;  4I5Q A;  3CXG A;  1GH2 A;  5JWO B;  1F3A A;  4ZB9 A;  1T3B A;  4H86 A;  2MYG A;  3CTG A;  4TR1 B;  19GS A;  3O3T A;  12GS A;  2ES7 A;  1K0M A;  2I81 A;  5J4U A;  1PN9 A;  7GSS A;  1Z3E A;  4F03 A;  1X5D A;  2HT9 A;  4MMM A;  4TOP A;  2YWN A;  4K7N A;  2WDU A;  3KGK A;  1GL8 A;  4GF0 A;  2GT6 A;  1DBY A;  1QUW A;  4GLT A;  2NTO A;  1O85 A;  3TJB A;  1K3O A;  3ZVJ D;  4F9Z A;  2A2S A;  1PKZ A;  2KLX A;  4USS A;  1FOH A;  1PL1 A;  2HSH A;  4ACS A;  2L4Q A;  3IR4 A;  1DE1 A;  2V1M A;  3GIX A;  1YKC A;  1A8Y A;  3KTL A;  4IBP A;  3M0F A;  2YCD A;  4TN8 A;  3QMX A;  5KOW A;  2KP2 A;  4MJB A;  1U6T A;  4G9H A;  2WB9 A;  5G5E A;  4JU5 A;  1RW1 A;  2VCX A;  3J7Y k;  6GSY A;  3QCP A;  6GST A;  3U5R E;  2YWM A;  3VWU A;  3VI7 A;  5BMU A;  3O6T A;  5GAP D;  2YN1 A;  1GLQ A;  2PN8 A;  1G7O A;  2LQQ A;  3CBU A;  4ULX A;  1UC7 A;  4RI7 A;  4EUY A;  3TKS A;  4RUV A;  3BCI A;  2O8V B;  3H93 A;  2CV4 A;  2IME A;  2H75 A;  3VUR A;  2E2M A;  3KXO A;  5KOX A;  4O32 A;  6GSX A;  3KMO A;  5ECQ B;  4K5R A;  1ABA A;  1UVZ A;  4AGS A;  2DLX A;  1XVQ A;  4EIP A;  3GKM A;  3D6I A;  2IIY A;  4WET A;  2H6Z A;  4PX1 A;  2GDR A;  1XWK A;  1XFL A;  3PR8 A;  3DGQ A;  4TXV A;  1XZO A;  5ECS A;  4LA1 A;  4PUF C;  5CP1 A;  4K8M A;  3UBL A;  1OVN A;  4NMU A;  2WJU A;  3GRX A;  5IO0 A;  3A3T A;  1PL2 A;  1AQX A;  4PQI A;  2TRX A;  2H0I A;  4HZ2 A;  1OKT A;  3HJO A;  1O6J A;  1H4O A;  4ECC A;  1H75 A;  1HQO A;  3F0I A;  5GZZ B;  4TKY A;  1T8E B;  5KN0 A;  4G0K A;  3GN3 A;  1ZOF A;  3HKR A;  3F3R A;  3VWV A;  2DSA A;  1YQ1 A;  2R6K A;  2X99 A;  1BED A;  1S3D A;  3PGT A;  4N0V A;  1XVW A;  1W4V A;  4MH3 A;  1MD3 A;  2J9H A;  3MYD A;  4HI7 A;  4XS6 A;  2WRT A;  1GSF A;  1R7H A;  2YWO A;  1J9B A;  1KBN A;  5DJM A;  1TK0 B;  4GSS A;  3I6A A;  4JBB A;  2VL9 A;  3H8Q A;  1GUK A;  5G1L A;  4BVX B;  3ZTL A;  5IIZ A;  1GWC A;  5KN1 A;  1GTA A;  2IPA A;  4F2I A;  1EZK A;  4A5P A;  1IYI A;  4IW9 A;  1R5A A;  2N5B A;  3UAR A;  2BMX A;  2N5A A;  5ECL B;  1A2L A;  2HZE B;  4IS0 A;  1Z6M A;  3WGX A;  4OMV A;  1PQN A;  4X4J A;  1SEN A;  1YEX A;  3G9B A;  2PU9 C;  4NHW A;  3P90 A;  2LEG A;  2YOI A;  4TXO B;  2ZNM A;  3W6G A;  2OE3 A;  3UVT A;  3GV1 A;  2R0P A;  2GT5 A;  3IPZ A;  3P2A A;  1XBS A;  1T1V A;  5L71 A;  1SJZ A;  3C8E A;  4PUA A;  1V9W A;  3M9J A;  3DIE A;  3EU3 A;  4BL7 A;  4EIQ A;  3NIV A;  6GSU A;  2M72 A;  5IMD A;  4K0N A;  1ERT A;  3C73 A;  3VI5 A;  3RHB A;  2YNX A;  5A4W A;  1PN0 A;  4PXO A;  3LXT A;  1F3B A;  1A2J A;  3ME8 A;  4K0G A;  2IFQ B;  4O7H A;  1EP7 A;  3FZ4 A;  2CVB A;  2GS3 A;  1O8X A;  2IMD A;  1GUH A;  4Q5Q A;  4MCU A;  5JCW A;  4IJI A;  2XBI A;  5CYY A;  2B5Y A;  1B4Q A;  1EOH A;  5IQY A;  4YQV A;  3D22 A;  1QMV A;  2PER A;  2VL3 A;  2H1B A;  1CQG A;  2B7J A;  1GSU A;  3L78 A;  4N0Z A;  3I69 A;  2L59 A;  1F9M A;  13GS A;  1HNB A;  2FY6 A;  2IMK A;  1GSD A;  2H01 A;  3F6F A;  1ZYP A;  2MMZ A;  2YP6 A;  1GRX A;  1Z5Y E;  4XCS A;  1YKA A;  2VO4 A;  1SKW B;  1B9Y C;  3FMW A;  3Q18 A;  3VFI A;  2C3T A;  1XW9 A;  1TK8 B;  4ZBB A;  1B8X A;  2NPB A;  1JHB A;  4FO5 A;  3IHG A;  5D93 A;  2OA7 A;  5C04 A;  4O5R A;  1KNG A;  3GUS A;  1XG8 A;  1ST9 A;  2VOC A;  3IA1 A;  2REM A;  2HFD A;  2MMA A;  1ZMA A;  2NBS A;  1PSQ A;  3ZL5 A;  4JR6 A;  2ZUP A;  1N2A A;  1FOV A;  4E8E A;  3EMX A;  2HI7 A;  4OO4 A;  2WS2 A;  3UL3 A;  4F0B A;  2CA8 A;  5CRE A;  4LL4 B;  4KDU A;  1TDI A;  4N10 A;  4AJ8 A;  2YZU A;  2ZCT A;  3W8J A;  2L57 A;  2C3N A;  1SK2 A;  3TOT A;  3KH9 A;  3UJ1 A;  4ZB6 A;  1XWA A;  2DJ3 A;  1ACV A;  3IXR A;  2B7K A;  2VCV A;  4WBR D;  3WT2 A;  3G7J A;  3LSZ A;  5G30 A;  2EIO A;  2XBQ A;  1CQH A;  1URM A;  3HD5 A;  3EWL A;  3IAM 2;  5INY A;  1JFU A;  1GSY A;  1GUL A;  1WOU A;  3WGE A;  2HRA A;  2PBJ A;  2CZ2 A;  2RLI A;  2PMT A;  2C3Q A;  3EUR A;  3CRU A;  3TKR A;  3L9S A;  3QOU A;  4O5Q A;  2LRC A;  1TJD A;  5B6M A;  5EY6 A;  2R3X A;  2P0G A;  4Z2T A;  2B5X A;  5G31 A;  3ZFL A;  5CAX A;  3GL5 A;  4JED A;  3C1S A;  2NVL A;  2O85 A;  4XTS A;  3FYG A;  2X8C A;  1OC9 A;  3ZLP A;  2VL2 A;  3V1W A;  1V40 A;  3A2V A;  1PKW A;  1OAZ A;  3HJP A;  1A8L A;  5EPF A;  3UEM A;  3SBC A;  2KP1 A;  3J7Y b;  2HRN A;  3JCM L;  2IN3 A;  4ECB A;  1JLW A;  3ZML A;  3DWV A;  2AB6 A;  4CDO A;  2DIZ A;  1ZYE A;  1TRW A;  1JZO A;  3BD2 A;  3TRP A;  1SK0 A;  4ZBA A;  3EYT A;  2O89 A;  1K3Y A;  3HY2 A;  2F51 A;  1E2Y A;  3LW9 A;  1X9M B;  3NZN A;  3ZZX A;  5AIV A;  1M9B A;  1N8J A;  1QK8 A;  1SU9 A;  5DQS A;  3FZA A;  2H0H A;  4ECJ A;  2EIR A;  1ERV A;  3BBY A;  4BIK A;  4ZIJ A;  4J2F A;  4KDY A;  1K0O A;  3GFK A;  5D73 A;  5DCH A;  2L5O A;  5ECI B;  3FW2 A;  2B1K A;  5JWQ B;  2VIM A;  1PMT A;  5LD0 A;  3FR3 A;  3EE2 A;  4HUA A;  3C7M A;  1A0R P;  2FWF A;  1J08 A;  2H70 A;  3E9J B;  2DJ2 A;  2ON7 A;  1KEB A;  1EGR A;  3P7X A;  2PPT A;  2TIR A;  1M9A A;  4J57 E;  5AIS A;  5KN2 A;  3WGD A;  2HSY A;  4ZL9 A;  2K6V A;  3Q19 A;  1X9S B;  1U3I A;  3GX8 A;  3APS A;  4Q5F A;  1V58 A;  2B6M A;  3RPP A;  1TI3 A;  3R3E A;  1NM3 A;  4WKW A;  3C71 A;  3PIN A;  4FYC A;  2I9H A;  3AY8 A;  2QKE A;  3ZMK A;  2M46 A;  4XS4 A;  4G0L A;  4EO3 A;  4N30 A;  4ZB8 A;  4KSO A;  1QXH A;  1ERW A;  1RQM A;  4HJM A;  3HDC A;  3EMP A;  4K2D A;  4LMW A;  5J3R A;  1T4Z A;  3GUR A;  2AJQ B;  1QFN A;  1KTE A;  5HR1 A;  2A4V A;  4DSS A;  4DEJ A;  3KP9 A;  4KE3 A;  4ECI A;  1Y6E A;  3IRA A;  1S3A A;  3CRT A;  5A4V A;  4WBJ A;  5JCG A;  3CSJ A;  1JZR A;  3TJG A;  5F06 A;  5G5F A;  2FA8 A;  3G7I A;  2H1A A;  1VRS D;  4FH8 A;  5IPH A;  2H8L A;  2MBT A;  3O76 A;  4EXJ A;  20GS A;  4JR4 A;  1SD9 A;  2C4J A;  1RK4 A;  1THX A;  2C1Y A;  4DSQ A;  3UMA A;  1K0N A;  3E3E A;  1X5E A;  4HJ2 A;  1XW5 A;  2MMO A;  4GST A;  4YH2 A;  3F63 A;  5IMC A;  4TR0 A;  4G10 A;  1ZYN A;  1X9W B;  4BL7 B;  4EDY A;  4PNG A;  5DQY A;  2P5R A;  1TU7 A;  2C0D A;  5JWR B;  3MSZ A;  5IOX A;  1O73 A;  1JZD A;  4YKG A;  5JCU A;  2X64 A;  1WPI A;  5AIX A;  2FA4 A;  2DKI A;  2GZP A;  5ID2 A;  1WIK A;  4EDZ A;  4RQX A;  5IPG A;  1BJX A;  4KAE A;  2QGV A;  3W8S A;  9GSS A;  2ALB A;  2QC7 A;  1M2A A;  2B1L A;  4NAX A;  4CY8 A;  2FWE A;  2V6O A;  2GQL A;  2AHE A;  5EL8 A;  1TU8 A;  2C0F A;  1WP0 A;  1SK1 A;  3F3Q A;  4TRX A;  2CQ9 A;  1GP1 A;  2N5F A;  3CSI A;  2H73 A;  1SYX A;  3EU4 A;  4I97 A;  1EEM A;  4HQS A;  1VF4 A;  4GQC A;  3ERG A;  4E8H A;  4G0I A;  2VCW A;  1ZGN A;  1JLV A;  5A5K A;  4KH7 A;  4PGT A;  4HQZ A;  5ECH B;  3VLN A;  3PH9 A;  1WMJ A;  5HQP A;  1ERU A;  2JAD A;  3ZYW A;  3KZQ A;  1A0F A;  1GSS A;  4X43 A;  3D5J A;  2YJ7 A;  2FGX A;  2GVP A;  1O8W A;  2DJ1 A;  1Y25 A;  3IE3 A;  1GTI A;  2PWJ A;  4I2U A;  1WRY A;  4KCA A;  3LGC A;  4KDX A;  4ILF A;  4LL1 B;  1SL0 B;  2P31 A;  1M7T A;  1PFO A;  4MA9 A;  2HSM A;  4K7O A;  4WXT A;  5BRT A;  2EIQ A;  3HVS A;  4ZBD A;  2H66 A;  3FY7 A;  3HZ8 A;  1Z9H A;  5B8A A;  1U88 A;  2WGR A;  3MWH A;  3ZFB A;  1TRU A;  4BVY A;  3IHQ A;  3WT1 A;  3UAP A;  3QAG A;  2H1D A;  2O87 A;  4POL A;  3A5W A;  4PNF A;  2LJK A;  5HR3 A;  3KEB A;  3LYP A;  5J9B A;  4IVF A;  2XPD A;  4IN0 A;  4XRD A;  2FHE A;  3FR6 A;  4YKF A;  4MNN A;  4V2N A;  1OE8 A;  4V1A p;  4HU7 A;  3LWA A;  5CRH A;  3GX0 A;  2LJR A;  1MDK A;  4JE1 A;  2YPM A;  1O7U A;  2O7K A;  1A2M A;  1EV4 A;  3LG6 A;  1OE7 A;  2DJK A;  3ZRE A;  5CNW A;  2VCQ A;  5ELG A;  5DDL A;  5ENU A;  1Z7R A;  4NPB A;  3IBH A;  2H6X A;  2GZY A;  3LOR A;  4ZL7 A;  4PQ1 A;  4I8B A;  1OC9 B;  4WR4 A;  4OCF A;  2B5E A;  2ON5 A;  5LNK e;  1R26 A;  3GL3 A;  1ZL9 A;  3APO A;  4MAB A;  5J5N A;  1DSB A;  1ZZY A;  4MF6 A;  4K2X A;  2PUK C;  8GSS A;  1SJ6 A;  3A2W A;  3PPU A;  3R2Q A;  2L4C A;  3TUE A;  1F37 A;  1K0A A;  1A23 A;  2LTK A;  1Q98 A;  1EV9 A;  1M3I A;  5ECR B; 
#chains in the Genus database with same CATH homology
 1MDJ A;  3HZ4 A;  2K9F A;  1BQ7 A;  2L6C A;  1VF1 A;  5B8B A;  3WYW A;  5CRW A;  4N11 A;  2HZF A;  4K6X A;  3C1R A;  3QR6 A;  5HR2 A;  2UZ8 A;  1GSQ A;  3HYP A;  1YJ6 A;  4KCE A;  3G7Y A;  2GSS A;  1AXD A;  2RM5 A;  5ECM B;  6GSW A;  4EL1 A;  4DVC A;  1TTZ A;  3F8U A;  3GNJ A;  2LS5 A;  4ZL8 A;  1SKR B;  4F82 A;  4HS1 A;  2LRT A;  3OR5 A;  2CT6 A;  3LEF A;  2VD0 A;  3GSS A;  5ABR A;  4HZ4 A;  2LUS A;  4GSN A;  2E0Q A;  1ILO A;  4PQH A;  2A4H A;  1IYH A;  2HNL A;  4KB3 A;  5EVO A;  1M2D A;  2HE3 A;  4ML6 A;  4L8E A;  2VLT A;  5ECP B;  3KH7 A;  2KHP A;  4GRF A;  3UBK A;  2KUC A;  4V2M A;  4L0W A;  4PTS A;  3DXB A;  3D4T A;  2HRF A;  3CMI A;  11GS A;  2VCZ A;  2WCI A;  1UN2 A;  6GSV A;  1YF1 A;  4POM A;  3TKS C;  1TKD B;  2DJJ A;  2LRN A;  3QD9 A;  4QL7 A;  3ZIV A;  4XS4 B;  3WD6 A;  2QA2 A;  1EGO A;  2YV9 A;  5ECK B;  2DIY A;  14GS A;  2FNO A;  2GLR A;  2H0G A;  4MPG A;  2E7P A;  2I1U A;  4Q5N A;  3K8N A;  1USB A;  1G7E A;  5GAN D;  1NSW A;  2R2J A;  3M9K A;  4CY6 A;  3TOU A;  4DSS B;  1G0T A;  1XPV A;  2Z9S A;  4L0U A;  3TJK A;  4ICY A;  1LU4 A;  4MP4 A;  3GKN A;  3IV4 A;  4OWY A;  3MIX A;  4KF9 A;  1U3A A;  2HLS A;  2JSZ A;  3LYK A;  4IP1 A;  1EOG A;  4EF0 A;  3BCK A;  4RQR A;  1GNW A;  3DKS A;  1J0F A;  2FWH A;  3D21 A;  2YV7 A;  1YEP A;  2IMI A;  2K8V A;  2H30 A;  2MMN A;  4DSR A;  5DCG A;  3SWL A;  4X0X A;  3U6V A;  5E59 A;  5G1K A;  2V6K A;  3TB2 A;  3DYR A;  3IK7 A;  3GKK A;  3F4R A;  5ID2 B;  3N9J A;  3QFB C;  4EVM A;  1PX6 A;  1DE2 A;  5DBQ A;  1OYJ A;  3FEU A;  4XRA A;  2H71 A;  3IC4 A;  1GLP A;  3TJF A;  3GA4 A;  17GS A;  3EVI A;  3HVX A;  3KCM A;  5J9C A;  5IO2 A;  3CYN A;  2RM6 A;  3EC3 A;  1SD8 A;  2QSI A;  2P5Q A;  2JZR A;  1BG5 A;  3UVH A;  3IC8 A;  2R5G A;  1GUM A;  5FHI A;  4OFT A;  4O92 A;  6GSS A;  2MBS A;  2NDO A;  4OFM A;  1T7P B;  5DAL A;  5F0G A;  3GYK A;  5AN1 A;  2G2Q A;  3GMF A;  1NHO A;  2IL3 A;  3US3 A;  1M2B A;  1QQ2 A;  2GZZ A;  4AF2 A;  3LFL A;  1TXX A;  3GHA A;  4MJE A;  1R5P A;  3I9V 2;  2F8F A;  2OAD A;  1XWC A;  4KUN A;  2DKH A;  3L9V A;  3H4K A;  5IMA A;  3VWX A;  1VF3 A;  5DAK A;  3HCZ A;  4ID0 A;  3KD0 A;  3H79 A;  3I43 A;  5AGY A;  5D9V A;  2WUL A;  1HD2 A;  2C0G A;  2JAC A;  10GS A;  1PRX A;  3DD3 A;  3KJY A;  4NHZ A;  2F8A A;  4IQA A;  3BJ5 A;  5H5R A;  1TOF A;  4OD7 A;  2DMM A;  2B3S A;  18GS A;  1HNA A;  4D73 A;  3QPM A;  2OBK A;  1FVJ A;  2BTO T;  3HVV A;  3MDK A;  3Q74 A;  5B7C A;  4HDE A;  4Z2U A;  1HYU A;  4IEL A;  1G6Y A;  3L0H A;  3RDW A;  4K5S A;  4IGJ A;  4Z2R A;  5HFG A;  2J23 A;  1YZX A;  1OKD A;  1W89 A;  1SL1 B;  3ME7 A;  1TRV A;  1TK5 B;  4FYB A;  2WZ9 A;  2AAW A;  4RI6 A;  4NV2 A;  5D8I A;  4LLR A;  2GSQ A;  3IDV A;  1K0B A;  3DEX A;  4IHU A;  1SYR A;  1SL2 B;  5IM9 A;  4LMV A;  3NOF A;  4POK A;  2DJ0 A;  5CO3 A;  3EPT A;  4GWR A;  4QQ7 A;  2X8H A;  2RII A;  16GS A;  1OC3 A;  4Z7X A;  3F9U A;  2PVO C;  2RUE A;  3L4N A;  5D9W A;  1K3L A;  4MF5 A;  3MNG A;  2EC4 A;  2IWT A;  3HA9 A;  1XXU A;  1AW9 A;  4TR3 A;  1SKS B;  4NV5 A;  3VPT A;  3UOM A;  3A2X A;  1BYE A;  3GH9 A;  1GSE A;  2LST A;  2V2G A;  1MD4 A;  1WE0 A;  2LKU A;  3VK9 A;  4MH2 A;  3GTU A;  3VPQ A;  1OC8 A;  5CRG A;  3DVX A;  1PD2 1;  4G19 A;  3HXS A;  1G6W A;  3DML A;  2LJA A;  4KX4 A;  2DBC A;  5ECN B;  2X4A A;  4NWY A;  2FLS A;  2LV3 A;  2LQO A;  2R37 A;  2GQM A;  2GGT A;  4X1U A;  2YWI A;  1I9D A;  2R0G A;  5COH A;  3H1N A;  1AC1 A;  2QA1 A;  3ISO A;  3ZVJ A;  3RAZ A;  4IQ1 A;  4TVE A;  1XIY A;  4YQM A;  2CX3 A;  2VL2 C;  5ECO B;  1XCC A;  2GST A;  4AJ6 A;  4BA7 A;  1EWX A;  3LJR A;  5J41 A;  4BPY A;  1K0D A;  1LJR A;  1AQW A;  1BX9 A;  3KP8 A;  3M1G A;  2HXK A;  4L5O A;  1BAY A;  2OE0 A;  4V2L A;  2YAN A;  3LQ7 A;  5H5Q A;  4K7I A;  1FW1 A;  1DUG A;  3UIW A;  4TR1 A;  3A5I A;  1VF2 A;  4KGI A;  2XC2 A;  4YQU A;  4BWQ A;  4MDC A;  3FRC A;  3N5O A;  5FWG A;  1T00 A;  1AIU A;  4EC0 A;  1A24 A;  1B48 A;  2R4V A;  1X0R A;  3FZ5 A;  2YJH A;  5IOW A;  1F6M C;  1THO A;  4EE0 A;  4JZQ A;  5B6N A;  2CZ3 A;  4KSM A;  4HU9 A;  3TRQ A;  1MEK A;  2RUF A;  3DRN A;  2LNT A;  5H5S A;  3BOA A;  3D4M A;  4ZXG A;  1WJK A;  1XW6 A;  5KN3 A;  5LCZ A;  2GSR A;  2VCT A;  3ZRD A;  2JSY A;  2BJX A;  3M8N A;  5FT3 A;  1LBK A;  4YAV A;  3GKX A;  2CAQ A;  2H1G A;  3EIN A;  1Z7P A;  1EEJ A;  1XWB A;  4GTU A;  2I3Y A;  1HNC A;  2VLV A;  5C00 A;  1R4W A;  1YF0 A;  1E6B A;  3TGZ A;  2K8S A;  1PA3 A;  3KM6 A;  1WWJ A;  2KOK A;  2V41 A;  2I4A A;  4PUR A;  2OAC A;  2AUV A;  2C80 A;  2M80 A;  4GQF A;  4XS1 A;  1X5C A;  1FG4 A;  2H6Y A;  4G2E A;  2FCH A;  1MTC A;  5IMF A;  4IKH A;  2FD3 A;  4XIH A;  4ZIL A;  5HFK A;  2DC5 A;  5GST A;  5HFI A;  3QDN A;  2IJY A;  1PGT A;  3FZ9 A;  1V98 A;  3GH6 A;  4KW6 A;  1V2A A;  2VM2 A;  2CVK A;  3KMN A;  5D96 A;  1M99 A;  2H74 A;  5F05 A;  4GCI A;  2X49 A;  3RPN A;  1ZYQ B;  5GSS A;  1B9X C;  2L5L A;  1YY7 A;  3CTF A;  2GTU A;  3DVW A;  4OFN A;  2V32 A;  2DML A;  2JZS A;  1V57 A;  3TCO A;  4Q5R A;  4QL9 A;  2GQK A;  5D9T A;  4BVX A;  2H76 A;  1NHY A;  4TR4 A;  5DAL B;  1EP8 A;  4MK3 A;  4CW9 A;  2H19 A;  1ML6 A;  1T4Y A;  4MZB A;  1K0C A;  2F9S A;  1I5G A;  2HZE A;  2E2G A;  2AYT A;  3S9F A;  1B4P A;  2TRC P;  1TRS A;  5D9X A;  2HYX A;  2CVD A;  3TKS E;  1FO5 A;  4KND A;  4TXO A;  5DAK B;  2VM1 A;  4ML1 A;  1NW2 A;  1AAZ A;  4IJ3 A;  1TW9 A;  2MZC A;  4GXZ A;  3TKP A;  3RBT A;  3Q6O A;  3FR9 A;  2PVQ A;  3ERW A;  2C0E A;  2FUG 2;  3APQ A;  3E0U A;  5DVB A;  4XHM A;  3GST A;  2IMF A;  3IAS 2;  4HOJ A;  2FWG A;  3LXZ A;  1AQV A;  3TDG A;  4MF7 A;  4D73 B;  2A2P A;  4OO5 A;  2JZT A;  2K18 A;  1UA5 A;  3L9U A;  4NXI A;  3ZIT A;  4MJA A;  3QAV A;  1GNE A;  4ISD A;  1AUC A;  2G0F A;  5ELA A;  2IFQ A;  4WF4 A;  2HRK A;  1ZCP A;  2D2Z A;  2OJL A;  4WR5 A;  2F3M A;  2CAI A;  4WEY A;  1S3C A;  1FB6 A;  4J56 E;  1Z6N A;  4CHS A;  3VWW A;  1U87 A;  3RHC A;  2AV4 A;  3TRX A;  2XPE A;  1M0U A;  1GTU A;  5DJL A;  3M3M A;  4EKZ A;  4O5U A;  1TP9 A;  4P3Y B;  5IMZ A;  1FAA A;  2X8G A;  1QGV A;  2YZH A;  1GTB A;  2VUP A;  4K1F A;  1XOA A;  4FIW A;  1MDI A;  2PGT A;  3ED3 A;  4MLY A;  1FB0 A;  3IK9 A;  2R0C A;  3TJJ A;  4WF5 A;  2VAF A;  1SJI A;  3GTU B;  4HEA 2;  4OCE A;  5IMV A;  1FVK A;  2L6D A;  2JL4 A;  4I6X A;  3HJM A;  2OKA A;  5F8B A;  1YDK A;  2JU5 A;  3F4S A;  4TW5 A;  22GS A;  4MZC A;  3QAW A;  3HHV A;  1XOB A;  3IOS A;  4I2T A;  2VD1 A;  3TKQ A;  3ERF A;  2LNS A;  3ZIJ A;  3F4T A;  5G2Z A;  4KA0 A;  4FQU A;  1Q4J A;  1C72 A;  2C8U A;  5A4U A;  4F0C A;  3FK8 A;  3FHK A;  2VLU A;  5CRD A;  3FKF A;  3CSH A;  4MZW A;  1ON4 A;  1TI1 A;  3KTB A;  4MJC A;  4L5L A;  1FHE A;  1JZW A;  4AJ7 A;  2CX4 A;  4IP6 A;  2OBI A;  2WFC A;  3QFA C;  5F07 A;  4BWS A;  3D0Z A;  5E4W A;  4V1A g;  3MAK A;  1O81 A;  4BVY B;  4YAP A;  2XHF A;  1XWG A;  4MPF A;  3F6D A;  2H72 A;  3KIJ A;  4JRR A;  5KEJ A;  1F2E A;  2A2R A;  4POB A;  1PX7 A;  4FYU A;  1VGL A;  2OE1 A;  5HR0 A;  3P8W A;  4K9Z A;  4I5Q A;  3CXG A;  1GH2 A;  5JWO B;  1F3A A;  4ZB9 A;  1T3B A;  4H86 A;  2MYG A;  3CTG A;  4TR1 B;  19GS A;  3O3T A;  12GS A;  2ES7 A;  1K0M A;  2I81 A;  5J4U A;  1PN9 A;  7GSS A;  1Z3E A;  4F03 A;  1X5D A;  2HT9 A;  4MMM A;  4TOP A;  2YWN A;  4K7N A;  2WDU A;  3KGK A;  1GL8 A;  4GF0 A;  2GT6 A;  1DBY A;  1QUW A;  4GLT A;  2NTO A;  1O85 A;  3TJB A;  1K3O A;  3ZVJ D;  4F9Z A;  2A2S A;  1PKZ A;  2KLX A;  4USS A;  1FOH A;  1PL1 A;  2HSH A;  4ACS A;  2L4Q A;  3IR4 A;  1DE1 A;  2V1M A;  3GIX A;  1YKC A;  1A8Y A;  3KTL A;  4IBP A;  3M0F A;  2YCD A;  4TN8 A;  3QMX A;  5KOW A;  2KP2 A;  4MJB A;  1U6T A;  4G9H A;  2WB9 A;  5G5E A;  4JU5 A;  1RW1 A;  2VCX A;  3J7Y k;  6GSY A;  3QCP A;  6GST A;  3U5R E;  2YWM A;  3VWU A;  3VI7 A;  5BMU A;  3O6T A;  5GAP D;  2YN1 A;  1GLQ A;  2PN8 A;  1G7O A;  2LQQ A;  3CBU A;  4ULX A;  1UC7 A;  4RI7 A;  4EUY A;  3TKS A;  4RUV A;  3BCI A;  2O8V B;  3H93 A;  2CV4 A;  2IME A;  2H75 A;  3VUR A;  2E2M A;  3KXO A;  5KOX A;  4O32 A;  6GSX A;  3KMO A;  5ECQ B;  4K5R A;  1ABA A;  1UVZ A;  4AGS A;  2DLX A;  1XVQ A;  4EIP A;  3GKM A;  3D6I A;  2IIY A;  4WET A;  2H6Z A;  4PX1 A;  2GDR A;  1XWK A;  1XFL A;  3PR8 A;  3DGQ A;  4TXV A;  1XZO A;  5ECS A;  4LA1 A;  4PUF C;  5CP1 A;  4K8M A;  3UBL A;  1OVN A;  4NMU A;  2WJU A;  3GRX A;  5IO0 A;  3A3T A;  1PL2 A;  1AQX A;  4PQI A;  2TRX A;  2H0I A;  4HZ2 A;  1OKT A;  3HJO A;  1O6J A;  1H4O A;  4ECC A;  1H75 A;  1HQO A;  3F0I A;  5GZZ B;  4TKY A;  1T8E B;  5KN0 A;  4G0K A;  3GN3 A;  1ZOF A;  3HKR A;  3F3R A;  3VWV A;  2DSA A;  1YQ1 A;  2R6K A;  2X99 A;  1BED A;  1S3D A;  3PGT A;  4N0V A;  1XVW A;  1W4V A;  4MH3 A;  1MD3 A;  2J9H A;  3MYD A;  4HI7 A;  4XS6 A;  2WRT A;  1GSF A;  1R7H A;  2YWO A;  1J9B A;  1KBN A;  5DJM A;  1TK0 B;  4GSS A;  3I6A A;  4JBB A;  2VL9 A;  3H8Q A;  1GUK A;  5G1L A;  4BVX B;  3ZTL A;  5IIZ A;  1GWC A;  5KN1 A;  1GTA A;  2IPA A;  4F2I A;  1EZK A;  4A5P A;  1IYI A;  4IW9 A;  1R5A A;  2N5B A;  3UAR A;  2BMX A;  2N5A A;  5ECL B;  1A2L A;  2HZE B;  4IS0 A;  1Z6M A;  3WGX A;  4OMV A;  1PQN A;  4X4J A;  1SEN A;  1YEX A;  3G9B A;  2PU9 C;  4NHW A;  3P90 A;  2LEG A;  2YOI A;  4TXO B;  2ZNM A;  3W6G A;  2OE3 A;  3UVT A;  3GV1 A;  2R0P A;  2GT5 A;  3IPZ A;  3P2A A;  1XBS A;  1T1V A;  5L71 A;  1SJZ A;  3C8E A;  4PUA A;  1V9W A;  3M9J A;  3DIE A;  3EU3 A;  4BL7 A;  4EIQ A;  3NIV A;  6GSU A;  2M72 A;  5IMD A;  4K0N A;  1ERT A;  3C73 A;  3VI5 A;  3RHB A;  2YNX A;  5A4W A;  1PN0 A;  4PXO A;  3LXT A;  1F3B A;  1A2J A;  3ME8 A;  4K0G A;  2IFQ B;  4O7H A;  1EP7 A;  3FZ4 A;  2CVB A;  2GS3 A;  1O8X A;  2IMD A;  1GUH A;  4Q5Q A;  4MCU A;  5JCW A;  4IJI A;  2XBI A;  5CYY A;  2B5Y A;  1B4Q A;  1EOH A;  5IQY A;  4YQV A;  3D22 A;  1QMV A;  2PER A;  2VL3 A;  2H1B A;  1CQG A;  2B7J A;  1GSU A;  3L78 A;  4N0Z A;  3I69 A;  2L59 A;  1F9M A;  13GS A;  1HNB A;  2FY6 A;  2IMK A;  1GSD A;  2H01 A;  3F6F A;  1ZYP A;  2MMZ A;  2YP6 A;  1GRX A;  1Z5Y E;  4XCS A;  1YKA A;  2VO4 A;  1SKW B;  1B9Y C;  3FMW A;  3Q18 A;  3VFI A;  2C3T A;  1XW9 A;  1TK8 B;  4ZBB A;  1B8X A;  2NPB A;  1JHB A;  4FO5 A;  3IHG A;  5D93 A;  2OA7 A;  5C04 A;  4O5R A;  1KNG A;  3GUS A;  1ST9 A;  2VOC A;  3IA1 A;  2REM A;  2HFD A;  2MMA A;  1ZMA A;  2NBS A;  1PSQ A;  3ZL5 A;  4JR6 A;  2ZUP A;  1N2A A;  1FOV A;  4E8E A;  3EMX A;  2HI7 A;  4OO4 A;  2WS2 A;  3UL3 A;  4F0B A;  2CA8 A;  5CRE A;  4LL4 B;  4KDU A;  1TDI A;  4N10 A;  4AJ8 A;  2YZU A;  2ZCT A;  3W8J A;  2L57 A;  2C3N A;  1SK2 A;  3TOT A;  3KH9 A;  3UJ1 A;  4ZB6 A;  1XWA A;  2DJ3 A;  1ACV A;  3IXR A;  2B7K A;  2VCV A;  4WBR D;  3WT2 A;  3G7J A;  3LSZ A;  5G30 A;  2EIO A;  2XBQ A;  1CQH A;  1URM A;  3HD5 A;  3EWL A;  3IAM 2;  5INY A;  1JFU A;  1GSY A;  1GUL A;  1WOU A;  3WGE A;  2HRA A;  2PBJ A;  2CZ2 A;  2RLI A;  2PMT A;  2C3Q A;  3EUR A;  3CRU A;  3TKR A;  3L9S A;  3QOU A;  4O5Q A;  2LRC A;  1TJD A;  5B6M A;  5EY6 A;  2R3X A;  2P0G A;  4Z2T A;  2B5X A;  5G31 A;  3ZFL A;  5CAX A;  3GL5 A;  4JED A;  3C1S A;  2NVL A;  2O85 A;  4XTS A;  3FYG A;  2X8C A;  1OC9 A;  3ZLP A;  2VL2 A;  3V1W A;  1V40 A;  3A2V A;  1PKW A;  1OAZ A;  3HJP A;  1A8L A;  5EPF A;  3UEM A;  3SBC A;  2KP1 A;  3J7Y b;  2HRN A;  3JCM L;  2IN3 A;  4ECB A;  1JLW A;  3ZML A;  3DWV A;  2AB6 A;  4CDO A;  2DIZ A;  1ZYE A;  1TRW A;  1JZO A;  3BD2 A;  3TRP A;  1SK0 A;  4ZBA A;  3EYT A;  2O89 A;  1K3Y A;  3HY2 A;  2F51 A;  1E2Y A;  3LW9 A;  1X9M B;  3NZN A;  3ZZX A;  5AIV A;  1M9B A;  1N8J A;  1QK8 A;  1SU9 A;  5DQS A;  3FZA A;  2H0H A;  4ECJ A;  2EIR A;  1ERV A;  3BBY A;  4ZIJ A;  4J2F A;  4KDY A;  1K0O A;  3GFK A;  5D73 A;  5DCH A;  2L5O A;  5ECI B;  3FW2 A;  2B1K A;  5JWQ B;  2VIM A;  1PMT A;  5LD0 A;  3FR3 A;  3EE2 A;  4HUA A;  3C7M A;  1A0R P;  2FWF A;  1J08 A;  2H70 A;  3E9J B;  2DJ2 A;  2ON7 A;  1KEB A;  1EGR A;  3P7X A;  2PPT A;  2TIR A;  1M9A A;  4J57 E;  5AIS A;  5KN2 A;  3WGD A;  2HSY A;  4ZL9 A;  2K6V A;  3Q19 A;  1X9S B;  1U3I A;  3GX8 A;  3APS A;  4Q5F A;  1V58 A;  2B6M A;  3RPP A;  1TI3 A;  3R3E A;  1NM3 A;  4WKW A;  3C71 A;  3PIN A;  4FYC A;  2I9H A;  3AY8 A;  2QKE A;  3ZMK A;  2M46 A;  4XS4 A;  4G0L A;  4EO3 A;  4N30 A;  4ZB8 A;  4KSO A;  1QXH A;  1ERW A;  1RQM A;  4HJM A;  3HDC A;  3EMP A;  4K2D A;  4LMW A;  5J3R A;  1T4Z A;  3GUR A;  2AJQ B;  1QFN A;  1KTE A;  5HR1 A;  2A4V A;  4DSS A;  4DEJ A;  3KP9 A;  4KE3 A;  4ECI A;  1Y6E A;  3IRA A;  1S3A A;  3CRT A;  5A4V A;  4WBJ A;  5JCG A;  3CSJ A;  1JZR A;  3TJG A;  5F06 A;  5G5F A;  2FA8 A;  3G7I A;  2H1A A;  1VRS D;  4FH8 A;  5IPH A;  2H8L A;  2MBT A;  3O76 A;  4EXJ A;  20GS A;  4JR4 A;  1SD9 A;  2C4J A;  1RK4 A;  1THX A;  2C1Y A;  4DSQ A;  3UMA A;  1K0N A;  3E3E A;  1X5E A;  4HJ2 A;  1XW5 A;  2MMO A;  4GST A;  4YH2 A;  3F63 A;  5IMC A;  4TR0 A;  4G10 A;  1ZYN A;  1X9W B;  4BL7 B;  4EDY A;  4PNG A;  5DQY A;  2P5R A;  1TU7 A;  2C0D A;  5JWR B;  3MSZ A;  5IOX A;  1O73 A;  1JZD A;  4YKG A;  5JCU A;  2X64 A;  1WPI A;  5AIX A;  2FA4 A;  2DKI A;  2GZP A;  5ID2 A;  1WIK A;  4EDZ A;  4RQX A;  5IPG A;  1BJX A;  4KAE A;  2QGV A;  3W8S A;  9GSS A;  2ALB A;  2QC7 A;  1M2A A;  2B1L A;  4NAX A;  4CY8 A;  2FWE A;  2V6O A;  2GQL A;  2AHE A;  5EL8 A;  1TU8 A;  2C0F A;  1WP0 A;  1SK1 A;  3F3Q A;  4TRX A;  2CQ9 A;  1GP1 A;  2N5F A;  3CSI A;  2H73 A;  1SYX A;  3EU4 A;  4I97 A;  1EEM A;  4HQS A;  1VF4 A;  4GQC A;  3ERG A;  4E8H A;  4G0I A;  2VCW A;  1ZGN A;  1JLV A;  5A5K A;  4KH7 A;  4PGT A;  4HQZ A;  5ECH B;  3VLN A;  3PH9 A;  1WMJ A;  5HQP A;  1ERU A;  2JAD A;  3ZYW A;  3KZQ A;  1A0F A;  1GSS A;  4X43 A;  3D5J A;  2YJ7 A;  2FGX A;  2GVP A;  1O8W A;  2DJ1 A;  1Y25 A;  3IE3 A;  1GTI A;  2PWJ A;  4I2U A;  1WRY A;  4KCA A;  3LGC A;  4KDX A;  4ILF A;  4LL1 B;  1SL0 B;  2P31 A;  1M7T A;  4MA9 A;  2HSM A;  4K7O A;  4WXT A;  5BRT A;  2EIQ A;  3HVS A;  4ZBD A;  2H66 A;  3FY7 A;  3HZ8 A;  1Z9H A;  5B8A A;  1U88 A;  2WGR A;  3MWH A;  3ZFB A;  1TRU A;  4BVY A;  3IHQ A;  3WT1 A;  3UAP A;  3QAG A;  2H1D A;  2O87 A;  4POL A;  3A5W A;  4PNF A;  2LJK A;  5HR3 A;  3KEB A;  3LYP A;  5J9B A;  4IVF A;  2XPD A;  4IN0 A;  4XRD A;  2FHE A;  3FR6 A;  4YKF A;  4MNN A;  4V2N A;  1OE8 A;  4V1A p;  4HU7 A;  3LWA A;  5CRH A;  3GX0 A;  2LJR A;  1MDK A;  4JE1 A;  2YPM A;  1O7U A;  2O7K A;  1A2M A;  1EV4 A;  3LG6 A;  1OE7 A;  2DJK A;  3ZRE A;  5CNW A;  2VCQ A;  5ELG A;  5DDL A;  5ENU A;  1Z7R A;  4NPB A;  3IBH A;  2H6X A;  2GZY A;  3LOR A;  4ZL7 A;  4PQ1 A;  4I8B A;  1OC9 B;  4WR4 A;  4OCF A;  2B5E A;  2ON5 A;  5LNK e;  1R26 A;  3GL3 A;  1ZL9 A;  3APO A;  4MAB A;  5J5N A;  1DSB A;  1ZZY A;  4MF6 A;  4K2X A;  2PUK C;  8GSS A;  1SJ6 A;  3A2W A;  3PPU A;  3R2Q A;  2L4C A;  3TUE A;  1F37 A;  1K0A A;  1A23 A;  2LTK A;  1Q98 A;  1EV9 A;  5ECR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...