2EC4A

Solution structure of the uas domain from human fas-associated factor 1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
171
structure length
171
Chain Sequence
b'ENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTAQQQEDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAS-associated factor 1
publication title Solution structure of the UAS domain from human FAS-associated factor 1
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 37
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ec4A00
3F3QA 3FRCA 3DVWA 3IK7A 3F63A 2CT6A 1ERVA 3EMXA 4IQ1A 3NZNA 1Q4JA 2ZNMA 4JBBA 2GS3A 2H71A 3IRAA 1M0UA 5AN1A 2JACA 4L0UA 2B5EA 2HRNA 3FZAA 1Z7RA 3KM6A 3KIJA 2JZSA 4BVXA 6GSTA 4OFTA 1MDJA 1ABAA 2VLTA 2YN1A 5HR3A 1EV9A 1OC9B 3EWLA 4KCAA 3TKSE 5FT3A 2HZEB 4RI7A 2K6VA 5JWRB 3TKSA 4WKWA 5G1KA 1JLVA 3ZL5A 2H6XA 1HNAA 1NSWA 2FY6A 1RK4A 6GSSA 3H4KA 2VL9A 5H5QA 5CP1A 3IHQA 1PL2A 4IHUA 4V1Ag 3BD2A 2FHEA 2LJRA 2MMOA 2JZTA 5ELAA 1WRYA 3W6GA 2Z9SA 1SL2B 3WT2A 3GSSA 2WJUA 1X5EA 2F3MA 1GULA 4I8BA 1V57A 2YJ7A 2REMA 1X5CA 2CZ3A 16GSA 1X9MB 4F9ZA 1NM3A 4JR6A 4EO3A 3CYNA 2H0GA 1LBKA 3TOTA 1XZOA 2PUKC 5D9TA 2JSYA 5IMAA 2H1BA 3WT1A 2IIYA 4WF5A 4DSQA 4TR1B 5IPGA 1WP0A 4MP4A 20GSA 2PU9C 4HJMA 3VPQA 3DD3A 3ME8A 4MJCA 2VCZA 4ZB8A 1XW6A 2FWFA 4GXZA 1PRXA 1VF1A 1WOUA 1X5DA 1TK0B 3FZ4A 1TTZA 4EKZA 4WBRD 5LD0A 1Z6MA 5D9XA 3APSA 1TRWA 3GH9A 1JZDA 1ZZYA 1ZGNA 1ILOA 2H6YA 4LA1A 1FVKA 3FZ9A 5KN2A 1SYXA 4POLA 4RQRA 6GSVA 3C7MA 1V58A 2D2ZA 4QL7A 2EC4A 2OBKA 5AISA 3EURA 3HVSA 2VCXA 2PMTA 2C8UA 3KH9A 3C8EA 2C0EA 2GT6A 2NBSA 3TKPA 1VRSD 1JZOA 2YJHA 5CRGA 3BCKA 4FO5A 2FGXA 2DJJA 4XS4B 2VIMA 3F8UA 1TOFA 5IQYA 2P5RA 4V2LA 1JFUA 3UBKA 3D0ZA 1XBSA 5DAKA 3KP8A 2KHPA 2K8VA 1F2EA 1SENA 1K0CA 1PMTA 3P7XA 3IAM2 3PINA 2TRCP 5DJLA 2K9FA 2FD3A 5IOWA 4EVMA 2C1YA 1X9WB 4MJBA 4GQFA 4TRXA 4X1UA 4WXTA 2FNOA 2KUCA 4O7HA 3ZIVA 1T7PB 3L4NA 4KX4A 4O5RA 3TDGA 4AF2A 3TKQA 3GL3A 2V6KA 4F2IA 2E2MA 1XW9A 1N8JA 1YEXA 4ZBAA 1SK2A 4BVYA 1FB6A 1XPVA 2YNXA 1A24A 1J08A 5HR2A 5IMZA 1K3LA 2CVBA 4TR4A 4L0WA 3UOMA 4G9HA 2AB6A 2LEGA 2G0FA 4CW9A 1B8XA 4IVFA 1AAZA 3FHKA 3MSZA 4V1Ap 3M1GA 4K7OA 3F6FA 2B7JA 3GYKA 1YKAA 4QQ7A 2E2GA 2C4JA 4K7IA 1AXDA 1W89A 4WETA 1FB0A 3WD6A 4TKYA 4TXOA 1Q98A 2AHEA 3A5WA 1BQ7A 1U3AA 5F05A 2DIZA 4PNGA 2B1LA 5G5FA 12GSA 2LRTA 2RUFA 1DE2A 2YOIA 4POKA 4OFNA 4GSNA 1XOBA 3ERGA 4JE1A 4Q5NA 4F82A 4TVEA 3WGDA 4X0XA 4KH7A 2O89A 4ML1A 3F9UA 4RI6A 1XWAA 5B8BA 2R6KA 2VL2A 4ZBBA 2PWJA 3KD0A 3OR5A 3UEMA 5HR1A 4AJ7A 1SKSB 1HYUA 2F8FA 2HNLA 2DJ3A 4XIHA 3EYTA 2VLVA 5DCGA 2GT5A 3APQA 5DALA 3A2VA 2JL4A 4NPBA 2CZ2A 1MTCA 2FUG2 1ACVA 3KMOA 1GWCA 4PQHA 4HI7A 5ECIB 2MYGA 4LMVA 2X8HA 1GNWA 2KP2A 1MEKA 2YZUA 1OC3A 1PGTA 3EVIA 1R4WA 4J56E 3L78A 1EP7A 1G7OA 1USBA 3GKNA 4YQVA 4MF6A 5GSTA 2GSSA 2VL3A 2WFCA 4FYBA 2XBIA 3WGEA 5ECSA 2YP6A 1VF2A 4MH2A 5CYYA 4JR4A 1GUHA 1EEMA 5AIXA 2H8LA 4ZBDA 3P2AA 2XHFA 2WS2A 1AQWA 1Z5YE 2L6CA 5ECOB 3C73A 5G2ZA 3H79A 2FA8A 4H86A 2QKEA 1H4OA 3LFLA 4EXJA 4MPFA 4D73A 4MH3A 1EWXA 5KEJA 3TJFA 2JSZA 1ERWA 1EV4A 3KH7A 3D5JA 2OE1A 2OA7A 4KB3A 4FIWA 1HQOA 4K7NA 1GH2A 1RQMA 5GAND 4FH8A 2L6DA 3GRXA 3GSTA 3L9UA 2C3QA 3EU3A 1PKZA 5IOXA 4L5LA 2IMEA 5IO0A 2CAQA 3UARA 1XCCA 3FZ5A 1TI1A 1R5PA 1LJRA 2C0GA 1PSQA 4MF5A 1VF3A 2DMMA 4HOJA 3MNGA 1XOAA 4HU7A 2RIIA 4PURA 1WIKA 4OMVA 1YEPA 1U3IA 2VCWA 3SBCA 4I5QA 1TU7A 3TKSC 4GCIA 2IFQA 2DJ0A 1ST9A 1I9DA 4RUVA 1Y25A 3CTGA 2IMFA 1M2BA 2VM1A 5J9BA 2P31A 5IPHA 3F3RA 5A5KA 1ZYQB 5DJMA 4L8EA 1XVQA 2R2JA 1DE1A 4GSTA 2ZUPA 3VLNA 5CRDA 2HT9A 3NOFA 1PL1A 3CSHA 5ELGA 4MDCA 3MWHA 5EPFA 5KN1A 4HJ2A 1M9BA 2PGTA 2A2RA 4K8MA 1A8LA 3LJRA 3GN3A 3E0UA 4I6XA 6GSYA 1K0AA 3HKRA 5CRWA 1GUKA 5B6MA 3KXOA 5LNKe 4PX1A 1YF0A 2K18A 1JZRA 1FO5A 2H30A 1OKDA 2B5XA 3IC4A 18GSA 2KLXA 2OE3A 3RBTA 2VD1A 3KTBA 4ULXA 5G30A 1ZMAA 4XHMA 1QQ2A 1YQ1A 3ZMKA 2DIYA 2O85A 4DSSA 5E59A 1V98A 2V41A 2IL3A 4GRFA 4N0ZA 3QFAC 1K0MA 3RPPA 3A2WA 1URMA 1X0RA 1T8EB 4BL7A 3UJ1A 3E3EA 2DJ2A 2LKUA 3O3TA 4OO5A 5IMFA 3IOSA 2YV9A 5IMDA 2EIQA 5J5NA 4GF0A 3I6AA 4EUYA 3FYGA 4BA7A 5J41A 1T1VA 1FW1A 1Z6NA 4KUNA 4JZQA 2LS5A 2I3YA 17GSA 5C00A 2F9SA 3IPZA 2LJKA 4OD7A 2DMLA 4GTUA 1YDKA 3PH9A 3FY7A 4K1FA 4PQIA 5HR0A 3ERWA 3K8NA 4XS4A 3L9SA 4BWSA 4IELA 2MBTA 1TKDB 4JRRA 3Q6OA 3M9JA 2QC7A 2QGVA 3IK9A 3ZYWA 1F9MA 2IMKA 11GSA 2B5YA 3UVTA 2HLSA 2HRFA 3DKSA 3LSZA 1BJXA 3TJGA 3D4TA 4L5OA 2TIRA 5ECHB 3IE3A 1JLWA 1XWCA 3H1NA 1U87A 1ZOFA 4K6XA 1SU9A 5F8BA 5ID2A 3GIXA 5IO2A 1O6JA 4EC0A 4XRAA 4G2EA 1CQHA 1TRVA 2YZHA 3WYWA 3Q74A 4PNFA 1XIYA 4DEJA 2BTOT 5B8AA 5HFGA 3IV4A 2V6OA 3EE2A 4OWYA 4ECCA 4TN8A 1GSYA 5IMCA 3QAWA 2C80A 2K8SA 1PX7A 3U5RE 2HXKA 1AC1A 1LU4A 4WR5A 4DSRA 5HQPA 3VWVA 4ECIA 2LSTA 1SYRA 3EMPA 1O7UA 1G6YA 1S3AA 1O73A 1Z7PA 5FWGA 2OBIA 4NV5A 2EIRA 2JZRA 3QCPA 2C0FA 1A2LA 4F03A 2A2SA 2EIOA 4KCEA 2GTUA 3HA9A 2ALBA 4KE3A 2WDUA 3GUSA 5H5RA 2LRCA 1GSEA 2X99A 2H76A 2R37A 3GNJA 2NPBA 2VOCA 3RPNA 2NTOA 2H0HA 3O6TA 1S3DA 4XRDA 3RHCA 1H75A 5DVBA 3BOAA 3QOUA 3RAZA 5L71A 3GKKA 3BBYA 1M99A 5E4WA 2E7PA 4KA0A 2ON5A 2HSHA 4NHZA 5JWOB 1DUGA 3E9JB 2H70A 1F37A 1T00A 1GRXA 6GSWA 1PX6A 2DJ1A 3LORA 2CA8A 3GTUB 10GSA 5KN0A 1AQVA 3VI7A 2VL2C 3TKRA 4TXOB 1XVWA 5EY6A 2FWEA 3KEBA 3RDWA 3KMNA 3FR6A 4QL9A 1MDKA 5B6NA 2L4QA 2N5FA 4IS0A 1QMVA 1ZYEA 1OE8A 3ISOA 3C71A 3DYRA 3PGTA 1SJZA 2GSTA 2BJXA 3FKFA 5INYA 3QPMA 1GTUA 4MJEA 4YQMA 3H93A 3KTLA 1NHOA 3N9JA 1HNCA 3M9KA 4MZCA 4EF0A 4WBJA 4HQSA 1VGLA 1SL1B 4KNDA 4AJ6A 1V2AA 6GSUA 2H75A 1IYHA 1U6TA 5JCGA 3GKMA 2ES7A 2GQMA 1G7EA 4ECBA 1B9YC 2H1DA 2VCQA 2X64A 3HJPA 2H1AA 2HYXA 3HJMA 2C0DA 3ERFA 3GURA 5F06A 1GL8A 2B7KA 2A4VA 4CHSA 1EOHA 2P5QA 3F4SA 5ENUA 2VUPA 4PGTA 2PVOC 2YWNA 4KSOA 1KTEA 2H74A 2IPAA 2LNSA 4CDOA 1G0TA 4IN0A 3DRNA 2OADA 2FA4A 1B4PA 2DLXA 2IMDA 1QUWA 1M7TA 2YV7A 3VWXA 3HXSA 3I9V2 1CQGA 5G31A 3DIEA 2GGTA 5CNWA 1OAZA 5CAXA 2GLRA 3I69A 2H73A 2PBJA 1BYEA 5ECRB 2FWGA 5IIZA 4ZL9A 3ZREA 1OC8A 1TK5B 3VWWA 4BPYA 1O8WA 3F0IA 2LRNA 1THOA 1XWBA 2GZYA 3TCOA 2GVPA 4IGJA 1B4QA 1FHEA 4TR3A 2JADA 4KAEA 4Q5RA 1TU8A 1R5AA 2X8CA 4HZ4A 1DSBA 2YPMA 3M0FA 2F51A 4KW6A 3GMFA 3W8SA 1TI3A 1ON4A 1F3AA 1SD8A 3GX8A 5D9VA 2NVLA 2B6MA 2MMNA 4D73B 4NV2A 3ZFBA 4K2DA 9GSSA 1U88A 2CVDA 1GP1A 2N5BA 2WRTA 4IJIA 4AJ8A 1YF1A 1E2YA 1A2JA 3EINA 2J9HA 5C04A 3WGXA 3IR4A 2BMXA 1JZWA 3UIWA 2I4AA 4I2UA 3L9VA 1SJIA 2RM6A 4HQZA 1BG5A 5AIVA 2L5OA 3IBHA 5B7CA 4K9ZA 1C72A 2O87A 3EC3A 4MPGA 1OC9A 3HJOA 2HZEA 2HE3A 5ECMB 4E8HA 1WE0A 2YWOA 3VK9A 2AV4A 1GUMA 3TUEA 4WEYA 2LJAA 1AUCA 2YWIA 3UAPA 2LNTA 2I1UA 4IP1A 2H66A 1M2DA 2HFDA 4ECJA 3HZ8A 2N5AA 1K0NA 5AGYA 3UL3A 3FK8A 4IJ3A 3UBLA 2B3SA 2GSRA 3I43A 3D22A 1FAAA 3ZVJD 2OE0A 3GH6A 4MLYA 1YZXA 1EEJA 5CRHA 5GZZB 4LL4B 1G6WA 2OJLA 1GSSA 1R26A 2B1KA 2VD0A 2FWHA 3C1SA 2L59A 1EOGA 5J3RA 1TXXA 1THXA 2MBSA 3O76A 1SKWB 2AUVA 3NIVA 2RUEA 2WB9A 4IBPA 2IFQB 2H01A 2L57A 2IN3A 3IDVA 4TOPA 2O7KA 4GQCA 2NDOA 3DMLA 1FOVA 2L4CA 3HCZA 4J2FA 3UMAA 3VI5A 3CRTA 5ECPB 2PPTA 3TGZA 1SK1A 5LCZA 2I9HA 2R3XA 3FR9A 4ILFA 3LXZA 4XTSA 3MDKA 3LYPA 5KN3A 4POBA 2V1MA 4PUFC 3HDCA 2CX3A 4N0VA 2C3NA 4TR1A 4FYUA 4PQ1A 1MD3A 14GSA 2OKAA 3UVHA 3HY2A 1XWKA 4O92A 2IWTA 4O32A 1M9AA 1VF4A 1EZKA 1TRSA 3Q18A 4DVCA 3ZVJA 3TJKA 3ZITA 2GQKA 4JEDA 4BWQA 2CV4A 1ML6A 1SK0A 1OVNA 2WGRA 4IP6A 1HNBA 5A4WA 1EGRA 5D93A 1BAYA 2DJKA 1GSDA 3ZTLA 2LQOA 3L0HA 4Z7XA 2H1GA 5D73A 1TP9A 5DDLA 2LTKA 4OO4A 3S9FA 4I97A 2KOKA 1K3OA 1K0BA 1TRUA 5D96A 5GAPD 4NHWA 2XPEA 4XS6A 2ZCTA 4DSSB 4ZILA 1MD4A 2DSAA 3LEFA 4G10A 2M80A 5J9CA 4WF4A 5JCUA 4WR4A 4YAVA 1HD2A 3HHVA 4ISDA 4ZB6A 1GLQA 1ERUA 4YAPA 1T4ZA 3DXBA 3ZLPA 1SKRB 2RLIA 2GQLA 1YKCA 5DBQA 5HFIA 5COHA 5G1LA 3TOUA 3ZMLA 2X8GA 4PXOA 3IA1A 2H0IA 2YWMA 2CX4A 1FVJA 1GTAA 1KNGA 3QAGA 4MZBA 1QK8A 4ID0A 2YANA 4NAXA 5CO3A 3QR6A 4HUAA 5ECQB 5ABRA 5FHIA 4IQAA 8GSSA 3DVXA 2GZPA 1WPIA 4XCSA 3KCMA 3VPTA 2J23A 2M72A 1WJKA 4LLRA 1S3CA 4OFMA 3J7Yb 2WZ9A 4MF7A 1J9BA 3IAS2 3LWAA 2L5LA 2FLSA 3HD5A 4ZXGA 4Q5FA 3DWVA 1I5GA 2AYTA 3LYKA 4Q5QA 3J7Yk 2H72A 1QGVA 1KEBA 3BCIA 5EL8A 2VCVA 5DAKB 1PD21 3TRXA 5ID2B 5H5SA 5DQYA 3F6DA 3TRQA 2LQQA 4JU5A 3D21A 1JHBA 3F4TA 19GSA 4MMMA 1NW2A 3JCML 5DCHA 4KDUA 4MJAA 2VCTA 3G7JA 7GSSA 1XW5A 2IJYA 2ON7A 1K3YA 4LL1B 3CRUA 3ZFLA 5IM9A 4GWRA 2KP1A 1T4YA 4EDYA 4TW5A 2VLUA 4N10A 3HVVA 2VM2A 1K0OA 1RW1A 5JWQB 4KGIA 4ML6A 2HI7A 3G9BA 1PKWA 3HVXA 1TK8B 4MZWA 4OCEA 1X9SB 1XFLA 2OACA 3ME7A 1N2AA 5JCWA 4FYCA 2CVKA 4EE0A 4J57E 1UVZA 1GLPA 2G2QA 1O8XA 3P8WA 3VURA 1R7HA 3C1RA 3N5OA 3TRPA 3QMXA 3D4MA 2VO4A 1IYIA 1AW9A 4ACSA 1M2AA 2CQ9A 1KBNA 4K0NA 4MK3A 5ECKB 4YQUA 3APOA 4TXVA 3GTUA 2O8VB 1PA3A 3QAVA 2I81A 5CREA 2YCDA 1QXHA 2MMAA 3CXGA 4KSMA 2AAWA 1B48A 4RQXA 1EP8A 2RM5A 5ECNB 3ED3A 1QFNA 2P0GA 1EGOA 3KP9A 5A4UA 3W8JA 2JU5A 3TB2A 1V40A 4GLTA 1OKTA 2DBCA 3VWUA 3A2XA 4TR0A 2MMZA 22GSA 5IMVA 1TW9A 2AJQB 3GL5A 3DGQA 4F0BA 1TDIA 3CMIA 3DEXA 2PERA 2R4VA 2DC5A 4G19A 3HZ4A 1UN2A 1K0DA 1AQXA 4I2TA 3LXTA 1Z9HA 1BEDA 3CSJA 2V32A 1BX9A 2GDRA 4HZ2A 1ERTA 2V2GA 1A2MA 2XPDA 2HSYA 5A4VA 3LQ7A 3D6IA 4AGSA 3M3MA 3LGCA 1YJ6A 3Q19A 5D9WA 2PVQA 3R2QA 2WCIA 4MA9A 3SWLA 3QDNA 3V1WA 4HDEA 2PN8A 3US3A 4NWYA 1DBYA 2QSIA 2XBQA 3VFIA 4V2NA 1GSQA 3FEUA 1A0FA 3A3TA 3IXRA 3KJYA 1SD9A 3U6VA 2H6ZA 5D8IA 3H8QA 4KDYA 1GTIA 1ZL9A 3G7YA 5DALB 4XS1A 2F8AA 3GFKA 4IKHA 2M46A 3P90A 3GKXA 1OE7A 5F07A 3ZRDA 2C3TA 3EU4A 1YY7A 4F0CA 2XC2A 3TJJA 3GV1A 4EDZA 3MAKA 2MZCA 5G5EA 1WWJA 4POMA 4KDXA 4EL1A 3KGKA 3BJ5A 1OYJA 5ECLB 3ZIJA 13GSA 1GSUA 3GHAA 1Z3EA 3M8NA 1B9XC 3FW2A 1Y6EA 1V9WA 1SL0B 5GSSA 3CSIA 1GNEA 4E8EA 2GZZA 4YH2A 3FR3A 2LUSA 2H19A 4NXIA 3QFBC 4MABA 1ZCPA 1SJ6A 3AY8A 1A8YA 1FG4A 1PN9A 1WMJA 4ZIJA 5DQSA 1AIUA 3TJBA 1E6BA 4N30A 1W4VA 2HZFA 1F3BA 2CAIA 4IW9A 4ZL7A 2GSQA 3GX0A 4MCUA 4NMUA 4N11A 4K0GA 1GTBA 4V2MA 2FCHA 3KZQA 5F0GA 3PR8A 3CBUA 6GSXA 4OCFA 2E0QA 4PUAA 2WULA 2VAFA 3G7IA 3LG6A 1UA5A 2R5GA 4HEA2 1NHYA 2IMIA 4P3YB 1TJDA 3GA4A 4ZB9A 3QD9A 4X43A 4HU9A 5J4UA 5EVOA 4ZL8A 3CTFA 1GSFA 1A23A 1O85A 3F4RA 1T3BA 1PQNA 4LMWA 3ZZXA 1XWGA 3HYPA 1XXUA 1F6MC 5HFKA 4HS1A 1J0FA 1O81A 1UC7A 3RHBA 1MDIA 1A0RP 2LV3A 2TRXA 4GSSA
chains in the Genus database with same CATH superfamily
3F3QA 3FRCA 3DVWA 3IK7A 3F63A 2CT6A 1ERVA 3EMXA 4IQ1A 3NZNA 1Q4JA 2ZNMA 4JBBA 2GS3A 2H71A 3IRAA 4PTSA 1M0UA 5AN1A 2JACA 4L0UA 2B5EA 2HRNA 3FZAA 1Z7RA 3KM6A 3KIJA 2JZSA 4BVXA 6GSTA 4OFTA 1MDJA 1ABAA 2VLTA 2YN1A 5HR3A 1EV9A 1OC9B 3EWLA 4KCAA 3TKSE 5FT3A 2HZEB 4RI7A 2K6VA 5JWRB 3TKSA 4WKWA 5G1KA 1JLVA 3ZL5A 2H6XA 1HNAA 1NSWA 2FY6A 1RK4A 6GSSA 3H4KA 2VL9A 5H5QA 5CP1A 3IHQA 1PL2A 4IHUA 4V1Ag 3BD2A 2FHEA 2LJRA 2MMOA 2JZTA 5ELAA 1WRYA 3W6GA 2Z9SA 1SL2B 3WT2A 3GSSA 2WJUA 1X5EA 2F3MA 1GULA 4I8BA 1V57A 2YJ7A 2REMA 1ZYPA 1X5CA 2CZ3A 16GSA 1X9MB 4F9ZA 1NM3A 4JR6A 4EO3A 3CYNA 2H0GA 1LBKA 4CY8A 3TOTA 1XZOA 2PUKC 5D9TA 4O5UA 2JSYA 5IMAA 4YKFA 2H1BA 3WT1A 2IIYA 4WF5A 4DSQA 4TR1B 5IPGA 1WP0A 4MP4A 20GSA 2PU9C 4HJMA 3VPQA 3DD3A 3ME8A 4MJCA 2VCZA 3MYDA 4ZB8A 1XW6A 2FWFA 4GXZA 1PRXA 1VF1A 1WOUA 1X5DA 1TK0B 3FZ4A 1TTZA 4EKZA 3EPTA 4WBRD 1PN0A 5LD0A 1Z6MA 5D9XA 3APSA 1TRWA 3GH9A 1JZDA 1ZZYA 1ZGNA 1ILOA 2H6YA 4LA1A 1FVKA 3FZ9A 5KN2A 1SYXA 4POLA 4RQRA 6GSVA 3C7MA 1V58A 2D2ZA 4QL7A 2EC4A 2OBKA 5AISA 3EURA 3HVSA 4USSA 2VCXA 2PMTA 2C8UA 3KH9A 3C8EA 2C0EA 2GT6A 2NBSA 3TKPA 1VRSD 1JZOA 2YJHA 5CRGA 3BCKA 4FO5A 2FGXA 2DJJA 4XS4B 2VIMA 2A4HA 3F8UA 1TOFA 5IQYA 2P5RA 4V2LA 1JFUA 3UBKA 3D0ZA 1XBSA 2X4AA 5DAKA 3KP8A 2KHPA 2K8VA 1F2EA 1SENA 1K0CA 1PMTA 3P7XA 3IAM2 3PINA 2TRCP 5DJLA 2K9FA 2FD3A 5IOWA 4EVMA 2C1YA 1X9WB 2X49A 4MJBA 4GQFA 4TRXA 4X1UA 4WXTA 2FNOA 2KUCA 2A2PA 4O7HA 3ZIVA 1T7PB 3L4NA 4KX4A 4O5RA 3TDGA 4AF2A 3TKQA 3GL3A 2V6KA 4F2IA 2E2MA 1XW9A 1N8JA 1YEXA 4ZBAA 1SK2A 4BVYA 1FB6A 5KOWA 1XPVA 4YKGA 2YNXA 1A24A 1J08A 5HR2A 5IMZA 1K3LA 2CVBA 4TR4A 4L0WA 3UOMA 4G9HA 2AB6A 2LEGA 2G0FA 4CW9A 1B8XA 4IVFA 1AAZA 3FHKA 3MSZA 4V1Ap 3M1GA 4K7OA 3F6FA 1FOHA 2B7JA 3A5IA 3GYKA 1YKAA 4QQ7A 2E2GA 2C4JA 4K7IA 1AXDA 1W89A 4WETA 1FB0A 3WD6A 4TKYA 4TXOA 1Q98A 2AHEA 3A5WA 1BQ7A 1U3AA 4G0LA 5F05A 2DIZA 4PNGA 2B1LA 5G5FA 12GSA 2LRTA 2RUFA 1DE2A 2YOIA 4POKA 4OFNA 4GSNA 1XOBA 3ERGA 4JE1A 4Q5NA 4F82A 4TVEA 3WGDA 4X0XA 4KH7A 2O89A 4ML1A 3F9UA 4RI6A 1XWAA 5B8BA 2R6KA 2VL2A 4ZBBA 4FQUA 2PWJA 3KD0A 3OR5A 3UEMA 5HR1A 4AJ7A 1SKSB 1HYUA 2F8FA 2HNLA 2DJ3A 4XIHA 3EYTA 2VLVA 5DCGA 2GT5A 3APQA 5DALA 4A5PA 3A2VA 2JL4A 4NPBA 2CZ2A 1MTCA 2FUG2 1ACVA 3KMOA 1GWCA 4PQHA 4X4JA 4HI7A 5ECIB 2MYGA 4LMVA 2X8HA 5BRTA 1GNWA 2KP2A 1MEKA 2YZUA 1OC3A 1PGTA 3EVIA 1R4WA 4J56E 3L78A 1EP7A 1G7OA 1USBA 3GKNA 4YQVA 4MF6A 5GSTA 2GSSA 2VL3A 2WFCA 4FYBA 2XBIA 3WGEA 5ECSA 3IHGA 2YP6A 1VF2A 4MH2A 5CYYA 4JR4A 1GUHA 1EEMA 5AIXA 2H8LA 4ZBDA 3P2AA 2XHFA 2WS2A 1AQWA 1Z5YE 2L6CA 5ECOB 3C73A 5G2ZA 3H79A 2FA8A 4H86A 2QKEA 1H4OA 3LFLA 4EXJA 4MPFA 4D73A 2QA2A 4MH3A 1EWXA 5KEJA 3TJFA 2JSZA 1ERWA 1EV4A 3KH7A 3D5JA 2OE1A 2OA7A 4KB3A 4FIWA 1HQOA 4K7NA 2HRAA 1GH2A 1RQMA 5GAND 4FH8A 2L6DA 3GRXA 3GSTA 3L9UA 2C3QA 3EU3A 1PKZA 5IOXA 4L5LA 2IMEA 5IO0A 2CAQA 3UARA 1XCCA 3FZ5A 1TI1A 1R5PA 1LJRA 2C0GA 1PSQA 4MF5A 1VF3A 2DMMA 4HOJA 3MNGA 1XOAA 4HU7A 2RIIA 4PURA 4K5RA 1WIKA 4OMVA 1YEPA 1U3IA 2VCWA 3SBCA 4I5QA 1TU7A 1M3IA 3TKSC 4GCIA 2IFQA 2DJ0A 1ST9A 1I9DA 4RUVA 1Y25A 3CTGA 2IMFA 1M2BA 2VM1A 5J9BA 2P31A 5IPHA 3F3RA 5A5KA 1ZYQB 5DJMA 4L8EA 1XVQA 2R2JA 1DE1A 4GSTA 2ZUPA 3VLNA 5CRDA 4BVXB 2HT9A 3NOFA 1PL1A 3CSHA 5ELGA 2HSMA 4MDCA 3MWHA 5EPFA 5KN1A 4HJ2A 4Z2TA 1M9BA 2PGTA 2A2RA 4K8MA 1A8LA 3LJRA 3GN3A 3E0UA 4I6XA 6GSYA 1K0AA 3HKRA 5CRWA 1GUKA 5B6MA 3KXOA 5LNKe 4PX1A 1YF0A 2K18A 4Z2UA 1JZRA 1FO5A 2H30A 1OKDA 2B5XA 3IC4A 18GSA 2KLXA 2OE3A 3RBTA 2VD1A 3KTBA 4ULXA 5G30A 1ZMAA 4XHMA 1QQ2A 1YQ1A 3ZMKA 2DIYA 2O85A 4DSSA 5E59A 1V98A 2V41A 5KOXA 2IL3A 4GRFA 4N0ZA 3QFAC 1K0MA 3RPPA 3A2WA 1URMA 1X0RA 1T8EB 4BL7A 3UJ1A 3E3EA 2DJ2A 2LKUA 3O3TA 4OO5A 5IMFA 3IOSA 2YV9A 5IMDA 2EIQA 5J5NA 4GF0A 3I6AA 4EUYA 3FYGA 4BA7A 5J41A 1T1VA 1FW1A 1Z6NA 4KUNA 4JZQA 2LS5A 2I3YA 17GSA 1S3RA 5C00A 2F9SA 3IPZA 3R3EA 2LJKA 4OD7A 2DMLA 4GTUA 1YDKA 3PH9A 3FY7A 4K1FA 4PQIA 5HR0A 3ERWA 3K8NA 4XS4A 3L9SA 4BWSA 4IELA 3PPUA 2MBTA 1TKDB 4JRRA 3Q6OA 3M9JA 2QC7A 2QGVA 3IK9A 3ZYWA 1F9MA 2IMKA 11GSA 2B5YA 3UVTA 2HLSA 2HRFA 3DKSA 3LSZA 1BJXA 3TJGA 3D4TA 4L5OA 2TIRA 5ECHB 3IE3A 1JLWA 1XWCA 3H1NA 1U87A 1ZOFA 4K6XA 1SU9A 5F8BA 5ID2A 3GIXA 5IO2A 1O6JA 5BMUA 4EC0A 4XRAA 4G2EA 1CQHA 1TRVA 2YZHA 3WYWA 3Q74A 4PNFA 1XIYA 4DEJA 2BTOT 5B8AA 5HFGA 3IV4A 2V6OA 3EE2A 4OWYA 4ECCA 4TN8A 1GSYA 5IMCA 3QAWA 2C80A 2K8SA 1PX7A 3U5RE 2HXKA 1AC1A 1LU4A 4WR5A 4DSRA 5HQPA 3VWVA 4ECIA 2LSTA 1SYRA 3EMPA 1O7UA 1G6YA 1S3AA 1O73A 1Z7PA 5FWGA 2OBIA 4NV5A 2EIRA 2JZRA 3QCPA 2C0FA 1A2LA 4F03A 2A2SA 3FMWA 2EIOA 4KCEA 2GTUA 3IC8A 3HA9A 2ALBA 4KE3A 2WDUA 3GUSA 5H5RA 2LRCA 1GSEA 2X99A 2H76A 2R37A 3GNJA 2NPBA 2VOCA 3RPNA 2NTOA 2H0HA 3O6TA 1S3DA 4BVYB 4XRDA 3RHCA 1H75A 5DVBA 3BOAA 3QOUA 3RAZA 5L71A 3GKKA 3BBYA 1M99A 5E4WA 2E7PA 4KA0A 2ON5A 2HSHA 4NHZA 5JWOB 1DUGA 3E9JB 2H70A 1F37A 1T00A 1GRXA 6GSWA 1PX6A 2DJ1A 3LORA 2CA8A 3GTUB 10GSA 5KN0A 1AQVA 3VI7A 2VL2C 4KF9A 3TKRA 4TXOB 1XVWA 5EY6A 2FWEA 3KEBA 3RDWA 3KMNA 3FR6A 4QL9A 1MDKA 5B6NA 2L4QA 2N5FA 4IS0A 1QMVA 1ZYEA 1OE8A 3ISOA 3C71A 3DYRA 3PGTA 1SJZA 2GSTA 2BJXA 3FKFA 5INYA 3QPMA 1GTUA 4Z2RA 4MJEA 4YQMA 3H93A 4HSCX 3KTLA 1NHOA 3N9JA 1HNCA 3M9KA 4MZCA 4EF0A 4WBJA 4HQSA 1VGLA 1SL1B 4KNDA 4AJ6A 1V2AA 6GSUA 2H75A 1IYHA 1U6TA 5JCGA 3GKMA 2ES7A 2GQMA 1G7EA 4ECBA 1B9YC 2H1DA 2VCQA 2X64A 3HJPA 2H1AA 2HYXA 3HJMA 2C0DA 3ERFA 3GURA 5F06A 1GL8A 2B7KA 4EIPA 2A4VA 4CHSA 1EOHA 2P5QA 3F4SA 5ENUA 2VUPA 4PGTA 2PVOC 2YWNA 4KSOA 1KTEA 2H74A 2IPAA 2LNSA 4CDOA 1G0TA 4IN0A 3DRNA 2OADA 2FA4A 1B4PA 2DLXA 2IMDA 1QUWA 1M7TA 2YV7A 3VWXA 3HXSA 3I9V2 1CQGA 5G31A 3DIEA 2GGTA 5CNWA 1OAZA 5CAXA 2GLRA 3I69A 2H73A 2PBJA 1BYEA 5ECRB 2FWGA 5IIZA 4ZL9A 3ZREA 1OC8A 1TK5B 3VWWA 4BPYA 1O8WA 3F0IA 2LRNA 1THOA 1XWBA 2GZYA 3TCOA 2GVPA 4IGJA 1B4QA 1FHEA 4TR3A 2JADA 4KAEA 4Q5RA 1TU8A 1R5AA 2X8CA 4HZ4A 1DSBA 2YPMA 3M0FA 2F51A 4KW6A 3GMFA 3W8SA 1TI3A 1ON4A 1F3AA 1SD8A 3GX8A 5D9VA 2NVLA 2B6MA 2MMNA 4D73B 4NV2A 3ZFBA 4K2DA 9GSSA 1U88A 2CVDA 1GP1A 2N5BA 2WRTA 4IJIA 4AJ8A 1YF1A 1E2YA 1A2JA 3EINA 2J9HA 5C04A 3WGXA 3IR4A 2BMXA 1JZWA 3UIWA 2I4AA 4I2UA 3L9VA 1SJIA 2RM6A 4HQZA 1BG5A 5AIVA 2L5OA 3IBHA 5B7CA 4K9ZA 1C72A 2O87A 3EC3A 4MPGA 1OC9A 3HJOA 2HZEA 2HE3A 5ECMB 4E8HA 1WE0A 4EIQA 2YWOA 3VK9A 2AV4A 1GUMA 3TUEA 4WEYA 2LJAA 1AUCA 2YWIA 3UAPA 2LNTA 2I1UA 4IP1A 1ZYNA 2H66A 1M2DA 2HFDA 4ECJA 3HZ8A 2N5AA 1K0NA 5AGYA 3UL3A 3FK8A 4IJ3A 3UBLA 2B3SA 2GSRA 3I43A 3D22A 1FAAA 3ZVJD 2OE0A 3GH6A 4MLYA 1YZXA 1EEJA 5CRHA 5GZZB 4LL4B 1G6WA 4G0IA 2OJLA 1GSSA 1R26A 2B1KA 2VD0A 2FWHA 3C1SA 2L59A 1EOGA 5J3RA 1TXXA 1THXA 2MBSA 3O76A 1SKWB 2AUVA 3NIVA 2RUEA 2WB9A 4IBPA 4BIKA 2IFQB 2H01A 2L57A 2IN3A 3IDVA 4TOPA 2O7KA 4GQCA 2NDOA 3DMLA 1FOVA 2L4CA 3HCZA 4J2FA 3UMAA 3VI5A 1M3JA 3CRTA 5ECPB 2PPTA 3TGZA 1SK1A 5LCZA 2I9HA 2R3XA 3FR9A 4ILFA 3LXZA 4XTSA 2R0CA 3LYPA 3MDKA 5KN3A 4POBA 2V1MA 4PUFC 3HDCA 2CX3A 4N0VA 2C3NA 4TR1A 4FYUA 4PQ1A 1MD3A 14GSA 2HRKA 2OKAA 3UVHA 3HY2A 1XWKA 4O92A 2IWTA 4O32A 1M9AA 1VF4A 3Q18A 1EZKA 1TRSA 2DKIA 4DVCA 3ZVJA 3TJKA 3ZITA 2GQKA 4JEDA 4BWQA 2CV4A 1ML6A 1SK0A 1OVNA 2WGRA 4IP6A 1HNBA 5A4WA 1EGRA 5D93A 1BAYA 2DJKA 1GSDA 3ZTLA 2LQOA 3L0HA 4Z7XA 2H1GA 5D73A 1TP9A 5DDLA 2LTKA 3HVNA 4OO4A 3S9FA 4I97A 2KOKA 1K3OA 1K0BA 1TRUA 5D96A 5GAPD 4NHWA 2XPEA 4XS6A 2ZCTA 4DSSB 2UZ8A 4ZILA 1MD4A 2DSAA 4K2XA 3LEFA 4G10A 2M80A 5J9CA 4WF4A 5JCUA 4WR4A 4YAVA 4BL7B 1HD2A 3HHVA 4ISDA 4ZB6A 1GLQA 1ERUA 4YAPA 1T4ZA 3DXBA 3ZLPA 1SKRB 2RLIA 2GQLA 1YKCA 3LW9A 5DBQA 5HFIA 4K5SA 4MNNA 5COHA 5G1LA 3TOUA 3ZMLA 2X8GA 4PXOA 3IA1A 2H0IA 2YWMA 2CX4A 1FVJA 1GTAA 1KNGA 3QAGA 4MZBA 1QK8A 4ID0A 2YANA 4NAXA 5CO3A 3QR6A 4HUAA 5ECQB 5ABRA 5FHIA 4IQAA 8GSSA 3DVXA 2GZPA 1WPIA 4XCSA 3KCMA 3VPTA 2J23A 2M72A 1WJKA 4LLRA 1S3CA 4OFMA 3J7Yb 2WZ9A 4MF7A 1J9BA 3IAS2 3LWAA 2L5LA 2FLSA 3HD5A 4ZXGA 4Q5FA 1PFOA 3DWVA 1I5GA 2AYTA 3LYKA 4Q5QA 3J7Yk 2H72A 1QGVA 1KEBA 3BCIA 5EL8A 2VCVA 5DAKB 1PD21 3TRXA 5ID2B 5H5SA 5DQYA 3F6DA 3TRQA 2LQQA 4JU5A 3D21A 4G0KA 1JHBA 3F4TA 19GSA 4MMMA 1XG8A 1NW2A 3JCML 5DCHA 4KDUA 4MJAA 2VCTA 3G7JA 7GSSA 1XW5A 2IJYA 2ON7A 1K3YA 4LL1B 3CRUA 3ZFLA 5IM9A 4GWRA 2KP1A 1T4YA 4EDYA 4TW5A 2VLUA 4N10A 3HVVA 2VM2A 1K0OA 1RW1A 5JWQB 4KGIA 4ML6A 2HI7A 3G9BA 1PKWA 3HVXA 1TK8B 3MIXA 4MZWA 4OCEA 1X9SB 1XFLA 2OACA 3ME7A 1N2AA 5JCWA 4FYCA 2CVKA 4EE0A 4J57E 1UVZA 1GLPA 2G2QA 1O8XA 3P8WA 3VURA 1R7HA 3C1RA 3N5OA 3TRPA 3QMXA 3D4MA 2VO4A 1IYIA 1AW9A 4ACSA 1M2AA 2CQ9A 1KBNA 4K0NA 4MK3A 5ECKB 4YQUA 3APOA 4TXVA 3GTUA 2O8VB 1PA3A 3QAVA 2I81A 5CREA 2YCDA 1QXHA 2MMAA 3CXGA 4KSMA 2AAWA 1B48A 4RQXA 1EP8A 2RM5A 5ECNB 3ED3A 1QFNA 2P0GA 1EGOA 3KP9A 5A4UA 3W8JA 2JU5A 3TB2A 1V40A 4GLTA 4O5QA 1OKTA 2DBCA 3VWUA 3A2XA 4TR0A 2MMZA 22GSA 5IMVA 4ICYA 1TW9A 2AJQB 3GL5A 3DGQA 4F0BA 1TDIA 3CMIA 3DEXA 2PERA 2R4VA 2DC5A 4G19A 3HZ4A 1UN2A 1K0DA 1AQXA 4I2TA 3LXTA 1Z9HA 1BEDA 3CSJA 2V32A 1BX9A 2GDRA 4HZ2A 1ERTA 2V2GA 1A2MA 2XPDA 2HSYA 5A4VA 3LQ7A 3D6IA 4AGSA 3M3MA 3LGCA 1YJ6A 3Q19A 5D9WA 2PVQA 3R2QA 2WCIA 4MA9A 3SWLA 3QDNA 3V1WA 4HDEA 2PN8A 3US3A 4NWYA 1DBYA 2QSIA 2XBQA 3VFIA 4V2NA 1GSQA 3FEUA 1A0FA 3A3TA 3IXRA 3KJYA 1SD9A 3U6VA 2H6ZA 5D8IA 3H8QA 4KDYA 1GTIA 1ZL9A 3G7YA 5DALB 4XS1A 2F8AA 3GFKA 4IKHA 2M46A 3P90A 3GKXA 1OE7A 5F07A 3ZRDA 2C3TA 3EU4A 1YY7A 4F0CA 2XC2A 3TJJA 3GV1A 4EDZA 3MAKA 2MZCA 5G5EA 1WWJA 4POMA 4KDXA 4EL1A 3KGKA 3BJ5A 1OYJA 5ECLB 3ZIJA 13GSA 1GSUA 3GHAA 1Z3EA 3M8NA 4CY6A 1B9XC 3FW2A 2DKHA 1Y6EA 1V9WA 1SL0B 5GSSA 3CSIA 1GNEA 4E8EA 2GZZA 4YH2A 3FR3A 2LUSA 2H19A 4NXIA 3QFBC 4MABA 1ZCPA 1SJ6A 3AY8A 1A8YA 1FG4A 1PN9A 1WMJA 4ZIJA 5DQSA 2R0PA 1AIUA 3TJBA 1E6BA 4N30A 1W4VA 2HZFA 2QA1A 1F3BA 2CAIA 4IW9A 4ZL7A 3CQFA 2GSQA 3GX0A 4MCUA 4NMUA 4N11A 4K0GA 1GTBA 4V2MA 2FCHA 3KZQA 5F0GA 3PR8A 3CBUA 6GSXA 4OCFA 2E0QA 4PUAA 2WULA 2VAFA 3G7IA 3LG6A 1UA5A 2R5GA 4HEA2 1NHYA 2IMIA 4P3YB 1TJDA 3GA4A 4ZB9A 3QD9A 4X43A 4HU9A 5J4UA 5EVOA 4ZL8A 3CTFA 1GSFA 1A23A 1O85A 3F4RA 2R0GA 1T3BA 1PQNA 4LMWA 3ZZXA 1XWGA 3HYPA 1XXUA 1F6MC 5HFKA 4HS1A 1J0FA 1O81A 1UC7A 3RHBA 1MDIA 1A0RP 2LV3A 2TRXA 4GSSA
chains in the Genus database with same CATH topology
3F3QA 3FRCA 3DVWA 3IK7A 3F63A 2CT6A 1ERVA 3EMXA 4IQ1A 3NZNA 1Q4JA 2ZNMA 4JBBA 2GS3A 2H71A 3IRAA 4PTSA 1M0UA 5AN1A 2JACA 4L0UA 2B5EA 2HRNA 3FZAA 1Z7RA 3KM6A 3KIJA 2JZSA 4BVXA 6GSTA 4OFTA 1MDJA 1ABAA 2VLTA 2YN1A 5HR3A 1EV9A 1OC9B 3EWLA 4KCAA 3TKSE 5FT3A 2HZEB 4RI7A 2K6VA 5JWRB 3TKSA 4WKWA 5G1KA 1JLVA 3ZL5A 2H6XA 1HNAA 1NSWA 2FY6A 1RK4A 6GSSA 3H4KA 2VL9A 5H5QA 5CP1A 3IHQA 1PL2A 4IHUA 4V1Ag 3BD2A 2FHEA 2LJRA 2MMOA 2JZTA 5ELAA 1WRYA 3W6GA 2Z9SA 1SL2B 3WT2A 3GSSA 2WJUA 1X5EA 2F3MA 1GULA 4I8BA 1V57A 2YJ7A 2REMA 1ZYPA 1X5CA 2CZ3A 16GSA 1X9MB 4F9ZA 1NM3A 4JR6A 4EO3A 3CYNA 2H0GA 1LBKA 4CY8A 3TOTA 1XZOA 2PUKC 5D9TA 4O5UA 2JSYA 5IMAA 4YKFA 2H1BA 3WT1A 2IIYA 4WF5A 4DSQA 4TR1B 5IPGA 1WP0A 4MP4A 20GSA 2PU9C 4HJMA 3VPQA 3DD3A 3ME8A 4MJCA 2VCZA 3MYDA 4ZB8A 1XW6A 2FWFA 4GXZA 1PRXA 1VF1A 1WOUA 1X5DA 1TK0B 3FZ4A 1TTZA 4EKZA 3EPTA 4WBRD 1PN0A 5LD0A 1Z6MA 5D9XA 3APSA 1TRWA 3GH9A 1JZDA 1ZZYA 1ZGNA 1ILOA 2H6YA 4LA1A 1FVKA 3FZ9A 5KN2A 1SYXA 4POLA 4RQRA 6GSVA 3C7MA 1V58A 2D2ZA 4QL7A 2EC4A 2OBKA 5AISA 3EURA 3HVSA 4USSA 2VCXA 2PMTA 2C8UA 3KH9A 3C8EA 2C0EA 2GT6A 2NBSA 3TKPA 1VRSD 1JZOA 2YJHA 5CRGA 3BCKA 4FO5A 2FGXA 2DJJA 4XS4B 2VIMA 2A4HA 3F8UA 1TOFA 5IQYA 2P5RA 4V2LA 1JFUA 3UBKA 3D0ZA 1XBSA 2X4AA 5DAKA 3KP8A 2KHPA 2K8VA 1F2EA 1SENA 1K0CA 1PMTA 3P7XA 3IAM2 3PINA 2TRCP 5DJLA 2K9FA 2FD3A 5IOWA 4EVMA 2C1YA 1X9WB 2X49A 4MJBA 4GQFA 4TRXA 4X1UA 4WXTA 2FNOA 2KUCA 2A2PA 4O7HA 3ZIVA 1T7PB 3L4NA 4KX4A 4O5RA 3TDGA 4AF2A 3TKQA 3GL3A 2V6KA 4F2IA 2E2MA 1XW9A 1N8JA 1YEXA 4ZBAA 1SK2A 4BVYA 1FB6A 5KOWA 1XPVA 4YKGA 2YNXA 1A24A 1J08A 5HR2A 5IMZA 1K3LA 2CVBA 4TR4A 4L0WA 3UOMA 4G9HA 2AB6A 2LEGA 2G0FA 4CW9A 1B8XA 4IVFA 1AAZA 3FHKA 3MSZA 4V1Ap 3M1GA 4K7OA 3F6FA 1FOHA 2B7JA 3A5IA 3GYKA 1YKAA 4QQ7A 2E2GA 2C4JA 4K7IA 1AXDA 1W89A 4WETA 1FB0A 3WD6A 4TKYA 4TXOA 1Q98A 2AHEA 3A5WA 1BQ7A 1U3AA 4G0LA 5F05A 2DIZA 4PNGA 2B1LA 5G5FA 12GSA 2LRTA 2RUFA 1DE2A 2YOIA 4POKA 4OFNA 4GSNA 1XOBA 3ERGA 4JE1A 4Q5NA 4F82A 4TVEA 3WGDA 4X0XA 4KH7A 2O89A 4ML1A 3F9UA 4RI6A 1XWAA 5B8BA 2R6KA 2VL2A 4ZBBA 4FQUA 2PWJA 3KD0A 3OR5A 3UEMA 5HR1A 4AJ7A 1SKSB 1HYUA 2F8FA 2HNLA 2DJ3A 4XIHA 3EYTA 2VLVA 5DCGA 2GT5A 3APQA 5DALA 4A5PA 3A2VA 2JL4A 4NPBA 2CZ2A 1MTCA 2FUG2 1ACVA 3KMOA 1GWCA 4PQHA 4X4JA 4HI7A 5ECIB 2MYGA 4LMVA 2X8HA 5BRTA 1GNWA 2KP2A 1MEKA 2YZUA 1OC3A 1PGTA 3EVIA 1R4WA 4J56E 3L78A 1EP7A 1G7OA 1USBA 3GKNA 4YQVA 4MF6A 5GSTA 2GSSA 2VL3A 2WFCA 4FYBA 2XBIA 3WGEA 5ECSA 3IHGA 2YP6A 1VF2A 4MH2A 5CYYA 4JR4A 1GUHA 1EEMA 5AIXA 2H8LA 4ZBDA 3P2AA 2XHFA 2WS2A 1AQWA 1Z5YE 2L6CA 5ECOB 3C73A 5G2ZA 3H79A 2FA8A 4H86A 2QKEA 1H4OA 3LFLA 4EXJA 4MPFA 4D73A 2QA2A 4MH3A 1EWXA 5KEJA 3TJFA 2JSZA 1ERWA 1EV4A 3KH7A 3D5JA 2OE1A 2OA7A 4KB3A 4FIWA 1HQOA 4K7NA 2HRAA 1GH2A 1RQMA 5GAND 4FH8A 2L6DA 3GRXA 3GSTA 3L9UA 2C3QA 3EU3A 1PKZA 5IOXA 4L5LA 2IMEA 5IO0A 2CAQA 3UARA 1XCCA 3FZ5A 1TI1A 1R5PA 1LJRA 2C0GA 1PSQA 4MF5A 1VF3A 2DMMA 4HOJA 3MNGA 1XOAA 4HU7A 2RIIA 4PURA 4K5RA 1WIKA 4OMVA 1YEPA 1U3IA 2VCWA 3SBCA 4I5QA 1TU7A 3TKSC 4GCIA 2IFQA 2DJ0A 1ST9A 1I9DA 4RUVA 1Y25A 3CTGA 2IMFA 1M2BA 2VM1A 5J9BA 2P31A 5IPHA 3F3RA 5A5KA 1ZYQB 5DJMA 4L8EA 1XVQA 2R2JA 1DE1A 4GSTA 2ZUPA 3VLNA 5CRDA 4BVXB 2HT9A 3NOFA 1PL1A 3CSHA 5ELGA 2HSMA 4MDCA 3MWHA 5EPFA 5KN1A 4HJ2A 4Z2TA 1M9BA 2PGTA 2A2RA 4K8MA 1A8LA 3LJRA 3GN3A 3E0UA 4I6XA 6GSYA 1K0AA 3HKRA 5CRWA 1GUKA 5B6MA 3KXOA 5LNKe 4PX1A 1YF0A 2K18A 4Z2UA 1JZRA 1FO5A 2H30A 1OKDA 2B5XA 3IC4A 18GSA 2KLXA 2OE3A 3RBTA 2VD1A 3KTBA 4ULXA 5G30A 1ZMAA 4XHMA 1QQ2A 1YQ1A 3ZMKA 2DIYA 2O85A 4DSSA 5E59A 1V98A 2V41A 5KOXA 2IL3A 4GRFA 4N0ZA 3QFAC 1K0MA 3RPPA 3A2WA 1URMA 1X0RA 1T8EB 4BL7A 3UJ1A 3E3EA 2DJ2A 2LKUA 3O3TA 4OO5A 5IMFA 3IOSA 2YV9A 5IMDA 2EIQA 5J5NA 4GF0A 3I6AA 4EUYA 3FYGA 4BA7A 5J41A 1T1VA 1FW1A 1Z6NA 4KUNA 4JZQA 2LS5A 2I3YA 17GSA 5C00A 2F9SA 3IPZA 3R3EA 2LJKA 4OD7A 2DMLA 4GTUA 1YDKA 3PH9A 3FY7A 4K1FA 4PQIA 5HR0A 3ERWA 3K8NA 4XS4A 3L9SA 4BWSA 4IELA 3PPUA 2MBTA 1TKDB 4JRRA 3Q6OA 3M9JA 2QC7A 2QGVA 3IK9A 3ZYWA 1F9MA 2IMKA 11GSA 2B5YA 3UVTA 2HLSA 2HRFA 3DKSA 3LSZA 1BJXA 3TJGA 3D4TA 4L5OA 2TIRA 5ECHB 3IE3A 1JLWA 1XWCA 3H1NA 1U87A 1ZOFA 4K6XA 1SU9A 5F8BA 5ID2A 3GIXA 5IO2A 1O6JA 5BMUA 4EC0A 4XRAA 4G2EA 1CQHA 1TRVA 2YZHA 3WYWA 3Q74A 4PNFA 1XIYA 4DEJA 2BTOT 5B8AA 5HFGA 3IV4A 2V6OA 3EE2A 4OWYA 4ECCA 4TN8A 1GSYA 5IMCA 3QAWA 2C80A 2K8SA 1PX7A 3U5RE 2HXKA 1AC1A 1LU4A 4WR5A 4DSRA 5HQPA 3VWVA 4ECIA 2LSTA 1SYRA 3EMPA 1O7UA 1G6YA 1S3AA 1O73A 1Z7PA 5FWGA 2OBIA 4NV5A 2EIRA 2JZRA 3QCPA 2C0FA 1A2LA 4F03A 2A2SA 3FMWA 2EIOA 4KCEA 2GTUA 3IC8A 3HA9A 2ALBA 4KE3A 2WDUA 3GUSA 5H5RA 2LRCA 1GSEA 2X99A 2H76A 2R37A 3GNJA 2NPBA 2VOCA 3RPNA 2NTOA 2H0HA 3O6TA 1S3DA 4BVYB 4XRDA 3RHCA 1H75A 5DVBA 3BOAA 3QOUA 3RAZA 5L71A 3GKKA 3BBYA 1M99A 5E4WA 2E7PA 4KA0A 2ON5A 2HSHA 4NHZA 5JWOB 1DUGA 3E9JB 2H70A 1F37A 1T00A 1GRXA 6GSWA 1PX6A 2DJ1A 3LORA 2CA8A 3GTUB 10GSA 5KN0A 1AQVA 3VI7A 2VL2C 4KF9A 3TKRA 4TXOB 1XVWA 5EY6A 2FWEA 3KEBA 3RDWA 3KMNA 3FR6A 4QL9A 1MDKA 5B6NA 2L4QA 2N5FA 4IS0A 1QMVA 1ZYEA 1OE8A 3ISOA 3C71A 3DYRA 3PGTA 1SJZA 2GSTA 2BJXA 3FKFA 5INYA 3QPMA 1GTUA 4Z2RA 4MJEA 4YQMA 3H93A 3KTLA 1NHOA 3N9JA 1HNCA 3M9KA 4MZCA 4EF0A 4WBJA 4HQSA 1VGLA 1SL1B 4KNDA 4AJ6A 1V2AA 6GSUA 2H75A 1IYHA 1U6TA 5JCGA 3GKMA 2ES7A 2GQMA 1G7EA 4ECBA 1B9YC 2H1DA 2VCQA 2X64A 3HJPA 2H1AA 2HYXA 3HJMA 2C0DA 3ERFA 3GURA 5F06A 1GL8A 2B7KA 4EIPA 2A4VA 4CHSA 1EOHA 2P5QA 3F4SA 5ENUA 2VUPA 4PGTA 2PVOC 2YWNA 4KSOA 1KTEA 2H74A 2IPAA 2LNSA 4CDOA 1G0TA 4IN0A 3DRNA 2OADA 2FA4A 1B4PA 2DLXA 2IMDA 1QUWA 1M7TA 2YV7A 3VWXA 3HXSA 3I9V2 1CQGA 5G31A 3DIEA 2GGTA 5CNWA 1OAZA 5CAXA 2GLRA 3I69A 2H73A 2PBJA 1BYEA 5ECRB 2FWGA 5IIZA 4ZL9A 3ZREA 1OC8A 1TK5B 3VWWA 4BPYA 1O8WA 3F0IA 2LRNA 1THOA 1XWBA 2GZYA 3TCOA 2GVPA 4IGJA 1B4QA 1FHEA 4TR3A 2JADA 4KAEA 4Q5RA 1TU8A 1R5AA 2X8CA 4HZ4A 1DSBA 2YPMA 3M0FA 2F51A 4KW6A 3GMFA 3W8SA 1TI3A 1ON4A 1F3AA 1SD8A 3GX8A 5D9VA 2NVLA 2B6MA 2MMNA 4D73B 4NV2A 3ZFBA 4K2DA 9GSSA 1U88A 2CVDA 1GP1A 2N5BA 2WRTA 4IJIA 4AJ8A 1YF1A 1E2YA 1A2JA 3EINA 2J9HA 5C04A 3WGXA 3IR4A 2BMXA 1JZWA 3UIWA 2I4AA 4I2UA 3L9VA 1SJIA 2RM6A 4HQZA 1BG5A 5AIVA 2L5OA 3IBHA 5B7CA 4K9ZA 1C72A 2O87A 3EC3A 4MPGA 1OC9A 3HJOA 2HZEA 2HE3A 5ECMB 4E8HA 1WE0A 4EIQA 2YWOA 3VK9A 2AV4A 1GUMA 3TUEA 4WEYA 2LJAA 1AUCA 2YWIA 3UAPA 2LNTA 2I1UA 4IP1A 1ZYNA 2H66A 1M2DA 2HFDA 4ECJA 3HZ8A 2N5AA 1K0NA 5AGYA 3UL3A 3FK8A 4IJ3A 3UBLA 2B3SA 2GSRA 3I43A 3D22A 1FAAA 3ZVJD 2OE0A 3GH6A 4MLYA 1YZXA 1EEJA 5CRHA 5GZZB 4LL4B 1G6WA 4G0IA 2OJLA 1GSSA 1R26A 2B1KA 2VD0A 2FWHA 3C1SA 2L59A 1EOGA 5J3RA 1TXXA 1THXA 2MBSA 3O76A 1SKWB 2AUVA 3NIVA 2RUEA 2WB9A 4IBPA 2IFQB 2H01A 2L57A 2IN3A 3IDVA 4TOPA 2O7KA 4GQCA 2NDOA 3DMLA 1FOVA 2L4CA 3HCZA 4J2FA 3UMAA 3VI5A 3CRTA 5ECPB 2PPTA 3TGZA 1SK1A 5LCZA 2I9HA 2R3XA 3FR9A 4ILFA 3LXZA 4XTSA 2R0CA 3LYPA 3MDKA 5KN3A 4POBA 2V1MA 4PUFC 3HDCA 2CX3A 4N0VA 2C3NA 4TR1A 4FYUA 4PQ1A 1MD3A 14GSA 2HRKA 2OKAA 3UVHA 3HY2A 1XWKA 4O92A 2IWTA 4O32A 1M9AA 1VF4A 3Q18A 1EZKA 1TRSA 2DKIA 4DVCA 3ZVJA 3TJKA 3ZITA 2GQKA 4JEDA 4BWQA 2CV4A 1ML6A 1SK0A 1OVNA 2WGRA 4IP6A 1HNBA 5A4WA 1EGRA 5D93A 1BAYA 2DJKA 1GSDA 3ZTLA 2LQOA 3L0HA 4Z7XA 2H1GA 5D73A 1TP9A 5DDLA 2LTKA 4OO4A 3S9FA 4I97A 2KOKA 1K3OA 1K0BA 1TRUA 5D96A 5GAPD 4NHWA 2XPEA 4XS6A 2ZCTA 4DSSB 2UZ8A 4ZILA 1MD4A 2DSAA 4K2XA 3LEFA 4G10A 2M80A 5J9CA 4WF4A 5JCUA 4WR4A 4YAVA 4BL7B 1HD2A 3HHVA 4ISDA 4ZB6A 1GLQA 1ERUA 4YAPA 1T4ZA 3DXBA 3ZLPA 1SKRB 2RLIA 2GQLA 1YKCA 3LW9A 5DBQA 5HFIA 4K5SA 4MNNA 5COHA 5G1LA 3TOUA 3ZMLA 2X8GA 4PXOA 3IA1A 2H0IA 2YWMA 2CX4A 1FVJA 1GTAA 1KNGA 3QAGA 4MZBA 1QK8A 4ID0A 2YANA 4NAXA 5CO3A 3QR6A 4HUAA 5ECQB 5ABRA 5FHIA 4IQAA 8GSSA 3DVXA 2GZPA 1WPIA 4XCSA 3KCMA 3VPTA 2J23A 2M72A 1WJKA 4LLRA 1S3CA 4OFMA 3J7Yb 2WZ9A 4MF7A 1J9BA 3IAS2 3LWAA 2L5LA 2FLSA 3HD5A 4ZXGA 4Q5FA 3DWVA 1I5GA 2AYTA 3LYKA 4Q5QA 3J7Yk 2H72A 1QGVA 1KEBA 3BCIA 5EL8A 2VCVA 5DAKB 1PD21 3TRXA 5ID2B 5H5SA 5DQYA 3F6DA 3TRQA 2LQQA 4JU5A 3D21A 4G0KA 1JHBA 3F4TA 19GSA 4MMMA 1NW2A 3JCML 5DCHA 4KDUA 4MJAA 2VCTA 3G7JA 7GSSA 1XW5A 2IJYA 2ON7A 1K3YA 4LL1B 3CRUA 3ZFLA 5IM9A 4GWRA 2KP1A 1T4YA 4EDYA 4TW5A 2VLUA 4N10A 3HVVA 2VM2A 1K0OA 1RW1A 5JWQB 4KGIA 4ML6A 2HI7A 3G9BA 1PKWA 3HVXA 1TK8B 3MIXA 4MZWA 4OCEA 1X9SB 1XFLA 2OACA 3ME7A 1N2AA 5JCWA 4FYCA 2CVKA 4EE0A 4J57E 1UVZA 1GLPA 2G2QA 1O8XA 3P8WA 3VURA 1R7HA 3C1RA 3N5OA 3TRPA 3QMXA 3D4MA 2VO4A 1IYIA 1AW9A 4ACSA 1M2AA 2CQ9A 1KBNA 4K0NA 4MK3A 5ECKB 4YQUA 3APOA 4TXVA 3GTUA 2O8VB 1PA3A 3QAVA 2I81A 5CREA 2YCDA 1QXHA 2MMAA 3CXGA 4KSMA 2AAWA 1B48A 4RQXA 1EP8A 2RM5A 5ECNB 3ED3A 1QFNA 2P0GA 1EGOA 3KP9A 5A4UA 3W8JA 2JU5A 3TB2A 1V40A 4GLTA 4O5QA 1OKTA 2DBCA 3VWUA 3A2XA 4TR0A 2MMZA 22GSA 5IMVA 4ICYA 1TW9A 2AJQB 3GL5A 3DGQA 4F0BA 1TDIA 3CMIA 3DEXA 2PERA 2R4VA 2DC5A 4G19A 3HZ4A 1UN2A 1K0DA 1AQXA 4I2TA 3LXTA 1Z9HA 1BEDA 3CSJA 2V32A 1BX9A 2GDRA 4HZ2A 1ERTA 2V2GA 1A2MA 2XPDA 2HSYA 5A4VA 3LQ7A 3D6IA 4AGSA 3M3MA 3LGCA 1YJ6A 3Q19A 5D9WA 2PVQA 3R2QA 2WCIA 4MA9A 3SWLA 3QDNA 3V1WA 4HDEA 2PN8A 3US3A 4NWYA 1DBYA 2QSIA 2XBQA 3VFIA 4V2NA 1GSQA 3FEUA 1A0FA 3A3TA 3IXRA 3KJYA 1SD9A 3U6VA 2H6ZA 5D8IA 3H8QA 4KDYA 1GTIA 1ZL9A 3G7YA 5DALB 4XS1A 2F8AA 3GFKA 4IKHA 2M46A 3P90A 3GKXA 1OE7A 5F07A 3ZRDA 2C3TA 3EU4A 1YY7A 4F0CA 2XC2A 3TJJA 3GV1A 4EDZA 3MAKA 2MZCA 5G5EA 1WWJA 4POMA 4KDXA 4EL1A 3KGKA 3BJ5A 1OYJA 5ECLB 3ZIJA 13GSA 1GSUA 3GHAA 1Z3EA 3M8NA 4CY6A 1B9XC 3FW2A 2DKHA 1Y6EA 1V9WA 1SL0B 5GSSA 3CSIA 1GNEA 4E8EA 2GZZA 4YH2A 3FR3A 2LUSA 2H19A 4NXIA 3QFBC 4MABA 1ZCPA 1SJ6A 3AY8A 1A8YA 1FG4A 1PN9A 1WMJA 4ZIJA 5DQSA 2R0PA 1AIUA 3TJBA 1E6BA 4N30A 1W4VA 2HZFA 2QA1A 1F3BA 2CAIA 4IW9A 4ZL7A 2GSQA 3GX0A 4MCUA 4NMUA 4N11A 4K0GA 1GTBA 4V2MA 2FCHA 3KZQA 5F0GA 3PR8A 3CBUA 6GSXA 4OCFA 2E0QA 4PUAA 2WULA 2VAFA 3G7IA 3LG6A 1UA5A 2R5GA 4HEA2 1NHYA 2IMIA 4P3YB 1TJDA 3GA4A 4ZB9A 3QD9A 4X43A 4HU9A 5J4UA 5EVOA 4ZL8A 3CTFA 1GSFA 1A23A 1O85A 3F4RA 2R0GA 1T3BA 1PQNA 4LMWA 3ZZXA 1XWGA 3HYPA 1XXUA 1F6MC 5HFKA 4HS1A 1J0FA 1O81A 1UC7A 3RHBA 1MDIA 1A0RP 2LV3A 2TRXA 4GSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F3Q A;  3FRC A;  3DVW A;  3IK7 A;  3F63 A;  2CT6 A;  1ERV A;  3EMX A;  4IQ1 A;  3NZN A;  1Q4J A;  2ZNM A;  4JBB A;  2GS3 A;  2H71 A;  3IRA A;  1M0U A;  5AN1 A;  2JAC A;  4L0U A;  2B5E A;  2HRN A;  3FZA A;  1Z7R A;  3KM6 A;  3KIJ A;  2JZS A;  4BVX A;  6GST A;  4OFT A;  1MDJ A;  1ABA A;  2VLT A;  2YN1 A;  5HR3 A;  1EV9 A;  1OC9 B;  3EWL A;  4KCA A;  3TKS E;  5FT3 A;  2HZE B;  4RI7 A;  2K6V A;  5JWR B;  3TKS A;  4WKW A;  5G1K A;  1JLV A;  3ZL5 A;  2H6X A;  1HNA A;  1NSW A;  2FY6 A;  1RK4 A;  6GSS A;  3H4K A;  2VL9 A;  5H5Q A;  5CP1 A;  3IHQ A;  1PL2 A;  4IHU A;  4V1A g;  3BD2 A;  2FHE A;  2LJR A;  2MMO A;  2JZT A;  5ELA A;  1WRY A;  3W6G A;  2Z9S A;  1SL2 B;  3WT2 A;  3GSS A;  2WJU A;  1X5E A;  2F3M A;  1GUL A;  4I8B A;  1V57 A;  2YJ7 A;  2REM A;  1X5C A;  2CZ3 A;  16GS A;  1X9M B;  4F9Z A;  1NM3 A;  4JR6 A;  4EO3 A;  3CYN A;  2H0G A;  1LBK A;  3TOT A;  1XZO A;  2PUK C;  5D9T A;  2JSY A;  5IMA A;  2H1B A;  3WT1 A;  2IIY A;  4WF5 A;  4DSQ A;  4TR1 B;  5IPG A;  1WP0 A;  4MP4 A;  20GS A;  2PU9 C;  4HJM A;  3VPQ A;  3DD3 A;  3ME8 A;  4MJC A;  2VCZ A;  4ZB8 A;  1XW6 A;  2FWF A;  4GXZ A;  1PRX A;  1VF1 A;  1WOU A;  1X5D A;  1TK0 B;  3FZ4 A;  1TTZ A;  4EKZ A;  4WBR D;  5LD0 A;  1Z6M A;  5D9X A;  3APS A;  1TRW A;  3GH9 A;  1JZD A;  1ZZY A;  1ZGN A;  1ILO A;  2H6Y A;  4LA1 A;  1FVK A;  3FZ9 A;  5KN2 A;  1SYX A;  4POL A;  4RQR A;  6GSV A;  3C7M A;  1V58 A;  2D2Z A;  4QL7 A;  2EC4 A;  2OBK A;  5AIS A;  3EUR A;  3HVS A;  2VCX A;  2PMT A;  2C8U A;  3KH9 A;  3C8E A;  2C0E A;  2GT6 A;  2NBS A;  3TKP A;  1VRS D;  1JZO A;  2YJH A;  5CRG A;  3BCK A;  4FO5 A;  2FGX A;  2DJJ A;  4XS4 B;  2VIM A;  3F8U A;  1TOF A;  5IQY A;  2P5R A;  4V2L A;  1JFU A;  3UBK A;  3D0Z A;  1XBS A;  5DAK A;  3KP8 A;  2KHP A;  2K8V A;  1F2E A;  1SEN A;  1K0C A;  1PMT A;  3P7X A;  3IAM 2;  3PIN A;  2TRC P;  5DJL A;  2K9F A;  2FD3 A;  5IOW A;  4EVM A;  2C1Y A;  1X9W B;  4MJB A;  4GQF A;  4TRX A;  4X1U A;  4WXT A;  2FNO A;  2KUC A;  4O7H A;  3ZIV A;  1T7P B;  3L4N A;  4KX4 A;  4O5R A;  3TDG A;  4AF2 A;  3TKQ A;  3GL3 A;  2V6K A;  4F2I A;  2E2M A;  1XW9 A;  1N8J A;  1YEX A;  4ZBA A;  1SK2 A;  4BVY A;  1FB6 A;  1XPV A;  2YNX A;  1A24 A;  1J08 A;  5HR2 A;  5IMZ A;  1K3L A;  2CVB A;  4TR4 A;  4L0W A;  3UOM A;  4G9H A;  2AB6 A;  2LEG A;  2G0F A;  4CW9 A;  1B8X A;  4IVF A;  1AAZ A;  3FHK A;  3MSZ A;  4V1A p;  3M1G A;  4K7O A;  3F6F A;  2B7J A;  3GYK A;  1YKA A;  4QQ7 A;  2E2G A;  2C4J A;  4K7I A;  1AXD A;  1W89 A;  4WET A;  1FB0 A;  3WD6 A;  4TKY A;  4TXO A;  1Q98 A;  2AHE A;  3A5W A;  1BQ7 A;  1U3A A;  5F05 A;  2DIZ A;  4PNG A;  2B1L A;  5G5F A;  12GS A;  2LRT A;  2RUF A;  1DE2 A;  2YOI A;  4POK A;  4OFN A;  4GSN A;  1XOB A;  3ERG A;  4JE1 A;  4Q5N A;  4F82 A;  4TVE A;  3WGD A;  4X0X A;  4KH7 A;  2O89 A;  4ML1 A;  3F9U A;  4RI6 A;  1XWA A;  5B8B A;  2R6K A;  2VL2 A;  4ZBB A;  2PWJ A;  3KD0 A;  3OR5 A;  3UEM A;  5HR1 A;  4AJ7 A;  1SKS B;  1HYU A;  2F8F A;  2HNL A;  2DJ3 A;  4XIH A;  3EYT A;  2VLV A;  5DCG A;  2GT5 A;  3APQ A;  5DAL A;  3A2V A;  2JL4 A;  4NPB A;  2CZ2 A;  1MTC A;  2FUG 2;  1ACV A;  3KMO A;  1GWC A;  4PQH A;  4HI7 A;  5ECI B;  2MYG A;  4LMV A;  2X8H A;  1GNW A;  2KP2 A;  1MEK A;  2YZU A;  1OC3 A;  1PGT A;  3EVI A;  1R4W A;  4J56 E;  3L78 A;  1EP7 A;  1G7O A;  1USB A;  3GKN A;  4YQV A;  4MF6 A;  5GST A;  2GSS A;  2VL3 A;  2WFC A;  4FYB A;  2XBI A;  3WGE A;  5ECS A;  2YP6 A;  1VF2 A;  4MH2 A;  5CYY A;  4JR4 A;  1GUH A;  1EEM A;  5AIX A;  2H8L A;  4ZBD A;  3P2A A;  2XHF A;  2WS2 A;  1AQW A;  1Z5Y E;  2L6C A;  5ECO B;  3C73 A;  5G2Z A;  3H79 A;  2FA8 A;  4H86 A;  2QKE A;  1H4O A;  3LFL A;  4EXJ A;  4MPF A;  4D73 A;  4MH3 A;  1EWX A;  5KEJ A;  3TJF A;  2JSZ A;  1ERW A;  1EV4 A;  3KH7 A;  3D5J A;  2OE1 A;  2OA7 A;  4KB3 A;  4FIW A;  1HQO A;  4K7N A;  1GH2 A;  1RQM A;  5GAN D;  4FH8 A;  2L6D A;  3GRX A;  3GST A;  3L9U A;  2C3Q A;  3EU3 A;  1PKZ A;  5IOX A;  4L5L A;  2IME A;  5IO0 A;  2CAQ A;  3UAR A;  1XCC A;  3FZ5 A;  1TI1 A;  1R5P A;  1LJR A;  2C0G A;  1PSQ A;  4MF5 A;  1VF3 A;  2DMM A;  4HOJ A;  3MNG A;  1XOA A;  4HU7 A;  2RII A;  4PUR A;  1WIK A;  4OMV A;  1YEP A;  1U3I A;  2VCW A;  3SBC A;  4I5Q A;  1TU7 A;  3TKS C;  4GCI A;  2IFQ A;  2DJ0 A;  1ST9 A;  1I9D A;  4RUV A;  1Y25 A;  3CTG A;  2IMF A;  1M2B A;  2VM1 A;  5J9B A;  2P31 A;  5IPH A;  3F3R A;  5A5K A;  1ZYQ B;  5DJM A;  4L8E A;  1XVQ A;  2R2J A;  1DE1 A;  4GST A;  2ZUP A;  3VLN A;  5CRD A;  2HT9 A;  3NOF A;  1PL1 A;  3CSH A;  5ELG A;  4MDC A;  3MWH A;  5EPF A;  5KN1 A;  4HJ2 A;  1M9B A;  2PGT A;  2A2R A;  4K8M A;  1A8L A;  3LJR A;  3GN3 A;  3E0U A;  4I6X A;  6GSY A;  1K0A A;  3HKR A;  5CRW A;  1GUK A;  5B6M A;  3KXO A;  5LNK e;  4PX1 A;  1YF0 A;  2K18 A;  1JZR A;  1FO5 A;  2H30 A;  1OKD A;  2B5X A;  3IC4 A;  18GS A;  2KLX A;  2OE3 A;  3RBT A;  2VD1 A;  3KTB A;  4ULX A;  5G30 A;  1ZMA A;  4XHM A;  1QQ2 A;  1YQ1 A;  3ZMK A;  2DIY A;  2O85 A;  4DSS A;  5E59 A;  1V98 A;  2V41 A;  2IL3 A;  4GRF A;  4N0Z A;  3QFA C;  1K0M A;  3RPP A;  3A2W A;  1URM A;  1X0R A;  1T8E B;  4BL7 A;  3UJ1 A;  3E3E A;  2DJ2 A;  2LKU A;  3O3T A;  4OO5 A;  5IMF A;  3IOS A;  2YV9 A;  5IMD A;  2EIQ A;  5J5N A;  4GF0 A;  3I6A A;  4EUY A;  3FYG A;  4BA7 A;  5J41 A;  1T1V A;  1FW1 A;  1Z6N A;  4KUN A;  4JZQ A;  2LS5 A;  2I3Y A;  17GS A;  5C00 A;  2F9S A;  3IPZ A;  2LJK A;  4OD7 A;  2DML A;  4GTU A;  1YDK A;  3PH9 A;  3FY7 A;  4K1F A;  4PQI A;  5HR0 A;  3ERW A;  3K8N A;  4XS4 A;  3L9S A;  4BWS A;  4IEL A;  2MBT A;  1TKD B;  4JRR A;  3Q6O A;  3M9J A;  2QC7 A;  2QGV A;  3IK9 A;  3ZYW A;  1F9M A;  2IMK A;  11GS A;  2B5Y A;  3UVT A;  2HLS A;  2HRF A;  3DKS A;  3LSZ A;  1BJX A;  3TJG A;  3D4T A;  4L5O A;  2TIR A;  5ECH B;  3IE3 A;  1JLW A;  1XWC A;  3H1N A;  1U87 A;  1ZOF A;  4K6X A;  1SU9 A;  5F8B A;  5ID2 A;  3GIX A;  5IO2 A;  1O6J A;  4EC0 A;  4XRA A;  4G2E A;  1CQH A;  1TRV A;  2YZH A;  3WYW A;  3Q74 A;  4PNF A;  1XIY A;  4DEJ A;  2BTO T;  5B8A A;  5HFG A;  3IV4 A;  2V6O A;  3EE2 A;  4OWY A;  4ECC A;  4TN8 A;  1GSY A;  5IMC A;  3QAW A;  2C80 A;  2K8S A;  1PX7 A;  3U5R E;  2HXK A;  1AC1 A;  1LU4 A;  4WR5 A;  4DSR A;  5HQP A;  3VWV A;  4ECI A;  2LST A;  1SYR A;  3EMP A;  1O7U A;  1G6Y A;  1S3A A;  1O73 A;  1Z7P A;  5FWG A;  2OBI A;  4NV5 A;  2EIR A;  2JZR A;  3QCP A;  2C0F A;  1A2L A;  4F03 A;  2A2S A;  2EIO A;  4KCE A;  2GTU A;  3HA9 A;  2ALB A;  4KE3 A;  2WDU A;  3GUS A;  5H5R A;  2LRC A;  1GSE A;  2X99 A;  2H76 A;  2R37 A;  3GNJ A;  2NPB A;  2VOC A;  3RPN A;  2NTO A;  2H0H A;  3O6T A;  1S3D A;  4XRD A;  3RHC A;  1H75 A;  5DVB A;  3BOA A;  3QOU A;  3RAZ A;  5L71 A;  3GKK A;  3BBY A;  1M99 A;  5E4W A;  2E7P A;  4KA0 A;  2ON5 A;  2HSH A;  4NHZ A;  5JWO B;  1DUG A;  3E9J B;  2H70 A;  1F37 A;  1T00 A;  1GRX A;  6GSW A;  1PX6 A;  2DJ1 A;  3LOR A;  2CA8 A;  3GTU B;  10GS A;  5KN0 A;  1AQV A;  3VI7 A;  2VL2 C;  3TKR A;  4TXO B;  1XVW A;  5EY6 A;  2FWE A;  3KEB A;  3RDW A;  3KMN A;  3FR6 A;  4QL9 A;  1MDK A;  5B6N A;  2L4Q A;  2N5F A;  4IS0 A;  1QMV A;  1ZYE A;  1OE8 A;  3ISO A;  3C71 A;  3DYR A;  3PGT A;  1SJZ A;  2GST A;  2BJX A;  3FKF A;  5INY A;  3QPM A;  1GTU A;  4MJE A;  4YQM A;  3H93 A;  3KTL A;  1NHO A;  3N9J A;  1HNC A;  3M9K A;  4MZC A;  4EF0 A;  4WBJ A;  4HQS A;  1VGL A;  1SL1 B;  4KND A;  4AJ6 A;  1V2A A;  6GSU A;  2H75 A;  1IYH A;  1U6T A;  5JCG A;  3GKM A;  2ES7 A;  2GQM A;  1G7E A;  4ECB A;  1B9Y C;  2H1D A;  2VCQ A;  2X64 A;  3HJP A;  2H1A A;  2HYX A;  3HJM A;  2C0D A;  3ERF A;  3GUR A;  5F06 A;  1GL8 A;  2B7K A;  2A4V A;  4CHS A;  1EOH A;  2P5Q A;  3F4S A;  5ENU A;  2VUP A;  4PGT A;  2PVO C;  2YWN A;  4KSO A;  1KTE A;  2H74 A;  2IPA A;  2LNS A;  4CDO A;  1G0T A;  4IN0 A;  3DRN A;  2OAD A;  2FA4 A;  1B4P A;  2DLX A;  2IMD A;  1QUW A;  1M7T A;  2YV7 A;  3VWX A;  3HXS A;  3I9V 2;  1CQG A;  5G31 A;  3DIE A;  2GGT A;  5CNW A;  1OAZ A;  5CAX A;  2GLR A;  3I69 A;  2H73 A;  2PBJ A;  1BYE A;  5ECR B;  2FWG A;  5IIZ A;  4ZL9 A;  3ZRE A;  1OC8 A;  1TK5 B;  3VWW A;  4BPY A;  1O8W A;  3F0I A;  2LRN A;  1THO A;  1XWB A;  2GZY A;  3TCO A;  2GVP A;  4IGJ A;  1B4Q A;  1FHE A;  4TR3 A;  2JAD A;  4KAE A;  4Q5R A;  1TU8 A;  1R5A A;  2X8C A;  4HZ4 A;  1DSB A;  2YPM A;  3M0F A;  2F51 A;  4KW6 A;  3GMF A;  3W8S A;  1TI3 A;  1ON4 A;  1F3A A;  1SD8 A;  3GX8 A;  5D9V A;  2NVL A;  2B6M A;  2MMN A;  4D73 B;  4NV2 A;  3ZFB A;  4K2D A;  9GSS A;  1U88 A;  2CVD A;  1GP1 A;  2N5B A;  2WRT A;  4IJI A;  4AJ8 A;  1YF1 A;  1E2Y A;  1A2J A;  3EIN A;  2J9H A;  5C04 A;  3WGX A;  3IR4 A;  2BMX A;  1JZW A;  3UIW A;  2I4A A;  4I2U A;  3L9V A;  1SJI A;  2RM6 A;  4HQZ A;  1BG5 A;  5AIV A;  2L5O A;  3IBH A;  5B7C A;  4K9Z A;  1C72 A;  2O87 A;  3EC3 A;  4MPG A;  1OC9 A;  3HJO A;  2HZE A;  2HE3 A;  5ECM B;  4E8H A;  1WE0 A;  2YWO A;  3VK9 A;  2AV4 A;  1GUM A;  3TUE A;  4WEY A;  2LJA A;  1AUC A;  2YWI A;  3UAP A;  2LNT A;  2I1U A;  4IP1 A;  2H66 A;  1M2D A;  2HFD A;  4ECJ A;  3HZ8 A;  2N5A A;  1K0N A;  5AGY A;  3UL3 A;  3FK8 A;  4IJ3 A;  3UBL A;  2B3S A;  2GSR A;  3I43 A;  3D22 A;  1FAA A;  3ZVJ D;  2OE0 A;  3GH6 A;  4MLY A;  1YZX A;  1EEJ A;  5CRH A;  5GZZ B;  4LL4 B;  1G6W A;  2OJL A;  1GSS A;  1R26 A;  2B1K A;  2VD0 A;  2FWH A;  3C1S A;  2L59 A;  1EOG A;  5J3R A;  1TXX A;  1THX A;  2MBS A;  3O76 A;  1SKW B;  2AUV A;  3NIV A;  2RUE A;  2WB9 A;  4IBP A;  2IFQ B;  2H01 A;  2L57 A;  2IN3 A;  3IDV A;  4TOP A;  2O7K A;  4GQC A;  2NDO A;  3DML A;  1FOV A;  2L4C A;  3HCZ A;  4J2F A;  3UMA A;  3VI5 A;  3CRT A;  5ECP B;  2PPT A;  3TGZ A;  1SK1 A;  5LCZ A;  2I9H A;  2R3X A;  3FR9 A;  4ILF A;  3LXZ A;  4XTS A;  3MDK A;  3LYP A;  5KN3 A;  4POB A;  2V1M A;  4PUF C;  3HDC A;  2CX3 A;  4N0V A;  2C3N A;  4TR1 A;  4FYU A;  4PQ1 A;  1MD3 A;  14GS A;  2OKA A;  3UVH A;  3HY2 A;  1XWK A;  4O92 A;  2IWT A;  4O32 A;  1M9A A;  1VF4 A;  1EZK A;  1TRS A;  3Q18 A;  4DVC A;  3ZVJ A;  3TJK A;  3ZIT A;  2GQK A;  4JED A;  4BWQ A;  2CV4 A;  1ML6 A;  1SK0 A;  1OVN A;  2WGR A;  4IP6 A;  1HNB A;  5A4W A;  1EGR A;  5D93 A;  1BAY A;  2DJK A;  1GSD A;  3ZTL A;  2LQO A;  3L0H A;  4Z7X A;  2H1G A;  5D73 A;  1TP9 A;  5DDL A;  2LTK A;  4OO4 A;  3S9F A;  4I97 A;  2KOK A;  1K3O A;  1K0B A;  1TRU A;  5D96 A;  5GAP D;  4NHW A;  2XPE A;  4XS6 A;  2ZCT A;  4DSS B;  4ZIL A;  1MD4 A;  2DSA A;  3LEF A;  4G10 A;  2M80 A;  5J9C A;  4WF4 A;  5JCU A;  4WR4 A;  4YAV A;  1HD2 A;  3HHV A;  4ISD A;  4ZB6 A;  1GLQ A;  1ERU A;  4YAP A;  1T4Z A;  3DXB A;  3ZLP A;  1SKR B;  2RLI A;  2GQL A;  1YKC A;  5DBQ A;  5HFI A;  5COH A;  5G1L A;  3TOU A;  3ZML A;  2X8G A;  4PXO A;  3IA1 A;  2H0I A;  2YWM A;  2CX4 A;  1FVJ A;  1GTA A;  1KNG A;  3QAG A;  4MZB A;  1QK8 A;  4ID0 A;  2YAN A;  4NAX A;  5CO3 A;  3QR6 A;  4HUA A;  5ECQ B;  5ABR A;  5FHI A;  4IQA A;  8GSS A;  3DVX A;  2GZP A;  1WPI A;  4XCS A;  3KCM A;  3VPT A;  2J23 A;  2M72 A;  1WJK A;  4LLR A;  1S3C A;  4OFM A;  3J7Y b;  2WZ9 A;  4MF7 A;  1J9B A;  3IAS 2;  3LWA A;  2L5L A;  2FLS A;  3HD5 A;  4ZXG A;  4Q5F A;  3DWV A;  1I5G A;  2AYT A;  3LYK A;  4Q5Q A;  3J7Y k;  2H72 A;  1QGV A;  1KEB A;  3BCI A;  5EL8 A;  2VCV A;  5DAK B;  1PD2 1;  3TRX A;  5ID2 B;  5H5S A;  5DQY A;  3F6D A;  3TRQ A;  2LQQ A;  4JU5 A;  3D21 A;  1JHB A;  3F4T A;  19GS A;  4MMM A;  1NW2 A;  3JCM L;  5DCH A;  4KDU A;  4MJA A;  2VCT A;  3G7J A;  7GSS A;  1XW5 A;  2IJY A;  2ON7 A;  1K3Y A;  4LL1 B;  3CRU A;  3ZFL A;  5IM9 A;  4GWR A;  2KP1 A;  1T4Y A;  4EDY A;  4TW5 A;  2VLU A;  4N10 A;  3HVV A;  2VM2 A;  1K0O A;  1RW1 A;  5JWQ B;  4KGI A;  4ML6 A;  2HI7 A;  3G9B A;  1PKW A;  3HVX A;  1TK8 B;  4MZW A;  4OCE A;  1X9S B;  1XFL A;  2OAC A;  3ME7 A;  1N2A A;  5JCW A;  4FYC A;  2CVK A;  4EE0 A;  4J57 E;  1UVZ A;  1GLP A;  2G2Q A;  1O8X A;  3P8W A;  3VUR A;  1R7H A;  3C1R A;  3N5O A;  3TRP A;  3QMX A;  3D4M A;  2VO4 A;  1IYI A;  1AW9 A;  4ACS A;  1M2A A;  2CQ9 A;  1KBN A;  4K0N A;  4MK3 A;  5ECK B;  4YQU A;  3APO A;  4TXV A;  3GTU A;  2O8V B;  1PA3 A;  3QAV A;  2I81 A;  5CRE A;  2YCD A;  1QXH A;  2MMA A;  3CXG A;  4KSM A;  2AAW A;  1B48 A;  4RQX A;  1EP8 A;  2RM5 A;  5ECN B;  3ED3 A;  1QFN A;  2P0G A;  1EGO A;  3KP9 A;  5A4U A;  3W8J A;  2JU5 A;  3TB2 A;  1V40 A;  4GLT A;  1OKT A;  2DBC A;  3VWU A;  3A2X A;  4TR0 A;  2MMZ A;  22GS A;  5IMV A;  1TW9 A;  2AJQ B;  3GL5 A;  3DGQ A;  4F0B A;  1TDI A;  3CMI A;  3DEX A;  2PER A;  2R4V A;  2DC5 A;  4G19 A;  3HZ4 A;  1UN2 A;  1K0D A;  1AQX A;  4I2T A;  3LXT A;  1Z9H A;  1BED A;  3CSJ A;  2V32 A;  1BX9 A;  2GDR A;  4HZ2 A;  1ERT A;  2V2G A;  1A2M A;  2XPD A;  2HSY A;  5A4V A;  3LQ7 A;  3D6I A;  4AGS A;  3M3M A;  3LGC A;  1YJ6 A;  3Q19 A;  5D9W A;  2PVQ A;  3R2Q A;  2WCI A;  4MA9 A;  3SWL A;  3QDN A;  3V1W A;  4HDE A;  2PN8 A;  3US3 A;  4NWY A;  1DBY A;  2QSI A;  2XBQ A;  3VFI A;  4V2N A;  1GSQ A;  3FEU A;  1A0F A;  3A3T A;  3IXR A;  3KJY A;  1SD9 A;  3U6V A;  2H6Z A;  5D8I A;  3H8Q A;  4KDY A;  1GTI A;  1ZL9 A;  3G7Y A;  5DAL B;  4XS1 A;  2F8A A;  3GFK A;  4IKH A;  2M46 A;  3P90 A;  3GKX A;  1OE7 A;  5F07 A;  3ZRD A;  2C3T A;  3EU4 A;  1YY7 A;  4F0C A;  2XC2 A;  3TJJ A;  3GV1 A;  4EDZ A;  3MAK A;  2MZC A;  5G5E A;  1WWJ A;  4POM A;  4KDX A;  4EL1 A;  3KGK A;  3BJ5 A;  1OYJ A;  5ECL B;  3ZIJ A;  13GS A;  1GSU A;  3GHA A;  1Z3E A;  3M8N A;  1B9X C;  3FW2 A;  1Y6E A;  1V9W A;  1SL0 B;  5GSS A;  3CSI A;  1GNE A;  4E8E A;  2GZZ A;  4YH2 A;  3FR3 A;  2LUS A;  2H19 A;  4NXI A;  3QFB C;  4MAB A;  1ZCP A;  1SJ6 A;  3AY8 A;  1A8Y A;  1FG4 A;  1PN9 A;  1WMJ A;  4ZIJ A;  5DQS A;  1AIU A;  3TJB A;  1E6B A;  4N30 A;  1W4V A;  2HZF A;  1F3B A;  2CAI A;  4IW9 A;  4ZL7 A;  2GSQ A;  3GX0 A;  4MCU A;  4NMU A;  4N11 A;  4K0G A;  1GTB A;  4V2M A;  2FCH A;  3KZQ A;  5F0G A;  3PR8 A;  3CBU A;  6GSX A;  4OCF A;  2E0Q A;  4PUA A;  2WUL A;  2VAF A;  3G7I A;  3LG6 A;  1UA5 A;  2R5G A;  4HEA 2;  1NHY A;  2IMI A;  4P3Y B;  1TJD A;  3GA4 A;  4ZB9 A;  3QD9 A;  4X43 A;  4HU9 A;  5J4U A;  5EVO A;  4ZL8 A;  3CTF A;  1GSF A;  1A23 A;  1O85 A;  3F4R A;  1T3B A;  1PQN A;  4LMW A;  3ZZX A;  1XWG A;  3HYP A;  1XXU A;  1F6M C;  5HFK A;  4HS1 A;  1J0F A;  1O81 A;  1UC7 A;  3RHB A;  1MDI A;  1A0R P;  2LV3 A;  2TRX A;  4GSS A; 
#chains in the Genus database with same CATH topology
 3F3Q A;  3FRC A;  3DVW A;  3IK7 A;  3F63 A;  2CT6 A;  1ERV A;  3EMX A;  4IQ1 A;  3NZN A;  1Q4J A;  2ZNM A;  4JBB A;  2GS3 A;  2H71 A;  3IRA A;  4PTS A;  1M0U A;  5AN1 A;  2JAC A;  4L0U A;  2B5E A;  2HRN A;  3FZA A;  1Z7R A;  3KM6 A;  3KIJ A;  2JZS A;  4BVX A;  6GST A;  4OFT A;  1MDJ A;  1ABA A;  2VLT A;  2YN1 A;  5HR3 A;  1EV9 A;  1OC9 B;  3EWL A;  4KCA A;  3TKS E;  5FT3 A;  2HZE B;  4RI7 A;  2K6V A;  5JWR B;  3TKS A;  4WKW A;  5G1K A;  1JLV A;  3ZL5 A;  2H6X A;  1HNA A;  1NSW A;  2FY6 A;  1RK4 A;  6GSS A;  3H4K A;  2VL9 A;  5H5Q A;  5CP1 A;  3IHQ A;  1PL2 A;  4IHU A;  4V1A g;  3BD2 A;  2FHE A;  2LJR A;  2MMO A;  2JZT A;  5ELA A;  1WRY A;  3W6G A;  2Z9S A;  1SL2 B;  3WT2 A;  3GSS A;  2WJU A;  1X5E A;  2F3M A;  1GUL A;  4I8B A;  1V57 A;  2YJ7 A;  2REM A;  1ZYP A;  1X5C A;  2CZ3 A;  16GS A;  1X9M B;  4F9Z A;  1NM3 A;  4JR6 A;  4EO3 A;  3CYN A;  2H0G A;  1LBK A;  4CY8 A;  3TOT A;  1XZO A;  2PUK C;  5D9T A;  4O5U A;  2JSY A;  5IMA A;  4YKF A;  2H1B A;  3WT1 A;  2IIY A;  4WF5 A;  4DSQ A;  4TR1 B;  5IPG A;  1WP0 A;  4MP4 A;  20GS A;  2PU9 C;  4HJM A;  3VPQ A;  3DD3 A;  3ME8 A;  4MJC A;  2VCZ A;  3MYD A;  4ZB8 A;  1XW6 A;  2FWF A;  4GXZ A;  1PRX A;  1VF1 A;  1WOU A;  1X5D A;  1TK0 B;  3FZ4 A;  1TTZ A;  4EKZ A;  3EPT A;  4WBR D;  1PN0 A;  5LD0 A;  1Z6M A;  5D9X A;  3APS A;  1TRW A;  3GH9 A;  1JZD A;  1ZZY A;  1ZGN A;  1ILO A;  2H6Y A;  4LA1 A;  1FVK A;  3FZ9 A;  5KN2 A;  1SYX A;  4POL A;  4RQR A;  6GSV A;  3C7M A;  1V58 A;  2D2Z A;  4QL7 A;  2EC4 A;  2OBK A;  5AIS A;  3EUR A;  3HVS A;  4USS A;  2VCX A;  2PMT A;  2C8U A;  3KH9 A;  3C8E A;  2C0E A;  2GT6 A;  2NBS A;  3TKP A;  1VRS D;  1JZO A;  2YJH A;  5CRG A;  3BCK A;  4FO5 A;  2FGX A;  2DJJ A;  4XS4 B;  2VIM A;  2A4H A;  3F8U A;  1TOF A;  5IQY A;  2P5R A;  4V2L A;  1JFU A;  3UBK A;  3D0Z A;  1XBS A;  2X4A A;  5DAK A;  3KP8 A;  2KHP A;  2K8V A;  1F2E A;  1SEN A;  1K0C A;  1PMT A;  3P7X A;  3IAM 2;  3PIN A;  2TRC P;  5DJL A;  2K9F A;  2FD3 A;  5IOW A;  4EVM A;  2C1Y A;  1X9W B;  2X49 A;  4MJB A;  4GQF A;  4TRX A;  4X1U A;  4WXT A;  2FNO A;  2KUC A;  2A2P A;  4O7H A;  3ZIV A;  1T7P B;  3L4N A;  4KX4 A;  4O5R A;  3TDG A;  4AF2 A;  3TKQ A;  3GL3 A;  2V6K A;  4F2I A;  2E2M A;  1XW9 A;  1N8J A;  1YEX A;  4ZBA A;  1SK2 A;  4BVY A;  1FB6 A;  5KOW A;  1XPV A;  4YKG A;  2YNX A;  1A24 A;  1J08 A;  5HR2 A;  5IMZ A;  1K3L A;  2CVB A;  4TR4 A;  4L0W A;  3UOM A;  4G9H A;  2AB6 A;  2LEG A;  2G0F A;  4CW9 A;  1B8X A;  4IVF A;  1AAZ A;  3FHK A;  3MSZ A;  4V1A p;  3M1G A;  4K7O A;  3F6F A;  1FOH A;  2B7J A;  3A5I A;  3GYK A;  1YKA A;  4QQ7 A;  2E2G A;  2C4J A;  4K7I A;  1AXD A;  1W89 A;  4WET A;  1FB0 A;  3WD6 A;  4TKY A;  4TXO A;  1Q98 A;  2AHE A;  3A5W A;  1BQ7 A;  1U3A A;  4G0L A;  5F05 A;  2DIZ A;  4PNG A;  2B1L A;  5G5F A;  12GS A;  2LRT A;  2RUF A;  1DE2 A;  2YOI A;  4POK A;  4OFN A;  4GSN A;  1XOB A;  3ERG A;  4JE1 A;  4Q5N A;  4F82 A;  4TVE A;  3WGD A;  4X0X A;  4KH7 A;  2O89 A;  4ML1 A;  3F9U A;  4RI6 A;  1XWA A;  5B8B A;  2R6K A;  2VL2 A;  4ZBB A;  4FQU A;  2PWJ A;  3KD0 A;  3OR5 A;  3UEM A;  5HR1 A;  4AJ7 A;  1SKS B;  1HYU A;  2F8F A;  2HNL A;  2DJ3 A;  4XIH A;  3EYT A;  2VLV A;  5DCG A;  2GT5 A;  3APQ A;  5DAL A;  4A5P A;  3A2V A;  2JL4 A;  4NPB A;  2CZ2 A;  1MTC A;  2FUG 2;  1ACV A;  3KMO A;  1GWC A;  4PQH A;  4X4J A;  4HI7 A;  5ECI B;  2MYG A;  4LMV A;  2X8H A;  5BRT A;  1GNW A;  2KP2 A;  1MEK A;  2YZU A;  1OC3 A;  1PGT A;  3EVI A;  1R4W A;  4J56 E;  3L78 A;  1EP7 A;  1G7O A;  1USB A;  3GKN A;  4YQV A;  4MF6 A;  5GST A;  2GSS A;  2VL3 A;  2WFC A;  4FYB A;  2XBI A;  3WGE A;  5ECS A;  3IHG A;  2YP6 A;  1VF2 A;  4MH2 A;  5CYY A;  4JR4 A;  1GUH A;  1EEM A;  5AIX A;  2H8L A;  4ZBD A;  3P2A A;  2XHF A;  2WS2 A;  1AQW A;  1Z5Y E;  2L6C A;  5ECO B;  3C73 A;  5G2Z A;  3H79 A;  2FA8 A;  4H86 A;  2QKE A;  1H4O A;  3LFL A;  4EXJ A;  4MPF A;  4D73 A;  2QA2 A;  4MH3 A;  1EWX A;  5KEJ A;  3TJF A;  2JSZ A;  1ERW A;  1EV4 A;  3KH7 A;  3D5J A;  2OE1 A;  2OA7 A;  4KB3 A;  4FIW A;  1HQO A;  4K7N A;  2HRA A;  1GH2 A;  1RQM A;  5GAN D;  4FH8 A;  2L6D A;  3GRX A;  3GST A;  3L9U A;  2C3Q A;  3EU3 A;  1PKZ A;  5IOX A;  4L5L A;  2IME A;  5IO0 A;  2CAQ A;  3UAR A;  1XCC A;  3FZ5 A;  1TI1 A;  1R5P A;  1LJR A;  2C0G A;  1PSQ A;  4MF5 A;  1VF3 A;  2DMM A;  4HOJ A;  3MNG A;  1XOA A;  4HU7 A;  2RII A;  4PUR A;  4K5R A;  1WIK A;  4OMV A;  1YEP A;  1U3I A;  2VCW A;  3SBC A;  4I5Q A;  1TU7 A;  1M3I A;  3TKS C;  4GCI A;  2IFQ A;  2DJ0 A;  1ST9 A;  1I9D A;  4RUV A;  1Y25 A;  3CTG A;  2IMF A;  1M2B A;  2VM1 A;  5J9B A;  2P31 A;  5IPH A;  3F3R A;  5A5K A;  1ZYQ B;  5DJM A;  4L8E A;  1XVQ A;  2R2J A;  1DE1 A;  4GST A;  2ZUP A;  3VLN A;  5CRD A;  4BVX B;  2HT9 A;  3NOF A;  1PL1 A;  3CSH A;  5ELG A;  2HSM A;  4MDC A;  3MWH A;  5EPF A;  5KN1 A;  4HJ2 A;  4Z2T A;  1M9B A;  2PGT A;  2A2R A;  4K8M A;  1A8L A;  3LJR A;  3GN3 A;  3E0U A;  4I6X A;  6GSY A;  1K0A A;  3HKR A;  5CRW A;  1GUK A;  5B6M A;  3KXO A;  5LNK e;  4PX1 A;  1YF0 A;  2K18 A;  4Z2U A;  1JZR A;  1FO5 A;  2H30 A;  1OKD A;  2B5X A;  3IC4 A;  18GS A;  2KLX A;  2OE3 A;  3RBT A;  2VD1 A;  3KTB A;  4ULX A;  5G30 A;  1ZMA A;  4XHM A;  1QQ2 A;  1YQ1 A;  3ZMK A;  2DIY A;  2O85 A;  4DSS A;  5E59 A;  1V98 A;  2V41 A;  5KOX A;  2IL3 A;  4GRF A;  4N0Z A;  3QFA C;  1K0M A;  3RPP A;  3A2W A;  1URM A;  1X0R A;  1T8E B;  4BL7 A;  3UJ1 A;  3E3E A;  2DJ2 A;  2LKU A;  3O3T A;  4OO5 A;  5IMF A;  3IOS A;  2YV9 A;  5IMD A;  2EIQ A;  5J5N A;  4GF0 A;  3I6A A;  4EUY A;  3FYG A;  4BA7 A;  5J41 A;  1T1V A;  1FW1 A;  1Z6N A;  4KUN A;  4JZQ A;  2LS5 A;  2I3Y A;  17GS A;  1S3R A;  5C00 A;  2F9S A;  3IPZ A;  3R3E A;  2LJK A;  4OD7 A;  2DML A;  4GTU A;  1YDK A;  3PH9 A;  3FY7 A;  4K1F A;  4PQI A;  5HR0 A;  3ERW A;  3K8N A;  4XS4 A;  3L9S A;  4BWS A;  4IEL A;  3PPU A;  2MBT A;  1TKD B;  4JRR A;  3Q6O A;  3M9J A;  2QC7 A;  2QGV A;  3IK9 A;  3ZYW A;  1F9M A;  2IMK A;  11GS A;  2B5Y A;  3UVT A;  2HLS A;  2HRF A;  3DKS A;  3LSZ A;  1BJX A;  3TJG A;  3D4T A;  4L5O A;  2TIR A;  5ECH B;  3IE3 A;  1JLW A;  1XWC A;  3H1N A;  1U87 A;  1ZOF A;  4K6X A;  1SU9 A;  5F8B A;  5ID2 A;  3GIX A;  5IO2 A;  1O6J A;  5BMU A;  4EC0 A;  4XRA A;  4G2E A;  1CQH A;  1TRV A;  2YZH A;  3WYW A;  3Q74 A;  4PNF A;  1XIY A;  4DEJ A;  2BTO T;  5B8A A;  5HFG A;  3IV4 A;  2V6O A;  3EE2 A;  4OWY A;  4ECC A;  4TN8 A;  1GSY A;  5IMC A;  3QAW A;  2C80 A;  2K8S A;  1PX7 A;  3U5R E;  2HXK A;  1AC1 A;  1LU4 A;  4WR5 A;  4DSR A;  5HQP A;  3VWV A;  4ECI A;  2LST A;  1SYR A;  3EMP A;  1O7U A;  1G6Y A;  1S3A A;  1O73 A;  1Z7P A;  5FWG A;  2OBI A;  4NV5 A;  2EIR A;  2JZR A;  3QCP A;  2C0F A;  1A2L A;  4F03 A;  2A2S A;  3FMW A;  2EIO A;  4KCE A;  2GTU A;  3IC8 A;  3HA9 A;  2ALB A;  4KE3 A;  2WDU A;  3GUS A;  5H5R A;  2LRC A;  1GSE A;  2X99 A;  2H76 A;  2R37 A;  3GNJ A;  2NPB A;  2VOC A;  3RPN A;  2NTO A;  2H0H A;  3O6T A;  1S3D A;  4BVY B;  4XRD A;  3RHC A;  1H75 A;  5DVB A;  3BOA A;  3QOU A;  3RAZ A;  5L71 A;  3GKK A;  3BBY A;  1M99 A;  5E4W A;  2E7P A;  4KA0 A;  2ON5 A;  2HSH A;  4NHZ A;  5JWO B;  1DUG A;  3E9J B;  2H70 A;  1F37 A;  1T00 A;  1GRX A;  6GSW A;  1PX6 A;  2DJ1 A;  3LOR A;  2CA8 A;  3GTU B;  10GS A;  5KN0 A;  1AQV A;  3VI7 A;  2VL2 C;  4KF9 A;  3TKR A;  4TXO B;  1XVW A;  5EY6 A;  2FWE A;  3KEB A;  3RDW A;  3KMN A;  3FR6 A;  4QL9 A;  1MDK A;  5B6N A;  2L4Q A;  2N5F A;  4IS0 A;  1QMV A;  1ZYE A;  1OE8 A;  3ISO A;  3C71 A;  3DYR A;  3PGT A;  1SJZ A;  2GST A;  2BJX A;  3FKF A;  5INY A;  3QPM A;  1GTU A;  4Z2R A;  4MJE A;  4YQM A;  3H93 A;  4HSC X;  3KTL A;  1NHO A;  3N9J A;  1HNC A;  3M9K A;  4MZC A;  4EF0 A;  4WBJ A;  4HQS A;  1VGL A;  1SL1 B;  4KND A;  4AJ6 A;  1V2A A;  6GSU A;  2H75 A;  1IYH A;  1U6T A;  5JCG A;  3GKM A;  2ES7 A;  2GQM A;  1G7E A;  4ECB A;  1B9Y C;  2H1D A;  2VCQ A;  2X64 A;  3HJP A;  2H1A A;  2HYX A;  3HJM A;  2C0D A;  3ERF A;  3GUR A;  5F06 A;  1GL8 A;  2B7K A;  4EIP A;  2A4V A;  4CHS A;  1EOH A;  2P5Q A;  3F4S A;  5ENU A;  2VUP A;  4PGT A;  2PVO C;  2YWN A;  4KSO A;  1KTE A;  2H74 A;  2IPA A;  2LNS A;  4CDO A;  1G0T A;  4IN0 A;  3DRN A;  2OAD A;  2FA4 A;  1B4P A;  2DLX A;  2IMD A;  1QUW A;  1M7T A;  2YV7 A;  3VWX A;  3HXS A;  3I9V 2;  1CQG A;  5G31 A;  3DIE A;  2GGT A;  5CNW A;  1OAZ A;  5CAX A;  2GLR A;  3I69 A;  2H73 A;  2PBJ A;  1BYE A;  5ECR B;  2FWG A;  5IIZ A;  4ZL9 A;  3ZRE A;  1OC8 A;  1TK5 B;  3VWW A;  4BPY A;  1O8W A;  3F0I A;  2LRN A;  1THO A;  1XWB A;  2GZY A;  3TCO A;  2GVP A;  4IGJ A;  1B4Q A;  1FHE A;  4TR3 A;  2JAD A;  4KAE A;  4Q5R A;  1TU8 A;  1R5A A;  2X8C A;  4HZ4 A;  1DSB A;  2YPM A;  3M0F A;  2F51 A;  4KW6 A;  3GMF A;  3W8S A;  1TI3 A;  1ON4 A;  1F3A A;  1SD8 A;  3GX8 A;  5D9V A;  2NVL A;  2B6M A;  2MMN A;  4D73 B;  4NV2 A;  3ZFB A;  4K2D A;  9GSS A;  1U88 A;  2CVD A;  1GP1 A;  2N5B A;  2WRT A;  4IJI A;  4AJ8 A;  1YF1 A;  1E2Y A;  1A2J A;  3EIN A;  2J9H A;  5C04 A;  3WGX A;  3IR4 A;  2BMX A;  1JZW A;  3UIW A;  2I4A A;  4I2U A;  3L9V A;  1SJI A;  2RM6 A;  4HQZ A;  1BG5 A;  5AIV A;  2L5O A;  3IBH A;  5B7C A;  4K9Z A;  1C72 A;  2O87 A;  3EC3 A;  4MPG A;  1OC9 A;  3HJO A;  2HZE A;  2HE3 A;  5ECM B;  4E8H A;  1WE0 A;  4EIQ A;  2YWO A;  3VK9 A;  2AV4 A;  1GUM A;  3TUE A;  4WEY A;  2LJA A;  1AUC A;  2YWI A;  3UAP A;  2LNT A;  2I1U A;  4IP1 A;  1ZYN A;  2H66 A;  1M2D A;  2HFD A;  4ECJ A;  3HZ8 A;  2N5A A;  1K0N A;  5AGY A;  3UL3 A;  3FK8 A;  4IJ3 A;  3UBL A;  2B3S A;  2GSR A;  3I43 A;  3D22 A;  1FAA A;  3ZVJ D;  2OE0 A;  3GH6 A;  4MLY A;  1YZX A;  1EEJ A;  5CRH A;  5GZZ B;  4LL4 B;  1G6W A;  4G0I A;  2OJL A;  1GSS A;  1R26 A;  2B1K A;  2VD0 A;  2FWH A;  3C1S A;  2L59 A;  1EOG A;  5J3R A;  1TXX A;  1THX A;  2MBS A;  3O76 A;  1SKW B;  2AUV A;  3NIV A;  2RUE A;  2WB9 A;  4IBP A;  4BIK A;  2IFQ B;  2H01 A;  2L57 A;  2IN3 A;  3IDV A;  4TOP A;  2O7K A;  4GQC A;  2NDO A;  3DML A;  1FOV A;  2L4C A;  3HCZ A;  4J2F A;  3UMA A;  3VI5 A;  1M3J A;  3CRT A;  5ECP B;  2PPT A;  3TGZ A;  1SK1 A;  5LCZ A;  2I9H A;  2R3X A;  3FR9 A;  4ILF A;  3LXZ A;  4XTS A;  2R0C A;  3LYP A;  3MDK A;  5KN3 A;  4POB A;  2V1M A;  4PUF C;  3HDC A;  2CX3 A;  4N0V A;  2C3N A;  4TR1 A;  4FYU A;  4PQ1 A;  1MD3 A;  14GS A;  2HRK A;  2OKA A;  3UVH A;  3HY2 A;  1XWK A;  4O92 A;  2IWT A;  4O32 A;  1M9A A;  1VF4 A;  3Q18 A;  1EZK A;  1TRS A;  2DKI A;  4DVC A;  3ZVJ A;  3TJK A;  3ZIT A;  2GQK A;  4JED A;  4BWQ A;  2CV4 A;  1ML6 A;  1SK0 A;  1OVN A;  2WGR A;  4IP6 A;  1HNB A;  5A4W A;  1EGR A;  5D93 A;  1BAY A;  2DJK A;  1GSD A;  3ZTL A;  2LQO A;  3L0H A;  4Z7X A;  2H1G A;  5D73 A;  1TP9 A;  5DDL A;  2LTK A;  3HVN A;  4OO4 A;  3S9F A;  4I97 A;  2KOK A;  1K3O A;  1K0B A;  1TRU A;  5D96 A;  5GAP D;  4NHW A;  2XPE A;  4XS6 A;  2ZCT A;  4DSS B;  2UZ8 A;  4ZIL A;  1MD4 A;  2DSA A;  4K2X A;  3LEF A;  4G10 A;  2M80 A;  5J9C A;  4WF4 A;  5JCU A;  4WR4 A;  4YAV A;  4BL7 B;  1HD2 A;  3HHV A;  4ISD A;  4ZB6 A;  1GLQ A;  1ERU A;  4YAP A;  1T4Z A;  3DXB A;  3ZLP A;  1SKR B;  2RLI A;  2GQL A;  1YKC A;  3LW9 A;  5DBQ A;  5HFI A;  4K5S A;  4MNN A;  5COH A;  5G1L A;  3TOU A;  3ZML A;  2X8G A;  4PXO A;  3IA1 A;  2H0I A;  2YWM A;  2CX4 A;  1FVJ A;  1GTA A;  1KNG A;  3QAG A;  4MZB A;  1QK8 A;  4ID0 A;  2YAN A;  4NAX A;  5CO3 A;  3QR6 A;  4HUA A;  5ECQ B;  5ABR A;  5FHI A;  4IQA A;  8GSS A;  3DVX A;  2GZP A;  1WPI A;  4XCS A;  3KCM A;  3VPT A;  2J23 A;  2M72 A;  1WJK A;  4LLR A;  1S3C A;  4OFM A;  3J7Y b;  2WZ9 A;  4MF7 A;  1J9B A;  3IAS 2;  3LWA A;  2L5L A;  2FLS A;  3HD5 A;  4ZXG A;  4Q5F A;  1PFO A;  3DWV A;  1I5G A;  2AYT A;  3LYK A;  4Q5Q A;  3J7Y k;  2H72 A;  1QGV A;  1KEB A;  3BCI A;  5EL8 A;  2VCV A;  5DAK B;  1PD2 1;  3TRX A;  5ID2 B;  5H5S A;  5DQY A;  3F6D A;  3TRQ A;  2LQQ A;  4JU5 A;  3D21 A;  4G0K A;  1JHB A;  3F4T A;  19GS A;  4MMM A;  1XG8 A;  1NW2 A;  3JCM L;  5DCH A;  4KDU A;  4MJA A;  2VCT A;  3G7J A;  7GSS A;  1XW5 A;  2IJY A;  2ON7 A;  1K3Y A;  4LL1 B;  3CRU A;  3ZFL A;  5IM9 A;  4GWR A;  2KP1 A;  1T4Y A;  4EDY A;  4TW5 A;  2VLU A;  4N10 A;  3HVV A;  2VM2 A;  1K0O A;  1RW1 A;  5JWQ B;  4KGI A;  4ML6 A;  2HI7 A;  3G9B A;  1PKW A;  3HVX A;  1TK8 B;  3MIX A;  4MZW A;  4OCE A;  1X9S B;  1XFL A;  2OAC A;  3ME7 A;  1N2A A;  5JCW A;  4FYC A;  2CVK A;  4EE0 A;  4J57 E;  1UVZ A;  1GLP A;  2G2Q A;  1O8X A;  3P8W A;  3VUR A;  1R7H A;  3C1R A;  3N5O A;  3TRP A;  3QMX A;  3D4M A;  2VO4 A;  1IYI A;  1AW9 A;  4ACS A;  1M2A A;  2CQ9 A;  1KBN A;  4K0N A;  4MK3 A;  5ECK B;  4YQU A;  3APO A;  4TXV A;  3GTU A;  2O8V B;  1PA3 A;  3QAV A;  2I81 A;  5CRE A;  2YCD A;  1QXH A;  2MMA A;  3CXG A;  4KSM A;  2AAW A;  1B48 A;  4RQX A;  1EP8 A;  2RM5 A;  5ECN B;  3ED3 A;  1QFN A;  2P0G A;  1EGO A;  3KP9 A;  5A4U A;  3W8J A;  2JU5 A;  3TB2 A;  1V40 A;  4GLT A;  4O5Q A;  1OKT A;  2DBC A;  3VWU A;  3A2X A;  4TR0 A;  2MMZ A;  22GS A;  5IMV A;  4ICY A;  1TW9 A;  2AJQ B;  3GL5 A;  3DGQ A;  4F0B A;  1TDI A;  3CMI A;  3DEX A;  2PER A;  2R4V A;  2DC5 A;  4G19 A;  3HZ4 A;  1UN2 A;  1K0D A;  1AQX A;  4I2T A;  3LXT A;  1Z9H A;  1BED A;  3CSJ A;  2V32 A;  1BX9 A;  2GDR A;  4HZ2 A;  1ERT A;  2V2G A;  1A2M A;  2XPD A;  2HSY A;  5A4V A;  3LQ7 A;  3D6I A;  4AGS A;  3M3M A;  3LGC A;  1YJ6 A;  3Q19 A;  5D9W A;  2PVQ A;  3R2Q A;  2WCI A;  4MA9 A;  3SWL A;  3QDN A;  3V1W A;  4HDE A;  2PN8 A;  3US3 A;  4NWY A;  1DBY A;  2QSI A;  2XBQ A;  3VFI A;  4V2N A;  1GSQ A;  3FEU A;  1A0F A;  3A3T A;  3IXR A;  3KJY A;  1SD9 A;  3U6V A;  2H6Z A;  5D8I A;  3H8Q A;  4KDY A;  1GTI A;  1ZL9 A;  3G7Y A;  5DAL B;  4XS1 A;  2F8A A;  3GFK A;  4IKH A;  2M46 A;  3P90 A;  3GKX A;  1OE7 A;  5F07 A;  3ZRD A;  2C3T A;  3EU4 A;  1YY7 A;  4F0C A;  2XC2 A;  3TJJ A;  3GV1 A;  4EDZ A;  3MAK A;  2MZC A;  5G5E A;  1WWJ A;  4POM A;  4KDX A;  4EL1 A;  3KGK A;  3BJ5 A;  1OYJ A;  5ECL B;  3ZIJ A;  13GS A;  1GSU A;  3GHA A;  1Z3E A;  3M8N A;  4CY6 A;  1B9X C;  3FW2 A;  2DKH A;  1Y6E A;  1V9W A;  1SL0 B;  5GSS A;  3CSI A;  1GNE A;  4E8E A;  2GZZ A;  4YH2 A;  3FR3 A;  2LUS A;  2H19 A;  4NXI A;  3QFB C;  4MAB A;  1ZCP A;  1SJ6 A;  3AY8 A;  1A8Y A;  1FG4 A;  1PN9 A;  1WMJ A;  4ZIJ A;  5DQS A;  2R0P A;  1AIU A;  3TJB A;  1E6B A;  4N30 A;  1W4V A;  2HZF A;  2QA1 A;  1F3B A;  2CAI A;  4IW9 A;  4ZL7 A;  3CQF A;  2GSQ A;  3GX0 A;  4MCU A;  4NMU A;  4N11 A;  4K0G A;  1GTB A;  4V2M A;  2FCH A;  3KZQ A;  5F0G A;  3PR8 A;  3CBU A;  6GSX A;  4OCF A;  2E0Q A;  4PUA A;  2WUL A;  2VAF A;  3G7I A;  3LG6 A;  1UA5 A;  2R5G A;  4HEA 2;  1NHY A;  2IMI A;  4P3Y B;  1TJD A;  3GA4 A;  4ZB9 A;  3QD9 A;  4X43 A;  4HU9 A;  5J4U A;  5EVO A;  4ZL8 A;  3CTF A;  1GSF A;  1A23 A;  1O85 A;  3F4R A;  2R0G A;  1T3B A;  1PQN A;  4LMW A;  3ZZX A;  1XWG A;  3HYP A;  1XXU A;  1F6M C;  5HFK A;  4HS1 A;  1J0F A;  1O81 A;  1UC7 A;  3RHB A;  1MDI A;  1A0R P;  2LV3 A;  2TRX A;  4GSS A; 
#chains in the Genus database with same CATH homology
 3F3Q A;  3FRC A;  3DVW A;  3IK7 A;  3F63 A;  2CT6 A;  1ERV A;  3EMX A;  4IQ1 A;  3NZN A;  1Q4J A;  2ZNM A;  4JBB A;  2GS3 A;  2H71 A;  3IRA A;  4PTS A;  1M0U A;  5AN1 A;  2JAC A;  4L0U A;  2B5E A;  2HRN A;  3FZA A;  1Z7R A;  3KM6 A;  3KIJ A;  2JZS A;  4BVX A;  6GST A;  4OFT A;  1MDJ A;  1ABA A;  2VLT A;  2YN1 A;  5HR3 A;  1EV9 A;  1OC9 B;  3EWL A;  4KCA A;  3TKS E;  5FT3 A;  2HZE B;  4RI7 A;  2K6V A;  5JWR B;  3TKS A;  4WKW A;  5G1K A;  1JLV A;  3ZL5 A;  2H6X A;  1HNA A;  1NSW A;  2FY6 A;  1RK4 A;  6GSS A;  3H4K A;  2VL9 A;  5H5Q A;  5CP1 A;  3IHQ A;  1PL2 A;  4IHU A;  4V1A g;  3BD2 A;  2FHE A;  2LJR A;  2MMO A;  2JZT A;  5ELA A;  1WRY A;  3W6G A;  2Z9S A;  1SL2 B;  3WT2 A;  3GSS A;  2WJU A;  1X5E A;  2F3M A;  1GUL A;  4I8B A;  1V57 A;  2YJ7 A;  2REM A;  1ZYP A;  1X5C A;  2CZ3 A;  16GS A;  1X9M B;  4F9Z A;  1NM3 A;  4JR6 A;  4EO3 A;  3CYN A;  2H0G A;  1LBK A;  4CY8 A;  3TOT A;  1XZO A;  2PUK C;  5D9T A;  4O5U A;  2JSY A;  5IMA A;  4YKF A;  2H1B A;  3WT1 A;  2IIY A;  4WF5 A;  4DSQ A;  4TR1 B;  5IPG A;  1WP0 A;  4MP4 A;  20GS A;  2PU9 C;  4HJM A;  3VPQ A;  3DD3 A;  3ME8 A;  4MJC A;  2VCZ A;  3MYD A;  4ZB8 A;  1XW6 A;  2FWF A;  4GXZ A;  1PRX A;  1VF1 A;  1WOU A;  1X5D A;  1TK0 B;  3FZ4 A;  1TTZ A;  4EKZ A;  3EPT A;  4WBR D;  1PN0 A;  5LD0 A;  1Z6M A;  5D9X A;  3APS A;  1TRW A;  3GH9 A;  1JZD A;  1ZZY A;  1ZGN A;  1ILO A;  2H6Y A;  4LA1 A;  1FVK A;  3FZ9 A;  5KN2 A;  1SYX A;  4POL A;  4RQR A;  6GSV A;  3C7M A;  1V58 A;  2D2Z A;  4QL7 A;  2EC4 A;  2OBK A;  5AIS A;  3EUR A;  3HVS A;  4USS A;  2VCX A;  2PMT A;  2C8U A;  3KH9 A;  3C8E A;  2C0E A;  2GT6 A;  2NBS A;  3TKP A;  1VRS D;  1JZO A;  2YJH A;  5CRG A;  3BCK A;  4FO5 A;  2FGX A;  2DJJ A;  4XS4 B;  2VIM A;  2A4H A;  3F8U A;  1TOF A;  5IQY A;  2P5R A;  4V2L A;  1JFU A;  3UBK A;  3D0Z A;  1XBS A;  2X4A A;  5DAK A;  3KP8 A;  2KHP A;  2K8V A;  1F2E A;  1SEN A;  1K0C A;  1PMT A;  3P7X A;  3IAM 2;  3PIN A;  2TRC P;  5DJL A;  2K9F A;  2FD3 A;  5IOW A;  4EVM A;  2C1Y A;  1X9W B;  2X49 A;  4MJB A;  4GQF A;  4TRX A;  4X1U A;  4WXT A;  2FNO A;  2KUC A;  2A2P A;  4O7H A;  3ZIV A;  1T7P B;  3L4N A;  4KX4 A;  4O5R A;  3TDG A;  4AF2 A;  3TKQ A;  3GL3 A;  2V6K A;  4F2I A;  2E2M A;  1XW9 A;  1N8J A;  1YEX A;  4ZBA A;  1SK2 A;  4BVY A;  1FB6 A;  5KOW A;  1XPV A;  4YKG A;  2YNX A;  1A24 A;  1J08 A;  5HR2 A;  5IMZ A;  1K3L A;  2CVB A;  4TR4 A;  4L0W A;  3UOM A;  4G9H A;  2AB6 A;  2LEG A;  2G0F A;  4CW9 A;  1B8X A;  4IVF A;  1AAZ A;  3FHK A;  3MSZ A;  4V1A p;  3M1G A;  4K7O A;  3F6F A;  1FOH A;  2B7J A;  3A5I A;  3GYK A;  1YKA A;  4QQ7 A;  2E2G A;  2C4J A;  4K7I A;  1AXD A;  1W89 A;  4WET A;  1FB0 A;  3WD6 A;  4TKY A;  4TXO A;  1Q98 A;  2AHE A;  3A5W A;  1BQ7 A;  1U3A A;  4G0L A;  5F05 A;  2DIZ A;  4PNG A;  2B1L A;  5G5F A;  12GS A;  2LRT A;  2RUF A;  1DE2 A;  2YOI A;  4POK A;  4OFN A;  4GSN A;  1XOB A;  3ERG A;  4JE1 A;  4Q5N A;  4F82 A;  4TVE A;  3WGD A;  4X0X A;  4KH7 A;  2O89 A;  4ML1 A;  3F9U A;  4RI6 A;  1XWA A;  5B8B A;  2R6K A;  2VL2 A;  4ZBB A;  4FQU A;  2PWJ A;  3KD0 A;  3OR5 A;  3UEM A;  5HR1 A;  4AJ7 A;  1SKS B;  1HYU A;  2F8F A;  2HNL A;  2DJ3 A;  4XIH A;  3EYT A;  2VLV A;  5DCG A;  2GT5 A;  3APQ A;  5DAL A;  4A5P A;  3A2V A;  2JL4 A;  4NPB A;  2CZ2 A;  1MTC A;  2FUG 2;  1ACV A;  3KMO A;  1GWC A;  4PQH A;  4X4J A;  4HI7 A;  5ECI B;  2MYG A;  4LMV A;  2X8H A;  5BRT A;  1GNW A;  2KP2 A;  1MEK A;  2YZU A;  1OC3 A;  1PGT A;  3EVI A;  1R4W A;  4J56 E;  3L78 A;  1EP7 A;  1G7O A;  1USB A;  3GKN A;  4YQV A;  4MF6 A;  5GST A;  2GSS A;  2VL3 A;  2WFC A;  4FYB A;  2XBI A;  3WGE A;  5ECS A;  3IHG A;  2YP6 A;  1VF2 A;  4MH2 A;  5CYY A;  4JR4 A;  1GUH A;  1EEM A;  5AIX A;  2H8L A;  4ZBD A;  3P2A A;  2XHF A;  2WS2 A;  1AQW A;  1Z5Y E;  2L6C A;  5ECO B;  3C73 A;  5G2Z A;  3H79 A;  2FA8 A;  4H86 A;  2QKE A;  1H4O A;  3LFL A;  4EXJ A;  4MPF A;  4D73 A;  2QA2 A;  4MH3 A;  1EWX A;  5KEJ A;  3TJF A;  2JSZ A;  1ERW A;  1EV4 A;  3KH7 A;  3D5J A;  2OE1 A;  2OA7 A;  4KB3 A;  4FIW A;  1HQO A;  4K7N A;  2HRA A;  1GH2 A;  1RQM A;  5GAN D;  4FH8 A;  2L6D A;  3GRX A;  3GST A;  3L9U A;  2C3Q A;  3EU3 A;  1PKZ A;  5IOX A;  4L5L A;  2IME A;  5IO0 A;  2CAQ A;  3UAR A;  1XCC A;  3FZ5 A;  1TI1 A;  1R5P A;  1LJR A;  2C0G A;  1PSQ A;  4MF5 A;  1VF3 A;  2DMM A;  4HOJ A;  3MNG A;  1XOA A;  4HU7 A;  2RII A;  4PUR A;  4K5R A;  1WIK A;  4OMV A;  1YEP A;  1U3I A;  2VCW A;  3SBC A;  4I5Q A;  1TU7 A;  3TKS C;  4GCI A;  2IFQ A;  2DJ0 A;  1ST9 A;  1I9D A;  4RUV A;  1Y25 A;  3CTG A;  2IMF A;  1M2B A;  2VM1 A;  5J9B A;  2P31 A;  5IPH A;  3F3R A;  5A5K A;  1ZYQ B;  5DJM A;  4L8E A;  1XVQ A;  2R2J A;  1DE1 A;  4GST A;  2ZUP A;  3VLN A;  5CRD A;  4BVX B;  2HT9 A;  3NOF A;  1PL1 A;  3CSH A;  5ELG A;  2HSM A;  4MDC A;  3MWH A;  5EPF A;  5KN1 A;  4HJ2 A;  4Z2T A;  1M9B A;  2PGT A;  2A2R A;  4K8M A;  1A8L A;  3LJR A;  3GN3 A;  3E0U A;  4I6X A;  6GSY A;  1K0A A;  3HKR A;  5CRW A;  1GUK A;  5B6M A;  3KXO A;  5LNK e;  4PX1 A;  1YF0 A;  2K18 A;  4Z2U A;  1JZR A;  1FO5 A;  2H30 A;  1OKD A;  2B5X A;  3IC4 A;  18GS A;  2KLX A;  2OE3 A;  3RBT A;  2VD1 A;  3KTB A;  4ULX A;  5G30 A;  1ZMA A;  4XHM A;  1QQ2 A;  1YQ1 A;  3ZMK A;  2DIY A;  2O85 A;  4DSS A;  5E59 A;  1V98 A;  2V41 A;  5KOX A;  2IL3 A;  4GRF A;  4N0Z A;  3QFA C;  1K0M A;  3RPP A;  3A2W A;  1URM A;  1X0R A;  1T8E B;  4BL7 A;  3UJ1 A;  3E3E A;  2DJ2 A;  2LKU A;  3O3T A;  4OO5 A;  5IMF A;  3IOS A;  2YV9 A;  5IMD A;  2EIQ A;  5J5N A;  4GF0 A;  3I6A A;  4EUY A;  3FYG A;  4BA7 A;  5J41 A;  1T1V A;  1FW1 A;  1Z6N A;  4KUN A;  4JZQ A;  2LS5 A;  2I3Y A;  17GS A;  5C00 A;  2F9S A;  3IPZ A;  3R3E A;  2LJK A;  4OD7 A;  2DML A;  4GTU A;  1YDK A;  3PH9 A;  3FY7 A;  4K1F A;  4PQI A;  5HR0 A;  3ERW A;  3K8N A;  4XS4 A;  3L9S A;  4BWS A;  4IEL A;  3PPU A;  2MBT A;  1TKD B;  4JRR A;  3Q6O A;  3M9J A;  2QC7 A;  2QGV A;  3IK9 A;  3ZYW A;  1F9M A;  2IMK A;  11GS A;  2B5Y A;  3UVT A;  2HLS A;  2HRF A;  3DKS A;  3LSZ A;  1BJX A;  3TJG A;  3D4T A;  4L5O A;  2TIR A;  5ECH B;  3IE3 A;  1JLW A;  1XWC A;  3H1N A;  1U87 A;  1ZOF A;  4K6X A;  1SU9 A;  5F8B A;  5ID2 A;  3GIX A;  5IO2 A;  1O6J A;  5BMU A;  4EC0 A;  4XRA A;  4G2E A;  1CQH A;  1TRV A;  2YZH A;  3WYW A;  3Q74 A;  4PNF A;  1XIY A;  4DEJ A;  2BTO T;  5B8A A;  5HFG A;  3IV4 A;  2V6O A;  3EE2 A;  4OWY A;  4ECC A;  4TN8 A;  1GSY A;  5IMC A;  3QAW A;  2C80 A;  2K8S A;  1PX7 A;  3U5R E;  2HXK A;  1AC1 A;  1LU4 A;  4WR5 A;  4DSR A;  5HQP A;  3VWV A;  4ECI A;  2LST A;  1SYR A;  3EMP A;  1O7U A;  1G6Y A;  1S3A A;  1O73 A;  1Z7P A;  5FWG A;  2OBI A;  4NV5 A;  2EIR A;  2JZR A;  3QCP A;  2C0F A;  1A2L A;  4F03 A;  2A2S A;  3FMW A;  2EIO A;  4KCE A;  2GTU A;  3IC8 A;  3HA9 A;  2ALB A;  4KE3 A;  2WDU A;  3GUS A;  5H5R A;  2LRC A;  1GSE A;  2X99 A;  2H76 A;  2R37 A;  3GNJ A;  2NPB A;  2VOC A;  3RPN A;  2NTO A;  2H0H A;  3O6T A;  1S3D A;  4BVY B;  4XRD A;  3RHC A;  1H75 A;  5DVB A;  3BOA A;  3QOU A;  3RAZ A;  5L71 A;  3GKK A;  3BBY A;  1M99 A;  5E4W A;  2E7P A;  4KA0 A;  2ON5 A;  2HSH A;  4NHZ A;  5JWO B;  1DUG A;  3E9J B;  2H70 A;  1F37 A;  1T00 A;  1GRX A;  6GSW A;  1PX6 A;  2DJ1 A;  3LOR A;  2CA8 A;  3GTU B;  10GS A;  5KN0 A;  1AQV A;  3VI7 A;  2VL2 C;  4KF9 A;  3TKR A;  4TXO B;  1XVW A;  5EY6 A;  2FWE A;  3KEB A;  3RDW A;  3KMN A;  3FR6 A;  4QL9 A;  1MDK A;  5B6N A;  2L4Q A;  2N5F A;  4IS0 A;  1QMV A;  1ZYE A;  1OE8 A;  3ISO A;  3C71 A;  3DYR A;  3PGT A;  1SJZ A;  2GST A;  2BJX A;  3FKF A;  5INY A;  3QPM A;  1GTU A;  4Z2R A;  4MJE A;  4YQM A;  3H93 A;  3KTL A;  1NHO A;  3N9J A;  1HNC A;  3M9K A;  4MZC A;  4EF0 A;  4WBJ A;  4HQS A;  1VGL A;  1SL1 B;  4KND A;  4AJ6 A;  1V2A A;  6GSU A;  2H75 A;  1IYH A;  1U6T A;  5JCG A;  3GKM A;  2ES7 A;  2GQM A;  1G7E A;  4ECB A;  1B9Y C;  2H1D A;  2VCQ A;  2X64 A;  3HJP A;  2H1A A;  2HYX A;  3HJM A;  2C0D A;  3ERF A;  3GUR A;  5F06 A;  1GL8 A;  2B7K A;  4EIP A;  2A4V A;  4CHS A;  1EOH A;  2P5Q A;  3F4S A;  5ENU A;  2VUP A;  4PGT A;  2PVO C;  2YWN A;  4KSO A;  1KTE A;  2H74 A;  2IPA A;  2LNS A;  4CDO A;  1G0T A;  4IN0 A;  3DRN A;  2OAD A;  2FA4 A;  1B4P A;  2DLX A;  2IMD A;  1QUW A;  1M7T A;  2YV7 A;  3VWX A;  3HXS A;  3I9V 2;  1CQG A;  5G31 A;  3DIE A;  2GGT A;  5CNW A;  1OAZ A;  5CAX A;  2GLR A;  3I69 A;  2H73 A;  2PBJ A;  1BYE A;  5ECR B;  2FWG A;  5IIZ A;  4ZL9 A;  3ZRE A;  1OC8 A;  1TK5 B;  3VWW A;  4BPY A;  1O8W A;  3F0I A;  2LRN A;  1THO A;  1XWB A;  2GZY A;  3TCO A;  2GVP A;  4IGJ A;  1B4Q A;  1FHE A;  4TR3 A;  2JAD A;  4KAE A;  4Q5R A;  1TU8 A;  1R5A A;  2X8C A;  4HZ4 A;  1DSB A;  2YPM A;  3M0F A;  2F51 A;  4KW6 A;  3GMF A;  3W8S A;  1TI3 A;  1ON4 A;  1F3A A;  1SD8 A;  3GX8 A;  5D9V A;  2NVL A;  2B6M A;  2MMN A;  4D73 B;  4NV2 A;  3ZFB A;  4K2D A;  9GSS A;  1U88 A;  2CVD A;  1GP1 A;  2N5B A;  2WRT A;  4IJI A;  4AJ8 A;  1YF1 A;  1E2Y A;  1A2J A;  3EIN A;  2J9H A;  5C04 A;  3WGX A;  3IR4 A;  2BMX A;  1JZW A;  3UIW A;  2I4A A;  4I2U A;  3L9V A;  1SJI A;  2RM6 A;  4HQZ A;  1BG5 A;  5AIV A;  2L5O A;  3IBH A;  5B7C A;  4K9Z A;  1C72 A;  2O87 A;  3EC3 A;  4MPG A;  1OC9 A;  3HJO A;  2HZE A;  2HE3 A;  5ECM B;  4E8H A;  1WE0 A;  4EIQ A;  2YWO A;  3VK9 A;  2AV4 A;  1GUM A;  3TUE A;  4WEY A;  2LJA A;  1AUC A;  2YWI A;  3UAP A;  2LNT A;  2I1U A;  4IP1 A;  1ZYN A;  2H66 A;  1M2D A;  2HFD A;  4ECJ A;  3HZ8 A;  2N5A A;  1K0N A;  5AGY A;  3UL3 A;  3FK8 A;  4IJ3 A;  3UBL A;  2B3S A;  2GSR A;  3I43 A;  3D22 A;  1FAA A;  3ZVJ D;  2OE0 A;  3GH6 A;  4MLY A;  1YZX A;  1EEJ A;  5CRH A;  5GZZ B;  4LL4 B;  1G6W A;  4G0I A;  2OJL A;  1GSS A;  1R26 A;  2B1K A;  2VD0 A;  2FWH A;  3C1S A;  2L59 A;  1EOG A;  5J3R A;  1TXX A;  1THX A;  2MBS A;  3O76 A;  1SKW B;  2AUV A;  3NIV A;  2RUE A;  2WB9 A;  4IBP A;  2IFQ B;  2H01 A;  2L57 A;  2IN3 A;  3IDV A;  4TOP A;  2O7K A;  4GQC A;  2NDO A;  3DML A;  1FOV A;  2L4C A;  3HCZ A;  4J2F A;  3UMA A;  3VI5 A;  3CRT A;  5ECP B;  2PPT A;  3TGZ A;  1SK1 A;  5LCZ A;  2I9H A;  2R3X A;  3FR9 A;  4ILF A;  3LXZ A;  4XTS A;  2R0C A;  3LYP A;  3MDK A;  5KN3 A;  4POB A;  2V1M A;  4PUF C;  3HDC A;  2CX3 A;  4N0V A;  2C3N A;  4TR1 A;  4FYU A;  4PQ1 A;  1MD3 A;  14GS A;  2HRK A;  2OKA A;  3UVH A;  3HY2 A;  1XWK A;  4O92 A;  2IWT A;  4O32 A;  1M9A A;  1VF4 A;  3Q18 A;  1EZK A;  1TRS A;  2DKI A;  4DVC A;  3ZVJ A;  3TJK A;  3ZIT A;  2GQK A;  4JED A;  4BWQ A;  2CV4 A;  1ML6 A;  1SK0 A;  1OVN A;  2WGR A;  4IP6 A;  1HNB A;  5A4W A;  1EGR A;  5D93 A;  1BAY A;  2DJK A;  1GSD A;  3ZTL A;  2LQO A;  3L0H A;  4Z7X A;  2H1G A;  5D73 A;  1TP9 A;  5DDL A;  2LTK A;  4OO4 A;  3S9F A;  4I97 A;  2KOK A;  1K3O A;  1K0B A;  1TRU A;  5D96 A;  5GAP D;  4NHW A;  2XPE A;  4XS6 A;  2ZCT A;  4DSS B;  2UZ8 A;  4ZIL A;  1MD4 A;  2DSA A;  4K2X A;  3LEF A;  4G10 A;  2M80 A;  5J9C A;  4WF4 A;  5JCU A;  4WR4 A;  4YAV A;  4BL7 B;  1HD2 A;  3HHV A;  4ISD A;  4ZB6 A;  1GLQ A;  1ERU A;  4YAP A;  1T4Z A;  3DXB A;  3ZLP A;  1SKR B;  2RLI A;  2GQL A;  1YKC A;  3LW9 A;  5DBQ A;  5HFI A;  4K5S A;  4MNN A;  5COH A;  5G1L A;  3TOU A;  3ZML A;  2X8G A;  4PXO A;  3IA1 A;  2H0I A;  2YWM A;  2CX4 A;  1FVJ A;  1GTA A;  1KNG A;  3QAG A;  4MZB A;  1QK8 A;  4ID0 A;  2YAN A;  4NAX A;  5CO3 A;  3QR6 A;  4HUA A;  5ECQ B;  5ABR A;  5FHI A;  4IQA A;  8GSS A;  3DVX A;  2GZP A;  1WPI A;  4XCS A;  3KCM A;  3VPT A;  2J23 A;  2M72 A;  1WJK A;  4LLR A;  1S3C A;  4OFM A;  3J7Y b;  2WZ9 A;  4MF7 A;  1J9B A;  3IAS 2;  3LWA A;  2L5L A;  2FLS A;  3HD5 A;  4ZXG A;  4Q5F A;  3DWV A;  1I5G A;  2AYT A;  3LYK A;  4Q5Q A;  3J7Y k;  2H72 A;  1QGV A;  1KEB A;  3BCI A;  5EL8 A;  2VCV A;  5DAK B;  1PD2 1;  3TRX A;  5ID2 B;  5H5S A;  5DQY A;  3F6D A;  3TRQ A;  2LQQ A;  4JU5 A;  3D21 A;  4G0K A;  1JHB A;  3F4T A;  19GS A;  4MMM A;  1NW2 A;  3JCM L;  5DCH A;  4KDU A;  4MJA A;  2VCT A;  3G7J A;  7GSS A;  1XW5 A;  2IJY A;  2ON7 A;  1K3Y A;  4LL1 B;  3CRU A;  3ZFL A;  5IM9 A;  4GWR A;  2KP1 A;  1T4Y A;  4EDY A;  4TW5 A;  2VLU A;  4N10 A;  3HVV A;  2VM2 A;  1K0O A;  1RW1 A;  5JWQ B;  4KGI A;  4ML6 A;  2HI7 A;  3G9B A;  1PKW A;  3HVX A;  1TK8 B;  3MIX A;  4MZW A;  4OCE A;  1X9S B;  1XFL A;  2OAC A;  3ME7 A;  1N2A A;  5JCW A;  4FYC A;  2CVK A;  4EE0 A;  4J57 E;  1UVZ A;  1GLP A;  2G2Q A;  1O8X A;  3P8W A;  3VUR A;  1R7H A;  3C1R A;  3N5O A;  3TRP A;  3QMX A;  3D4M A;  2VO4 A;  1IYI A;  1AW9 A;  4ACS A;  1M2A A;  2CQ9 A;  1KBN A;  4K0N A;  4MK3 A;  5ECK B;  4YQU A;  3APO A;  4TXV A;  3GTU A;  2O8V B;  1PA3 A;  3QAV A;  2I81 A;  5CRE A;  2YCD A;  1QXH A;  2MMA A;  3CXG A;  4KSM A;  2AAW A;  1B48 A;  4RQX A;  1EP8 A;  2RM5 A;  5ECN B;  3ED3 A;  1QFN A;  2P0G A;  1EGO A;  3KP9 A;  5A4U A;  3W8J A;  2JU5 A;  3TB2 A;  1V40 A;  4GLT A;  4O5Q A;  1OKT A;  2DBC A;  3VWU A;  3A2X A;  4TR0 A;  2MMZ A;  22GS A;  5IMV A;  4ICY A;  1TW9 A;  2AJQ B;  3GL5 A;  3DGQ A;  4F0B A;  1TDI A;  3CMI A;  3DEX A;  2PER A;  2R4V A;  2DC5 A;  4G19 A;  3HZ4 A;  1UN2 A;  1K0D A;  1AQX A;  4I2T A;  3LXT A;  1Z9H A;  1BED A;  3CSJ A;  2V32 A;  1BX9 A;  2GDR A;  4HZ2 A;  1ERT A;  2V2G A;  1A2M A;  2XPD A;  2HSY A;  5A4V A;  3LQ7 A;  3D6I A;  4AGS A;  3M3M A;  3LGC A;  1YJ6 A;  3Q19 A;  5D9W A;  2PVQ A;  3R2Q A;  2WCI A;  4MA9 A;  3SWL A;  3QDN A;  3V1W A;  4HDE A;  2PN8 A;  3US3 A;  4NWY A;  1DBY A;  2QSI A;  2XBQ A;  3VFI A;  4V2N A;  1GSQ A;  3FEU A;  1A0F A;  3A3T A;  3IXR A;  3KJY A;  1SD9 A;  3U6V A;  2H6Z A;  5D8I A;  3H8Q A;  4KDY A;  1GTI A;  1ZL9 A;  3G7Y A;  5DAL B;  4XS1 A;  2F8A A;  3GFK A;  4IKH A;  2M46 A;  3P90 A;  3GKX A;  1OE7 A;  5F07 A;  3ZRD A;  2C3T A;  3EU4 A;  1YY7 A;  4F0C A;  2XC2 A;  3TJJ A;  3GV1 A;  4EDZ A;  3MAK A;  2MZC A;  5G5E A;  1WWJ A;  4POM A;  4KDX A;  4EL1 A;  3KGK A;  3BJ5 A;  1OYJ A;  5ECL B;  3ZIJ A;  13GS A;  1GSU A;  3GHA A;  1Z3E A;  3M8N A;  4CY6 A;  1B9X C;  3FW2 A;  2DKH A;  1Y6E A;  1V9W A;  1SL0 B;  5GSS A;  3CSI A;  1GNE A;  4E8E A;  2GZZ A;  4YH2 A;  3FR3 A;  2LUS A;  2H19 A;  4NXI A;  3QFB C;  4MAB A;  1ZCP A;  1SJ6 A;  3AY8 A;  1A8Y A;  1FG4 A;  1PN9 A;  1WMJ A;  4ZIJ A;  5DQS A;  2R0P A;  1AIU A;  3TJB A;  1E6B A;  4N30 A;  1W4V A;  2HZF A;  2QA1 A;  1F3B A;  2CAI A;  4IW9 A;  4ZL7 A;  2GSQ A;  3GX0 A;  4MCU A;  4NMU A;  4N11 A;  4K0G A;  1GTB A;  4V2M A;  2FCH A;  3KZQ A;  5F0G A;  3PR8 A;  3CBU A;  6GSX A;  4OCF A;  2E0Q A;  4PUA A;  2WUL A;  2VAF A;  3G7I A;  3LG6 A;  1UA5 A;  2R5G A;  4HEA 2;  1NHY A;  2IMI A;  4P3Y B;  1TJD A;  3GA4 A;  4ZB9 A;  3QD9 A;  4X43 A;  4HU9 A;  5J4U A;  5EVO A;  4ZL8 A;  3CTF A;  1GSF A;  1A23 A;  1O85 A;  3F4R A;  2R0G A;  1T3B A;  1PQN A;  4LMW A;  3ZZX A;  1XWG A;  3HYP A;  1XXU A;  1F6M C;  5HFK A;  4HS1 A;  1J0F A;  1O81 A;  1UC7 A;  3RHB A;  1MDI A;  1A0R P;  2LV3 A;  2TRX A;  4GSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...