2EC4A

Solution structure of the uas domain from human fas-associated factor 1
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
171
structure length
171
Chain Sequence
ENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAFQEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDSNRARFLTMCNRHFGSVVAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLMAAMEIFTAQQQEDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords FAS-associated factor 1
publication title Solution structure of the UAS domain from human FAS-associated factor 1
rcsb
source organism Homo sapiens
total genus 37
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-02-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2ec4A00
1F37A 4HU7A 3UARA 3WYWA 3EMPA 1X5EA 1UA5A 2IFQA 1YJ6A 3QCPA 2NPBA 2L4QA 4EKZA 3MNGA 2REMA 3WT1A 3GYKA 3O3TA 3ZIVA 5J4UA 1YZXA 5D73A 3QMXA 2GZZA 3IXRA 2E2MA 4TOPA 4OFMA 2CV4A 2YZUA 1ON4A 1BJXA 2GSSA 1WRYA 1SD8A 4KGIA 1A2LA 5A5KA 5EY6A 1XPVA 3EU3A 5IOWA 1H4OA 1XZOA 6GSYA 4WR5A 2R37A 3I69A 2FCHA 3DRNA 3M9KA 1ILOA 1ACVA 3TKRA 4ML6A 3FKFA 3J7Yk 2ZCTA 1HD2A 1URMA 5L71A 3DWVA 1IYIA 1EEJA 3GHAA 2XBIA 1SK2A 2I9HA 1UVZA 2RLIA 2IFQB 1NHYA 1JLVA 4MF6A 2CA8A 19GSA 2V6KA 2P5QA 2FD3A 3PINA 4MK3A 2LQOA 1R4WA 1PKWA 2F8AA 2R5GA 4KA0A 3FK8A 3FZ9A 4J57E 4MZWA 2PGTA 1Z6MA 5JWOB 1EGOA 2GQKA 2LKUA 4TXOA 1KTEA 3VI7A 3HXSA 2LTKA 4N0VA 3QFBC 4KCEA 4HU9A 3GIXA 5KN3A 3KP9A 2YJHA 1HNBA 3Q6OA 1UC7A 3BD2A 2IMFA 3EC3A 5LCZA 4F82A 4NHWA 4I2UA 1TP9A 1M9AA 2L5OA 5EPFA 3APQA 5IO2A 2N5FA 2P0GA 4V2LA 2VL2A 2KP2A 3P8WA 5ECNB 3GV1A 1TK8B 2LQQA 2VD0A 2IN3A 2YNXA 3RAZA 2OACA 3FR3A 1M99A 2AHEA 2C3NA 4MDCA 5JCUA 5COHA 3CSJA 4L5LA 5H5RA 2JZRA 3DIEA 2GT5A 1Q4JA 2X8GA 4MPFA 3TJJA 2ON7A 4V2MA 4NXIA 2H8LA 2I1UA 1ERWA 2H30A 2HI7A 2VAFA 5A4VA 1A0FA 1PQNA 3FW2A 3P2AA 2C0FA 2DJ1A 4RQXA 4GF0A 1SK0A 5DVBA 1GP1A 3DEXA 5EL8A 1XWBA 5HR2A 3C73A 4XIHA 3GL3A 2VM2A 3PGTA 1ZZYA 2NBSA 4AF2A 1SD9A 3ZITA 1FO5A 3EE2A 3GURA 4XCSA 3KGKA 14GSA 5CREA 2JU5A 3EVIA 5F05A 3WGXA 3CTGA 3ZREA 1PX6A 2TRXA 2GSTA 4HJMA 1XBSA 2RM6A 2GDRA 4IKHA 5HR0A 2VO4A 1Z7PA 3NZNA 1AW9A 2KUCA 1TRWA 2E2GA 3ZZXA 3HDCA 1ST9A 2MMOA 2J9HA 1USBA 1SKRB 1VF1A 2IL3A 4BL7A 2C0DA 1GSDA 5IMAA 1YKAA 2LNSA 2LUSA 1GULA 4YQVA 2VL3A 4WF5A 1WJKA 3E0UA 4CDOA 1DE2A 3GKXA 4XHMA 1O81A 1NHOA 2YJ7A 4WEYA 4J56E 1GNEA 2VD1A 4N0ZA 3TGZA 5HR3A 3RHBA 4XS4A 1S3AA 1THOA 2ES7A 2OE1A 1O85A 1TI3A 4HZ4A 2EC4A 5FWGA 4JZQA 2VCQA 4G10A 2YPMA 2RUFA 3HA9A 3KIJA 1SK1A 2L5LA 1A8YA 3TKSA 2VM1A 3R2QA 2L4CA 2X64A 4TR4A 4F0BA 4OMVA 2AYTA 5DJMA 2L6DA 3GN3A 3HCZA 2NVLA 5D8IA 5DQYA 1FOVA 4KCAA 4LL1B 3KZQA 1NM3A 3F6FA 2RM5A 3N9JA 1X0RA 3LQ7A 4I8BA 2EIRA 3G7YA 3LXTA 1EP8A 1MDIA 2WCIA 3F0IA 1EGRA 5KN0A 2C3QA 3GRXA 4NV2A 3IE3A 1OKTA 2F51A 2WZ9A 3P7XA 4BWSA 1K3OA 1B48A 3G9BA 3H4KA 3RPPA 4N10A 1XW6A 2V41A 3FZ5A 3IV4A 2J23A 4XS4B 4YAVA 1OE7A 2VIMA 3M0FA 2OBIA 5ABRA 3KH9A 3CTFA 5DCHA 1PRXA 2H6XA 2LJAA 3KMOA 2WULA 1F3BA 5D9VA 4K8MA 4Z7XA 5IPGA 3ZFLA 4KNDA 1SYXA 2GSRA 1FG4A 1SL2B 4HUAA 3CBUA 1GNWA 3BCIA 3RDWA 2LEGA 2H0GA 2AJQB 1GSSA 4OWYA 3A2WA 2H0IA 5D9WA 4KSMA 1VGLA 4FYUA 2JSZA 5IIZA 4ISDA 5A4WA 1JFUA 2MMZA 2G0FA 3ZFBA 2C0GA 3ZMLA 3C8EA 1A2JA 1G0TA 3CMIA 2NTOA 2A2RA 2YOIA 4FO5A 1K3YA 1GTUA 2H1BA 4TXVA 4HJ2A 3CSIA 3K8NA 1ZYQB 5HFKA 3HJOA 3UL3A 3L4NA 2V6OA 3VLNA 2NDOA 1M2AA 2HYXA 4WKWA 2P31A 4NWYA 3ERGA 4JRRA 1O6JA 2L59A 3GKKA 5H5QA 5ENUA 4IQ1A 2YCDA 3I43A 3L9UA 1S3CA 1BYEA 3LFLA 1BX9A 3UVHA 1U6TA 3KTBA 2DBCA 3TJKA 2ON5A 1V98A 1O7UA 1V2AA 4PURA 4ECIA 3TJFA 6GSTA 1U3AA 5ECHB 1M0UA 2YN1A 5JWQB 2PVOC 5ELAA 1KNGA 2DLXA 7GSSA 4TR1B 4I5QA 5DALB 2AB6A 2CX4A 1E6BA 1LU4A 1K0DA 1JZRA 3QFAC 2CZ2A 4L0WA 3N5OA 2K18A 1X9WB 1AQWA 3L0HA 3NOFA 6GSUA 4TW5A 3L9VA 1T4ZA 4HEA2 2WRTA 1G7OA 3RPNA 1YEXA 22GSA 4O7HA 2DSAA 4L0UA 2B1LA 3ZIJA 4OFTA 3QAGA 5G2ZA 1ERUA 2JACA 3GUSA 5C00A 2HSHA 4KX4A 4YQUA 2L57A 2E0QA 1GUHA 2YZHA 2O89A 2G2QA 1TRVA 3WT2A 11GSA 1GUKA 4JR4A 4MH2A 5D9TA 5G30A 1B8XA 2KLXA 1O73A 3LYKA 5FT3A 1G6WA 3IAM2 3EU4A 2IWTA 4GQCA 4KH7A 4X0XA 4D73A 3D22A 2LRCA 2DJ0A 3IAS2 4HQZA 5EVOA 4AJ8A 2R4VA 3NIVA 3FRCA 1GTBA 2C8UA 5D93A 2FWHA 1K0BA 1ZOFA 4ZILA 3A2VA 1PX7A 5F0GA 4FYCA 4OO4A 2WFCA 3C71A 2C1YA 3C1SA 3RBTA 4F9ZA 3DVXA 2WS2A 1WPIA 1KBNA 1TKDB 4POMA 5ECRB 2CAQA 2VCTA 1K0CA 4IP1A 4E8EA 4WETA 3TRPA 2A2SA 2X99A 2RUEA 3LEFA 3Q18A 2B5EA 4OD7A 4LMWA 2H1GA 1M7TA 4MJBA 20GSA 4KSOA 2CAIA 4G9HA 2B3SA 3L9SA 5GSSA 3APSA 1ZL9A 2FLSA 3U6VA 4K7OA 2R6KA 3FYGA 5CRGA 3MSZA 5IMCA 3EWLA 3BOAA 5ECMB 1T8EB 4E8HA 4MPGA 1XWCA 2MBTA 5J3RA 2H66A 1H75A 3VWWA 4GRFA 1WE0A 5B6NA 4K9ZA 2N5BA 1XVWA 4OCFA 2IMKA 1G7EA 1RQMA 1X9SB 5B8BA 3VWVA 1V57A 2DJJA 3A2XA 5ECLB 1SKSB 1M2DA 3HYPA 4JBBA 1JZWA 1A2MA 2H01A 3DGQA 4ZB9A 5A4UA 1AQVA 3W6GA 1XFLA 3UJ1A 2HRNA 3SWLA 2XPEA 4TXOB 3QAWA 3D6IA 3WD6A 1XOAA 1SENA 1ZGNA 2IPAA 3A5WA 3TRQA 2ZUPA 6GSSA 2K8VA 2AUVA 1FW1A 4CHSA 1J9BA 4PQ1A 2CVKA 1EEMA 4L8EA 3KJYA 1KEBA 5CRHA 4XS6A 4QL9A 4F2IA 1RW1A 4BA7A 1CQGA 2H74A 3ZL5A 2RIIA 1ML6A 2N5AA 5DDLA 2KP1A 2H0HA 1TXXA 2DIYA 3F8UA 1T1VA 4EC0A 4EVMA 4NPBA 4BWQA 3LJRA 4IELA 5GZZB 5JCWA 1B4QA 2IMEA 4I2TA 13GSA 2PBJA 3IC4A 4AGSA 1YKCA 2FHEA 5C04A 2H1AA 2O7KA 4I6XA 3BJ5A 4XRDA 3EURA 1K3LA 3FZ4A 3RHCA 3WGDA 2OE3A 2K9FA 3M9JA 4OCEA 1PL1A 3F6DA 3QPMA 16GSA 5H5SA 2GT6A 2CVBA 1VF3A 5G5EA 4CW9A 3Q19A 2VUPA 2OKAA 4TVEA 4XS1A 3EMXA 4RQRA 18GSA 1Z5YE 2AAWA 1T00A 3JCML 3W8JA 3VURA 1QUWA 3Q74A 1XCCA 5ECSA 4KDUA 1PA3A 1YY7A 5LD0A 2IIYA 2MMAA 4NV5A 3UBLA 4HS1A 3MAKA 1PGTA 1K0MA 3TUEA 4G2EA 1FB0A 5IMDA 4KDXA 4J2FA 1B9XC 1DE1A 1XXUA 3ME7A 4YH2A 4AJ7A 3H79A 1SKWB 4IJIA 1GSQA 5E4WA 5B6MA 3E3EA 4FYBA 1ERVA 1XVQA 4PQHA 4BPYA 4MABA 1T7PB 4ZL7A 2VLVA 2KHPA 4H86A 2MZCA 5J9BA 1F3AA 4IHUA 5B7CA 4QQ7A 3KP8A 3VK9A 1FVKA 3DVWA 1T3BA 2GS3A 2DMLA 5B8AA 2X8HA 2HRFA 5CP1A 3G7IA 3IDVA 1JLWA 4K2DA 5AISA 5F07A 1PL2A 1SJIA 3GSTA 1ZMAA 5GSTA 4MZCA 5G5FA 2OBKA 2EIOA 2M72A 2PPTA 5F8BA 1GRXA 1W89A 3FZAA 2FNOA 2GZPA 3CSHA 3O76A 2H71A 2B7JA 3C7MA 4ZB6A 2VL2C 1HQOA 2B7KA 4JE1A 1EOGA 2TIRA 3IK7A 4G19A 1VRSD 4JR6A 2HZFA 3ZVJA 3PR8A 1W4VA 4Q5NA 5CAXA 5KN1A 3P90A 4PGTA 4LL4B 2KOKA 3F4SA 5HQPA 2H6YA 1Z9HA 1GSUA 3H1NA 1B9YC 2A4VA 3GFKA 3GTUA 2WB9A 4K1FA 2DMMA 1S3DA 2GTUA 3IR4A 4TR0A 1JZDA 2B5YA 3IPZA 4GSTA 3VI5A 3KEBA 5G1LA 4DSQA 1QGVA 3ERWA 4MCUA 2BMXA 4EDZA 2LS5A 1OC9A 3DMLA 2JL4A 2FWGA 4TN8A 4FH8A 5E59A 1THXA 1X5CA 2YWMA 2MBSA 2OE0A 4PUAA 1IYHA 3HJPA 5D9XA 2FWEA 2YV7A 3C1RA 4EE0A 2IMDA 1TJDA 1Z7RA 1Q98A 2ALBA 2H19A 1A23A 3VWUA 3LXZA 3F4TA 1SL0B 4HZ2A 1M9BA 4MH3A 3FHKA 1TK0B 4IBPA 1C72A 5G1KA 3GSSA 3DXBA 1PKZA 2H75A 2O8VB 4GXZA 2QKEA 4TR3A 2V2GA 3UVTA 2M80A 5LNKe 1Y6EA 3GX8A 2PMTA 2GVPA 2VL9A 2LJKA 5GAND 2GSQA 5AGYA 2AV4A 4WR4A 3DD3A 2GLRA 2D2ZA 4GSNA 3V1WA 5HFGA 4HOJA 3IK9A 2O87A 4O92A 1E2YA 1TOFA 2C0EA 1AC1A 4KUNA 4ECBA 5J9CA 1OC9B 5GAPD 1B4PA 1F6MC 3F9UA 5D96A 1TI1A 3QDNA 3O6TA 3SBCA 1QXHA 4EDYA 2WJUA 2WGRA 4X43A 4TRXA 2H70A 1MD4A 4MJAA 2VCWA 3TB2A 1HNAA 3H93A 4L5OA 2OA7A 3ZMKA 1U88A 1XOBA 4ML1A 1WIKA 4N30A 3UEMA 2YWIA 1JHBA 1I5GA 4EXJA 2TRCP 5KEJA 2E7PA 4ECJA 4IW9A 4QL7A 4O32A 3TKSC 1QFNA 5IMVA 2VLTA 2DJ3A 1OC3A 4V1Ag 3F3RA 1SU9A 1TRUA 1AIUA 2PERA 2I81A 3MWHA 4PQIA 2FGXA 3I6AA 2R3XA 5G31A 1ZCPA 3OR5A 5INYA 3FY7A 4V1Ap 1OE8A 3EINA 1TU7A 1OC8A 4PXOA 3IOSA 2PUKC 2FA8A 3ME8A 1X5DA 4K0NA 3HVXA 4BVYA 2GQMA 1I9DA 1GH2A 2FA4A 1J0FA 1A0RP 2C3TA 3GKMA 1QMVA 3IBHA 3M1GA 4MF7A 3LYPA 6GSWA 4IVFA 4TKYA 1YF0A 5IPHA 1MDKA 1YDKA 4NHZA 3PH9A 4NMUA 3VFIA 5DCGA 4ZBBA 1O8WA 1N8JA 1U87A 4MJCA 2K8SA 2PVQA 1GUMA 3LG6A 3UOMA 2C4JA 2R2JA 4KDYA 2XBQA 3LWAA 4D73B 4ACSA 4RI7A 4MZBA 5IMFA 4GLTA 3IA1A 3TJBA 2YWNA 2H1DA 1Z3EA 3FEUA 1FHEA 3CRUA 3U5RE 4F0CA 2HFDA 3IRAA 1TK5B 2FUG2 1R5AA 2L6CA 5J5NA 8GSSA 4Q5QA 3GMFA 3HY2A 4I97A 1DSBA 2VOCA 3D0ZA 3TDGA 5ECKB 2CVDA 3IHQA 4EUYA 1QQ2A 3M8NA 1GL8A 4PNGA 1UN2A 1K0AA 4IP6A 2LSTA 3GNJA 1EZKA 4ZB8A 2XHFA 2DJKA 1SYRA 5IO0A 2F9SA 4MMMA 3TKSE 1XIYA 3I9V2 4KAEA 2MMNA 1XW9A 4DVCA 3UMAA 2ZNMA 3ZVJD 17GSA 4DSSA 1TTZA 5DBQA 1BG5A 2WDUA 4HDEA 1VF2A 1GTIA 1NSWA 4XTSA 1V9WA 5ECPB 4WF4A 2M46A 3D5JA 3KM6A 5ECOB 1AQXA 1ZYEA 4ZBAA 1YEPA 4PX1A 3CYNA 1A24A 4IJ3A 4N11A 2EIQA 3A3TA 1TU8A 1LJRA 2GQLA 5HFIA 4POKA 1OYJA 5ECIB 2MYGA 3EYTA 1MTCA 1U3IA 3QR6A 4EL1A 3VWXA 2YP6A 4ID0A 1A8LA 4GSSA 4GWRA 1RK4A 2F3MA 3HD5A 3ED3A 4K7IA 1BAYA 1PMTA 3TRXA 3GH6A 1CQHA 4GCIA 3TJGA 1R26A 1AAZA 4ZXGA 2LRTA 4NAXA 4GQFA 4MP4A 2VCVA 4DSSB 3TOUA 2LNTA 1X9MB 1G6YA 1FB6A 6GSVA 2HXKA 3F3QA 3HVSA 1K0NA 1K0OA 4OO5A 3H8QA 3L78A 1TDIA 2X8CA 3F4RA 2DIZA 2O85A 4HI7A 4ILFA 2I3YA 2H6ZA 3CXGA 1O8XA 2YWOA 2BJXA 1JZOA 1BQ7A 1F9MA 1TRSA 1FAAA 2VCXA 2DC5A 3G7JA 5JWRB 1PD21 1M2BA 3E9JB 1GSYA 5IMZA 4KB3A 3ZYWA 1VF4A 2XC2A 4ZIJA 2LRNA 5AIVA 3LORA 2P5RA 3VPQA 1XW5A 3FR6A 3HZ8A 4K0GA 4WBRD 2HE3A 1J08A 1WWJA 4ZL9A 4DSRA 3UBKA 2H72A 5CO3A 1SL1B 2JADA 2FY6A 5AN1A 2HLSA 1GSFA 1GLQA 2LV3A 5ECQB 5CRDA 1R7HA 3UAPA 5IQYA 1SJZA 5CNWA 1ABAA 4IN0A 4V2NA 2HZEA 3GX0A 1AUCA 4POLA 3KCMA 1GTAA 4HQSA 3FR9A 12GSA 4IGJA 2Z9SA 4ZL8A 4Q5RA 3QOUA 2PN8A 1XWKA 3GH9A 4EO3A 4POBA 1DBYA 4ZBDA 3GA4A 4WXTA 4EF0A 1PSQA 3DYRA 1HYUA 3BCKA 3ZRDA 1EV4A 1OVNA 5ID2A 3ERFA 1YF1A 3S9FA 1LBKA 1GSEA 1OKDA 4K7NA 3LGCA 1DUGA 5DAKA 2C80A 2H76A 2CT6A 6GSXA 2FWFA 2YV9A 1Y25A 3UIWA 4LA1A 1F2EA 4PNFA 2BTOT 1NW2A 4YAPA 2OJLA 3CRTA 4ULXA 3AY8A 3KMNA 3D4MA 1XWAA 3F63A 3ISOA 3QAVA 1HNCA 2VCZA 3HHVA 2HZEB 5IM9A 2B1KA 4ECCA 4YQMA 1T4YA 3US3A 1XWGA 2GGTA 4MA9A 3HZ4A 3D4TA 3D21A 3J7Yb 1EV9A 5DQSA 1ERTA 1EP7A 4PUFC 1MDJA 3GKNA 4RI6A 4FIWA 3BBYA 4K6XA 2K6VA 1OAZA 5KN2A 1GLPA 4IS0A 1AXDA 2OADA 4MJEA 3QD9A 5ID2B 4TR1A 4KW6A 5DALA 2IMIA 4O5RA 2GZYA 2JSYA 3APOA 5DAKB 2QGVA 1N2AA 2CQ9A 4GTUA 2PU9C 4LLRA 1QK8A 5F06A 1GWCA 3KXOA 4XRAA 1WOUA 3M3MA 1R5PA 1SJ6A 3KH7A 2XPDA 4OFNA 2B5XA 4IQAA 1MD3A 3TOTA 10GSA 4WBJA 1WP0A 5ELGA 1TW9A 5IOXA 3GL5A 4X1UA 2HNLA 2LJRA 5CRWA 1V58A 2JZTA 3TCOA 2PWJA 3MDKA 2CZ3A 3KD0A 5J41A 1EOHA 3ZTLA 4P3YB 4BVXA 4JU5A 3LSZA 4JEDA 1YQ1A 3HKRA 3W8SA 4AJ6A 5FHIA 3HJMA 5HR1A 1PN9A 1BEDA 5AIXA 2V32A 2DJ2A 4MLYA 1EWXA 5JCGA 4Q5FA 3GTUB 2H73A 3VPTA 4RUVA 5CYYA 3DKSA 1FVJA 2HSYA 5DJLA 3TKQA 4LMVA 1V40A 2IJYA 4KE3A 2VLUA 4F03A 2QC7A 3ZLPA 2JZSA 1MEKA 2YANA 9GSSA 3TKPA 2B6MA 3KTLA 1WMJA 4DEJA 2V1MA 2I4AA 2F8FA 2HT9A 3HVVA 2CX3A 2QSIA 1Z6NA 4MF5A 3WGEA
chains in the Genus database with same CATH superfamily
1FOHA 1F37A 4HU7A 3UARA 3WYWA 3EMPA 1X5EA 1UA5A 2IFQA 1YJ6A 4BVXB 3QCPA 2NPBA 2UZ8A 2L4QA 4EKZA 3MNGA 2REMA 3WT1A 3GYKA 3O3TA 3ZIVA 5J4UA 1YZXA 5D73A 3QMXA 2GZZA 3IXRA 2E2MA 3R3EA 4TOPA 4OFMA 2CV4A 2YZUA 1ON4A 1BJXA 2GSSA 1WRYA 1SD8A 4KGIA 1A2LA 5A5KA 5EY6A 1XPVA 3EU3A 5IOWA 2HRAA 1H4OA 1XZOA 6GSYA 4WR5A 2R37A 3I69A 2FCHA 3DRNA 3M9KA 1ILOA 1ACVA 3TKRA 4ML6A 3FKFA 3MYDA 3J7Yk 2ZCTA 1HD2A 1URMA 5L71A 3DWVA 1IYIA 1EEJA 3GHAA 2XBIA 1SK2A 2I9HA 1UVZA 2RLIA 2IFQB 1NHYA 1JLVA 4MF6A 2CA8A 19GSA 2V6KA 2P5QA 2FD3A 3PINA 4MK3A 2LQOA 1R4WA 1PKWA 2F8AA 2R5GA 4KA0A 4Z2UA 3FK8A 3FZ9A 4J57E 4MZWA 2PGTA 1Z6MA 5JWOB 1EGOA 2GQKA 2LKUA 3FMWA 4TXOA 1KTEA 3VI7A 3HXSA 2LTKA 4N0VA 3QFBC 4KCEA 4HU9A 3GIXA 2X49A 5KN3A 3KP9A 2YJHA 1HNBA 3Q6OA 1UC7A 3BD2A 2IMFA 3EC3A 5LCZA 4F82A 4NHWA 4I2UA 1TP9A 1M9AA 4BVYB 2L5OA 5EPFA 3APQA 5IO2A 2N5FA 2P0GA 4V2LA 2VL2A 2KP2A 1ZYNA 3P8WA 5ECNB 3GV1A 1TK8B 2LQQA 2VD0A 2IN3A 2YNXA 3RAZA 2OACA 3FR3A 1M99A 2AHEA 2C3NA 4MDCA 5JCUA 5COHA 3CSJA 4L5LA 5H5RA 2JZRA 3DIEA 2GT5A 1Q4JA 4G0KA 2X8GA 4MPFA 3TJJA 2ON7A 4V2MA 4NXIA 2H8LA 2I1UA 1ERWA 2H30A 2HI7A 2VAFA 5A4VA 1A0FA 1PQNA 3FW2A 3P2AA 2C0FA 2DJ1A 4RQXA 4GF0A 1SK0A 5DVBA 1GP1A 3DEXA 5EL8A 1XWBA 5HR2A 3C73A 4XIHA 3GL3A 2VM2A 3PGTA 1ZZYA 2NBSA 4AF2A 1SD9A 3ZITA 1FO5A 3EE2A 3GURA 4XCSA 3KGKA 14GSA 5CREA 4CY8A 2JU5A 3EVIA 5F05A 3WGXA 3CTGA 3ZREA 1PX6A 2TRXA 2GSTA 4HJMA 1XBSA 2RM6A 2GDRA 4IKHA 5HR0A 2VO4A 1Z7PA 3NZNA 1AW9A 2KUCA 1TRWA 2E2GA 3ZZXA 3HDCA 1ST9A 2MMOA 2J9HA 1USBA 1SKRB 1VF1A 2IL3A 4BL7A 2C0DA 1GSDA 5IMAA 1YKAA 2LNSA 2LUSA 1GULA 4YQVA 2VL3A 4WF5A 1WJKA 3E0UA 4CDOA 1DE2A 3GKXA 4XHMA 1O81A 1NHOA 2YJ7A 4WEYA 4J56E 1GNEA 2VD1A 4N0ZA 3TGZA 5HR3A 3RHBA 4XS4A 1S3AA 1THOA 2ES7A 2OE1A 1O85A 1TI3A 4HZ4A 2EC4A 2R0PA 5FWGA 4JZQA 2VCQA 4G10A 2YPMA 2RUFA 3HA9A 3KIJA 1SK1A 2L5LA 1A8YA 3TKSA 2VM1A 3R2QA 2L4CA 2X64A 4TR4A 4F0BA 4OMVA 2AYTA 5DJMA 2L6DA 3GN3A 3HCZA 2NVLA 5D8IA 5DQYA 1FOVA 4KCAA 4LL1B 3KZQA 1NM3A 3F6FA 2RM5A 3N9JA 1X0RA 4BL7B 3LQ7A 4I8BA 2EIRA 3G7YA 3LXTA 1EP8A 1MDIA 2WCIA 3F0IA 1EGRA 5KN0A 2C3QA 3GRXA 4NV2A 3IE3A 1OKTA 2F51A 2WZ9A 3P7XA 4BWSA 1K3OA 1B48A 3G9BA 3H4KA 3RPPA 4N10A 1XW6A 2V41A 3FZ5A 3IV4A 2J23A 4XS4B 4YAVA 1OE7A 2VIMA 3M0FA 2OBIA 5ABRA 3KH9A 2DKHA 3CTFA 5DCHA 1PRXA 2H6XA 2LJAA 3KMOA 2WULA 1F3BA 5D9VA 4K8MA 4Z7XA 5IPGA 3ZFLA 1S3RA 4KNDA 1SYXA 2GSRA 1FG4A 1SL2B 4HUAA 3CBUA 1GNWA 3BCIA 3RDWA 2LEGA 2H0GA 2AJQB 1GSSA 4OWYA 3A2WA 2H0IA 5D9WA 4KSMA 1VGLA 4FYUA 2JSZA 5IIZA 4ISDA 2R0CA 5A4WA 1JFUA 2MMZA 2G0FA 3ZFBA 2C0GA 3ZMLA 3C8EA 1A2JA 1G0TA 3CMIA 2NTOA 2A2RA 2YOIA 4FO5A 1K3YA 1GTUA 2H1BA 4TXVA 4HJ2A 3CSIA 3K8NA 1ZYQB 5HFKA 3HJOA 3UL3A 3L4NA 2V6OA 3VLNA 2NDOA 1M2AA 2HYXA 4WKWA 2P31A 4NWYA 3ERGA 4JRRA 1O6JA 2L59A 3GKKA 5H5QA 5ENUA 4IQ1A 2YCDA 3I43A 3L9UA 1S3CA 1BYEA 3LFLA 1BX9A 3UVHA 1U6TA 3KTBA 2DBCA 3TJKA 2ON5A 1V98A 1O7UA 1V2AA 4PURA 4ECIA 3TJFA 6GSTA 1U3AA 5ECHB 1M0UA 2YN1A 5JWQB 2PVOC 3HVNA 5ELAA 1KNGA 2DLXA 7GSSA 4TR1B 4I5QA 5DALB 2AB6A 2CX4A 1E6BA 1LU4A 1K0DA 1JZRA 3QFAC 2CZ2A 4L0WA 3N5OA 2K18A 1X9WB 1AQWA 3L0HA 3NOFA 6GSUA 4TW5A 3L9VA 1T4ZA 4HEA2 2WRTA 1G7OA 3RPNA 1M3IA 1YEXA 22GSA 4O7HA 2DSAA 4L0UA 2B1LA 3ZIJA 4OFTA 3QAGA 5G2ZA 1ERUA 2JACA 3GUSA 5C00A 2HSHA 4KX4A 4YQUA 2L57A 2E0QA 1GUHA 2YZHA 2O89A 2G2QA 1TRVA 3WT2A 11GSA 1GUKA 4JR4A 4MH2A 4MNNA 4O5UA 5D9TA 5G30A 1B8XA 2KLXA 1O73A 3LYKA 5FT3A 1G6WA 3IAM2 3EU4A 2IWTA 4GQCA 4KH7A 4X0XA 4D73A 3D22A 2LRCA 2DJ0A 3IAS2 4YKFA 4HQZA 5EVOA 4AJ8A 2R4VA 3NIVA 3FRCA 1GTBA 2C8UA 5D93A 2FWHA 1K0BA 1ZOFA 2HRKA 4ZILA 3A2VA 1PX7A 5F0GA 4FYCA 4OO4A 2WFCA 3C71A 2C1YA 3C1SA 3RBTA 1ZYPA 4F9ZA 3DVXA 2WS2A 1WPIA 1KBNA 1TKDB 4POMA 5ECRB 2CAQA 2VCTA 1K0CA 4IP1A 4E8EA 4WETA 3TRPA 2A2SA 2X99A 2RUEA 3LEFA 3Q18A 2B5EA 4OD7A 4LMWA 2H1GA 1M7TA 4MJBA 20GSA 4KSOA 2CAIA 4G9HA 2B3SA 3L9SA 5GSSA 3APSA 1ZL9A 2FLSA 3U6VA 4K7OA 2R6KA 3FYGA 5CRGA 3MSZA 5IMCA 3EWLA 3BOAA 5ECMB 1T8EB 4E8HA 4MPGA 1XWCA 2MBTA 5J3RA 2H66A 1H75A 3VWWA 4GRFA 1WE0A 5B6NA 4K9ZA 2N5BA 1XVWA 4OCFA 2IMKA 2HSMA 1G7EA 1RQMA 1X9SB 5B8BA 3VWVA 1V57A 2DJJA 3A2XA 4ICYA 5ECLB 1SKSB 1M2DA 3HYPA 4JBBA 1JZWA 1A2MA 2H01A 3DGQA 4ZB9A 5A4UA 1AQVA 3W6GA 1XFLA 3UJ1A 2HRNA 3SWLA 2XPEA 4TXOB 3QAWA 3D6IA 3WD6A 1XOAA 1SENA 1ZGNA 2IPAA 3A5WA 3TRQA 2ZUPA 6GSSA 2K8VA 2AUVA 1FW1A 4EIPA 4CHSA 1J9BA 4PQ1A 2CVKA 1EEMA 4L8EA 3KJYA 1KEBA 5CRHA 4XS6A 4QL9A 4F2IA 1RW1A 1XG8A 4BA7A 1CQGA 2H74A 3ZL5A 2QA2A 2RIIA 4HSCX 4K5RA 1ML6A 2N5AA 3A5IA 5DDLA 2KP1A 2H0HA 1TXXA 2DIYA 3F8UA 1T1VA 4EC0A 4EVMA 4NPBA 4BWQA 3LJRA 4IELA 5GZZB 5JCWA 1B4QA 2IMEA 4KF9A 4I2TA 13GSA 2PBJA 3IC4A 4AGSA 1YKCA 2FHEA 5C04A 2H1AA 2O7KA 4I6XA 3BJ5A 4XRDA 3EURA 1K3LA 3FZ4A 3RHCA 3WGDA 2OE3A 2K9FA 3M9JA 4OCEA 1PL1A 3F6DA 3QPMA 16GSA 5H5SA 2GT6A 2CVBA 1VF3A 5G5EA 4CW9A 3Q19A 2VUPA 2OKAA 4TVEA 4XS1A 3EMXA 4RQRA 18GSA 1Z5YE 2AAWA 1T00A 3JCML 4PTSA 3W8JA 3VURA 1QUWA 3Q74A 1XCCA 5ECSA 4KDUA 1PA3A 1YY7A 5LD0A 2IIYA 2MMAA 4NV5A 3UBLA 4HS1A 3MAKA 1PGTA 1K0MA 3TUEA 4G2EA 1FB0A 5IMDA 4KDXA 4J2FA 1B9XC 1DE1A 1XXUA 3ME7A 4YH2A 4AJ7A 3H79A 1SKWB 4IJIA 1PFOA 1GSQA 5E4WA 5B6MA 3E3EA 4FYBA 1ERVA 1XVQA 4PQHA 4BPYA 4MABA 4EIQA 1T7PB 4ZL7A 2VLVA 2KHPA 4H86A 2MZCA 5J9BA 1F3AA 4IHUA 5B7CA 4QQ7A 3KP8A 3VK9A 1FVKA 3DVWA 1T3BA 2GS3A 2DMLA 5B8AA 2X8HA 2HRFA 5CP1A 3G7IA 3IDVA 1JLWA 2A2PA 4K2DA 5AISA 5F07A 1PL2A 1SJIA 3GSTA 1ZMAA 5GSTA 4MZCA 5G5FA 2OBKA 2EIOA 2M72A 2PPTA 5F8BA 4K5SA 4Z2RA 1GRXA 1W89A 3FZAA 2FNOA 2GZPA 3CSHA 3MIXA 3O76A 2H71A 2B7JA 3C7MA 4ZB6A 2VL2C 1HQOA 2B7KA 4JE1A 1EOGA 2TIRA 3IK7A 4G19A 1VRSD 4JR6A 2HZFA 3ZVJA 3PR8A 1W4VA 4Q5NA 5CAXA 5KN1A 3P90A 4PGTA 4LL4B 2KOKA 3F4SA 5HQPA 2H6YA 1Z9HA 1GSUA 3H1NA 1B9YC 2A4VA 3GFKA 3GTUA 2WB9A 4K1FA 2DMMA 1S3DA 2GTUA 3IR4A 4TR0A 1JZDA 2B5YA 3IPZA 4GSTA 3VI5A 3KEBA 5G1LA 4DSQA 1QGVA 3ERWA 4MCUA 2BMXA 4EDZA 2LS5A 1OC9A 3DMLA 2JL4A 2FWGA 4TN8A 4FH8A 5E59A 1THXA 1X5CA 2YWMA 2MBSA 2OE0A 4PUAA 1IYHA 3HJPA 5D9XA 2FWEA 2YV7A 3C1RA 4EE0A 2IMDA 1TJDA 1Z7RA 1Q98A 2ALBA 2H19A 1A23A 3VWUA 3LXZA 3F4TA 1SL0B 4HZ2A 1M9BA 4MH3A 3FHKA 1TK0B 4IBPA 1C72A 5G1KA 3GSSA 3DXBA 1PKZA 2H75A 2O8VB 4GXZA 2QKEA 4TR3A 2V2GA 3UVTA 2M80A 5LNKe 1Y6EA 3GX8A 2PMTA 2GVPA 2VL9A 4USSA 2LJKA 5GAND 2GSQA 5AGYA 2AV4A 4WR4A 3DD3A 4K2XA 2GLRA 2D2ZA 4GSNA 3V1WA 5HFGA 4HOJA 3IK9A 2O87A 4O92A 1E2YA 1TOFA 2C0EA 1AC1A 4KUNA 4ECBA 5J9CA 1OC9B 5GAPD 1B4PA 1F6MC 3F9UA 5D96A 1TI1A 3QDNA 3O6TA 3SBCA 1QXHA 4EDYA 2WJUA 2WGRA 4X43A 4TRXA 2H70A 1PN0A 1MD4A 4MJAA 2VCWA 3TB2A 1HNAA 3H93A 4L5OA 2OA7A 3ZMKA 1U88A 1XOBA 4ML1A 1WIKA 4N30A 3UEMA 2YWIA 1JHBA 1I5GA 4EXJA 2TRCP 4G0LA 5KEJA 2E7PA 4ECJA 4IW9A 4QL7A 4O32A 3TKSC 1QFNA 5IMVA 2VLTA 2DJ3A 1OC3A 4V1Ag 3F3RA 4G0IA 1SU9A 1TRUA 1AIUA 2PERA 2I81A 3MWHA 1M3JA 4PQIA 2FGXA 3I6AA 2R3XA 5G31A 1ZCPA 3OR5A 5INYA 3FY7A 4V1Ap 1OE8A 3EINA 1TU7A 1OC8A 4PXOA 3IOSA 2PUKC 2FA8A 3ME8A 1X5DA 4K0NA 3HVXA 4BVYA 3PPUA 2GQMA 1I9DA 1GH2A 2FA4A 1J0FA 1A0RP 2C3TA 3GKMA 1QMVA 3IBHA 3M1GA 4MF7A 3LYPA 6GSWA 4IVFA 4TKYA 1YF0A 5IPHA 1MDKA 1YDKA 4NHZA 3PH9A 4NMUA 3VFIA 5DCGA 4ZBBA 1O8WA 1N8JA 1U87A 4MJCA 2K8SA 2PVQA 1GUMA 3LG6A 3UOMA 2C4JA 2R2JA 4KDYA 2XBQA 3IC8A 3LWAA 4D73B 4ACSA 4RI7A 4MZBA 5IMFA 4GLTA 3IA1A 3TJBA 2YWNA 2H1DA 1Z3EA 3FEUA 4CY6A 1FHEA 3CRUA 3U5RE 4F0CA 2HFDA 3IRAA 1TK5B 2FUG2 1R5AA 2L6CA 5J5NA 8GSSA 4Q5QA 3GMFA 3HY2A 4I97A 1DSBA 2VOCA 3D0ZA 3CQFA 5ECKB 2CVDA 3TDGA 3IHQA 4EUYA 1QQ2A 5BRTA 3M8NA 1GL8A 4PNGA 1UN2A 1K0AA 4IP6A 2LSTA 2X4AA 3GNJA 1EZKA 4ZB8A 2XHFA 2DJKA 1SYRA 5IO0A 2F9SA 4MMMA 3TKSE 1XIYA 3I9V2 4KAEA 2MMNA 4YKGA 1XW9A 4DVCA 3UMAA 2ZNMA 3ZVJD 17GSA 4DSSA 1TTZA 5DBQA 1BG5A 2WDUA 4BIKA 2QA1A 4HDEA 1VF2A 1GTIA 1NSWA 4XTSA 1V9WA 5ECPB 4WF4A 2M46A 3D5JA 3KM6A 5ECOB 1AQXA 1ZYEA 4ZBAA 1YEPA 4PX1A 3CYNA 1A24A 4IJ3A 4N11A 2EIQA 3A3TA 1TU8A 1LJRA 2GQLA 4A5PA 5HFIA 4POKA 1OYJA 5ECIB 2MYGA 3EYTA 1MTCA 1U3IA 3QR6A 4EL1A 3VWXA 2YP6A 4ID0A 1A8LA 4GSSA 4GWRA 1RK4A 2F3MA 3HD5A 3ED3A 4K7IA 1BAYA 1PMTA 3TRXA 3GH6A 4X4JA 1CQHA 4GCIA 3TJGA 1R26A 1AAZA 4ZXGA 2LRTA 4NAXA 4GQFA 4MP4A 2VCVA 4DSSB 3TOUA 2LNTA 1X9MB 1G6YA 1FB6A 6GSVA 2HXKA 3F3QA 3HVSA 1K0NA 1K0OA 4OO5A 3H8QA 3L78A 1TDIA 2X8CA 3F4RA 2DIZA 2O85A 4HI7A 4ILFA 2I3YA 2H6ZA 3CXGA 1O8XA 2YWOA 2BJXA 1JZOA 1BQ7A 1F9MA 1TRSA 1FAAA 2VCXA 2DC5A 3G7JA 5JWRB 1PD21 1M2BA 3E9JB 1GSYA 5IMZA 4KB3A 3ZYWA 1VF4A 2XC2A 4ZIJA 2LRNA 5AIVA 3LORA 2P5RA 3VPQA 1XW5A 3FR6A 3HZ8A 4K0GA 4WBRD 2HE3A 1J08A 1WWJA 4ZL9A 3IHGA 4DSRA 3UBKA 2H72A 5CO3A 1SL1B 2JADA 2FY6A 5AN1A 2HLSA 1GSFA 1GLQA 2LV3A 5ECQB 5CRDA 1R7HA 3UAPA 5IQYA 1SJZA 5CNWA 1ABAA 4IN0A 4V2NA 2HZEA 3GX0A 1AUCA 4POLA 3KCMA 1GTAA 4HQSA 3FR9A 12GSA 4IGJA 2Z9SA 4ZL8A 4Q5RA 3QOUA 2A4HA 1XWKA 2PN8A 3GH9A 4EO3A 4POBA 1DBYA 4ZBDA 3GA4A 4WXTA 4EF0A 1PSQA 3DYRA 1HYUA 3BCKA 3ZRDA 1EV4A 1OVNA 5ID2A 3ERFA 1YF1A 3S9FA 1LBKA 1GSEA 1OKDA 4K7NA 3LGCA 1DUGA 5DAKA 2C80A 2H76A 2CT6A 4Z2TA 6GSXA 2FWFA 2YV9A 1Y25A 3UIWA 4LA1A 1F2EA 4PNFA 2BTOT 1NW2A 4YAPA 2OJLA 3CRTA 4ULXA 3AY8A 3KMNA 3D4MA 1XWAA 3F63A 3ISOA 3QAVA 5KOXA 2R0GA 1HNCA 2VCZA 3HHVA 2HZEB 5IM9A 2B1KA 4ECCA 4YQMA 1T4YA 3US3A 1XWGA 2GGTA 4MA9A 3HZ4A 3D4TA 3D21A 3J7Yb 1EV9A 2DKIA 5BMUA 5DQSA 1ERTA 5KOWA 1EP7A 4PUFC 1MDJA 3GKNA 4RI6A 4FIWA 3BBYA 4K6XA 2K6VA 1OAZA 5KN2A 1GLPA 4IS0A 1AXDA 2OADA 4MJEA 3QD9A 5ID2B 4TR1A 4KW6A 5DALA 2IMIA 4O5RA 2GZYA 2JSYA 3EPTA 3APOA 5DAKB 2QGVA 1N2AA 2CQ9A 4GTUA 2PU9C 4LLRA 1QK8A 5F06A 1GWCA 3KXOA 4XRAA 1WOUA 3M3MA 1R5PA 1SJ6A 3KH7A 4O5QA 2XPDA 4OFNA 2B5XA 4IQAA 1MD3A 3TOTA 10GSA 4WBJA 1WP0A 5ELGA 1TW9A 5IOXA 3GL5A 4X1UA 2HNLA 2LJRA 5CRWA 1V58A 2JZTA 3TCOA 2PWJA 3MDKA 2CZ3A 3KD0A 5J41A 3LW9A 1EOHA 3ZTLA 4P3YB 4BVXA 4JU5A 3LSZA 4JEDA 1YQ1A 3HKRA 3W8SA 4AJ6A 5FHIA 3HJMA 5HR1A 1PN9A 1BEDA 5AIXA 2V32A 2DJ2A 4MLYA 1EWXA 5JCGA 4Q5FA 3GTUB 2H73A 3VPTA 4RUVA 5CYYA 3DKSA 1FVJA 2HSYA 5DJLA 3TKQA 4LMVA 4FQUA 1V40A 2IJYA 4KE3A 2VLUA 4F03A 2QC7A 3ZLPA 2JZSA 1MEKA 2YANA 9GSSA 3TKPA 2B6MA 3KTLA 1WMJA 4DEJA 2V1MA 2I4AA 2F8FA 2HT9A 3HVVA 2CX3A 2QSIA 1Z6NA 4MF5A 3WGEA
chains in the Genus database with same CATH topology
1FOHA 1F37A 4HU7A 3UARA 3WYWA 3EMPA 1X5EA 1UA5A 2IFQA 1YJ6A 4BVXB 3QCPA 2NPBA 2UZ8A 2L4QA 4EKZA 3MNGA 2REMA 3WT1A 3GYKA 3O3TA 3ZIVA 5J4UA 1YZXA 5D73A 3QMXA 2GZZA 3IXRA 2E2MA 3R3EA 4TOPA 4OFMA 2CV4A 2YZUA 1ON4A 1BJXA 2GSSA 1WRYA 1SD8A 4KGIA 1A2LA 5A5KA 5EY6A 1XPVA 3EU3A 5IOWA 2HRAA 1H4OA 1XZOA 6GSYA 4WR5A 2R37A 3I69A 2FCHA 3DRNA 3M9KA 1ILOA 1ACVA 3TKRA 4ML6A 3FKFA 3MYDA 3J7Yk 2ZCTA 1HD2A 1URMA 5L71A 3DWVA 1IYIA 1EEJA 3GHAA 2XBIA 1SK2A 2I9HA 1UVZA 2RLIA 2IFQB 1NHYA 1JLVA 4MF6A 2CA8A 19GSA 2V6KA 2P5QA 2FD3A 3PINA 4MK3A 2LQOA 1R4WA 1PKWA 2F8AA 2R5GA 4KA0A 4Z2UA 3FK8A 3FZ9A 4J57E 4MZWA 2PGTA 1Z6MA 5JWOB 1EGOA 2GQKA 2LKUA 3FMWA 4TXOA 1KTEA 3VI7A 3HXSA 2LTKA 4N0VA 3QFBC 4KCEA 4HU9A 3GIXA 2X49A 5KN3A 3KP9A 2YJHA 1HNBA 3Q6OA 1UC7A 3BD2A 2IMFA 3EC3A 5LCZA 4F82A 4NHWA 4I2UA 1TP9A 1M9AA 4BVYB 2L5OA 5EPFA 3APQA 5IO2A 2N5FA 2P0GA 4V2LA 2VL2A 2KP2A 1ZYNA 3P8WA 5ECNB 3GV1A 1TK8B 2LQQA 2VD0A 2IN3A 2YNXA 3RAZA 2OACA 3FR3A 1M99A 2AHEA 2C3NA 4MDCA 5JCUA 5COHA 3CSJA 4L5LA 5H5RA 2JZRA 3DIEA 2GT5A 1Q4JA 4G0KA 2X8GA 4MPFA 3TJJA 2ON7A 4V2MA 4NXIA 2H8LA 2I1UA 1ERWA 2H30A 2HI7A 2VAFA 5A4VA 1A0FA 1PQNA 3FW2A 3P2AA 2C0FA 2DJ1A 4RQXA 4GF0A 1SK0A 5DVBA 1GP1A 3DEXA 5EL8A 1XWBA 5HR2A 3C73A 4XIHA 3GL3A 2VM2A 3PGTA 1ZZYA 2NBSA 4AF2A 1SD9A 3ZITA 1FO5A 3EE2A 3GURA 4XCSA 3KGKA 14GSA 5CREA 4CY8A 2JU5A 3EVIA 5F05A 3WGXA 3CTGA 3ZREA 1PX6A 2TRXA 2GSTA 4HJMA 1XBSA 2RM6A 2GDRA 4IKHA 5HR0A 2VO4A 1Z7PA 3NZNA 1AW9A 2KUCA 1TRWA 2E2GA 3ZZXA 3HDCA 1ST9A 2MMOA 2J9HA 1USBA 1SKRB 1VF1A 2IL3A 4BL7A 2C0DA 1GSDA 5IMAA 1YKAA 2LNSA 2LUSA 1GULA 4YQVA 2VL3A 4WF5A 1WJKA 3E0UA 4CDOA 1DE2A 3GKXA 4XHMA 1O81A 1NHOA 2YJ7A 4WEYA 4J56E 1GNEA 2VD1A 4N0ZA 3TGZA 5HR3A 3RHBA 4XS4A 1S3AA 1THOA 2ES7A 2OE1A 1O85A 1TI3A 4HZ4A 2EC4A 2R0PA 5FWGA 4JZQA 2VCQA 4G10A 2YPMA 2RUFA 3HA9A 3KIJA 1SK1A 2L5LA 1A8YA 3TKSA 2VM1A 3R2QA 2L4CA 2X64A 4TR4A 4F0BA 4OMVA 2AYTA 5DJMA 2L6DA 3GN3A 3HCZA 2NVLA 5D8IA 5DQYA 1FOVA 4KCAA 4LL1B 3KZQA 1NM3A 3F6FA 2RM5A 3N9JA 1X0RA 4BL7B 3LQ7A 4I8BA 2EIRA 3G7YA 3LXTA 1EP8A 1MDIA 2WCIA 3F0IA 1EGRA 5KN0A 2C3QA 3GRXA 4NV2A 3IE3A 1OKTA 2F51A 2WZ9A 3P7XA 4BWSA 1K3OA 1B48A 3G9BA 3H4KA 3RPPA 4N10A 1XW6A 2V41A 3FZ5A 3IV4A 2J23A 4XS4B 4YAVA 1OE7A 2VIMA 3M0FA 2OBIA 5ABRA 3KH9A 2DKHA 3CTFA 5DCHA 1PRXA 2H6XA 2LJAA 3KMOA 2WULA 1F3BA 5D9VA 4K8MA 4Z7XA 5IPGA 3ZFLA 4KNDA 1SYXA 2GSRA 1FG4A 1SL2B 4HUAA 3CBUA 1GNWA 3BCIA 3RDWA 2LEGA 2H0GA 2AJQB 1GSSA 4OWYA 3A2WA 2H0IA 5D9WA 4KSMA 1VGLA 4FYUA 2JSZA 5IIZA 4ISDA 2R0CA 5A4WA 1JFUA 2MMZA 2G0FA 3ZFBA 2C0GA 3ZMLA 3C8EA 1A2JA 1G0TA 3CMIA 2NTOA 2A2RA 2YOIA 4FO5A 1K3YA 1GTUA 2H1BA 4TXVA 4HJ2A 3CSIA 3K8NA 1ZYQB 5HFKA 3HJOA 3UL3A 3L4NA 2V6OA 3VLNA 2NDOA 1M2AA 2HYXA 4WKWA 2P31A 4NWYA 3ERGA 4JRRA 1O6JA 2L59A 3GKKA 5H5QA 5ENUA 4IQ1A 2YCDA 3I43A 3L9UA 1S3CA 1BYEA 3LFLA 1BX9A 3UVHA 1U6TA 3KTBA 2DBCA 3TJKA 2ON5A 1V98A 1O7UA 1V2AA 4PURA 4ECIA 3TJFA 6GSTA 1U3AA 5ECHB 1M0UA 2YN1A 5JWQB 2PVOC 5ELAA 1KNGA 2DLXA 7GSSA 4TR1B 4I5QA 5DALB 2AB6A 2CX4A 1E6BA 1LU4A 1K0DA 1JZRA 3QFAC 2CZ2A 4L0WA 3N5OA 2K18A 1X9WB 1AQWA 3L0HA 3NOFA 6GSUA 4TW5A 3L9VA 1T4ZA 4HEA2 2WRTA 1G7OA 3RPNA 1YEXA 22GSA 4O7HA 2DSAA 4L0UA 2B1LA 3ZIJA 4OFTA 3QAGA 5G2ZA 1ERUA 2JACA 3GUSA 5C00A 2HSHA 4KX4A 4YQUA 2L57A 2E0QA 1GUHA 2YZHA 2O89A 2G2QA 1TRVA 3WT2A 11GSA 1GUKA 4JR4A 4MH2A 4MNNA 4O5UA 5D9TA 5G30A 1B8XA 2KLXA 1O73A 3LYKA 5FT3A 1G6WA 3IAM2 3EU4A 2IWTA 4GQCA 4KH7A 4X0XA 4D73A 3D22A 2LRCA 2DJ0A 3IAS2 4YKFA 4HQZA 5EVOA 4AJ8A 2R4VA 3NIVA 3FRCA 1GTBA 2C8UA 5D93A 2FWHA 1K0BA 1ZOFA 2HRKA 4ZILA 3A2VA 1PX7A 5F0GA 4FYCA 4OO4A 2WFCA 3C71A 2C1YA 3C1SA 3RBTA 1ZYPA 4F9ZA 3DVXA 2WS2A 1WPIA 1KBNA 1TKDB 4POMA 5ECRB 2CAQA 2VCTA 1K0CA 4IP1A 4E8EA 4WETA 3TRPA 2A2SA 2X99A 2RUEA 3LEFA 3Q18A 2B5EA 4OD7A 4LMWA 2H1GA 1M7TA 4MJBA 20GSA 4KSOA 2CAIA 4G9HA 2B3SA 3L9SA 5GSSA 3APSA 1ZL9A 2FLSA 3U6VA 4K7OA 2R6KA 3FYGA 5CRGA 3MSZA 5IMCA 3EWLA 3BOAA 5ECMB 1T8EB 4E8HA 4MPGA 1XWCA 2MBTA 5J3RA 2H66A 1H75A 3VWWA 4GRFA 1WE0A 5B6NA 4K9ZA 2N5BA 1XVWA 4OCFA 2IMKA 2HSMA 1G7EA 1RQMA 1X9SB 5B8BA 3VWVA 1V57A 2DJJA 3A2XA 4ICYA 5ECLB 1SKSB 1M2DA 3HYPA 4JBBA 1JZWA 1A2MA 2H01A 3DGQA 4ZB9A 5A4UA 1AQVA 3W6GA 1XFLA 3UJ1A 2HRNA 3SWLA 2XPEA 4TXOB 3QAWA 3D6IA 3WD6A 1XOAA 1SENA 1ZGNA 2IPAA 3A5WA 3TRQA 2ZUPA 6GSSA 2K8VA 2AUVA 1FW1A 4EIPA 4CHSA 1J9BA 4PQ1A 2CVKA 1EEMA 4L8EA 3KJYA 1KEBA 5CRHA 4XS6A 4QL9A 4F2IA 1RW1A 4BA7A 1CQGA 2H74A 3ZL5A 2QA2A 2RIIA 4K5RA 1ML6A 2N5AA 3A5IA 5DDLA 2KP1A 2H0HA 1TXXA 2DIYA 3F8UA 1T1VA 4EC0A 4EVMA 4NPBA 4BWQA 3LJRA 4IELA 5GZZB 5JCWA 1B4QA 2IMEA 4KF9A 4I2TA 13GSA 2PBJA 3IC4A 4AGSA 1YKCA 2FHEA 5C04A 2H1AA 2O7KA 4I6XA 3BJ5A 4XRDA 3EURA 1K3LA 3FZ4A 3RHCA 3WGDA 2OE3A 2K9FA 3M9JA 4OCEA 1PL1A 3F6DA 3QPMA 16GSA 5H5SA 2GT6A 2CVBA 1VF3A 5G5EA 4CW9A 3Q19A 2VUPA 2OKAA 4TVEA 4XS1A 3EMXA 4RQRA 18GSA 1Z5YE 2AAWA 1T00A 3JCML 4PTSA 3W8JA 3VURA 1QUWA 3Q74A 1XCCA 5ECSA 4KDUA 1PA3A 1YY7A 5LD0A 2IIYA 2MMAA 4NV5A 3UBLA 4HS1A 3MAKA 1PGTA 1K0MA 3TUEA 4G2EA 1FB0A 5IMDA 4KDXA 4J2FA 1B9XC 1DE1A 1XXUA 3ME7A 4YH2A 4AJ7A 3H79A 1SKWB 4IJIA 1GSQA 5E4WA 5B6MA 3E3EA 4FYBA 1ERVA 1XVQA 4PQHA 4BPYA 4MABA 4EIQA 1T7PB 4ZL7A 2VLVA 2KHPA 4H86A 2MZCA 5J9BA 1F3AA 4IHUA 5B7CA 4QQ7A 3KP8A 3VK9A 1FVKA 3DVWA 1T3BA 2GS3A 2DMLA 5B8AA 2X8HA 2HRFA 5CP1A 3G7IA 3IDVA 1JLWA 2A2PA 4K2DA 5AISA 5F07A 1PL2A 1SJIA 3GSTA 1ZMAA 5GSTA 4MZCA 5G5FA 2OBKA 2EIOA 2M72A 2PPTA 5F8BA 4K5SA 4Z2RA 1GRXA 1W89A 3FZAA 2FNOA 2GZPA 3CSHA 3MIXA 3O76A 2H71A 2B7JA 3C7MA 4ZB6A 2VL2C 1HQOA 2B7KA 4JE1A 1EOGA 2TIRA 3IK7A 4G19A 1VRSD 4JR6A 2HZFA 3ZVJA 3PR8A 1W4VA 4Q5NA 5CAXA 5KN1A 3P90A 4PGTA 4LL4B 2KOKA 3F4SA 5HQPA 2H6YA 1Z9HA 1GSUA 3H1NA 1B9YC 2A4VA 3GFKA 3GTUA 2WB9A 4K1FA 2DMMA 1S3DA 2GTUA 3IR4A 4TR0A 1JZDA 2B5YA 3IPZA 4GSTA 3VI5A 3KEBA 5G1LA 4DSQA 1QGVA 3ERWA 4MCUA 2BMXA 4EDZA 2LS5A 1OC9A 3DMLA 2JL4A 2FWGA 4TN8A 4FH8A 5E59A 1THXA 1X5CA 2YWMA 2MBSA 2OE0A 4PUAA 1IYHA 3HJPA 5D9XA 2FWEA 2YV7A 3C1RA 4EE0A 2IMDA 1TJDA 1Z7RA 1Q98A 2ALBA 2H19A 1A23A 3VWUA 3LXZA 3F4TA 1SL0B 4HZ2A 1M9BA 4MH3A 3FHKA 1TK0B 4IBPA 1C72A 5G1KA 3GSSA 3DXBA 1PKZA 2H75A 2O8VB 4GXZA 2QKEA 4TR3A 2V2GA 3UVTA 2M80A 5LNKe 1Y6EA 3GX8A 2PMTA 2GVPA 2VL9A 4USSA 2LJKA 5GAND 2GSQA 5AGYA 2AV4A 4WR4A 3DD3A 4K2XA 2GLRA 2D2ZA 4GSNA 3V1WA 5HFGA 4HOJA 3IK9A 2O87A 4O92A 1E2YA 1TOFA 2C0EA 1AC1A 4KUNA 4ECBA 5J9CA 1OC9B 5GAPD 1B4PA 1F6MC 3F9UA 5D96A 1TI1A 3QDNA 3O6TA 3SBCA 1QXHA 4EDYA 2WJUA 2WGRA 4X43A 4TRXA 2H70A 1PN0A 1MD4A 4MJAA 2VCWA 3TB2A 1HNAA 3H93A 4L5OA 2OA7A 3ZMKA 1U88A 1XOBA 4ML1A 1WIKA 4N30A 3UEMA 2YWIA 1JHBA 1I5GA 4EXJA 2TRCP 4G0LA 5KEJA 2E7PA 4ECJA 4IW9A 4QL7A 4O32A 3TKSC 1QFNA 5IMVA 2VLTA 2DJ3A 1OC3A 4V1Ag 3F3RA 4G0IA 1SU9A 1TRUA 1AIUA 2PERA 2I81A 3MWHA 4PQIA 2FGXA 3I6AA 2R3XA 5G31A 1ZCPA 3OR5A 5INYA 3FY7A 4V1Ap 1OE8A 3EINA 1TU7A 1OC8A 4PXOA 3IOSA 2PUKC 2FA8A 3ME8A 1X5DA 4K0NA 3HVXA 4BVYA 3PPUA 2GQMA 1I9DA 1GH2A 2FA4A 1J0FA 1A0RP 2C3TA 3GKMA 1QMVA 3IBHA 3M1GA 4MF7A 3LYPA 6GSWA 4IVFA 4TKYA 1YF0A 5IPHA 1MDKA 1YDKA 4NHZA 3PH9A 4NMUA 3VFIA 5DCGA 4ZBBA 1O8WA 1N8JA 1U87A 4MJCA 2K8SA 2PVQA 1GUMA 3LG6A 3UOMA 2C4JA 2R2JA 4KDYA 2XBQA 3IC8A 3LWAA 4D73B 4ACSA 4RI7A 4MZBA 5IMFA 4GLTA 3IA1A 3TJBA 2YWNA 2H1DA 1Z3EA 3FEUA 4CY6A 1FHEA 3CRUA 3U5RE 4F0CA 2HFDA 3IRAA 1TK5B 2FUG2 1R5AA 2L6CA 5J5NA 8GSSA 4Q5QA 3GMFA 3HY2A 4I97A 1DSBA 2VOCA 3D0ZA 3TDGA 5ECKB 2CVDA 3IHQA 4EUYA 1QQ2A 5BRTA 3M8NA 1GL8A 4PNGA 1UN2A 1K0AA 4IP6A 2LSTA 2X4AA 3GNJA 1EZKA 4ZB8A 2XHFA 2DJKA 1SYRA 5IO0A 2F9SA 4MMMA 3TKSE 1XIYA 3I9V2 4KAEA 2MMNA 4YKGA 1XW9A 4DVCA 3UMAA 2ZNMA 3ZVJD 17GSA 4DSSA 1TTZA 5DBQA 1BG5A 2WDUA 2QA1A 4HDEA 1VF2A 1GTIA 1NSWA 4XTSA 1V9WA 5ECPB 4WF4A 2M46A 3D5JA 3KM6A 5ECOB 1AQXA 1ZYEA 4ZBAA 1YEPA 4PX1A 3CYNA 1A24A 4IJ3A 4N11A 2EIQA 3A3TA 1TU8A 1LJRA 2GQLA 4A5PA 5HFIA 4POKA 1OYJA 5ECIB 2MYGA 3EYTA 1MTCA 1U3IA 3QR6A 4EL1A 3VWXA 2YP6A 4ID0A 1A8LA 4GSSA 4GWRA 1RK4A 2F3MA 3HD5A 3ED3A 4K7IA 1BAYA 1PMTA 3TRXA 3GH6A 4X4JA 1CQHA 4GCIA 3TJGA 1R26A 1AAZA 4ZXGA 2LRTA 4NAXA 4GQFA 4MP4A 2VCVA 4DSSB 3TOUA 2LNTA 1X9MB 1G6YA 1FB6A 6GSVA 2HXKA 3F3QA 3HVSA 1K0NA 1K0OA 4OO5A 3H8QA 3L78A 1TDIA 2X8CA 3F4RA 2DIZA 2O85A 4HI7A 4ILFA 2I3YA 2H6ZA 3CXGA 1O8XA 2YWOA 2BJXA 1JZOA 1BQ7A 1F9MA 1TRSA 1FAAA 2VCXA 2DC5A 3G7JA 5JWRB 1PD21 1M2BA 3E9JB 1GSYA 5IMZA 4KB3A 3ZYWA 1VF4A 2XC2A 4ZIJA 2LRNA 5AIVA 3LORA 2P5RA 3VPQA 1XW5A 3FR6A 3HZ8A 4K0GA 4WBRD 2HE3A 1J08A 1WWJA 4ZL9A 3IHGA 4DSRA 3UBKA 2H72A 5CO3A 1SL1B 2JADA 2FY6A 5AN1A 2HLSA 1GSFA 1GLQA 2LV3A 5ECQB 5CRDA 1R7HA 3UAPA 5IQYA 1SJZA 5CNWA 1ABAA 4IN0A 4V2NA 2HZEA 3GX0A 1AUCA 4POLA 3KCMA 1GTAA 4HQSA 3FR9A 12GSA 4IGJA 2Z9SA 4ZL8A 4Q5RA 3QOUA 2A4HA 1XWKA 2PN8A 3GH9A 4EO3A 4POBA 1DBYA 4ZBDA 3GA4A 4WXTA 4EF0A 1PSQA 3DYRA 1HYUA 3BCKA 3ZRDA 1EV4A 1OVNA 5ID2A 3ERFA 1YF1A 3S9FA 1LBKA 1GSEA 1OKDA 4K7NA 3LGCA 1DUGA 5DAKA 2C80A 2H76A 2CT6A 4Z2TA 6GSXA 2FWFA 2YV9A 1Y25A 3UIWA 4LA1A 1F2EA 4PNFA 2BTOT 1NW2A 4YAPA 2OJLA 3CRTA 4ULXA 3AY8A 3KMNA 3D4MA 1XWAA 3F63A 3ISOA 3QAVA 5KOXA 2R0GA 1HNCA 2VCZA 3HHVA 2HZEB 5IM9A 2B1KA 4ECCA 4YQMA 1T4YA 3US3A 1XWGA 2GGTA 4MA9A 3HZ4A 3D4TA 3D21A 3J7Yb 1EV9A 2DKIA 5BMUA 5DQSA 1ERTA 5KOWA 1EP7A 4PUFC 1MDJA 3GKNA 4RI6A 4FIWA 3BBYA 4K6XA 2K6VA 1OAZA 5KN2A 1GLPA 4IS0A 1AXDA 2OADA 4MJEA 3QD9A 5ID2B 4TR1A 4KW6A 5DALA 2IMIA 4O5RA 2GZYA 2JSYA 3EPTA 3APOA 5DAKB 2QGVA 1N2AA 2CQ9A 4GTUA 2PU9C 4LLRA 1QK8A 5F06A 1GWCA 3KXOA 4XRAA 1WOUA 3M3MA 1R5PA 1SJ6A 3KH7A 4O5QA 2XPDA 4OFNA 2B5XA 4IQAA 1MD3A 3TOTA 10GSA 4WBJA 1WP0A 5ELGA 1TW9A 5IOXA 3GL5A 4X1UA 2HNLA 2LJRA 5CRWA 1V58A 2JZTA 3TCOA 2PWJA 3MDKA 2CZ3A 3KD0A 5J41A 3LW9A 1EOHA 3ZTLA 4P3YB 4BVXA 4JU5A 3LSZA 4JEDA 1YQ1A 3HKRA 3W8SA 4AJ6A 5FHIA 3HJMA 5HR1A 1PN9A 1BEDA 5AIXA 2V32A 2DJ2A 4MLYA 1EWXA 5JCGA 4Q5FA 3GTUB 2H73A 3VPTA 4RUVA 5CYYA 3DKSA 1FVJA 2HSYA 5DJLA 3TKQA 4LMVA 4FQUA 1V40A 2IJYA 4KE3A 2VLUA 4F03A 2QC7A 3ZLPA 2JZSA 1MEKA 2YANA 9GSSA 3TKPA 2B6MA 3KTLA 1WMJA 4DEJA 2V1MA 2I4AA 2F8FA 2HT9A 3HVVA 2CX3A 2QSIA 1Z6NA 4MF5A 3WGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F37 A;  4HU7 A;  3UAR A;  3WYW A;  3EMP A;  1X5E A;  1UA5 A;  2IFQ A;  1YJ6 A;  3QCP A;  2NPB A;  2L4Q A;  4EKZ A;  3MNG A;  2REM A;  3WT1 A;  3GYK A;  3O3T A;  3ZIV A;  5J4U A;  1YZX A;  5D73 A;  3QMX A;  2GZZ A;  3IXR A;  2E2M A;  4TOP A;  4OFM A;  2CV4 A;  2YZU A;  1ON4 A;  1BJX A;  2GSS A;  1WRY A;  1SD8 A;  4KGI A;  1A2L A;  5A5K A;  5EY6 A;  1XPV A;  3EU3 A;  5IOW A;  1H4O A;  1XZO A;  6GSY A;  4WR5 A;  2R37 A;  3I69 A;  2FCH A;  3DRN A;  3M9K A;  1ILO A;  1ACV A;  3TKR A;  4ML6 A;  3FKF A;  3J7Y k;  2ZCT A;  1HD2 A;  1URM A;  5L71 A;  3DWV A;  1IYI A;  1EEJ A;  3GHA A;  2XBI A;  1SK2 A;  2I9H A;  1UVZ A;  2RLI A;  2IFQ B;  1NHY A;  1JLV A;  4MF6 A;  2CA8 A;  19GS A;  2V6K A;  2P5Q A;  2FD3 A;  3PIN A;  4MK3 A;  2LQO A;  1R4W A;  1PKW A;  2F8A A;  2R5G A;  4KA0 A;  3FK8 A;  3FZ9 A;  4J57 E;  4MZW A;  2PGT A;  1Z6M A;  5JWO B;  1EGO A;  2GQK A;  2LKU A;  4TXO A;  1KTE A;  3VI7 A;  3HXS A;  2LTK A;  4N0V A;  3QFB C;  4KCE A;  4HU9 A;  3GIX A;  5KN3 A;  3KP9 A;  2YJH A;  1HNB A;  3Q6O A;  1UC7 A;  3BD2 A;  2IMF A;  3EC3 A;  5LCZ A;  4F82 A;  4NHW A;  4I2U A;  1TP9 A;  1M9A A;  2L5O A;  5EPF A;  3APQ A;  5IO2 A;  2N5F A;  2P0G A;  4V2L A;  2VL2 A;  2KP2 A;  3P8W A;  5ECN B;  3GV1 A;  1TK8 B;  2LQQ A;  2VD0 A;  2IN3 A;  2YNX A;  3RAZ A;  2OAC A;  3FR3 A;  1M99 A;  2AHE A;  2C3N A;  4MDC A;  5JCU A;  5COH A;  3CSJ A;  4L5L A;  5H5R A;  2JZR A;  3DIE A;  2GT5 A;  1Q4J A;  2X8G A;  4MPF A;  3TJJ A;  2ON7 A;  4V2M A;  4NXI A;  2H8L A;  2I1U A;  1ERW A;  2H30 A;  2HI7 A;  2VAF A;  5A4V A;  1A0F A;  1PQN A;  3FW2 A;  3P2A A;  2C0F A;  2DJ1 A;  4RQX A;  4GF0 A;  1SK0 A;  5DVB A;  1GP1 A;  3DEX A;  5EL8 A;  1XWB A;  5HR2 A;  3C73 A;  4XIH A;  3GL3 A;  2VM2 A;  3PGT A;  1ZZY A;  2NBS A;  4AF2 A;  1SD9 A;  3ZIT A;  1FO5 A;  3EE2 A;  3GUR A;  4XCS A;  3KGK A;  14GS A;  5CRE A;  2JU5 A;  3EVI A;  5F05 A;  3WGX A;  3CTG A;  3ZRE A;  1PX6 A;  2TRX A;  2GST A;  4HJM A;  1XBS A;  2RM6 A;  2GDR A;  4IKH A;  5HR0 A;  2VO4 A;  1Z7P A;  3NZN A;  1AW9 A;  2KUC A;  1TRW A;  2E2G A;  3ZZX A;  3HDC A;  1ST9 A;  2MMO A;  2J9H A;  1USB A;  1SKR B;  1VF1 A;  2IL3 A;  4BL7 A;  2C0D A;  1GSD A;  5IMA A;  1YKA A;  2LNS A;  2LUS A;  1GUL A;  4YQV A;  2VL3 A;  4WF5 A;  1WJK A;  3E0U A;  4CDO A;  1DE2 A;  3GKX A;  4XHM A;  1O81 A;  1NHO A;  2YJ7 A;  4WEY A;  4J56 E;  1GNE A;  2VD1 A;  4N0Z A;  3TGZ A;  5HR3 A;  3RHB A;  4XS4 A;  1S3A A;  1THO A;  2ES7 A;  2OE1 A;  1O85 A;  1TI3 A;  4HZ4 A;  2EC4 A;  5FWG A;  4JZQ A;  2VCQ A;  4G10 A;  2YPM A;  2RUF A;  3HA9 A;  3KIJ A;  1SK1 A;  2L5L A;  1A8Y A;  3TKS A;  2VM1 A;  3R2Q A;  2L4C A;  2X64 A;  4TR4 A;  4F0B A;  4OMV A;  2AYT A;  5DJM A;  2L6D A;  3GN3 A;  3HCZ A;  2NVL A;  5D8I A;  5DQY A;  1FOV A;  4KCA A;  4LL1 B;  3KZQ A;  1NM3 A;  3F6F A;  2RM5 A;  3N9J A;  1X0R A;  3LQ7 A;  4I8B A;  2EIR A;  3G7Y A;  3LXT A;  1EP8 A;  1MDI A;  2WCI A;  3F0I A;  1EGR A;  5KN0 A;  2C3Q A;  3GRX A;  4NV2 A;  3IE3 A;  1OKT A;  2F51 A;  2WZ9 A;  3P7X A;  4BWS A;  1K3O A;  1B48 A;  3G9B A;  3H4K A;  3RPP A;  4N10 A;  1XW6 A;  2V41 A;  3FZ5 A;  3IV4 A;  2J23 A;  4XS4 B;  4YAV A;  1OE7 A;  2VIM A;  3M0F A;  2OBI A;  5ABR A;  3KH9 A;  3CTF A;  5DCH A;  1PRX A;  2H6X A;  2LJA A;  3KMO A;  2WUL A;  1F3B A;  5D9V A;  4K8M A;  4Z7X A;  5IPG A;  3ZFL A;  4KND A;  1SYX A;  2GSR A;  1FG4 A;  1SL2 B;  4HUA A;  3CBU A;  1GNW A;  3BCI A;  3RDW A;  2LEG A;  2H0G A;  2AJQ B;  1GSS A;  4OWY A;  3A2W A;  2H0I A;  5D9W A;  4KSM A;  1VGL A;  4FYU A;  2JSZ A;  5IIZ A;  4ISD A;  5A4W A;  1JFU A;  2MMZ A;  2G0F A;  3ZFB A;  2C0G A;  3ZML A;  3C8E A;  1A2J A;  1G0T A;  3CMI A;  2NTO A;  2A2R A;  2YOI A;  4FO5 A;  1K3Y A;  1GTU A;  2H1B A;  4TXV A;  4HJ2 A;  3CSI A;  3K8N A;  1ZYQ B;  5HFK A;  3HJO A;  3UL3 A;  3L4N A;  2V6O A;  3VLN A;  2NDO A;  1M2A A;  2HYX A;  4WKW A;  2P31 A;  4NWY A;  3ERG A;  4JRR A;  1O6J A;  2L59 A;  3GKK A;  5H5Q A;  5ENU A;  4IQ1 A;  2YCD A;  3I43 A;  3L9U A;  1S3C A;  1BYE A;  3LFL A;  1BX9 A;  3UVH A;  1U6T A;  3KTB A;  2DBC A;  3TJK A;  2ON5 A;  1V98 A;  1O7U A;  1V2A A;  4PUR A;  4ECI A;  3TJF A;  6GST A;  1U3A A;  5ECH B;  1M0U A;  2YN1 A;  5JWQ B;  2PVO C;  5ELA A;  1KNG A;  2DLX A;  7GSS A;  4TR1 B;  4I5Q A;  5DAL B;  2AB6 A;  2CX4 A;  1E6B A;  1LU4 A;  1K0D A;  1JZR A;  3QFA C;  2CZ2 A;  4L0W A;  3N5O A;  2K18 A;  1X9W B;  1AQW A;  3L0H A;  3NOF A;  6GSU A;  4TW5 A;  3L9V A;  1T4Z A;  4HEA 2;  2WRT A;  1G7O A;  3RPN A;  1YEX A;  22GS A;  4O7H A;  2DSA A;  4L0U A;  2B1L A;  3ZIJ A;  4OFT A;  3QAG A;  5G2Z A;  1ERU A;  2JAC A;  3GUS A;  5C00 A;  2HSH A;  4KX4 A;  4YQU A;  2L57 A;  2E0Q A;  1GUH A;  2YZH A;  2O89 A;  2G2Q A;  1TRV A;  3WT2 A;  11GS A;  1GUK A;  4JR4 A;  4MH2 A;  5D9T A;  5G30 A;  1B8X A;  2KLX A;  1O73 A;  3LYK A;  5FT3 A;  1G6W A;  3IAM 2;  3EU4 A;  2IWT A;  4GQC A;  4KH7 A;  4X0X A;  4D73 A;  3D22 A;  2LRC A;  2DJ0 A;  3IAS 2;  4HQZ A;  5EVO A;  4AJ8 A;  2R4V A;  3NIV A;  3FRC A;  1GTB A;  2C8U A;  5D93 A;  2FWH A;  1K0B A;  1ZOF A;  4ZIL A;  3A2V A;  1PX7 A;  5F0G A;  4FYC A;  4OO4 A;  2WFC A;  3C71 A;  2C1Y A;  3C1S A;  3RBT A;  4F9Z A;  3DVX A;  2WS2 A;  1WPI A;  1KBN A;  1TKD B;  4POM A;  5ECR B;  2CAQ A;  2VCT A;  1K0C A;  4IP1 A;  4E8E A;  4WET A;  3TRP A;  2A2S A;  2X99 A;  2RUE A;  3LEF A;  3Q18 A;  2B5E A;  4OD7 A;  4LMW A;  2H1G A;  1M7T A;  4MJB A;  20GS A;  4KSO A;  2CAI A;  4G9H A;  2B3S A;  3L9S A;  5GSS A;  3APS A;  1ZL9 A;  2FLS A;  3U6V A;  4K7O A;  2R6K A;  3FYG A;  5CRG A;  3MSZ A;  5IMC A;  3EWL A;  3BOA A;  5ECM B;  1T8E B;  4E8H A;  4MPG A;  1XWC A;  2MBT A;  5J3R A;  2H66 A;  1H75 A;  3VWW A;  4GRF A;  1WE0 A;  5B6N A;  4K9Z A;  2N5B A;  1XVW A;  4OCF A;  2IMK A;  1G7E A;  1RQM A;  1X9S B;  5B8B A;  3VWV A;  1V57 A;  2DJJ A;  3A2X A;  5ECL B;  1SKS B;  1M2D A;  3HYP A;  4JBB A;  1JZW A;  1A2M A;  2H01 A;  3DGQ A;  4ZB9 A;  5A4U A;  1AQV A;  3W6G A;  1XFL A;  3UJ1 A;  2HRN A;  3SWL A;  2XPE A;  4TXO B;  3QAW A;  3D6I A;  3WD6 A;  1XOA A;  1SEN A;  1ZGN A;  2IPA A;  3A5W A;  3TRQ A;  2ZUP A;  6GSS A;  2K8V A;  2AUV A;  1FW1 A;  4CHS A;  1J9B A;  4PQ1 A;  2CVK A;  1EEM A;  4L8E A;  3KJY A;  1KEB A;  5CRH A;  4XS6 A;  4QL9 A;  4F2I A;  1RW1 A;  4BA7 A;  1CQG A;  2H74 A;  3ZL5 A;  2RII A;  1ML6 A;  2N5A A;  5DDL A;  2KP1 A;  2H0H A;  1TXX A;  2DIY A;  3F8U A;  1T1V A;  4EC0 A;  4EVM A;  4NPB A;  4BWQ A;  3LJR A;  4IEL A;  5GZZ B;  5JCW A;  1B4Q A;  2IME A;  4I2T A;  13GS A;  2PBJ A;  3IC4 A;  4AGS A;  1YKC A;  2FHE A;  5C04 A;  2H1A A;  2O7K A;  4I6X A;  3BJ5 A;  4XRD A;  3EUR A;  1K3L A;  3FZ4 A;  3RHC A;  3WGD A;  2OE3 A;  2K9F A;  3M9J A;  4OCE A;  1PL1 A;  3F6D A;  3QPM A;  16GS A;  5H5S A;  2GT6 A;  2CVB A;  1VF3 A;  5G5E A;  4CW9 A;  3Q19 A;  2VUP A;  2OKA A;  4TVE A;  4XS1 A;  3EMX A;  4RQR A;  18GS A;  1Z5Y E;  2AAW A;  1T00 A;  3JCM L;  3W8J A;  3VUR A;  1QUW A;  3Q74 A;  1XCC A;  5ECS A;  4KDU A;  1PA3 A;  1YY7 A;  5LD0 A;  2IIY A;  2MMA A;  4NV5 A;  3UBL A;  4HS1 A;  3MAK A;  1PGT A;  1K0M A;  3TUE A;  4G2E A;  1FB0 A;  5IMD A;  4KDX A;  4J2F A;  1B9X C;  1DE1 A;  1XXU A;  3ME7 A;  4YH2 A;  4AJ7 A;  3H79 A;  1SKW B;  4IJI A;  1GSQ A;  5E4W A;  5B6M A;  3E3E A;  4FYB A;  1ERV A;  1XVQ A;  4PQH A;  4BPY A;  4MAB A;  1T7P B;  4ZL7 A;  2VLV A;  2KHP A;  4H86 A;  2MZC A;  5J9B A;  1F3A A;  4IHU A;  5B7C A;  4QQ7 A;  3KP8 A;  3VK9 A;  1FVK A;  3DVW A;  1T3B A;  2GS3 A;  2DML A;  5B8A A;  2X8H A;  2HRF A;  5CP1 A;  3G7I A;  3IDV A;  1JLW A;  4K2D A;  5AIS A;  5F07 A;  1PL2 A;  1SJI A;  3GST A;  1ZMA A;  5GST A;  4MZC A;  5G5F A;  2OBK A;  2EIO A;  2M72 A;  2PPT A;  5F8B A;  1GRX A;  1W89 A;  3FZA A;  2FNO A;  2GZP A;  3CSH A;  3O76 A;  2H71 A;  2B7J A;  3C7M A;  4ZB6 A;  2VL2 C;  1HQO A;  2B7K A;  4JE1 A;  1EOG A;  2TIR A;  3IK7 A;  4G19 A;  1VRS D;  4JR6 A;  2HZF A;  3ZVJ A;  3PR8 A;  1W4V A;  4Q5N A;  5CAX A;  5KN1 A;  3P90 A;  4PGT A;  4LL4 B;  2KOK A;  3F4S A;  5HQP A;  2H6Y A;  1Z9H A;  1GSU A;  3H1N A;  1B9Y C;  2A4V A;  3GFK A;  3GTU A;  2WB9 A;  4K1F A;  2DMM A;  1S3D A;  2GTU A;  3IR4 A;  4TR0 A;  1JZD A;  2B5Y A;  3IPZ A;  4GST A;  3VI5 A;  3KEB A;  5G1L A;  4DSQ A;  1QGV A;  3ERW A;  4MCU A;  2BMX A;  4EDZ A;  2LS5 A;  1OC9 A;  3DML A;  2JL4 A;  2FWG A;  4TN8 A;  4FH8 A;  5E59 A;  1THX A;  1X5C A;  2YWM A;  2MBS A;  2OE0 A;  4PUA A;  1IYH A;  3HJP A;  5D9X A;  2FWE A;  2YV7 A;  3C1R A;  4EE0 A;  2IMD A;  1TJD A;  1Z7R A;  1Q98 A;  2ALB A;  2H19 A;  1A23 A;  3VWU A;  3LXZ A;  3F4T A;  1SL0 B;  4HZ2 A;  1M9B A;  4MH3 A;  3FHK A;  1TK0 B;  4IBP A;  1C72 A;  5G1K A;  3GSS A;  3DXB A;  1PKZ A;  2H75 A;  2O8V B;  4GXZ A;  2QKE A;  4TR3 A;  2V2G A;  3UVT A;  2M80 A;  5LNK e;  1Y6E A;  3GX8 A;  2PMT A;  2GVP A;  2VL9 A;  2LJK A;  5GAN D;  2GSQ A;  5AGY A;  2AV4 A;  4WR4 A;  3DD3 A;  2GLR A;  2D2Z A;  4GSN A;  3V1W A;  5HFG A;  4HOJ A;  3IK9 A;  2O87 A;  4O92 A;  1E2Y A;  1TOF A;  2C0E A;  1AC1 A;  4KUN A;  4ECB A;  5J9C A;  1OC9 B;  5GAP D;  1B4P A;  1F6M C;  3F9U A;  5D96 A;  1TI1 A;  3QDN A;  3O6T A;  3SBC A;  1QXH A;  4EDY A;  2WJU A;  2WGR A;  4X43 A;  4TRX A;  2H70 A;  1MD4 A;  4MJA A;  2VCW A;  3TB2 A;  1HNA A;  3H93 A;  4L5O A;  2OA7 A;  3ZMK A;  1U88 A;  1XOB A;  4ML1 A;  1WIK A;  4N30 A;  3UEM A;  2YWI A;  1JHB A;  1I5G A;  4EXJ A;  2TRC P;  5KEJ A;  2E7P A;  4ECJ A;  4IW9 A;  4QL7 A;  4O32 A;  3TKS C;  1QFN A;  5IMV A;  2VLT A;  2DJ3 A;  1OC3 A;  4V1A g;  3F3R A;  1SU9 A;  1TRU A;  1AIU A;  2PER A;  2I81 A;  3MWH A;  4PQI A;  2FGX A;  3I6A A;  2R3X A;  5G31 A;  1ZCP A;  3OR5 A;  5INY A;  3FY7 A;  4V1A p;  1OE8 A;  3EIN A;  1TU7 A;  1OC8 A;  4PXO A;  3IOS A;  2PUK C;  2FA8 A;  3ME8 A;  1X5D A;  4K0N A;  3HVX A;  4BVY A;  2GQM A;  1I9D A;  1GH2 A;  2FA4 A;  1J0F A;  1A0R P;  2C3T A;  3GKM A;  1QMV A;  3IBH A;  3M1G A;  4MF7 A;  3LYP A;  6GSW A;  4IVF A;  4TKY A;  1YF0 A;  5IPH A;  1MDK A;  1YDK A;  4NHZ A;  3PH9 A;  4NMU A;  3VFI A;  5DCG A;  4ZBB A;  1O8W A;  1N8J A;  1U87 A;  4MJC A;  2K8S A;  2PVQ A;  1GUM A;  3LG6 A;  3UOM A;  2C4J A;  2R2J A;  4KDY A;  2XBQ A;  3LWA A;  4D73 B;  4ACS A;  4RI7 A;  4MZB A;  5IMF A;  4GLT A;  3IA1 A;  3TJB A;  2YWN A;  2H1D A;  1Z3E A;  3FEU A;  1FHE A;  3CRU A;  3U5R E;  4F0C A;  2HFD A;  3IRA A;  1TK5 B;  2FUG 2;  1R5A A;  2L6C A;  5J5N A;  8GSS A;  4Q5Q A;  3GMF A;  3HY2 A;  4I97 A;  1DSB A;  2VOC A;  3D0Z A;  3TDG A;  5ECK B;  2CVD A;  3IHQ A;  4EUY A;  1QQ2 A;  3M8N A;  1GL8 A;  4PNG A;  1UN2 A;  1K0A A;  4IP6 A;  2LST A;  3GNJ A;  1EZK A;  4ZB8 A;  2XHF A;  2DJK A;  1SYR A;  5IO0 A;  2F9S A;  4MMM A;  3TKS E;  1XIY A;  3I9V 2;  4KAE A;  2MMN A;  1XW9 A;  4DVC A;  3UMA A;  2ZNM A;  3ZVJ D;  17GS A;  4DSS A;  1TTZ A;  5DBQ A;  1BG5 A;  2WDU A;  4HDE A;  1VF2 A;  1GTI A;  1NSW A;  4XTS A;  1V9W A;  5ECP B;  4WF4 A;  2M46 A;  3D5J A;  3KM6 A;  5ECO B;  1AQX A;  1ZYE A;  4ZBA A;  1YEP A;  4PX1 A;  3CYN A;  1A24 A;  4IJ3 A;  4N11 A;  2EIQ A;  3A3T A;  1TU8 A;  1LJR A;  2GQL A;  5HFI A;  4POK A;  1OYJ A;  5ECI B;  2MYG A;  3EYT A;  1MTC A;  1U3I A;  3QR6 A;  4EL1 A;  3VWX A;  2YP6 A;  4ID0 A;  1A8L A;  4GSS A;  4GWR A;  1RK4 A;  2F3M A;  3HD5 A;  3ED3 A;  4K7I A;  1BAY A;  1PMT A;  3TRX A;  3GH6 A;  1CQH A;  4GCI A;  3TJG A;  1R26 A;  1AAZ A;  4ZXG A;  2LRT A;  4NAX A;  4GQF A;  4MP4 A;  2VCV A;  4DSS B;  3TOU A;  2LNT A;  1X9M B;  1G6Y A;  1FB6 A;  6GSV A;  2HXK A;  3F3Q A;  3HVS A;  1K0N A;  1K0O A;  4OO5 A;  3H8Q A;  3L78 A;  1TDI A;  2X8C A;  3F4R A;  2DIZ A;  2O85 A;  4HI7 A;  4ILF A;  2I3Y A;  2H6Z A;  3CXG A;  1O8X A;  2YWO A;  2BJX A;  1JZO A;  1BQ7 A;  1F9M A;  1TRS A;  1FAA A;  2VCX A;  2DC5 A;  3G7J A;  5JWR B;  1PD2 1;  1M2B A;  3E9J B;  1GSY A;  5IMZ A;  4KB3 A;  3ZYW A;  1VF4 A;  2XC2 A;  4ZIJ A;  2LRN A;  5AIV A;  3LOR A;  2P5R A;  3VPQ A;  1XW5 A;  3FR6 A;  3HZ8 A;  4K0G A;  4WBR D;  2HE3 A;  1J08 A;  1WWJ A;  4ZL9 A;  4DSR A;  3UBK A;  2H72 A;  5CO3 A;  1SL1 B;  2JAD A;  2FY6 A;  5AN1 A;  2HLS A;  1GSF A;  1GLQ A;  2LV3 A;  5ECQ B;  5CRD A;  1R7H A;  3UAP A;  5IQY A;  1SJZ A;  5CNW A;  1ABA A;  4IN0 A;  4V2N A;  2HZE A;  3GX0 A;  1AUC A;  4POL A;  3KCM A;  1GTA A;  4HQS A;  3FR9 A;  12GS A;  4IGJ A;  2Z9S A;  4ZL8 A;  4Q5R A;  3QOU A;  2PN8 A;  1XWK A;  3GH9 A;  4EO3 A;  4POB A;  1DBY A;  4ZBD A;  3GA4 A;  4WXT A;  4EF0 A;  1PSQ A;  3DYR A;  1HYU A;  3BCK A;  3ZRD A;  1EV4 A;  1OVN A;  5ID2 A;  3ERF A;  1YF1 A;  3S9F A;  1LBK A;  1GSE A;  1OKD A;  4K7N A;  3LGC A;  1DUG A;  5DAK A;  2C80 A;  2H76 A;  2CT6 A;  6GSX A;  2FWF A;  2YV9 A;  1Y25 A;  3UIW A;  4LA1 A;  1F2E A;  4PNF A;  2BTO T;  1NW2 A;  4YAP A;  2OJL A;  3CRT A;  4ULX A;  3AY8 A;  3KMN A;  3D4M A;  1XWA A;  3F63 A;  3ISO A;  3QAV A;  1HNC A;  2VCZ A;  3HHV A;  2HZE B;  5IM9 A;  2B1K A;  4ECC A;  4YQM A;  1T4Y A;  3US3 A;  1XWG A;  2GGT A;  4MA9 A;  3HZ4 A;  3D4T A;  3D21 A;  3J7Y b;  1EV9 A;  5DQS A;  1ERT A;  1EP7 A;  4PUF C;  1MDJ A;  3GKN A;  4RI6 A;  4FIW A;  3BBY A;  4K6X A;  2K6V A;  1OAZ A;  5KN2 A;  1GLP A;  4IS0 A;  1AXD A;  2OAD A;  4MJE A;  3QD9 A;  5ID2 B;  4TR1 A;  4KW6 A;  5DAL A;  2IMI A;  4O5R A;  2GZY A;  2JSY A;  3APO A;  5DAK B;  2QGV A;  1N2A A;  2CQ9 A;  4GTU A;  2PU9 C;  4LLR A;  1QK8 A;  5F06 A;  1GWC A;  3KXO A;  4XRA A;  1WOU A;  3M3M A;  1R5P A;  1SJ6 A;  3KH7 A;  2XPD A;  4OFN A;  2B5X A;  4IQA A;  1MD3 A;  3TOT A;  10GS A;  4WBJ A;  1WP0 A;  5ELG A;  1TW9 A;  5IOX A;  3GL5 A;  4X1U A;  2HNL A;  2LJR A;  5CRW A;  1V58 A;  2JZT A;  3TCO A;  2PWJ A;  3MDK A;  2CZ3 A;  3KD0 A;  5J41 A;  1EOH A;  3ZTL A;  4P3Y B;  4BVX A;  4JU5 A;  3LSZ A;  4JED A;  1YQ1 A;  3HKR A;  3W8S A;  4AJ6 A;  5FHI A;  3HJM A;  5HR1 A;  1PN9 A;  1BED A;  5AIX A;  2V32 A;  2DJ2 A;  4MLY A;  1EWX A;  5JCG A;  4Q5F A;  3GTU B;  2H73 A;  3VPT A;  4RUV A;  5CYY A;  3DKS A;  1FVJ A;  2HSY A;  5DJL A;  3TKQ A;  4LMV A;  1V40 A;  2IJY A;  4KE3 A;  2VLU A;  4F03 A;  2QC7 A;  3ZLP A;  2JZS A;  1MEK A;  2YAN A;  9GSS A;  3TKP A;  2B6M A;  3KTL A;  1WMJ A;  4DEJ A;  2V1M A;  2I4A A;  2F8F A;  2HT9 A;  3HVV A;  2CX3 A;  2QSI A;  1Z6N A;  4MF5 A;  3WGE A; 
#chains in the Genus database with same CATH topology
 1FOH A;  1F37 A;  4HU7 A;  3UAR A;  3WYW A;  3EMP A;  1X5E A;  1UA5 A;  2IFQ A;  1YJ6 A;  4BVX B;  3QCP A;  2NPB A;  2UZ8 A;  2L4Q A;  4EKZ A;  3MNG A;  2REM A;  3WT1 A;  3GYK A;  3O3T A;  3ZIV A;  5J4U A;  1YZX A;  5D73 A;  3QMX A;  2GZZ A;  3IXR A;  2E2M A;  3R3E A;  4TOP A;  4OFM A;  2CV4 A;  2YZU A;  1ON4 A;  1BJX A;  2GSS A;  1WRY A;  1SD8 A;  4KGI A;  1A2L A;  5A5K A;  5EY6 A;  1XPV A;  3EU3 A;  5IOW A;  2HRA A;  1H4O A;  1XZO A;  6GSY A;  4WR5 A;  2R37 A;  3I69 A;  2FCH A;  3DRN A;  3M9K A;  1ILO A;  1ACV A;  3TKR A;  4ML6 A;  3FKF A;  3MYD A;  3J7Y k;  2ZCT A;  1HD2 A;  1URM A;  5L71 A;  3DWV A;  1IYI A;  1EEJ A;  3GHA A;  2XBI A;  1SK2 A;  2I9H A;  1UVZ A;  2RLI A;  2IFQ B;  1NHY A;  1JLV A;  4MF6 A;  2CA8 A;  19GS A;  2V6K A;  2P5Q A;  2FD3 A;  3PIN A;  4MK3 A;  2LQO A;  1R4W A;  1PKW A;  2F8A A;  2R5G A;  4KA0 A;  4Z2U A;  3FK8 A;  3FZ9 A;  4J57 E;  4MZW A;  2PGT A;  1Z6M A;  5JWO B;  1EGO A;  2GQK A;  2LKU A;  3FMW A;  4TXO A;  1KTE A;  3VI7 A;  3HXS A;  2LTK A;  4N0V A;  3QFB C;  4KCE A;  4HU9 A;  3GIX A;  2X49 A;  5KN3 A;  3KP9 A;  2YJH A;  1HNB A;  3Q6O A;  1UC7 A;  3BD2 A;  2IMF A;  3EC3 A;  5LCZ A;  4F82 A;  4NHW A;  4I2U A;  1TP9 A;  1M9A A;  4BVY B;  2L5O A;  5EPF A;  3APQ A;  5IO2 A;  2N5F A;  2P0G A;  4V2L A;  2VL2 A;  2KP2 A;  1ZYN A;  3P8W A;  5ECN B;  3GV1 A;  1TK8 B;  2LQQ A;  2VD0 A;  2IN3 A;  2YNX A;  3RAZ A;  2OAC A;  3FR3 A;  1M99 A;  2AHE A;  2C3N A;  4MDC A;  5JCU A;  5COH A;  3CSJ A;  4L5L A;  5H5R A;  2JZR A;  3DIE A;  2GT5 A;  1Q4J A;  4G0K A;  2X8G A;  4MPF A;  3TJJ A;  2ON7 A;  4V2M A;  4NXI A;  2H8L A;  2I1U A;  1ERW A;  2H30 A;  2HI7 A;  2VAF A;  5A4V A;  1A0F A;  1PQN A;  3FW2 A;  3P2A A;  2C0F A;  2DJ1 A;  4RQX A;  4GF0 A;  1SK0 A;  5DVB A;  1GP1 A;  3DEX A;  5EL8 A;  1XWB A;  5HR2 A;  3C73 A;  4XIH A;  3GL3 A;  2VM2 A;  3PGT A;  1ZZY A;  2NBS A;  4AF2 A;  1SD9 A;  3ZIT A;  1FO5 A;  3EE2 A;  3GUR A;  4XCS A;  3KGK A;  14GS A;  5CRE A;  4CY8 A;  2JU5 A;  3EVI A;  5F05 A;  3WGX A;  3CTG A;  3ZRE A;  1PX6 A;  2TRX A;  2GST A;  4HJM A;  1XBS A;  2RM6 A;  2GDR A;  4IKH A;  5HR0 A;  2VO4 A;  1Z7P A;  3NZN A;  1AW9 A;  2KUC A;  1TRW A;  2E2G A;  3ZZX A;  3HDC A;  1ST9 A;  2MMO A;  2J9H A;  1USB A;  1SKR B;  1VF1 A;  2IL3 A;  4BL7 A;  2C0D A;  1GSD A;  5IMA A;  1YKA A;  2LNS A;  2LUS A;  1GUL A;  4YQV A;  2VL3 A;  4WF5 A;  1WJK A;  3E0U A;  4CDO A;  1DE2 A;  3GKX A;  4XHM A;  1O81 A;  1NHO A;  2YJ7 A;  4WEY A;  4J56 E;  1GNE A;  2VD1 A;  4N0Z A;  3TGZ A;  5HR3 A;  3RHB A;  4XS4 A;  1S3A A;  1THO A;  2ES7 A;  2OE1 A;  1O85 A;  1TI3 A;  4HZ4 A;  2EC4 A;  2R0P A;  5FWG A;  4JZQ A;  2VCQ A;  4G10 A;  2YPM A;  2RUF A;  3HA9 A;  3KIJ A;  1SK1 A;  2L5L A;  1A8Y A;  3TKS A;  2VM1 A;  3R2Q A;  2L4C A;  2X64 A;  4TR4 A;  4F0B A;  4OMV A;  2AYT A;  5DJM A;  2L6D A;  3GN3 A;  3HCZ A;  2NVL A;  5D8I A;  5DQY A;  1FOV A;  4KCA A;  4LL1 B;  3KZQ A;  1NM3 A;  3F6F A;  2RM5 A;  3N9J A;  1X0R A;  4BL7 B;  3LQ7 A;  4I8B A;  2EIR A;  3G7Y A;  3LXT A;  1EP8 A;  1MDI A;  2WCI A;  3F0I A;  1EGR A;  5KN0 A;  2C3Q A;  3GRX A;  4NV2 A;  3IE3 A;  1OKT A;  2F51 A;  2WZ9 A;  3P7X A;  4BWS A;  1K3O A;  1B48 A;  3G9B A;  3H4K A;  3RPP A;  4N10 A;  1XW6 A;  2V41 A;  3FZ5 A;  3IV4 A;  2J23 A;  4XS4 B;  4YAV A;  1OE7 A;  2VIM A;  3M0F A;  2OBI A;  5ABR A;  3KH9 A;  2DKH A;  3CTF A;  5DCH A;  1PRX A;  2H6X A;  2LJA A;  3KMO A;  2WUL A;  1F3B A;  5D9V A;  4K8M A;  4Z7X A;  5IPG A;  3ZFL A;  1S3R A;  4KND A;  1SYX A;  2GSR A;  1FG4 A;  1SL2 B;  4HUA A;  3CBU A;  1GNW A;  3BCI A;  3RDW A;  2LEG A;  2H0G A;  2AJQ B;  1GSS A;  4OWY A;  3A2W A;  2H0I A;  5D9W A;  4KSM A;  1VGL A;  4FYU A;  2JSZ A;  5IIZ A;  4ISD A;  2R0C A;  5A4W A;  1JFU A;  2MMZ A;  2G0F A;  3ZFB A;  2C0G A;  3ZML A;  3C8E A;  1A2J A;  1G0T A;  3CMI A;  2NTO A;  2A2R A;  2YOI A;  4FO5 A;  1K3Y A;  1GTU A;  2H1B A;  4TXV A;  4HJ2 A;  3CSI A;  3K8N A;  1ZYQ B;  5HFK A;  3HJO A;  3UL3 A;  3L4N A;  2V6O A;  3VLN A;  2NDO A;  1M2A A;  2HYX A;  4WKW A;  2P31 A;  4NWY A;  3ERG A;  4JRR A;  1O6J A;  2L59 A;  3GKK A;  5H5Q A;  5ENU A;  4IQ1 A;  2YCD A;  3I43 A;  3L9U A;  1S3C A;  1BYE A;  3LFL A;  1BX9 A;  3UVH A;  1U6T A;  3KTB A;  2DBC A;  3TJK A;  2ON5 A;  1V98 A;  1O7U A;  1V2A A;  4PUR A;  4ECI A;  3TJF A;  6GST A;  1U3A A;  5ECH B;  1M0U A;  2YN1 A;  5JWQ B;  2PVO C;  3HVN A;  5ELA A;  1KNG A;  2DLX A;  7GSS A;  4TR1 B;  4I5Q A;  5DAL B;  2AB6 A;  2CX4 A;  1E6B A;  1LU4 A;  1K0D A;  1JZR A;  3QFA C;  2CZ2 A;  4L0W A;  3N5O A;  2K18 A;  1X9W B;  1AQW A;  3L0H A;  3NOF A;  6GSU A;  4TW5 A;  3L9V A;  1T4Z A;  4HEA 2;  2WRT A;  1G7O A;  3RPN A;  1M3I A;  1YEX A;  22GS A;  4O7H A;  2DSA A;  4L0U A;  2B1L A;  3ZIJ A;  4OFT A;  3QAG A;  5G2Z A;  1ERU A;  2JAC A;  3GUS A;  5C00 A;  2HSH A;  4KX4 A;  4YQU A;  2L57 A;  2E0Q A;  1GUH A;  2YZH A;  2O89 A;  2G2Q A;  1TRV A;  3WT2 A;  11GS A;  1GUK A;  4JR4 A;  4MH2 A;  4MNN A;  4O5U A;  5D9T A;  5G30 A;  1B8X A;  2KLX A;  1O73 A;  3LYK A;  5FT3 A;  1G6W A;  3IAM 2;  3EU4 A;  2IWT A;  4GQC A;  4KH7 A;  4X0X A;  4D73 A;  3D22 A;  2LRC A;  2DJ0 A;  3IAS 2;  4YKF A;  4HQZ A;  5EVO A;  4AJ8 A;  2R4V A;  3NIV A;  3FRC A;  1GTB A;  2C8U A;  5D93 A;  2FWH A;  1K0B A;  1ZOF A;  2HRK A;  4ZIL A;  3A2V A;  1PX7 A;  5F0G A;  4FYC A;  4OO4 A;  2WFC A;  3C71 A;  2C1Y A;  3C1S A;  3RBT A;  1ZYP A;  4F9Z A;  3DVX A;  2WS2 A;  1WPI A;  1KBN A;  1TKD B;  4POM A;  5ECR B;  2CAQ A;  2VCT A;  1K0C A;  4IP1 A;  4E8E A;  4WET A;  3TRP A;  2A2S A;  2X99 A;  2RUE A;  3LEF A;  3Q18 A;  2B5E A;  4OD7 A;  4LMW A;  2H1G A;  1M7T A;  4MJB A;  20GS A;  4KSO A;  2CAI A;  4G9H A;  2B3S A;  3L9S A;  5GSS A;  3APS A;  1ZL9 A;  2FLS A;  3U6V A;  4K7O A;  2R6K A;  3FYG A;  5CRG A;  3MSZ A;  5IMC A;  3EWL A;  3BOA A;  5ECM B;  1T8E B;  4E8H A;  4MPG A;  1XWC A;  2MBT A;  5J3R A;  2H66 A;  1H75 A;  3VWW A;  4GRF A;  1WE0 A;  5B6N A;  4K9Z A;  2N5B A;  1XVW A;  4OCF A;  2IMK A;  2HSM A;  1G7E A;  1RQM A;  1X9S B;  5B8B A;  3VWV A;  1V57 A;  2DJJ A;  3A2X A;  4ICY A;  5ECL B;  1SKS B;  1M2D A;  3HYP A;  4JBB A;  1JZW A;  1A2M A;  2H01 A;  3DGQ A;  4ZB9 A;  5A4U A;  1AQV A;  3W6G A;  1XFL A;  3UJ1 A;  2HRN A;  3SWL A;  2XPE A;  4TXO B;  3QAW A;  3D6I A;  3WD6 A;  1XOA A;  1SEN A;  1ZGN A;  2IPA A;  3A5W A;  3TRQ A;  2ZUP A;  6GSS A;  2K8V A;  2AUV A;  1FW1 A;  4EIP A;  4CHS A;  1J9B A;  4PQ1 A;  2CVK A;  1EEM A;  4L8E A;  3KJY A;  1KEB A;  5CRH A;  4XS6 A;  4QL9 A;  4F2I A;  1RW1 A;  1XG8 A;  4BA7 A;  1CQG A;  2H74 A;  3ZL5 A;  2QA2 A;  2RII A;  4HSC X;  4K5R A;  1ML6 A;  2N5A A;  3A5I A;  5DDL A;  2KP1 A;  2H0H A;  1TXX A;  2DIY A;  3F8U A;  1T1V A;  4EC0 A;  4EVM A;  4NPB A;  4BWQ A;  3LJR A;  4IEL A;  5GZZ B;  5JCW A;  1B4Q A;  2IME A;  4KF9 A;  4I2T A;  13GS A;  2PBJ A;  3IC4 A;  4AGS A;  1YKC A;  2FHE A;  5C04 A;  2H1A A;  2O7K A;  4I6X A;  3BJ5 A;  4XRD A;  3EUR A;  1K3L A;  3FZ4 A;  3RHC A;  3WGD A;  2OE3 A;  2K9F A;  3M9J A;  4OCE A;  1PL1 A;  3F6D A;  3QPM A;  16GS A;  5H5S A;  2GT6 A;  2CVB A;  1VF3 A;  5G5E A;  4CW9 A;  3Q19 A;  2VUP A;  2OKA A;  4TVE A;  4XS1 A;  3EMX A;  4RQR A;  18GS A;  1Z5Y E;  2AAW A;  1T00 A;  3JCM L;  4PTS A;  3W8J A;  3VUR A;  1QUW A;  3Q74 A;  1XCC A;  5ECS A;  4KDU A;  1PA3 A;  1YY7 A;  5LD0 A;  2IIY A;  2MMA A;  4NV5 A;  3UBL A;  4HS1 A;  3MAK A;  1PGT A;  1K0M A;  3TUE A;  4G2E A;  1FB0 A;  5IMD A;  4KDX A;  4J2F A;  1B9X C;  1DE1 A;  1XXU A;  3ME7 A;  4YH2 A;  4AJ7 A;  3H79 A;  1SKW B;  4IJI A;  1PFO A;  1GSQ A;  5E4W A;  5B6M A;  3E3E A;  4FYB A;  1ERV A;  1XVQ A;  4PQH A;  4BPY A;  4MAB A;  4EIQ A;  1T7P B;  4ZL7 A;  2VLV A;  2KHP A;  4H86 A;  2MZC A;  5J9B A;  1F3A A;  4IHU A;  5B7C A;  4QQ7 A;  3KP8 A;  3VK9 A;  1FVK A;  3DVW A;  1T3B A;  2GS3 A;  2DML A;  5B8A A;  2X8H A;  2HRF A;  5CP1 A;  3G7I A;  3IDV A;  1JLW A;  2A2P A;  4K2D A;  5AIS A;  5F07 A;  1PL2 A;  1SJI A;  3GST A;  1ZMA A;  5GST A;  4MZC A;  5G5F A;  2OBK A;  2EIO A;  2M72 A;  2PPT A;  5F8B A;  4K5S A;  4Z2R A;  1GRX A;  1W89 A;  3FZA A;  2FNO A;  2GZP A;  3CSH A;  3MIX A;  3O76 A;  2H71 A;  2B7J A;  3C7M A;  4ZB6 A;  2VL2 C;  1HQO A;  2B7K A;  4JE1 A;  1EOG A;  2TIR A;  3IK7 A;  4G19 A;  1VRS D;  4JR6 A;  2HZF A;  3ZVJ A;  3PR8 A;  1W4V A;  4Q5N A;  5CAX A;  5KN1 A;  3P90 A;  4PGT A;  4LL4 B;  2KOK A;  3F4S A;  5HQP A;  2H6Y A;  1Z9H A;  1GSU A;  3H1N A;  1B9Y C;  2A4V A;  3GFK A;  3GTU A;  2WB9 A;  4K1F A;  2DMM A;  1S3D A;  2GTU A;  3IR4 A;  4TR0 A;  1JZD A;  2B5Y A;  3IPZ A;  4GST A;  3VI5 A;  3KEB A;  5G1L A;  4DSQ A;  1QGV A;  3ERW A;  4MCU A;  2BMX A;  4EDZ A;  2LS5 A;  1OC9 A;  3DML A;  2JL4 A;  2FWG A;  4TN8 A;  4FH8 A;  5E59 A;  1THX A;  1X5C A;  2YWM A;  2MBS A;  2OE0 A;  4PUA A;  1IYH A;  3HJP A;  5D9X A;  2FWE A;  2YV7 A;  3C1R A;  4EE0 A;  2IMD A;  1TJD A;  1Z7R A;  1Q98 A;  2ALB A;  2H19 A;  1A23 A;  3VWU A;  3LXZ A;  3F4T A;  1SL0 B;  4HZ2 A;  1M9B A;  4MH3 A;  3FHK A;  1TK0 B;  4IBP A;  1C72 A;  5G1K A;  3GSS A;  3DXB A;  1PKZ A;  2H75 A;  2O8V B;  4GXZ A;  2QKE A;  4TR3 A;  2V2G A;  3UVT A;  2M80 A;  5LNK e;  1Y6E A;  3GX8 A;  2PMT A;  2GVP A;  2VL9 A;  4USS A;  2LJK A;  5GAN D;  2GSQ A;  5AGY A;  2AV4 A;  4WR4 A;  3DD3 A;  4K2X A;  2GLR A;  2D2Z A;  4GSN A;  3V1W A;  5HFG A;  4HOJ A;  3IK9 A;  2O87 A;  4O92 A;  1E2Y A;  1TOF A;  2C0E A;  1AC1 A;  4KUN A;  4ECB A;  5J9C A;  1OC9 B;  5GAP D;  1B4P A;  1F6M C;  3F9U A;  5D96 A;  1TI1 A;  3QDN A;  3O6T A;  3SBC A;  1QXH A;  4EDY A;  2WJU A;  2WGR A;  4X43 A;  4TRX A;  2H70 A;  1PN0 A;  1MD4 A;  4MJA A;  2VCW A;  3TB2 A;  1HNA A;  3H93 A;  4L5O A;  2OA7 A;  3ZMK A;  1U88 A;  1XOB A;  4ML1 A;  1WIK A;  4N30 A;  3UEM A;  2YWI A;  1JHB A;  1I5G A;  4EXJ A;  2TRC P;  4G0L A;  5KEJ A;  2E7P A;  4ECJ A;  4IW9 A;  4QL7 A;  4O32 A;  3TKS C;  1QFN A;  5IMV A;  2VLT A;  2DJ3 A;  1OC3 A;  4V1A g;  3F3R A;  4G0I A;  1SU9 A;  1TRU A;  1AIU A;  2PER A;  2I81 A;  3MWH A;  1M3J A;  4PQI A;  2FGX A;  3I6A A;  2R3X A;  5G31 A;  1ZCP A;  3OR5 A;  5INY A;  3FY7 A;  4V1A p;  1OE8 A;  3EIN A;  1TU7 A;  1OC8 A;  4PXO A;  3IOS A;  2PUK C;  2FA8 A;  3ME8 A;  1X5D A;  4K0N A;  3HVX A;  4BVY A;  3PPU A;  2GQM A;  1I9D A;  1GH2 A;  2FA4 A;  1J0F A;  1A0R P;  2C3T A;  3GKM A;  1QMV A;  3IBH A;  3M1G A;  4MF7 A;  3LYP A;  6GSW A;  4IVF A;  4TKY A;  1YF0 A;  5IPH A;  1MDK A;  1YDK A;  4NHZ A;  3PH9 A;  4NMU A;  3VFI A;  5DCG A;  4ZBB A;  1O8W A;  1N8J A;  1U87 A;  4MJC A;  2K8S A;  2PVQ A;  1GUM A;  3LG6 A;  3UOM A;  2C4J A;  2R2J A;  4KDY A;  2XBQ A;  3IC8 A;  3LWA A;  4D73 B;  4ACS A;  4RI7 A;  4MZB A;  5IMF A;  4GLT A;  3IA1 A;  3TJB A;  2YWN A;  2H1D A;  1Z3E A;  3FEU A;  4CY6 A;  1FHE A;  3CRU A;  3U5R E;  4F0C A;  2HFD A;  3IRA A;  1TK5 B;  2FUG 2;  1R5A A;  2L6C A;  5J5N A;  8GSS A;  4Q5Q A;  3GMF A;  3HY2 A;  4I97 A;  1DSB A;  2VOC A;  3D0Z A;  3CQF A;  5ECK B;  2CVD A;  3TDG A;  3IHQ A;  4EUY A;  1QQ2 A;  5BRT A;  3M8N A;  1GL8 A;  4PNG A;  1UN2 A;  1K0A A;  4IP6 A;  2LST A;  2X4A A;  3GNJ A;  1EZK A;  4ZB8 A;  2XHF A;  2DJK A;  1SYR A;  5IO0 A;  2F9S A;  4MMM A;  3TKS E;  1XIY A;  3I9V 2;  4KAE A;  2MMN A;  4YKG A;  1XW9 A;  4DVC A;  3UMA A;  2ZNM A;  3ZVJ D;  17GS A;  4DSS A;  1TTZ A;  5DBQ A;  1BG5 A;  2WDU A;  4BIK A;  2QA1 A;  4HDE A;  1VF2 A;  1GTI A;  1NSW A;  4XTS A;  1V9W A;  5ECP B;  4WF4 A;  2M46 A;  3D5J A;  3KM6 A;  5ECO B;  1AQX A;  1ZYE A;  4ZBA A;  1YEP A;  4PX1 A;  3CYN A;  1A24 A;  4IJ3 A;  4N11 A;  2EIQ A;  3A3T A;  1TU8 A;  1LJR A;  2GQL A;  4A5P A;  5HFI A;  4POK A;  1OYJ A;  5ECI B;  2MYG A;  3EYT A;  1MTC A;  1U3I A;  3QR6 A;  4EL1 A;  3VWX A;  2YP6 A;  4ID0 A;  1A8L A;  4GSS A;  4GWR A;  1RK4 A;  2F3M A;  3HD5 A;  3ED3 A;  4K7I A;  1BAY A;  1PMT A;  3TRX A;  3GH6 A;  4X4J A;  1CQH A;  4GCI A;  3TJG A;  1R26 A;  1AAZ A;  4ZXG A;  2LRT A;  4NAX A;  4GQF A;  4MP4 A;  2VCV A;  4DSS B;  3TOU A;  2LNT A;  1X9M B;  1G6Y A;  1FB6 A;  6GSV A;  2HXK A;  3F3Q A;  3HVS A;  1K0N A;  1K0O A;  4OO5 A;  3H8Q A;  3L78 A;  1TDI A;  2X8C A;  3F4R A;  2DIZ A;  2O85 A;  4HI7 A;  4ILF A;  2I3Y A;  2H6Z A;  3CXG A;  1O8X A;  2YWO A;  2BJX A;  1JZO A;  1BQ7 A;  1F9M A;  1TRS A;  1FAA A;  2VCX A;  2DC5 A;  3G7J A;  5JWR B;  1PD2 1;  1M2B A;  3E9J B;  1GSY A;  5IMZ A;  4KB3 A;  3ZYW A;  1VF4 A;  2XC2 A;  4ZIJ A;  2LRN A;  5AIV A;  3LOR A;  2P5R A;  3VPQ A;  1XW5 A;  3FR6 A;  3HZ8 A;  4K0G A;  4WBR D;  2HE3 A;  1J08 A;  1WWJ A;  4ZL9 A;  3IHG A;  4DSR A;  3UBK A;  2H72 A;  5CO3 A;  1SL1 B;  2JAD A;  2FY6 A;  5AN1 A;  2HLS A;  1GSF A;  1GLQ A;  2LV3 A;  5ECQ B;  5CRD A;  1R7H A;  3UAP A;  5IQY A;  1SJZ A;  5CNW A;  1ABA A;  4IN0 A;  4V2N A;  2HZE A;  3GX0 A;  1AUC A;  4POL A;  3KCM A;  1GTA A;  4HQS A;  3FR9 A;  12GS A;  4IGJ A;  2Z9S A;  4ZL8 A;  4Q5R A;  3QOU A;  2A4H A;  1XWK A;  2PN8 A;  3GH9 A;  4EO3 A;  4POB A;  1DBY A;  4ZBD A;  3GA4 A;  4WXT A;  4EF0 A;  1PSQ A;  3DYR A;  1HYU A;  3BCK A;  3ZRD A;  1EV4 A;  1OVN A;  5ID2 A;  3ERF A;  1YF1 A;  3S9F A;  1LBK A;  1GSE A;  1OKD A;  4K7N A;  3LGC A;  1DUG A;  5DAK A;  2C80 A;  2H76 A;  2CT6 A;  4Z2T A;  6GSX A;  2FWF A;  2YV9 A;  1Y25 A;  3UIW A;  4LA1 A;  1F2E A;  4PNF A;  2BTO T;  1NW2 A;  4YAP A;  2OJL A;  3CRT A;  4ULX A;  3AY8 A;  3KMN A;  3D4M A;  1XWA A;  3F63 A;  3ISO A;  3QAV A;  5KOX A;  2R0G A;  1HNC A;  2VCZ A;  3HHV A;  2HZE B;  5IM9 A;  2B1K A;  4ECC A;  4YQM A;  1T4Y A;  3US3 A;  1XWG A;  2GGT A;  4MA9 A;  3HZ4 A;  3D4T A;  3D21 A;  3J7Y b;  1EV9 A;  2DKI A;  5BMU A;  5DQS A;  1ERT A;  5KOW A;  1EP7 A;  4PUF C;  1MDJ A;  3GKN A;  4RI6 A;  4FIW A;  3BBY A;  4K6X A;  2K6V A;  1OAZ A;  5KN2 A;  1GLP A;  4IS0 A;  1AXD A;  2OAD A;  4MJE A;  3QD9 A;  5ID2 B;  4TR1 A;  4KW6 A;  5DAL A;  2IMI A;  4O5R A;  2GZY A;  2JSY A;  3EPT A;  3APO A;  5DAK B;  2QGV A;  1N2A A;  2CQ9 A;  4GTU A;  2PU9 C;  4LLR A;  1QK8 A;  5F06 A;  1GWC A;  3KXO A;  4XRA A;  1WOU A;  3M3M A;  1R5P A;  1SJ6 A;  3KH7 A;  4O5Q A;  2XPD A;  4OFN A;  2B5X A;  4IQA A;  1MD3 A;  3TOT A;  10GS A;  4WBJ A;  1WP0 A;  5ELG A;  1TW9 A;  5IOX A;  3GL5 A;  4X1U A;  2HNL A;  2LJR A;  5CRW A;  1V58 A;  2JZT A;  3TCO A;  2PWJ A;  3MDK A;  2CZ3 A;  3KD0 A;  5J41 A;  3LW9 A;  1EOH A;  3ZTL A;  4P3Y B;  4BVX A;  4JU5 A;  3LSZ A;  4JED A;  1YQ1 A;  3HKR A;  3W8S A;  4AJ6 A;  5FHI A;  3HJM A;  5HR1 A;  1PN9 A;  1BED A;  5AIX A;  2V32 A;  2DJ2 A;  4MLY A;  1EWX A;  5JCG A;  4Q5F A;  3GTU B;  2H73 A;  3VPT A;  4RUV A;  5CYY A;  3DKS A;  1FVJ A;  2HSY A;  5DJL A;  3TKQ A;  4LMV A;  4FQU A;  1V40 A;  2IJY A;  4KE3 A;  2VLU A;  4F03 A;  2QC7 A;  3ZLP A;  2JZS A;  1MEK A;  2YAN A;  9GSS A;  3TKP A;  2B6M A;  3KTL A;  1WMJ A;  4DEJ A;  2V1M A;  2I4A A;  2F8F A;  2HT9 A;  3HVV A;  2CX3 A;  2QSI A;  1Z6N A;  4MF5 A;  3WGE A; 
#chains in the Genus database with same CATH homology
 1FOH A;  1F37 A;  4HU7 A;  3UAR A;  3WYW A;  3EMP A;  1X5E A;  1UA5 A;  2IFQ A;  1YJ6 A;  4BVX B;  3QCP A;  2NPB A;  2UZ8 A;  2L4Q A;  4EKZ A;  3MNG A;  2REM A;  3WT1 A;  3GYK A;  3O3T A;  3ZIV A;  5J4U A;  1YZX A;  5D73 A;  3QMX A;  2GZZ A;  3IXR A;  2E2M A;  3R3E A;  4TOP A;  4OFM A;  2CV4 A;  2YZU A;  1ON4 A;  1BJX A;  2GSS A;  1WRY A;  1SD8 A;  4KGI A;  1A2L A;  5A5K A;  5EY6 A;  1XPV A;  3EU3 A;  5IOW A;  2HRA A;  1H4O A;  1XZO A;  6GSY A;  4WR5 A;  2R37 A;  3I69 A;  2FCH A;  3DRN A;  3M9K A;  1ILO A;  1ACV A;  3TKR A;  4ML6 A;  3FKF A;  3MYD A;  3J7Y k;  2ZCT A;  1HD2 A;  1URM A;  5L71 A;  3DWV A;  1IYI A;  1EEJ A;  3GHA A;  2XBI A;  1SK2 A;  2I9H A;  1UVZ A;  2RLI A;  2IFQ B;  1NHY A;  1JLV A;  4MF6 A;  2CA8 A;  19GS A;  2V6K A;  2P5Q A;  2FD3 A;  3PIN A;  4MK3 A;  2LQO A;  1R4W A;  1PKW A;  2F8A A;  2R5G A;  4KA0 A;  4Z2U A;  3FK8 A;  3FZ9 A;  4J57 E;  4MZW A;  2PGT A;  1Z6M A;  5JWO B;  1EGO A;  2GQK A;  2LKU A;  3FMW A;  4TXO A;  1KTE A;  3VI7 A;  3HXS A;  2LTK A;  4N0V A;  3QFB C;  4KCE A;  4HU9 A;  3GIX A;  2X49 A;  5KN3 A;  3KP9 A;  2YJH A;  1HNB A;  3Q6O A;  1UC7 A;  3BD2 A;  2IMF A;  3EC3 A;  5LCZ A;  4F82 A;  4NHW A;  4I2U A;  1TP9 A;  1M9A A;  4BVY B;  2L5O A;  5EPF A;  3APQ A;  5IO2 A;  2N5F A;  2P0G A;  4V2L A;  2VL2 A;  2KP2 A;  1ZYN A;  3P8W A;  5ECN B;  3GV1 A;  1TK8 B;  2LQQ A;  2VD0 A;  2IN3 A;  2YNX A;  3RAZ A;  2OAC A;  3FR3 A;  1M99 A;  2AHE A;  2C3N A;  4MDC A;  5JCU A;  5COH A;  3CSJ A;  4L5L A;  5H5R A;  2JZR A;  3DIE A;  2GT5 A;  1Q4J A;  4G0K A;  2X8G A;  4MPF A;  3TJJ A;  2ON7 A;  4V2M A;  4NXI A;  2H8L A;  2I1U A;  1ERW A;  2H30 A;  2HI7 A;  2VAF A;  5A4V A;  1A0F A;  1PQN A;  3FW2 A;  3P2A A;  2C0F A;  2DJ1 A;  4RQX A;  4GF0 A;  1SK0 A;  5DVB A;  1GP1 A;  3DEX A;  5EL8 A;  1XWB A;  5HR2 A;  3C73 A;  4XIH A;  3GL3 A;  2VM2 A;  3PGT A;  1ZZY A;  2NBS A;  4AF2 A;  1SD9 A;  3ZIT A;  1FO5 A;  3EE2 A;  3GUR A;  4XCS A;  3KGK A;  14GS A;  5CRE A;  4CY8 A;  2JU5 A;  3EVI A;  5F05 A;  3WGX A;  3CTG A;  3ZRE A;  1PX6 A;  2TRX A;  2GST A;  4HJM A;  1XBS A;  2RM6 A;  2GDR A;  4IKH A;  5HR0 A;  2VO4 A;  1Z7P A;  3NZN A;  1AW9 A;  2KUC A;  1TRW A;  2E2G A;  3ZZX A;  3HDC A;  1ST9 A;  2MMO A;  2J9H A;  1USB A;  1SKR B;  1VF1 A;  2IL3 A;  4BL7 A;  2C0D A;  1GSD A;  5IMA A;  1YKA A;  2LNS A;  2LUS A;  1GUL A;  4YQV A;  2VL3 A;  4WF5 A;  1WJK A;  3E0U A;  4CDO A;  1DE2 A;  3GKX A;  4XHM A;  1O81 A;  1NHO A;  2YJ7 A;  4WEY A;  4J56 E;  1GNE A;  2VD1 A;  4N0Z A;  3TGZ A;  5HR3 A;  3RHB A;  4XS4 A;  1S3A A;  1THO A;  2ES7 A;  2OE1 A;  1O85 A;  1TI3 A;  4HZ4 A;  2EC4 A;  2R0P A;  5FWG A;  4JZQ A;  2VCQ A;  4G10 A;  2YPM A;  2RUF A;  3HA9 A;  3KIJ A;  1SK1 A;  2L5L A;  1A8Y A;  3TKS A;  2VM1 A;  3R2Q A;  2L4C A;  2X64 A;  4TR4 A;  4F0B A;  4OMV A;  2AYT A;  5DJM A;  2L6D A;  3GN3 A;  3HCZ A;  2NVL A;  5D8I A;  5DQY A;  1FOV A;  4KCA A;  4LL1 B;  3KZQ A;  1NM3 A;  3F6F A;  2RM5 A;  3N9J A;  1X0R A;  4BL7 B;  3LQ7 A;  4I8B A;  2EIR A;  3G7Y A;  3LXT A;  1EP8 A;  1MDI A;  2WCI A;  3F0I A;  1EGR A;  5KN0 A;  2C3Q A;  3GRX A;  4NV2 A;  3IE3 A;  1OKT A;  2F51 A;  2WZ9 A;  3P7X A;  4BWS A;  1K3O A;  1B48 A;  3G9B A;  3H4K A;  3RPP A;  4N10 A;  1XW6 A;  2V41 A;  3FZ5 A;  3IV4 A;  2J23 A;  4XS4 B;  4YAV A;  1OE7 A;  2VIM A;  3M0F A;  2OBI A;  5ABR A;  3KH9 A;  2DKH A;  3CTF A;  5DCH A;  1PRX A;  2H6X A;  2LJA A;  3KMO A;  2WUL A;  1F3B A;  5D9V A;  4K8M A;  4Z7X A;  5IPG A;  3ZFL A;  4KND A;  1SYX A;  2GSR A;  1FG4 A;  1SL2 B;  4HUA A;  3CBU A;  1GNW A;  3BCI A;  3RDW A;  2LEG A;  2H0G A;  2AJQ B;  1GSS A;  4OWY A;  3A2W A;  2H0I A;  5D9W A;  4KSM A;  1VGL A;  4FYU A;  2JSZ A;  5IIZ A;  4ISD A;  2R0C A;  5A4W A;  1JFU A;  2MMZ A;  2G0F A;  3ZFB A;  2C0G A;  3ZML A;  3C8E A;  1A2J A;  1G0T A;  3CMI A;  2NTO A;  2A2R A;  2YOI A;  4FO5 A;  1K3Y A;  1GTU A;  2H1B A;  4TXV A;  4HJ2 A;  3CSI A;  3K8N A;  1ZYQ B;  5HFK A;  3HJO A;  3UL3 A;  3L4N A;  2V6O A;  3VLN A;  2NDO A;  1M2A A;  2HYX A;  4WKW A;  2P31 A;  4NWY A;  3ERG A;  4JRR A;  1O6J A;  2L59 A;  3GKK A;  5H5Q A;  5ENU A;  4IQ1 A;  2YCD A;  3I43 A;  3L9U A;  1S3C A;  1BYE A;  3LFL A;  1BX9 A;  3UVH A;  1U6T A;  3KTB A;  2DBC A;  3TJK A;  2ON5 A;  1V98 A;  1O7U A;  1V2A A;  4PUR A;  4ECI A;  3TJF A;  6GST A;  1U3A A;  5ECH B;  1M0U A;  2YN1 A;  5JWQ B;  2PVO C;  5ELA A;  1KNG A;  2DLX A;  7GSS A;  4TR1 B;  4I5Q A;  5DAL B;  2AB6 A;  2CX4 A;  1E6B A;  1LU4 A;  1K0D A;  1JZR A;  3QFA C;  2CZ2 A;  4L0W A;  3N5O A;  2K18 A;  1X9W B;  1AQW A;  3L0H A;  3NOF A;  6GSU A;  4TW5 A;  3L9V A;  1T4Z A;  4HEA 2;  2WRT A;  1G7O A;  3RPN A;  1YEX A;  22GS A;  4O7H A;  2DSA A;  4L0U A;  2B1L A;  3ZIJ A;  4OFT A;  3QAG A;  5G2Z A;  1ERU A;  2JAC A;  3GUS A;  5C00 A;  2HSH A;  4KX4 A;  4YQU A;  2L57 A;  2E0Q A;  1GUH A;  2YZH A;  2O89 A;  2G2Q A;  1TRV A;  3WT2 A;  11GS A;  1GUK A;  4JR4 A;  4MH2 A;  4MNN A;  4O5U A;  5D9T A;  5G30 A;  1B8X A;  2KLX A;  1O73 A;  3LYK A;  5FT3 A;  1G6W A;  3IAM 2;  3EU4 A;  2IWT A;  4GQC A;  4KH7 A;  4X0X A;  4D73 A;  3D22 A;  2LRC A;  2DJ0 A;  3IAS 2;  4YKF A;  4HQZ A;  5EVO A;  4AJ8 A;  2R4V A;  3NIV A;  3FRC A;  1GTB A;  2C8U A;  5D93 A;  2FWH A;  1K0B A;  1ZOF A;  2HRK A;  4ZIL A;  3A2V A;  1PX7 A;  5F0G A;  4FYC A;  4OO4 A;  2WFC A;  3C71 A;  2C1Y A;  3C1S A;  3RBT A;  1ZYP A;  4F9Z A;  3DVX A;  2WS2 A;  1WPI A;  1KBN A;  1TKD B;  4POM A;  5ECR B;  2CAQ A;  2VCT A;  1K0C A;  4IP1 A;  4E8E A;  4WET A;  3TRP A;  2A2S A;  2X99 A;  2RUE A;  3LEF A;  3Q18 A;  2B5E A;  4OD7 A;  4LMW A;  2H1G A;  1M7T A;  4MJB A;  20GS A;  4KSO A;  2CAI A;  4G9H A;  2B3S A;  3L9S A;  5GSS A;  3APS A;  1ZL9 A;  2FLS A;  3U6V A;  4K7O A;  2R6K A;  3FYG A;  5CRG A;  3MSZ A;  5IMC A;  3EWL A;  3BOA A;  5ECM B;  1T8E B;  4E8H A;  4MPG A;  1XWC A;  2MBT A;  5J3R A;  2H66 A;  1H75 A;  3VWW A;  4GRF A;  1WE0 A;  5B6N A;  4K9Z A;  2N5B A;  1XVW A;  4OCF A;  2IMK A;  2HSM A;  1G7E A;  1RQM A;  1X9S B;  5B8B A;  3VWV A;  1V57 A;  2DJJ A;  3A2X A;  4ICY A;  5ECL B;  1SKS B;  1M2D A;  3HYP A;  4JBB A;  1JZW A;  1A2M A;  2H01 A;  3DGQ A;  4ZB9 A;  5A4U A;  1AQV A;  3W6G A;  1XFL A;  3UJ1 A;  2HRN A;  3SWL A;  2XPE A;  4TXO B;  3QAW A;  3D6I A;  3WD6 A;  1XOA A;  1SEN A;  1ZGN A;  2IPA A;  3A5W A;  3TRQ A;  2ZUP A;  6GSS A;  2K8V A;  2AUV A;  1FW1 A;  4EIP A;  4CHS A;  1J9B A;  4PQ1 A;  2CVK A;  1EEM A;  4L8E A;  3KJY A;  1KEB A;  5CRH A;  4XS6 A;  4QL9 A;  4F2I A;  1RW1 A;  4BA7 A;  1CQG A;  2H74 A;  3ZL5 A;  2QA2 A;  2RII A;  4K5R A;  1ML6 A;  2N5A A;  3A5I A;  5DDL A;  2KP1 A;  2H0H A;  1TXX A;  2DIY A;  3F8U A;  1T1V A;  4EC0 A;  4EVM A;  4NPB A;  4BWQ A;  3LJR A;  4IEL A;  5GZZ B;  5JCW A;  1B4Q A;  2IME A;  4KF9 A;  4I2T A;  13GS A;  2PBJ A;  3IC4 A;  4AGS A;  1YKC A;  2FHE A;  5C04 A;  2H1A A;  2O7K A;  4I6X A;  3BJ5 A;  4XRD A;  3EUR A;  1K3L A;  3FZ4 A;  3RHC A;  3WGD A;  2OE3 A;  2K9F A;  3M9J A;  4OCE A;  1PL1 A;  3F6D A;  3QPM A;  16GS A;  5H5S A;  2GT6 A;  2CVB A;  1VF3 A;  5G5E A;  4CW9 A;  3Q19 A;  2VUP A;  2OKA A;  4TVE A;  4XS1 A;  3EMX A;  4RQR A;  18GS A;  1Z5Y E;  2AAW A;  1T00 A;  3JCM L;  4PTS A;  3W8J A;  3VUR A;  1QUW A;  3Q74 A;  1XCC A;  5ECS A;  4KDU A;  1PA3 A;  1YY7 A;  5LD0 A;  2IIY A;  2MMA A;  4NV5 A;  3UBL A;  4HS1 A;  3MAK A;  1PGT A;  1K0M A;  3TUE A;  4G2E A;  1FB0 A;  5IMD A;  4KDX A;  4J2F A;  1B9X C;  1DE1 A;  1XXU A;  3ME7 A;  4YH2 A;  4AJ7 A;  3H79 A;  1SKW B;  4IJI A;  1GSQ A;  5E4W A;  5B6M A;  3E3E A;  4FYB A;  1ERV A;  1XVQ A;  4PQH A;  4BPY A;  4MAB A;  4EIQ A;  1T7P B;  4ZL7 A;  2VLV A;  2KHP A;  4H86 A;  2MZC A;  5J9B A;  1F3A A;  4IHU A;  5B7C A;  4QQ7 A;  3KP8 A;  3VK9 A;  1FVK A;  3DVW A;  1T3B A;  2GS3 A;  2DML A;  5B8A A;  2X8H A;  2HRF A;  5CP1 A;  3G7I A;  3IDV A;  1JLW A;  2A2P A;  4K2D A;  5AIS A;  5F07 A;  1PL2 A;  1SJI A;  3GST A;  1ZMA A;  5GST A;  4MZC A;  5G5F A;  2OBK A;  2EIO A;  2M72 A;  2PPT A;  5F8B A;  4K5S A;  4Z2R A;  1GRX A;  1W89 A;  3FZA A;  2FNO A;  2GZP A;  3CSH A;  3MIX A;  3O76 A;  2H71 A;  2B7J A;  3C7M A;  4ZB6 A;  2VL2 C;  1HQO A;  2B7K A;  4JE1 A;  1EOG A;  2TIR A;  3IK7 A;  4G19 A;  1VRS D;  4JR6 A;  2HZF A;  3ZVJ A;  3PR8 A;  1W4V A;  4Q5N A;  5CAX A;  5KN1 A;  3P90 A;  4PGT A;  4LL4 B;  2KOK A;  3F4S A;  5HQP A;  2H6Y A;  1Z9H A;  1GSU A;  3H1N A;  1B9Y C;  2A4V A;  3GFK A;  3GTU A;  2WB9 A;  4K1F A;  2DMM A;  1S3D A;  2GTU A;  3IR4 A;  4TR0 A;  1JZD A;  2B5Y A;  3IPZ A;  4GST A;  3VI5 A;  3KEB A;  5G1L A;  4DSQ A;  1QGV A;  3ERW A;  4MCU A;  2BMX A;  4EDZ A;  2LS5 A;  1OC9 A;  3DML A;  2JL4 A;  2FWG A;  4TN8 A;  4FH8 A;  5E59 A;  1THX A;  1X5C A;  2YWM A;  2MBS A;  2OE0 A;  4PUA A;  1IYH A;  3HJP A;  5D9X A;  2FWE A;  2YV7 A;  3C1R A;  4EE0 A;  2IMD A;  1TJD A;  1Z7R A;  1Q98 A;  2ALB A;  2H19 A;  1A23 A;  3VWU A;  3LXZ A;  3F4T A;  1SL0 B;  4HZ2 A;  1M9B A;  4MH3 A;  3FHK A;  1TK0 B;  4IBP A;  1C72 A;  5G1K A;  3GSS A;  3DXB A;  1PKZ A;  2H75 A;  2O8V B;  4GXZ A;  2QKE A;  4TR3 A;  2V2G A;  3UVT A;  2M80 A;  5LNK e;  1Y6E A;  3GX8 A;  2PMT A;  2GVP A;  2VL9 A;  4USS A;  2LJK A;  5GAN D;  2GSQ A;  5AGY A;  2AV4 A;  4WR4 A;  3DD3 A;  4K2X A;  2GLR A;  2D2Z A;  4GSN A;  3V1W A;  5HFG A;  4HOJ A;  3IK9 A;  2O87 A;  4O92 A;  1E2Y A;  1TOF A;  2C0E A;  1AC1 A;  4KUN A;  4ECB A;  5J9C A;  1OC9 B;  5GAP D;  1B4P A;  1F6M C;  3F9U A;  5D96 A;  1TI1 A;  3QDN A;  3O6T A;  3SBC A;  1QXH A;  4EDY A;  2WJU A;  2WGR A;  4X43 A;  4TRX A;  2H70 A;  1PN0 A;  1MD4 A;  4MJA A;  2VCW A;  3TB2 A;  1HNA A;  3H93 A;  4L5O A;  2OA7 A;  3ZMK A;  1U88 A;  1XOB A;  4ML1 A;  1WIK A;  4N30 A;  3UEM A;  2YWI A;  1JHB A;  1I5G A;  4EXJ A;  2TRC P;  4G0L A;  5KEJ A;  2E7P A;  4ECJ A;  4IW9 A;  4QL7 A;  4O32 A;  3TKS C;  1QFN A;  5IMV A;  2VLT A;  2DJ3 A;  1OC3 A;  4V1A g;  3F3R A;  4G0I A;  1SU9 A;  1TRU A;  1AIU A;  2PER A;  2I81 A;  3MWH A;  4PQI A;  2FGX A;  3I6A A;  2R3X A;  5G31 A;  1ZCP A;  3OR5 A;  5INY A;  3FY7 A;  4V1A p;  1OE8 A;  3EIN A;  1TU7 A;  1OC8 A;  4PXO A;  3IOS A;  2PUK C;  2FA8 A;  3ME8 A;  1X5D A;  4K0N A;  3HVX A;  4BVY A;  3PPU A;  2GQM A;  1I9D A;  1GH2 A;  2FA4 A;  1J0F A;  1A0R P;  2C3T A;  3GKM A;  1QMV A;  3IBH A;  3M1G A;  4MF7 A;  3LYP A;  6GSW A;  4IVF A;  4TKY A;  1YF0 A;  5IPH A;  1MDK A;  1YDK A;  4NHZ A;  3PH9 A;  4NMU A;  3VFI A;  5DCG A;  4ZBB A;  1O8W A;  1N8J A;  1U87 A;  4MJC A;  2K8S A;  2PVQ A;  1GUM A;  3LG6 A;  3UOM A;  2C4J A;  2R2J A;  4KDY A;  2XBQ A;  3IC8 A;  3LWA A;  4D73 B;  4ACS A;  4RI7 A;  4MZB A;  5IMF A;  4GLT A;  3IA1 A;  3TJB A;  2YWN A;  2H1D A;  1Z3E A;  3FEU A;  4CY6 A;  1FHE A;  3CRU A;  3U5R E;  4F0C A;  2HFD A;  3IRA A;  1TK5 B;  2FUG 2;  1R5A A;  2L6C A;  5J5N A;  8GSS A;  4Q5Q A;  3GMF A;  3HY2 A;  4I97 A;  1DSB A;  2VOC A;  3D0Z A;  3TDG A;  5ECK B;  2CVD A;  3IHQ A;  4EUY A;  1QQ2 A;  5BRT A;  3M8N A;  1GL8 A;  4PNG A;  1UN2 A;  1K0A A;  4IP6 A;  2LST A;  2X4A A;  3GNJ A;  1EZK A;  4ZB8 A;  2XHF A;  2DJK A;  1SYR A;  5IO0 A;  2F9S A;  4MMM A;  3TKS E;  1XIY A;  3I9V 2;  4KAE A;  2MMN A;  4YKG A;  1XW9 A;  4DVC A;  3UMA A;  2ZNM A;  3ZVJ D;  17GS A;  4DSS A;  1TTZ A;  5DBQ A;  1BG5 A;  2WDU A;  2QA1 A;  4HDE A;  1VF2 A;  1GTI A;  1NSW A;  4XTS A;  1V9W A;  5ECP B;  4WF4 A;  2M46 A;  3D5J A;  3KM6 A;  5ECO B;  1AQX A;  1ZYE A;  4ZBA A;  1YEP A;  4PX1 A;  3CYN A;  1A24 A;  4IJ3 A;  4N11 A;  2EIQ A;  3A3T A;  1TU8 A;  1LJR A;  2GQL A;  4A5P A;  5HFI A;  4POK A;  1OYJ A;  5ECI B;  2MYG A;  3EYT A;  1MTC A;  1U3I A;  3QR6 A;  4EL1 A;  3VWX A;  2YP6 A;  4ID0 A;  1A8L A;  4GSS A;  4GWR A;  1RK4 A;  2F3M A;  3HD5 A;  3ED3 A;  4K7I A;  1BAY A;  1PMT A;  3TRX A;  3GH6 A;  4X4J A;  1CQH A;  4GCI A;  3TJG A;  1R26 A;  1AAZ A;  4ZXG A;  2LRT A;  4NAX A;  4GQF A;  4MP4 A;  2VCV A;  4DSS B;  3TOU A;  2LNT A;  1X9M B;  1G6Y A;  1FB6 A;  6GSV A;  2HXK A;  3F3Q A;  3HVS A;  1K0N A;  1K0O A;  4OO5 A;  3H8Q A;  3L78 A;  1TDI A;  2X8C A;  3F4R A;  2DIZ A;  2O85 A;  4HI7 A;  4ILF A;  2I3Y A;  2H6Z A;  3CXG A;  1O8X A;  2YWO A;  2BJX A;  1JZO A;  1BQ7 A;  1F9M A;  1TRS A;  1FAA A;  2VCX A;  2DC5 A;  3G7J A;  5JWR B;  1PD2 1;  1M2B A;  3E9J B;  1GSY A;  5IMZ A;  4KB3 A;  3ZYW A;  1VF4 A;  2XC2 A;  4ZIJ A;  2LRN A;  5AIV A;  3LOR A;  2P5R A;  3VPQ A;  1XW5 A;  3FR6 A;  3HZ8 A;  4K0G A;  4WBR D;  2HE3 A;  1J08 A;  1WWJ A;  4ZL9 A;  3IHG A;  4DSR A;  3UBK A;  2H72 A;  5CO3 A;  1SL1 B;  2JAD A;  2FY6 A;  5AN1 A;  2HLS A;  1GSF A;  1GLQ A;  2LV3 A;  5ECQ B;  5CRD A;  1R7H A;  3UAP A;  5IQY A;  1SJZ A;  5CNW A;  1ABA A;  4IN0 A;  4V2N A;  2HZE A;  3GX0 A;  1AUC A;  4POL A;  3KCM A;  1GTA A;  4HQS A;  3FR9 A;  12GS A;  4IGJ A;  2Z9S A;  4ZL8 A;  4Q5R A;  3QOU A;  2A4H A;  1XWK A;  2PN8 A;  3GH9 A;  4EO3 A;  4POB A;  1DBY A;  4ZBD A;  3GA4 A;  4WXT A;  4EF0 A;  1PSQ A;  3DYR A;  1HYU A;  3BCK A;  3ZRD A;  1EV4 A;  1OVN A;  5ID2 A;  3ERF A;  1YF1 A;  3S9F A;  1LBK A;  1GSE A;  1OKD A;  4K7N A;  3LGC A;  1DUG A;  5DAK A;  2C80 A;  2H76 A;  2CT6 A;  4Z2T A;  6GSX A;  2FWF A;  2YV9 A;  1Y25 A;  3UIW A;  4LA1 A;  1F2E A;  4PNF A;  2BTO T;  1NW2 A;  4YAP A;  2OJL A;  3CRT A;  4ULX A;  3AY8 A;  3KMN A;  3D4M A;  1XWA A;  3F63 A;  3ISO A;  3QAV A;  5KOX A;  2R0G A;  1HNC A;  2VCZ A;  3HHV A;  2HZE B;  5IM9 A;  2B1K A;  4ECC A;  4YQM A;  1T4Y A;  3US3 A;  1XWG A;  2GGT A;  4MA9 A;  3HZ4 A;  3D4T A;  3D21 A;  3J7Y b;  1EV9 A;  2DKI A;  5BMU A;  5DQS A;  1ERT A;  5KOW A;  1EP7 A;  4PUF C;  1MDJ A;  3GKN A;  4RI6 A;  4FIW A;  3BBY A;  4K6X A;  2K6V A;  1OAZ A;  5KN2 A;  1GLP A;  4IS0 A;  1AXD A;  2OAD A;  4MJE A;  3QD9 A;  5ID2 B;  4TR1 A;  4KW6 A;  5DAL A;  2IMI A;  4O5R A;  2GZY A;  2JSY A;  3EPT A;  3APO A;  5DAK B;  2QGV A;  1N2A A;  2CQ9 A;  4GTU A;  2PU9 C;  4LLR A;  1QK8 A;  5F06 A;  1GWC A;  3KXO A;  4XRA A;  1WOU A;  3M3M A;  1R5P A;  1SJ6 A;  3KH7 A;  4O5Q A;  2XPD A;  4OFN A;  2B5X A;  4IQA A;  1MD3 A;  3TOT A;  10GS A;  4WBJ A;  1WP0 A;  5ELG A;  1TW9 A;  5IOX A;  3GL5 A;  4X1U A;  2HNL A;  2LJR A;  5CRW A;  1V58 A;  2JZT A;  3TCO A;  2PWJ A;  3MDK A;  2CZ3 A;  3KD0 A;  5J41 A;  3LW9 A;  1EOH A;  3ZTL A;  4P3Y B;  4BVX A;  4JU5 A;  3LSZ A;  4JED A;  1YQ1 A;  3HKR A;  3W8S A;  4AJ6 A;  5FHI A;  3HJM A;  5HR1 A;  1PN9 A;  1BED A;  5AIX A;  2V32 A;  2DJ2 A;  4MLY A;  1EWX A;  5JCG A;  4Q5F A;  3GTU B;  2H73 A;  3VPT A;  4RUV A;  5CYY A;  3DKS A;  1FVJ A;  2HSY A;  5DJL A;  3TKQ A;  4LMV A;  4FQU A;  1V40 A;  2IJY A;  4KE3 A;  2VLU A;  4F03 A;  2QC7 A;  3ZLP A;  2JZS A;  1MEK A;  2YAN A;  9GSS A;  3TKP A;  2B6M A;  3KTL A;  1WMJ A;  4DEJ A;  2V1M A;  2I4A A;  2F8F A;  2HT9 A;  3HVV A;  2CX3 A;  2QSI A;  1Z6N A;  4MF5 A;  3WGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...