3E9JB

Structure of the charge-transfer intermediate of the transmembrane redox catalyst dsbb
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
188
structure length
188
Chain Sequence
b'AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHAYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol/disulfide oxidoreductase DsbA
publication title Preparation and structure of the charge-transfer intermediate of the transmembrane redox catalyst DsbB.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Oxidoreductase
total genus 54
structure length 188
sequence length 188
chains with identical sequence E
ec nomenclature ec 1.8.4.-:
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01323 DSBA DSBA-like thioredoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3e9jB00
3IXRA 3VI7A 2H1BA 3FEUA 3H4KA 1A2LA 1T1VA 2F8FA 5ECHB 5DALB 3ZVJD 3GFKA 3F8UA 4YQUA 2LRTA 1HD2A 3RPPA 4FYBA 5ECKB 1ZCPA 4K9ZA 2AAWA 1YF1A 2EIOA 2TIRA 4F9ZA 4ILFA 2DMMA 3G7YA 3H93A 2LRNA 2AJQB 2DC5A 2FGXA 1SKWB 4JR4A 1PD21 2CT6A 2L6DA 4YQMA 2TRCP 2OBKA 5FHIA 5CRHA 4HZ2A 2JZRA 4E8EA 2PUKC 1OC9B 1USBA 5AGYA 4PURA 6GSSA 3BCKA 1JZRA 2V2GA 3Q74A 4JRRA 3A2VA 3LFLA 3GTUB 4MPGA 3F6DA 3KM6A 3KMOA 3L9UA 3BJ5A 3VWUA 2DIYA 1J08A 1R5PA 2MMZA 2X8CA 1BG5A 1JZDA 3LG6A 5IM9A 5AIVA 2M72A 3ERFA 3ZYWA 2WZ9A 2GZYA 3DIEA 1FOVA 3L4NA 2X64A 1U6TA 4FH8A 4ZB8A 1SD9A 3GKXA 1B9YC 2IMIA 2FLSA 5KN0A 1FB6A 1UA5A 5GAPD 1JLVA 2WJUA 3LYPA 3F4SA 3IK9A 3GIXA 4CW9A 4J57E 4TR1B 3FZ4A 1YKAA 5IMDA 2H6YA 2IL3A 4MCUA 1TXXA 3GYKA 2CVDA 4NMUA 4K2DA 3CRTA 4XHMA 1MDJA 2HZEA 3US3A 5GSTA 1A2MA 2TRXA 1WIKA 3LSZA 4MZBA 2OACA 2B6MA 4ML6A 2CVKA 3WT1A 2MMOA 2GQKA 3HYPA 1DE2A 3C7MA 4POKA 4ZIJA 4D73A 3LJRA 2PWJA 3ZZXA 1GSSA 5D73A 5G5EA 4RQRA 4MMMA 5F06A 1T4YA 2OJLA 1ST9A 4N11A 3UARA 1W89A 4HDEA 4KX4A 2H6ZA 19GSA 4O5RA 5HFIA 18GSA 1O6JA 2C8UA 4IQ1A 4EXJA 2I1UA 4MPFA 1AQWA 3TKSC 1KTEA 3GNJA 1SL1B 4WF4A 5ECLB 4NPBA 3C8EA 4LA1A 3UIWA 4K6XA 5D8IA 3HJOA 3TJBA 3ME7A 4LL1B 1XW6A 4HJ2A 5B8AA 2C3NA 1PX6A 1X9MB 4Z7XA 3IBHA 4CDOA 2X99A 1B9XC 4V2LA 3GX0A 3VWXA 4KCEA 3TCOA 2C4JA 3BCIA 3HZ4A 2R3XA 2I3YA 2Z9SA 2ON7A 1LU4A 1SK2A 1XZOA 1PMTA 1BX9A 4OFNA 3FYGA 3I69A 4WETA 4PQHA 4X1UA 3M3MA 3J7Yb 5ELAA 5F05A 1H4OA 4TXVA 1UC7A 1MTCA 2C0DA 4RUVA 1XIYA 4KDYA 2VL2A 3NIVA 2VUPA 3LXTA 5J41A 5IO2A 1K3OA 1GULA 3VPTA 3EINA 3MSZA 2C0GA 4TOPA 3EE2A 5H5RA 1S3DA 3C73A 1ZYQB 1T8EB 4HU7A 1WMJA 4NWYA 2OE1A 2YOIA 1JFUA 3I43A 4MLYA 1N2AA 3CSIA 2NTOA 5A4VA 4RQXA 2DMLA 2G0FA 1X9WB 1E6BA 4WF5A 3ZLPA 4AJ6A 3IAS2 1N8JA 2H0IA 4LMVA 4ZBDA 1OC8A 1V58A 2GZZA 3QOUA 4EDYA 1GSQA 4QQ7A 3ZTLA 2I9HA 2JU5A 1BJXA 2WS2A 4K8MA 3LXZA 1A24A 4ACSA 4POBA 5DALA 2F8AA 5EPFA 5CRWA 3QPMA 4IP6A 2EC4A 3DVXA 3ISOA 2L5LA 3P2AA 2C3TA 2JSYA 4K1FA 4OWYA 1R26A 4XTSA 2GGTA 5B6MA 2DJJA 2VL9A 3IE3A 4EDZA 5IPHA 1I5GA 1T00A 2KHPA 4F82A 2WRTA 3L0HA 3ERWA 4MF7A 4E8HA 1V57A 2FD3A 4V1Ag 3ED3A 3TOTA 1YDKA 5IMCA 2VM1A 1TKDB 4KAEA 5D93A 2KUCA 2OADA 4Q5FA 2YWIA 2GT6A 4XS4B 2AYTA 3KH7A 9GSSA 5INYA 4IQAA 3RDWA 1TRWA 1S3AA 2CA8A 6GSTA 1E2YA 2YZHA 3DD3A 2YANA 3APQA 5ECMB 2I4AA 1EEJA 4MJEA 4AJ8A 1YQ1A 3R2QA 3VLNA 1SYXA 2YP6A 4NV5A 4DSQA 5ECPB 4CHSA 3ZVJA 2C1YA 3I6AA 1OYJA 2J9HA 1I9DA 1XPVA 1MDKA 2K8SA 2DBCA 3F6FA 1JZWA 4BWQA 3KXOA 4KSMA 3U6VA 1AUCA 5HFKA 3QMXA 4MA9A 4XCSA 3HDCA 3WGEA 4GSNA 4YAPA 4BWSA 1THOA 3GH6A 4GQCA 1EOHA 4BA7A 4ID0A 3W6GA 3TUEA 2V6KA 3Q18A 2YNXA 3NZNA 5G5FA 5L71A 3HVVA 2CX3A 4NXIA 5JWRB 3UVHA 4KW6A 2MBSA 2LS5A 3ZL5A 4KDXA 3PR8A 4L5LA 1G6WA 3KD0A 3FZ9A 3HA9A 3N5OA 1V40A 5A4UA 2B5EA 3P90A 1M7TA 1B4PA 5HFGA 2LUSA 2GSTA 1FVJA 3HVXA 2OA7A 1YJ6A 4HEA2 5CRGA 1FVKA 3LWAA 3KIJA 4IKHA 2VCVA 4XIHA 3D22A 2DJKA 3EVIA 1ERUA 4I6XA 2AUVA 5DJMA 4K7NA 1T4ZA 2V41A 1J9BA 1F3AA 5ECOB 5DQYA 1GL8A 4GTUA 4WKWA 3LORA 1SD8A 3WGXA 3CTFA 1GNEA 2B7KA 1ZZYA 1NHOA 4P3YB 4L0WA 2RM6A 4MF5A 1G6YA 1ILOA 3F4RA 2N5AA 5LNKe 1TOFA 1T7PB 3IPZA 3EU3A 3FK8A 3VWVA 1WPIA 1TW9A 1TRUA 3C71A 1QGVA 5IMVA 5F07A 3DVWA 3EMPA 4NAXA 2YWOA 3UVTA 1Z7PA 3CTGA 1RW1A 13GSA 2XC2A 1F2EA 1R7HA 3BD2A 4WXTA 4XS1A 1QMVA 1TU7A 5LD0A 3VWWA 3RAZA 1MDIA 3SWLA 1BAYA 1VRSD 1Y6EA 1OE8A 2O8VB 3ZMLA 3M0FA 5IOWA 5J9CA 1AW9A 3O76A 2VL3A 4FYUA 1TI1A 1VF3A 3LEFA 3EURA 4GSSA 14GSA 3QR6A 4RI7A 4AJ7A 2BTOT 1YF0A 4PXOA 2HSHA 3IR4A 1GLQA 2HE3A 3A2WA 2PVQA 3IDVA 4Q5QA 2L59A 2P31A 1EP7A 2YV9A 1KNGA 2P0GA 4YAVA 2QC7A 2MMNA 4TR0A 2NBSA 1FHEA 2B5YA 2FCHA 3HJPA 1ZMAA 2EIQA 3TJKA 1M2BA 3H1NA 2H1DA 1TRSA 1X5DA 4L8EA 2ZUPA 5D9WA 4EKZA 1ZOFA 4GWRA 4NHWA 3VURA 4NV2A 2H73A 3KTLA 1SK1A 4DSSA 4EF0A 3KGKA 4EO3A 4POMA 1O81A 2JZTA 5J5NA 2IWTA 1Z6MA 4OD7A 4MJCA 4K0GA 5GAND 5FWGA 1SJZA 5CAXA 5HR3A 1A2JA 2O85A 2M46A 2YN1A 2H6XA 3GN3A 2DLXA 1YZXA 3O3TA 1GP1A 2FWFA 2LKUA 2LRCA 5ENUA 3MAKA 2MYGA 1QK8A 3MDKA 1ERTA 2B1LA 5ABRA 2GSRA 3A5WA 2E2GA 4PQIA 1SENA 4XRDA 2B1KA 3GURA 2K6VA 2E2MA 2GQMA 2FUG2 4I2UA 2REMA 5IPGA 2LJRA 3P8WA 3QFBC 2OE0A 3RHBA 4NHZA 1Z7RA 1GH2A 4IS0A 1C72A 4JZQA 4BL7A 1ERVA 2DJ2A 2BMXA 3M8NA 3S9FA 1VF4A 4ML1A 2FA4A 2OBIA 3GHAA 5HR2A 4I2TA 2PN8A 4KB3A 1EEMA 4DEJA 3D21A 2VD0A 3WT2A 2GLRA 3L78A 4IELA 5IMAA 4ZL7A 2FNOA 4EUYA 2RUFA 3TJGA 2FWGA 2LV3A 3APSA 4JR6A 3GRXA 3TRQA 2IMDA 2IFQB 1T3BA 4L5OA 3D4MA 2FA8A 3QAWA 1F6MC 4OCEA 4IJIA 1IYIA 3CXGA 3QAGA 1V98A 3QCPA 4HI7A 4HU9A 2PMTA 5D9XA 1G0TA 4KGIA 4MABA 4OFTA 4QL9A 2GSQA 2ALBA 2OKAA 3FR6A 2FY6A 5JCGA 5DCHA 1SL2B 1X5EA 3CSJA 1XW5A 5ID2B 5IIZA 4YQVA 2VOCA 2YWMA 1GTAA 2HRNA 5J3RA 4ZILA 1FG4A 4KNDA 5GSSA 1EV9A 1EV4A 3FHKA 3IC4A 3LGCA 5IMZA 3P7XA 1NHYA 4JBBA 3TKPA 20GSA 3G9BA 2JSZA 3FR9A 4GRFA 3WGDA 3GUSA 22GSA 3F3QA 2RLIA 1W4VA 4HJMA 2IJYA 3MNGA 5KN3A 1GSDA 2R2JA 5KN2A 4IN0A 3FY7A 4PUAA 3ERGA 2HI7A 5H5SA 1AC1A 2R37A 4ZBBA 2ON5A 4MP4A 5LCZA 3FZ5A 3WD6A 1HYUA 3GX8A 4N10A 2IPAA 1Q4JA 3F0IA 3HHVA 3JCML 4MH3A 2VLTA 4WEYA 1WE0A 3KMNA 2GTUA 3DMLA 3QD9A 3DYRA 3D5JA 1SJIA 5E59A 1SKSB 1OC9A 1HNCA 2WGRA 1G7OA 3FR3A 5CREA 3UOMA 4N0ZA 1TK0B 2VCQA 3GSTA 4ECJA 4KE3A 3CYNA 3AY8A 3GKMA 3GTUA 5ECIB 1OC3A 1A0RP 1RQMA 1WOUA 4PUFC 3UL3A 1GRXA 3ZIVA 3CRUA 4ZB6A 2E0QA 5B7CA 1Z9HA 1XWGA 2X8HA 4V2MA 2CAIA 1DE1A 2G2QA 4TRXA 4ISDA 3GKNA 2VD1A 2HZEB 3APOA 1OKTA 1EP8A 4GXZA 5G2ZA 3CSHA 2AHEA 2XPDA 3F9UA 4IGJA 2NPBA 3ZFBA 1H75A 3KP9A 4PNGA 2LNSA 3HXSA 2A2SA 4GF0A 3I9V2 3ZITA 3UAPA 4AGSA 2HSYA 4TR1A 1WJKA 3HKRA 5B8BA 4ZBAA 1A23A 4D73B 2LEGA 2HYXA 3N9JA 4AF2A 5HQPA 3GKKA 4F03A 5JWQB 2PGTA 7GSSA 4LL4B 4EC0A 1ON4A 4MZCA 4QL7A 1K0OA 2YZUA 4Q5RA 2V6OA 1XWKA 3GMFA 2V32A 1GLPA 3UBLA 2JZSA 1XXUA 2FWEA 1MD4A 1U88A 1GNWA 4MDCA 4XRAA 2O7KA 2IMEA 1XFLA 3GA4A 1ZGNA 3UMAA 4TKYA 1GTIA 5D9VA 4EL1A 4O7HA 3ZRDA 1WP0A 2C3QA 1K0BA 2FHEA 3IOSA 2JL4A 4TR3A 1UN2A 4JEDA 3GL5A 4X43A 2AV4A 2YJHA 1K0AA 5CYYA 2LJAA 1GUHA 5KN1A 6GSVA 3D6IA 1LBKA 3K8NA 1OKDA 2C0FA 4PNFA 17GSA 4I97A 1AQVA 3C1SA 3VI5A 4N0VA 4KH7A 1ACVA 5EL8A 3KP8A 2OE3A 6GSYA 2LQOA 2H8LA 3UBKA 5DAKB 3M9JA 4HZ4A 3EC3A 5GZZB 5CRDA 3ZFLA 1K0CA 1M9AA 3QAVA 1B48A 1TU8A 5F0GA 2L4QA 4JU5A 1O73A 2L5OA 1Q98A 2R5GA 4IBPA 2N5BA 3HCZA 3BOAA 2H74A 4MZWA 1F37A 5DVBA 4DVCA 1X0RA 2H0GA 5JCWA 5G30A 4FIWA 1Z5YE 8GSSA 5DCGA 1CQHA 1XW9A 1M2DA 2HNLA 4X0XA 1WWJA 3KJYA 5E4WA 4TXOB 2CX4A 5ID2A 2N5FA 3OR5A 1HNBA 4PX1A 4L0UA 5G1KA 1JZOA 1UVZA 1AAZA 5IO0A 2O87A 1G7EA 2DJ3A 1MD3A 2A4VA 4GSTA 2GT5A 2YPMA 3VPQA 2HLSA 2VLVA 1ZYEA 5EY6A 3M1GA 4G9HA 5C00A 1HNAA 4DSRA 2XHFA 1PL2A 2WCIA 3TDGA 2YWNA 3TKSE 5KEJA 4GCIA 2KLXA 1F3BA 3QDNA 3A2XA 3LYKA 4BVXA 1B4QA 4ZXGA 1TK5B 1URMA 2FWHA 4K7OA 1XOBA 1A0FA 1KBNA 2R6KA 2LNTA 3IK7A 1TJDA 2O89A 2CV4A 3TGZA 2CZ3A 1CQGA 1YEXA 4F0CA 2H70A 3ZREA 2B7JA 1K3YA 4ZB9A 1WRYA 1LJRA 1GTUA 1XBSA 4IVFA 3SBCA 2VCXA 1TDIA 2PERA 5ECRB 1NSWA 3L9VA 4WBRD 3TRPA 3TJFA 4EE0A 2H1AA 4XS4A 3PGTA 2CVBA 4OMVA 1GUKA 2IIYA 3W8SA 1NM3A 1QFNA 2YCDA 3D4TA 1M99A 5DQSA 1YKCA 4LMWA 3KTBA 2B3SA 1OE7A 2X8GA 4O32A 1KEBA 1SJ6A 4K7IA 1VF1A 1BQ7A 2CAQA 5ECSA 1EGOA 2H1GA 1GWCA 1QXHA 1X9SB 4PGTA 4N30A 2F9SA 1A8YA 1X5CA 5J4UA 3KCMA 2KOKA 2K18A 2RUEA 4G19A 3GL3A 5A5KA 3DGQA 2DJ1A 4TR4A 1TP9A 2GZPA 4FO5A 5C04A 1XWAA 3H8QA 2CZ2A 4IJ3A 6GSUA 2KP2A 1EOGA 2PPTA 2QSIA 3CMIA 2F3MA 3FKFA 1O85A 3GSSA 1PX7A 3HZ8A 2WDUA 4MJAA 3O6TA 2VAFA 3KEBA 1NW2A 2VCZA 2EIRA 1R5AA 5B6NA 3UJ1A 1PL1A 1A8LA 1VGLA 1JHBA 2LSTA 5IQYA 4ECCA 3IV4A 1AQXA 1QQ2A 3ME8A 5D96A 1FAAA 5G31A 1AXDA 1BEDA 3HVSA 2HXKA 1U3IA 4BVYA 4KDUA 2DIZA 1SK0A 5J9BA 2VIMA 4TN8A 1K3LA 4ECIA 1Y25A 4ZL9A 5HR1A 1GSYA 3F4TA 4HQZA 4IW9A 2MBTA 1B8XA 5IMFA 3E0UA 5FT3A 1BYEA 1THXA 2JACA 3V1WA 4KA0A 3L9SA 3A3TA 1U3AA 3PINA 4GQFA 2A2RA 2XPEA 1PSQA 3H79A 1F9MA 3VK9A 5D9TA 2P5QA 4OFMA 2VCTA 2R4VA 1V9WA 3TJJA 3BBYA 3FW2A 5H5QA 3IAM2 4FYCA 3IRAA 3VFIA 3HJMA 2IN3A 5DAKA 2JADA 3RBTA 2NVLA 2L57A 3CBUA 3TRXA 1YY7A 3ZMKA 4OCFA 2IMKA 2V1MA 1DSBA 2MZCA 12GSA 2XBQA 2C0EA 1SYRA 1GTBA 2H72A 3EYTA 5JCUA 2ZCTA 4ULXA 1Z3EA 2RIIA 4JE1A 4H86A 1AIUA 5AISA 1TI3A 4MH2A 1ML6A 2YV7A 2VO4A 2NDOA 1PKWA 2H30A 2P5RA 5A4WA 5F8BA 2ZNMA 2B5XA 3Q6OA 1SU9A 2WB9A 2HZFA 1QUWA 1DBYA 4TXOA 3M9KA 3ZIJA 1O7UA 4MK3A 3EMXA 2H76A 4Q5NA 1XVWA 3FZAA 4OO5A 4WR5A 4MJBA 2XBIA 2D2ZA 1TRVA 2K9FA 2PBJA 2AB6A 6GSWA 3G7IA 3Q19A 5DJLA 4V1Ap 1O8XA 4LLRA 2C80A 1SL0B 2GVPA 1XVQA 2KP1A 4O92A 2H0HA 3HD5A 1EWXA 6GSXA 2M80A 1XWBA 2J23A 1GUMA 4DSSB 1PKZA 3NOFA 1GSEA 3GH9A 3DWVA 4YH2A 4OO4A 4GLTA 4PQ1A 2YJ7A 4WBJA 2I81A 4TW5A 2ES7A 4TVEA 4XS6A 1V2AA 3F63A 3HY2A 16GSA 1TTZA 3J7Yk 1PGTA 4I8BA 2H66A 3E9JB 1PN9A 2DJ0A 2E7PA 1OVNA 1JLWA 4HOJA 2VCWA 3LQ7A 3TKQA 5HR0A 2BJXA 5AN1A 1YEPA 3C1RA 1XOAA 1XWCA 4G2EA 3EWLA 2QKEA 10GSA 2VLUA 4IHUA 5ELGA 2GS3A 4KUNA 3G7JA 1TK8B 1XCCA 4K0NA 1FB0A 3E3EA 3TOUA 2LTKA 2K8VA 3W8JA 1ABAA 1PA3A 4IP1A 4EVMA 3WYWA 3KH9A 3IHQA 2H75A 1FO5A 4HQSA 1O8WA 2WFCA 5COHA 2H71A 1K0NA 1M9BA 4BPYA 1EGRA 3DRNA 2PVOC 3FRCA 2VL2C 1RK4A 2GQLA 2IMFA 3RPNA 5JWOB 1K0DA 1SKRB 4V2NA 5DBQA 2L4CA 4J56E 1ZL9A 2CQ9A 3TB2A 1S3CA 2GDRA 3UEMA 2LJKA 4KCAA 2H01A 3DKSA 2HRFA 1IYHA 1OAZA 1MEKA 3TKRA 1M2AA 1GSFA 4POLA 1DUGA 11GSA 2DSAA 1M0UA 3EU4A 5DDLA 2HT9A 4MF6A 4I5QA 1U87A 1J0FA 2F51A 2L6CA 5CO3A 3DXBA 1EZKA 1ERWA 5AIXA 4KSOA 1PRXA 4F2IA 1FW1A 1PQNA 1Z6NA 5G1LA 2MMAA 5ECNB 1HQOA 2LQQA 3D0ZA 4J2FA 4HUAA 1VF2A 4HS1A 2H19A 2GSSA 1R4WA 1K0MA 2PU9C 3KZQA 5CNWA 3DEXA 3GV1A 2VM2A 3F3RA 4RI6A 2IFQA 3IA1A 2HFDA 3U5RE 4G10A 5EVOA 1GSUA 4WR4A 2QGVA 5CP1A 4F0BA 2RM5A 3PH9A 5IOXA 4ECBA 4ZL8A 2WULA 3RHCA 3QFAC 5ECQB 3TKSA 3MWHA
chains in the Genus database with same CATH superfamily
3IXRA 3VI7A 2H1BA 3FEUA 2A4HA 3H4KA 1A2LA 1T1VA 2F8FA 5ECHB 5DALB 2X49A 3ZVJD 3GFKA 3F8UA 4YQUA 2LRTA 1HD2A 3RPPA 4FYBA 5ECKB 1ZCPA 4K9ZA 2AAWA 1YF1A 2EIOA 2TIRA 3IC8A 4F9ZA 4ILFA 2DMMA 3G7YA 3H93A 2LRNA 4X4JA 3EPTA 2AJQB 2DC5A 2FGXA 1SKWB 4JR4A 1PD21 2CT6A 2L6DA 4YQMA 2TRCP 2OBKA 5FHIA 5CRHA 4HZ2A 2JZRA 4E8EA 2PUKC 1OC9B 1USBA 5AGYA 4PURA 6GSSA 3BCKA 1JZRA 2V2GA 3Q74A 4JRRA 3A2VA 3LFLA 3GTUB 4MPGA 3F6DA 3KM6A 3KMOA 3L9UA 3BJ5A 3VWUA 2DIYA 1J08A 1R5PA 2MMZA 2X8CA 1BG5A 1JZDA 5KOXA 3LG6A 5IM9A 5AIVA 2M72A 3ERFA 3ZYWA 4EIQA 2WZ9A 2GZYA 3DIEA 1FOVA 3L4NA 4YKFA 2X64A 1U6TA 4FH8A 4ZB8A 1SD9A 3GKXA 1B9YC 2IMIA 2FLSA 5KN0A 1FB6A 1UA5A 5GAPD 1JLVA 2WJUA 3LYPA 3F4SA 3IK9A 3GIXA 4CW9A 4J57E 4TR1B 3FZ4A 1YKAA 5IMDA 2H6YA 2IL3A 4MCUA 1TXXA 3HVNA 3GYKA 2CVDA 4NMUA 4K2DA 3CRTA 4XHMA 1MDJA 2HZEA 3US3A 5GSTA 1A2MA 2TRXA 1WIKA 3LSZA 4MZBA 2OACA 2B6MA 4ML6A 2CVKA 3WT1A 2MMOA 2GQKA 3HYPA 1DE2A 3C7MA 4POKA 4ZIJA 4D73A 3LJRA 2PWJA 3ZZXA 1GSSA 5D73A 5G5EA 4RQRA 4MMMA 2DKHA 5F06A 1T4YA 2OJLA 1ST9A 4N11A 3UARA 1W89A 4HDEA 4KX4A 2H6ZA 19GSA 4O5RA 5HFIA 18GSA 1O6JA 2C8UA 4IQ1A 4EXJA 2I1UA 4MPFA 1AQWA 3TKSC 1KTEA 3GNJA 1SL1B 4WF4A 5ECLB 4NPBA 3C8EA 4LA1A 3UIWA 4K6XA 5D8IA 3HJOA 3TJBA 3ME7A 4LL1B 1XW6A 4HJ2A 5B8AA 2C3NA 1PX6A 4BIKA 1X9MB 1M3IA 4Z7XA 3IHGA 3IBHA 4CDOA 2X99A 1B9XC 4V2LA 3GX0A 3VWXA 4KCEA 3TCOA 2C4JA 3BCIA 3HZ4A 2R3XA 2I3YA 2Z9SA 2ON7A 1LU4A 1SK2A 1XZOA 1PMTA 2X4AA 1BX9A 4OFNA 3FYGA 3I69A 4WETA 4PQHA 4X1UA 3M3MA 3J7Yb 5ELAA 5F05A 1H4OA 4TXVA 1UC7A 1MTCA 2C0DA 4RUVA 1XIYA 4KDYA 2VL2A 3NIVA 2VUPA 3LXTA 5J41A 5IO2A 1K3OA 1GULA 3VPTA 3EINA 3MSZA 2C0GA 4TOPA 3EE2A 5H5RA 1S3DA 3C73A 1PFOA 1ZYQB 1T8EB 4HU7A 1WMJA 4NWYA 2OE1A 2YOIA 1JFUA 3I43A 4MLYA 1N2AA 3CSIA 2NTOA 5A4VA 4RQXA 2DMLA 2G0FA 1X9WB 1E6BA 4WF5A 3ZLPA 4AJ6A 4FQUA 3IAS2 1N8JA 2H0IA 4LMVA 4ZBDA 1OC8A 1V58A 2GZZA 3QOUA 4EDYA 1GSQA 4QQ7A 3ZTLA 2I9HA 2JU5A 1BJXA 2WS2A 4K8MA 3LXZA 1A24A 4ACSA 4POBA 5DALA 2F8AA 5EPFA 5CRWA 3QPMA 1M3JA 4IP6A 2EC4A 3DVXA 3ISOA 2L5LA 3P2AA 3FMWA 2C3TA 2JSYA 4K1FA 4OWYA 1R26A 4XTSA 2GGTA 5B6MA 2DJJA 2VL9A 3IE3A 4EDZA 5IPHA 1I5GA 1T00A 2KHPA 4F82A 2WRTA 3L0HA 3ERWA 4O5UA 4MF7A 4E8HA 1V57A 2FD3A 4G0IA 4V1Ag 3ED3A 3TOTA 1YDKA 5IMCA 2VM1A 1TKDB 4KAEA 5D93A 2KUCA 2OADA 4Q5FA 2YWIA 2GT6A 4XS4B 2AYTA 3KH7A 9GSSA 5INYA 4IQAA 3RDWA 1TRWA 1S3AA 2CA8A 6GSTA 1E2YA 2YZHA 3DD3A 2YANA 3APQA 5ECMB 2I4AA 1EEJA 4MJEA 4AJ8A 1YQ1A 3R2QA 3VLNA 1SYXA 2YP6A 4NV5A 4K5SA 4DSQA 5ECPB 4CHSA 3ZVJA 2C1YA 3I6AA 1OYJA 2J9HA 1I9DA 1XPVA 1MDKA 2K8SA 2DBCA 3F6FA 1JZWA 4BWQA 3KXOA 4KSMA 3U6VA 1AUCA 5HFKA 3QMXA 4MA9A 4XCSA 3HDCA 3WGEA 4GSNA 4YAPA 4BWSA 1THOA 3GH6A 4GQCA 1EOHA 4BA7A 4ID0A 4BL7B 3W6GA 3TUEA 2V6KA 3Q18A 2YNXA 3NZNA 5G5FA 5L71A 3HVVA 2CX3A 4NXIA 5JWRB 3UVHA 4KW6A 2MBSA 2LS5A 3ZL5A 2R0PA 3PR8A 4KDXA 4L5LA 1G6WA 3KD0A 3FZ9A 3HA9A 3N5OA 1V40A 5A4UA 2B5EA 4YKGA 3R3EA 3P90A 1M7TA 2QA1A 1B4PA 5HFGA 2LUSA 2GSTA 1FVJA 3HVXA 2OA7A 5BRTA 1YJ6A 4HEA2 5CRGA 1FVKA 3LWAA 3KIJA 4IKHA 2VCVA 2HRKA 4XIHA 3D22A 2DJKA 2UZ8A 4BVYB 3EVIA 1ERUA 4I6XA 2AUVA 5DJMA 3MIXA 4K7NA 1T4ZA 2V41A 1J9BA 1F3AA 5ECOB 5DQYA 1GL8A 4GTUA 4WKWA 3LORA 1SD8A 3WGXA 4MNNA 3CTFA 1GNEA 2B7KA 1ZZYA 1NHOA 4P3YB 4L0WA 2RM6A 4MF5A 1G6YA 1ILOA 3F4RA 2N5AA 5LNKe 1TOFA 1T7PB 3IPZA 3EU3A 3FK8A 3VWVA 1WPIA 1TW9A 1TRUA 3C71A 1QGVA 5IMVA 5F07A 3DVWA 3EMPA 4NAXA 2YWOA 3UVTA 1Z7PA 3CTGA 1RW1A 13GSA 2XC2A 1F2EA 1R7HA 3BD2A 4WXTA 4XS1A 1QMVA 1TU7A 5LD0A 3VWWA 3RAZA 1MDIA 3SWLA 1BAYA 1VRSD 1Y6EA 1OE8A 2O8VB 3ZMLA 3M0FA 5IOWA 5J9CA 1AW9A 3O76A 2VL3A 4FYUA 1TI1A 1VF3A 3LEFA 3EURA 4GSSA 14GSA 3QR6A 2R0CA 4RI7A 4AJ7A 2BTOT 1YF0A 4PXOA 2HSHA 3IR4A 1GLQA 2HE3A 3A2WA 2PVQA 3IDVA 4Q5QA 2L59A 2P31A 1EP7A 2YV9A 1KNGA 2P0GA 4YAVA 2QC7A 2MMNA 4TR0A 2NBSA 1FHEA 2B5YA 2FCHA 3HJPA 1ZMAA 2EIQA 3TJKA 1M2BA 3H1NA 2H1DA 1TRSA 1X5DA 1PN0A 4L8EA 2ZUPA 5D9WA 4EKZA 1ZOFA 4GWRA 4NHWA 3VURA 4NV2A 2H73A 3KTLA 1SK1A 4DSSA 4CY8A 4EF0A 3KGKA 4EO3A 4POMA 1O81A 2JZTA 5J5NA 2IWTA 1Z6MA 4OD7A 4MJCA 3PPUA 4K0GA 5GAND 5FWGA 1SJZA 5CAXA 5HR3A 1A2JA 2O85A 2M46A 2YN1A 2H6XA 3GN3A 2DLXA 1YZXA 3O3TA 1GP1A 2FWFA 2LKUA 2LRCA 5ENUA 3MAKA 2MYGA 1QK8A 3MDKA 1ERTA 2B1LA 5ABRA 2GSRA 3A5WA 2E2GA 4PQIA 1SENA 4XRDA 2B1KA 3GURA 2K6VA 2E2MA 2GQMA 2FUG2 4I2UA 2REMA 5IPGA 2LJRA 3P8WA 3QFBC 2OE0A 3RHBA 4NHZA 1Z7RA 1GH2A 4IS0A 1C72A 4JZQA 4BL7A 1ERVA 2DJ2A 2BMXA 3M8NA 3S9FA 1VF4A 4ML1A 2FA4A 2DKIA 2OBIA 3GHAA 5HR2A 4I2TA 2PN8A 4KB3A 5KOWA 1EEMA 4DEJA 3D21A 2VD0A 3WT2A 2GLRA 4K2XA 2A2PA 3L78A 4IELA 2R0GA 5IMAA 4ZL7A 2FNOA 4EUYA 2RUFA 1ZYNA 3TJGA 2FWGA 2LV3A 3APSA 4JR6A 3GRXA 3TRQA 2IMDA 2IFQB 1T3BA 4L5OA 3D4MA 2FA8A 3QAWA 1F6MC 4OCEA 4IJIA 1IYIA 3CXGA 3QAGA 1V98A 3QCPA 4HI7A 4HU9A 2PMTA 5D9XA 1G0TA 4KGIA 4MABA 4OFTA 4QL9A 2GSQA 2ALBA 2OKAA 3FR6A 2FY6A 5JCGA 5DCHA 1SL2B 1X5EA 3CSJA 1XW5A 5ID2B 5IIZA 4YQVA 2VOCA 2YWMA 1GTAA 2HRNA 1FOHA 4ZILA 1FG4A 4KNDA 5J3RA 5GSSA 1EV9A 1EV4A 3FHKA 3IC4A 3LGCA 5IMZA 3P7XA 1NHYA 4JBBA 3TKPA 20GSA 3G9BA 2JSZA 3FR9A 4GRFA 3WGDA 3GUSA 22GSA 4BVXB 3F3QA 2RLIA 1W4VA 4HJMA 2IJYA 3MNGA 5KN3A 1GSDA 2R2JA 5KN2A 2QA2A 4IN0A 3FY7A 4PUAA 3ERGA 2HI7A 5H5SA 1AC1A 2R37A 4ZBBA 2ON5A 4MP4A 5LCZA 3FZ5A 3WD6A 1HYUA 3GX8A 4N10A 2IPAA 1Q4JA 3F0IA 3HHVA 3JCML 4MH3A 2VLTA 4WEYA 1WE0A 3KMNA 2GTUA 3DMLA 3QD9A 3DYRA 3D5JA 1SJIA 5E59A 1SKSB 1OC9A 1HNCA 2WGRA 1G7OA 3FR3A 5CREA 3UOMA 4N0ZA 1TK0B 2VCQA 3GSTA 4ECJA 4KE3A 3CYNA 3AY8A 3GKMA 2HRAA 3GTUA 5ECIB 1OC3A 1A0RP 1RQMA 1WOUA 4PUFC 3UL3A 1GRXA 3ZIVA 3CRUA 4ZB6A 2E0QA 4G0LA 5B7CA 1Z9HA 1XWGA 2X8HA 4V2MA 2CAIA 1DE1A 2G2QA 1S3RA 4TRXA 4ISDA 3GKNA 2VD1A 2HZEB 3APOA 1OKTA 1EP8A 4GXZA 5G2ZA 3CSHA 2AHEA 2XPDA 3F9UA 4IGJA 2NPBA 3ZFBA 1H75A 3KP9A 4PNGA 2LNSA 3HXSA 4CY6A 2A2SA 4GF0A 3I9V2 3ZITA 3UAPA 4AGSA 2HSYA 4TR1A 1WJKA 3HKRA 5B8BA 4ZBAA 1A23A 4D73B 2LEGA 2HYXA 3N9JA 4AF2A 5HQPA 3GKKA 4F03A 5JWQB 2PGTA 7GSSA 4LL4B 4EC0A 1ON4A 4MZCA 4QL7A 1K0OA 2YZUA 4Q5RA 2V6OA 1XWKA 3GMFA 3A5IA 2V32A 1GLPA 3UBLA 2JZSA 1XXUA 2FWEA 1MD4A 1U88A 1GNWA 4MDCA 4XRAA 2O7KA 4PTSA 2IMEA 1XFLA 3GA4A 1ZGNA 3UMAA 4TKYA 1GTIA 5D9VA 4EL1A 4O7HA 3ZRDA 1WP0A 2C3QA 1K0BA 2FHEA 3IOSA 2JL4A 4TR3A 1UN2A 4JEDA 4KF9A 4X43A 3GL5A 2AV4A 2YJHA 1K0AA 5CYYA 2LJAA 1GUHA 5KN1A 6GSVA 3D6IA 1LBKA 3K8NA 1OKDA 2C0FA 4PNFA 17GSA 4I97A 1AQVA 3C1SA 3VI5A 4N0VA 4KH7A 1ACVA 5EL8A 3KP8A 2OE3A 6GSYA 2LQOA 2H8LA 3UBKA 3M9JA 5DAKB 4HZ4A 3EC3A 5GZZB 5CRDA 3ZFLA 1K0CA 5BMUA 1M9AA 3QAVA 1B48A 1TU8A 5F0GA 2L4QA 4JU5A 1O73A 2L5OA 1Q98A 2R5GA 4Z2UA 4IBPA 2N5BA 1ZYPA 3HCZA 3BOAA 2H74A 4MZWA 1F37A 3MYDA 5DVBA 4DVCA 1X0RA 2H0GA 5JCWA 5G30A 4FIWA 1Z5YE 8GSSA 5DCGA 1CQHA 1XW9A 1M2DA 2HNLA 4X0XA 1WWJA 3KJYA 5E4WA 4TXOB 2CX4A 5ID2A 2N5FA 3OR5A 1HNBA 4PX1A 4L0UA 5G1KA 1JZOA 1UVZA 1AAZA 5IO0A 4G0KA 2O87A 4ICYA 1G7EA 2DJ3A 1MD3A 2A4VA 4GSTA 2GT5A 4Z2RA 2YPMA 3VPQA 2HLSA 2VLVA 1ZYEA 5EY6A 3M1GA 4G9HA 5C00A 1HNAA 4DSRA 2XHFA 1PL2A 2WCIA 3TDGA 2YWNA 3TKSE 5KEJA 4GCIA 2KLXA 1F3BA 3QDNA 3A2XA 3LYKA 4BVXA 1B4QA 4ZXGA 1TK5B 1URMA 2FWHA 4K7OA 1XOBA 1A0FA 1KBNA 2R6KA 2LNTA 3IK7A 1TJDA 2O89A 2CV4A 3TGZA 2CZ3A 1CQGA 1YEXA 4F0CA 2H70A 3ZREA 2B7JA 1K3YA 4ZB9A 4A5PA 1WRYA 1LJRA 1GTUA 1XBSA 4IVFA 3SBCA 2VCXA 1TDIA 2PERA 5ECRB 1NSWA 3L9VA 4WBRD 3TRPA 3TJFA 4EE0A 2H1AA 4XS4A 3PGTA 2CVBA 4OMVA 1GUKA 2IIYA 3W8SA 1NM3A 1QFNA 2YCDA 3D4TA 1M99A 5DQSA 1YKCA 4LMWA 3KTBA 2B3SA 1OE7A 2X8GA 4O32A 1KEBA 1SJ6A 4K7IA 1VF1A 1BQ7A 2CAQA 5ECSA 1EGOA 2H1GA 1GWCA 1QXHA 4HSCX 1X9SB 4PGTA 4N30A 2F9SA 1A8YA 1X5CA 5J4UA 3KCMA 2KOKA 2K18A 2RUEA 4G19A 3GL3A 5A5KA 3DGQA 2DJ1A 4TR4A 1TP9A 2GZPA 4FO5A 5C04A 1XWAA 3H8QA 2CZ2A 4IJ3A 6GSUA 2KP2A 1EOGA 2PPTA 2QSIA 3CQFA 3CMIA 2F3MA 3FKFA 1O85A 3GSSA 1PX7A 3HZ8A 2WDUA 4MJAA 3O6TA 2VAFA 3KEBA 1NW2A 2VCZA 2EIRA 1R5AA 5B6NA 3UJ1A 1PL1A 4USSA 1A8LA 1VGLA 1JHBA 2LSTA 5IQYA 4ECCA 3IV4A 1AQXA 1QQ2A 3ME8A 5D96A 1FAAA 5G31A 1AXDA 1BEDA 3HVSA 2HXKA 1U3IA 4BVYA 4KDUA 2DIZA 1SK0A 5J9BA 2VIMA 4TN8A 1K3LA 4K5RA 4ECIA 1Y25A 4ZL9A 5HR1A 1GSYA 3F4TA 4HQZA 4IW9A 2MBTA 1B8XA 5IMFA 3E0UA 5FT3A 1BYEA 1THXA 2JACA 3V1WA 4KA0A 3L9SA 3A3TA 1U3AA 3PINA 4GQFA 2A2RA 2XPEA 1PSQA 3H79A 1F9MA 3VK9A 5D9TA 2P5QA 4O5QA 4OFMA 2VCTA 2R4VA 1V9WA 3TJJA 3BBYA 3FW2A 5H5QA 3IAM2 4FYCA 3IRAA 3VFIA 3HJMA 2IN3A 5DAKA 2JADA 3RBTA 2NVLA 3LW9A 2L57A 3CBUA 3TRXA 1YY7A 3ZMKA 4OCFA 2IMKA 2V1MA 1DSBA 2MZCA 12GSA 2XBQA 2C0EA 4EIPA 1SYRA 1GTBA 2H72A 3EYTA 5JCUA 2ZCTA 4ULXA 1Z3EA 2RIIA 2HSMA 4Z2TA 4JE1A 4H86A 1AIUA 5AISA 1TI3A 4MH2A 1ML6A 2YV7A 2VO4A 2NDOA 1PKWA 2H30A 2P5RA 5A4WA 5F8BA 2ZNMA 2B5XA 3Q6OA 1SU9A 2WB9A 2HZFA 1QUWA 1DBYA 4TXOA 3M9KA 3ZIJA 1O7UA 4MK3A 3EMXA 2H76A 4Q5NA 1XVWA 3FZAA 4OO5A 4WR5A 4MJBA 2XBIA 2D2ZA 1XG8A 1TRVA 2K9FA 2PBJA 2AB6A 6GSWA 3G7IA 3Q19A 5DJLA 4V1Ap 1O8XA 4LLRA 2C80A 1SL0B 2GVPA 1XVQA 2KP1A 4O92A 2H0HA 3HD5A 1EWXA 6GSXA 2M80A 1XWBA 2J23A 1GUMA 4DSSB 1PKZA 3NOFA 1GSEA 3GH9A 3DWVA 4YH2A 4OO4A 4GLTA 4PQ1A 2YJ7A 4WBJA 2I81A 4TW5A 2ES7A 4TVEA 4XS6A 1V2AA 3F63A 3HY2A 16GSA 1TTZA 3J7Yk 1PGTA 4I8BA 2H66A 3E9JB 1PN9A 2DJ0A 2E7PA 1OVNA 1JLWA 4HOJA 2VCWA 3LQ7A 3TKQA 5HR0A 2BJXA 5AN1A 1YEPA 3C1RA 1XOAA 1XWCA 4G2EA 3EWLA 2QKEA 10GSA 2VLUA 4IHUA 5ELGA 2GS3A 4KUNA 3G7JA 1TK8B 1XCCA 4K0NA 1FB0A 3E3EA 3TOUA 2LTKA 2K8VA 3W8JA 1ABAA 1PA3A 4IP1A 4EVMA 3WYWA 3KH9A 3IHQA 2H75A 1FO5A 4HQSA 1O8WA 2WFCA 5COHA 2H71A 1K0NA 1M9BA 4BPYA 1EGRA 3DRNA 2PVOC 3FRCA 2VL2C 1RK4A 2GQLA 2IMFA 3RPNA 5JWOB 1K0DA 1SKRB 4V2NA 5DBQA 2L4CA 4J56E 1ZL9A 2CQ9A 3TB2A 1S3CA 2GDRA 3UEMA 2LJKA 4KCAA 2H01A 3DKSA 2HRFA 1IYHA 1OAZA 1MEKA 3TKRA 1M2AA 1GSFA 4POLA 1DUGA 11GSA 2DSAA 1M0UA 3EU4A 5DDLA 2HT9A 4MF6A 4I5QA 1U87A 1J0FA 2F51A 2L6CA 5CO3A 3DXBA 1EZKA 1ERWA 5AIXA 4KSOA 1PRXA 4F2IA 1FW1A 1PQNA 1Z6NA 5G1LA 2MMAA 5ECNB 1HQOA 2LQQA 3D0ZA 4J2FA 4HUAA 1VF2A 4HS1A 2H19A 2GSSA 1R4WA 1K0MA 2PU9C 3KZQA 5CNWA 3DEXA 3GV1A 2VM2A 3F3RA 4RI6A 2IFQA 3IA1A 2HFDA 3U5RE 4G10A 1GSUA 4WR4A 5EVOA 2QGVA 5CP1A 4F0BA 2RM5A 3PH9A 5IOXA 4ECBA 4ZL8A 2WULA 3RHCA 3QFAC 5ECQB 3TKSA 3MWHA
chains in the Genus database with same CATH topology
3IXRA 3VI7A 2H1BA 3FEUA 2A4HA 3H4KA 1A2LA 1T1VA 2F8FA 5ECHB 5DALB 2X49A 3ZVJD 3GFKA 3F8UA 4YQUA 2LRTA 1HD2A 3RPPA 4FYBA 5ECKB 1ZCPA 4K9ZA 2AAWA 1YF1A 2EIOA 2TIRA 3IC8A 4F9ZA 4ILFA 2DMMA 3G7YA 3H93A 2LRNA 4X4JA 3EPTA 2AJQB 2DC5A 2FGXA 1SKWB 4JR4A 1PD21 2CT6A 2L6DA 4YQMA 2TRCP 2OBKA 5FHIA 5CRHA 4HZ2A 2JZRA 4E8EA 2PUKC 1OC9B 1USBA 5AGYA 4PURA 6GSSA 3BCKA 1JZRA 2V2GA 3Q74A 4JRRA 3A2VA 3LFLA 3GTUB 4MPGA 3F6DA 3KM6A 3KMOA 3L9UA 3BJ5A 3VWUA 2DIYA 1J08A 1R5PA 2MMZA 2X8CA 1BG5A 1JZDA 5KOXA 3LG6A 5IM9A 5AIVA 2M72A 3ERFA 3ZYWA 4EIQA 2WZ9A 2GZYA 3DIEA 1FOVA 3L4NA 4YKFA 2X64A 1U6TA 4FH8A 4ZB8A 1SD9A 3GKXA 1B9YC 2IMIA 2FLSA 5KN0A 1FB6A 1UA5A 5GAPD 1JLVA 2WJUA 3LYPA 3F4SA 3IK9A 3GIXA 4CW9A 4J57E 4TR1B 3FZ4A 1YKAA 5IMDA 2H6YA 2IL3A 4MCUA 1TXXA 3GYKA 2CVDA 4NMUA 4K2DA 3CRTA 4XHMA 1MDJA 2HZEA 3US3A 5GSTA 1A2MA 2TRXA 1WIKA 3LSZA 4MZBA 2OACA 2B6MA 4ML6A 2CVKA 3WT1A 2MMOA 2GQKA 3HYPA 1DE2A 3C7MA 4POKA 4ZIJA 4D73A 3LJRA 2PWJA 3ZZXA 1GSSA 5D73A 5G5EA 4RQRA 4MMMA 2DKHA 5F06A 1T4YA 2OJLA 1ST9A 4N11A 3UARA 1W89A 4HDEA 4KX4A 2H6ZA 19GSA 4O5RA 5HFIA 18GSA 1O6JA 2C8UA 4IQ1A 4EXJA 2I1UA 4MPFA 1AQWA 3TKSC 1KTEA 3GNJA 1SL1B 4WF4A 5ECLB 4NPBA 3C8EA 4LA1A 3UIWA 4K6XA 5D8IA 3HJOA 3TJBA 3ME7A 4LL1B 1XW6A 4HJ2A 5B8AA 2C3NA 1PX6A 1X9MB 4Z7XA 3IHGA 3IBHA 4CDOA 2X99A 1B9XC 4V2LA 3GX0A 3VWXA 4KCEA 3TCOA 2C4JA 3BCIA 3HZ4A 2R3XA 2I3YA 2Z9SA 2ON7A 1LU4A 1SK2A 1XZOA 1PMTA 2X4AA 1BX9A 4OFNA 3FYGA 3I69A 4WETA 4PQHA 4X1UA 3M3MA 3J7Yb 5ELAA 5F05A 1H4OA 4TXVA 1UC7A 1MTCA 2C0DA 4RUVA 1XIYA 4KDYA 2VL2A 3NIVA 2VUPA 3LXTA 5J41A 5IO2A 1K3OA 1GULA 3VPTA 3EINA 3MSZA 2C0GA 4TOPA 3EE2A 5H5RA 1S3DA 3C73A 1ZYQB 1T8EB 4HU7A 1WMJA 4NWYA 2OE1A 2YOIA 1JFUA 3I43A 4MLYA 1N2AA 3CSIA 2NTOA 5A4VA 4RQXA 2DMLA 2G0FA 1X9WB 1E6BA 4WF5A 3ZLPA 4AJ6A 4FQUA 3IAS2 1N8JA 2H0IA 4LMVA 4ZBDA 1OC8A 1V58A 2GZZA 3QOUA 4EDYA 1GSQA 4QQ7A 3ZTLA 2I9HA 2JU5A 1BJXA 2WS2A 4K8MA 3LXZA 1A24A 4ACSA 4POBA 5DALA 2F8AA 5EPFA 5CRWA 3QPMA 4IP6A 2EC4A 3DVXA 3ISOA 2L5LA 3P2AA 3FMWA 2C3TA 2JSYA 4K1FA 4OWYA 1R26A 4XTSA 2GGTA 5B6MA 2DJJA 2VL9A 3IE3A 4EDZA 5IPHA 1I5GA 1T00A 2KHPA 4F82A 2WRTA 3L0HA 3ERWA 4O5UA 4MF7A 4E8HA 1V57A 2FD3A 4G0IA 4V1Ag 3ED3A 3TOTA 1YDKA 5IMCA 2VM1A 1TKDB 4KAEA 5D93A 2KUCA 2OADA 4Q5FA 2YWIA 2GT6A 4XS4B 2AYTA 3KH7A 9GSSA 5INYA 4IQAA 3RDWA 1TRWA 1S3AA 2CA8A 6GSTA 1E2YA 2YZHA 3DD3A 2YANA 3APQA 5ECMB 2I4AA 1EEJA 4MJEA 4AJ8A 1YQ1A 3R2QA 3VLNA 1SYXA 2YP6A 4NV5A 4K5SA 4DSQA 5ECPB 4CHSA 3ZVJA 2C1YA 3I6AA 1OYJA 2J9HA 1I9DA 1XPVA 1MDKA 2K8SA 2DBCA 3F6FA 1JZWA 4BWQA 3KXOA 4KSMA 3U6VA 1AUCA 5HFKA 3QMXA 4MA9A 4XCSA 3HDCA 3WGEA 4GSNA 4YAPA 4BWSA 1THOA 3GH6A 4GQCA 1EOHA 4BA7A 4ID0A 4BL7B 3W6GA 3TUEA 2V6KA 3Q18A 2YNXA 3NZNA 5G5FA 5L71A 3HVVA 2CX3A 4NXIA 5JWRB 3UVHA 4KW6A 2MBSA 2LS5A 3ZL5A 2R0PA 3PR8A 4KDXA 4L5LA 1G6WA 3KD0A 3FZ9A 3HA9A 3N5OA 1V40A 5A4UA 2B5EA 4YKGA 3R3EA 3P90A 1M7TA 2QA1A 1B4PA 5HFGA 2LUSA 2GSTA 1FVJA 3HVXA 2OA7A 5BRTA 1YJ6A 4HEA2 5CRGA 1FVKA 3LWAA 3KIJA 4IKHA 2VCVA 2HRKA 4XIHA 3D22A 2DJKA 2UZ8A 4BVYB 3EVIA 1ERUA 4I6XA 2AUVA 5DJMA 3MIXA 4K7NA 1T4ZA 2V41A 1J9BA 1F3AA 5ECOB 5DQYA 1GL8A 4GTUA 4WKWA 3LORA 1SD8A 3WGXA 4MNNA 3CTFA 1GNEA 2B7KA 1ZZYA 1NHOA 4P3YB 4L0WA 2RM6A 4MF5A 1G6YA 1ILOA 3F4RA 2N5AA 5LNKe 1TOFA 1T7PB 3IPZA 3EU3A 3FK8A 3VWVA 1WPIA 1TW9A 1TRUA 3C71A 1QGVA 5IMVA 5F07A 3DVWA 3EMPA 4NAXA 2YWOA 3UVTA 1Z7PA 3CTGA 1RW1A 13GSA 2XC2A 1F2EA 1R7HA 3BD2A 4WXTA 4XS1A 1QMVA 1TU7A 5LD0A 3VWWA 3RAZA 1MDIA 3SWLA 1BAYA 1VRSD 1Y6EA 1OE8A 2O8VB 3ZMLA 3M0FA 5IOWA 5J9CA 1AW9A 3O76A 2VL3A 4FYUA 1TI1A 1VF3A 3LEFA 3EURA 4GSSA 14GSA 3QR6A 2R0CA 4RI7A 4AJ7A 2BTOT 1YF0A 4PXOA 2HSHA 3IR4A 1GLQA 2HE3A 3A2WA 2PVQA 3IDVA 4Q5QA 2L59A 2P31A 1EP7A 2YV9A 1KNGA 2P0GA 4YAVA 2QC7A 2MMNA 4TR0A 2NBSA 1FHEA 2B5YA 2FCHA 3HJPA 1ZMAA 2EIQA 3TJKA 1M2BA 3H1NA 2H1DA 1TRSA 1X5DA 1PN0A 4L8EA 2ZUPA 5D9WA 4EKZA 1ZOFA 4GWRA 4NHWA 3VURA 4NV2A 2H73A 3KTLA 1SK1A 4DSSA 4CY8A 4EF0A 3KGKA 4EO3A 4POMA 1O81A 2JZTA 5J5NA 2IWTA 1Z6MA 4OD7A 4MJCA 3PPUA 4K0GA 5GAND 5FWGA 1SJZA 5CAXA 5HR3A 1A2JA 2O85A 2M46A 2YN1A 2H6XA 3GN3A 2DLXA 1YZXA 3O3TA 1GP1A 2FWFA 2LKUA 2LRCA 5ENUA 3MAKA 2MYGA 1QK8A 3MDKA 1ERTA 2B1LA 5ABRA 2GSRA 3A5WA 2E2GA 4PQIA 1SENA 4XRDA 2B1KA 3GURA 2K6VA 2E2MA 2GQMA 2FUG2 4I2UA 2REMA 5IPGA 2LJRA 3P8WA 3QFBC 2OE0A 3RHBA 4NHZA 1Z7RA 1GH2A 4IS0A 1C72A 4JZQA 4BL7A 1ERVA 2DJ2A 2BMXA 3M8NA 3S9FA 1VF4A 4ML1A 2FA4A 2DKIA 2OBIA 3GHAA 5HR2A 4I2TA 2PN8A 4KB3A 5KOWA 1EEMA 4DEJA 3D21A 2VD0A 3WT2A 2GLRA 4K2XA 2A2PA 3L78A 4IELA 2R0GA 5IMAA 4ZL7A 2FNOA 4EUYA 2RUFA 1ZYNA 3TJGA 2FWGA 2LV3A 3APSA 4JR6A 3GRXA 3TRQA 2IMDA 2IFQB 1T3BA 4L5OA 3D4MA 2FA8A 3QAWA 1F6MC 4OCEA 4IJIA 1IYIA 3CXGA 3QAGA 1V98A 3QCPA 4HI7A 4HU9A 2PMTA 5D9XA 1G0TA 4KGIA 4MABA 4OFTA 4QL9A 2GSQA 2ALBA 2OKAA 3FR6A 2FY6A 5JCGA 5DCHA 1SL2B 1X5EA 3CSJA 1XW5A 5ID2B 5IIZA 4YQVA 2VOCA 2YWMA 1GTAA 2HRNA 1FOHA 4ZILA 1FG4A 4KNDA 5J3RA 5GSSA 1EV9A 1EV4A 3FHKA 3IC4A 3LGCA 5IMZA 3P7XA 1NHYA 4JBBA 3TKPA 20GSA 3G9BA 2JSZA 3FR9A 4GRFA 3WGDA 3GUSA 22GSA 4BVXB 3F3QA 2RLIA 1W4VA 4HJMA 2IJYA 3MNGA 5KN3A 1GSDA 2R2JA 5KN2A 2QA2A 4IN0A 3FY7A 4PUAA 3ERGA 2HI7A 5H5SA 1AC1A 2R37A 4ZBBA 2ON5A 4MP4A 5LCZA 3FZ5A 3WD6A 1HYUA 3GX8A 4N10A 2IPAA 1Q4JA 3F0IA 3HHVA 3JCML 4MH3A 2VLTA 4WEYA 1WE0A 3KMNA 2GTUA 3DMLA 3QD9A 3DYRA 3D5JA 1SJIA 5E59A 1SKSB 1OC9A 1HNCA 2WGRA 1G7OA 3FR3A 5CREA 3UOMA 4N0ZA 1TK0B 2VCQA 3GSTA 4ECJA 4KE3A 3CYNA 3AY8A 3GKMA 2HRAA 3GTUA 5ECIB 1OC3A 1A0RP 1RQMA 1WOUA 4PUFC 3UL3A 1GRXA 3ZIVA 3CRUA 4ZB6A 2E0QA 4G0LA 5B7CA 1Z9HA 1XWGA 2X8HA 4V2MA 2CAIA 1DE1A 2G2QA 4TRXA 4ISDA 3GKNA 2VD1A 2HZEB 3APOA 1OKTA 1EP8A 4GXZA 5G2ZA 3CSHA 2AHEA 2XPDA 3F9UA 4IGJA 2NPBA 3ZFBA 1H75A 3KP9A 4PNGA 2LNSA 3HXSA 4CY6A 2A2SA 4GF0A 3I9V2 3ZITA 3UAPA 4AGSA 2HSYA 4TR1A 1WJKA 3HKRA 5B8BA 4ZBAA 1A23A 4D73B 2LEGA 2HYXA 3N9JA 4AF2A 5HQPA 3GKKA 4F03A 5JWQB 2PGTA 7GSSA 4LL4B 4EC0A 1ON4A 4MZCA 4QL7A 1K0OA 2YZUA 4Q5RA 2V6OA 1XWKA 3GMFA 3A5IA 2V32A 1GLPA 3UBLA 2JZSA 1XXUA 2FWEA 1MD4A 1U88A 1GNWA 4MDCA 4XRAA 2O7KA 4PTSA 2IMEA 1XFLA 3GA4A 1ZGNA 3UMAA 4TKYA 1GTIA 5D9VA 4EL1A 4O7HA 3ZRDA 1WP0A 2C3QA 1K0BA 2FHEA 3IOSA 2JL4A 4TR3A 1UN2A 4JEDA 4KF9A 4X43A 3GL5A 2AV4A 2YJHA 1K0AA 5CYYA 2LJAA 1GUHA 5KN1A 6GSVA 3D6IA 1LBKA 3K8NA 1OKDA 2C0FA 4PNFA 17GSA 4I97A 1AQVA 3C1SA 3VI5A 4N0VA 4KH7A 1ACVA 5EL8A 3KP8A 2OE3A 6GSYA 2LQOA 2H8LA 3UBKA 3M9JA 5DAKB 4HZ4A 3EC3A 5GZZB 5CRDA 3ZFLA 1K0CA 5BMUA 1M9AA 3QAVA 1B48A 1TU8A 5F0GA 2L4QA 4JU5A 1O73A 2L5OA 1Q98A 2R5GA 4Z2UA 4IBPA 2N5BA 1ZYPA 3HCZA 3BOAA 2H74A 4MZWA 1F37A 3MYDA 5DVBA 4DVCA 1X0RA 2H0GA 5JCWA 5G30A 4FIWA 1Z5YE 8GSSA 5DCGA 1CQHA 1XW9A 1M2DA 2HNLA 4X0XA 1WWJA 3KJYA 5E4WA 4TXOB 2CX4A 5ID2A 2N5FA 3OR5A 1HNBA 4PX1A 4L0UA 5G1KA 1JZOA 1UVZA 1AAZA 5IO0A 4G0KA 2O87A 4ICYA 1G7EA 2DJ3A 1MD3A 2A4VA 4GSTA 2GT5A 4Z2RA 2YPMA 3VPQA 2HLSA 2VLVA 1ZYEA 5EY6A 3M1GA 4G9HA 5C00A 1HNAA 4DSRA 2XHFA 1PL2A 2WCIA 3TDGA 2YWNA 3TKSE 5KEJA 4GCIA 2KLXA 1F3BA 3QDNA 3A2XA 3LYKA 4BVXA 1B4QA 4ZXGA 1TK5B 1URMA 2FWHA 4K7OA 1XOBA 1A0FA 1KBNA 2R6KA 2LNTA 3IK7A 1TJDA 2O89A 2CV4A 3TGZA 2CZ3A 1CQGA 1YEXA 4F0CA 2H70A 3ZREA 2B7JA 1K3YA 4ZB9A 4A5PA 1WRYA 1LJRA 1GTUA 1XBSA 4IVFA 3SBCA 2VCXA 1TDIA 2PERA 5ECRB 1NSWA 3L9VA 4WBRD 3TRPA 3TJFA 4EE0A 2H1AA 4XS4A 3PGTA 2CVBA 4OMVA 1GUKA 2IIYA 3W8SA 1NM3A 1QFNA 2YCDA 3D4TA 1M99A 5DQSA 1YKCA 4LMWA 3KTBA 2B3SA 1OE7A 2X8GA 4O32A 1KEBA 1SJ6A 4K7IA 1VF1A 1BQ7A 2CAQA 5ECSA 1EGOA 2H1GA 1GWCA 1QXHA 1X9SB 4PGTA 4N30A 2F9SA 1A8YA 1X5CA 5J4UA 3KCMA 2KOKA 2K18A 2RUEA 4G19A 3GL3A 5A5KA 3DGQA 2DJ1A 4TR4A 1TP9A 2GZPA 4FO5A 5C04A 1XWAA 3H8QA 2CZ2A 4IJ3A 6GSUA 2KP2A 1EOGA 2PPTA 2QSIA 3CMIA 2F3MA 3FKFA 1O85A 3GSSA 1PX7A 3HZ8A 2WDUA 4MJAA 3O6TA 2VAFA 3KEBA 1NW2A 2VCZA 2EIRA 1R5AA 5B6NA 3UJ1A 1PL1A 4USSA 1A8LA 1VGLA 1JHBA 2LSTA 5IQYA 4ECCA 3IV4A 1AQXA 1QQ2A 3ME8A 5D96A 1FAAA 5G31A 1AXDA 1BEDA 3HVSA 2HXKA 1U3IA 4BVYA 4KDUA 2DIZA 1SK0A 5J9BA 2VIMA 4TN8A 1K3LA 4K5RA 4ECIA 1Y25A 4ZL9A 5HR1A 1GSYA 3F4TA 4HQZA 4IW9A 2MBTA 1B8XA 5IMFA 3E0UA 5FT3A 1BYEA 1THXA 2JACA 3V1WA 4KA0A 3L9SA 3A3TA 1U3AA 3PINA 4GQFA 2A2RA 2XPEA 1PSQA 3H79A 1F9MA 3VK9A 5D9TA 2P5QA 4O5QA 4OFMA 2VCTA 2R4VA 1V9WA 3TJJA 3BBYA 3FW2A 5H5QA 3IAM2 4FYCA 3IRAA 3VFIA 3HJMA 2IN3A 5DAKA 2JADA 3RBTA 2NVLA 3LW9A 2L57A 3CBUA 3TRXA 1YY7A 3ZMKA 4OCFA 2IMKA 2V1MA 1DSBA 2MZCA 12GSA 2XBQA 2C0EA 4EIPA 1SYRA 1GTBA 2H72A 3EYTA 5JCUA 2ZCTA 4ULXA 1Z3EA 2RIIA 2HSMA 4Z2TA 4JE1A 4H86A 1AIUA 5AISA 1TI3A 4MH2A 1ML6A 2YV7A 2VO4A 2NDOA 1PKWA 2H30A 2P5RA 5A4WA 5F8BA 2ZNMA 2B5XA 3Q6OA 1SU9A 2WB9A 2HZFA 1QUWA 1DBYA 4TXOA 3M9KA 3ZIJA 1O7UA 4MK3A 3EMXA 2H76A 4Q5NA 1XVWA 3FZAA 4OO5A 4WR5A 4MJBA 2XBIA 2D2ZA 1TRVA 2K9FA 2PBJA 2AB6A 6GSWA 3G7IA 3Q19A 5DJLA 4V1Ap 1O8XA 4LLRA 2C80A 1SL0B 2GVPA 1XVQA 2KP1A 4O92A 2H0HA 3HD5A 1EWXA 6GSXA 2M80A 1XWBA 2J23A 1GUMA 4DSSB 1PKZA 3NOFA 1GSEA 3GH9A 3DWVA 4YH2A 4OO4A 4GLTA 4PQ1A 2YJ7A 4WBJA 2I81A 4TW5A 2ES7A 4TVEA 4XS6A 1V2AA 3F63A 3HY2A 16GSA 1TTZA 3J7Yk 1PGTA 4I8BA 2H66A 3E9JB 1PN9A 2DJ0A 2E7PA 1OVNA 1JLWA 4HOJA 2VCWA 3LQ7A 3TKQA 5HR0A 2BJXA 5AN1A 1YEPA 3C1RA 1XOAA 1XWCA 4G2EA 3EWLA 2QKEA 10GSA 2VLUA 4IHUA 5ELGA 2GS3A 4KUNA 3G7JA 1TK8B 1XCCA 4K0NA 1FB0A 3E3EA 3TOUA 2LTKA 2K8VA 3W8JA 1ABAA 1PA3A 4IP1A 4EVMA 3WYWA 3KH9A 3IHQA 2H75A 1FO5A 4HQSA 1O8WA 2WFCA 5COHA 2H71A 1K0NA 1M9BA 4BPYA 1EGRA 3DRNA 2PVOC 3FRCA 2VL2C 1RK4A 2GQLA 2IMFA 3RPNA 5JWOB 1K0DA 1SKRB 4V2NA 5DBQA 2L4CA 4J56E 1ZL9A 2CQ9A 3TB2A 1S3CA 2GDRA 3UEMA 2LJKA 4KCAA 2H01A 3DKSA 2HRFA 1IYHA 1OAZA 1MEKA 3TKRA 1M2AA 1GSFA 4POLA 1DUGA 11GSA 2DSAA 1M0UA 3EU4A 5DDLA 2HT9A 4MF6A 4I5QA 1U87A 1J0FA 2F51A 2L6CA 5CO3A 3DXBA 1EZKA 1ERWA 5AIXA 4KSOA 1PRXA 4F2IA 1FW1A 1PQNA 1Z6NA 5G1LA 2MMAA 5ECNB 1HQOA 2LQQA 3D0ZA 4J2FA 4HUAA 1VF2A 4HS1A 2H19A 2GSSA 1R4WA 1K0MA 2PU9C 3KZQA 5CNWA 3DEXA 3GV1A 2VM2A 3F3RA 4RI6A 2IFQA 3IA1A 2HFDA 3U5RE 4G10A 1GSUA 4WR4A 5EVOA 2QGVA 5CP1A 4F0BA 2RM5A 3PH9A 5IOXA 4ECBA 4ZL8A 2WULA 3RHCA 3QFAC 5ECQB 3TKSA 3MWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IXR A;  3VI7 A;  2H1B A;  3FEU A;  3H4K A;  1A2L A;  1T1V A;  2F8F A;  5ECH B;  5DAL B;  3ZVJ D;  3GFK A;  3F8U A;  4YQU A;  2LRT A;  1HD2 A;  3RPP A;  4FYB A;  5ECK B;  1ZCP A;  4K9Z A;  2AAW A;  1YF1 A;  2EIO A;  2TIR A;  4F9Z A;  4ILF A;  2DMM A;  3G7Y A;  3H93 A;  2LRN A;  2AJQ B;  2DC5 A;  2FGX A;  1SKW B;  4JR4 A;  1PD2 1;  2CT6 A;  2L6D A;  4YQM A;  2TRC P;  2OBK A;  5FHI A;  5CRH A;  4HZ2 A;  2JZR A;  4E8E A;  2PUK C;  1OC9 B;  1USB A;  5AGY A;  4PUR A;  6GSS A;  3BCK A;  1JZR A;  2V2G A;  3Q74 A;  4JRR A;  3A2V A;  3LFL A;  3GTU B;  4MPG A;  3F6D A;  3KM6 A;  3KMO A;  3L9U A;  3BJ5 A;  3VWU A;  2DIY A;  1J08 A;  1R5P A;  2MMZ A;  2X8C A;  1BG5 A;  1JZD A;  3LG6 A;  5IM9 A;  5AIV A;  2M72 A;  3ERF A;  3ZYW A;  2WZ9 A;  2GZY A;  3DIE A;  1FOV A;  3L4N A;  2X64 A;  1U6T A;  4FH8 A;  4ZB8 A;  1SD9 A;  3GKX A;  1B9Y C;  2IMI A;  2FLS A;  5KN0 A;  1FB6 A;  1UA5 A;  5GAP D;  1JLV A;  2WJU A;  3LYP A;  3F4S A;  3IK9 A;  3GIX A;  4CW9 A;  4J57 E;  4TR1 B;  3FZ4 A;  1YKA A;  5IMD A;  2H6Y A;  2IL3 A;  4MCU A;  1TXX A;  3GYK A;  2CVD A;  4NMU A;  4K2D A;  3CRT A;  4XHM A;  1MDJ A;  2HZE A;  3US3 A;  5GST A;  1A2M A;  2TRX A;  1WIK A;  3LSZ A;  4MZB A;  2OAC A;  2B6M A;  4ML6 A;  2CVK A;  3WT1 A;  2MMO A;  2GQK A;  3HYP A;  1DE2 A;  3C7M A;  4POK A;  4ZIJ A;  4D73 A;  3LJR A;  2PWJ A;  3ZZX A;  1GSS A;  5D73 A;  5G5E A;  4RQR A;  4MMM A;  5F06 A;  1T4Y A;  2OJL A;  1ST9 A;  4N11 A;  3UAR A;  1W89 A;  4HDE A;  4KX4 A;  2H6Z A;  19GS A;  4O5R A;  5HFI A;  18GS A;  1O6J A;  2C8U A;  4IQ1 A;  4EXJ A;  2I1U A;  4MPF A;  1AQW A;  3TKS C;  1KTE A;  3GNJ A;  1SL1 B;  4WF4 A;  5ECL B;  4NPB A;  3C8E A;  4LA1 A;  3UIW A;  4K6X A;  5D8I A;  3HJO A;  3TJB A;  3ME7 A;  4LL1 B;  1XW6 A;  4HJ2 A;  5B8A A;  2C3N A;  1PX6 A;  1X9M B;  4Z7X A;  3IBH A;  4CDO A;  2X99 A;  1B9X C;  4V2L A;  3GX0 A;  3VWX A;  4KCE A;  3TCO A;  2C4J A;  3BCI A;  3HZ4 A;  2R3X A;  2I3Y A;  2Z9S A;  2ON7 A;  1LU4 A;  1SK2 A;  1XZO A;  1PMT A;  1BX9 A;  4OFN A;  3FYG A;  3I69 A;  4WET A;  4PQH A;  4X1U A;  3M3M A;  3J7Y b;  5ELA A;  5F05 A;  1H4O A;  4TXV A;  1UC7 A;  1MTC A;  2C0D A;  4RUV A;  1XIY A;  4KDY A;  2VL2 A;  3NIV A;  2VUP A;  3LXT A;  5J41 A;  5IO2 A;  1K3O A;  1GUL A;  3VPT A;  3EIN A;  3MSZ A;  2C0G A;  4TOP A;  3EE2 A;  5H5R A;  1S3D A;  3C73 A;  1ZYQ B;  1T8E B;  4HU7 A;  1WMJ A;  4NWY A;  2OE1 A;  2YOI A;  1JFU A;  3I43 A;  4MLY A;  1N2A A;  3CSI A;  2NTO A;  5A4V A;  4RQX A;  2DML A;  2G0F A;  1X9W B;  1E6B A;  4WF5 A;  3ZLP A;  4AJ6 A;  3IAS 2;  1N8J A;  2H0I A;  4LMV A;  4ZBD A;  1OC8 A;  1V58 A;  2GZZ A;  3QOU A;  4EDY A;  1GSQ A;  4QQ7 A;  3ZTL A;  2I9H A;  2JU5 A;  1BJX A;  2WS2 A;  4K8M A;  3LXZ A;  1A24 A;  4ACS A;  4POB A;  5DAL A;  2F8A A;  5EPF A;  5CRW A;  3QPM A;  4IP6 A;  2EC4 A;  3DVX A;  3ISO A;  2L5L A;  3P2A A;  2C3T A;  2JSY A;  4K1F A;  4OWY A;  1R26 A;  4XTS A;  2GGT A;  5B6M A;  2DJJ A;  2VL9 A;  3IE3 A;  4EDZ A;  5IPH A;  1I5G A;  1T00 A;  2KHP A;  4F82 A;  2WRT A;  3L0H A;  3ERW A;  4MF7 A;  4E8H A;  1V57 A;  2FD3 A;  4V1A g;  3ED3 A;  3TOT A;  1YDK A;  5IMC A;  2VM1 A;  1TKD B;  4KAE A;  5D93 A;  2KUC A;  2OAD A;  4Q5F A;  2YWI A;  2GT6 A;  4XS4 B;  2AYT A;  3KH7 A;  9GSS A;  5INY A;  4IQA A;  3RDW A;  1TRW A;  1S3A A;  2CA8 A;  6GST A;  1E2Y A;  2YZH A;  3DD3 A;  2YAN A;  3APQ A;  5ECM B;  2I4A A;  1EEJ A;  4MJE A;  4AJ8 A;  1YQ1 A;  3R2Q A;  3VLN A;  1SYX A;  2YP6 A;  4NV5 A;  4DSQ A;  5ECP B;  4CHS A;  3ZVJ A;  2C1Y A;  3I6A A;  1OYJ A;  2J9H A;  1I9D A;  1XPV A;  1MDK A;  2K8S A;  2DBC A;  3F6F A;  1JZW A;  4BWQ A;  3KXO A;  4KSM A;  3U6V A;  1AUC A;  5HFK A;  3QMX A;  4MA9 A;  4XCS A;  3HDC A;  3WGE A;  4GSN A;  4YAP A;  4BWS A;  1THO A;  3GH6 A;  4GQC A;  1EOH A;  4BA7 A;  4ID0 A;  3W6G A;  3TUE A;  2V6K A;  3Q18 A;  2YNX A;  3NZN A;  5G5F A;  5L71 A;  3HVV A;  2CX3 A;  4NXI A;  5JWR B;  3UVH A;  4KW6 A;  2MBS A;  2LS5 A;  3ZL5 A;  4KDX A;  3PR8 A;  4L5L A;  1G6W A;  3KD0 A;  3FZ9 A;  3HA9 A;  3N5O A;  1V40 A;  5A4U A;  2B5E A;  3P90 A;  1M7T A;  1B4P A;  5HFG A;  2LUS A;  2GST A;  1FVJ A;  3HVX A;  2OA7 A;  1YJ6 A;  4HEA 2;  5CRG A;  1FVK A;  3LWA A;  3KIJ A;  4IKH A;  2VCV A;  4XIH A;  3D22 A;  2DJK A;  3EVI A;  1ERU A;  4I6X A;  2AUV A;  5DJM A;  4K7N A;  1T4Z A;  2V41 A;  1J9B A;  1F3A A;  5ECO B;  5DQY A;  1GL8 A;  4GTU A;  4WKW A;  3LOR A;  1SD8 A;  3WGX A;  3CTF A;  1GNE A;  2B7K A;  1ZZY A;  1NHO A;  4P3Y B;  4L0W A;  2RM6 A;  4MF5 A;  1G6Y A;  1ILO A;  3F4R A;  2N5A A;  5LNK e;  1TOF A;  1T7P B;  3IPZ A;  3EU3 A;  3FK8 A;  3VWV A;  1WPI A;  1TW9 A;  1TRU A;  3C71 A;  1QGV A;  5IMV A;  5F07 A;  3DVW A;  3EMP A;  4NAX A;  2YWO A;  3UVT A;  1Z7P A;  3CTG A;  1RW1 A;  13GS A;  2XC2 A;  1F2E A;  1R7H A;  3BD2 A;  4WXT A;  4XS1 A;  1QMV A;  1TU7 A;  5LD0 A;  3VWW A;  3RAZ A;  1MDI A;  3SWL A;  1BAY A;  1VRS D;  1Y6E A;  1OE8 A;  2O8V B;  3ZML A;  3M0F A;  5IOW A;  5J9C A;  1AW9 A;  3O76 A;  2VL3 A;  4FYU A;  1TI1 A;  1VF3 A;  3LEF A;  3EUR A;  4GSS A;  14GS A;  3QR6 A;  4RI7 A;  4AJ7 A;  2BTO T;  1YF0 A;  4PXO A;  2HSH A;  3IR4 A;  1GLQ A;  2HE3 A;  3A2W A;  2PVQ A;  3IDV A;  4Q5Q A;  2L59 A;  2P31 A;  1EP7 A;  2YV9 A;  1KNG A;  2P0G A;  4YAV A;  2QC7 A;  2MMN A;  4TR0 A;  2NBS A;  1FHE A;  2B5Y A;  2FCH A;  3HJP A;  1ZMA A;  2EIQ A;  3TJK A;  1M2B A;  3H1N A;  2H1D A;  1TRS A;  1X5D A;  4L8E A;  2ZUP A;  5D9W A;  4EKZ A;  1ZOF A;  4GWR A;  4NHW A;  3VUR A;  4NV2 A;  2H73 A;  3KTL A;  1SK1 A;  4DSS A;  4EF0 A;  3KGK A;  4EO3 A;  4POM A;  1O81 A;  2JZT A;  5J5N A;  2IWT A;  1Z6M A;  4OD7 A;  4MJC A;  4K0G A;  5GAN D;  5FWG A;  1SJZ A;  5CAX A;  5HR3 A;  1A2J A;  2O85 A;  2M46 A;  2YN1 A;  2H6X A;  3GN3 A;  2DLX A;  1YZX A;  3O3T A;  1GP1 A;  2FWF A;  2LKU A;  2LRC A;  5ENU A;  3MAK A;  2MYG A;  1QK8 A;  3MDK A;  1ERT A;  2B1L A;  5ABR A;  2GSR A;  3A5W A;  2E2G A;  4PQI A;  1SEN A;  4XRD A;  2B1K A;  3GUR A;  2K6V A;  2E2M A;  2GQM A;  2FUG 2;  4I2U A;  2REM A;  5IPG A;  2LJR A;  3P8W A;  3QFB C;  2OE0 A;  3RHB A;  4NHZ A;  1Z7R A;  1GH2 A;  4IS0 A;  1C72 A;  4JZQ A;  4BL7 A;  1ERV A;  2DJ2 A;  2BMX A;  3M8N A;  3S9F A;  1VF4 A;  4ML1 A;  2FA4 A;  2OBI A;  3GHA A;  5HR2 A;  4I2T A;  2PN8 A;  4KB3 A;  1EEM A;  4DEJ A;  3D21 A;  2VD0 A;  3WT2 A;  2GLR A;  3L78 A;  4IEL A;  5IMA A;  4ZL7 A;  2FNO A;  4EUY A;  2RUF A;  3TJG A;  2FWG A;  2LV3 A;  3APS A;  4JR6 A;  3GRX A;  3TRQ A;  2IMD A;  2IFQ B;  1T3B A;  4L5O A;  3D4M A;  2FA8 A;  3QAW A;  1F6M C;  4OCE A;  4IJI A;  1IYI A;  3CXG A;  3QAG A;  1V98 A;  3QCP A;  4HI7 A;  4HU9 A;  2PMT A;  5D9X A;  1G0T A;  4KGI A;  4MAB A;  4OFT A;  4QL9 A;  2GSQ A;  2ALB A;  2OKA A;  3FR6 A;  2FY6 A;  5JCG A;  5DCH A;  1SL2 B;  1X5E A;  3CSJ A;  1XW5 A;  5ID2 B;  5IIZ A;  4YQV A;  2VOC A;  2YWM A;  1GTA A;  2HRN A;  5J3R A;  4ZIL A;  1FG4 A;  4KND A;  5GSS A;  1EV9 A;  1EV4 A;  3FHK A;  3IC4 A;  3LGC A;  5IMZ A;  3P7X A;  1NHY A;  4JBB A;  3TKP A;  20GS A;  3G9B A;  2JSZ A;  3FR9 A;  4GRF A;  3WGD A;  3GUS A;  22GS A;  3F3Q A;  2RLI A;  1W4V A;  4HJM A;  2IJY A;  3MNG A;  5KN3 A;  1GSD A;  2R2J A;  5KN2 A;  4IN0 A;  3FY7 A;  4PUA A;  3ERG A;  2HI7 A;  5H5S A;  1AC1 A;  2R37 A;  4ZBB A;  2ON5 A;  4MP4 A;  5LCZ A;  3FZ5 A;  3WD6 A;  1HYU A;  3GX8 A;  4N10 A;  2IPA A;  1Q4J A;  3F0I A;  3HHV A;  3JCM L;  4MH3 A;  2VLT A;  4WEY A;  1WE0 A;  3KMN A;  2GTU A;  3DML A;  3QD9 A;  3DYR A;  3D5J A;  1SJI A;  5E59 A;  1SKS B;  1OC9 A;  1HNC A;  2WGR A;  1G7O A;  3FR3 A;  5CRE A;  3UOM A;  4N0Z A;  1TK0 B;  2VCQ A;  3GST A;  4ECJ A;  4KE3 A;  3CYN A;  3AY8 A;  3GKM A;  3GTU A;  5ECI B;  1OC3 A;  1A0R P;  1RQM A;  1WOU A;  4PUF C;  3UL3 A;  1GRX A;  3ZIV A;  3CRU A;  4ZB6 A;  2E0Q A;  5B7C A;  1Z9H A;  1XWG A;  2X8H A;  4V2M A;  2CAI A;  1DE1 A;  2G2Q A;  4TRX A;  4ISD A;  3GKN A;  2VD1 A;  2HZE B;  3APO A;  1OKT A;  1EP8 A;  4GXZ A;  5G2Z A;  3CSH A;  2AHE A;  2XPD A;  3F9U A;  4IGJ A;  2NPB A;  3ZFB A;  1H75 A;  3KP9 A;  4PNG A;  2LNS A;  3HXS A;  2A2S A;  4GF0 A;  3I9V 2;  3ZIT A;  3UAP A;  4AGS A;  2HSY A;  4TR1 A;  1WJK A;  3HKR A;  5B8B A;  4ZBA A;  1A23 A;  4D73 B;  2LEG A;  2HYX A;  3N9J A;  4AF2 A;  5HQP A;  3GKK A;  4F03 A;  5JWQ B;  2PGT A;  7GSS A;  4LL4 B;  4EC0 A;  1ON4 A;  4MZC A;  4QL7 A;  1K0O A;  2YZU A;  4Q5R A;  2V6O A;  1XWK A;  3GMF A;  2V32 A;  1GLP A;  3UBL A;  2JZS A;  1XXU A;  2FWE A;  1MD4 A;  1U88 A;  1GNW A;  4MDC A;  4XRA A;  2O7K A;  2IME A;  1XFL A;  3GA4 A;  1ZGN A;  3UMA A;  4TKY A;  1GTI A;  5D9V A;  4EL1 A;  4O7H A;  3ZRD A;  1WP0 A;  2C3Q A;  1K0B A;  2FHE A;  3IOS A;  2JL4 A;  4TR3 A;  1UN2 A;  4JED A;  3GL5 A;  4X43 A;  2AV4 A;  2YJH A;  1K0A A;  5CYY A;  2LJA A;  1GUH A;  5KN1 A;  6GSV A;  3D6I A;  1LBK A;  3K8N A;  1OKD A;  2C0F A;  4PNF A;  17GS A;  4I97 A;  1AQV A;  3C1S A;  3VI5 A;  4N0V A;  4KH7 A;  1ACV A;  5EL8 A;  3KP8 A;  2OE3 A;  6GSY A;  2LQO A;  2H8L A;  3UBK A;  5DAK B;  3M9J A;  4HZ4 A;  3EC3 A;  5GZZ B;  5CRD A;  3ZFL A;  1K0C A;  1M9A A;  3QAV A;  1B48 A;  1TU8 A;  5F0G A;  2L4Q A;  4JU5 A;  1O73 A;  2L5O A;  1Q98 A;  2R5G A;  4IBP A;  2N5B A;  3HCZ A;  3BOA A;  2H74 A;  4MZW A;  1F37 A;  5DVB A;  4DVC A;  1X0R A;  2H0G A;  5JCW A;  5G30 A;  4FIW A;  1Z5Y E;  8GSS A;  5DCG A;  1CQH A;  1XW9 A;  1M2D A;  2HNL A;  4X0X A;  1WWJ A;  3KJY A;  5E4W A;  4TXO B;  2CX4 A;  5ID2 A;  2N5F A;  3OR5 A;  1HNB A;  4PX1 A;  4L0U A;  5G1K A;  1JZO A;  1UVZ A;  1AAZ A;  5IO0 A;  2O87 A;  1G7E A;  2DJ3 A;  1MD3 A;  2A4V A;  4GST A;  2GT5 A;  2YPM A;  3VPQ A;  2HLS A;  2VLV A;  1ZYE A;  5EY6 A;  3M1G A;  4G9H A;  5C00 A;  1HNA A;  4DSR A;  2XHF A;  1PL2 A;  2WCI A;  3TDG A;  2YWN A;  3TKS E;  5KEJ A;  4GCI A;  2KLX A;  1F3B A;  3QDN A;  3A2X A;  3LYK A;  4BVX A;  1B4Q A;  4ZXG A;  1TK5 B;  1URM A;  2FWH A;  4K7O A;  1XOB A;  1A0F A;  1KBN A;  2R6K A;  2LNT A;  3IK7 A;  1TJD A;  2O89 A;  2CV4 A;  3TGZ A;  2CZ3 A;  1CQG A;  1YEX A;  4F0C A;  2H70 A;  3ZRE A;  2B7J A;  1K3Y A;  4ZB9 A;  1WRY A;  1LJR A;  1GTU A;  1XBS A;  4IVF A;  3SBC A;  2VCX A;  1TDI A;  2PER A;  5ECR B;  1NSW A;  3L9V A;  4WBR D;  3TRP A;  3TJF A;  4EE0 A;  2H1A A;  4XS4 A;  3PGT A;  2CVB A;  4OMV A;  1GUK A;  2IIY A;  3W8S A;  1NM3 A;  1QFN A;  2YCD A;  3D4T A;  1M99 A;  5DQS A;  1YKC A;  4LMW A;  3KTB A;  2B3S A;  1OE7 A;  2X8G A;  4O32 A;  1KEB A;  1SJ6 A;  4K7I A;  1VF1 A;  1BQ7 A;  2CAQ A;  5ECS A;  1EGO A;  2H1G A;  1GWC A;  1QXH A;  1X9S B;  4PGT A;  4N30 A;  2F9S A;  1A8Y A;  1X5C A;  5J4U A;  3KCM A;  2KOK A;  2K18 A;  2RUE A;  4G19 A;  3GL3 A;  5A5K A;  3DGQ A;  2DJ1 A;  4TR4 A;  1TP9 A;  2GZP A;  4FO5 A;  5C04 A;  1XWA A;  3H8Q A;  2CZ2 A;  4IJ3 A;  6GSU A;  2KP2 A;  1EOG A;  2PPT A;  2QSI A;  3CMI A;  2F3M A;  3FKF A;  1O85 A;  3GSS A;  1PX7 A;  3HZ8 A;  2WDU A;  4MJA A;  3O6T A;  2VAF A;  3KEB A;  1NW2 A;  2VCZ A;  2EIR A;  1R5A A;  5B6N A;  3UJ1 A;  1PL1 A;  1A8L A;  1VGL A;  1JHB A;  2LST A;  5IQY A;  4ECC A;  3IV4 A;  1AQX A;  1QQ2 A;  3ME8 A;  5D96 A;  1FAA A;  5G31 A;  1AXD A;  1BED A;  3HVS A;  2HXK A;  1U3I A;  4BVY A;  4KDU A;  2DIZ A;  1SK0 A;  5J9B A;  2VIM A;  4TN8 A;  1K3L A;  4ECI A;  1Y25 A;  4ZL9 A;  5HR1 A;  1GSY A;  3F4T A;  4HQZ A;  4IW9 A;  2MBT A;  1B8X A;  5IMF A;  3E0U A;  5FT3 A;  1BYE A;  1THX A;  2JAC A;  3V1W A;  4KA0 A;  3L9S A;  3A3T A;  1U3A A;  3PIN A;  4GQF A;  2A2R A;  2XPE A;  1PSQ A;  3H79 A;  1F9M A;  3VK9 A;  5D9T A;  2P5Q A;  4OFM A;  2VCT A;  2R4V A;  1V9W A;  3TJJ A;  3BBY A;  3FW2 A;  5H5Q A;  3IAM 2;  4FYC A;  3IRA A;  3VFI A;  3HJM A;  2IN3 A;  5DAK A;  2JAD A;  3RBT A;  2NVL A;  2L57 A;  3CBU A;  3TRX A;  1YY7 A;  3ZMK A;  4OCF A;  2IMK A;  2V1M A;  1DSB A;  2MZC A;  12GS A;  2XBQ A;  2C0E A;  1SYR A;  1GTB A;  2H72 A;  3EYT A;  5JCU A;  2ZCT A;  4ULX A;  1Z3E A;  2RII A;  4JE1 A;  4H86 A;  1AIU A;  5AIS A;  1TI3 A;  4MH2 A;  1ML6 A;  2YV7 A;  2VO4 A;  2NDO A;  1PKW A;  2H30 A;  2P5R A;  5A4W A;  5F8B A;  2ZNM A;  2B5X A;  3Q6O A;  1SU9 A;  2WB9 A;  2HZF A;  1QUW A;  1DBY A;  4TXO A;  3M9K A;  3ZIJ A;  1O7U A;  4MK3 A;  3EMX A;  2H76 A;  4Q5N A;  1XVW A;  3FZA A;  4OO5 A;  4WR5 A;  4MJB A;  2XBI A;  2D2Z A;  1TRV A;  2K9F A;  2PBJ A;  2AB6 A;  6GSW A;  3G7I A;  3Q19 A;  5DJL A;  4V1A p;  1O8X A;  4LLR A;  2C80 A;  1SL0 B;  2GVP A;  1XVQ A;  2KP1 A;  4O92 A;  2H0H A;  3HD5 A;  1EWX A;  6GSX A;  2M80 A;  1XWB A;  2J23 A;  1GUM A;  4DSS B;  1PKZ A;  3NOF A;  1GSE A;  3GH9 A;  3DWV A;  4YH2 A;  4OO4 A;  4GLT A;  4PQ1 A;  2YJ7 A;  4WBJ A;  2I81 A;  4TW5 A;  2ES7 A;  4TVE A;  4XS6 A;  1V2A A;  3F63 A;  3HY2 A;  16GS A;  1TTZ A;  3J7Y k;  1PGT A;  4I8B A;  2H66 A;  3E9J B;  1PN9 A;  2DJ0 A;  2E7P A;  1OVN A;  1JLW A;  4HOJ A;  2VCW A;  3LQ7 A;  3TKQ A;  5HR0 A;  2BJX A;  5AN1 A;  1YEP A;  3C1R A;  1XOA A;  1XWC A;  4G2E A;  3EWL A;  2QKE A;  10GS A;  2VLU A;  4IHU A;  5ELG A;  2GS3 A;  4KUN A;  3G7J A;  1TK8 B;  1XCC A;  4K0N A;  1FB0 A;  3E3E A;  3TOU A;  2LTK A;  2K8V A;  3W8J A;  1ABA A;  1PA3 A;  4IP1 A;  4EVM A;  3WYW A;  3KH9 A;  3IHQ A;  2H75 A;  1FO5 A;  4HQS A;  1O8W A;  2WFC A;  5COH A;  2H71 A;  1K0N A;  1M9B A;  4BPY A;  1EGR A;  3DRN A;  2PVO C;  3FRC A;  2VL2 C;  1RK4 A;  2GQL A;  2IMF A;  3RPN A;  5JWO B;  1K0D A;  1SKR B;  4V2N A;  5DBQ A;  2L4C A;  4J56 E;  1ZL9 A;  2CQ9 A;  3TB2 A;  1S3C A;  2GDR A;  3UEM A;  2LJK A;  4KCA A;  2H01 A;  3DKS A;  2HRF A;  1IYH A;  1OAZ A;  1MEK A;  3TKR A;  1M2A A;  1GSF A;  4POL A;  1DUG A;  11GS A;  2DSA A;  1M0U A;  3EU4 A;  5DDL A;  2HT9 A;  4MF6 A;  4I5Q A;  1U87 A;  1J0F A;  2F51 A;  2L6C A;  5CO3 A;  3DXB A;  1EZK A;  1ERW A;  5AIX A;  4KSO A;  1PRX A;  4F2I A;  1FW1 A;  1PQN A;  1Z6N A;  5G1L A;  2MMA A;  5ECN B;  1HQO A;  2LQQ A;  3D0Z A;  4J2F A;  4HUA A;  1VF2 A;  4HS1 A;  2H19 A;  2GSS A;  1R4W A;  1K0M A;  2PU9 C;  3KZQ A;  5CNW A;  3DEX A;  3GV1 A;  2VM2 A;  3F3R A;  4RI6 A;  2IFQ A;  3IA1 A;  2HFD A;  3U5R E;  4G10 A;  5EVO A;  1GSU A;  4WR4 A;  2QGV A;  5CP1 A;  4F0B A;  2RM5 A;  3PH9 A;  5IOX A;  4ECB A;  4ZL8 A;  2WUL A;  3RHC A;  3QFA C;  5ECQ B;  3TKS A;  3MWH A; 
#chains in the Genus database with same CATH topology
 3IXR A;  3VI7 A;  2H1B A;  3FEU A;  2A4H A;  3H4K A;  1A2L A;  1T1V A;  2F8F A;  5ECH B;  5DAL B;  2X49 A;  3ZVJ D;  3GFK A;  3F8U A;  4YQU A;  2LRT A;  1HD2 A;  3RPP A;  4FYB A;  5ECK B;  1ZCP A;  4K9Z A;  2AAW A;  1YF1 A;  2EIO A;  2TIR A;  3IC8 A;  4F9Z A;  4ILF A;  2DMM A;  3G7Y A;  3H93 A;  2LRN A;  4X4J A;  3EPT A;  2AJQ B;  2DC5 A;  2FGX A;  1SKW B;  4JR4 A;  1PD2 1;  2CT6 A;  2L6D A;  4YQM A;  2TRC P;  2OBK A;  5FHI A;  5CRH A;  4HZ2 A;  2JZR A;  4E8E A;  2PUK C;  1OC9 B;  1USB A;  5AGY A;  4PUR A;  6GSS A;  3BCK A;  1JZR A;  2V2G A;  3Q74 A;  4JRR A;  3A2V A;  3LFL A;  3GTU B;  4MPG A;  3F6D A;  3KM6 A;  3KMO A;  3L9U A;  3BJ5 A;  3VWU A;  2DIY A;  1J08 A;  1R5P A;  2MMZ A;  2X8C A;  1BG5 A;  1JZD A;  5KOX A;  3LG6 A;  5IM9 A;  5AIV A;  2M72 A;  3ERF A;  3ZYW A;  4EIQ A;  2WZ9 A;  2GZY A;  3DIE A;  1FOV A;  3L4N A;  4YKF A;  2X64 A;  1U6T A;  4FH8 A;  4ZB8 A;  1SD9 A;  3GKX A;  1B9Y C;  2IMI A;  2FLS A;  5KN0 A;  1FB6 A;  1UA5 A;  5GAP D;  1JLV A;  2WJU A;  3LYP A;  3F4S A;  3IK9 A;  3GIX A;  4CW9 A;  4J57 E;  4TR1 B;  3FZ4 A;  1YKA A;  5IMD A;  2H6Y A;  2IL3 A;  4MCU A;  1TXX A;  3HVN A;  3GYK A;  2CVD A;  4NMU A;  4K2D A;  3CRT A;  4XHM A;  1MDJ A;  2HZE A;  3US3 A;  5GST A;  1A2M A;  2TRX A;  1WIK A;  3LSZ A;  4MZB A;  2OAC A;  2B6M A;  4ML6 A;  2CVK A;  3WT1 A;  2MMO A;  2GQK A;  3HYP A;  1DE2 A;  3C7M A;  4POK A;  4ZIJ A;  4D73 A;  3LJR A;  2PWJ A;  3ZZX A;  1GSS A;  5D73 A;  5G5E A;  4RQR A;  4MMM A;  2DKH A;  5F06 A;  1T4Y A;  2OJL A;  1ST9 A;  4N11 A;  3UAR A;  1W89 A;  4HDE A;  4KX4 A;  2H6Z A;  19GS A;  4O5R A;  5HFI A;  18GS A;  1O6J A;  2C8U A;  4IQ1 A;  4EXJ A;  2I1U A;  4MPF A;  1AQW A;  3TKS C;  1KTE A;  3GNJ A;  1SL1 B;  4WF4 A;  5ECL B;  4NPB A;  3C8E A;  4LA1 A;  3UIW A;  4K6X A;  5D8I A;  3HJO A;  3TJB A;  3ME7 A;  4LL1 B;  1XW6 A;  4HJ2 A;  5B8A A;  2C3N A;  1PX6 A;  4BIK A;  1X9M B;  1M3I A;  4Z7X A;  3IHG A;  3IBH A;  4CDO A;  2X99 A;  1B9X C;  4V2L A;  3GX0 A;  3VWX A;  4KCE A;  3TCO A;  2C4J A;  3BCI A;  3HZ4 A;  2R3X A;  2I3Y A;  2Z9S A;  2ON7 A;  1LU4 A;  1SK2 A;  1XZO A;  1PMT A;  2X4A A;  1BX9 A;  4OFN A;  3FYG A;  3I69 A;  4WET A;  4PQH A;  4X1U A;  3M3M A;  3J7Y b;  5ELA A;  5F05 A;  1H4O A;  4TXV A;  1UC7 A;  1MTC A;  2C0D A;  4RUV A;  1XIY A;  4KDY A;  2VL2 A;  3NIV A;  2VUP A;  3LXT A;  5J41 A;  5IO2 A;  1K3O A;  1GUL A;  3VPT A;  3EIN A;  3MSZ A;  2C0G A;  4TOP A;  3EE2 A;  5H5R A;  1S3D A;  3C73 A;  1PFO A;  1ZYQ B;  1T8E B;  4HU7 A;  1WMJ A;  4NWY A;  2OE1 A;  2YOI A;  1JFU A;  3I43 A;  4MLY A;  1N2A A;  3CSI A;  2NTO A;  5A4V A;  4RQX A;  2DML A;  2G0F A;  1X9W B;  1E6B A;  4WF5 A;  3ZLP A;  4AJ6 A;  4FQU A;  3IAS 2;  1N8J A;  2H0I A;  4LMV A;  4ZBD A;  1OC8 A;  1V58 A;  2GZZ A;  3QOU A;  4EDY A;  1GSQ A;  4QQ7 A;  3ZTL A;  2I9H A;  2JU5 A;  1BJX A;  2WS2 A;  4K8M A;  3LXZ A;  1A24 A;  4ACS A;  4POB A;  5DAL A;  2F8A A;  5EPF A;  5CRW A;  3QPM A;  1M3J A;  4IP6 A;  2EC4 A;  3DVX A;  3ISO A;  2L5L A;  3P2A A;  3FMW A;  2C3T A;  2JSY A;  4K1F A;  4OWY A;  1R26 A;  4XTS A;  2GGT A;  5B6M A;  2DJJ A;  2VL9 A;  3IE3 A;  4EDZ A;  5IPH A;  1I5G A;  1T00 A;  2KHP A;  4F82 A;  2WRT A;  3L0H A;  3ERW A;  4O5U A;  4MF7 A;  4E8H A;  1V57 A;  2FD3 A;  4G0I A;  4V1A g;  3ED3 A;  3TOT A;  1YDK A;  5IMC A;  2VM1 A;  1TKD B;  4KAE A;  5D93 A;  2KUC A;  2OAD A;  4Q5F A;  2YWI A;  2GT6 A;  4XS4 B;  2AYT A;  3KH7 A;  9GSS A;  5INY A;  4IQA A;  3RDW A;  1TRW A;  1S3A A;  2CA8 A;  6GST A;  1E2Y A;  2YZH A;  3DD3 A;  2YAN A;  3APQ A;  5ECM B;  2I4A A;  1EEJ A;  4MJE A;  4AJ8 A;  1YQ1 A;  3R2Q A;  3VLN A;  1SYX A;  2YP6 A;  4NV5 A;  4K5S A;  4DSQ A;  5ECP B;  4CHS A;  3ZVJ A;  2C1Y A;  3I6A A;  1OYJ A;  2J9H A;  1I9D A;  1XPV A;  1MDK A;  2K8S A;  2DBC A;  3F6F A;  1JZW A;  4BWQ A;  3KXO A;  4KSM A;  3U6V A;  1AUC A;  5HFK A;  3QMX A;  4MA9 A;  4XCS A;  3HDC A;  3WGE A;  4GSN A;  4YAP A;  4BWS A;  1THO A;  3GH6 A;  4GQC A;  1EOH A;  4BA7 A;  4ID0 A;  4BL7 B;  3W6G A;  3TUE A;  2V6K A;  3Q18 A;  2YNX A;  3NZN A;  5G5F A;  5L71 A;  3HVV A;  2CX3 A;  4NXI A;  5JWR B;  3UVH A;  4KW6 A;  2MBS A;  2LS5 A;  3ZL5 A;  2R0P A;  3PR8 A;  4KDX A;  4L5L A;  1G6W A;  3KD0 A;  3FZ9 A;  3HA9 A;  3N5O A;  1V40 A;  5A4U A;  2B5E A;  4YKG A;  3R3E A;  3P90 A;  1M7T A;  2QA1 A;  1B4P A;  5HFG A;  2LUS A;  2GST A;  1FVJ A;  3HVX A;  2OA7 A;  5BRT A;  1YJ6 A;  4HEA 2;  5CRG A;  1FVK A;  3LWA A;  3KIJ A;  4IKH A;  2VCV A;  2HRK A;  4XIH A;  3D22 A;  2DJK A;  2UZ8 A;  4BVY B;  3EVI A;  1ERU A;  4I6X A;  2AUV A;  5DJM A;  3MIX A;  4K7N A;  1T4Z A;  2V41 A;  1J9B A;  1F3A A;  5ECO B;  5DQY A;  1GL8 A;  4GTU A;  4WKW A;  3LOR A;  1SD8 A;  3WGX A;  4MNN A;  3CTF A;  1GNE A;  2B7K A;  1ZZY A;  1NHO A;  4P3Y B;  4L0W A;  2RM6 A;  4MF5 A;  1G6Y A;  1ILO A;  3F4R A;  2N5A A;  5LNK e;  1TOF A;  1T7P B;  3IPZ A;  3EU3 A;  3FK8 A;  3VWV A;  1WPI A;  1TW9 A;  1TRU A;  3C71 A;  1QGV A;  5IMV A;  5F07 A;  3DVW A;  3EMP A;  4NAX A;  2YWO A;  3UVT A;  1Z7P A;  3CTG A;  1RW1 A;  13GS A;  2XC2 A;  1F2E A;  1R7H A;  3BD2 A;  4WXT A;  4XS1 A;  1QMV A;  1TU7 A;  5LD0 A;  3VWW A;  3RAZ A;  1MDI A;  3SWL A;  1BAY A;  1VRS D;  1Y6E A;  1OE8 A;  2O8V B;  3ZML A;  3M0F A;  5IOW A;  5J9C A;  1AW9 A;  3O76 A;  2VL3 A;  4FYU A;  1TI1 A;  1VF3 A;  3LEF A;  3EUR A;  4GSS A;  14GS A;  3QR6 A;  2R0C A;  4RI7 A;  4AJ7 A;  2BTO T;  1YF0 A;  4PXO A;  2HSH A;  3IR4 A;  1GLQ A;  2HE3 A;  3A2W A;  2PVQ A;  3IDV A;  4Q5Q A;  2L59 A;  2P31 A;  1EP7 A;  2YV9 A;  1KNG A;  2P0G A;  4YAV A;  2QC7 A;  2MMN A;  4TR0 A;  2NBS A;  1FHE A;  2B5Y A;  2FCH A;  3HJP A;  1ZMA A;  2EIQ A;  3TJK A;  1M2B A;  3H1N A;  2H1D A;  1TRS A;  1X5D A;  1PN0 A;  4L8E A;  2ZUP A;  5D9W A;  4EKZ A;  1ZOF A;  4GWR A;  4NHW A;  3VUR A;  4NV2 A;  2H73 A;  3KTL A;  1SK1 A;  4DSS A;  4CY8 A;  4EF0 A;  3KGK A;  4EO3 A;  4POM A;  1O81 A;  2JZT A;  5J5N A;  2IWT A;  1Z6M A;  4OD7 A;  4MJC A;  3PPU A;  4K0G A;  5GAN D;  5FWG A;  1SJZ A;  5CAX A;  5HR3 A;  1A2J A;  2O85 A;  2M46 A;  2YN1 A;  2H6X A;  3GN3 A;  2DLX A;  1YZX A;  3O3T A;  1GP1 A;  2FWF A;  2LKU A;  2LRC A;  5ENU A;  3MAK A;  2MYG A;  1QK8 A;  3MDK A;  1ERT A;  2B1L A;  5ABR A;  2GSR A;  3A5W A;  2E2G A;  4PQI A;  1SEN A;  4XRD A;  2B1K A;  3GUR A;  2K6V A;  2E2M A;  2GQM A;  2FUG 2;  4I2U A;  2REM A;  5IPG A;  2LJR A;  3P8W A;  3QFB C;  2OE0 A;  3RHB A;  4NHZ A;  1Z7R A;  1GH2 A;  4IS0 A;  1C72 A;  4JZQ A;  4BL7 A;  1ERV A;  2DJ2 A;  2BMX A;  3M8N A;  3S9F A;  1VF4 A;  4ML1 A;  2FA4 A;  2DKI A;  2OBI A;  3GHA A;  5HR2 A;  4I2T A;  2PN8 A;  4KB3 A;  5KOW A;  1EEM A;  4DEJ A;  3D21 A;  2VD0 A;  3WT2 A;  2GLR A;  4K2X A;  2A2P A;  3L78 A;  4IEL A;  2R0G A;  5IMA A;  4ZL7 A;  2FNO A;  4EUY A;  2RUF A;  1ZYN A;  3TJG A;  2FWG A;  2LV3 A;  3APS A;  4JR6 A;  3GRX A;  3TRQ A;  2IMD A;  2IFQ B;  1T3B A;  4L5O A;  3D4M A;  2FA8 A;  3QAW A;  1F6M C;  4OCE A;  4IJI A;  1IYI A;  3CXG A;  3QAG A;  1V98 A;  3QCP A;  4HI7 A;  4HU9 A;  2PMT A;  5D9X A;  1G0T A;  4KGI A;  4MAB A;  4OFT A;  4QL9 A;  2GSQ A;  2ALB A;  2OKA A;  3FR6 A;  2FY6 A;  5JCG A;  5DCH A;  1SL2 B;  1X5E A;  3CSJ A;  1XW5 A;  5ID2 B;  5IIZ A;  4YQV A;  2VOC A;  2YWM A;  1GTA A;  2HRN A;  1FOH A;  4ZIL A;  1FG4 A;  4KND A;  5J3R A;  5GSS A;  1EV9 A;  1EV4 A;  3FHK A;  3IC4 A;  3LGC A;  5IMZ A;  3P7X A;  1NHY A;  4JBB A;  3TKP A;  20GS A;  3G9B A;  2JSZ A;  3FR9 A;  4GRF A;  3WGD A;  3GUS A;  22GS A;  4BVX B;  3F3Q A;  2RLI A;  1W4V A;  4HJM A;  2IJY A;  3MNG A;  5KN3 A;  1GSD A;  2R2J A;  5KN2 A;  2QA2 A;  4IN0 A;  3FY7 A;  4PUA A;  3ERG A;  2HI7 A;  5H5S A;  1AC1 A;  2R37 A;  4ZBB A;  2ON5 A;  4MP4 A;  5LCZ A;  3FZ5 A;  3WD6 A;  1HYU A;  3GX8 A;  4N10 A;  2IPA A;  1Q4J A;  3F0I A;  3HHV A;  3JCM L;  4MH3 A;  2VLT A;  4WEY A;  1WE0 A;  3KMN A;  2GTU A;  3DML A;  3QD9 A;  3DYR A;  3D5J A;  1SJI A;  5E59 A;  1SKS B;  1OC9 A;  1HNC A;  2WGR A;  1G7O A;  3FR3 A;  5CRE A;  3UOM A;  4N0Z A;  1TK0 B;  2VCQ A;  3GST A;  4ECJ A;  4KE3 A;  3CYN A;  3AY8 A;  3GKM A;  2HRA A;  3GTU A;  5ECI B;  1OC3 A;  1A0R P;  1RQM A;  1WOU A;  4PUF C;  3UL3 A;  1GRX A;  3ZIV A;  3CRU A;  4ZB6 A;  2E0Q A;  4G0L A;  5B7C A;  1Z9H A;  1XWG A;  2X8H A;  4V2M A;  2CAI A;  1DE1 A;  2G2Q A;  1S3R A;  4TRX A;  4ISD A;  3GKN A;  2VD1 A;  2HZE B;  3APO A;  1OKT A;  1EP8 A;  4GXZ A;  5G2Z A;  3CSH A;  2AHE A;  2XPD A;  3F9U A;  4IGJ A;  2NPB A;  3ZFB A;  1H75 A;  3KP9 A;  4PNG A;  2LNS A;  3HXS A;  4CY6 A;  2A2S A;  4GF0 A;  3I9V 2;  3ZIT A;  3UAP A;  4AGS A;  2HSY A;  4TR1 A;  1WJK A;  3HKR A;  5B8B A;  4ZBA A;  1A23 A;  4D73 B;  2LEG A;  2HYX A;  3N9J A;  4AF2 A;  5HQP A;  3GKK A;  4F03 A;  5JWQ B;  2PGT A;  7GSS A;  4LL4 B;  4EC0 A;  1ON4 A;  4MZC A;  4QL7 A;  1K0O A;  2YZU A;  4Q5R A;  2V6O A;  1XWK A;  3GMF A;  3A5I A;  2V32 A;  1GLP A;  3UBL A;  2JZS A;  1XXU A;  2FWE A;  1MD4 A;  1U88 A;  1GNW A;  4MDC A;  4XRA A;  2O7K A;  4PTS A;  2IME A;  1XFL A;  3GA4 A;  1ZGN A;  3UMA A;  4TKY A;  1GTI A;  5D9V A;  4EL1 A;  4O7H A;  3ZRD A;  1WP0 A;  2C3Q A;  1K0B A;  2FHE A;  3IOS A;  2JL4 A;  4TR3 A;  1UN2 A;  4JED A;  4KF9 A;  4X43 A;  3GL5 A;  2AV4 A;  2YJH A;  1K0A A;  5CYY A;  2LJA A;  1GUH A;  5KN1 A;  6GSV A;  3D6I A;  1LBK A;  3K8N A;  1OKD A;  2C0F A;  4PNF A;  17GS A;  4I97 A;  1AQV A;  3C1S A;  3VI5 A;  4N0V A;  4KH7 A;  1ACV A;  5EL8 A;  3KP8 A;  2OE3 A;  6GSY A;  2LQO A;  2H8L A;  3UBK A;  3M9J A;  5DAK B;  4HZ4 A;  3EC3 A;  5GZZ B;  5CRD A;  3ZFL A;  1K0C A;  5BMU A;  1M9A A;  3QAV A;  1B48 A;  1TU8 A;  5F0G A;  2L4Q A;  4JU5 A;  1O73 A;  2L5O A;  1Q98 A;  2R5G A;  4Z2U A;  4IBP A;  2N5B A;  1ZYP A;  3HCZ A;  3BOA A;  2H74 A;  4MZW A;  1F37 A;  3MYD A;  5DVB A;  4DVC A;  1X0R A;  2H0G A;  5JCW A;  5G30 A;  4FIW A;  1Z5Y E;  8GSS A;  5DCG A;  1CQH A;  1XW9 A;  1M2D A;  2HNL A;  4X0X A;  1WWJ A;  3KJY A;  5E4W A;  4TXO B;  2CX4 A;  5ID2 A;  2N5F A;  3OR5 A;  1HNB A;  4PX1 A;  4L0U A;  5G1K A;  1JZO A;  1UVZ A;  1AAZ A;  5IO0 A;  4G0K A;  2O87 A;  4ICY A;  1G7E A;  2DJ3 A;  1MD3 A;  2A4V A;  4GST A;  2GT5 A;  4Z2R A;  2YPM A;  3VPQ A;  2HLS A;  2VLV A;  1ZYE A;  5EY6 A;  3M1G A;  4G9H A;  5C00 A;  1HNA A;  4DSR A;  2XHF A;  1PL2 A;  2WCI A;  3TDG A;  2YWN A;  3TKS E;  5KEJ A;  4GCI A;  2KLX A;  1F3B A;  3QDN A;  3A2X A;  3LYK A;  4BVX A;  1B4Q A;  4ZXG A;  1TK5 B;  1URM A;  2FWH A;  4K7O A;  1XOB A;  1A0F A;  1KBN A;  2R6K A;  2LNT A;  3IK7 A;  1TJD A;  2O89 A;  2CV4 A;  3TGZ A;  2CZ3 A;  1CQG A;  1YEX A;  4F0C A;  2H70 A;  3ZRE A;  2B7J A;  1K3Y A;  4ZB9 A;  4A5P A;  1WRY A;  1LJR A;  1GTU A;  1XBS A;  4IVF A;  3SBC A;  2VCX A;  1TDI A;  2PER A;  5ECR B;  1NSW A;  3L9V A;  4WBR D;  3TRP A;  3TJF A;  4EE0 A;  2H1A A;  4XS4 A;  3PGT A;  2CVB A;  4OMV A;  1GUK A;  2IIY A;  3W8S A;  1NM3 A;  1QFN A;  2YCD A;  3D4T A;  1M99 A;  5DQS A;  1YKC A;  4LMW A;  3KTB A;  2B3S A;  1OE7 A;  2X8G A;  4O32 A;  1KEB A;  1SJ6 A;  4K7I A;  1VF1 A;  1BQ7 A;  2CAQ A;  5ECS A;  1EGO A;  2H1G A;  1GWC A;  1QXH A;  4HSC X;  1X9S B;  4PGT A;  4N30 A;  2F9S A;  1A8Y A;  1X5C A;  5J4U A;  3KCM A;  2KOK A;  2K18 A;  2RUE A;  4G19 A;  3GL3 A;  5A5K A;  3DGQ A;  2DJ1 A;  4TR4 A;  1TP9 A;  2GZP A;  4FO5 A;  5C04 A;  1XWA A;  3H8Q A;  2CZ2 A;  4IJ3 A;  6GSU A;  2KP2 A;  1EOG A;  2PPT A;  2QSI A;  3CQF A;  3CMI A;  2F3M A;  3FKF A;  1O85 A;  3GSS A;  1PX7 A;  3HZ8 A;  2WDU A;  4MJA A;  3O6T A;  2VAF A;  3KEB A;  1NW2 A;  2VCZ A;  2EIR A;  1R5A A;  5B6N A;  3UJ1 A;  1PL1 A;  4USS A;  1A8L A;  1VGL A;  1JHB A;  2LST A;  5IQY A;  4ECC A;  3IV4 A;  1AQX A;  1QQ2 A;  3ME8 A;  5D96 A;  1FAA A;  5G31 A;  1AXD A;  1BED A;  3HVS A;  2HXK A;  1U3I A;  4BVY A;  4KDU A;  2DIZ A;  1SK0 A;  5J9B A;  2VIM A;  4TN8 A;  1K3L A;  4K5R A;  4ECI A;  1Y25 A;  4ZL9 A;  5HR1 A;  1GSY A;  3F4T A;  4HQZ A;  4IW9 A;  2MBT A;  1B8X A;  5IMF A;  3E0U A;  5FT3 A;  1BYE A;  1THX A;  2JAC A;  3V1W A;  4KA0 A;  3L9S A;  3A3T A;  1U3A A;  3PIN A;  4GQF A;  2A2R A;  2XPE A;  1PSQ A;  3H79 A;  1F9M A;  3VK9 A;  5D9T A;  2P5Q A;  4O5Q A;  4OFM A;  2VCT A;  2R4V A;  1V9W A;  3TJJ A;  3BBY A;  3FW2 A;  5H5Q A;  3IAM 2;  4FYC A;  3IRA A;  3VFI A;  3HJM A;  2IN3 A;  5DAK A;  2JAD A;  3RBT A;  2NVL A;  3LW9 A;  2L57 A;  3CBU A;  3TRX A;  1YY7 A;  3ZMK A;  4OCF A;  2IMK A;  2V1M A;  1DSB A;  2MZC A;  12GS A;  2XBQ A;  2C0E A;  4EIP A;  1SYR A;  1GTB A;  2H72 A;  3EYT A;  5JCU A;  2ZCT A;  4ULX A;  1Z3E A;  2RII A;  2HSM A;  4Z2T A;  4JE1 A;  4H86 A;  1AIU A;  5AIS A;  1TI3 A;  4MH2 A;  1ML6 A;  2YV7 A;  2VO4 A;  2NDO A;  1PKW A;  2H30 A;  2P5R A;  5A4W A;  5F8B A;  2ZNM A;  2B5X A;  3Q6O A;  1SU9 A;  2WB9 A;  2HZF A;  1QUW A;  1DBY A;  4TXO A;  3M9K A;  3ZIJ A;  1O7U A;  4MK3 A;  3EMX A;  2H76 A;  4Q5N A;  1XVW A;  3FZA A;  4OO5 A;  4WR5 A;  4MJB A;  2XBI A;  2D2Z A;  1XG8 A;  1TRV A;  2K9F A;  2PBJ A;  2AB6 A;  6GSW A;  3G7I A;  3Q19 A;  5DJL A;  4V1A p;  1O8X A;  4LLR A;  2C80 A;  1SL0 B;  2GVP A;  1XVQ A;  2KP1 A;  4O92 A;  2H0H A;  3HD5 A;  1EWX A;  6GSX A;  2M80 A;  1XWB A;  2J23 A;  1GUM A;  4DSS B;  1PKZ A;  3NOF A;  1GSE A;  3GH9 A;  3DWV A;  4YH2 A;  4OO4 A;  4GLT A;  4PQ1 A;  2YJ7 A;  4WBJ A;  2I81 A;  4TW5 A;  2ES7 A;  4TVE A;  4XS6 A;  1V2A A;  3F63 A;  3HY2 A;  16GS A;  1TTZ A;  3J7Y k;  1PGT A;  4I8B A;  2H66 A;  3E9J B;  1PN9 A;  2DJ0 A;  2E7P A;  1OVN A;  1JLW A;  4HOJ A;  2VCW A;  3LQ7 A;  3TKQ A;  5HR0 A;  2BJX A;  5AN1 A;  1YEP A;  3C1R A;  1XOA A;  1XWC A;  4G2E A;  3EWL A;  2QKE A;  10GS A;  2VLU A;  4IHU A;  5ELG A;  2GS3 A;  4KUN A;  3G7J A;  1TK8 B;  1XCC A;  4K0N A;  1FB0 A;  3E3E A;  3TOU A;  2LTK A;  2K8V A;  3W8J A;  1ABA A;  1PA3 A;  4IP1 A;  4EVM A;  3WYW A;  3KH9 A;  3IHQ A;  2H75 A;  1FO5 A;  4HQS A;  1O8W A;  2WFC A;  5COH A;  2H71 A;  1K0N A;  1M9B A;  4BPY A;  1EGR A;  3DRN A;  2PVO C;  3FRC A;  2VL2 C;  1RK4 A;  2GQL A;  2IMF A;  3RPN A;  5JWO B;  1K0D A;  1SKR B;  4V2N A;  5DBQ A;  2L4C A;  4J56 E;  1ZL9 A;  2CQ9 A;  3TB2 A;  1S3C A;  2GDR A;  3UEM A;  2LJK A;  4KCA A;  2H01 A;  3DKS A;  2HRF A;  1IYH A;  1OAZ A;  1MEK A;  3TKR A;  1M2A A;  1GSF A;  4POL A;  1DUG A;  11GS A;  2DSA A;  1M0U A;  3EU4 A;  5DDL A;  2HT9 A;  4MF6 A;  4I5Q A;  1U87 A;  1J0F A;  2F51 A;  2L6C A;  5CO3 A;  3DXB A;  1EZK A;  1ERW A;  5AIX A;  4KSO A;  1PRX A;  4F2I A;  1FW1 A;  1PQN A;  1Z6N A;  5G1L A;  2MMA A;  5ECN B;  1HQO A;  2LQQ A;  3D0Z A;  4J2F A;  4HUA A;  1VF2 A;  4HS1 A;  2H19 A;  2GSS A;  1R4W A;  1K0M A;  2PU9 C;  3KZQ A;  5CNW A;  3DEX A;  3GV1 A;  2VM2 A;  3F3R A;  4RI6 A;  2IFQ A;  3IA1 A;  2HFD A;  3U5R E;  4G10 A;  1GSU A;  4WR4 A;  5EVO A;  2QGV A;  5CP1 A;  4F0B A;  2RM5 A;  3PH9 A;  5IOX A;  4ECB A;  4ZL8 A;  2WUL A;  3RHC A;  3QFA C;  5ECQ B;  3TKS A;  3MWH A; 
#chains in the Genus database with same CATH homology
 3IXR A;  3VI7 A;  2H1B A;  3FEU A;  2A4H A;  3H4K A;  1A2L A;  1T1V A;  2F8F A;  5ECH B;  5DAL B;  2X49 A;  3ZVJ D;  3GFK A;  3F8U A;  4YQU A;  2LRT A;  1HD2 A;  3RPP A;  4FYB A;  5ECK B;  1ZCP A;  4K9Z A;  2AAW A;  1YF1 A;  2EIO A;  2TIR A;  3IC8 A;  4F9Z A;  4ILF A;  2DMM A;  3G7Y A;  3H93 A;  2LRN A;  4X4J A;  3EPT A;  2AJQ B;  2DC5 A;  2FGX A;  1SKW B;  4JR4 A;  1PD2 1;  2CT6 A;  2L6D A;  4YQM A;  2TRC P;  2OBK A;  5FHI A;  5CRH A;  4HZ2 A;  2JZR A;  4E8E A;  2PUK C;  1OC9 B;  1USB A;  5AGY A;  4PUR A;  6GSS A;  3BCK A;  1JZR A;  2V2G A;  3Q74 A;  4JRR A;  3A2V A;  3LFL A;  3GTU B;  4MPG A;  3F6D A;  3KM6 A;  3KMO A;  3L9U A;  3BJ5 A;  3VWU A;  2DIY A;  1J08 A;  1R5P A;  2MMZ A;  2X8C A;  1BG5 A;  1JZD A;  5KOX A;  3LG6 A;  5IM9 A;  5AIV A;  2M72 A;  3ERF A;  3ZYW A;  4EIQ A;  2WZ9 A;  2GZY A;  3DIE A;  1FOV A;  3L4N A;  4YKF A;  2X64 A;  1U6T A;  4FH8 A;  4ZB8 A;  1SD9 A;  3GKX A;  1B9Y C;  2IMI A;  2FLS A;  5KN0 A;  1FB6 A;  1UA5 A;  5GAP D;  1JLV A;  2WJU A;  3LYP A;  3F4S A;  3IK9 A;  3GIX A;  4CW9 A;  4J57 E;  4TR1 B;  3FZ4 A;  1YKA A;  5IMD A;  2H6Y A;  2IL3 A;  4MCU A;  1TXX A;  3GYK A;  2CVD A;  4NMU A;  4K2D A;  3CRT A;  4XHM A;  1MDJ A;  2HZE A;  3US3 A;  5GST A;  1A2M A;  2TRX A;  1WIK A;  3LSZ A;  4MZB A;  2OAC A;  2B6M A;  4ML6 A;  2CVK A;  3WT1 A;  2MMO A;  2GQK A;  3HYP A;  1DE2 A;  3C7M A;  4POK A;  4ZIJ A;  4D73 A;  3LJR A;  2PWJ A;  3ZZX A;  1GSS A;  5D73 A;  5G5E A;  4RQR A;  4MMM A;  2DKH A;  5F06 A;  1T4Y A;  2OJL A;  1ST9 A;  4N11 A;  3UAR A;  1W89 A;  4HDE A;  4KX4 A;  2H6Z A;  19GS A;  4O5R A;  5HFI A;  18GS A;  1O6J A;  2C8U A;  4IQ1 A;  4EXJ A;  2I1U A;  4MPF A;  1AQW A;  3TKS C;  1KTE A;  3GNJ A;  1SL1 B;  4WF4 A;  5ECL B;  4NPB A;  3C8E A;  4LA1 A;  3UIW A;  4K6X A;  5D8I A;  3HJO A;  3TJB A;  3ME7 A;  4LL1 B;  1XW6 A;  4HJ2 A;  5B8A A;  2C3N A;  1PX6 A;  1X9M B;  4Z7X A;  3IHG A;  3IBH A;  4CDO A;  2X99 A;  1B9X C;  4V2L A;  3GX0 A;  3VWX A;  4KCE A;  3TCO A;  2C4J A;  3BCI A;  3HZ4 A;  2R3X A;  2I3Y A;  2Z9S A;  2ON7 A;  1LU4 A;  1SK2 A;  1XZO A;  1PMT A;  2X4A A;  1BX9 A;  4OFN A;  3FYG A;  3I69 A;  4WET A;  4PQH A;  4X1U A;  3M3M A;  3J7Y b;  5ELA A;  5F05 A;  1H4O A;  4TXV A;  1UC7 A;  1MTC A;  2C0D A;  4RUV A;  1XIY A;  4KDY A;  2VL2 A;  3NIV A;  2VUP A;  3LXT A;  5J41 A;  5IO2 A;  1K3O A;  1GUL A;  3VPT A;  3EIN A;  3MSZ A;  2C0G A;  4TOP A;  3EE2 A;  5H5R A;  1S3D A;  3C73 A;  1ZYQ B;  1T8E B;  4HU7 A;  1WMJ A;  4NWY A;  2OE1 A;  2YOI A;  1JFU A;  3I43 A;  4MLY A;  1N2A A;  3CSI A;  2NTO A;  5A4V A;  4RQX A;  2DML A;  2G0F A;  1X9W B;  1E6B A;  4WF5 A;  3ZLP A;  4AJ6 A;  4FQU A;  3IAS 2;  1N8J A;  2H0I A;  4LMV A;  4ZBD A;  1OC8 A;  1V58 A;  2GZZ A;  3QOU A;  4EDY A;  1GSQ A;  4QQ7 A;  3ZTL A;  2I9H A;  2JU5 A;  1BJX A;  2WS2 A;  4K8M A;  3LXZ A;  1A24 A;  4ACS A;  4POB A;  5DAL A;  2F8A A;  5EPF A;  5CRW A;  3QPM A;  4IP6 A;  2EC4 A;  3DVX A;  3ISO A;  2L5L A;  3P2A A;  3FMW A;  2C3T A;  2JSY A;  4K1F A;  4OWY A;  1R26 A;  4XTS A;  2GGT A;  5B6M A;  2DJJ A;  2VL9 A;  3IE3 A;  4EDZ A;  5IPH A;  1I5G A;  1T00 A;  2KHP A;  4F82 A;  2WRT A;  3L0H A;  3ERW A;  4O5U A;  4MF7 A;  4E8H A;  1V57 A;  2FD3 A;  4G0I A;  4V1A g;  3ED3 A;  3TOT A;  1YDK A;  5IMC A;  2VM1 A;  1TKD B;  4KAE A;  5D93 A;  2KUC A;  2OAD A;  4Q5F A;  2YWI A;  2GT6 A;  4XS4 B;  2AYT A;  3KH7 A;  9GSS A;  5INY A;  4IQA A;  3RDW A;  1TRW A;  1S3A A;  2CA8 A;  6GST A;  1E2Y A;  2YZH A;  3DD3 A;  2YAN A;  3APQ A;  5ECM B;  2I4A A;  1EEJ A;  4MJE A;  4AJ8 A;  1YQ1 A;  3R2Q A;  3VLN A;  1SYX A;  2YP6 A;  4NV5 A;  4K5S A;  4DSQ A;  5ECP B;  4CHS A;  3ZVJ A;  2C1Y A;  3I6A A;  1OYJ A;  2J9H A;  1I9D A;  1XPV A;  1MDK A;  2K8S A;  2DBC A;  3F6F A;  1JZW A;  4BWQ A;  3KXO A;  4KSM A;  3U6V A;  1AUC A;  5HFK A;  3QMX A;  4MA9 A;  4XCS A;  3HDC A;  3WGE A;  4GSN A;  4YAP A;  4BWS A;  1THO A;  3GH6 A;  4GQC A;  1EOH A;  4BA7 A;  4ID0 A;  4BL7 B;  3W6G A;  3TUE A;  2V6K A;  3Q18 A;  2YNX A;  3NZN A;  5G5F A;  5L71 A;  3HVV A;  2CX3 A;  4NXI A;  5JWR B;  3UVH A;  4KW6 A;  2MBS A;  2LS5 A;  3ZL5 A;  2R0P A;  3PR8 A;  4KDX A;  4L5L A;  1G6W A;  3KD0 A;  3FZ9 A;  3HA9 A;  3N5O A;  1V40 A;  5A4U A;  2B5E A;  4YKG A;  3R3E A;  3P90 A;  1M7T A;  2QA1 A;  1B4P A;  5HFG A;  2LUS A;  2GST A;  1FVJ A;  3HVX A;  2OA7 A;  5BRT A;  1YJ6 A;  4HEA 2;  5CRG A;  1FVK A;  3LWA A;  3KIJ A;  4IKH A;  2VCV A;  2HRK A;  4XIH A;  3D22 A;  2DJK A;  2UZ8 A;  4BVY B;  3EVI A;  1ERU A;  4I6X A;  2AUV A;  5DJM A;  3MIX A;  4K7N A;  1T4Z A;  2V41 A;  1J9B A;  1F3A A;  5ECO B;  5DQY A;  1GL8 A;  4GTU A;  4WKW A;  3LOR A;  1SD8 A;  3WGX A;  4MNN A;  3CTF A;  1GNE A;  2B7K A;  1ZZY A;  1NHO A;  4P3Y B;  4L0W A;  2RM6 A;  4MF5 A;  1G6Y A;  1ILO A;  3F4R A;  2N5A A;  5LNK e;  1TOF A;  1T7P B;  3IPZ A;  3EU3 A;  3FK8 A;  3VWV A;  1WPI A;  1TW9 A;  1TRU A;  3C71 A;  1QGV A;  5IMV A;  5F07 A;  3DVW A;  3EMP A;  4NAX A;  2YWO A;  3UVT A;  1Z7P A;  3CTG A;  1RW1 A;  13GS A;  2XC2 A;  1F2E A;  1R7H A;  3BD2 A;  4WXT A;  4XS1 A;  1QMV A;  1TU7 A;  5LD0 A;  3VWW A;  3RAZ A;  1MDI A;  3SWL A;  1BAY A;  1VRS D;  1Y6E A;  1OE8 A;  2O8V B;  3ZML A;  3M0F A;  5IOW A;  5J9C A;  1AW9 A;  3O76 A;  2VL3 A;  4FYU A;  1TI1 A;  1VF3 A;  3LEF A;  3EUR A;  4GSS A;  14GS A;  3QR6 A;  2R0C A;  4RI7 A;  4AJ7 A;  2BTO T;  1YF0 A;  4PXO A;  2HSH A;  3IR4 A;  1GLQ A;  2HE3 A;  3A2W A;  2PVQ A;  3IDV A;  4Q5Q A;  2L59 A;  2P31 A;  1EP7 A;  2YV9 A;  1KNG A;  2P0G A;  4YAV A;  2QC7 A;  2MMN A;  4TR0 A;  2NBS A;  1FHE A;  2B5Y A;  2FCH A;  3HJP A;  1ZMA A;  2EIQ A;  3TJK A;  1M2B A;  3H1N A;  2H1D A;  1TRS A;  1X5D A;  1PN0 A;  4L8E A;  2ZUP A;  5D9W A;  4EKZ A;  1ZOF A;  4GWR A;  4NHW A;  3VUR A;  4NV2 A;  2H73 A;  3KTL A;  1SK1 A;  4DSS A;  4CY8 A;  4EF0 A;  3KGK A;  4EO3 A;  4POM A;  1O81 A;  2JZT A;  5J5N A;  2IWT A;  1Z6M A;  4OD7 A;  4MJC A;  3PPU A;  4K0G A;  5GAN D;  5FWG A;  1SJZ A;  5CAX A;  5HR3 A;  1A2J A;  2O85 A;  2M46 A;  2YN1 A;  2H6X A;  3GN3 A;  2DLX A;  1YZX A;  3O3T A;  1GP1 A;  2FWF A;  2LKU A;  2LRC A;  5ENU A;  3MAK A;  2MYG A;  1QK8 A;  3MDK A;  1ERT A;  2B1L A;  5ABR A;  2GSR A;  3A5W A;  2E2G A;  4PQI A;  1SEN A;  4XRD A;  2B1K A;  3GUR A;  2K6V A;  2E2M A;  2GQM A;  2FUG 2;  4I2U A;  2REM A;  5IPG A;  2LJR A;  3P8W A;  3QFB C;  2OE0 A;  3RHB A;  4NHZ A;  1Z7R A;  1GH2 A;  4IS0 A;  1C72 A;  4JZQ A;  4BL7 A;  1ERV A;  2DJ2 A;  2BMX A;  3M8N A;  3S9F A;  1VF4 A;  4ML1 A;  2FA4 A;  2DKI A;  2OBI A;  3GHA A;  5HR2 A;  4I2T A;  2PN8 A;  4KB3 A;  5KOW A;  1EEM A;  4DEJ A;  3D21 A;  2VD0 A;  3WT2 A;  2GLR A;  4K2X A;  2A2P A;  3L78 A;  4IEL A;  2R0G A;  5IMA A;  4ZL7 A;  2FNO A;  4EUY A;  2RUF A;  1ZYN A;  3TJG A;  2FWG A;  2LV3 A;  3APS A;  4JR6 A;  3GRX A;  3TRQ A;  2IMD A;  2IFQ B;  1T3B A;  4L5O A;  3D4M A;  2FA8 A;  3QAW A;  1F6M C;  4OCE A;  4IJI A;  1IYI A;  3CXG A;  3QAG A;  1V98 A;  3QCP A;  4HI7 A;  4HU9 A;  2PMT A;  5D9X A;  1G0T A;  4KGI A;  4MAB A;  4OFT A;  4QL9 A;  2GSQ A;  2ALB A;  2OKA A;  3FR6 A;  2FY6 A;  5JCG A;  5DCH A;  1SL2 B;  1X5E A;  3CSJ A;  1XW5 A;  5ID2 B;  5IIZ A;  4YQV A;  2VOC A;  2YWM A;  1GTA A;  2HRN A;  1FOH A;  4ZIL A;  1FG4 A;  4KND A;  5J3R A;  5GSS A;  1EV9 A;  1EV4 A;  3FHK A;  3IC4 A;  3LGC A;  5IMZ A;  3P7X A;  1NHY A;  4JBB A;  3TKP A;  20GS A;  3G9B A;  2JSZ A;  3FR9 A;  4GRF A;  3WGD A;  3GUS A;  22GS A;  4BVX B;  3F3Q A;  2RLI A;  1W4V A;  4HJM A;  2IJY A;  3MNG A;  5KN3 A;  1GSD A;  2R2J A;  5KN2 A;  2QA2 A;  4IN0 A;  3FY7 A;  4PUA A;  3ERG A;  2HI7 A;  5H5S A;  1AC1 A;  2R37 A;  4ZBB A;  2ON5 A;  4MP4 A;  5LCZ A;  3FZ5 A;  3WD6 A;  1HYU A;  3GX8 A;  4N10 A;  2IPA A;  1Q4J A;  3F0I A;  3HHV A;  3JCM L;  4MH3 A;  2VLT A;  4WEY A;  1WE0 A;  3KMN A;  2GTU A;  3DML A;  3QD9 A;  3DYR A;  3D5J A;  1SJI A;  5E59 A;  1SKS B;  1OC9 A;  1HNC A;  2WGR A;  1G7O A;  3FR3 A;  5CRE A;  3UOM A;  4N0Z A;  1TK0 B;  2VCQ A;  3GST A;  4ECJ A;  4KE3 A;  3CYN A;  3AY8 A;  3GKM A;  2HRA A;  3GTU A;  5ECI B;  1OC3 A;  1A0R P;  1RQM A;  1WOU A;  4PUF C;  3UL3 A;  1GRX A;  3ZIV A;  3CRU A;  4ZB6 A;  2E0Q A;  4G0L A;  5B7C A;  1Z9H A;  1XWG A;  2X8H A;  4V2M A;  2CAI A;  1DE1 A;  2G2Q A;  4TRX A;  4ISD A;  3GKN A;  2VD1 A;  2HZE B;  3APO A;  1OKT A;  1EP8 A;  4GXZ A;  5G2Z A;  3CSH A;  2AHE A;  2XPD A;  3F9U A;  4IGJ A;  2NPB A;  3ZFB A;  1H75 A;  3KP9 A;  4PNG A;  2LNS A;  3HXS A;  4CY6 A;  2A2S A;  4GF0 A;  3I9V 2;  3ZIT A;  3UAP A;  4AGS A;  2HSY A;  4TR1 A;  1WJK A;  3HKR A;  5B8B A;  4ZBA A;  1A23 A;  4D73 B;  2LEG A;  2HYX A;  3N9J A;  4AF2 A;  5HQP A;  3GKK A;  4F03 A;  5JWQ B;  2PGT A;  7GSS A;  4LL4 B;  4EC0 A;  1ON4 A;  4MZC A;  4QL7 A;  1K0O A;  2YZU A;  4Q5R A;  2V6O A;  1XWK A;  3GMF A;  3A5I A;  2V32 A;  1GLP A;  3UBL A;  2JZS A;  1XXU A;  2FWE A;  1MD4 A;  1U88 A;  1GNW A;  4MDC A;  4XRA A;  2O7K A;  4PTS A;  2IME A;  1XFL A;  3GA4 A;  1ZGN A;  3UMA A;  4TKY A;  1GTI A;  5D9V A;  4EL1 A;  4O7H A;  3ZRD A;  1WP0 A;  2C3Q A;  1K0B A;  2FHE A;  3IOS A;  2JL4 A;  4TR3 A;  1UN2 A;  4JED A;  4KF9 A;  4X43 A;  3GL5 A;  2AV4 A;  2YJH A;  1K0A A;  5CYY A;  2LJA A;  1GUH A;  5KN1 A;  6GSV A;  3D6I A;  1LBK A;  3K8N A;  1OKD A;  2C0F A;  4PNF A;  17GS A;  4I97 A;  1AQV A;  3C1S A;  3VI5 A;  4N0V A;  4KH7 A;  1ACV A;  5EL8 A;  3KP8 A;  2OE3 A;  6GSY A;  2LQO A;  2H8L A;  3UBK A;  3M9J A;  5DAK B;  4HZ4 A;  3EC3 A;  5GZZ B;  5CRD A;  3ZFL A;  1K0C A;  5BMU A;  1M9A A;  3QAV A;  1B48 A;  1TU8 A;  5F0G A;  2L4Q A;  4JU5 A;  1O73 A;  2L5O A;  1Q98 A;  2R5G A;  4Z2U A;  4IBP A;  2N5B A;  1ZYP A;  3HCZ A;  3BOA A;  2H74 A;  4MZW A;  1F37 A;  3MYD A;  5DVB A;  4DVC A;  1X0R A;  2H0G A;  5JCW A;  5G30 A;  4FIW A;  1Z5Y E;  8GSS A;  5DCG A;  1CQH A;  1XW9 A;  1M2D A;  2HNL A;  4X0X A;  1WWJ A;  3KJY A;  5E4W A;  4TXO B;  2CX4 A;  5ID2 A;  2N5F A;  3OR5 A;  1HNB A;  4PX1 A;  4L0U A;  5G1K A;  1JZO A;  1UVZ A;  1AAZ A;  5IO0 A;  4G0K A;  2O87 A;  4ICY A;  1G7E A;  2DJ3 A;  1MD3 A;  2A4V A;  4GST A;  2GT5 A;  4Z2R A;  2YPM A;  3VPQ A;  2HLS A;  2VLV A;  1ZYE A;  5EY6 A;  3M1G A;  4G9H A;  5C00 A;  1HNA A;  4DSR A;  2XHF A;  1PL2 A;  2WCI A;  3TDG A;  2YWN A;  3TKS E;  5KEJ A;  4GCI A;  2KLX A;  1F3B A;  3QDN A;  3A2X A;  3LYK A;  4BVX A;  1B4Q A;  4ZXG A;  1TK5 B;  1URM A;  2FWH A;  4K7O A;  1XOB A;  1A0F A;  1KBN A;  2R6K A;  2LNT A;  3IK7 A;  1TJD A;  2O89 A;  2CV4 A;  3TGZ A;  2CZ3 A;  1CQG A;  1YEX A;  4F0C A;  2H70 A;  3ZRE A;  2B7J A;  1K3Y A;  4ZB9 A;  4A5P A;  1WRY A;  1LJR A;  1GTU A;  1XBS A;  4IVF A;  3SBC A;  2VCX A;  1TDI A;  2PER A;  5ECR B;  1NSW A;  3L9V A;  4WBR D;  3TRP A;  3TJF A;  4EE0 A;  2H1A A;  4XS4 A;  3PGT A;  2CVB A;  4OMV A;  1GUK A;  2IIY A;  3W8S A;  1NM3 A;  1QFN A;  2YCD A;  3D4T A;  1M99 A;  5DQS A;  1YKC A;  4LMW A;  3KTB A;  2B3S A;  1OE7 A;  2X8G A;  4O32 A;  1KEB A;  1SJ6 A;  4K7I A;  1VF1 A;  1BQ7 A;  2CAQ A;  5ECS A;  1EGO A;  2H1G A;  1GWC A;  1QXH A;  1X9S B;  4PGT A;  4N30 A;  2F9S A;  1A8Y A;  1X5C A;  5J4U A;  3KCM A;  2KOK A;  2K18 A;  2RUE A;  4G19 A;  3GL3 A;  5A5K A;  3DGQ A;  2DJ1 A;  4TR4 A;  1TP9 A;  2GZP A;  4FO5 A;  5C04 A;  1XWA A;  3H8Q A;  2CZ2 A;  4IJ3 A;  6GSU A;  2KP2 A;  1EOG A;  2PPT A;  2QSI A;  3CMI A;  2F3M A;  3FKF A;  1O85 A;  3GSS A;  1PX7 A;  3HZ8 A;  2WDU A;  4MJA A;  3O6T A;  2VAF A;  3KEB A;  1NW2 A;  2VCZ A;  2EIR A;  1R5A A;  5B6N A;  3UJ1 A;  1PL1 A;  4USS A;  1A8L A;  1VGL A;  1JHB A;  2LST A;  5IQY A;  4ECC A;  3IV4 A;  1AQX A;  1QQ2 A;  3ME8 A;  5D96 A;  1FAA A;  5G31 A;  1AXD A;  1BED A;  3HVS A;  2HXK A;  1U3I A;  4BVY A;  4KDU A;  2DIZ A;  1SK0 A;  5J9B A;  2VIM A;  4TN8 A;  1K3L A;  4K5R A;  4ECI A;  1Y25 A;  4ZL9 A;  5HR1 A;  1GSY A;  3F4T A;  4HQZ A;  4IW9 A;  2MBT A;  1B8X A;  5IMF A;  3E0U A;  5FT3 A;  1BYE A;  1THX A;  2JAC A;  3V1W A;  4KA0 A;  3L9S A;  3A3T A;  1U3A A;  3PIN A;  4GQF A;  2A2R A;  2XPE A;  1PSQ A;  3H79 A;  1F9M A;  3VK9 A;  5D9T A;  2P5Q A;  4O5Q A;  4OFM A;  2VCT A;  2R4V A;  1V9W A;  3TJJ A;  3BBY A;  3FW2 A;  5H5Q A;  3IAM 2;  4FYC A;  3IRA A;  3VFI A;  3HJM A;  2IN3 A;  5DAK A;  2JAD A;  3RBT A;  2NVL A;  3LW9 A;  2L57 A;  3CBU A;  3TRX A;  1YY7 A;  3ZMK A;  4OCF A;  2IMK A;  2V1M A;  1DSB A;  2MZC A;  12GS A;  2XBQ A;  2C0E A;  4EIP A;  1SYR A;  1GTB A;  2H72 A;  3EYT A;  5JCU A;  2ZCT A;  4ULX A;  1Z3E A;  2RII A;  2HSM A;  4Z2T A;  4JE1 A;  4H86 A;  1AIU A;  5AIS A;  1TI3 A;  4MH2 A;  1ML6 A;  2YV7 A;  2VO4 A;  2NDO A;  1PKW A;  2H30 A;  2P5R A;  5A4W A;  5F8B A;  2ZNM A;  2B5X A;  3Q6O A;  1SU9 A;  2WB9 A;  2HZF A;  1QUW A;  1DBY A;  4TXO A;  3M9K A;  3ZIJ A;  1O7U A;  4MK3 A;  3EMX A;  2H76 A;  4Q5N A;  1XVW A;  3FZA A;  4OO5 A;  4WR5 A;  4MJB A;  2XBI A;  2D2Z A;  1TRV A;  2K9F A;  2PBJ A;  2AB6 A;  6GSW A;  3G7I A;  3Q19 A;  5DJL A;  4V1A p;  1O8X A;  4LLR A;  2C80 A;  1SL0 B;  2GVP A;  1XVQ A;  2KP1 A;  4O92 A;  2H0H A;  3HD5 A;  1EWX A;  6GSX A;  2M80 A;  1XWB A;  2J23 A;  1GUM A;  4DSS B;  1PKZ A;  3NOF A;  1GSE A;  3GH9 A;  3DWV A;  4YH2 A;  4OO4 A;  4GLT A;  4PQ1 A;  2YJ7 A;  4WBJ A;  2I81 A;  4TW5 A;  2ES7 A;  4TVE A;  4XS6 A;  1V2A A;  3F63 A;  3HY2 A;  16GS A;  1TTZ A;  3J7Y k;  1PGT A;  4I8B A;  2H66 A;  3E9J B;  1PN9 A;  2DJ0 A;  2E7P A;  1OVN A;  1JLW A;  4HOJ A;  2VCW A;  3LQ7 A;  3TKQ A;  5HR0 A;  2BJX A;  5AN1 A;  1YEP A;  3C1R A;  1XOA A;  1XWC A;  4G2E A;  3EWL A;  2QKE A;  10GS A;  2VLU A;  4IHU A;  5ELG A;  2GS3 A;  4KUN A;  3G7J A;  1TK8 B;  1XCC A;  4K0N A;  1FB0 A;  3E3E A;  3TOU A;  2LTK A;  2K8V A;  3W8J A;  1ABA A;  1PA3 A;  4IP1 A;  4EVM A;  3WYW A;  3KH9 A;  3IHQ A;  2H75 A;  1FO5 A;  4HQS A;  1O8W A;  2WFC A;  5COH A;  2H71 A;  1K0N A;  1M9B A;  4BPY A;  1EGR A;  3DRN A;  2PVO C;  3FRC A;  2VL2 C;  1RK4 A;  2GQL A;  2IMF A;  3RPN A;  5JWO B;  1K0D A;  1SKR B;  4V2N A;  5DBQ A;  2L4C A;  4J56 E;  1ZL9 A;  2CQ9 A;  3TB2 A;  1S3C A;  2GDR A;  3UEM A;  2LJK A;  4KCA A;  2H01 A;  3DKS A;  2HRF A;  1IYH A;  1OAZ A;  1MEK A;  3TKR A;  1M2A A;  1GSF A;  4POL A;  1DUG A;  11GS A;  2DSA A;  1M0U A;  3EU4 A;  5DDL A;  2HT9 A;  4MF6 A;  4I5Q A;  1U87 A;  1J0F A;  2F51 A;  2L6C A;  5CO3 A;  3DXB A;  1EZK A;  1ERW A;  5AIX A;  4KSO A;  1PRX A;  4F2I A;  1FW1 A;  1PQN A;  1Z6N A;  5G1L A;  2MMA A;  5ECN B;  1HQO A;  2LQQ A;  3D0Z A;  4J2F A;  4HUA A;  1VF2 A;  4HS1 A;  2H19 A;  2GSS A;  1R4W A;  1K0M A;  2PU9 C;  3KZQ A;  5CNW A;  3DEX A;  3GV1 A;  2VM2 A;  3F3R A;  4RI6 A;  2IFQ A;  3IA1 A;  2HFD A;  3U5R E;  4G10 A;  1GSU A;  4WR4 A;  5EVO A;  2QGV A;  5CP1 A;  4F0B A;  2RM5 A;  3PH9 A;  5IOX A;  4ECB A;  4ZL8 A;  2WUL A;  3RHC A;  3QFA C;  5ECQ B;  3TKS A;  3MWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...