3ZVJD

Crystal structure of high molecular weight (hmw) form of peroxiredoxin i from schistosoma mansoni
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
168
structure length
168
Chain Sequence
MVLLPNRPAPEFKGQAVINGEFKEICLKDYRGKYVVLFFYPADFTFVCPTEIIAFSDQVEEFNSRNCQVIACSTDSQYSHLAWDNLDRKSGGLGHMKIPLLADRKQEISKAYGVFDEEDGNAFRGLFIIDPNGILRQITLNDKPVGRSVDETLRLLDAFQFVEKHGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN PEROXIDASE
publication title Moonlighting by Different Stressors: Crystal Structure of the Chaperone Species of a 2-Cys Peroxiredoxin.
pubmed doi rcsb
source organism Schistosoma mansoni
total genus 33
structure length 168
sequence length 168
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00578 AhpC-TSA AhpC/TSA family
D PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zvjD00
5B6NA 3UBLA 2HRFA 2YCDA 3WT1A 2J9HA 3BD2A 1SD8A 4GLTA 4XS4A 3H93A 1J0FA 3US3A 1WRYA 2C3TA 1JLVA 3TKSA 4IJIA 1QFNA 2H70A 2ALBA 1AXDA 1NM3A 1GSDA 1T3BA 2XPEA 2LTKA 2HNLA 2YJHA 3VLNA 4MCUA 2VCXA 1TOFA 1AUCA 1B8XA 1UC7A 1YY7A 4ZBBA 4NV2A 1K3OA 3TGZA 3TJBA 1HNBA 1GUKA 4FYBA 4KDYA 2BJXA 4GWRA 2GZZA 3GX0A 2KP2A 4RUVA 3FHKA 5JCWA 1GSQA 2H71A 4BVYA 1GSSA 1U3AA 3HKRA 3LORA 4XIHA 2VOCA 1UN2A 3WGDA 4YQVA 1Z6MA 1A2JA 1MDIA 1XPVA 3D6IA 3ZRDA 1XBSA 4IHUA 4TVEA 4IP1A 2NBSA 2B1KA 2H0GA 3I69A 4PX1A 2X8CA 2CT6A 2X8GA 4P3YB 4HU7A 3UBKA 3EYTA 3UARA 3LYKA 2L4QA 4EC0A 1EZKA 2R2JA 2XBQA 1NW2A 3TRQA 10GSA 1A23A 4AJ8A 3ZLPA 3ED3A 5CRHA 1K0OA 4WR4A 1G6YA 2GGTA 4WETA 1DUGA 2MMNA 5CP1A 3L0HA 4JZQA 4K7NA 1K3YA 4NHZA 2X64A 4D73A 2VM2A 2F8FA 3TJKA 5J4UA 5G1LA 1SL1B 1FOVA 1M9AA 4N10A 1JFUA 2CX4A 4YAVA 1ERWA 1RQMA 1X9MB 3J7Yb 3RDWA 1FO5A 3KXOA 3QR6A 3I9V2 3HDCA 1SKSB 4L0WA 5DDLA 1K0CA 5J9CA 1GTIA 3Q74A 4F2IA 3MSZA 2X8HA 3QAGA 1V98A 5DALA 1GLQA 3M8NA 5AGYA 1GP1A 5DQSA 1PX6A 4MH2A 5G30A 5AIXA 3LXTA 2I81A 3F8UA 3EU4A 2FWGA 3FY7A 4MA9A 2LJRA 3ZMLA 3ZTLA 1F3AA 2H0HA 4MJBA 1GL8A 5DVBA 5IO2A 4MLYA 3FKFA 3IOSA 1AQVA 4ACSA 1SYXA 3E9JB 4ZBAA 2E2GA 2WDUA 1H75A 3UVTA 2G2QA 4LA1A 2VO4A 4HZ4A 4HDEA 2YNXA 2K18A 5B6MA 2XPDA 2H01A 5IMAA 1M9BA 2VM1A 7GSSA 2WZ9A 4MF6A 4IQAA 3GH9A 2YV9A 3W8JA 4Q5RA 3I6AA 1XZOA 1NHYA 4DSRA 2E7PA 3MWHA 4OO4A 4HEA2 2A2RA 5ECMB 3GTUB 3LFLA 5ABRA 3A2VA 2YJ7A 2MZCA 2JSYA 3LYPA 3M9KA 2FLSA 2HZEB 2VD1A 1JHBA 2VCZA 2WB9A 3RAZA 4WBRD 2LS5A 1AW9A 1LJRA 5CRWA 2I1UA 4TR3A 4MJAA 2C3NA 3UEMA 3J7Yk 1PD21 1SK0A 3QPMA 4PURA 1Z7PA 2M80A 3LSZA 4MZCA 3QDNA 4FYUA 2AUVA 1G7EA 2AV4A 11GSA 2H19A 2O7KA 4IP6A 2A2SA 4HI7A 4TW5A 2DMMA 3F9UA 5D8IA 5A4UA 1A2LA 1OYJA 22GSA 4K0NA 3UAPA 3ZFLA 3BBYA 1WE0A 5FT3A 2P5QA 2XC2A 1JZRA 2CX3A 3A2XA 2FD3A 3QAVA 2XBIA 2MYGA 4YQMA 5CO3A 1T4ZA 2GQMA 1GSFA 3IC4A 1V58A 3TKRA 4EVMA 3CYNA 2WS2A 2IL3A 3EMXA 2L59A 2H6YA 2CQ9A 1BJXA 1T1VA 2NVLA 5E4WA 4EDZA 1THXA 1YKCA 2VL9A 4JEDA 3BCIA 1SJZA 4Q5FA 2JADA 2LEGA 3GKNA 1CQHA 1DE2A 1H4OA 5C00A 2HZFA 5H5QA 3QAWA 5ECPB 1K0MA 4LLRA 3P8WA 4F9ZA 1IYIA 2LV3A 1K0DA 3Q6OA 3MDKA 1S3CA 3HZ4A 1ZGNA 3IAS2 3GL5A 4HZ2A 1ON4A 2AYTA 2FWEA 4ZB9A 1FB6A 1YEPA 3QD9A 5D73A 1DE1A 1A8LA 5HQPA 2TRXA 3KMOA 2RIIA 3V1WA 2IPAA 4K8MA 4KGIA 2YP6A 4NWYA 3CTGA 2O87A 3CSIA 4KA0A 6GSUA 4I97A 4K6XA 2H6ZA 1QMVA 1WOUA 1A0FA 5ECLB 2MBTA 1GWCA 4ECJA 2LSTA 4KX4A 4L0UA 1XOBA 3L9SA 4GCIA 4N0VA 1GSEA 4TR1A 4NHWA 4MF5A 3L78A 4POBA 2N5BA 3VWXA 2OADA 3FRCA 5G1KA 2PPTA 2DJ0A 2I4AA 1YJ6A 4AJ6A 2MMOA 2F9SA 3HJPA 4D73B 3BOAA 3AY8A 2HLSA 1Y25A 3FYGA 4WF4A 2CVBA 2FCHA 2YV7A 1F2EA 2LJKA 4PUAA 3Q18A 2MBSA 2GSQA 4DSSB 3FR3A 1AQXA 1ZZYA 2GSRA 2GQLA 1OKTA 4XHMA 3IA1A 4KSOA 4JRRA 2R4VA 3D0ZA 4OCEA 2AB6A 2LKUA 4XTSA 1M2DA 1GUMA 3GA4A 5IPGA 1TRSA 2C0FA 2BMXA 3ERWA 3DIEA 1SL0B 3K8NA 5D93A 1T00A 1VRSD 1R5PA 2OA7A 5IOXA 4MP4A 5ID2A 1J9BA 1UVZA 2H1BA 3GSSA 3ZIJA 3PGTA 1A0RP 1R26A 2P5RA 3GX8A 1XWBA 1YDKA 5DJLA 5FHIA 4HUAA 6GSSA 4HQSA 1TK8B 1I5GA 2FA8A 3PH9A 3KCMA 4AF2A 2G0FA 4HS1A 2E0QA 1Y6EA 2K8SA 1WIKA 3GL3A 2JU5A 2CV4A 5IMVA 3ZVJD 4CDOA 5ECIB 5IO0A 1GRXA 1PKZA 4ECBA 2YWOA 3GSTA 1R7HA 1TU8A 4V2MA 1VF4A 2X99A 4Q5QA 1ILOA 5INYA 3CTFA 1FB0A 2EC4A 2Z9SA 1V57A 2OE3A 2VD0A 3HHVA 4H86A 3WGEA 1XWKA 2HXKA 2H66A 3G7YA 3ERGA 3L9UA 3EC3A 1O6JA 3C1RA 4FH8A 5G31A 1TI1A 3IBHA 1SU9A 4RQRA 2C8UA 1KNGA 2LQOA 2WCIA 3APSA 3R2QA 1TI3A 1J08A 2VLVA 3CXGA 4WBJA 3IE3A 1TRVA 2L4CA 1OC9B 2REMA 3KJYA 2BTOT 5G2ZA 4L5OA 4HOJA 1G7OA 4PNFA 3ZMKA 4DEJA 3D21A 18GSA 4EKZA 2J23A 3HA9A 3ZL5A 1EV9A 2F51A 2L5LA 1MEKA 6GSTA 3UIWA 1XW5A 2FWFA 2DIYA 5AIVA 4BL7A 3VPQA 2CZ2A 3NIVA 3FZ4A 5HR0A 1ZOFA 4O32A 1E6BA 2AAWA 1FAAA 4IELA 4E8HA 4KNDA 2K9FA 3LJRA 2KP1A 4AJ7A 3RHCA 4K9ZA 5ECHB 4X0XA 3F0IA 2JACA 4OWYA 3TJFA 2C0EA 4HJ2A 2V2GA 2V41A 4YQUA 2GT6A 2K8VA 2DC5A 5CRGA 2GTUA 4GSNA 4KH7A 1GH2A 4ID0A 4IVFA 1E2YA 1RW1A 4GSSA 2FGXA 3TJGA 5D9WA 2GDRA 1OAZA 1FVJA 4POLA 3A3TA 2R5GA 3O6TA 3HY2A 3VI7A 5CREA 2YN1A 2B6MA 3WYWA 3EE2A 1PA3A 2V1MA 4NAXA 2LQQA 1YF1A 2V32A 4HJMA 1IYHA 3GKKA 5F8BA 3WT2A 1TW9A 4DSSA 2P0GA 2ZCTA 1FG4A 2NDOA 5A5KA 3N5OA 2H1DA 2QGVA 3RBTA 5J9BA 1AIUA 4ZB8A 3TCOA 1T4YA 3G7IA 5JWQB 4YAPA 4IBPA 4PGTA 3CBUA 4EXJA 4GXZA 3G9BA 4TR1B 2H1GA 3HXSA 4F03A 1MD3A 2LJAA 4KUNA 5KN0A 1U3IA 3FZAA 1XVQA 3CRUA 4I2UA 4J2FA 3SWLA 1ACVA 4ZIJA 1YKAA 2WFCA 3TOTA 1A8YA 2AJQB 2PERA 1BX9A 2CA8A 5ECNB 1KBNA 5HR3A 1XWGA 2R6KA 2LUSA 4RI7A 3KEBA 2O8VB 4MJCA 2KLXA 3ME8A 5GSTA 1TXXA 4ZL9A 1X9SB 2E2MA 5IMDA 2H72A 2HI7A 1EP8A 4K0GA 1QUWA 5GAPD 4GQFA 4I8BA 3M9JA 3BCKA 2B7JA 2DJKA 5DCGA 5KEJA 4N11A 4DSQA 3WD6A 1Z5YE 1EV4A 3QOUA 3H1NA 4O5RA 1QXHA 9GSSA 2H6XA 1V40A 1M2AA 17GSA 1EWXA 4QL7A 4WKWA 2PU9C 3ZREA 5J5NA 3F4SA 5ID2B 3QFBC 5EVOA 1G6WA 3H8QA 2H75A 3PINA 3CMIA 3ISOA 3IRAA 2HE3A 1T8EB 2HT9A 3CSHA 4JU5A 4KAEA 4PQHA 1JZOA 3HYPA 1EEJA 3GKXA 3KP9A 3TRPA 5IQYA 1EGRA 4PXOA 5HFIA 3KM6A 2B5EA 2H30A 1SJIA 1AC1A 1HNCA 6GSYA 2EIQA 2IJYA 2C0DA 1V9WA 3LGCA 4ZL8A 1TK0B 4JR6A 1OC9A 3F63A 19GSA 2RUFA 3FZ5A 2OACA 3GNJA 1XXUA 1O7UA 1YQ1A 2DJJA 1M99A 3D22A 1PL2A 3FK8A 3M0FA 4ML1A 1GNWA 1USBA 1VF1A 5DJMA 3ZFBA 4OFNA 1THOA 3N9JA 5J3RA 1GTAA 1F9MA 3APOA 4BA7A 3HJOA 2FY6A 4IW9A 1A2MA 6GSVA 3A2WA 1TKDB 2JZSA 4XCSA 4V2LA 4KCEA 3E0UA 5HFKA 3QCPA 2AHEA 4PNGA 3C71A 3HZ8A 2JZRA 3ME7A 1CQGA 2L6CA 2R3XA 3O76A 4J56E 4IS0A 1OE7A 3DXBA 3VWVA 2OBKA 3P2AA 1GTBA 5HR2A 3U5RE 2GVPA 3GUSA 3M1GA 5L71A 1UA5A 4RI6A 4FO5A 1SKWB 3EU3A 2EIRA 1GSUA 1JLWA 4NV5A 1U88A 1SKRB 1VF3A 2RM6A 2F3MA 5J41A 2TIRA 3C73A 4POKA 1O8WA 1C72A 3TUEA 4MPGA 1GSYA 1SYRA 2V6OA 1JZWA 4MH3A 3VI5A 4QQ7A 4LL4B 2LNTA 5DQYA 3DVWA 3FEUA 3E3EA 5LCZA 1DBYA 4X1UA 3F6DA 5DCHA 2LRTA 2R37A 4GSTA 5F05A 4WEYA 2MMAA 2H8LA 3KMNA 4DVCA 2DJ2A 1GULA 1OKDA 3TRXA 5ENUA 2DJ1A 5C04A 13GSA 5D96A 1TTZA 3D4TA 4FIWA 1DSBA 3BJ5A 1QQ2A 2VAFA 4I2TA 1WP0A 5JCGA 2QKEA 2PBJA 2KUCA 2L6DA 4LMWA 2IMFA 1WPIA 3RHBA 3KH9A 2JL4A 1G0TA 1NHOA 1SL2B 3F4RA 3UL3A 3W6GA 2XHFA 4QL9A 3TDGA 5EPFA 1FVKA 4PQ1A 2M46A 1BQ7A 5F07A 2IN3A 5AISA 3S9FA 3F6FA 3CSJA 1EGOA 2FWHA 1X5CA 2VL2C 2CVDA 2CZ3A 3DVXA 5D9VA 2HSYA 2PWJA 1GUHA 2HRNA 2K6VA 3TKPA 2DMLA 3IV4A 3TB2A 2GZPA 3HCZA 3NOFA 5A4VA 2LRCA 5AN1A 2RM5A 1Q4JA 4XS6A 3CRTA 2FA4A 1ABAA 4GQCA 3JCML 1M7TA 3GFKA 3DMLA 3TKSC 3VWWA 4JR4A 1O73A 1BEDA 1QK8A 2ZUPA 2I3YA 1FW1A 2VLUA 1X0RA 1AAZA 1W89A 5IMZA 3QFAC 1Z9HA 3MAKA 5EY6A 4Q5NA 1F37A 2VCQA 4ZL7A 3EVIA 2WJUA 1ST9A 5LD0A 2OKAA 3ZYWA 4L8EA 3PR8A 4ZILA 2YZHA 4PUFC 1B48A 3HVSA 1MDKA 1XOAA 1K0NA 2H73A 2OJLA 3IK9A 1B4QA 20GSA 6GSWA 4FYCA 4CHSA 5JWOB 3D4MA 5F06A 1XW6A 4OO5A 5ECKB 2GS3A 2VIMA 4V2NA 1LBKA 4XRAA 1ERTA 1URMA 5ECRB 3OR5A 4NPBA 2D2ZA 4TXVA 3O3TA 1EEMA 2OBIA 3VFIA 1SENA 2RLIA 5DAKA 4WF5A 1YZXA 1PMTA 3KH7A 4TKYA 1SJ6A 1OC8A 5B8AA 1VGLA 3WGXA 4ISDA 3DRNA 2IMKA 5JCUA 4ECCA 3L9VA 3C1SA 4MZBA 1Z7RA 3P90A 1KTEA 2YPMA 2M72A 2C80A 5A4WA 1K0BA 2IMEA 4MF7A 2GZYA 2O89A 3UMAA 3UVHA 5DBQA 2YWIA 3IXRA 1FHEA 3GMFA 2DIZA 1AQWA 4RQXA 2YWMA 3DEXA 3DYRA 5FWGA 5GAND 1X5DA 4IQ1A 4KSMA 4F0CA 4ILFA 4OCFA 2C1YA 3ZIVA 3IPZA 2FNOA 5H5RA 4KB3A 5KN1A 2CAIA 1XIYA 5CAXA 1SK1A 2GSTA 5G5EA 1EOGA 4ULXA 4IKHA 2IFQA 2HFDA 3LQ7A 1PX7A 3F3QA 4MABA 1XCCA 1PL1A 1LU4A 4CW9A 3IK7A 3KIJA 4K7IA 4KDUA 1S3DA 3GURA 3LG6A 2PUKC 1YEXA 2YANA 2VCTA 2H0IA 1NSWA 4F82A 1KEBA 2GLRA 5GSSA 4JE1A 1ERVA 3GKMA 1S3AA 2VUPA 1TRWA 1TU7A 2DJ3A 2IWTA 5F0GA 3ERFA 3KTBA 5D9XA 5H5SA 3TJJA 3QMXA 3F3RA 2LRNA 3VWUA 3ZITA 1XW9A 1B9YC 3DWVA 4G19A 1TJDA 2LNSA 1K3LA 2N5AA 1GNEA 3IR4A 3RPPA 5IM9A 4EF0A 1XVWA 1OC3A 1TRUA 2KHPA 1BG5A 3GRXA 14GSA 1I9DA 4MPFA 1PN9A 2L5OA 4IN0A 1X9WB 3SBCA 1PGTA 4V1Ap 1MDJA 4BWSA 3C8EA 2CAQA 2WRTA 2YWNA 5COHA 1ERUA 4F0BA 2V6KA 2H1AA 2P31A 2NTOA 3IHQA 1TDIA 2FUG2 2N5FA 2C3QA 1ZMAA 4WR5A 3EURA 5EL8A 4Z7XA 2OE0A 4TXOA 1XWAA 1PKWA 1HNAA 5GZZB 5E59A 4I6XA 1R4WA 4MJEA 2ON7A 3FR9A 4GTUA 2CVKA 1F6MC 1MTCA 1HYUA 2GSSA 5CYYA 2PN8A 4O92A 2DLXA 1Z6NA 1ZCPA 1HD2A 3VK9A 2PVQA 4NMUA 2KOKA 3EMPA 4ZBDA 1Q98A 4K7OA 3KGKA 2DBCA 2QC7A 1ML6A 4TRXA 2H74A 4EO3A 1ZL9A 2C4JA 3KP8A 5B8BA 4KW6A 1WWJA 2PMTA 1SK2A 1MD4A 4KCAA 1EP7A 3FZ9A 3GHAA 3A5WA 4EDYA 3IAM2 4HQZA 3GIXA 2RUEA 3H4KA 4O7HA 1OE8A 4ZXGA 3KD0A 1OVNA 1M2BA 4N30A 3H79A 1M0UA 4X43A 5HFGA 4MDCA 1BYEA 5CRDA 1O8XA 2VCWA 2B7KA 1K0AA 1PRXA 4I5QA 2F8AA 3M3MA 1GLPA 2YOIA 5IMFA 2GQKA 3GYKA 1B9XC 5DAKB 2MMZA 4OMVA 4XS4B 1QGVA 4EL1A 4ECIA 2C0GA 3HJMA 4EUYA 3GH6A 3APQA 12GSA 1W4VA 2VL3A 5KN2A 2IMDA 3HVXA 1N2AA 4G9HA 1ZYQB 4YH2A 3NZNA 3RPNA 3GV1A 3MNGA 3U6VA 4ML6A 5ELGA 3ZZXA 2B1LA 1V2AA 8GSSA 3TKSE 4JBBA 3P7XA 2B5YA 4GRFA 5ECSA 5ECOB 3DD3A 2FHEA 4L5LA 4KDXA 4IJ3A 2ZNMA 4XRDA 5HR1A 1O85A 3VURA 2H76A 4K2DA 1XWCA 5IIZA 1Z3EA 4MMMA 1SD9A 4HU9A 4IGJA 2GT5A 1O81A 4G2EA 4J57E 3UJ1A 3L4NA 3DKSA 1YF0A 4MK3A 3GN3A 3LEFA 4GF0A 2YZUA 1WJKA 3C7MA 2HSHA 1T7PB 1U6TA 3HD5A 4BWQA 5ELAA 4EE0A 3F4TA 2PGTA 2IFQB 2L57A 4ZB6A 3ZVJA 4LL1B 1F3BA 1RK4A 1JZDA 2I9HA 4OD7A 3FW2A 4XS1A 5IPHA 4AGSA 4TR0A 1HQOA 16GSA 4TOPA 5G5FA 1X5EA 2HYXA 5B7CA 4TR4A 3IDVA 4POMA 3G7JA 2VLTA 2A4VA 3GTUA 2B5XA 4TN8A 5IOWA 2NPBA 5DALB 3EINA 3I43A 5CNWA 4BVXA 5JWRB 2HZEA 2PVOC 4OFTA 3FR6A 5LNKe 2EIOA 1B4PA 4PQIA 2ON5A 4KE3A 3TOUA 2OE1A 5ECQB 4MZWA 2VCVA 2IMIA 3HVVA 3KTLA 1TP9A 4N0ZA 5IMCA 5KN3A 2JSZA 1PSQA 1U87A 1WMJA 2QSIA 4OFMA 4BPYA 2WULA 2ES7A 4WXTA 1N8JA 3TKQA 4LMVA 2TRCP 3W8SA 4K1FA 2IIYA 2JZTA 1ZYEA 4NXIA 4TXOB 4V1Ag 1R5AA 3UOMA 1A24A 2O85A 2DSAA 3DGQA 3LXZA 3KZQA 2B3SA 4E8EA 3EWLA 1VF2A 3VPTA 1XFLA 2WGRA 6GSXA 5D9TA 1GTUA 1PQNA 1TK5B 3LWAA 2VL2A 1BAYA 3Q19A 1EOHA 3D5JA 4G10A
chains in the Genus database with same CATH superfamily
5B6NA 3UBLA 2HRFA 2YCDA 3WT1A 2J9HA 3BD2A 1SD8A 4GLTA 4XS4A 3H93A 1J0FA 3US3A 1WRYA 2C3TA 3MYDA 1JLVA 3TKSA 4IJIA 1QFNA 2H70A 2ALBA 1AXDA 1NM3A 1GSDA 1T3BA 2XPEA 2LTKA 2HNLA 2YJHA 3VLNA 4MCUA 2VCXA 1TOFA 1AUCA 1B8XA 1UC7A 1YY7A 4CY8A 4ZBBA 4NV2A 1K3OA 3TGZA 3TJBA 1HNBA 1GUKA 4FYBA 4KDYA 2BJXA 1ZYPA 4GWRA 2GZZA 3GX0A 2KP2A 4RUVA 3FHKA 5JCWA 1GSQA 2H71A 4BVYA 1GSSA 1U3AA 3HKRA 3LORA 4XIHA 2VOCA 1UN2A 3WGDA 4YQVA 1Z6MA 1A2JA 1MDIA 1XPVA 3D6IA 3ZRDA 1XBSA 4IHUA 4TVEA 4IP1A 2NBSA 2B1KA 2H0GA 3I69A 4PX1A 2X8CA 2CT6A 2X8GA 4P3YB 3LW9A 4HU7A 3UBKA 3EYTA 3UARA 3LYKA 2L4QA 4EC0A 1EZKA 2R2JA 2XBQA 1NW2A 3TRQA 10GSA 1A23A 4AJ8A 3ZLPA 3ED3A 5CRHA 1K0OA 4WR4A 1G6YA 2GGTA 4WETA 4FQUA 1DUGA 2MMNA 5CP1A 3L0HA 4JZQA 4K7NA 1K3YA 4NHZA 2X64A 4D73A 2VM2A 2F8FA 3TJKA 5J4UA 5G1LA 1SL1B 1FOVA 1M9AA 4N10A 1JFUA 2CX4A 4YAVA 1ERWA 1RQMA 1X9MB 3J7Yb 3RDWA 1FO5A 3KXOA 3QR6A 3I9V2 3HDCA 1PN0A 1SKSB 4L0WA 5DDLA 1K0CA 5J9CA 1GTIA 3Q74A 4F2IA 3MSZA 2X8HA 3QAGA 1V98A 5DALA 1GLQA 3M8NA 5AGYA 1GP1A 1PX6A 5DQSA 4MH2A 5G30A 5AIXA 3LXTA 2I81A 3F8UA 3EU4A 2FWGA 3FY7A 4MA9A 2LJRA 3ZMLA 3ZTLA 1F3AA 2H0HA 4MJBA 1GL8A 5DVBA 5IO2A 4MLYA 3FKFA 3IOSA 1AQVA 4ACSA 1SYXA 3E9JB 4ZBAA 2E2GA 2WDUA 1H75A 3UVTA 2G2QA 4LA1A 2VO4A 4HZ4A 4HDEA 2YNXA 2K18A 5B6MA 2XPDA 2H01A 5IMAA 1M9BA 2VM1A 7GSSA 2WZ9A 4MF6A 4IQAA 3GH9A 2YV9A 3W8JA 4Q5RA 3I6AA 1XZOA 1NHYA 4DSRA 2E7PA 3MWHA 4OO4A 4HEA2 2A2RA 5ECMB 3GTUB 3LFLA 5ABRA 3A2VA 2YJ7A 2MZCA 4BVXB 2JSYA 3LYPA 3M9KA 2FLSA 2HZEB 2VD1A 1JHBA 2VCZA 2WB9A 3RAZA 4WBRD 2LS5A 1AW9A 1LJRA 5CRWA 2I1UA 4TR3A 4MJAA 2C3NA 3UEMA 3J7Yk 1PD21 1SK0A 3QPMA 4PURA 1Z7PA 2M80A 3LSZA 4MZCA 3QDNA 4FYUA 2AUVA 1G7EA 2AV4A 11GSA 2H19A 2O7KA 4IP6A 2A2SA 4HI7A 4TW5A 4O5UA 2DMMA 3F9UA 5D8IA 5A4UA 1A2LA 1OYJA 22GSA 4K0NA 3UAPA 3ZFLA 3BBYA 5BRTA 1WE0A 5FT3A 2P5QA 2XC2A 1JZRA 2CX3A 3A2XA 2FD3A 3QAVA 2XBIA 2MYGA 4YQMA 5CO3A 2R0CA 1T4ZA 2GQMA 1GSFA 3IC4A 1V58A 3TKRA 4EVMA 3CYNA 2WS2A 2IL3A 3EMXA 2L59A 2H6YA 2CQ9A 1BJXA 1T1VA 2NVLA 5E4WA 4EDZA 1THXA 1YKCA 2VL9A 4JEDA 4KF9A 4EIPA 3BCIA 1SJZA 4Q5FA 2JADA 2LEGA 3GKNA 5KOXA 1CQHA 1DE2A 1H4OA 5C00A 2HZFA 5H5QA 3QAWA 5ECPB 1K0MA 4LLRA 3P8WA 4F9ZA 1IYIA 2LV3A 1K0DA 3Q6OA 3MDKA 1S3CA 3HZ4A 1ZGNA 4BL7B 3IAS2 3GL5A 4BVYB 4HZ2A 1ON4A 2AYTA 2FWEA 4ZB9A 1FB6A 1YEPA 3QD9A 1PFOA 3HVNA 5D73A 1DE1A 1A8LA 5HQPA 2TRXA 3KMOA 2RIIA 3V1WA 2IPAA 4K8MA 4KGIA 2YP6A 4NWYA 3CTGA 2O87A 3CSIA 4KA0A 6GSUA 4I97A 4K6XA 2H6ZA 1QMVA 1WOUA 1A0FA 5ECLB 2MBTA 1GWCA 4ECJA 2LSTA 4KX4A 4L0UA 1XOBA 3L9SA 4GCIA 4N0VA 1GSEA 4TR1A 4NHWA 4MF5A 3L78A 4POBA 2N5BA 3VWXA 2OADA 3FRCA 5G1KA 2PPTA 2DJ0A 2I4AA 1YJ6A 4AJ6A 2MMOA 2F9SA 3HJPA 4D73B 3BOAA 3AY8A 2HLSA 1Y25A 3FYGA 4WF4A 2CVBA 2FCHA 2YV7A 1F2EA 2LJKA 1M3JA 4PUAA 3Q18A 2MBSA 2GSQA 4DSSB 3FR3A 1AQXA 1ZZYA 2GSRA 2GQLA 1OKTA 4XHMA 3IA1A 4KSOA 4JRRA 2R4VA 3D0ZA 4OCEA 2AB6A 2LKUA 4XTSA 1M2DA 1GUMA 3GA4A 5IPGA 4BIKA 1TRSA 2C0FA 2BMXA 3ERWA 3DIEA 1SL0B 2R0GA 3K8NA 1T00A 1VRSD 1R5PA 5D93A 2OA7A 5IOXA 4MP4A 5ID2A 1J9BA 1UVZA 2H1BA 3GSSA 3ZIJA 3PGTA 1A0RP 1R26A 2P5RA 3GX8A 1XWBA 1YDKA 5DJLA 5FHIA 4HUAA 6GSSA 4HQSA 1TK8B 1I5GA 2FA8A 3PH9A 3KCMA 4AF2A 2G0FA 4HS1A 2E0QA 1Y6EA 2K8SA 1WIKA 3GL3A 2JU5A 2CV4A 5IMVA 3ZVJD 4CDOA 5ECIB 5IO0A 1GRXA 1PKZA 4ECBA 2YWOA 3GSTA 1R7HA 1TU8A 4V2MA 1VF4A 2X99A 4Q5QA 2QA1A 5INYA 1ILOA 3CTFA 1FB0A 2EC4A 2Z9SA 1V57A 2OE3A 2VD0A 4Z2UA 3HHVA 4H86A 3WGEA 1XWKA 2HXKA 2H66A 3G7YA 3ERGA 3L9UA 3EC3A 1O6JA 3C1RA 4FH8A 5G31A 1TI1A 3IBHA 1SU9A 4RQRA 2C8UA 1KNGA 2LQOA 2WCIA 3APSA 3R2QA 1TI3A 1J08A 2VLVA 3CXGA 4WBJA 3IE3A 1TRVA 2L4CA 1OC9B 2REMA 3KJYA 2BTOT 5G2ZA 4L5OA 4HOJA 1G7OA 4PNFA 3ZMKA 4ICYA 4DEJA 3D21A 18GSA 4EKZA 2J23A 3HA9A 3ZL5A 1EV9A 2F51A 2L5LA 1MEKA 6GSTA 3UIWA 1XW5A 2FWFA 2DIYA 2QA2A 5AIVA 4BL7A 3VPQA 1S3RA 2CZ2A 5BMUA 3NIVA 3FZ4A 5HR0A 1ZOFA 4O32A 1E6BA 2AAWA 1FAAA 4IELA 4E8HA 4K5SA 4KNDA 2K9FA 3LJRA 2KP1A 4AJ7A 3RHCA 4K9ZA 5ECHB 4X0XA 3F0IA 2JACA 4OWYA 3TJFA 2C0EA 4HJ2A 2V2GA 2V41A 4YQUA 2GT6A 2K8VA 2DC5A 5CRGA 2GTUA 4GSNA 4KH7A 1GH2A 4ID0A 4IVFA 1E2YA 1RW1A 4GSSA 2FGXA 3TJGA 5D9WA 2GDRA 1OAZA 1FVJA 4POLA 3A3TA 5KOWA 2R5GA 4G0KA 3O6TA 3HY2A 3VI7A 2DKHA 5CREA 2YN1A 2B6MA 3WYWA 3EE2A 1PA3A 2V1MA 4NAXA 2LQQA 1YF1A 2V32A 4HJMA 1IYHA 3GKKA 5F8BA 3WT2A 1TW9A 1ZYNA 4DSSA 2P0GA 2ZCTA 1FG4A 2NDOA 5A5KA 3N5OA 2H1DA 2QGVA 3RBTA 5J9BA 1AIUA 4ZB8A 4A5PA 3TCOA 1T4YA 3G7IA 5JWQB 4YAPA 4IBPA 4PGTA 3CBUA 4EXJA 4GXZA 3G9BA 4TR1B 2H1GA 3HXSA 4F03A 1MD3A 2LJAA 4KUNA 5KN0A 1U3IA 3FZAA 1XVQA 3CRUA 4I2UA 4J2FA 3SWLA 1ACVA 4ZIJA 1YKAA 2WFCA 3TOTA 1A8YA 2AJQB 2PERA 1BX9A 2CA8A 5ECNB 1KBNA 4MNNA 5HR3A 1XWGA 2R6KA 2LUSA 4RI7A 3KEBA 2O8VB 4MJCA 2KLXA 3ME8A 5GSTA 1TXXA 4ZL9A 1X9SB 2E2MA 5IMDA 2H72A 2HI7A 1EP8A 4K0GA 1QUWA 5GAPD 3IC8A 4GQFA 4I8BA 3M9JA 3BCKA 2B7JA 2DJKA 5DCGA 5KEJA 4N11A 4DSQA 3WD6A 1Z5YE 1EV4A 3QOUA 3H1NA 4O5RA 1QXHA 9GSSA 2H6XA 1V40A 1M2AA 17GSA 2HRAA 1EWXA 4QL7A 4WKWA 2PU9C 3ZREA 5J5NA 3F4SA 4YKGA 5ID2B 3QFBC 5EVOA 1G6WA 3H8QA 2H75A 3PINA 3CMIA 3ISOA 3IRAA 2HE3A 1T8EB 2HT9A 3CSHA 4JU5A 4KAEA 4PQHA 2HSMA 1JZOA 3HYPA 1EEJA 3GKXA 3KP9A 3TRPA 5IQYA 1EGRA 4PXOA 5HFIA 3KM6A 2B5EA 2H30A 1SJIA 1AC1A 1HNCA 6GSYA 2EIQA 2IJYA 2C0DA 1V9WA 3LGCA 4ZL8A 1TK0B 4JR6A 1OC9A 3F63A 19GSA 2RUFA 3FZ5A 2OACA 3GNJA 1XXUA 1O7UA 1YQ1A 2DJJA 1M99A 3D22A 1PL2A 3FK8A 3M0FA 4ML1A 1GNWA 1USBA 1VF1A 5DJMA 3ZFBA 4OFNA 4K2XA 1THOA 3N9JA 5J3RA 1GTAA 1F9MA 3APOA 4BA7A 3HJOA 2FY6A 3MIXA 2UZ8A 4IW9A 1A2MA 6GSVA 4EIQA 3A2WA 1TKDB 2JZSA 4XCSA 4V2LA 4KCEA 3E0UA 5HFKA 3QCPA 2AHEA 4PNGA 3C71A 3HZ8A 2JZRA 3ME7A 1CQGA 2L6CA 2R3XA 3O76A 4J56E 4IS0A 1OE7A 3DXBA 3VWVA 2OBKA 3P2AA 1GTBA 5HR2A 3U5RE 2GVPA 3GUSA 3M1GA 5L71A 1UA5A 4RI6A 4FO5A 1SKWB 3EU3A 2EIRA 1GSUA 1JLWA 4NV5A 1U88A 1SKRB 1VF3A 2RM6A 2F3MA 5J41A 2TIRA 3C73A 4POKA 1O8WA 1C72A 3TUEA 4O5QA 4MPGA 1GSYA 4K5RA 1SYRA 2V6OA 1JZWA 4MH3A 3VI5A 4QQ7A 4LL4B 2LNTA 5DQYA 3DVWA 3FEUA 3E3EA 5LCZA 1DBYA 4X1UA 3F6DA 5DCHA 2LRTA 2R37A 4GSTA 5F05A 4WEYA 2MMAA 2H8LA 2HRKA 3KMNA 4DVCA 2DJ2A 1GULA 1OKDA 3TRXA 5ENUA 2DJ1A 5C04A 13GSA 5D96A 1TTZA 3D4TA 4FIWA 1DSBA 3BJ5A 1QQ2A 2VAFA 4I2TA 1WP0A 5JCGA 2QKEA 2PBJA 2KUCA 2L6DA 4LMWA 2IMFA 1WPIA 3RHBA 3KH9A 2JL4A 1G0TA 1NHOA 1SL2B 3F4RA 3UL3A 3W6GA 2XHFA 4QL9A 3TDGA 5EPFA 1FVKA 4PQ1A 2M46A 1BQ7A 5F07A 2IN3A 5AISA 3S9FA 3F6FA 3CSJA 1EGOA 2FWHA 1X5CA 2VL2C 2CVDA 2CZ3A 3DVXA 5D9VA 2HSYA 2PWJA 1GUHA 2HRNA 2K6VA 3TKPA 2DMLA 3IV4A 3TB2A 2GZPA 3HCZA 2DKIA 3NOFA 5A4VA 2LRCA 5AN1A 2RM5A 1Q4JA 4XS6A 3CRTA 2FA4A 1ABAA 4GQCA 3JCML 1M7TA 3GFKA 3DMLA 3TKSC 3VWWA 4HSCX 4JR4A 1O73A 1BEDA 1QK8A 2ZUPA 2I3YA 1FW1A 2VLUA 1X0RA 1AAZA 1W89A 5IMZA 3QFAC 1Z9HA 4G0LA 3MAKA 5EY6A 4Q5NA 1F37A 2VCQA 4ZL7A 3EVIA 2WJUA 1ST9A 5LD0A 2OKAA 3ZYWA 4L8EA 3PR8A 1FOHA 4ZILA 2YZHA 4PUFC 1B48A 3HVSA 1MDKA 1XOAA 1K0NA 2H73A 2OJLA 3IK9A 1B4QA 20GSA 6GSWA 4FYCA 4CHSA 5JWOB 3D4MA 5F06A 1XW6A 4OO5A 5ECKB 2GS3A 2VIMA 2X4AA 4V2NA 1LBKA 4XRAA 1ERTA 1URMA 5ECRB 3OR5A 4NPBA 2D2ZA 4TXVA 3O3TA 1EEMA 2OBIA 3VFIA 1SENA 2RLIA 5DAKA 4WF5A 1YZXA 1PMTA 3KH7A 4TKYA 1SJ6A 1OC8A 5B8AA 1VGLA 3WGXA 4ISDA 3DRNA 2IMKA 5JCUA 4ECCA 3L9VA 3C1SA 4MZBA 1Z7RA 3P90A 2R0PA 4Z2TA 1KTEA 2YPMA 3A5IA 3PPUA 2M72A 2C80A 5A4WA 1K0BA 2IMEA 4MF7A 2GZYA 2O89A 3UMAA 3UVHA 5DBQA 2YWIA 3IXRA 1FHEA 3GMFA 2DIZA 1AQWA 4RQXA 2YWMA 2A4HA 3DEXA 3DYRA 5FWGA 5GAND 3EPTA 4PTSA 1X5DA 4IQ1A 4KSMA 4F0CA 4ILFA 4OCFA 2C1YA 3ZIVA 3IPZA 2FNOA 5H5RA 4KB3A 5KN1A 2CAIA 4X4JA 1XIYA 5CAXA 1SK1A 4USSA 2GSTA 5G5EA 1EOGA 4ULXA 4IKHA 2IFQA 2HFDA 3LQ7A 1PX7A 3F3QA 4MABA 1XCCA 1PL1A 1LU4A 4CW9A 3IK7A 3KIJA 4K7IA 4KDUA 1S3DA 3GURA 3LG6A 2PUKC 1YEXA 2YANA 2VCTA 2H0IA 1NSWA 4F82A 1KEBA 2GLRA 5GSSA 4JE1A 1ERVA 3GKMA 1S3AA 2VUPA 1TRWA 1TU7A 2DJ3A 1XG8A 2IWTA 5F0GA 3ERFA 3KTBA 5D9XA 5H5SA 3TJJA 3QMXA 3F3RA 2LRNA 3VWUA 3ZITA 1XW9A 3CQFA 1B9YC 3DWVA 4G19A 1TJDA 2LNSA 1K3LA 4Z2RA 2N5AA 1GNEA 3IR4A 3RPPA 5IM9A 4EF0A 1XVWA 1OC3A 1TRUA 2KHPA 1BG5A 3GRXA 14GSA 1I9DA 4MPFA 1PN9A 2L5OA 4IN0A 1X9WB 3SBCA 1PGTA 4V1Ap 1MDJA 4BWSA 3C8EA 2CAQA 2WRTA 2YWNA 5COHA 1ERUA 4F0BA 2V6KA 2H1AA 2P31A 2NTOA 3IHQA 1TDIA 2FUG2 2N5FA 2C3QA 1ZMAA 4WR5A 3EURA 5EL8A 4Z7XA 2OE0A 4TXOA 1XWAA 1PKWA 1HNAA 5GZZB 5E59A 4I6XA 1R4WA 4MJEA 2ON7A 3FR9A 4GTUA 4G0IA 2CVKA 1F6MC 1MTCA 1M3IA 1HYUA 2GSSA 5CYYA 2PN8A 4O92A 2DLXA 1Z6NA 1ZCPA 1HD2A 3VK9A 2PVQA 4NMUA 2KOKA 3EMPA 4ZBDA 1Q98A 4K7OA 3KGKA 2DBCA 2QC7A 1ML6A 4TRXA 2H74A 4EO3A 1ZL9A 2C4JA 3FMWA 3KP8A 5B8BA 4KW6A 1WWJA 2PMTA 1SK2A 1MD4A 4KCAA 4YKFA 1EP7A 3FZ9A 3GHAA 3A5WA 4EDYA 2X49A 3IAM2 4HQZA 3GIXA 2RUEA 3H4KA 4O7HA 1OE8A 4ZXGA 3KD0A 1OVNA 1M2BA 4N30A 3H79A 1M0UA 4X43A 5HFGA 4MDCA 1BYEA 5CRDA 1O8XA 2VCWA 2B7KA 1K0AA 1PRXA 4I5QA 2F8AA 3M3MA 1GLPA 2YOIA 5IMFA 2GQKA 3GYKA 1B9XC 5DAKB 2MMZA 4OMVA 4XS4B 1QGVA 4EL1A 4ECIA 2C0GA 3HJMA 4EUYA 3GH6A 3APQA 12GSA 1W4VA 2VL3A 5KN2A 2IMDA 3HVXA 1N2AA 4G9HA 1ZYQB 4YH2A 3NZNA 3RPNA 3GV1A 3MNGA 3U6VA 4ML6A 5ELGA 3ZZXA 2B1LA 1V2AA 8GSSA 3TKSE 4JBBA 3P7XA 2B5YA 4GRFA 5ECSA 5ECOB 3DD3A 2FHEA 4L5LA 4KDXA 4IJ3A 2ZNMA 4XRDA 5HR1A 1O85A 3VURA 2H76A 4K2DA 1XWCA 5IIZA 1Z3EA 4MMMA 1SD9A 4HU9A 4IGJA 2GT5A 1O81A 4G2EA 4J57E 3UJ1A 3L4NA 3DKSA 1YF0A 4MK3A 3R3EA 3GN3A 3LEFA 4CY6A 4GF0A 2YZUA 1WJKA 3C7MA 2HSHA 1T7PB 1U6TA 3HD5A 4BWQA 5ELAA 4EE0A 3F4TA 2PGTA 2IFQB 2L57A 4ZB6A 3ZVJA 4LL1B 1F3BA 1RK4A 1JZDA 2I9HA 4OD7A 3FW2A 2A2PA 4XS1A 5IPHA 4AGSA 4TR0A 1HQOA 16GSA 4TOPA 5G5FA 1X5EA 2HYXA 5B7CA 4TR4A 3IDVA 4POMA 3G7JA 2VLTA 2A4VA 3GTUA 2B5XA 4TN8A 3IHGA 5IOWA 2NPBA 5DALB 3EINA 3I43A 5CNWA 4BVXA 5JWRB 2HZEA 2PVOC 4OFTA 3FR6A 5LNKe 2EIOA 1B4PA 4PQIA 2ON5A 4KE3A 3TOUA 2OE1A 5ECQB 4MZWA 2VCVA 2IMIA 3HVVA 3KTLA 1TP9A 4N0ZA 5IMCA 5KN3A 2JSZA 1PSQA 1U87A 1WMJA 2QSIA 4OFMA 4BPYA 2WULA 2ES7A 4WXTA 1N8JA 3TKQA 4LMVA 2TRCP 3W8SA 4K1FA 2IIYA 2JZTA 1ZYEA 4NXIA 4TXOB 4V1Ag 1R5AA 3UOMA 1A24A 2O85A 2DSAA 3DGQA 3LXZA 3KZQA 2B3SA 4E8EA 3EWLA 1VF2A 3VPTA 1XFLA 2WGRA 6GSXA 5D9TA 1GTUA 1PQNA 1TK5B 3LWAA 2VL2A 1BAYA 3Q19A 1EOHA 3D5JA 4G10A
chains in the Genus database with same CATH topology
5B6NA 3UBLA 2HRFA 2YCDA 3WT1A 2J9HA 3BD2A 1SD8A 4GLTA 4XS4A 3H93A 1J0FA 3US3A 1WRYA 2C3TA 3MYDA 1JLVA 3TKSA 4IJIA 1QFNA 2H70A 2ALBA 1AXDA 1NM3A 1GSDA 1T3BA 2XPEA 2LTKA 2HNLA 2YJHA 3VLNA 4MCUA 2VCXA 1TOFA 1AUCA 1B8XA 1UC7A 1YY7A 4CY8A 4ZBBA 4NV2A 1K3OA 3TGZA 3TJBA 1HNBA 1GUKA 4FYBA 4KDYA 2BJXA 1ZYPA 4GWRA 2GZZA 3GX0A 2KP2A 4RUVA 3FHKA 5JCWA 1GSQA 2H71A 4BVYA 1GSSA 1U3AA 3HKRA 3LORA 4XIHA 2VOCA 1UN2A 3WGDA 4YQVA 1Z6MA 1A2JA 1MDIA 1XPVA 3D6IA 3ZRDA 1XBSA 4IHUA 4TVEA 4IP1A 2NBSA 2B1KA 2H0GA 3I69A 4PX1A 2X8CA 2CT6A 2X8GA 4P3YB 3LW9A 4HU7A 3UBKA 3EYTA 3UARA 3LYKA 2L4QA 4EC0A 1EZKA 2R2JA 2XBQA 1NW2A 3TRQA 10GSA 1A23A 4AJ8A 3ZLPA 3ED3A 5CRHA 1K0OA 4WR4A 1G6YA 2GGTA 4WETA 4FQUA 1DUGA 2MMNA 5CP1A 3L0HA 4JZQA 4K7NA 1K3YA 4NHZA 2X64A 4D73A 2VM2A 2F8FA 3TJKA 5J4UA 5G1LA 1SL1B 1FOVA 1M9AA 4N10A 1JFUA 2CX4A 4YAVA 1ERWA 1RQMA 1X9MB 3J7Yb 3RDWA 1FO5A 3KXOA 3QR6A 3I9V2 3HDCA 1PN0A 1SKSB 4L0WA 5DDLA 1K0CA 5J9CA 1GTIA 3Q74A 4F2IA 3MSZA 2X8HA 3QAGA 1V98A 5DALA 1GLQA 3M8NA 5AGYA 1GP1A 1PX6A 5DQSA 4MH2A 5G30A 5AIXA 3LXTA 2I81A 3F8UA 3EU4A 2FWGA 3FY7A 4MA9A 2LJRA 3ZMLA 3ZTLA 1F3AA 2H0HA 4MJBA 1GL8A 5DVBA 5IO2A 4MLYA 3FKFA 3IOSA 1AQVA 4ACSA 1SYXA 3E9JB 4ZBAA 2E2GA 2WDUA 1H75A 3UVTA 2G2QA 4LA1A 2VO4A 4HZ4A 4HDEA 2YNXA 2K18A 5B6MA 2XPDA 2H01A 5IMAA 1M9BA 2VM1A 7GSSA 2WZ9A 4MF6A 4IQAA 3GH9A 2YV9A 3W8JA 4Q5RA 3I6AA 1XZOA 1NHYA 4DSRA 2E7PA 3MWHA 4OO4A 4HEA2 2A2RA 5ECMB 3GTUB 3LFLA 5ABRA 3A2VA 2YJ7A 2MZCA 4BVXB 2JSYA 3LYPA 3M9KA 2FLSA 2HZEB 2VD1A 1JHBA 2VCZA 2WB9A 3RAZA 4WBRD 2LS5A 1AW9A 1LJRA 5CRWA 2I1UA 4TR3A 4MJAA 2C3NA 3UEMA 3J7Yk 1PD21 1SK0A 3QPMA 4PURA 1Z7PA 2M80A 3LSZA 4MZCA 3QDNA 4FYUA 2AUVA 1G7EA 2AV4A 11GSA 2H19A 2O7KA 4IP6A 2A2SA 4HI7A 4TW5A 4O5UA 2DMMA 3F9UA 5D8IA 5A4UA 1A2LA 1OYJA 22GSA 4K0NA 3UAPA 3ZFLA 3BBYA 5BRTA 1WE0A 5FT3A 2P5QA 2XC2A 1JZRA 2CX3A 3A2XA 2FD3A 3QAVA 2XBIA 2MYGA 4YQMA 5CO3A 2R0CA 1T4ZA 2GQMA 1GSFA 3IC4A 1V58A 3TKRA 4EVMA 3CYNA 2WS2A 2IL3A 3EMXA 2L59A 2H6YA 2CQ9A 1BJXA 1T1VA 2NVLA 5E4WA 4EDZA 1THXA 1YKCA 2VL9A 4JEDA 4KF9A 4EIPA 3BCIA 1SJZA 4Q5FA 2JADA 2LEGA 3GKNA 5KOXA 1CQHA 1DE2A 1H4OA 5C00A 2HZFA 5H5QA 3QAWA 5ECPB 1K0MA 4LLRA 3P8WA 4F9ZA 1IYIA 2LV3A 1K0DA 3Q6OA 3MDKA 1S3CA 3HZ4A 1ZGNA 4BL7B 3IAS2 3GL5A 4BVYB 4HZ2A 1ON4A 2AYTA 2FWEA 4ZB9A 1FB6A 1YEPA 3QD9A 5D73A 1DE1A 1A8LA 5HQPA 2TRXA 3KMOA 2RIIA 3V1WA 2IPAA 4K8MA 4KGIA 2YP6A 4NWYA 3CTGA 2O87A 3CSIA 4KA0A 6GSUA 4I97A 4K6XA 2H6ZA 1QMVA 1WOUA 1A0FA 5ECLB 2MBTA 1GWCA 4ECJA 2LSTA 4KX4A 4L0UA 1XOBA 3L9SA 4GCIA 4N0VA 1GSEA 4TR1A 4NHWA 4MF5A 3L78A 4POBA 2N5BA 3VWXA 2OADA 3FRCA 5G1KA 2PPTA 2DJ0A 2I4AA 1YJ6A 4AJ6A 2MMOA 2F9SA 3HJPA 4D73B 3BOAA 3AY8A 2HLSA 1Y25A 3FYGA 4WF4A 2CVBA 2FCHA 2YV7A 1F2EA 2LJKA 4PUAA 3Q18A 2MBSA 2GSQA 4DSSB 3FR3A 1AQXA 1ZZYA 2GSRA 2GQLA 1OKTA 4XHMA 3IA1A 4KSOA 4JRRA 2R4VA 3D0ZA 4OCEA 2AB6A 2LKUA 4XTSA 1M2DA 1GUMA 3GA4A 5IPGA 1TRSA 2C0FA 2BMXA 3ERWA 3DIEA 1SL0B 2R0GA 3K8NA 1T00A 1VRSD 1R5PA 5D93A 2OA7A 5IOXA 4MP4A 5ID2A 1J9BA 1UVZA 2H1BA 3GSSA 3ZIJA 3PGTA 1A0RP 1R26A 2P5RA 3GX8A 1XWBA 1YDKA 5DJLA 5FHIA 4HUAA 6GSSA 4HQSA 1TK8B 1I5GA 2FA8A 3PH9A 3KCMA 4AF2A 2G0FA 4HS1A 2E0QA 1Y6EA 2K8SA 1WIKA 3GL3A 2JU5A 2CV4A 5IMVA 3ZVJD 4CDOA 5ECIB 5IO0A 1GRXA 1PKZA 4ECBA 2YWOA 3GSTA 1R7HA 1TU8A 4V2MA 1VF4A 2X99A 4Q5QA 2QA1A 5INYA 1ILOA 3CTFA 1FB0A 2EC4A 2Z9SA 1V57A 2OE3A 2VD0A 4Z2UA 3HHVA 4H86A 3WGEA 1XWKA 2HXKA 2H66A 3G7YA 3ERGA 3L9UA 3EC3A 1O6JA 3C1RA 4FH8A 5G31A 1TI1A 3IBHA 1SU9A 4RQRA 2C8UA 1KNGA 2LQOA 2WCIA 3APSA 3R2QA 1TI3A 1J08A 2VLVA 3CXGA 4WBJA 3IE3A 1TRVA 2L4CA 1OC9B 2REMA 3KJYA 2BTOT 5G2ZA 4L5OA 4HOJA 1G7OA 4PNFA 3ZMKA 4ICYA 4DEJA 3D21A 18GSA 4EKZA 2J23A 3HA9A 3ZL5A 1EV9A 2F51A 2L5LA 1MEKA 6GSTA 3UIWA 1XW5A 2FWFA 2DIYA 2QA2A 5AIVA 4BL7A 3VPQA 2CZ2A 5BMUA 3NIVA 3FZ4A 5HR0A 1ZOFA 4O32A 1E6BA 2AAWA 1FAAA 4IELA 4E8HA 4K5SA 4KNDA 2K9FA 3LJRA 2KP1A 4AJ7A 3RHCA 4K9ZA 5ECHB 4X0XA 3F0IA 2JACA 4OWYA 3TJFA 2C0EA 4HJ2A 2V2GA 2V41A 4YQUA 2GT6A 2K8VA 2DC5A 5CRGA 2GTUA 4GSNA 4KH7A 1GH2A 4ID0A 4IVFA 1E2YA 1RW1A 4GSSA 2FGXA 3TJGA 5D9WA 2GDRA 1OAZA 1FVJA 4POLA 3A3TA 5KOWA 2R5GA 4G0KA 3O6TA 3HY2A 3VI7A 2DKHA 5CREA 2YN1A 2B6MA 3WYWA 3EE2A 1PA3A 2V1MA 4NAXA 2LQQA 1YF1A 2V32A 4HJMA 1IYHA 3GKKA 5F8BA 3WT2A 1TW9A 1ZYNA 4DSSA 2P0GA 2ZCTA 1FG4A 2NDOA 5A5KA 3N5OA 2H1DA 2QGVA 3RBTA 5J9BA 1AIUA 4ZB8A 4A5PA 3TCOA 1T4YA 3G7IA 5JWQB 4YAPA 4IBPA 4PGTA 3CBUA 4EXJA 4GXZA 3G9BA 4TR1B 2H1GA 3HXSA 4F03A 1MD3A 2LJAA 4KUNA 5KN0A 1U3IA 3FZAA 1XVQA 3CRUA 4I2UA 4J2FA 3SWLA 1ACVA 4ZIJA 1YKAA 2WFCA 3TOTA 1A8YA 2AJQB 2PERA 1BX9A 2CA8A 5ECNB 1KBNA 4MNNA 5HR3A 1XWGA 2R6KA 2LUSA 4RI7A 3KEBA 2O8VB 4MJCA 2KLXA 3ME8A 5GSTA 1TXXA 4ZL9A 1X9SB 2E2MA 5IMDA 2H72A 2HI7A 1EP8A 4K0GA 1QUWA 5GAPD 3IC8A 4GQFA 4I8BA 3M9JA 3BCKA 2B7JA 2DJKA 5DCGA 5KEJA 4N11A 4DSQA 3WD6A 1Z5YE 1EV4A 3QOUA 3H1NA 4O5RA 1QXHA 9GSSA 2H6XA 1V40A 1M2AA 17GSA 2HRAA 1EWXA 4QL7A 4WKWA 2PU9C 3ZREA 5J5NA 3F4SA 4YKGA 5ID2B 3QFBC 5EVOA 1G6WA 3H8QA 2H75A 3PINA 3CMIA 3ISOA 3IRAA 2HE3A 1T8EB 2HT9A 3CSHA 4JU5A 4KAEA 4PQHA 2HSMA 1JZOA 3HYPA 1EEJA 3GKXA 3KP9A 3TRPA 5IQYA 1EGRA 4PXOA 5HFIA 3KM6A 2B5EA 2H30A 1SJIA 1AC1A 1HNCA 6GSYA 2EIQA 2IJYA 2C0DA 1V9WA 3LGCA 4ZL8A 1TK0B 4JR6A 1OC9A 3F63A 19GSA 2RUFA 3FZ5A 2OACA 3GNJA 1XXUA 1O7UA 1YQ1A 2DJJA 1M99A 3D22A 1PL2A 3FK8A 3M0FA 4ML1A 1GNWA 1USBA 1VF1A 5DJMA 3ZFBA 4OFNA 4K2XA 1THOA 3N9JA 5J3RA 1GTAA 1F9MA 3APOA 4BA7A 3HJOA 2FY6A 3MIXA 2UZ8A 4IW9A 1A2MA 6GSVA 4EIQA 3A2WA 1TKDB 2JZSA 4XCSA 4V2LA 4KCEA 3E0UA 5HFKA 3QCPA 2AHEA 4PNGA 3C71A 3HZ8A 2JZRA 3ME7A 1CQGA 2L6CA 2R3XA 3O76A 4J56E 4IS0A 1OE7A 3DXBA 3VWVA 2OBKA 3P2AA 1GTBA 5HR2A 3U5RE 2GVPA 3GUSA 3M1GA 5L71A 1UA5A 4RI6A 4FO5A 1SKWB 3EU3A 2EIRA 1GSUA 1JLWA 4NV5A 1U88A 1SKRB 1VF3A 2RM6A 2F3MA 5J41A 2TIRA 3C73A 4POKA 1O8WA 1C72A 3TUEA 4O5QA 4MPGA 1GSYA 4K5RA 1SYRA 2V6OA 1JZWA 4MH3A 3VI5A 4QQ7A 4LL4B 2LNTA 5DQYA 3DVWA 3FEUA 3E3EA 5LCZA 1DBYA 4X1UA 3F6DA 5DCHA 2LRTA 2R37A 4GSTA 5F05A 4WEYA 2MMAA 2H8LA 2HRKA 3KMNA 4DVCA 2DJ2A 1GULA 1OKDA 3TRXA 5ENUA 2DJ1A 5C04A 13GSA 5D96A 1TTZA 3D4TA 4FIWA 1DSBA 3BJ5A 1QQ2A 2VAFA 4I2TA 1WP0A 5JCGA 2QKEA 2PBJA 2KUCA 2L6DA 4LMWA 2IMFA 1WPIA 3RHBA 3KH9A 2JL4A 1G0TA 1NHOA 1SL2B 3F4RA 3UL3A 3W6GA 2XHFA 4QL9A 3TDGA 5EPFA 1FVKA 4PQ1A 2M46A 1BQ7A 5F07A 2IN3A 5AISA 3S9FA 3F6FA 3CSJA 1EGOA 2FWHA 1X5CA 2VL2C 2CVDA 2CZ3A 3DVXA 5D9VA 2HSYA 2PWJA 1GUHA 2HRNA 2K6VA 3TKPA 2DMLA 3IV4A 3TB2A 2GZPA 3HCZA 2DKIA 3NOFA 5A4VA 2LRCA 5AN1A 2RM5A 1Q4JA 4XS6A 3CRTA 2FA4A 1ABAA 4GQCA 3JCML 1M7TA 3GFKA 3DMLA 3TKSC 3VWWA 4JR4A 1O73A 1BEDA 1QK8A 2ZUPA 2I3YA 1FW1A 2VLUA 1X0RA 1AAZA 1W89A 5IMZA 3QFAC 1Z9HA 4G0LA 3MAKA 5EY6A 4Q5NA 1F37A 2VCQA 4ZL7A 3EVIA 2WJUA 1ST9A 5LD0A 2OKAA 3ZYWA 4L8EA 3PR8A 1FOHA 4ZILA 2YZHA 4PUFC 1B48A 3HVSA 1MDKA 1XOAA 1K0NA 2H73A 2OJLA 3IK9A 1B4QA 20GSA 6GSWA 4FYCA 4CHSA 5JWOB 3D4MA 5F06A 1XW6A 4OO5A 5ECKB 2GS3A 2VIMA 2X4AA 4V2NA 1LBKA 4XRAA 1ERTA 1URMA 5ECRB 3OR5A 4NPBA 2D2ZA 4TXVA 3O3TA 1EEMA 2OBIA 3VFIA 1SENA 2RLIA 5DAKA 4WF5A 1YZXA 1PMTA 3KH7A 4TKYA 1SJ6A 1OC8A 5B8AA 1VGLA 3WGXA 4ISDA 3DRNA 2IMKA 5JCUA 4ECCA 3L9VA 3C1SA 4MZBA 1Z7RA 3P90A 2R0PA 4Z2TA 1KTEA 2YPMA 3A5IA 3PPUA 2M72A 2C80A 5A4WA 1K0BA 2IMEA 4MF7A 2GZYA 2O89A 3UMAA 3UVHA 5DBQA 2YWIA 3IXRA 1FHEA 3GMFA 2DIZA 1AQWA 4RQXA 2YWMA 2A4HA 3DEXA 3DYRA 5FWGA 5GAND 3EPTA 4PTSA 1X5DA 4IQ1A 4KSMA 4F0CA 4ILFA 4OCFA 2C1YA 3ZIVA 3IPZA 2FNOA 5H5RA 4KB3A 5KN1A 2CAIA 4X4JA 1XIYA 5CAXA 1SK1A 4USSA 2GSTA 5G5EA 1EOGA 4ULXA 4IKHA 2IFQA 2HFDA 3LQ7A 1PX7A 3F3QA 4MABA 1XCCA 1PL1A 1LU4A 4CW9A 3IK7A 3KIJA 4K7IA 4KDUA 1S3DA 3GURA 3LG6A 2PUKC 1YEXA 2YANA 2VCTA 2H0IA 1NSWA 4F82A 1KEBA 2GLRA 5GSSA 4JE1A 1ERVA 3GKMA 1S3AA 2VUPA 1TRWA 1TU7A 2DJ3A 2IWTA 5F0GA 3ERFA 3KTBA 5D9XA 5H5SA 3TJJA 3QMXA 3F3RA 2LRNA 3VWUA 3ZITA 1XW9A 1B9YC 3DWVA 4G19A 1TJDA 2LNSA 1K3LA 4Z2RA 2N5AA 1GNEA 3IR4A 3RPPA 5IM9A 4EF0A 1XVWA 1OC3A 1TRUA 2KHPA 1BG5A 3GRXA 14GSA 1I9DA 4MPFA 1PN9A 2L5OA 4IN0A 1X9WB 3SBCA 1PGTA 4V1Ap 1MDJA 4BWSA 3C8EA 2CAQA 2WRTA 2YWNA 5COHA 1ERUA 4F0BA 2V6KA 2H1AA 2P31A 2NTOA 3IHQA 1TDIA 2FUG2 2N5FA 2C3QA 1ZMAA 4WR5A 3EURA 5EL8A 4Z7XA 2OE0A 4TXOA 1XWAA 1PKWA 1HNAA 5GZZB 5E59A 4I6XA 1R4WA 4MJEA 2ON7A 3FR9A 4GTUA 4G0IA 2CVKA 1F6MC 1MTCA 1HYUA 2GSSA 5CYYA 2PN8A 4O92A 2DLXA 1Z6NA 1ZCPA 1HD2A 3VK9A 2PVQA 4NMUA 2KOKA 3EMPA 4ZBDA 1Q98A 4K7OA 3KGKA 2DBCA 2QC7A 1ML6A 4TRXA 2H74A 4EO3A 1ZL9A 2C4JA 3FMWA 3KP8A 5B8BA 4KW6A 1WWJA 2PMTA 1SK2A 1MD4A 4KCAA 4YKFA 1EP7A 3FZ9A 3GHAA 3A5WA 4EDYA 2X49A 3IAM2 4HQZA 3GIXA 2RUEA 3H4KA 4O7HA 1OE8A 4ZXGA 3KD0A 1OVNA 1M2BA 4N30A 3H79A 1M0UA 4X43A 5HFGA 4MDCA 1BYEA 5CRDA 1O8XA 2VCWA 2B7KA 1K0AA 1PRXA 4I5QA 2F8AA 3M3MA 1GLPA 2YOIA 5IMFA 2GQKA 3GYKA 1B9XC 5DAKB 2MMZA 4OMVA 4XS4B 1QGVA 4EL1A 4ECIA 2C0GA 3HJMA 4EUYA 3GH6A 3APQA 12GSA 1W4VA 2VL3A 5KN2A 2IMDA 3HVXA 1N2AA 4G9HA 1ZYQB 4YH2A 3NZNA 3RPNA 3GV1A 3MNGA 3U6VA 4ML6A 5ELGA 3ZZXA 2B1LA 1V2AA 8GSSA 3TKSE 4JBBA 3P7XA 2B5YA 4GRFA 5ECSA 5ECOB 3DD3A 2FHEA 4L5LA 4KDXA 4IJ3A 2ZNMA 4XRDA 5HR1A 1O85A 3VURA 2H76A 4K2DA 1XWCA 5IIZA 1Z3EA 4MMMA 1SD9A 4HU9A 4IGJA 2GT5A 1O81A 4G2EA 4J57E 3UJ1A 3L4NA 3DKSA 1YF0A 4MK3A 3R3EA 3GN3A 3LEFA 4CY6A 4GF0A 2YZUA 1WJKA 3C7MA 2HSHA 1T7PB 1U6TA 3HD5A 4BWQA 5ELAA 4EE0A 3F4TA 2PGTA 2IFQB 2L57A 4ZB6A 3ZVJA 4LL1B 1F3BA 1RK4A 1JZDA 2I9HA 4OD7A 3FW2A 2A2PA 4XS1A 5IPHA 4AGSA 4TR0A 1HQOA 16GSA 4TOPA 5G5FA 1X5EA 2HYXA 5B7CA 4TR4A 3IDVA 4POMA 3G7JA 2VLTA 2A4VA 3GTUA 2B5XA 4TN8A 3IHGA 5IOWA 2NPBA 5DALB 3EINA 3I43A 5CNWA 4BVXA 5JWRB 2HZEA 2PVOC 4OFTA 3FR6A 5LNKe 2EIOA 1B4PA 4PQIA 2ON5A 4KE3A 3TOUA 2OE1A 5ECQB 4MZWA 2VCVA 2IMIA 3HVVA 3KTLA 1TP9A 4N0ZA 5IMCA 5KN3A 2JSZA 1PSQA 1U87A 1WMJA 2QSIA 4OFMA 4BPYA 2WULA 2ES7A 4WXTA 1N8JA 3TKQA 4LMVA 2TRCP 3W8SA 4K1FA 2IIYA 2JZTA 1ZYEA 4NXIA 4TXOB 4V1Ag 1R5AA 3UOMA 1A24A 2O85A 2DSAA 3DGQA 3LXZA 3KZQA 2B3SA 4E8EA 3EWLA 1VF2A 3VPTA 1XFLA 2WGRA 6GSXA 5D9TA 1GTUA 1PQNA 1TK5B 3LWAA 2VL2A 1BAYA 3Q19A 1EOHA 3D5JA 4G10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B6N A;  3UBL A;  2HRF A;  2YCD A;  3WT1 A;  2J9H A;  3BD2 A;  1SD8 A;  4GLT A;  4XS4 A;  3H93 A;  1J0F A;  3US3 A;  1WRY A;  2C3T A;  1JLV A;  3TKS A;  4IJI A;  1QFN A;  2H70 A;  2ALB A;  1AXD A;  1NM3 A;  1GSD A;  1T3B A;  2XPE A;  2LTK A;  2HNL A;  2YJH A;  3VLN A;  4MCU A;  2VCX A;  1TOF A;  1AUC A;  1B8X A;  1UC7 A;  1YY7 A;  4ZBB A;  4NV2 A;  1K3O A;  3TGZ A;  3TJB A;  1HNB A;  1GUK A;  4FYB A;  4KDY A;  2BJX A;  4GWR A;  2GZZ A;  3GX0 A;  2KP2 A;  4RUV A;  3FHK A;  5JCW A;  1GSQ A;  2H71 A;  4BVY A;  1GSS A;  1U3A A;  3HKR A;  3LOR A;  4XIH A;  2VOC A;  1UN2 A;  3WGD A;  4YQV A;  1Z6M A;  1A2J A;  1MDI A;  1XPV A;  3D6I A;  3ZRD A;  1XBS A;  4IHU A;  4TVE A;  4IP1 A;  2NBS A;  2B1K A;  2H0G A;  3I69 A;  4PX1 A;  2X8C A;  2CT6 A;  2X8G A;  4P3Y B;  4HU7 A;  3UBK A;  3EYT A;  3UAR A;  3LYK A;  2L4Q A;  4EC0 A;  1EZK A;  2R2J A;  2XBQ A;  1NW2 A;  3TRQ A;  10GS A;  1A23 A;  4AJ8 A;  3ZLP A;  3ED3 A;  5CRH A;  1K0O A;  4WR4 A;  1G6Y A;  2GGT A;  4WET A;  1DUG A;  2MMN A;  5CP1 A;  3L0H A;  4JZQ A;  4K7N A;  1K3Y A;  4NHZ A;  2X64 A;  4D73 A;  2VM2 A;  2F8F A;  3TJK A;  5J4U A;  5G1L A;  1SL1 B;  1FOV A;  1M9A A;  4N10 A;  1JFU A;  2CX4 A;  4YAV A;  1ERW A;  1RQM A;  1X9M B;  3J7Y b;  3RDW A;  1FO5 A;  3KXO A;  3QR6 A;  3I9V 2;  3HDC A;  1SKS B;  4L0W A;  5DDL A;  1K0C A;  5J9C A;  1GTI A;  3Q74 A;  4F2I A;  3MSZ A;  2X8H A;  3QAG A;  1V98 A;  5DAL A;  1GLQ A;  3M8N A;  5AGY A;  1GP1 A;  5DQS A;  1PX6 A;  4MH2 A;  5G30 A;  5AIX A;  3LXT A;  2I81 A;  3F8U A;  3EU4 A;  2FWG A;  3FY7 A;  4MA9 A;  2LJR A;  3ZML A;  3ZTL A;  1F3A A;  2H0H A;  4MJB A;  1GL8 A;  5DVB A;  5IO2 A;  4MLY A;  3FKF A;  3IOS A;  1AQV A;  4ACS A;  1SYX A;  3E9J B;  4ZBA A;  2E2G A;  2WDU A;  1H75 A;  3UVT A;  2G2Q A;  4LA1 A;  2VO4 A;  4HZ4 A;  4HDE A;  2YNX A;  2K18 A;  5B6M A;  2XPD A;  2H01 A;  5IMA A;  1M9B A;  2VM1 A;  7GSS A;  2WZ9 A;  4MF6 A;  4IQA A;  3GH9 A;  2YV9 A;  3W8J A;  4Q5R A;  3I6A A;  1XZO A;  1NHY A;  4DSR A;  2E7P A;  3MWH A;  4OO4 A;  4HEA 2;  2A2R A;  5ECM B;  3GTU B;  3LFL A;  5ABR A;  3A2V A;  2YJ7 A;  2MZC A;  2JSY A;  3LYP A;  3M9K A;  2FLS A;  2HZE B;  2VD1 A;  1JHB A;  2VCZ A;  2WB9 A;  3RAZ A;  4WBR D;  2LS5 A;  1AW9 A;  1LJR A;  5CRW A;  2I1U A;  4TR3 A;  4MJA A;  2C3N A;  3UEM A;  3J7Y k;  1PD2 1;  1SK0 A;  3QPM A;  4PUR A;  1Z7P A;  2M80 A;  3LSZ A;  4MZC A;  3QDN A;  4FYU A;  2AUV A;  1G7E A;  2AV4 A;  11GS A;  2H19 A;  2O7K A;  4IP6 A;  2A2S A;  4HI7 A;  4TW5 A;  2DMM A;  3F9U A;  5D8I A;  5A4U A;  1A2L A;  1OYJ A;  22GS A;  4K0N A;  3UAP A;  3ZFL A;  3BBY A;  1WE0 A;  5FT3 A;  2P5Q A;  2XC2 A;  1JZR A;  2CX3 A;  3A2X A;  2FD3 A;  3QAV A;  2XBI A;  2MYG A;  4YQM A;  5CO3 A;  1T4Z A;  2GQM A;  1GSF A;  3IC4 A;  1V58 A;  3TKR A;  4EVM A;  3CYN A;  2WS2 A;  2IL3 A;  3EMX A;  2L59 A;  2H6Y A;  2CQ9 A;  1BJX A;  1T1V A;  2NVL A;  5E4W A;  4EDZ A;  1THX A;  1YKC A;  2VL9 A;  4JED A;  3BCI A;  1SJZ A;  4Q5F A;  2JAD A;  2LEG A;  3GKN A;  1CQH A;  1DE2 A;  1H4O A;  5C00 A;  2HZF A;  5H5Q A;  3QAW A;  5ECP B;  1K0M A;  4LLR A;  3P8W A;  4F9Z A;  1IYI A;  2LV3 A;  1K0D A;  3Q6O A;  3MDK A;  1S3C A;  3HZ4 A;  1ZGN A;  3IAS 2;  3GL5 A;  4HZ2 A;  1ON4 A;  2AYT A;  2FWE A;  4ZB9 A;  1FB6 A;  1YEP A;  3QD9 A;  5D73 A;  1DE1 A;  1A8L A;  5HQP A;  2TRX A;  3KMO A;  2RII A;  3V1W A;  2IPA A;  4K8M A;  4KGI A;  2YP6 A;  4NWY A;  3CTG A;  2O87 A;  3CSI A;  4KA0 A;  6GSU A;  4I97 A;  4K6X A;  2H6Z A;  1QMV A;  1WOU A;  1A0F A;  5ECL B;  2MBT A;  1GWC A;  4ECJ A;  2LST A;  4KX4 A;  4L0U A;  1XOB A;  3L9S A;  4GCI A;  4N0V A;  1GSE A;  4TR1 A;  4NHW A;  4MF5 A;  3L78 A;  4POB A;  2N5B A;  3VWX A;  2OAD A;  3FRC A;  5G1K A;  2PPT A;  2DJ0 A;  2I4A A;  1YJ6 A;  4AJ6 A;  2MMO A;  2F9S A;  3HJP A;  4D73 B;  3BOA A;  3AY8 A;  2HLS A;  1Y25 A;  3FYG A;  4WF4 A;  2CVB A;  2FCH A;  2YV7 A;  1F2E A;  2LJK A;  4PUA A;  3Q18 A;  2MBS A;  2GSQ A;  4DSS B;  3FR3 A;  1AQX A;  1ZZY A;  2GSR A;  2GQL A;  1OKT A;  4XHM A;  3IA1 A;  4KSO A;  4JRR A;  2R4V A;  3D0Z A;  4OCE A;  2AB6 A;  2LKU A;  4XTS A;  1M2D A;  1GUM A;  3GA4 A;  5IPG A;  1TRS A;  2C0F A;  2BMX A;  3ERW A;  3DIE A;  1SL0 B;  3K8N A;  5D93 A;  1T00 A;  1VRS D;  1R5P A;  2OA7 A;  5IOX A;  4MP4 A;  5ID2 A;  1J9B A;  1UVZ A;  2H1B A;  3GSS A;  3ZIJ A;  3PGT A;  1A0R P;  1R26 A;  2P5R A;  3GX8 A;  1XWB A;  1YDK A;  5DJL A;  5FHI A;  4HUA A;  6GSS A;  4HQS A;  1TK8 B;  1I5G A;  2FA8 A;  3PH9 A;  3KCM A;  4AF2 A;  2G0F A;  4HS1 A;  2E0Q A;  1Y6E A;  2K8S A;  1WIK A;  3GL3 A;  2JU5 A;  2CV4 A;  5IMV A;  3ZVJ D;  4CDO A;  5ECI B;  5IO0 A;  1GRX A;  1PKZ A;  4ECB A;  2YWO A;  3GST A;  1R7H A;  1TU8 A;  4V2M A;  1VF4 A;  2X99 A;  4Q5Q A;  1ILO A;  5INY A;  3CTF A;  1FB0 A;  2EC4 A;  2Z9S A;  1V57 A;  2OE3 A;  2VD0 A;  3HHV A;  4H86 A;  3WGE A;  1XWK A;  2HXK A;  2H66 A;  3G7Y A;  3ERG A;  3L9U A;  3EC3 A;  1O6J A;  3C1R A;  4FH8 A;  5G31 A;  1TI1 A;  3IBH A;  1SU9 A;  4RQR A;  2C8U A;  1KNG A;  2LQO A;  2WCI A;  3APS A;  3R2Q A;  1TI3 A;  1J08 A;  2VLV A;  3CXG A;  4WBJ A;  3IE3 A;  1TRV A;  2L4C A;  1OC9 B;  2REM A;  3KJY A;  2BTO T;  5G2Z A;  4L5O A;  4HOJ A;  1G7O A;  4PNF A;  3ZMK A;  4DEJ A;  3D21 A;  18GS A;  4EKZ A;  2J23 A;  3HA9 A;  3ZL5 A;  1EV9 A;  2F51 A;  2L5L A;  1MEK A;  6GST A;  3UIW A;  1XW5 A;  2FWF A;  2DIY A;  5AIV A;  4BL7 A;  3VPQ A;  2CZ2 A;  3NIV A;  3FZ4 A;  5HR0 A;  1ZOF A;  4O32 A;  1E6B A;  2AAW A;  1FAA A;  4IEL A;  4E8H A;  4KND A;  2K9F A;  3LJR A;  2KP1 A;  4AJ7 A;  3RHC A;  4K9Z A;  5ECH B;  4X0X A;  3F0I A;  2JAC A;  4OWY A;  3TJF A;  2C0E A;  4HJ2 A;  2V2G A;  2V41 A;  4YQU A;  2GT6 A;  2K8V A;  2DC5 A;  5CRG A;  2GTU A;  4GSN A;  4KH7 A;  1GH2 A;  4ID0 A;  4IVF A;  1E2Y A;  1RW1 A;  4GSS A;  2FGX A;  3TJG A;  5D9W A;  2GDR A;  1OAZ A;  1FVJ A;  4POL A;  3A3T A;  2R5G A;  3O6T A;  3HY2 A;  3VI7 A;  5CRE A;  2YN1 A;  2B6M A;  3WYW A;  3EE2 A;  1PA3 A;  2V1M A;  4NAX A;  2LQQ A;  1YF1 A;  2V32 A;  4HJM A;  1IYH A;  3GKK A;  5F8B A;  3WT2 A;  1TW9 A;  4DSS A;  2P0G A;  2ZCT A;  1FG4 A;  2NDO A;  5A5K A;  3N5O A;  2H1D A;  2QGV A;  3RBT A;  5J9B A;  1AIU A;  4ZB8 A;  3TCO A;  1T4Y A;  3G7I A;  5JWQ B;  4YAP A;  4IBP A;  4PGT A;  3CBU A;  4EXJ A;  4GXZ A;  3G9B A;  4TR1 B;  2H1G A;  3HXS A;  4F03 A;  1MD3 A;  2LJA A;  4KUN A;  5KN0 A;  1U3I A;  3FZA A;  1XVQ A;  3CRU A;  4I2U A;  4J2F A;  3SWL A;  1ACV A;  4ZIJ A;  1YKA A;  2WFC A;  3TOT A;  1A8Y A;  2AJQ B;  2PER A;  1BX9 A;  2CA8 A;  5ECN B;  1KBN A;  5HR3 A;  1XWG A;  2R6K A;  2LUS A;  4RI7 A;  3KEB A;  2O8V B;  4MJC A;  2KLX A;  3ME8 A;  5GST A;  1TXX A;  4ZL9 A;  1X9S B;  2E2M A;  5IMD A;  2H72 A;  2HI7 A;  1EP8 A;  4K0G A;  1QUW A;  5GAP D;  4GQF A;  4I8B A;  3M9J A;  3BCK A;  2B7J A;  2DJK A;  5DCG A;  5KEJ A;  4N11 A;  4DSQ A;  3WD6 A;  1Z5Y E;  1EV4 A;  3QOU A;  3H1N A;  4O5R A;  1QXH A;  9GSS A;  2H6X A;  1V40 A;  1M2A A;  17GS A;  1EWX A;  4QL7 A;  4WKW A;  2PU9 C;  3ZRE A;  5J5N A;  3F4S A;  5ID2 B;  3QFB C;  5EVO A;  1G6W A;  3H8Q A;  2H75 A;  3PIN A;  3CMI A;  3ISO A;  3IRA A;  2HE3 A;  1T8E B;  2HT9 A;  3CSH A;  4JU5 A;  4KAE A;  4PQH A;  1JZO A;  3HYP A;  1EEJ A;  3GKX A;  3KP9 A;  3TRP A;  5IQY A;  1EGR A;  4PXO A;  5HFI A;  3KM6 A;  2B5E A;  2H30 A;  1SJI A;  1AC1 A;  1HNC A;  6GSY A;  2EIQ A;  2IJY A;  2C0D A;  1V9W A;  3LGC A;  4ZL8 A;  1TK0 B;  4JR6 A;  1OC9 A;  3F63 A;  19GS A;  2RUF A;  3FZ5 A;  2OAC A;  3GNJ A;  1XXU A;  1O7U A;  1YQ1 A;  2DJJ A;  1M99 A;  3D22 A;  1PL2 A;  3FK8 A;  3M0F A;  4ML1 A;  1GNW A;  1USB A;  1VF1 A;  5DJM A;  3ZFB A;  4OFN A;  1THO A;  3N9J A;  5J3R A;  1GTA A;  1F9M A;  3APO A;  4BA7 A;  3HJO A;  2FY6 A;  4IW9 A;  1A2M A;  6GSV A;  3A2W A;  1TKD B;  2JZS A;  4XCS A;  4V2L A;  4KCE A;  3E0U A;  5HFK A;  3QCP A;  2AHE A;  4PNG A;  3C71 A;  3HZ8 A;  2JZR A;  3ME7 A;  1CQG A;  2L6C A;  2R3X A;  3O76 A;  4J56 E;  4IS0 A;  1OE7 A;  3DXB A;  3VWV A;  2OBK A;  3P2A A;  1GTB A;  5HR2 A;  3U5R E;  2GVP A;  3GUS A;  3M1G A;  5L71 A;  1UA5 A;  4RI6 A;  4FO5 A;  1SKW B;  3EU3 A;  2EIR A;  1GSU A;  1JLW A;  4NV5 A;  1U88 A;  1SKR B;  1VF3 A;  2RM6 A;  2F3M A;  5J41 A;  2TIR A;  3C73 A;  4POK A;  1O8W A;  1C72 A;  3TUE A;  4MPG A;  1GSY A;  1SYR A;  2V6O A;  1JZW A;  4MH3 A;  3VI5 A;  4QQ7 A;  4LL4 B;  2LNT A;  5DQY A;  3DVW A;  3FEU A;  3E3E A;  5LCZ A;  1DBY A;  4X1U A;  3F6D A;  5DCH A;  2LRT A;  2R37 A;  4GST A;  5F05 A;  4WEY A;  2MMA A;  2H8L A;  3KMN A;  4DVC A;  2DJ2 A;  1GUL A;  1OKD A;  3TRX A;  5ENU A;  2DJ1 A;  5C04 A;  13GS A;  5D96 A;  1TTZ A;  3D4T A;  4FIW A;  1DSB A;  3BJ5 A;  1QQ2 A;  2VAF A;  4I2T A;  1WP0 A;  5JCG A;  2QKE A;  2PBJ A;  2KUC A;  2L6D A;  4LMW A;  2IMF A;  1WPI A;  3RHB A;  3KH9 A;  2JL4 A;  1G0T A;  1NHO A;  1SL2 B;  3F4R A;  3UL3 A;  3W6G A;  2XHF A;  4QL9 A;  3TDG A;  5EPF A;  1FVK A;  4PQ1 A;  2M46 A;  1BQ7 A;  5F07 A;  2IN3 A;  5AIS A;  3S9F A;  3F6F A;  3CSJ A;  1EGO A;  2FWH A;  1X5C A;  2VL2 C;  2CVD A;  2CZ3 A;  3DVX A;  5D9V A;  2HSY A;  2PWJ A;  1GUH A;  2HRN A;  2K6V A;  3TKP A;  2DML A;  3IV4 A;  3TB2 A;  2GZP A;  3HCZ A;  3NOF A;  5A4V A;  2LRC A;  5AN1 A;  2RM5 A;  1Q4J A;  4XS6 A;  3CRT A;  2FA4 A;  1ABA A;  4GQC A;  3JCM L;  1M7T A;  3GFK A;  3DML A;  3TKS C;  3VWW A;  4JR4 A;  1O73 A;  1BED A;  1QK8 A;  2ZUP A;  2I3Y A;  1FW1 A;  2VLU A;  1X0R A;  1AAZ A;  1W89 A;  5IMZ A;  3QFA C;  1Z9H A;  3MAK A;  5EY6 A;  4Q5N A;  1F37 A;  2VCQ A;  4ZL7 A;  3EVI A;  2WJU A;  1ST9 A;  5LD0 A;  2OKA A;  3ZYW A;  4L8E A;  3PR8 A;  4ZIL A;  2YZH A;  4PUF C;  1B48 A;  3HVS A;  1MDK A;  1XOA A;  1K0N A;  2H73 A;  2OJL A;  3IK9 A;  1B4Q A;  20GS A;  6GSW A;  4FYC A;  4CHS A;  5JWO B;  3D4M A;  5F06 A;  1XW6 A;  4OO5 A;  5ECK B;  2GS3 A;  2VIM A;  4V2N A;  1LBK A;  4XRA A;  1ERT A;  1URM A;  5ECR B;  3OR5 A;  4NPB A;  2D2Z A;  4TXV A;  3O3T A;  1EEM A;  2OBI A;  3VFI A;  1SEN A;  2RLI A;  5DAK A;  4WF5 A;  1YZX A;  1PMT A;  3KH7 A;  4TKY A;  1SJ6 A;  1OC8 A;  5B8A A;  1VGL A;  3WGX A;  4ISD A;  3DRN A;  2IMK A;  5JCU A;  4ECC A;  3L9V A;  3C1S A;  4MZB A;  1Z7R A;  3P90 A;  1KTE A;  2YPM A;  2M72 A;  2C80 A;  5A4W A;  1K0B A;  2IME A;  4MF7 A;  2GZY A;  2O89 A;  3UMA A;  3UVH A;  5DBQ A;  2YWI A;  3IXR A;  1FHE A;  3GMF A;  2DIZ A;  1AQW A;  4RQX A;  2YWM A;  3DEX A;  3DYR A;  5FWG A;  5GAN D;  1X5D A;  4IQ1 A;  4KSM A;  4F0C A;  4ILF A;  4OCF A;  2C1Y A;  3ZIV A;  3IPZ A;  2FNO A;  5H5R A;  4KB3 A;  5KN1 A;  2CAI A;  1XIY A;  5CAX A;  1SK1 A;  2GST A;  5G5E A;  1EOG A;  4ULX A;  4IKH A;  2IFQ A;  2HFD A;  3LQ7 A;  1PX7 A;  3F3Q A;  4MAB A;  1XCC A;  1PL1 A;  1LU4 A;  4CW9 A;  3IK7 A;  3KIJ A;  4K7I A;  4KDU A;  1S3D A;  3GUR A;  3LG6 A;  2PUK C;  1YEX A;  2YAN A;  2VCT A;  2H0I A;  1NSW A;  4F82 A;  1KEB A;  2GLR A;  5GSS A;  4JE1 A;  1ERV A;  3GKM A;  1S3A A;  2VUP A;  1TRW A;  1TU7 A;  2DJ3 A;  2IWT A;  5F0G A;  3ERF A;  3KTB A;  5D9X A;  5H5S A;  3TJJ A;  3QMX A;  3F3R A;  2LRN A;  3VWU A;  3ZIT A;  1XW9 A;  1B9Y C;  3DWV A;  4G19 A;  1TJD A;  2LNS A;  1K3L A;  2N5A A;  1GNE A;  3IR4 A;  3RPP A;  5IM9 A;  4EF0 A;  1XVW A;  1OC3 A;  1TRU A;  2KHP A;  1BG5 A;  3GRX A;  14GS A;  1I9D A;  4MPF A;  1PN9 A;  2L5O A;  4IN0 A;  1X9W B;  3SBC A;  1PGT A;  4V1A p;  1MDJ A;  4BWS A;  3C8E A;  2CAQ A;  2WRT A;  2YWN A;  5COH A;  1ERU A;  4F0B A;  2V6K A;  2H1A A;  2P31 A;  2NTO A;  3IHQ A;  1TDI A;  2FUG 2;  2N5F A;  2C3Q A;  1ZMA A;  4WR5 A;  3EUR A;  5EL8 A;  4Z7X A;  2OE0 A;  4TXO A;  1XWA A;  1PKW A;  1HNA A;  5GZZ B;  5E59 A;  4I6X A;  1R4W A;  4MJE A;  2ON7 A;  3FR9 A;  4GTU A;  2CVK A;  1F6M C;  1MTC A;  1HYU A;  2GSS A;  5CYY A;  2PN8 A;  4O92 A;  2DLX A;  1Z6N A;  1ZCP A;  1HD2 A;  3VK9 A;  2PVQ A;  4NMU A;  2KOK A;  3EMP A;  4ZBD A;  1Q98 A;  4K7O A;  3KGK A;  2DBC A;  2QC7 A;  1ML6 A;  4TRX A;  2H74 A;  4EO3 A;  1ZL9 A;  2C4J A;  3KP8 A;  5B8B A;  4KW6 A;  1WWJ A;  2PMT A;  1SK2 A;  1MD4 A;  4KCA A;  1EP7 A;  3FZ9 A;  3GHA A;  3A5W A;  4EDY A;  3IAM 2;  4HQZ A;  3GIX A;  2RUE A;  3H4K A;  4O7H A;  1OE8 A;  4ZXG A;  3KD0 A;  1OVN A;  1M2B A;  4N30 A;  3H79 A;  1M0U A;  4X43 A;  5HFG A;  4MDC A;  1BYE A;  5CRD A;  1O8X A;  2VCW A;  2B7K A;  1K0A A;  1PRX A;  4I5Q A;  2F8A A;  3M3M A;  1GLP A;  2YOI A;  5IMF A;  2GQK A;  3GYK A;  1B9X C;  5DAK B;  2MMZ A;  4OMV A;  4XS4 B;  1QGV A;  4EL1 A;  4ECI A;  2C0G A;  3HJM A;  4EUY A;  3GH6 A;  3APQ A;  12GS A;  1W4V A;  2VL3 A;  5KN2 A;  2IMD A;  3HVX A;  1N2A A;  4G9H A;  1ZYQ B;  4YH2 A;  3NZN A;  3RPN A;  3GV1 A;  3MNG A;  3U6V A;  4ML6 A;  5ELG A;  3ZZX A;  2B1L A;  1V2A A;  8GSS A;  3TKS E;  4JBB A;  3P7X A;  2B5Y A;  4GRF A;  5ECS A;  5ECO B;  3DD3 A;  2FHE A;  4L5L A;  4KDX A;  4IJ3 A;  2ZNM A;  4XRD A;  5HR1 A;  1O85 A;  3VUR A;  2H76 A;  4K2D A;  1XWC A;  5IIZ A;  1Z3E A;  4MMM A;  1SD9 A;  4HU9 A;  4IGJ A;  2GT5 A;  1O81 A;  4G2E A;  4J57 E;  3UJ1 A;  3L4N A;  3DKS A;  1YF0 A;  4MK3 A;  3GN3 A;  3LEF A;  4GF0 A;  2YZU A;  1WJK A;  3C7M A;  2HSH A;  1T7P B;  1U6T A;  3HD5 A;  4BWQ A;  5ELA A;  4EE0 A;  3F4T A;  2PGT A;  2IFQ B;  2L57 A;  4ZB6 A;  3ZVJ A;  4LL1 B;  1F3B A;  1RK4 A;  1JZD A;  2I9H A;  4OD7 A;  3FW2 A;  4XS1 A;  5IPH A;  4AGS A;  4TR0 A;  1HQO A;  16GS A;  4TOP A;  5G5F A;  1X5E A;  2HYX A;  5B7C A;  4TR4 A;  3IDV A;  4POM A;  3G7J A;  2VLT A;  2A4V A;  3GTU A;  2B5X A;  4TN8 A;  5IOW A;  2NPB A;  5DAL B;  3EIN A;  3I43 A;  5CNW A;  4BVX A;  5JWR B;  2HZE A;  2PVO C;  4OFT A;  3FR6 A;  5LNK e;  2EIO A;  1B4P A;  4PQI A;  2ON5 A;  4KE3 A;  3TOU A;  2OE1 A;  5ECQ B;  4MZW A;  2VCV A;  2IMI A;  3HVV A;  3KTL A;  1TP9 A;  4N0Z A;  5IMC A;  5KN3 A;  2JSZ A;  1PSQ A;  1U87 A;  1WMJ A;  2QSI A;  4OFM A;  4BPY A;  2WUL A;  2ES7 A;  4WXT A;  1N8J A;  3TKQ A;  4LMV A;  2TRC P;  3W8S A;  4K1F A;  2IIY A;  2JZT A;  1ZYE A;  4NXI A;  4TXO B;  4V1A g;  1R5A A;  3UOM A;  1A24 A;  2O85 A;  2DSA A;  3DGQ A;  3LXZ A;  3KZQ A;  2B3S A;  4E8E A;  3EWL A;  1VF2 A;  3VPT A;  1XFL A;  2WGR A;  6GSX A;  5D9T A;  1GTU A;  1PQN A;  1TK5 B;  3LWA A;  2VL2 A;  1BAY A;  3Q19 A;  1EOH A;  3D5J A;  4G10 A; 
#chains in the Genus database with same CATH topology
 5B6N A;  3UBL A;  2HRF A;  2YCD A;  3WT1 A;  2J9H A;  3BD2 A;  1SD8 A;  4GLT A;  4XS4 A;  3H93 A;  1J0F A;  3US3 A;  1WRY A;  2C3T A;  3MYD A;  1JLV A;  3TKS A;  4IJI A;  1QFN A;  2H70 A;  2ALB A;  1AXD A;  1NM3 A;  1GSD A;  1T3B A;  2XPE A;  2LTK A;  2HNL A;  2YJH A;  3VLN A;  4MCU A;  2VCX A;  1TOF A;  1AUC A;  1B8X A;  1UC7 A;  1YY7 A;  4CY8 A;  4ZBB A;  4NV2 A;  1K3O A;  3TGZ A;  3TJB A;  1HNB A;  1GUK A;  4FYB A;  4KDY A;  2BJX A;  1ZYP A;  4GWR A;  2GZZ A;  3GX0 A;  2KP2 A;  4RUV A;  3FHK A;  5JCW A;  1GSQ A;  2H71 A;  4BVY A;  1GSS A;  1U3A A;  3HKR A;  3LOR A;  4XIH A;  2VOC A;  1UN2 A;  3WGD A;  4YQV A;  1Z6M A;  1A2J A;  1MDI A;  1XPV A;  3D6I A;  3ZRD A;  1XBS A;  4IHU A;  4TVE A;  4IP1 A;  2NBS A;  2B1K A;  2H0G A;  3I69 A;  4PX1 A;  2X8C A;  2CT6 A;  2X8G A;  4P3Y B;  3LW9 A;  4HU7 A;  3UBK A;  3EYT A;  3UAR A;  3LYK A;  2L4Q A;  4EC0 A;  1EZK A;  2R2J A;  2XBQ A;  1NW2 A;  3TRQ A;  10GS A;  1A23 A;  4AJ8 A;  3ZLP A;  3ED3 A;  5CRH A;  1K0O A;  4WR4 A;  1G6Y A;  2GGT A;  4WET A;  4FQU A;  1DUG A;  2MMN A;  5CP1 A;  3L0H A;  4JZQ A;  4K7N A;  1K3Y A;  4NHZ A;  2X64 A;  4D73 A;  2VM2 A;  2F8F A;  3TJK A;  5J4U A;  5G1L A;  1SL1 B;  1FOV A;  1M9A A;  4N10 A;  1JFU A;  2CX4 A;  4YAV A;  1ERW A;  1RQM A;  1X9M B;  3J7Y b;  3RDW A;  1FO5 A;  3KXO A;  3QR6 A;  3I9V 2;  3HDC A;  1PN0 A;  1SKS B;  4L0W A;  5DDL A;  1K0C A;  5J9C A;  1GTI A;  3Q74 A;  4F2I A;  3MSZ A;  2X8H A;  3QAG A;  1V98 A;  5DAL A;  1GLQ A;  3M8N A;  5AGY A;  1GP1 A;  1PX6 A;  5DQS A;  4MH2 A;  5G30 A;  5AIX A;  3LXT A;  2I81 A;  3F8U A;  3EU4 A;  2FWG A;  3FY7 A;  4MA9 A;  2LJR A;  3ZML A;  3ZTL A;  1F3A A;  2H0H A;  4MJB A;  1GL8 A;  5DVB A;  5IO2 A;  4MLY A;  3FKF A;  3IOS A;  1AQV A;  4ACS A;  1SYX A;  3E9J B;  4ZBA A;  2E2G A;  2WDU A;  1H75 A;  3UVT A;  2G2Q A;  4LA1 A;  2VO4 A;  4HZ4 A;  4HDE A;  2YNX A;  2K18 A;  5B6M A;  2XPD A;  2H01 A;  5IMA A;  1M9B A;  2VM1 A;  7GSS A;  2WZ9 A;  4MF6 A;  4IQA A;  3GH9 A;  2YV9 A;  3W8J A;  4Q5R A;  3I6A A;  1XZO A;  1NHY A;  4DSR A;  2E7P A;  3MWH A;  4OO4 A;  4HEA 2;  2A2R A;  5ECM B;  3GTU B;  3LFL A;  5ABR A;  3A2V A;  2YJ7 A;  2MZC A;  4BVX B;  2JSY A;  3LYP A;  3M9K A;  2FLS A;  2HZE B;  2VD1 A;  1JHB A;  2VCZ A;  2WB9 A;  3RAZ A;  4WBR D;  2LS5 A;  1AW9 A;  1LJR A;  5CRW A;  2I1U A;  4TR3 A;  4MJA A;  2C3N A;  3UEM A;  3J7Y k;  1PD2 1;  1SK0 A;  3QPM A;  4PUR A;  1Z7P A;  2M80 A;  3LSZ A;  4MZC A;  3QDN A;  4FYU A;  2AUV A;  1G7E A;  2AV4 A;  11GS A;  2H19 A;  2O7K A;  4IP6 A;  2A2S A;  4HI7 A;  4TW5 A;  4O5U A;  2DMM A;  3F9U A;  5D8I A;  5A4U A;  1A2L A;  1OYJ A;  22GS A;  4K0N A;  3UAP A;  3ZFL A;  3BBY A;  5BRT A;  1WE0 A;  5FT3 A;  2P5Q A;  2XC2 A;  1JZR A;  2CX3 A;  3A2X A;  2FD3 A;  3QAV A;  2XBI A;  2MYG A;  4YQM A;  5CO3 A;  2R0C A;  1T4Z A;  2GQM A;  1GSF A;  3IC4 A;  1V58 A;  3TKR A;  4EVM A;  3CYN A;  2WS2 A;  2IL3 A;  3EMX A;  2L59 A;  2H6Y A;  2CQ9 A;  1BJX A;  1T1V A;  2NVL A;  5E4W A;  4EDZ A;  1THX A;  1YKC A;  2VL9 A;  4JED A;  4KF9 A;  4EIP A;  3BCI A;  1SJZ A;  4Q5F A;  2JAD A;  2LEG A;  3GKN A;  5KOX A;  1CQH A;  1DE2 A;  1H4O A;  5C00 A;  2HZF A;  5H5Q A;  3QAW A;  5ECP B;  1K0M A;  4LLR A;  3P8W A;  4F9Z A;  1IYI A;  2LV3 A;  1K0D A;  3Q6O A;  3MDK A;  1S3C A;  3HZ4 A;  1ZGN A;  4BL7 B;  3IAS 2;  3GL5 A;  4BVY B;  4HZ2 A;  1ON4 A;  2AYT A;  2FWE A;  4ZB9 A;  1FB6 A;  1YEP A;  3QD9 A;  1PFO A;  3HVN A;  5D73 A;  1DE1 A;  1A8L A;  5HQP A;  2TRX A;  3KMO A;  2RII A;  3V1W A;  2IPA A;  4K8M A;  4KGI A;  2YP6 A;  4NWY A;  3CTG A;  2O87 A;  3CSI A;  4KA0 A;  6GSU A;  4I97 A;  4K6X A;  2H6Z A;  1QMV A;  1WOU A;  1A0F A;  5ECL B;  2MBT A;  1GWC A;  4ECJ A;  2LST A;  4KX4 A;  4L0U A;  1XOB A;  3L9S A;  4GCI A;  4N0V A;  1GSE A;  4TR1 A;  4NHW A;  4MF5 A;  3L78 A;  4POB A;  2N5B A;  3VWX A;  2OAD A;  3FRC A;  5G1K A;  2PPT A;  2DJ0 A;  2I4A A;  1YJ6 A;  4AJ6 A;  2MMO A;  2F9S A;  3HJP A;  4D73 B;  3BOA A;  3AY8 A;  2HLS A;  1Y25 A;  3FYG A;  4WF4 A;  2CVB A;  2FCH A;  2YV7 A;  1F2E A;  2LJK A;  1M3J A;  4PUA A;  3Q18 A;  2MBS A;  2GSQ A;  4DSS B;  3FR3 A;  1AQX A;  1ZZY A;  2GSR A;  2GQL A;  1OKT A;  4XHM A;  3IA1 A;  4KSO A;  4JRR A;  2R4V A;  3D0Z A;  4OCE A;  2AB6 A;  2LKU A;  4XTS A;  1M2D A;  1GUM A;  3GA4 A;  5IPG A;  4BIK A;  1TRS A;  2C0F A;  2BMX A;  3ERW A;  3DIE A;  1SL0 B;  2R0G A;  3K8N A;  1T00 A;  1VRS D;  1R5P A;  5D93 A;  2OA7 A;  5IOX A;  4MP4 A;  5ID2 A;  1J9B A;  1UVZ A;  2H1B A;  3GSS A;  3ZIJ A;  3PGT A;  1A0R P;  1R26 A;  2P5R A;  3GX8 A;  1XWB A;  1YDK A;  5DJL A;  5FHI A;  4HUA A;  6GSS A;  4HQS A;  1TK8 B;  1I5G A;  2FA8 A;  3PH9 A;  3KCM A;  4AF2 A;  2G0F A;  4HS1 A;  2E0Q A;  1Y6E A;  2K8S A;  1WIK A;  3GL3 A;  2JU5 A;  2CV4 A;  5IMV A;  3ZVJ D;  4CDO A;  5ECI B;  5IO0 A;  1GRX A;  1PKZ A;  4ECB A;  2YWO A;  3GST A;  1R7H A;  1TU8 A;  4V2M A;  1VF4 A;  2X99 A;  4Q5Q A;  2QA1 A;  5INY A;  1ILO A;  3CTF A;  1FB0 A;  2EC4 A;  2Z9S A;  1V57 A;  2OE3 A;  2VD0 A;  4Z2U A;  3HHV A;  4H86 A;  3WGE A;  1XWK A;  2HXK A;  2H66 A;  3G7Y A;  3ERG A;  3L9U A;  3EC3 A;  1O6J A;  3C1R A;  4FH8 A;  5G31 A;  1TI1 A;  3IBH A;  1SU9 A;  4RQR A;  2C8U A;  1KNG A;  2LQO A;  2WCI A;  3APS A;  3R2Q A;  1TI3 A;  1J08 A;  2VLV A;  3CXG A;  4WBJ A;  3IE3 A;  1TRV A;  2L4C A;  1OC9 B;  2REM A;  3KJY A;  2BTO T;  5G2Z A;  4L5O A;  4HOJ A;  1G7O A;  4PNF A;  3ZMK A;  4ICY A;  4DEJ A;  3D21 A;  18GS A;  4EKZ A;  2J23 A;  3HA9 A;  3ZL5 A;  1EV9 A;  2F51 A;  2L5L A;  1MEK A;  6GST A;  3UIW A;  1XW5 A;  2FWF A;  2DIY A;  2QA2 A;  5AIV A;  4BL7 A;  3VPQ A;  1S3R A;  2CZ2 A;  5BMU A;  3NIV A;  3FZ4 A;  5HR0 A;  1ZOF A;  4O32 A;  1E6B A;  2AAW A;  1FAA A;  4IEL A;  4E8H A;  4K5S A;  4KND A;  2K9F A;  3LJR A;  2KP1 A;  4AJ7 A;  3RHC A;  4K9Z A;  5ECH B;  4X0X A;  3F0I A;  2JAC A;  4OWY A;  3TJF A;  2C0E A;  4HJ2 A;  2V2G A;  2V41 A;  4YQU A;  2GT6 A;  2K8V A;  2DC5 A;  5CRG A;  2GTU A;  4GSN A;  4KH7 A;  1GH2 A;  4ID0 A;  4IVF A;  1E2Y A;  1RW1 A;  4GSS A;  2FGX A;  3TJG A;  5D9W A;  2GDR A;  1OAZ A;  1FVJ A;  4POL A;  3A3T A;  5KOW A;  2R5G A;  4G0K A;  3O6T A;  3HY2 A;  3VI7 A;  2DKH A;  5CRE A;  2YN1 A;  2B6M A;  3WYW A;  3EE2 A;  1PA3 A;  2V1M A;  4NAX A;  2LQQ A;  1YF1 A;  2V32 A;  4HJM A;  1IYH A;  3GKK A;  5F8B A;  3WT2 A;  1TW9 A;  1ZYN A;  4DSS A;  2P0G A;  2ZCT A;  1FG4 A;  2NDO A;  5A5K A;  3N5O A;  2H1D A;  2QGV A;  3RBT A;  5J9B A;  1AIU A;  4ZB8 A;  4A5P A;  3TCO A;  1T4Y A;  3G7I A;  5JWQ B;  4YAP A;  4IBP A;  4PGT A;  3CBU A;  4EXJ A;  4GXZ A;  3G9B A;  4TR1 B;  2H1G A;  3HXS A;  4F03 A;  1MD3 A;  2LJA A;  4KUN A;  5KN0 A;  1U3I A;  3FZA A;  1XVQ A;  3CRU A;  4I2U A;  4J2F A;  3SWL A;  1ACV A;  4ZIJ A;  1YKA A;  2WFC A;  3TOT A;  1A8Y A;  2AJQ B;  2PER A;  1BX9 A;  2CA8 A;  5ECN B;  1KBN A;  4MNN A;  5HR3 A;  1XWG A;  2R6K A;  2LUS A;  4RI7 A;  3KEB A;  2O8V B;  4MJC A;  2KLX A;  3ME8 A;  5GST A;  1TXX A;  4ZL9 A;  1X9S B;  2E2M A;  5IMD A;  2H72 A;  2HI7 A;  1EP8 A;  4K0G A;  1QUW A;  5GAP D;  3IC8 A;  4GQF A;  4I8B A;  3M9J A;  3BCK A;  2B7J A;  2DJK A;  5DCG A;  5KEJ A;  4N11 A;  4DSQ A;  3WD6 A;  1Z5Y E;  1EV4 A;  3QOU A;  3H1N A;  4O5R A;  1QXH A;  9GSS A;  2H6X A;  1V40 A;  1M2A A;  17GS A;  2HRA A;  1EWX A;  4QL7 A;  4WKW A;  2PU9 C;  3ZRE A;  5J5N A;  3F4S A;  4YKG A;  5ID2 B;  3QFB C;  5EVO A;  1G6W A;  3H8Q A;  2H75 A;  3PIN A;  3CMI A;  3ISO A;  3IRA A;  2HE3 A;  1T8E B;  2HT9 A;  3CSH A;  4JU5 A;  4KAE A;  4PQH A;  2HSM A;  1JZO A;  3HYP A;  1EEJ A;  3GKX A;  3KP9 A;  3TRP A;  5IQY A;  1EGR A;  4PXO A;  5HFI A;  3KM6 A;  2B5E A;  2H30 A;  1SJI A;  1AC1 A;  1HNC A;  6GSY A;  2EIQ A;  2IJY A;  2C0D A;  1V9W A;  3LGC A;  4ZL8 A;  1TK0 B;  4JR6 A;  1OC9 A;  3F63 A;  19GS A;  2RUF A;  3FZ5 A;  2OAC A;  3GNJ A;  1XXU A;  1O7U A;  1YQ1 A;  2DJJ A;  1M99 A;  3D22 A;  1PL2 A;  3FK8 A;  3M0F A;  4ML1 A;  1GNW A;  1USB A;  1VF1 A;  5DJM A;  3ZFB A;  4OFN A;  4K2X A;  1THO A;  3N9J A;  5J3R A;  1GTA A;  1F9M A;  3APO A;  4BA7 A;  3HJO A;  2FY6 A;  3MIX A;  2UZ8 A;  4IW9 A;  1A2M A;  6GSV A;  4EIQ A;  3A2W A;  1TKD B;  2JZS A;  4XCS A;  4V2L A;  4KCE A;  3E0U A;  5HFK A;  3QCP A;  2AHE A;  4PNG A;  3C71 A;  3HZ8 A;  2JZR A;  3ME7 A;  1CQG A;  2L6C A;  2R3X A;  3O76 A;  4J56 E;  4IS0 A;  1OE7 A;  3DXB A;  3VWV A;  2OBK A;  3P2A A;  1GTB A;  5HR2 A;  3U5R E;  2GVP A;  3GUS A;  3M1G A;  5L71 A;  1UA5 A;  4RI6 A;  4FO5 A;  1SKW B;  3EU3 A;  2EIR A;  1GSU A;  1JLW A;  4NV5 A;  1U88 A;  1SKR B;  1VF3 A;  2RM6 A;  2F3M A;  5J41 A;  2TIR A;  3C73 A;  4POK A;  1O8W A;  1C72 A;  3TUE A;  4O5Q A;  4MPG A;  1GSY A;  4K5R A;  1SYR A;  2V6O A;  1JZW A;  4MH3 A;  3VI5 A;  4QQ7 A;  4LL4 B;  2LNT A;  5DQY A;  3DVW A;  3FEU A;  3E3E A;  5LCZ A;  1DBY A;  4X1U A;  3F6D A;  5DCH A;  2LRT A;  2R37 A;  4GST A;  5F05 A;  4WEY A;  2MMA A;  2H8L A;  2HRK A;  3KMN A;  4DVC A;  2DJ2 A;  1GUL A;  1OKD A;  3TRX A;  5ENU A;  2DJ1 A;  5C04 A;  13GS A;  5D96 A;  1TTZ A;  3D4T A;  4FIW A;  1DSB A;  3BJ5 A;  1QQ2 A;  2VAF A;  4I2T A;  1WP0 A;  5JCG A;  2QKE A;  2PBJ A;  2KUC A;  2L6D A;  4LMW A;  2IMF A;  1WPI A;  3RHB A;  3KH9 A;  2JL4 A;  1G0T A;  1NHO A;  1SL2 B;  3F4R A;  3UL3 A;  3W6G A;  2XHF A;  4QL9 A;  3TDG A;  5EPF A;  1FVK A;  4PQ1 A;  2M46 A;  1BQ7 A;  5F07 A;  2IN3 A;  5AIS A;  3S9F A;  3F6F A;  3CSJ A;  1EGO A;  2FWH A;  1X5C A;  2VL2 C;  2CVD A;  2CZ3 A;  3DVX A;  5D9V A;  2HSY A;  2PWJ A;  1GUH A;  2HRN A;  2K6V A;  3TKP A;  2DML A;  3IV4 A;  3TB2 A;  2GZP A;  3HCZ A;  2DKI A;  3NOF A;  5A4V A;  2LRC A;  5AN1 A;  2RM5 A;  1Q4J A;  4XS6 A;  3CRT A;  2FA4 A;  1ABA A;  4GQC A;  3JCM L;  1M7T A;  3GFK A;  3DML A;  3TKS C;  3VWW A;  4HSC X;  4JR4 A;  1O73 A;  1BED A;  1QK8 A;  2ZUP A;  2I3Y A;  1FW1 A;  2VLU A;  1X0R A;  1AAZ A;  1W89 A;  5IMZ A;  3QFA C;  1Z9H A;  4G0L A;  3MAK A;  5EY6 A;  4Q5N A;  1F37 A;  2VCQ A;  4ZL7 A;  3EVI A;  2WJU A;  1ST9 A;  5LD0 A;  2OKA A;  3ZYW A;  4L8E A;  3PR8 A;  1FOH A;  4ZIL A;  2YZH A;  4PUF C;  1B48 A;  3HVS A;  1MDK A;  1XOA A;  1K0N A;  2H73 A;  2OJL A;  3IK9 A;  1B4Q A;  20GS A;  6GSW A;  4FYC A;  4CHS A;  5JWO B;  3D4M A;  5F06 A;  1XW6 A;  4OO5 A;  5ECK B;  2GS3 A;  2VIM A;  2X4A A;  4V2N A;  1LBK A;  4XRA A;  1ERT A;  1URM A;  5ECR B;  3OR5 A;  4NPB A;  2D2Z A;  4TXV A;  3O3T A;  1EEM A;  2OBI A;  3VFI A;  1SEN A;  2RLI A;  5DAK A;  4WF5 A;  1YZX A;  1PMT A;  3KH7 A;  4TKY A;  1SJ6 A;  1OC8 A;  5B8A A;  1VGL A;  3WGX A;  4ISD A;  3DRN A;  2IMK A;  5JCU A;  4ECC A;  3L9V A;  3C1S A;  4MZB A;  1Z7R A;  3P90 A;  2R0P A;  4Z2T A;  1KTE A;  2YPM A;  3A5I A;  3PPU A;  2M72 A;  2C80 A;  5A4W A;  1K0B A;  2IME A;  4MF7 A;  2GZY A;  2O89 A;  3UMA A;  3UVH A;  5DBQ A;  2YWI A;  3IXR A;  1FHE A;  3GMF A;  2DIZ A;  1AQW A;  4RQX A;  2YWM A;  2A4H A;  3DEX A;  3DYR A;  5FWG A;  5GAN D;  3EPT A;  4PTS A;  1X5D A;  4IQ1 A;  4KSM A;  4F0C A;  4ILF A;  4OCF A;  2C1Y A;  3ZIV A;  3IPZ A;  2FNO A;  5H5R A;  4KB3 A;  5KN1 A;  2CAI A;  4X4J A;  1XIY A;  5CAX A;  1SK1 A;  4USS A;  2GST A;  5G5E A;  1EOG A;  4ULX A;  4IKH A;  2IFQ A;  2HFD A;  3LQ7 A;  1PX7 A;  3F3Q A;  4MAB A;  1XCC A;  1PL1 A;  1LU4 A;  4CW9 A;  3IK7 A;  3KIJ A;  4K7I A;  4KDU A;  1S3D A;  3GUR A;  3LG6 A;  2PUK C;  1YEX A;  2YAN A;  2VCT A;  2H0I A;  1NSW A;  4F82 A;  1KEB A;  2GLR A;  5GSS A;  4JE1 A;  1ERV A;  3GKM A;  1S3A A;  2VUP A;  1TRW A;  1TU7 A;  2DJ3 A;  1XG8 A;  2IWT A;  5F0G A;  3ERF A;  3KTB A;  5D9X A;  5H5S A;  3TJJ A;  3QMX A;  3F3R A;  2LRN A;  3VWU A;  3ZIT A;  1XW9 A;  3CQF A;  1B9Y C;  3DWV A;  4G19 A;  1TJD A;  2LNS A;  1K3L A;  4Z2R A;  2N5A A;  1GNE A;  3IR4 A;  3RPP A;  5IM9 A;  4EF0 A;  1XVW A;  1OC3 A;  1TRU A;  2KHP A;  1BG5 A;  3GRX A;  14GS A;  1I9D A;  4MPF A;  1PN9 A;  2L5O A;  4IN0 A;  1X9W B;  3SBC A;  1PGT A;  4V1A p;  1MDJ A;  4BWS A;  3C8E A;  2CAQ A;  2WRT A;  2YWN A;  5COH A;  1ERU A;  4F0B A;  2V6K A;  2H1A A;  2P31 A;  2NTO A;  3IHQ A;  1TDI A;  2FUG 2;  2N5F A;  2C3Q A;  1ZMA A;  4WR5 A;  3EUR A;  5EL8 A;  4Z7X A;  2OE0 A;  4TXO A;  1XWA A;  1PKW A;  1HNA A;  5GZZ B;  5E59 A;  4I6X A;  1R4W A;  4MJE A;  2ON7 A;  3FR9 A;  4GTU A;  4G0I A;  2CVK A;  1F6M C;  1MTC A;  1M3I A;  1HYU A;  2GSS A;  5CYY A;  2PN8 A;  4O92 A;  2DLX A;  1Z6N A;  1ZCP A;  1HD2 A;  3VK9 A;  2PVQ A;  4NMU A;  2KOK A;  3EMP A;  4ZBD A;  1Q98 A;  4K7O A;  3KGK A;  2DBC A;  2QC7 A;  1ML6 A;  4TRX A;  2H74 A;  4EO3 A;  1ZL9 A;  2C4J A;  3FMW A;  3KP8 A;  5B8B A;  4KW6 A;  1WWJ A;  2PMT A;  1SK2 A;  1MD4 A;  4KCA A;  4YKF A;  1EP7 A;  3FZ9 A;  3GHA A;  3A5W A;  4EDY A;  2X49 A;  3IAM 2;  4HQZ A;  3GIX A;  2RUE A;  3H4K A;  4O7H A;  1OE8 A;  4ZXG A;  3KD0 A;  1OVN A;  1M2B A;  4N30 A;  3H79 A;  1M0U A;  4X43 A;  5HFG A;  4MDC A;  1BYE A;  5CRD A;  1O8X A;  2VCW A;  2B7K A;  1K0A A;  1PRX A;  4I5Q A;  2F8A A;  3M3M A;  1GLP A;  2YOI A;  5IMF A;  2GQK A;  3GYK A;  1B9X C;  5DAK B;  2MMZ A;  4OMV A;  4XS4 B;  1QGV A;  4EL1 A;  4ECI A;  2C0G A;  3HJM A;  4EUY A;  3GH6 A;  3APQ A;  12GS A;  1W4V A;  2VL3 A;  5KN2 A;  2IMD A;  3HVX A;  1N2A A;  4G9H A;  1ZYQ B;  4YH2 A;  3NZN A;  3RPN A;  3GV1 A;  3MNG A;  3U6V A;  4ML6 A;  5ELG A;  3ZZX A;  2B1L A;  1V2A A;  8GSS A;  3TKS E;  4JBB A;  3P7X A;  2B5Y A;  4GRF A;  5ECS A;  5ECO B;  3DD3 A;  2FHE A;  4L5L A;  4KDX A;  4IJ3 A;  2ZNM A;  4XRD A;  5HR1 A;  1O85 A;  3VUR A;  2H76 A;  4K2D A;  1XWC A;  5IIZ A;  1Z3E A;  4MMM A;  1SD9 A;  4HU9 A;  4IGJ A;  2GT5 A;  1O81 A;  4G2E A;  4J57 E;  3UJ1 A;  3L4N A;  3DKS A;  1YF0 A;  4MK3 A;  3R3E A;  3GN3 A;  3LEF A;  4CY6 A;  4GF0 A;  2YZU A;  1WJK A;  3C7M A;  2HSH A;  1T7P B;  1U6T A;  3HD5 A;  4BWQ A;  5ELA A;  4EE0 A;  3F4T A;  2PGT A;  2IFQ B;  2L57 A;  4ZB6 A;  3ZVJ A;  4LL1 B;  1F3B A;  1RK4 A;  1JZD A;  2I9H A;  4OD7 A;  3FW2 A;  2A2P A;  4XS1 A;  5IPH A;  4AGS A;  4TR0 A;  1HQO A;  16GS A;  4TOP A;  5G5F A;  1X5E A;  2HYX A;  5B7C A;  4TR4 A;  3IDV A;  4POM A;  3G7J A;  2VLT A;  2A4V A;  3GTU A;  2B5X A;  4TN8 A;  3IHG A;  5IOW A;  2NPB A;  5DAL B;  3EIN A;  3I43 A;  5CNW A;  4BVX A;  5JWR B;  2HZE A;  2PVO C;  4OFT A;  3FR6 A;  5LNK e;  2EIO A;  1B4P A;  4PQI A;  2ON5 A;  4KE3 A;  3TOU A;  2OE1 A;  5ECQ B;  4MZW A;  2VCV A;  2IMI A;  3HVV A;  3KTL A;  1TP9 A;  4N0Z A;  5IMC A;  5KN3 A;  2JSZ A;  1PSQ A;  1U87 A;  1WMJ A;  2QSI A;  4OFM A;  4BPY A;  2WUL A;  2ES7 A;  4WXT A;  1N8J A;  3TKQ A;  4LMV A;  2TRC P;  3W8S A;  4K1F A;  2IIY A;  2JZT A;  1ZYE A;  4NXI A;  4TXO B;  4V1A g;  1R5A A;  3UOM A;  1A24 A;  2O85 A;  2DSA A;  3DGQ A;  3LXZ A;  3KZQ A;  2B3S A;  4E8E A;  3EWL A;  1VF2 A;  3VPT A;  1XFL A;  2WGR A;  6GSX A;  5D9T A;  1GTU A;  1PQN A;  1TK5 B;  3LWA A;  2VL2 A;  1BAY A;  3Q19 A;  1EOH A;  3D5J A;  4G10 A; 
#chains in the Genus database with same CATH homology
 5B6N A;  3UBL A;  2HRF A;  2YCD A;  3WT1 A;  2J9H A;  3BD2 A;  1SD8 A;  4GLT A;  4XS4 A;  3H93 A;  1J0F A;  3US3 A;  1WRY A;  2C3T A;  3MYD A;  1JLV A;  3TKS A;  4IJI A;  1QFN A;  2H70 A;  2ALB A;  1AXD A;  1NM3 A;  1GSD A;  1T3B A;  2XPE A;  2LTK A;  2HNL A;  2YJH A;  3VLN A;  4MCU A;  2VCX A;  1TOF A;  1AUC A;  1B8X A;  1UC7 A;  1YY7 A;  4CY8 A;  4ZBB A;  4NV2 A;  1K3O A;  3TGZ A;  3TJB A;  1HNB A;  1GUK A;  4FYB A;  4KDY A;  2BJX A;  1ZYP A;  4GWR A;  2GZZ A;  3GX0 A;  2KP2 A;  4RUV A;  3FHK A;  5JCW A;  1GSQ A;  2H71 A;  4BVY A;  1GSS A;  1U3A A;  3HKR A;  3LOR A;  4XIH A;  2VOC A;  1UN2 A;  3WGD A;  4YQV A;  1Z6M A;  1A2J A;  1MDI A;  1XPV A;  3D6I A;  3ZRD A;  1XBS A;  4IHU A;  4TVE A;  4IP1 A;  2NBS A;  2B1K A;  2H0G A;  3I69 A;  4PX1 A;  2X8C A;  2CT6 A;  2X8G A;  4P3Y B;  3LW9 A;  4HU7 A;  3UBK A;  3EYT A;  3UAR A;  3LYK A;  2L4Q A;  4EC0 A;  1EZK A;  2R2J A;  2XBQ A;  1NW2 A;  3TRQ A;  10GS A;  1A23 A;  4AJ8 A;  3ZLP A;  3ED3 A;  5CRH A;  1K0O A;  4WR4 A;  1G6Y A;  2GGT A;  4WET A;  4FQU A;  1DUG A;  2MMN A;  5CP1 A;  3L0H A;  4JZQ A;  4K7N A;  1K3Y A;  4NHZ A;  2X64 A;  4D73 A;  2VM2 A;  2F8F A;  3TJK A;  5J4U A;  5G1L A;  1SL1 B;  1FOV A;  1M9A A;  4N10 A;  1JFU A;  2CX4 A;  4YAV A;  1ERW A;  1RQM A;  1X9M B;  3J7Y b;  3RDW A;  1FO5 A;  3KXO A;  3QR6 A;  3I9V 2;  3HDC A;  1PN0 A;  1SKS B;  4L0W A;  5DDL A;  1K0C A;  5J9C A;  1GTI A;  3Q74 A;  4F2I A;  3MSZ A;  2X8H A;  3QAG A;  1V98 A;  5DAL A;  1GLQ A;  3M8N A;  5AGY A;  1GP1 A;  1PX6 A;  5DQS A;  4MH2 A;  5G30 A;  5AIX A;  3LXT A;  2I81 A;  3F8U A;  3EU4 A;  2FWG A;  3FY7 A;  4MA9 A;  2LJR A;  3ZML A;  3ZTL A;  1F3A A;  2H0H A;  4MJB A;  1GL8 A;  5DVB A;  5IO2 A;  4MLY A;  3FKF A;  3IOS A;  1AQV A;  4ACS A;  1SYX A;  3E9J B;  4ZBA A;  2E2G A;  2WDU A;  1H75 A;  3UVT A;  2G2Q A;  4LA1 A;  2VO4 A;  4HZ4 A;  4HDE A;  2YNX A;  2K18 A;  5B6M A;  2XPD A;  2H01 A;  5IMA A;  1M9B A;  2VM1 A;  7GSS A;  2WZ9 A;  4MF6 A;  4IQA A;  3GH9 A;  2YV9 A;  3W8J A;  4Q5R A;  3I6A A;  1XZO A;  1NHY A;  4DSR A;  2E7P A;  3MWH A;  4OO4 A;  4HEA 2;  2A2R A;  5ECM B;  3GTU B;  3LFL A;  5ABR A;  3A2V A;  2YJ7 A;  2MZC A;  4BVX B;  2JSY A;  3LYP A;  3M9K A;  2FLS A;  2HZE B;  2VD1 A;  1JHB A;  2VCZ A;  2WB9 A;  3RAZ A;  4WBR D;  2LS5 A;  1AW9 A;  1LJR A;  5CRW A;  2I1U A;  4TR3 A;  4MJA A;  2C3N A;  3UEM A;  3J7Y k;  1PD2 1;  1SK0 A;  3QPM A;  4PUR A;  1Z7P A;  2M80 A;  3LSZ A;  4MZC A;  3QDN A;  4FYU A;  2AUV A;  1G7E A;  2AV4 A;  11GS A;  2H19 A;  2O7K A;  4IP6 A;  2A2S A;  4HI7 A;  4TW5 A;  4O5U A;  2DMM A;  3F9U A;  5D8I A;  5A4U A;  1A2L A;  1OYJ A;  22GS A;  4K0N A;  3UAP A;  3ZFL A;  3BBY A;  5BRT A;  1WE0 A;  5FT3 A;  2P5Q A;  2XC2 A;  1JZR A;  2CX3 A;  3A2X A;  2FD3 A;  3QAV A;  2XBI A;  2MYG A;  4YQM A;  5CO3 A;  2R0C A;  1T4Z A;  2GQM A;  1GSF A;  3IC4 A;  1V58 A;  3TKR A;  4EVM A;  3CYN A;  2WS2 A;  2IL3 A;  3EMX A;  2L59 A;  2H6Y A;  2CQ9 A;  1BJX A;  1T1V A;  2NVL A;  5E4W A;  4EDZ A;  1THX A;  1YKC A;  2VL9 A;  4JED A;  4KF9 A;  4EIP A;  3BCI A;  1SJZ A;  4Q5F A;  2JAD A;  2LEG A;  3GKN A;  5KOX A;  1CQH A;  1DE2 A;  1H4O A;  5C00 A;  2HZF A;  5H5Q A;  3QAW A;  5ECP B;  1K0M A;  4LLR A;  3P8W A;  4F9Z A;  1IYI A;  2LV3 A;  1K0D A;  3Q6O A;  3MDK A;  1S3C A;  3HZ4 A;  1ZGN A;  4BL7 B;  3IAS 2;  3GL5 A;  4BVY B;  4HZ2 A;  1ON4 A;  2AYT A;  2FWE A;  4ZB9 A;  1FB6 A;  1YEP A;  3QD9 A;  5D73 A;  1DE1 A;  1A8L A;  5HQP A;  2TRX A;  3KMO A;  2RII A;  3V1W A;  2IPA A;  4K8M A;  4KGI A;  2YP6 A;  4NWY A;  3CTG A;  2O87 A;  3CSI A;  4KA0 A;  6GSU A;  4I97 A;  4K6X A;  2H6Z A;  1QMV A;  1WOU A;  1A0F A;  5ECL B;  2MBT A;  1GWC A;  4ECJ A;  2LST A;  4KX4 A;  4L0U A;  1XOB A;  3L9S A;  4GCI A;  4N0V A;  1GSE A;  4TR1 A;  4NHW A;  4MF5 A;  3L78 A;  4POB A;  2N5B A;  3VWX A;  2OAD A;  3FRC A;  5G1K A;  2PPT A;  2DJ0 A;  2I4A A;  1YJ6 A;  4AJ6 A;  2MMO A;  2F9S A;  3HJP A;  4D73 B;  3BOA A;  3AY8 A;  2HLS A;  1Y25 A;  3FYG A;  4WF4 A;  2CVB A;  2FCH A;  2YV7 A;  1F2E A;  2LJK A;  4PUA A;  3Q18 A;  2MBS A;  2GSQ A;  4DSS B;  3FR3 A;  1AQX A;  1ZZY A;  2GSR A;  2GQL A;  1OKT A;  4XHM A;  3IA1 A;  4KSO A;  4JRR A;  2R4V A;  3D0Z A;  4OCE A;  2AB6 A;  2LKU A;  4XTS A;  1M2D A;  1GUM A;  3GA4 A;  5IPG A;  1TRS A;  2C0F A;  2BMX A;  3ERW A;  3DIE A;  1SL0 B;  2R0G A;  3K8N A;  1T00 A;  1VRS D;  1R5P A;  5D93 A;  2OA7 A;  5IOX A;  4MP4 A;  5ID2 A;  1J9B A;  1UVZ A;  2H1B A;  3GSS A;  3ZIJ A;  3PGT A;  1A0R P;  1R26 A;  2P5R A;  3GX8 A;  1XWB A;  1YDK A;  5DJL A;  5FHI A;  4HUA A;  6GSS A;  4HQS A;  1TK8 B;  1I5G A;  2FA8 A;  3PH9 A;  3KCM A;  4AF2 A;  2G0F A;  4HS1 A;  2E0Q A;  1Y6E A;  2K8S A;  1WIK A;  3GL3 A;  2JU5 A;  2CV4 A;  5IMV A;  3ZVJ D;  4CDO A;  5ECI B;  5IO0 A;  1GRX A;  1PKZ A;  4ECB A;  2YWO A;  3GST A;  1R7H A;  1TU8 A;  4V2M A;  1VF4 A;  2X99 A;  4Q5Q A;  2QA1 A;  5INY A;  1ILO A;  3CTF A;  1FB0 A;  2EC4 A;  2Z9S A;  1V57 A;  2OE3 A;  2VD0 A;  4Z2U A;  3HHV A;  4H86 A;  3WGE A;  1XWK A;  2HXK A;  2H66 A;  3G7Y A;  3ERG A;  3L9U A;  3EC3 A;  1O6J A;  3C1R A;  4FH8 A;  5G31 A;  1TI1 A;  3IBH A;  1SU9 A;  4RQR A;  2C8U A;  1KNG A;  2LQO A;  2WCI A;  3APS A;  3R2Q A;  1TI3 A;  1J08 A;  2VLV A;  3CXG A;  4WBJ A;  3IE3 A;  1TRV A;  2L4C A;  1OC9 B;  2REM A;  3KJY A;  2BTO T;  5G2Z A;  4L5O A;  4HOJ A;  1G7O A;  4PNF A;  3ZMK A;  4ICY A;  4DEJ A;  3D21 A;  18GS A;  4EKZ A;  2J23 A;  3HA9 A;  3ZL5 A;  1EV9 A;  2F51 A;  2L5L A;  1MEK A;  6GST A;  3UIW A;  1XW5 A;  2FWF A;  2DIY A;  2QA2 A;  5AIV A;  4BL7 A;  3VPQ A;  2CZ2 A;  5BMU A;  3NIV A;  3FZ4 A;  5HR0 A;  1ZOF A;  4O32 A;  1E6B A;  2AAW A;  1FAA A;  4IEL A;  4E8H A;  4K5S A;  4KND A;  2K9F A;  3LJR A;  2KP1 A;  4AJ7 A;  3RHC A;  4K9Z A;  5ECH B;  4X0X A;  3F0I A;  2JAC A;  4OWY A;  3TJF A;  2C0E A;  4HJ2 A;  2V2G A;  2V41 A;  4YQU A;  2GT6 A;  2K8V A;  2DC5 A;  5CRG A;  2GTU A;  4GSN A;  4KH7 A;  1GH2 A;  4ID0 A;  4IVF A;  1E2Y A;  1RW1 A;  4GSS A;  2FGX A;  3TJG A;  5D9W A;  2GDR A;  1OAZ A;  1FVJ A;  4POL A;  3A3T A;  5KOW A;  2R5G A;  4G0K A;  3O6T A;  3HY2 A;  3VI7 A;  2DKH A;  5CRE A;  2YN1 A;  2B6M A;  3WYW A;  3EE2 A;  1PA3 A;  2V1M A;  4NAX A;  2LQQ A;  1YF1 A;  2V32 A;  4HJM A;  1IYH A;  3GKK A;  5F8B A;  3WT2 A;  1TW9 A;  1ZYN A;  4DSS A;  2P0G A;  2ZCT A;  1FG4 A;  2NDO A;  5A5K A;  3N5O A;  2H1D A;  2QGV A;  3RBT A;  5J9B A;  1AIU A;  4ZB8 A;  4A5P A;  3TCO A;  1T4Y A;  3G7I A;  5JWQ B;  4YAP A;  4IBP A;  4PGT A;  3CBU A;  4EXJ A;  4GXZ A;  3G9B A;  4TR1 B;  2H1G A;  3HXS A;  4F03 A;  1MD3 A;  2LJA A;  4KUN A;  5KN0 A;  1U3I A;  3FZA A;  1XVQ A;  3CRU A;  4I2U A;  4J2F A;  3SWL A;  1ACV A;  4ZIJ A;  1YKA A;  2WFC A;  3TOT A;  1A8Y A;  2AJQ B;  2PER A;  1BX9 A;  2CA8 A;  5ECN B;  1KBN A;  4MNN A;  5HR3 A;  1XWG A;  2R6K A;  2LUS A;  4RI7 A;  3KEB A;  2O8V B;  4MJC A;  2KLX A;  3ME8 A;  5GST A;  1TXX A;  4ZL9 A;  1X9S B;  2E2M A;  5IMD A;  2H72 A;  2HI7 A;  1EP8 A;  4K0G A;  1QUW A;  5GAP D;  3IC8 A;  4GQF A;  4I8B A;  3M9J A;  3BCK A;  2B7J A;  2DJK A;  5DCG A;  5KEJ A;  4N11 A;  4DSQ A;  3WD6 A;  1Z5Y E;  1EV4 A;  3QOU A;  3H1N A;  4O5R A;  1QXH A;  9GSS A;  2H6X A;  1V40 A;  1M2A A;  17GS A;  2HRA A;  1EWX A;  4QL7 A;  4WKW A;  2PU9 C;  3ZRE A;  5J5N A;  3F4S A;  4YKG A;  5ID2 B;  3QFB C;  5EVO A;  1G6W A;  3H8Q A;  2H75 A;  3PIN A;  3CMI A;  3ISO A;  3IRA A;  2HE3 A;  1T8E B;  2HT9 A;  3CSH A;  4JU5 A;  4KAE A;  4PQH A;  2HSM A;  1JZO A;  3HYP A;  1EEJ A;  3GKX A;  3KP9 A;  3TRP A;  5IQY A;  1EGR A;  4PXO A;  5HFI A;  3KM6 A;  2B5E A;  2H30 A;  1SJI A;  1AC1 A;  1HNC A;  6GSY A;  2EIQ A;  2IJY A;  2C0D A;  1V9W A;  3LGC A;  4ZL8 A;  1TK0 B;  4JR6 A;  1OC9 A;  3F63 A;  19GS A;  2RUF A;  3FZ5 A;  2OAC A;  3GNJ A;  1XXU A;  1O7U A;  1YQ1 A;  2DJJ A;  1M99 A;  3D22 A;  1PL2 A;  3FK8 A;  3M0F A;  4ML1 A;  1GNW A;  1USB A;  1VF1 A;  5DJM A;  3ZFB A;  4OFN A;  4K2X A;  1THO A;  3N9J A;  5J3R A;  1GTA A;  1F9M A;  3APO A;  4BA7 A;  3HJO A;  2FY6 A;  3MIX A;  2UZ8 A;  4IW9 A;  1A2M A;  6GSV A;  4EIQ A;  3A2W A;  1TKD B;  2JZS A;  4XCS A;  4V2L A;  4KCE A;  3E0U A;  5HFK A;  3QCP A;  2AHE A;  4PNG A;  3C71 A;  3HZ8 A;  2JZR A;  3ME7 A;  1CQG A;  2L6C A;  2R3X A;  3O76 A;  4J56 E;  4IS0 A;  1OE7 A;  3DXB A;  3VWV A;  2OBK A;  3P2A A;  1GTB A;  5HR2 A;  3U5R E;  2GVP A;  3GUS A;  3M1G A;  5L71 A;  1UA5 A;  4RI6 A;  4FO5 A;  1SKW B;  3EU3 A;  2EIR A;  1GSU A;  1JLW A;  4NV5 A;  1U88 A;  1SKR B;  1VF3 A;  2RM6 A;  2F3M A;  5J41 A;  2TIR A;  3C73 A;  4POK A;  1O8W A;  1C72 A;  3TUE A;  4O5Q A;  4MPG A;  1GSY A;  4K5R A;  1SYR A;  2V6O A;  1JZW A;  4MH3 A;  3VI5 A;  4QQ7 A;  4LL4 B;  2LNT A;  5DQY A;  3DVW A;  3FEU A;  3E3E A;  5LCZ A;  1DBY A;  4X1U A;  3F6D A;  5DCH A;  2LRT A;  2R37 A;  4GST A;  5F05 A;  4WEY A;  2MMA A;  2H8L A;  2HRK A;  3KMN A;  4DVC A;  2DJ2 A;  1GUL A;  1OKD A;  3TRX A;  5ENU A;  2DJ1 A;  5C04 A;  13GS A;  5D96 A;  1TTZ A;  3D4T A;  4FIW A;  1DSB A;  3BJ5 A;  1QQ2 A;  2VAF A;  4I2T A;  1WP0 A;  5JCG A;  2QKE A;  2PBJ A;  2KUC A;  2L6D A;  4LMW A;  2IMF A;  1WPI A;  3RHB A;  3KH9 A;  2JL4 A;  1G0T A;  1NHO A;  1SL2 B;  3F4R A;  3UL3 A;  3W6G A;  2XHF A;  4QL9 A;  3TDG A;  5EPF A;  1FVK A;  4PQ1 A;  2M46 A;  1BQ7 A;  5F07 A;  2IN3 A;  5AIS A;  3S9F A;  3F6F A;  3CSJ A;  1EGO A;  2FWH A;  1X5C A;  2VL2 C;  2CVD A;  2CZ3 A;  3DVX A;  5D9V A;  2HSY A;  2PWJ A;  1GUH A;  2HRN A;  2K6V A;  3TKP A;  2DML A;  3IV4 A;  3TB2 A;  2GZP A;  3HCZ A;  2DKI A;  3NOF A;  5A4V A;  2LRC A;  5AN1 A;  2RM5 A;  1Q4J A;  4XS6 A;  3CRT A;  2FA4 A;  1ABA A;  4GQC A;  3JCM L;  1M7T A;  3GFK A;  3DML A;  3TKS C;  3VWW A;  4JR4 A;  1O73 A;  1BED A;  1QK8 A;  2ZUP A;  2I3Y A;  1FW1 A;  2VLU A;  1X0R A;  1AAZ A;  1W89 A;  5IMZ A;  3QFA C;  1Z9H A;  4G0L A;  3MAK A;  5EY6 A;  4Q5N A;  1F37 A;  2VCQ A;  4ZL7 A;  3EVI A;  2WJU A;  1ST9 A;  5LD0 A;  2OKA A;  3ZYW A;  4L8E A;  3PR8 A;  1FOH A;  4ZIL A;  2YZH A;  4PUF C;  1B48 A;  3HVS A;  1MDK A;  1XOA A;  1K0N A;  2H73 A;  2OJL A;  3IK9 A;  1B4Q A;  20GS A;  6GSW A;  4FYC A;  4CHS A;  5JWO B;  3D4M A;  5F06 A;  1XW6 A;  4OO5 A;  5ECK B;  2GS3 A;  2VIM A;  2X4A A;  4V2N A;  1LBK A;  4XRA A;  1ERT A;  1URM A;  5ECR B;  3OR5 A;  4NPB A;  2D2Z A;  4TXV A;  3O3T A;  1EEM A;  2OBI A;  3VFI A;  1SEN A;  2RLI A;  5DAK A;  4WF5 A;  1YZX A;  1PMT A;  3KH7 A;  4TKY A;  1SJ6 A;  1OC8 A;  5B8A A;  1VGL A;  3WGX A;  4ISD A;  3DRN A;  2IMK A;  5JCU A;  4ECC A;  3L9V A;  3C1S A;  4MZB A;  1Z7R A;  3P90 A;  2R0P A;  4Z2T A;  1KTE A;  2YPM A;  3A5I A;  3PPU A;  2M72 A;  2C80 A;  5A4W A;  1K0B A;  2IME A;  4MF7 A;  2GZY A;  2O89 A;  3UMA A;  3UVH A;  5DBQ A;  2YWI A;  3IXR A;  1FHE A;  3GMF A;  2DIZ A;  1AQW A;  4RQX A;  2YWM A;  2A4H A;  3DEX A;  3DYR A;  5FWG A;  5GAN D;  3EPT A;  4PTS A;  1X5D A;  4IQ1 A;  4KSM A;  4F0C A;  4ILF A;  4OCF A;  2C1Y A;  3ZIV A;  3IPZ A;  2FNO A;  5H5R A;  4KB3 A;  5KN1 A;  2CAI A;  4X4J A;  1XIY A;  5CAX A;  1SK1 A;  4USS A;  2GST A;  5G5E A;  1EOG A;  4ULX A;  4IKH A;  2IFQ A;  2HFD A;  3LQ7 A;  1PX7 A;  3F3Q A;  4MAB A;  1XCC A;  1PL1 A;  1LU4 A;  4CW9 A;  3IK7 A;  3KIJ A;  4K7I A;  4KDU A;  1S3D A;  3GUR A;  3LG6 A;  2PUK C;  1YEX A;  2YAN A;  2VCT A;  2H0I A;  1NSW A;  4F82 A;  1KEB A;  2GLR A;  5GSS A;  4JE1 A;  1ERV A;  3GKM A;  1S3A A;  2VUP A;  1TRW A;  1TU7 A;  2DJ3 A;  2IWT A;  5F0G A;  3ERF A;  3KTB A;  5D9X A;  5H5S A;  3TJJ A;  3QMX A;  3F3R A;  2LRN A;  3VWU A;  3ZIT A;  1XW9 A;  1B9Y C;  3DWV A;  4G19 A;  1TJD A;  2LNS A;  1K3L A;  4Z2R A;  2N5A A;  1GNE A;  3IR4 A;  3RPP A;  5IM9 A;  4EF0 A;  1XVW A;  1OC3 A;  1TRU A;  2KHP A;  1BG5 A;  3GRX A;  14GS A;  1I9D A;  4MPF A;  1PN9 A;  2L5O A;  4IN0 A;  1X9W B;  3SBC A;  1PGT A;  4V1A p;  1MDJ A;  4BWS A;  3C8E A;  2CAQ A;  2WRT A;  2YWN A;  5COH A;  1ERU A;  4F0B A;  2V6K A;  2H1A A;  2P31 A;  2NTO A;  3IHQ A;  1TDI A;  2FUG 2;  2N5F A;  2C3Q A;  1ZMA A;  4WR5 A;  3EUR A;  5EL8 A;  4Z7X A;  2OE0 A;  4TXO A;  1XWA A;  1PKW A;  1HNA A;  5GZZ B;  5E59 A;  4I6X A;  1R4W A;  4MJE A;  2ON7 A;  3FR9 A;  4GTU A;  4G0I A;  2CVK A;  1F6M C;  1MTC A;  1HYU A;  2GSS A;  5CYY A;  2PN8 A;  4O92 A;  2DLX A;  1Z6N A;  1ZCP A;  1HD2 A;  3VK9 A;  2PVQ A;  4NMU A;  2KOK A;  3EMP A;  4ZBD A;  1Q98 A;  4K7O A;  3KGK A;  2DBC A;  2QC7 A;  1ML6 A;  4TRX A;  2H74 A;  4EO3 A;  1ZL9 A;  2C4J A;  3FMW A;  3KP8 A;  5B8B A;  4KW6 A;  1WWJ A;  2PMT A;  1SK2 A;  1MD4 A;  4KCA A;  4YKF A;  1EP7 A;  3FZ9 A;  3GHA A;  3A5W A;  4EDY A;  2X49 A;  3IAM 2;  4HQZ A;  3GIX A;  2RUE A;  3H4K A;  4O7H A;  1OE8 A;  4ZXG A;  3KD0 A;  1OVN A;  1M2B A;  4N30 A;  3H79 A;  1M0U A;  4X43 A;  5HFG A;  4MDC A;  1BYE A;  5CRD A;  1O8X A;  2VCW A;  2B7K A;  1K0A A;  1PRX A;  4I5Q A;  2F8A A;  3M3M A;  1GLP A;  2YOI A;  5IMF A;  2GQK A;  3GYK A;  1B9X C;  5DAK B;  2MMZ A;  4OMV A;  4XS4 B;  1QGV A;  4EL1 A;  4ECI A;  2C0G A;  3HJM A;  4EUY A;  3GH6 A;  3APQ A;  12GS A;  1W4V A;  2VL3 A;  5KN2 A;  2IMD A;  3HVX A;  1N2A A;  4G9H A;  1ZYQ B;  4YH2 A;  3NZN A;  3RPN A;  3GV1 A;  3MNG A;  3U6V A;  4ML6 A;  5ELG A;  3ZZX A;  2B1L A;  1V2A A;  8GSS A;  3TKS E;  4JBB A;  3P7X A;  2B5Y A;  4GRF A;  5ECS A;  5ECO B;  3DD3 A;  2FHE A;  4L5L A;  4KDX A;  4IJ3 A;  2ZNM A;  4XRD A;  5HR1 A;  1O85 A;  3VUR A;  2H76 A;  4K2D A;  1XWC A;  5IIZ A;  1Z3E A;  4MMM A;  1SD9 A;  4HU9 A;  4IGJ A;  2GT5 A;  1O81 A;  4G2E A;  4J57 E;  3UJ1 A;  3L4N A;  3DKS A;  1YF0 A;  4MK3 A;  3R3E A;  3GN3 A;  3LEF A;  4CY6 A;  4GF0 A;  2YZU A;  1WJK A;  3C7M A;  2HSH A;  1T7P B;  1U6T A;  3HD5 A;  4BWQ A;  5ELA A;  4EE0 A;  3F4T A;  2PGT A;  2IFQ B;  2L57 A;  4ZB6 A;  3ZVJ A;  4LL1 B;  1F3B A;  1RK4 A;  1JZD A;  2I9H A;  4OD7 A;  3FW2 A;  2A2P A;  4XS1 A;  5IPH A;  4AGS A;  4TR0 A;  1HQO A;  16GS A;  4TOP A;  5G5F A;  1X5E A;  2HYX A;  5B7C A;  4TR4 A;  3IDV A;  4POM A;  3G7J A;  2VLT A;  2A4V A;  3GTU A;  2B5X A;  4TN8 A;  3IHG A;  5IOW A;  2NPB A;  5DAL B;  3EIN A;  3I43 A;  5CNW A;  4BVX A;  5JWR B;  2HZE A;  2PVO C;  4OFT A;  3FR6 A;  5LNK e;  2EIO A;  1B4P A;  4PQI A;  2ON5 A;  4KE3 A;  3TOU A;  2OE1 A;  5ECQ B;  4MZW A;  2VCV A;  2IMI A;  3HVV A;  3KTL A;  1TP9 A;  4N0Z A;  5IMC A;  5KN3 A;  2JSZ A;  1PSQ A;  1U87 A;  1WMJ A;  2QSI A;  4OFM A;  4BPY A;  2WUL A;  2ES7 A;  4WXT A;  1N8J A;  3TKQ A;  4LMV A;  2TRC P;  3W8S A;  4K1F A;  2IIY A;  2JZT A;  1ZYE A;  4NXI A;  4TXO B;  4V1A g;  1R5A A;  3UOM A;  1A24 A;  2O85 A;  2DSA A;  3DGQ A;  3LXZ A;  3KZQ A;  2B3S A;  4E8E A;  3EWL A;  1VF2 A;  3VPT A;  1XFL A;  2WGR A;  6GSX A;  5D9T A;  1GTU A;  1PQN A;  1TK5 B;  3LWA A;  2VL2 A;  1BAY A;  3Q19 A;  1EOH A;  3D5J A;  4G10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...