3ZVJD

Crystal structure of high molecular weight (hmw) form of peroxiredoxin i from schistosoma mansoni
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
168
structure length
168
Chain Sequence
b'MVLLPNRPAPEFKGQAVINGEFKEICLKDYRGKYVVLFFYPADFTFVCPTEIIAFSDQVEEFNSRNCQVIACSTDSQYSHLAWDNLDRKSGGLGHMKIPLLADRKQEISKAYGVFDEEDGNAFRGLFIIDPNGILRQITLNDKPVGRSVDETLRLLDAFQFVEKHGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN PEROXIDASE
publication title Moonlighting by Different Stressors: Crystal Structure of the Chaperone Species of a 2-Cys Peroxiredoxin.
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Oxidoreductase
total genus 33
structure length 168
sequence length 168
ec nomenclature ec 1.11.1.15: Peroxiredoxin.
pdb deposition date 2011-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00578 AhpC-TSA AhpC/TSA family
D PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3zvjD00
5ECOB 2B5YA 3EU4A 4AJ8A 11GSA 2HSHA 3BBYA 3WGDA 5JCUA 1HNAA 2WB9A 1A8LA 3KXOA 4GXZA 1EOGA 1YKAA 2R5GA 1UA5A 4GSSA 5D9WA 1X9SB 1K0BA 4V2NA 3G7JA 2EIOA 1WP0A 4KNDA 2V6OA 3M8NA 1B9YC 2FHEA 3LGCA 3EMXA 4OFTA 4RUVA 3UMAA 5DCGA 4ECJA 1OC9B 1GP1A 4TR1A 1GUMA 1BEDA 4WXTA 2IMFA 2DSAA 3FEUA 1SJZA 1YKCA 4TRXA 3CXGA 1H4OA 2E7PA 5G1KA 1R7HA 5DQYA 5ECIB 1ZMAA 3F4RA 4TR3A 16GSA 2L57A 1M2DA 1TI3A 3EURA 17GSA 4GQCA 1KBNA 2M72A 3CRUA 2FWEA 1R5PA 1Q4JA 5H5QA 1RW1A 3ZZXA 3KM6A 1AW9A 2H66A 2IMDA 4YQMA 1T4YA 3DXBA 4IS0A 1NHOA 2O8VB 1XW5A 3UAPA 1T7PB 3HCZA 4WF4A 2NPBA 5ID2B 2OBIA 1VF1A 12GSA 5H5RA 2LRTA 2JL4A 4BVXA 3IOSA 2MZCA 2YJ7A 3W8SA 5F0GA 4ZB9A 2H1AA 5ECMB 1X0RA 3LXTA 3G7IA 3EU3A 2NBSA 1URMA 3J7Yk 3NZNA 4L5LA 5EL8A 4MABA 5C00A 3UOMA 3UBLA 2YZUA 3M9JA 1A0FA 2K8SA 2F3MA 2OBKA 2GSTA 2VUPA 3ZIVA 1K3OA 2YV9A 2LRCA 1PL1A 1N8JA 2VAFA 1B4QA 2X8CA 2IL3A 5J9CA 3P7XA 18GSA 4KW6A 1HYUA 4XS6A 2B5EA 3FZ5A 2B1KA 2DMLA 5GZZB 3DVWA 5ECKB 4KUNA 3GRXA 4ECBA 1YDKA 3MDKA 3DEXA 1AIUA 3TKSE 2L59A 4KSOA 3A2XA 2AV4A 1B48A 3VK9A 4IN0A 3KH7A 4ZBAA 3QMXA 1XVWA 2PU9C 2YWOA 1TRWA 3VPTA 5ELAA 1XZOA 4ZBDA 1TKDB 1N2AA 1XCCA 2XBIA 4E8HA 1F37A 4NWYA 1JFUA 1TK8B 1JZOA 10GSA 2N5FA 4MZBA 3IC4A 5G5EA 1BQ7A 4EDYA 5A4VA 3IR4A 3Q19A 1PKZA 4JZQA 3QFBC 1TOFA 3M3MA 4ZBBA 4IJIA 3C8EA 3D4TA 1SL1B 1BAYA 2C4JA 3TJGA 4JR6A 4FO5A 4FH8A 1ILOA 2CV4A 4K7NA 2DJJA 2M80A 4YQVA 5CREA 1Q98A 4YAVA 1GNWA 1TU7A 2R2JA 2WRTA 2P31A 5D9XA 2C0GA 1PSQA 2WULA 2HZEB 2HXKA 3L0HA 2HI7A 4HZ4A 3LQ7A 4K0NA 3LYPA 2X64A 3H93A 4K7IA 3D22A 1C72A 1UVZA 3PINA 2YJHA 1J08A 3CTGA 4FYUA 2YNXA 1J0FA 4KCEA 1SL0B 2A2SA 5DVBA 3M1GA 5INYA 1U87A 2EIQA 4ZL8A 4K0GA 2B1LA 3RHCA 3ZIJA 3P2AA 1K0AA 5CO3A 5AGYA 2O87A 1DBYA 1W4VA 2GSRA 1ZOFA 1GSEA 3IK9A 2R4VA 1O6JA 1MD4A 3EE2A 4TR4A 1PMTA 1QGVA 2V2GA 1S3DA 3FY7A 3GUSA 4LL1B 3CTFA 1R26A 1A24A 3ZVJA 3DMLA 3GTUA 3MSZA 2IPAA 1GTIA 1FB0A 1OKDA 4QL9A 4G9HA 2OE0A 3J7Yb 2H1GA 4D73A 2CVKA 3WD6A 1V2AA 3VI5A 1UN2A 4BWSA 1ERTA 3HXSA 4HS1A 3SBCA 2AYTA 2D2ZA 4EC0A 3RAZA 2PERA 1GNEA 3F9UA 4PUAA 4IKHA 2YOIA 1OC8A 3QD9A 2LJRA 4OFNA 1FB6A 3DGQA 3HJOA 4LLRA 1T3BA 2ZNMA 4LA1A 2OE1A 2I4AA 1Z3EA 4ZL7A 2N5BA 5F06A 2IJYA 3WGEA 1SD9A 4EDZA 4WF5A 1JZDA 3APQA 4N0VA 2MBTA 2XHFA 1GSQA 3C1RA 5EVOA 5D93A 1GSUA 1Z6NA 6GSSA 3GL3A 1RQMA 3KIJA 4K7OA 1MDKA 1SJ6A 4PX1A 3VPQA 3U5RE 5D9VA 1UC7A 3JCML 5J5NA 4QQ7A 1GRXA 3R2QA 1ERUA 3TKRA 1BG5A 1TXXA 2O85A 2DJ0A 4OD7A 4ID0A 2CVBA 3IAM2 3HYPA 4POMA 1F3BA 1T4ZA 2H0IA 1OYJA 1XW9A 3UEMA 2GGTA 5A4WA 3F4TA 4EVMA 3ZFLA 2JSYA 4ILFA 2B7KA 2VL2A 3KJYA 1SENA 3BD2A 4KCAA 1K3YA 3QAVA 3GL5A 1PA3A 4DEJA 1YF0A 3GH9A 1GTAA 4JRRA 2VD1A 5DCHA 5ECLB 5G30A 1X5CA 1GSFA 1SJIA 2C3NA 4KAEA 3TRXA 1F3AA 3N5OA 3HJPA 4BWQA 1XWAA 2LQQA 2GT6A 3F3RA 1OKTA 4OO4A 4X43A 3KEBA 2CX4A 2O7KA 4QL7A 4TXOA 1DE2A 1SU9A 3ERGA 2CA8A 3QFAC 3O76A 4I2UA 2WCIA 5JCGA 3TKPA 1O81A 4YQUA 2F8FA 2V6KA 2KP1A 3TRQA 2MMZA 5JWOB 1Z7RA 2GS3A 2HSYA 1XWGA 3H1NA 4ZILA 1GTUA 2PWJA 3GHAA 1TRSA 2KLXA 5IMZA 2R37A 4MLYA 2GVPA 4I97A 2V1MA 3L4NA 4EUYA 4F9ZA 4KB3A 4PQ1A 4MZCA 4JEDA 3WT2A 1DE1A 2H8LA 1FAAA 3VFIA 4XS1A 2ON5A 3D0ZA 1GSYA 2HZFA 2C1YA 5DBQA 2CVDA 3WT1A 2LQOA 2N5AA 2IIYA 2H01A 3ZLPA 2L6DA 3FZAA 3Q74A 4XRAA 4HOJA 3QR6A 3KMOA 2AHEA 3CYNA 1PD21 3L9UA 2GQMA 4L0UA 4GLTA 1O8XA 5L71A 1MTCA 3VWVA 1WMJA 2HLSA 5HQPA 3AY8A 5JWQB 3LSZA 4HJMA 3EYTA 3IPZA 2CAIA 1OE8A 5H5SA 4XS4B 5KN2A 3GNJA 4MA9A 1FW1A 1R5AA 3A3TA 4K8MA 1HD2A 4MJEA 2GDRA 2VLVA 1ZYEA 3CSIA 3TRPA 5AISA 2IMEA 1V40A 3F8UA 2KHPA 4MH2A 2PGTA 1U3IA 2X99A 3I69A 1XVQA 1B8XA 5ECHB 1QQ2A 4PQHA 5DAKB 3O3TA 4RI6A 1V57A 4HQSA 4JU5A 4POBA 2AAWA 5DDLA 1V98A 2M46A 1I5GA 1ZYQB 3G9BA 4WR5A 5J41A 5CRHA 2IFQA 4Q5NA 5F07A 3FW2A 1FO5A 4F0BA 4WEYA 2C8UA 4V1Ap 5ECSA 2YCDA 5ECQB 1MDIA 2ALBA 1TTZA 1TI1A 2FUG2 3GN3A 4MJBA 3ZRDA 3QPMA 4RI7A 3GKXA 1QFNA 3MAKA 4H86A 3IDVA 1GH2A 2LSTA 3KZQA 3RPPA 2HE3A 3APSA 2PMTA 3I6AA 3PR8A 1GWCA 5ABRA 5KN0A 3GKMA 2F9SA 4JR4A 5J3RA 2MMNA 2TIRA 2XPDA 3IXRA 6GSXA 2VCQA 1VF2A 5HR1A 5F05A 3KP9A 4TR1B 3TJKA 4KDUA 2CAQA 2ZCTA 2MMAA 2GZPA 2L5OA 1IYIA 4E8EA 3KTBA 4XHMA 5CRGA 1WPIA 5GAPD 3QDNA 3ISOA 5HFIA 5D73A 2KOKA 1M9AA 2GZZA 3LWAA 5IQYA 1XOAA 3OR5A 4EE0A 2K9FA 3F3QA 2GZYA 3GYKA 2DJKA 4FIWA 2X8HA 3UJ1A 3C1SA 2B7JA 1TK5B 4G10A 5ECPB 1Z9HA 5A4UA 1FVJA 2OADA 1A23A 4ECIA 1TRUA 2NVLA 5B8BA 2YPMA 4KSMA 1USBA 5IMFA 4HDEA 5CRWA 4WR4A 4L5OA 1M99A 4NPBA 2K18A 4GWRA 1M2AA 2GQLA 1FVKA 4ECCA 5EY6A 4TXVA 4F03A 5B8AA 6GSVA 4MJCA 4DSRA 2BJXA 4XRDA 1EV4A 2TRCP 3S9FA 2VIMA 4F82A 4N0ZA 2IMIA 3ZL5A 1WRYA 4HU7A 5CRDA 1QXHA 4KH7A 3TKSA 4CHSA 3TJBA 3HDCA 3LORA 3LYKA 3TJJA 1EEJA 2AUVA 2JU5A 3M9KA 4TVEA 3IHQA 3W6GA 1T8EB 2CZ3A 2VLTA 5FHIA 2HRNA 5D96A 3LXZA 3V1WA 3TOUA 4TN8A 2GTUA 3UARA 1F6MC 5J4UA 1FG4A 3LJRA 2GLRA 3FKFA 4KDXA 4AJ6A 2RM5A 4GF0A 1ON4A 5AIXA 1U3AA 1XWCA 3P90A 3W8JA 4K9ZA 3FR9A 4IQAA 2B3SA 1BJXA 1PN9A 3FZ9A 5AN1A 3VWUA 4NV2A 3F6DA 2PVOC 4BVYA 1LU4A 3FRCA 2G2QA 2J9HA 4V1Ag 1QUWA 2H1DA 5CP1A 3KP8A 2LTKA 2VO4A 2OKAA 2YWIA 1B4PA 1XOBA 2PBJA 4ULXA 4IW9A 4MDCA 2JACA 5G2ZA 2MBSA 2WGRA 3HZ4A 2REMA 5IOWA 2C3TA 1MEKA 4TW5A 4AF2A 5DALA 4EO3A 3KD0A 2KP2A 4MPGA 2I9HA 1HNCA 3GKNA 1K0MA 1X9MB 4F2IA 1A2MA 1WIKA 3DYRA 3I43A 2C0DA 4WBRD 1A2JA 1QMVA 2H73A 4OCFA 5IO2A 4JE1A 1TDIA 5B6NA 2H6XA 4JBBA 1K0DA 4Z7XA 1VGLA 4KGIA 4ZB6A 2H74A 6GSWA 5G5FA 4OMVA 2LNSA 4TOPA 3F4SA 3ME8A 5G31A 2H30A 19GSA 1F9MA 1ST9A 5LNKe 3CSJA 1JHBA 5D9TA 3VWXA 1IYHA 1XIYA 3ERFA 1MDJA 2L5LA 2H6YA 2FGXA 3TCOA 4ISDA 2QSIA 2RUFA 4KDYA 4NMUA 1BX9A 1EZKA 5E59A 4HU9A 2MMOA 3FYGA 3IRAA 1SKSB 3DVXA 1G0TA 2CZ2A 3GTUB 2GSQA 2FCHA 3FK8A 2G0FA 2VOCA 3VLNA 1W89A 5G1LA 1ERWA 3GMFA 1NHYA 2E2GA 4RQRA 4MF6A 4IELA 3H79A 4DSSB 4D73B 2H72A 3KCMA 4I2TA 4MF7A 4MMMA 5E4WA 2TRXA 2LUSA 5B7CA 4PURA 5HR0A 2DJ2A 4YH2A 2DBCA 2L6CA 3HZ8A 2XPEA 2C0FA 4MF5A 3HVVA 5IMDA 4XIHA 4GQFA 2JSZA 4OFMA 4MZWA 2VL2C 3O6TA 5B6MA 1Z7PA 1K0NA 3HJMA 3GSTA 3VI7A 4Q5QA 2DC5A 3FHKA 2HRFA 4GTUA 3IE3A 4HQZA 3F6FA 1QK8A 1PRXA 3RBTA 4YAPA 1R4WA 1XWBA 3EMPA 1Z5YE 1G6WA 2RUEA 20GSA 4WKWA 1XWKA 2K8VA 2EC4A 3GFKA 2FWHA 4DVCA 3TB2A 2OACA 3GV1A 4XCSA 3TUEA 1M9BA 4J2FA 4PNFA 5ENUA 2BMXA 2YN1A 4Q5RA 1EGOA 2P5RA 3CRTA 3C71A 6GSYA 3RDWA 3HHVA 4ML1A 4WETA 4K6XA 3ERWA 3GA4A 4XS4A 3UVTA 1GLPA 3DIEA 5IMCA 14GSA 1TJDA 5GSSA 3PGTA 3VURA 1OC3A 9GSSA 4L8EA 1XXUA 2LKUA 2H76A 1OC9A 4GCIA 1ACVA 3UBKA 3GIXA 2VCWA 4NHWA 1GLQA 1E6BA 4PXOA 2L4QA 3D21A 2DJ3A 3UL3A 5IIZA 2VD0A 2WFCA 1TP9A 1A0RP 6GSTA 3VWWA 2DJ1A 1I9DA 3ZITA 1A8YA 1G6YA 4J56E 5AIVA 4ML6A 3L9VA 2YZHA 1K0OA 4V2LA 1GULA 1X5DA 2H75A 4IVFA 1TW9A 5ELGA 1OE7A 1MD3A 5CAXA 3HA9A 4HZ2A 2DMMA 2R3XA 4I5QA 2JZTA 1PQNA 5ID2A 2LNTA 4LMWA 4TXOB 1VRSD 2JZSA 3ME7A 4O7HA 1XPVA 2VM1A 2LV3A 3MWHA 2J23A 3QAWA 1NM3A 3BOAA 3ZMLA 1LJRA 3EINA 3F63A 4OWYA 3ZVJD 4PGTA 4POLA 1NSWA 4IQ1A 4WBJA 2GSSA 3C73A 3C7MA 2BTOT 2WJUA 2O89A 4GRFA 3TOTA 1BYEA 2EIRA 1Y6EA 3ED3A 2H1BA 4POKA 5FWGA 4MH3A 5GAND 1WE0A 1AXDA 1VF3A 4LL4B 1KNGA 3KGKA 3FZ4A 4G2EA 4HI7A 3TDGA 4O5RA 2YANA 3D4MA 2VCTA 1JLWA 1X9WB 2B5XA 1GUHA 4IGJA 2H0HA 2AJQB 4EKZA 2C0EA 3BJ5A 1XW6A 2RLIA 2H70A 4HEA2 5FT3A 3N9JA 4CW9A 2LEGA 1TU8A 5IMVA 1S3CA 1RK4A 3ZFBA 2E0QA 1Z6MA 3M0FA 2I1UA 1DUGA 1O7UA 2ON7A 4V2MA 1DSBA 2QC7A 4O92A 1O85A 5LD0A 3IAS2 3IV4A 5IMAA 2WS2A 5D8IA 7GSSA 2LRNA 4ZXGA 1EGRA 5KN3A 5IO0A 4BA7A 1TRVA 8GSSA 1KEBA 3ZYWA 2IFQB 1PGTA 4KA0A 3U6VA 4IP1A 22GSA 2NTOA 3HY2A 6GSUA 1K3LA 4NV5A 1T1VA 2XC2A 2QGVA 2HZEA 4IP6A 2V32A 4ZB8A 2CT6A 5JWRB 2OJLA 4N11A 4G19A 1U88A 4EF0A 2VLUA 1K0CA 2PVQA 3HD5A 4K2DA 3G7YA 1PL2A 1O8WA 3GURA 4J57E 2PUKC 2DIYA 2FA4A 4LMVA 3TKSC 1EWXA 2PN8A 5HR3A 2I81A 2IN3A 3NIVA 3HKRA 3QCPA 1SYRA 1ZL9A 2FLSA 5ECNB 3KTLA 2DIZA 3MNGA 5HFGA 2FY6A 4TKYA 5JCWA 1F2EA 1Y25A 5J9BA 4DSQA 1XBSA 4MK3A 3DD3A 1YZXA 2ES7A 1OAZA 4EXJA 1WWJA 3PH9A 3GH6A 5EPFA 3GX0A 1WOUA 3EC3A 4FYBA 4K1FA 4Q5FA 1PX7A 1J9BA 3CSHA 3ZTLA 3DKSA 2HNLA 3P8WA 1ZGNA 4XTSA 1AQVA 4GSTA 1OVNA 1G7EA 1EEMA 2OA7A 2A2RA 4GSNA 4X1UA 1AUCA 3FR6A 3DWVA 1PX6A 5DJMA 3QOUA 1EP8A 1CQHA 1M0UA 1X5EA 3FR3A 1FOVA 4CDOA 2YWNA 1NW2A 1B9XC 2WZ9A 1AQWA 3EVIA 3H4KA 1AAZA 2CX3A 2VCXA 2CQ9A 1SL2B 2AB6A 5IOXA 1JLVA 1GSDA 1SK0A 3BCKA 3GX8A 2KUCA 1U6TA 3WGXA 2R6KA 1GL8A 3I9V2 4X0XA 3TGZA 5IPHA 1THOA 2JADA 3LFLA 3KMNA 4I8BA 3NOFA 2WDUA 1ABAA 3QAGA 3D6IA 1YQ1A 4DSSA 2HFDA 2K6VA 4PQIA 1E2YA 5F8BA 4PNGA 2YP6A 3DRNA 3IA1A 3LEFA 1V9WA 4N10A 4I6XA 2C80A 2NDOA 4IJ3A 5KN1A 1SYXA 3UIWA 4FYCA 4HJ2A 1EOHA 2GQKA 2RIIA 1A2LA 5IPGA 1KTEA 1V58A 5CYYA 2QKEA 1TK0B 13GSA 4ACSA 1HQOA 5IM9A 3APOA 3SWLA 2L4CA 5ECRB 2IWTA 2LS5A 2VCZA 4N30A 4P3YB 2XBQA 3UVHA 2V41A 1SKWB 1JZWA 1YF1A 1CQGA 1ZZYA 5DALB 4O32A 3D5JA 1WJKA 3TJFA 4MPFA 3CMIA 5KEJA 4MP4A 2HYXA 3E3EA 5C04A 4NHZA 1JZRA 3HVXA 2FNOA 3BCIA 3US3A 2VL3A 1HNBA 5GSTA 4L0WA 1G7OA 4EL1A 3F0IA 1XFLA 2LJKA 4OO5A 2LJAA 2B6MA 3RPNA 1SD8A 3A5WA 2F8AA 2RM6A 2FA8A 5DJLA 4ZIJA 3IBHA 1EP7A 5HR2A 1AC1A 2VL9A 3HVSA 2H0GA 1O73A 2FWFA 2A4VA 4NXIA 3TKQA 3H8QA 3RHBA 2ZUPA 3A2VA 1LBKA 1VF4A 1H75A 2H71A 2PPTA 2YV7A 1FHEA 1S3AA 3Q18A 2DLXA 1GUKA 3ZREA 4F0CA 3LG6A 2MYGA 4BPYA 2FD3A 3E0UA 2Z9SA 3L78A 2X8GA 1YJ6A 1SK2A 4HUAA 1AQXA 1PKWA 1YEPA 3CBUA 5COHA 1SKRB 3GKKA 1YY7A 4KX4A 5DQSA 4ZL9A 3ZMKA 1M2BA 4PUFC 3L9SA 1ERVA 2OE3A 3A2WA 5CNWA 2FWGA 4OCEA 2H19A 4AJ7A 2P0GA 3KH9A 2E2MA 1SK1A 2VCVA 5A5KA 5LCZA 2F51A 1GSSA 1GTBA 3WYWA 4MJAA 4TR0A 3GSSA 4MCUA 4AGSA 1M7TA 2IMKA 2HT9A 5HFKA 2H6ZA 2P5QA 4IBPA 1T00A 3E9JB 1ZCPA 2VM2A 3K8NA 4KE3A 2YWMA 1YEXA 2I3YA 2JZRA 2C3QA 5DAKA 2GT5A 3EWLA 3IK7A 1ML6A 1EV9A 3Q6OA 1THXA 4NAXA 4IHUA 4RQXA 4BL7A
chains in the Genus database with same CATH superfamily
5ECOB 2B5YA 3EU4A 4AJ8A 11GSA 2HSHA 3BBYA 3WGDA 5JCUA 1HNAA 2WB9A 1A8LA 3KXOA 4GXZA 1EOGA 1YKAA 2R5GA 1UA5A 4GSSA 5D9WA 1X9SB 1K0BA 4V2NA 3G7JA 2EIOA 1WP0A 4KNDA 2V6OA 3M8NA 1B9YC 2FHEA 3LGCA 3EMXA 4OFTA 4RUVA 3UMAA 5DCGA 4ECJA 1OC9B 1GP1A 4TR1A 1GUMA 1BEDA 4WXTA 2IMFA 2DSAA 3FEUA 1SJZA 1YKCA 4TRXA 3CXGA 1H4OA 2E7PA 5G1KA 1R7HA 5DQYA 5ECIB 1ZMAA 3F4RA 4TR3A 16GSA 2L57A 1M2DA 1TI3A 3EURA 17GSA 4GQCA 1KBNA 2M72A 3CRUA 2FWEA 1R5PA 3FMWA 1Q4JA 5H5QA 1RW1A 3ZZXA 3KM6A 1AW9A 2H66A 2IMDA 4YQMA 1T4YA 3DXBA 4IS0A 4YKGA 1NHOA 2O8VB 1XW5A 3UAPA 1T7PB 3HCZA 4WF4A 2NPBA 5ID2B 2OBIA 1VF1A 12GSA 5H5RA 2LRTA 2JL4A 4BVXA 3IOSA 2MZCA 2YJ7A 3W8SA 5F0GA 4ZB9A 2H1AA 5ECMB 1X0RA 3LXTA 3G7IA 3EU3A 2NBSA 1URMA 3J7Yk 3NZNA 4L5LA 5EL8A 4MABA 5C00A 3UOMA 3UBLA 2YZUA 3M9JA 1A0FA 2K8SA 2F3MA 2OBKA 2GSTA 2VUPA 3ZIVA 1S3RA 1K3OA 2YV9A 2LRCA 1PL1A 1N8JA 2VAFA 1B4QA 2X8CA 2IL3A 2DKIA 5J9CA 3P7XA 18GSA 4KW6A 1HYUA 4XS6A 2B5EA 3FZ5A 2B1KA 2DMLA 5GZZB 3DVWA 5ECKB 4KUNA 3GRXA 3A5IA 4ECBA 1YDKA 3MDKA 3DEXA 1AIUA 3TKSE 2X49A 2HRAA 2L59A 4KSOA 3A2XA 2AV4A 1B48A 3VK9A 4IN0A 3KH7A 4ZBAA 3QMXA 1XVWA 2PU9C 2YWOA 1TRWA 3VPTA 5ELAA 1XZOA 4ZBDA 1TKDB 1N2AA 1XCCA 2XBIA 4E8HA 1F37A 4NWYA 1JFUA 1TK8B 1JZOA 10GSA 2N5FA 4MZBA 3IC4A 4A5PA 5G5EA 1BQ7A 4EDYA 5A4VA 3IR4A 3Q19A 1PKZA 4JZQA 3QFBC 1TOFA 3M3MA 4ZBBA 4HSCX 4IJIA 3C8EA 3D4TA 1SL1B 1BAYA 2C4JA 3TJGA 4JR6A 4FO5A 4FH8A 1ILOA 2CV4A 4K7NA 2DJJA 2M80A 4YQVA 5CREA 1Q98A 4PTSA 1GNWA 1TU7A 4YAVA 2R2JA 2WRTA 2P31A 5D9XA 2C0GA 1PSQA 2WULA 2HZEB 2HXKA 3L0HA 2HI7A 4HZ4A 3LQ7A 4K0NA 3LYPA 2X64A 3H93A 4K7IA 3D22A 1C72A 1UVZA 3PINA 2YJHA 1J08A 3CTGA 4FYUA 2YNXA 1J0FA 4KCEA 1SL0B 2A2SA 5DVBA 3M1GA 5INYA 1U87A 2EIQA 4ZL8A 4K0GA 2B1LA 3RHCA 3ZIJA 3P2AA 1K0AA 5CO3A 5AGYA 2O87A 1DBYA 1W4VA 2GSRA 1ZOFA 1GSEA 4Z2UA 3IK9A 3EPTA 2R4VA 1O6JA 1MD4A 5KOXA 3EE2A 4TR4A 1PMTA 1QGVA 2V2GA 1S3DA 3FY7A 4EIQA 3GUSA 4LL1B 3CTFA 1M3IA 1R26A 1A24A 3ZVJA 3DMLA 3GTUA 3MSZA 2IPAA 1GTIA 1FB0A 1OKDA 4QL9A 4G9HA 2OE0A 3J7Yb 2H1GA 4D73A 2CVKA 3WD6A 1V2AA 3VI5A 5BMUA 1UN2A 4BWSA 1ERTA 3HXSA 4HS1A 3SBCA 2AYTA 2D2ZA 4EC0A 3RAZA 2PERA 1GNEA 3F9UA 4PUAA 4IKHA 2YOIA 1OC8A 3QD9A 2LJRA 3HVNA 4OFNA 1FB6A 3DGQA 3HJOA 4LLRA 1T3BA 2ZNMA 4LA1A 2OE1A 2I4AA 1Z3EA 4ZL7A 3IC8A 2N5BA 4K5RA 5F06A 2IJYA 3WGEA 1SD9A 4EDZA 4WF5A 1JZDA 3APQA 4N0VA 2MBTA 2XHFA 1GSQA 3C1RA 4MNNA 5EVOA 5D93A 1GSUA 1Z6NA 6GSSA 3GL3A 1RQMA 3KIJA 4K7OA 1MDKA 1SJ6A 4PX1A 3VPQA 3U5RE 5D9VA 1UC7A 3JCML 5J5NA 4QQ7A 1GRXA 3R2QA 1ERUA 3CQFA 3TKRA 1BG5A 1TXXA 2R0CA 2O85A 2DJ0A 2QA2A 4OD7A 4ID0A 2CVBA 3IAM2 3HYPA 4POMA 1F3BA 1T4ZA 2H0IA 1OYJA 1XW9A 3UEMA 2GGTA 5A4WA 3F4TA 4EVMA 3ZFLA 2JSYA 4ILFA 2B7KA 2VL2A 3KJYA 1SENA 3BD2A 4KCAA 1K3YA 4X4JA 3QAVA 3GL5A 1PA3A 4DEJA 1YF0A 3GH9A 1GTAA 4JRRA 2VD1A 5DCHA 5ECLB 5G30A 1X5CA 1GSFA 1SJIA 2C3NA 4KAEA 4K2XA 3TRXA 1F3AA 3N5OA 3HJPA 4BWQA 1XWAA 2LQQA 2GT6A 3F3RA 1OKTA 4OO4A 4X43A 3KEBA 2CX4A 2O7KA 4QL7A 3MYDA 2R0PA 4TXOA 1DE2A 1SU9A 3ERGA 2CA8A 3QFAC 3O76A 4I2UA 2WCIA 5JCGA 4USSA 3TKPA 1O81A 4YQUA 2F8FA 2V6KA 2KP1A 3TRQA 2MMZA 5JWOB 1Z7RA 2GS3A 2HSYA 1XWGA 3H1NA 4ZILA 1GTUA 2PWJA 3GHAA 1TRSA 2KLXA 5IMZA 2R37A 4MLYA 2GVPA 4I97A 2V1MA 3L4NA 4EUYA 4F9ZA 4KB3A 4PQ1A 4MZCA 4JEDA 3WT2A 1DE1A 2H8LA 1FAAA 3VFIA 4XS1A 2ON5A 3D0ZA 1GSYA 2HZFA 2C1YA 5DBQA 2CVDA 3WT1A 2LQOA 2N5AA 2IIYA 2H01A 4CY6A 3ZLPA 2L6DA 3FZAA 3Q74A 4XRAA 4HOJA 3QR6A 3KMOA 2AHEA 3CYNA 1PD21 3L9UA 2GQMA 4L0UA 4GLTA 1O8XA 5L71A 1MTCA 3VWVA 1WMJA 2HLSA 5HQPA 3AY8A 5JWQB 3LSZA 4HJMA 3EYTA 3IPZA 2CAIA 1OE8A 5H5SA 4XS4B 5KN2A 3GNJA 4MA9A 1FW1A 1R5AA 1ZYNA 3A3TA 4K8MA 1HD2A 4MJEA 2GDRA 2VLVA 4G0IA 1ZYEA 2HSMA 3CSIA 3TRPA 5AISA 2IMEA 1V40A 3F8UA 2KHPA 4MH2A 2PGTA 1U3IA 2X99A 3I69A 1XVQA 1B8XA 5ECHB 1QQ2A 4PQHA 5DAKB 3O3TA 4RI6A 1V57A 4HQSA 4JU5A 4POBA 2AAWA 5DDLA 1V98A 2M46A 1I5GA 4BL7B 1ZYQB 3G9BA 4WR5A 5J41A 5CRHA 2IFQA 4Q5NA 5F07A 3FW2A 1FO5A 4F0BA 4WEYA 2C8UA 4V1Ap 5ECSA 2YCDA 5ECQB 1MDIA 2ALBA 1TTZA 1TI1A 2FUG2 3GN3A 4MJBA 3ZRDA 3QPMA 4RI7A 3GKXA 1QFNA 3MAKA 4H86A 3IDVA 1GH2A 2LSTA 3KZQA 3RPPA 2HE3A 3APSA 4ICYA 2PMTA 3I6AA 3PR8A 1GWCA 5ABRA 5KN0A 3GKMA 2F9SA 4JR4A 5J3RA 2MMNA 2TIRA 2XPDA 3IXRA 6GSXA 2VCQA 1VF2A 5HR1A 5F05A 3KP9A 4TR1B 3TJKA 4KDUA 2CAQA 2ZCTA 2MMAA 2GZPA 2L5OA 1IYIA 4E8EA 3KTBA 4XHMA 5CRGA 1WPIA 5GAPD 3QDNA 3ISOA 4O5UA 5HFIA 5D73A 2KOKA 1M9AA 2GZZA 3LWAA 5IQYA 1XOAA 3OR5A 4EE0A 2K9FA 3F3QA 2GZYA 3GYKA 2DJKA 4FIWA 2X8HA 3UJ1A 2A2PA 3C1SA 2B7JA 1TK5B 4G10A 5ECPB 1Z9HA 5A4UA 1FVJA 2OADA 1A23A 4ECIA 1TRUA 2NVLA 1M3JA 5B8BA 2YPMA 4KSMA 1USBA 4BVXB 5IMFA 4HDEA 5CRWA 4WR4A 4L5OA 1M99A 4NPBA 2K18A 4GWRA 2HRKA 1M2AA 2GQLA 1FVKA 4ECCA 5EY6A 4TXVA 4F03A 5B8AA 6GSVA 1PFOA 4MJCA 4DSRA 2BJXA 4XRDA 1EV4A 2TRCP 3S9FA 2VIMA 4F82A 4N0ZA 2IMIA 3ZL5A 1FOHA 1WRYA 4HU7A 5CRDA 1QXHA 4KH7A 3TKSA 4CHSA 3TJBA 3HDCA 3LORA 3LYKA 3TJJA 1EEJA 2AUVA 2JU5A 3M9KA 4TVEA 3IHQA 3W6GA 1T8EB 2CZ3A 2VLTA 5FHIA 2HRNA 5D96A 3LXZA 3V1WA 3TOUA 4TN8A 2GTUA 3UARA 1F6MC 5J4UA 1FG4A 3LJRA 2GLRA 3FKFA 4KDXA 5BRTA 4AJ6A 2QA1A 2RM5A 1ON4A 4GF0A 5AIXA 1U3AA 1XWCA 3P90A 3W8JA 4K9ZA 3FR9A 4IQAA 2B3SA 1BJXA 1PN9A 3FZ9A 5AN1A 3VWUA 4NV2A 3F6DA 2PVOC 4BVYA 1LU4A 3FRCA 2G2QA 2J9HA 4V1Ag 1QUWA 2H1DA 5CP1A 3KP8A 2LTKA 2VO4A 2OKAA 2YWIA 1B4PA 1XOBA 2PBJA 4ULXA 4IW9A 4MDCA 2JACA 5G2ZA 2MBSA 2WGRA 3HZ4A 2REMA 5IOWA 2C3TA 1MEKA 4TW5A 4AF2A 5DALA 4EO3A 3KD0A 2KP2A 4MPGA 2I9HA 1HNCA 3GKNA 1K0MA 1X9MB 4F2IA 1A2MA 1WIKA 3DYRA 3I43A 2C0DA 4WBRD 1A2JA 1QMVA 2H73A 4OCFA 5IO2A 4JE1A 1TDIA 4K5SA 5B6NA 2H6XA 4JBBA 1K0DA 4Z7XA 1VGLA 4KGIA 4ZB6A 2H74A 6GSWA 5G5FA 4OMVA 2LNSA 4TOPA 3F4SA 3ME8A 4G0KA 5G31A 2H30A 19GSA 1F9MA 1ST9A 5LNKe 3CSJA 2A4HA 1JHBA 5D9TA 3VWXA 1IYHA 1XIYA 3ERFA 1MDJA 2L5LA 2H6YA 2FGXA 3TCOA 4ISDA 2QSIA 2RUFA 4KDYA 4NMUA 1BX9A 1EZKA 5E59A 4HU9A 2MMOA 3FYGA 3IRAA 1SKSB 3DVXA 1G0TA 2CZ2A 3GTUB 2GSQA 2FCHA 5KOWA 3FK8A 2G0FA 2VOCA 3VLNA 1W89A 5G1LA 1ERWA 3GMFA 1NHYA 2E2GA 4RQRA 4MF6A 4EIPA 4IELA 3H79A 4DSSB 4D73B 2H72A 3KCMA 4I2TA 4MF7A 4MMMA 5E4WA 2TRXA 2LUSA 5B7CA 4PURA 5HR0A 2DJ2A 4YH2A 2DBCA 2L6CA 3HZ8A 2XPEA 2C0FA 4MF5A 3HVVA 5IMDA 4XIHA 4GQFA 2JSZA 4OFMA 4MZWA 2VL2C 3O6TA 5B6MA 1Z7PA 1K0NA 3HJMA 3GSTA 3VI7A 4Q5QA 2DC5A 3FHKA 2HRFA 4GTUA 3IE3A 4HQZA 3F6FA 1QK8A 3MIXA 1PRXA 3RBTA 4YAPA 1R4WA 1XWBA 3EMPA 1Z5YE 1G6WA 2RUEA 20GSA 4WKWA 1XWKA 2K8VA 2EC4A 3GFKA 2FWHA 4DVCA 3TB2A 2OACA 3GV1A 4XCSA 3TUEA 4YKFA 1M9BA 4J2FA 2X4AA 4PNFA 5ENUA 2BMXA 2YN1A 4Q5RA 1EGOA 2P5RA 3CRTA 3C71A 6GSYA 3RDWA 3HHVA 4ML1A 4WETA 4K6XA 3ERWA 3GA4A 4XS4A 3UVTA 1GLPA 3DIEA 5IMCA 14GSA 1TJDA 5GSSA 3PGTA 3VURA 1OC3A 9GSSA 4L8EA 1XXUA 2LKUA 2H76A 1OC9A 4GCIA 1ACVA 3UBKA 3GIXA 2VCWA 4NHWA 1GLQA 1E6BA 4PXOA 2L4QA 3D21A 2DJ3A 3UL3A 5IIZA 2VD0A 2WFCA 1TP9A 1A0RP 6GSTA 3VWWA 2DJ1A 1I9DA 3ZITA 1A8YA 1G6YA 4J56E 5AIVA 4ML6A 3L9VA 2YZHA 1K0OA 4V2LA 1GULA 1X5DA 2H75A 3PPUA 4IVFA 1TW9A 5ELGA 1OE7A 1MD3A 5CAXA 3HA9A 4HZ2A 2DMMA 2R3XA 4I5QA 2JZTA 1PQNA 5ID2A 2LNTA 4LMWA 4TXOB 1VRSD 2JZSA 3ME7A 4O7HA 1XPVA 2VM1A 4O5QA 2LV3A 3MWHA 2J23A 3QAWA 1NM3A 3BOAA 3ZMLA 1LJRA 3EINA 3F63A 4OWYA 3ZVJD 4PGTA 4POLA 1NSWA 4IQ1A 4WBJA 2GSSA 3C73A 3C7MA 2BTOT 2WJUA 2O89A 4GRFA 3TOTA 1BYEA 2EIRA 1Y6EA 3ED3A 2H1BA 4POKA 5FWGA 4MH3A 5GAND 1WE0A 1AXDA 1VF3A 4LL4B 1KNGA 3KGKA 3FZ4A 4G2EA 4HI7A 3TDGA 4O5RA 2YANA 3D4MA 2VCTA 1JLWA 1X9WB 2B5XA 1GUHA 4IGJA 2H0HA 2AJQB 4EKZA 2C0EA 3BJ5A 1XW6A 2RLIA 2H70A 4HEA2 5FT3A 3N9JA 4CW9A 2LEGA 1TU8A 5IMVA 1S3CA 1RK4A 3ZFBA 2E0QA 1Z6MA 3M0FA 2I1UA 1DUGA 1O7UA 2ON7A 4V2MA 1DSBA 2QC7A 4O92A 1O85A 5LD0A 4CY8A 3IAS2 3IV4A 5IMAA 2WS2A 5D8IA 7GSSA 2LRNA 4Z2RA 4ZXGA 1EGRA 4KF9A 5KN3A 5IO0A 4BA7A 1TRVA 8GSSA 1KEBA 3ZYWA 2IFQB 1PGTA 4KA0A 3U6VA 4IP1A 22GSA 2NTOA 3HY2A 6GSUA 1K3LA 4NV5A 1T1VA 2XC2A 2QGVA 2HZEA 4IP6A 2V32A 4ZB8A 2CT6A 5JWRB 2OJLA 4N11A 4G19A 1U88A 4EF0A 2VLUA 1K0CA 2PVQA 3HD5A 4K2DA 3G7YA 1PL2A 1O8WA 3GURA 4J57E 2PUKC 2DIYA 2FA4A 4LMVA 3TKSC 1EWXA 2PN8A 5HR3A 2I81A 2IN3A 3NIVA 3HKRA 3QCPA 1SYRA 1ZL9A 2FLSA 5ECNB 3KTLA 2DIZA 3MNGA 5HFGA 2FY6A 4TKYA 5JCWA 1F2EA 1Y25A 5J9BA 4DSQA 2R0GA 1XBSA 4MK3A 4Z2TA 3DD3A 1YZXA 2ES7A 1OAZA 4EXJA 1WWJA 3PH9A 3GH6A 5EPFA 4BIKA 3GX0A 1WOUA 3EC3A 4FYBA 4K1FA 4Q5FA 1PX7A 1J9BA 3CSHA 3ZTLA 3DKSA 2HNLA 3P8WA 1ZGNA 4XTSA 1AQVA 4GSTA 1OVNA 1G7EA 1EEMA 2OA7A 2A2RA 4GSNA 4X1UA 1AUCA 3FR6A 3DWVA 1PX6A 5DJMA 3QOUA 1EP8A 1CQHA 1M0UA 1X5EA 3FR3A 1FOVA 4CDOA 2YWNA 2DKHA 1NW2A 1B9XC 2WZ9A 1AQWA 3R3EA 3EVIA 3H4KA 1AAZA 2CX3A 2VCXA 2CQ9A 1XG8A 1SL2B 2AB6A 5IOXA 1JLVA 1GSDA 1SK0A 3BCKA 3GX8A 2KUCA 1U6TA 3IHGA 3WGXA 2R6KA 1GL8A 3I9V2 4X0XA 3TGZA 5IPHA 1THOA 2JADA 3LFLA 3KMNA 4I8BA 3NOFA 4G0LA 2WDUA 1ABAA 3QAGA 3D6IA 1YQ1A 4DSSA 1PN0A 2HFDA 2K6VA 4PQIA 1E2YA 5F8BA 4PNGA 2YP6A 3DRNA 3IA1A 3LEFA 1V9WA 4N10A 4I6XA 2C80A 2NDOA 4IJ3A 5KN1A 1SYXA 3UIWA 4FYCA 4HJ2A 1EOHA 2GQKA 4BVYB 2RIIA 1A2LA 5IPGA 1KTEA 1V58A 5CYYA 2QKEA 3LW9A 1TK0B 13GSA 4ACSA 1HQOA 5IM9A 3APOA 3SWLA 2L4CA 5ECRB 2IWTA 4N30A 2LS5A 2VCZA 4P3YB 2XBQA 3UVHA 2V41A 1SKWB 1JZWA 1YF1A 1CQGA 1ZZYA 5DALB 4O32A 3D5JA 1WJKA 3TJFA 4MPFA 3CMIA 5KEJA 4MP4A 2HYXA 3E3EA 1ZYPA 5C04A 4NHZA 1JZRA 3HVXA 2FNOA 3BCIA 3US3A 2VL3A 1HNBA 5GSTA 4L0WA 1G7OA 4EL1A 3F0IA 1XFLA 2LJKA 4OO5A 2LJAA 2B6MA 3RPNA 1SD8A 3A5WA 2F8AA 2RM6A 2FA8A 5DJLA 4ZIJA 3IBHA 1EP7A 5HR2A 1AC1A 2VL9A 3HVSA 2H0GA 1O73A 2FWFA 2A4VA 4NXIA 3TKQA 3H8QA 3RHBA 2ZUPA 3A2VA 1LBKA 1VF4A 1H75A 2H71A 2PPTA 2YV7A 1FHEA 1S3AA 3Q18A 2DLXA 1GUKA 3ZREA 4F0CA 3LG6A 2MYGA 4BPYA 2FD3A 3E0UA 2Z9SA 3L78A 2X8GA 1YJ6A 1SK2A 4HUAA 1AQXA 1PKWA 1YEPA 3CBUA 5COHA 1SKRB 3GKKA 1YY7A 4KX4A 5DQSA 4ZL9A 3ZMKA 1M2BA 4PUFC 3L9SA 1ERVA 2OE3A 3A2WA 5CNWA 2UZ8A 2FWGA 4OCEA 2H19A 4AJ7A 2P0GA 3KH9A 2E2MA 1SK1A 2VCVA 5A5KA 5LCZA 2F51A 1GSSA 1GTBA 3WYWA 4MJAA 4TR0A 3GSSA 4MCUA 4AGSA 1M7TA 2IMKA 2HT9A 5HFKA 2H6ZA 2P5QA 4IBPA 1T00A 3E9JB 1ZCPA 2VM2A 3K8NA 4KE3A 2YWMA 1YEXA 2I3YA 2JZRA 2C3QA 5DAKA 2GT5A 3EWLA 4FQUA 3IK7A 1ML6A 1EV9A 3Q6OA 1THXA 4NAXA 4IHUA 4RQXA 4BL7A
chains in the Genus database with same CATH topology
5ECOB 2B5YA 3EU4A 4AJ8A 11GSA 2HSHA 3BBYA 3WGDA 5JCUA 1HNAA 2WB9A 1A8LA 3KXOA 4GXZA 1EOGA 1YKAA 2R5GA 1UA5A 4GSSA 5D9WA 1X9SB 1K0BA 4V2NA 3G7JA 2EIOA 1WP0A 4KNDA 2V6OA 3M8NA 1B9YC 2FHEA 3LGCA 3EMXA 4OFTA 4RUVA 3UMAA 5DCGA 4ECJA 1OC9B 1GP1A 4TR1A 1GUMA 1BEDA 4WXTA 2IMFA 2DSAA 3FEUA 1SJZA 1YKCA 4TRXA 3CXGA 1H4OA 2E7PA 5G1KA 1R7HA 5DQYA 5ECIB 1ZMAA 3F4RA 4TR3A 16GSA 2L57A 1M2DA 1TI3A 3EURA 17GSA 4GQCA 1KBNA 2M72A 3CRUA 2FWEA 1R5PA 3FMWA 1Q4JA 5H5QA 1RW1A 3ZZXA 3KM6A 1AW9A 2H66A 2IMDA 4YQMA 1T4YA 3DXBA 4IS0A 4YKGA 1NHOA 2O8VB 1XW5A 3UAPA 1T7PB 3HCZA 4WF4A 2NPBA 5ID2B 2OBIA 1VF1A 12GSA 5H5RA 2LRTA 2JL4A 4BVXA 3IOSA 2MZCA 2YJ7A 3W8SA 5F0GA 4ZB9A 2H1AA 5ECMB 1X0RA 3LXTA 3G7IA 3EU3A 2NBSA 1URMA 3J7Yk 3NZNA 4L5LA 5EL8A 4MABA 5C00A 3UOMA 3UBLA 2YZUA 3M9JA 1A0FA 2K8SA 2F3MA 2OBKA 2GSTA 2VUPA 3ZIVA 1K3OA 2YV9A 2LRCA 1PL1A 1N8JA 2VAFA 1B4QA 2X8CA 2IL3A 2DKIA 5J9CA 3P7XA 18GSA 4KW6A 1HYUA 4XS6A 2B5EA 3FZ5A 2B1KA 2DMLA 5GZZB 3DVWA 5ECKB 4KUNA 3GRXA 3A5IA 4ECBA 1YDKA 3MDKA 3DEXA 1AIUA 3TKSE 2X49A 2HRAA 2L59A 4KSOA 3A2XA 2AV4A 1B48A 3VK9A 4IN0A 3KH7A 4ZBAA 3QMXA 1XVWA 2PU9C 2YWOA 1TRWA 3VPTA 5ELAA 1XZOA 4ZBDA 1TKDB 1N2AA 1XCCA 2XBIA 4E8HA 1F37A 4NWYA 1JFUA 1TK8B 1JZOA 10GSA 2N5FA 4MZBA 3IC4A 4A5PA 5G5EA 1BQ7A 4EDYA 5A4VA 3IR4A 3Q19A 1PKZA 4JZQA 3QFBC 1TOFA 3M3MA 4ZBBA 4IJIA 3C8EA 3D4TA 1SL1B 1BAYA 2C4JA 3TJGA 4JR6A 4FO5A 4FH8A 1ILOA 2CV4A 4K7NA 2DJJA 2M80A 4YQVA 5CREA 1Q98A 4PTSA 4YAVA 1GNWA 1TU7A 2R2JA 2WRTA 2P31A 5D9XA 2C0GA 1PSQA 2WULA 2HZEB 2HXKA 3L0HA 2HI7A 4HZ4A 3LQ7A 4K0NA 3LYPA 2X64A 3H93A 4K7IA 3D22A 1C72A 1UVZA 3PINA 2YJHA 1J08A 3CTGA 4FYUA 2YNXA 1J0FA 4KCEA 1SL0B 2A2SA 5DVBA 3M1GA 5INYA 1U87A 2EIQA 4ZL8A 4K0GA 2B1LA 3RHCA 3ZIJA 3P2AA 1K0AA 5CO3A 5AGYA 2O87A 1DBYA 1W4VA 2GSRA 1ZOFA 1GSEA 4Z2UA 3IK9A 3EPTA 2R4VA 1O6JA 1MD4A 5KOXA 3EE2A 4TR4A 1PMTA 1QGVA 2V2GA 1S3DA 3FY7A 4EIQA 3GUSA 4LL1B 3CTFA 1R26A 1A24A 3ZVJA 3DMLA 3GTUA 3MSZA 2IPAA 1GTIA 1FB0A 1OKDA 4QL9A 4G9HA 2OE0A 3J7Yb 2H1GA 4D73A 2CVKA 3WD6A 1V2AA 3VI5A 5BMUA 1UN2A 4BWSA 1ERTA 3HXSA 4HS1A 3SBCA 2AYTA 2D2ZA 4EC0A 3RAZA 2PERA 1GNEA 3F9UA 4PUAA 4IKHA 2YOIA 1OC8A 3QD9A 2LJRA 4OFNA 1FB6A 3DGQA 3HJOA 4LLRA 1T3BA 2ZNMA 4LA1A 2OE1A 2I4AA 1Z3EA 4ZL7A 3IC8A 2N5BA 4K5RA 5F06A 2IJYA 3WGEA 1SD9A 4EDZA 4WF5A 1JZDA 3APQA 4N0VA 2MBTA 2XHFA 1GSQA 3C1RA 4MNNA 5EVOA 5D93A 1GSUA 1Z6NA 6GSSA 3GL3A 1RQMA 3KIJA 4K7OA 1MDKA 1SJ6A 4PX1A 3VPQA 3U5RE 5D9VA 1UC7A 3JCML 5J5NA 4QQ7A 1GRXA 3R2QA 1ERUA 3TKRA 1BG5A 1TXXA 2R0CA 2O85A 2DJ0A 2QA2A 4OD7A 4ID0A 2CVBA 3IAM2 3HYPA 4POMA 1F3BA 1T4ZA 2H0IA 1OYJA 1XW9A 3UEMA 2GGTA 5A4WA 3F4TA 4EVMA 3ZFLA 2JSYA 4ILFA 2B7KA 2VL2A 3KJYA 1SENA 3BD2A 4KCAA 1K3YA 4X4JA 3QAVA 3GL5A 1PA3A 4DEJA 1YF0A 3GH9A 1GTAA 4JRRA 2VD1A 5DCHA 5ECLB 5G30A 1X5CA 1GSFA 1SJIA 2C3NA 4KAEA 4K2XA 3TRXA 1F3AA 3N5OA 3HJPA 4BWQA 1XWAA 2LQQA 2GT6A 3F3RA 1OKTA 4OO4A 4X43A 3KEBA 2CX4A 2O7KA 4QL7A 3MYDA 2R0PA 4TXOA 1DE2A 1SU9A 3ERGA 2CA8A 3QFAC 3O76A 4I2UA 2WCIA 5JCGA 4USSA 3TKPA 1O81A 4YQUA 2F8FA 2V6KA 2KP1A 3TRQA 2MMZA 5JWOB 1Z7RA 2GS3A 2HSYA 1XWGA 3H1NA 4ZILA 1GTUA 2PWJA 3GHAA 1TRSA 2KLXA 5IMZA 2R37A 4MLYA 2GVPA 4I97A 2V1MA 3L4NA 4EUYA 4F9ZA 4KB3A 4PQ1A 4MZCA 4JEDA 3WT2A 1DE1A 2H8LA 1FAAA 3VFIA 4XS1A 2ON5A 3D0ZA 1GSYA 2HZFA 2C1YA 5DBQA 2CVDA 3WT1A 2LQOA 2N5AA 2IIYA 2H01A 4CY6A 3ZLPA 2L6DA 3FZAA 3Q74A 4XRAA 4HOJA 3QR6A 3KMOA 2AHEA 3CYNA 1PD21 3L9UA 2GQMA 4L0UA 4GLTA 1O8XA 5L71A 1MTCA 3VWVA 1WMJA 2HLSA 5HQPA 3AY8A 5JWQB 3LSZA 4HJMA 3EYTA 3IPZA 2CAIA 1OE8A 5H5SA 4XS4B 5KN2A 3GNJA 4MA9A 1FW1A 1R5AA 1ZYNA 3A3TA 4K8MA 1HD2A 4MJEA 2GDRA 2VLVA 4G0IA 1ZYEA 2HSMA 3CSIA 3TRPA 5AISA 2IMEA 1V40A 3F8UA 2KHPA 4MH2A 2PGTA 1U3IA 2X99A 3I69A 1XVQA 1B8XA 5ECHB 1QQ2A 4PQHA 5DAKB 3O3TA 4RI6A 1V57A 4HQSA 4JU5A 4POBA 2AAWA 5DDLA 1V98A 2M46A 1I5GA 4BL7B 1ZYQB 3G9BA 4WR5A 5J41A 5CRHA 2IFQA 4Q5NA 5F07A 3FW2A 1FO5A 4F0BA 4WEYA 2C8UA 4V1Ap 5ECSA 2YCDA 5ECQB 1MDIA 2ALBA 1TTZA 1TI1A 2FUG2 3GN3A 4MJBA 3ZRDA 3QPMA 4RI7A 3GKXA 1QFNA 3MAKA 4H86A 3IDVA 1GH2A 2LSTA 3KZQA 3RPPA 2HE3A 3APSA 4ICYA 2PMTA 3I6AA 3PR8A 1GWCA 5ABRA 5KN0A 3GKMA 2F9SA 4JR4A 5J3RA 2MMNA 2TIRA 2XPDA 3IXRA 6GSXA 2VCQA 1VF2A 5HR1A 5F05A 3KP9A 4TR1B 3TJKA 4KDUA 2CAQA 2ZCTA 2MMAA 2GZPA 2L5OA 1IYIA 4E8EA 3KTBA 4XHMA 5CRGA 1WPIA 5GAPD 3QDNA 3ISOA 4O5UA 5HFIA 5D73A 2KOKA 1M9AA 2GZZA 3LWAA 5IQYA 1XOAA 3OR5A 4EE0A 2K9FA 3F3QA 2GZYA 3GYKA 2DJKA 4FIWA 2X8HA 3UJ1A 2A2PA 3C1SA 2B7JA 1TK5B 4G10A 5ECPB 1Z9HA 5A4UA 1FVJA 2OADA 1A23A 4ECIA 1TRUA 2NVLA 5B8BA 2YPMA 4KSMA 1USBA 4BVXB 5IMFA 4HDEA 5CRWA 4WR4A 4L5OA 1M99A 4NPBA 2K18A 4GWRA 2HRKA 1M2AA 2GQLA 1FVKA 4ECCA 5EY6A 4TXVA 4F03A 5B8AA 6GSVA 4MJCA 4DSRA 2BJXA 4XRDA 1EV4A 2TRCP 3S9FA 2VIMA 4F82A 4N0ZA 2IMIA 3ZL5A 1FOHA 1WRYA 4HU7A 5CRDA 1QXHA 4KH7A 3TKSA 4CHSA 3TJBA 3HDCA 3LORA 3LYKA 3TJJA 1EEJA 2AUVA 2JU5A 3M9KA 4TVEA 3IHQA 3W6GA 1T8EB 2CZ3A 2VLTA 5FHIA 2HRNA 5D96A 3LXZA 3V1WA 3TOUA 4TN8A 2GTUA 3UARA 1F6MC 5J4UA 1FG4A 3LJRA 2GLRA 3FKFA 4KDXA 5BRTA 4AJ6A 2QA1A 2RM5A 1ON4A 4GF0A 5AIXA 1U3AA 1XWCA 3P90A 3W8JA 4K9ZA 3FR9A 4IQAA 2B3SA 1BJXA 1PN9A 3FZ9A 5AN1A 3VWUA 4NV2A 3F6DA 2PVOC 4BVYA 1LU4A 3FRCA 2G2QA 2J9HA 4V1Ag 1QUWA 2H1DA 5CP1A 3KP8A 2LTKA 2VO4A 2OKAA 2YWIA 1B4PA 1XOBA 2PBJA 4ULXA 4IW9A 4MDCA 2JACA 5G2ZA 2MBSA 2WGRA 3HZ4A 2REMA 5IOWA 2C3TA 1MEKA 4TW5A 4AF2A 5DALA 4EO3A 3KD0A 2KP2A 4MPGA 2I9HA 1HNCA 3GKNA 1K0MA 1X9MB 4F2IA 1A2MA 1WIKA 3DYRA 3I43A 2C0DA 4WBRD 1A2JA 1QMVA 2H73A 4OCFA 5IO2A 4JE1A 1TDIA 4K5SA 5B6NA 2H6XA 4JBBA 1K0DA 4Z7XA 1VGLA 4KGIA 4ZB6A 2H74A 6GSWA 5G5FA 4OMVA 2LNSA 4TOPA 3F4SA 3ME8A 4G0KA 5G31A 2H30A 19GSA 1F9MA 1ST9A 5LNKe 3CSJA 2A4HA 1JHBA 5D9TA 3VWXA 1IYHA 1XIYA 3ERFA 1MDJA 2L5LA 2H6YA 2FGXA 3TCOA 4ISDA 2QSIA 2RUFA 4KDYA 4NMUA 1BX9A 1EZKA 5E59A 4HU9A 2MMOA 3FYGA 3IRAA 1SKSB 3DVXA 1G0TA 2CZ2A 3GTUB 2GSQA 2FCHA 5KOWA 3FK8A 2G0FA 2VOCA 3VLNA 1W89A 5G1LA 1ERWA 3GMFA 1NHYA 2E2GA 4RQRA 4MF6A 4EIPA 4IELA 3H79A 4DSSB 4D73B 2H72A 3KCMA 4I2TA 4MF7A 4MMMA 5E4WA 2TRXA 2LUSA 5B7CA 4PURA 5HR0A 2DJ2A 4YH2A 2DBCA 2L6CA 3HZ8A 2XPEA 2C0FA 4MF5A 3HVVA 5IMDA 4XIHA 4GQFA 2JSZA 4OFMA 4MZWA 2VL2C 3O6TA 5B6MA 1Z7PA 1K0NA 3HJMA 3GSTA 3VI7A 4Q5QA 2DC5A 3FHKA 2HRFA 4GTUA 3IE3A 4HQZA 3F6FA 1QK8A 3MIXA 1PRXA 3RBTA 4YAPA 1R4WA 1XWBA 3EMPA 1Z5YE 1G6WA 2RUEA 20GSA 4WKWA 1XWKA 2K8VA 2EC4A 3GFKA 2FWHA 4DVCA 3TB2A 2OACA 3GV1A 4XCSA 3TUEA 4YKFA 1M9BA 4J2FA 2X4AA 4PNFA 5ENUA 2BMXA 2YN1A 4Q5RA 1EGOA 2P5RA 3CRTA 3C71A 6GSYA 3RDWA 3HHVA 4ML1A 4WETA 4K6XA 3ERWA 3GA4A 4XS4A 3UVTA 1GLPA 3DIEA 5IMCA 14GSA 1TJDA 5GSSA 3PGTA 3VURA 1OC3A 9GSSA 4L8EA 1XXUA 2LKUA 2H76A 1OC9A 4GCIA 1ACVA 3UBKA 3GIXA 2VCWA 4NHWA 1GLQA 1E6BA 4PXOA 2L4QA 3D21A 2DJ3A 3UL3A 5IIZA 2VD0A 2WFCA 1TP9A 1A0RP 6GSTA 3VWWA 2DJ1A 1I9DA 3ZITA 1A8YA 1G6YA 4J56E 5AIVA 4ML6A 3L9VA 2YZHA 1K0OA 4V2LA 1GULA 1X5DA 2H75A 3PPUA 4IVFA 1TW9A 5ELGA 1OE7A 1MD3A 5CAXA 3HA9A 4HZ2A 2DMMA 2R3XA 4I5QA 2JZTA 1PQNA 5ID2A 2LNTA 4LMWA 4TXOB 1VRSD 2JZSA 3ME7A 4O7HA 1XPVA 2VM1A 4O5QA 2LV3A 3MWHA 2J23A 3QAWA 1NM3A 3BOAA 3ZMLA 1LJRA 3EINA 3F63A 4OWYA 3ZVJD 4PGTA 4POLA 1NSWA 4IQ1A 4WBJA 2GSSA 3C73A 3C7MA 2BTOT 2WJUA 2O89A 4GRFA 3TOTA 1BYEA 2EIRA 1Y6EA 3ED3A 2H1BA 4POKA 5FWGA 4MH3A 5GAND 1WE0A 1AXDA 1VF3A 4LL4B 1KNGA 3KGKA 3FZ4A 4G2EA 4HI7A 3TDGA 4O5RA 2YANA 3D4MA 2VCTA 1JLWA 1X9WB 2B5XA 1GUHA 4IGJA 2H0HA 2AJQB 4EKZA 2C0EA 3BJ5A 1XW6A 2RLIA 2H70A 4HEA2 5FT3A 3N9JA 4CW9A 2LEGA 1TU8A 5IMVA 1S3CA 1RK4A 3ZFBA 2E0QA 1Z6MA 3M0FA 2I1UA 1DUGA 1O7UA 2ON7A 4V2MA 1DSBA 2QC7A 4O92A 1O85A 5LD0A 4CY8A 3IAS2 3IV4A 5IMAA 2WS2A 5D8IA 7GSSA 2LRNA 4Z2RA 4ZXGA 1EGRA 4KF9A 5KN3A 5IO0A 4BA7A 1TRVA 8GSSA 1KEBA 3ZYWA 2IFQB 1PGTA 4KA0A 3U6VA 4IP1A 22GSA 2NTOA 3HY2A 6GSUA 1K3LA 4NV5A 1T1VA 2XC2A 2QGVA 2HZEA 4IP6A 2V32A 4ZB8A 2CT6A 5JWRB 2OJLA 4N11A 4G19A 1U88A 4EF0A 2VLUA 1K0CA 2PVQA 3HD5A 4K2DA 3G7YA 1PL2A 1O8WA 3GURA 4J57E 2PUKC 2DIYA 2FA4A 4LMVA 3TKSC 1EWXA 2PN8A 5HR3A 2I81A 2IN3A 3NIVA 3HKRA 3QCPA 1SYRA 1ZL9A 2FLSA 5ECNB 3KTLA 2DIZA 3MNGA 5HFGA 2FY6A 4TKYA 5JCWA 1F2EA 1Y25A 5J9BA 4DSQA 2R0GA 1XBSA 4MK3A 4Z2TA 3DD3A 1YZXA 2ES7A 1OAZA 4EXJA 1WWJA 3PH9A 3GH6A 5EPFA 3GX0A 1WOUA 3EC3A 4FYBA 4K1FA 4Q5FA 1PX7A 1J9BA 3CSHA 3ZTLA 3DKSA 2HNLA 3P8WA 1ZGNA 4XTSA 1AQVA 4GSTA 1OVNA 1G7EA 1EEMA 2OA7A 2A2RA 4GSNA 4X1UA 1AUCA 3FR6A 3DWVA 1PX6A 5DJMA 3QOUA 1EP8A 1CQHA 1M0UA 1X5EA 3FR3A 1FOVA 4CDOA 2YWNA 2DKHA 1NW2A 1B9XC 2WZ9A 1AQWA 3R3EA 3EVIA 3H4KA 1AAZA 2CX3A 2VCXA 2CQ9A 1SL2B 2AB6A 5IOXA 1JLVA 1GSDA 1SK0A 3BCKA 3GX8A 2KUCA 1U6TA 3IHGA 3WGXA 2R6KA 1GL8A 3I9V2 4X0XA 3TGZA 5IPHA 1THOA 2JADA 3LFLA 3KMNA 4I8BA 3NOFA 4G0LA 2WDUA 1ABAA 3QAGA 3D6IA 1YQ1A 4DSSA 1PN0A 2HFDA 2K6VA 4PQIA 1E2YA 5F8BA 4PNGA 2YP6A 3DRNA 3IA1A 3LEFA 1V9WA 4N10A 4I6XA 2C80A 2NDOA 4IJ3A 5KN1A 1SYXA 3UIWA 4FYCA 4HJ2A 1EOHA 2GQKA 4BVYB 2RIIA 1A2LA 5IPGA 1KTEA 1V58A 5CYYA 2QKEA 3LW9A 1TK0B 13GSA 4ACSA 1HQOA 5IM9A 3APOA 3SWLA 2L4CA 5ECRB 2IWTA 4N30A 2LS5A 2VCZA 4P3YB 2XBQA 3UVHA 2V41A 1SKWB 1JZWA 1YF1A 1CQGA 1ZZYA 5DALB 4O32A 3D5JA 1WJKA 3TJFA 4MPFA 3CMIA 5KEJA 4MP4A 2HYXA 3E3EA 1ZYPA 5C04A 4NHZA 1JZRA 3HVXA 2FNOA 3BCIA 3US3A 2VL3A 1HNBA 5GSTA 4L0WA 1G7OA 4EL1A 3F0IA 1XFLA 2LJKA 4OO5A 2LJAA 2B6MA 3RPNA 1SD8A 3A5WA 2F8AA 2RM6A 2FA8A 5DJLA 4ZIJA 3IBHA 1EP7A 5HR2A 1AC1A 2VL9A 3HVSA 2H0GA 1O73A 2FWFA 2A4VA 4NXIA 3TKQA 3H8QA 3RHBA 2ZUPA 3A2VA 1LBKA 1VF4A 1H75A 2H71A 2PPTA 2YV7A 1FHEA 1S3AA 3Q18A 2DLXA 1GUKA 3ZREA 4F0CA 3LG6A 2MYGA 4BPYA 2FD3A 3E0UA 2Z9SA 3L78A 2X8GA 1YJ6A 1SK2A 4HUAA 1AQXA 1PKWA 1YEPA 3CBUA 5COHA 1SKRB 3GKKA 1YY7A 4KX4A 5DQSA 4ZL9A 3ZMKA 1M2BA 4PUFC 3L9SA 1ERVA 2OE3A 3A2WA 5CNWA 2UZ8A 2FWGA 4OCEA 2H19A 4AJ7A 2P0GA 3KH9A 2E2MA 1SK1A 2VCVA 5A5KA 5LCZA 2F51A 1GSSA 1GTBA 3WYWA 4MJAA 4TR0A 3GSSA 4MCUA 4AGSA 1M7TA 2IMKA 2HT9A 5HFKA 2H6ZA 2P5QA 4IBPA 1T00A 3E9JB 1ZCPA 2VM2A 3K8NA 4KE3A 2YWMA 1YEXA 2I3YA 2JZRA 2C3QA 5DAKA 2GT5A 3EWLA 4FQUA 3IK7A 1ML6A 1EV9A 3Q6OA 1THXA 4NAXA 4IHUA 4RQXA 4BL7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ECO B;  2B5Y A;  3EU4 A;  4AJ8 A;  11GS A;  2HSH A;  3BBY A;  3WGD A;  5JCU A;  1HNA A;  2WB9 A;  1A8L A;  3KXO A;  4GXZ A;  1EOG A;  1YKA A;  2R5G A;  1UA5 A;  4GSS A;  5D9W A;  1X9S B;  1K0B A;  4V2N A;  3G7J A;  2EIO A;  1WP0 A;  4KND A;  2V6O A;  3M8N A;  1B9Y C;  2FHE A;  3LGC A;  3EMX A;  4OFT A;  4RUV A;  3UMA A;  5DCG A;  4ECJ A;  1OC9 B;  1GP1 A;  4TR1 A;  1GUM A;  1BED A;  4WXT A;  2IMF A;  2DSA A;  3FEU A;  1SJZ A;  1YKC A;  4TRX A;  3CXG A;  1H4O A;  2E7P A;  5G1K A;  1R7H A;  5DQY A;  5ECI B;  1ZMA A;  3F4R A;  4TR3 A;  16GS A;  2L57 A;  1M2D A;  1TI3 A;  3EUR A;  17GS A;  4GQC A;  1KBN A;  2M72 A;  3CRU A;  2FWE A;  1R5P A;  1Q4J A;  5H5Q A;  1RW1 A;  3ZZX A;  3KM6 A;  1AW9 A;  2H66 A;  2IMD A;  4YQM A;  1T4Y A;  3DXB A;  4IS0 A;  1NHO A;  2O8V B;  1XW5 A;  3UAP A;  1T7P B;  3HCZ A;  4WF4 A;  2NPB A;  5ID2 B;  2OBI A;  1VF1 A;  12GS A;  5H5R A;  2LRT A;  2JL4 A;  4BVX A;  3IOS A;  2MZC A;  2YJ7 A;  3W8S A;  5F0G A;  4ZB9 A;  2H1A A;  5ECM B;  1X0R A;  3LXT A;  3G7I A;  3EU3 A;  2NBS A;  1URM A;  3J7Y k;  3NZN A;  4L5L A;  5EL8 A;  4MAB A;  5C00 A;  3UOM A;  3UBL A;  2YZU A;  3M9J A;  1A0F A;  2K8S A;  2F3M A;  2OBK A;  2GST A;  2VUP A;  3ZIV A;  1K3O A;  2YV9 A;  2LRC A;  1PL1 A;  1N8J A;  2VAF A;  1B4Q A;  2X8C A;  2IL3 A;  5J9C A;  3P7X A;  18GS A;  4KW6 A;  1HYU A;  4XS6 A;  2B5E A;  3FZ5 A;  2B1K A;  2DML A;  5GZZ B;  3DVW A;  5ECK B;  4KUN A;  3GRX A;  4ECB A;  1YDK A;  3MDK A;  3DEX A;  1AIU A;  3TKS E;  2L59 A;  4KSO A;  3A2X A;  2AV4 A;  1B48 A;  3VK9 A;  4IN0 A;  3KH7 A;  4ZBA A;  3QMX A;  1XVW A;  2PU9 C;  2YWO A;  1TRW A;  3VPT A;  5ELA A;  1XZO A;  4ZBD A;  1TKD B;  1N2A A;  1XCC A;  2XBI A;  4E8H A;  1F37 A;  4NWY A;  1JFU A;  1TK8 B;  1JZO A;  10GS A;  2N5F A;  4MZB A;  3IC4 A;  5G5E A;  1BQ7 A;  4EDY A;  5A4V A;  3IR4 A;  3Q19 A;  1PKZ A;  4JZQ A;  3QFB C;  1TOF A;  3M3M A;  4ZBB A;  4IJI A;  3C8E A;  3D4T A;  1SL1 B;  1BAY A;  2C4J A;  3TJG A;  4JR6 A;  4FO5 A;  4FH8 A;  1ILO A;  2CV4 A;  4K7N A;  2DJJ A;  2M80 A;  4YQV A;  5CRE A;  1Q98 A;  4YAV A;  1GNW A;  1TU7 A;  2R2J A;  2WRT A;  2P31 A;  5D9X A;  2C0G A;  1PSQ A;  2WUL A;  2HZE B;  2HXK A;  3L0H A;  2HI7 A;  4HZ4 A;  3LQ7 A;  4K0N A;  3LYP A;  2X64 A;  3H93 A;  4K7I A;  3D22 A;  1C72 A;  1UVZ A;  3PIN A;  2YJH A;  1J08 A;  3CTG A;  4FYU A;  2YNX A;  1J0F A;  4KCE A;  1SL0 B;  2A2S A;  5DVB A;  3M1G A;  5INY A;  1U87 A;  2EIQ A;  4ZL8 A;  4K0G A;  2B1L A;  3RHC A;  3ZIJ A;  3P2A A;  1K0A A;  5CO3 A;  5AGY A;  2O87 A;  1DBY A;  1W4V A;  2GSR A;  1ZOF A;  1GSE A;  3IK9 A;  2R4V A;  1O6J A;  1MD4 A;  3EE2 A;  4TR4 A;  1PMT A;  1QGV A;  2V2G A;  1S3D A;  3FY7 A;  3GUS A;  4LL1 B;  3CTF A;  1R26 A;  1A24 A;  3ZVJ A;  3DML A;  3GTU A;  3MSZ A;  2IPA A;  1GTI A;  1FB0 A;  1OKD A;  4QL9 A;  4G9H A;  2OE0 A;  3J7Y b;  2H1G A;  4D73 A;  2CVK A;  3WD6 A;  1V2A A;  3VI5 A;  1UN2 A;  4BWS A;  1ERT A;  3HXS A;  4HS1 A;  3SBC A;  2AYT A;  2D2Z A;  4EC0 A;  3RAZ A;  2PER A;  1GNE A;  3F9U A;  4PUA A;  4IKH A;  2YOI A;  1OC8 A;  3QD9 A;  2LJR A;  4OFN A;  1FB6 A;  3DGQ A;  3HJO A;  4LLR A;  1T3B A;  2ZNM A;  4LA1 A;  2OE1 A;  2I4A A;  1Z3E A;  4ZL7 A;  2N5B A;  5F06 A;  2IJY A;  3WGE A;  1SD9 A;  4EDZ A;  4WF5 A;  1JZD A;  3APQ A;  4N0V A;  2MBT A;  2XHF A;  1GSQ A;  3C1R A;  5EVO A;  5D93 A;  1GSU A;  1Z6N A;  6GSS A;  3GL3 A;  1RQM A;  3KIJ A;  4K7O A;  1MDK A;  1SJ6 A;  4PX1 A;  3VPQ A;  3U5R E;  5D9V A;  1UC7 A;  3JCM L;  5J5N A;  4QQ7 A;  1GRX A;  3R2Q A;  1ERU A;  3TKR A;  1BG5 A;  1TXX A;  2O85 A;  2DJ0 A;  4OD7 A;  4ID0 A;  2CVB A;  3IAM 2;  3HYP A;  4POM A;  1F3B A;  1T4Z A;  2H0I A;  1OYJ A;  1XW9 A;  3UEM A;  2GGT A;  5A4W A;  3F4T A;  4EVM A;  3ZFL A;  2JSY A;  4ILF A;  2B7K A;  2VL2 A;  3KJY A;  1SEN A;  3BD2 A;  4KCA A;  1K3Y A;  3QAV A;  3GL5 A;  1PA3 A;  4DEJ A;  1YF0 A;  3GH9 A;  1GTA A;  4JRR A;  2VD1 A;  5DCH A;  5ECL B;  5G30 A;  1X5C A;  1GSF A;  1SJI A;  2C3N A;  4KAE A;  3TRX A;  1F3A A;  3N5O A;  3HJP A;  4BWQ A;  1XWA A;  2LQQ A;  2GT6 A;  3F3R A;  1OKT A;  4OO4 A;  4X43 A;  3KEB A;  2CX4 A;  2O7K A;  4QL7 A;  4TXO A;  1DE2 A;  1SU9 A;  3ERG A;  2CA8 A;  3QFA C;  3O76 A;  4I2U A;  2WCI A;  5JCG A;  3TKP A;  1O81 A;  4YQU A;  2F8F A;  2V6K A;  2KP1 A;  3TRQ A;  2MMZ A;  5JWO B;  1Z7R A;  2GS3 A;  2HSY A;  1XWG A;  3H1N A;  4ZIL A;  1GTU A;  2PWJ A;  3GHA A;  1TRS A;  2KLX A;  5IMZ A;  2R37 A;  4MLY A;  2GVP A;  4I97 A;  2V1M A;  3L4N A;  4EUY A;  4F9Z A;  4KB3 A;  4PQ1 A;  4MZC A;  4JED A;  3WT2 A;  1DE1 A;  2H8L A;  1FAA A;  3VFI A;  4XS1 A;  2ON5 A;  3D0Z A;  1GSY A;  2HZF A;  2C1Y A;  5DBQ A;  2CVD A;  3WT1 A;  2LQO A;  2N5A A;  2IIY A;  2H01 A;  3ZLP A;  2L6D A;  3FZA A;  3Q74 A;  4XRA A;  4HOJ A;  3QR6 A;  3KMO A;  2AHE A;  3CYN A;  1PD2 1;  3L9U A;  2GQM A;  4L0U A;  4GLT A;  1O8X A;  5L71 A;  1MTC A;  3VWV A;  1WMJ A;  2HLS A;  5HQP A;  3AY8 A;  5JWQ B;  3LSZ A;  4HJM A;  3EYT A;  3IPZ A;  2CAI A;  1OE8 A;  5H5S A;  4XS4 B;  5KN2 A;  3GNJ A;  4MA9 A;  1FW1 A;  1R5A A;  3A3T A;  4K8M A;  1HD2 A;  4MJE A;  2GDR A;  2VLV A;  1ZYE A;  3CSI A;  3TRP A;  5AIS A;  2IME A;  1V40 A;  3F8U A;  2KHP A;  4MH2 A;  2PGT A;  1U3I A;  2X99 A;  3I69 A;  1XVQ A;  1B8X A;  5ECH B;  1QQ2 A;  4PQH A;  5DAK B;  3O3T A;  4RI6 A;  1V57 A;  4HQS A;  4JU5 A;  4POB A;  2AAW A;  5DDL A;  1V98 A;  2M46 A;  1I5G A;  1ZYQ B;  3G9B A;  4WR5 A;  5J41 A;  5CRH A;  2IFQ A;  4Q5N A;  5F07 A;  3FW2 A;  1FO5 A;  4F0B A;  4WEY A;  2C8U A;  4V1A p;  5ECS A;  2YCD A;  5ECQ B;  1MDI A;  2ALB A;  1TTZ A;  1TI1 A;  2FUG 2;  3GN3 A;  4MJB A;  3ZRD A;  3QPM A;  4RI7 A;  3GKX A;  1QFN A;  3MAK A;  4H86 A;  3IDV A;  1GH2 A;  2LST A;  3KZQ A;  3RPP A;  2HE3 A;  3APS A;  2PMT A;  3I6A A;  3PR8 A;  1GWC A;  5ABR A;  5KN0 A;  3GKM A;  2F9S A;  4JR4 A;  5J3R A;  2MMN A;  2TIR A;  2XPD A;  3IXR A;  6GSX A;  2VCQ A;  1VF2 A;  5HR1 A;  5F05 A;  3KP9 A;  4TR1 B;  3TJK A;  4KDU A;  2CAQ A;  2ZCT A;  2MMA A;  2GZP A;  2L5O A;  1IYI A;  4E8E A;  3KTB A;  4XHM A;  5CRG A;  1WPI A;  5GAP D;  3QDN A;  3ISO A;  5HFI A;  5D73 A;  2KOK A;  1M9A A;  2GZZ A;  3LWA A;  5IQY A;  1XOA A;  3OR5 A;  4EE0 A;  2K9F A;  3F3Q A;  2GZY A;  3GYK A;  2DJK A;  4FIW A;  2X8H A;  3UJ1 A;  3C1S A;  2B7J A;  1TK5 B;  4G10 A;  5ECP B;  1Z9H A;  5A4U A;  1FVJ A;  2OAD A;  1A23 A;  4ECI A;  1TRU A;  2NVL A;  5B8B A;  2YPM A;  4KSM A;  1USB A;  5IMF A;  4HDE A;  5CRW A;  4WR4 A;  4L5O A;  1M99 A;  4NPB A;  2K18 A;  4GWR A;  1M2A A;  2GQL A;  1FVK A;  4ECC A;  5EY6 A;  4TXV A;  4F03 A;  5B8A A;  6GSV A;  4MJC A;  4DSR A;  2BJX A;  4XRD A;  1EV4 A;  2TRC P;  3S9F A;  2VIM A;  4F82 A;  4N0Z A;  2IMI A;  3ZL5 A;  1WRY A;  4HU7 A;  5CRD A;  1QXH A;  4KH7 A;  3TKS A;  4CHS A;  3TJB A;  3HDC A;  3LOR A;  3LYK A;  3TJJ A;  1EEJ A;  2AUV A;  2JU5 A;  3M9K A;  4TVE A;  3IHQ A;  3W6G A;  1T8E B;  2CZ3 A;  2VLT A;  5FHI A;  2HRN A;  5D96 A;  3LXZ A;  3V1W A;  3TOU A;  4TN8 A;  2GTU A;  3UAR A;  1F6M C;  5J4U A;  1FG4 A;  3LJR A;  2GLR A;  3FKF A;  4KDX A;  4AJ6 A;  2RM5 A;  4GF0 A;  1ON4 A;  5AIX A;  1U3A A;  1XWC A;  3P90 A;  3W8J A;  4K9Z A;  3FR9 A;  4IQA A;  2B3S A;  1BJX A;  1PN9 A;  3FZ9 A;  5AN1 A;  3VWU A;  4NV2 A;  3F6D A;  2PVO C;  4BVY A;  1LU4 A;  3FRC A;  2G2Q A;  2J9H A;  4V1A g;  1QUW A;  2H1D A;  5CP1 A;  3KP8 A;  2LTK A;  2VO4 A;  2OKA A;  2YWI A;  1B4P A;  1XOB A;  2PBJ A;  4ULX A;  4IW9 A;  4MDC A;  2JAC A;  5G2Z A;  2MBS A;  2WGR A;  3HZ4 A;  2REM A;  5IOW A;  2C3T A;  1MEK A;  4TW5 A;  4AF2 A;  5DAL A;  4EO3 A;  3KD0 A;  2KP2 A;  4MPG A;  2I9H A;  1HNC A;  3GKN A;  1K0M A;  1X9M B;  4F2I A;  1A2M A;  1WIK A;  3DYR A;  3I43 A;  2C0D A;  4WBR D;  1A2J A;  1QMV A;  2H73 A;  4OCF A;  5IO2 A;  4JE1 A;  1TDI A;  5B6N A;  2H6X A;  4JBB A;  1K0D A;  4Z7X A;  1VGL A;  4KGI A;  4ZB6 A;  2H74 A;  6GSW A;  5G5F A;  4OMV A;  2LNS A;  4TOP A;  3F4S A;  3ME8 A;  5G31 A;  2H30 A;  19GS A;  1F9M A;  1ST9 A;  5LNK e;  3CSJ A;  1JHB A;  5D9T A;  3VWX A;  1IYH A;  1XIY A;  3ERF A;  1MDJ A;  2L5L A;  2H6Y A;  2FGX A;  3TCO A;  4ISD A;  2QSI A;  2RUF A;  4KDY A;  4NMU A;  1BX9 A;  1EZK A;  5E59 A;  4HU9 A;  2MMO A;  3FYG A;  3IRA A;  1SKS B;  3DVX A;  1G0T A;  2CZ2 A;  3GTU B;  2GSQ A;  2FCH A;  3FK8 A;  2G0F A;  2VOC A;  3VLN A;  1W89 A;  5G1L A;  1ERW A;  3GMF A;  1NHY A;  2E2G A;  4RQR A;  4MF6 A;  4IEL A;  3H79 A;  4DSS B;  4D73 B;  2H72 A;  3KCM A;  4I2T A;  4MF7 A;  4MMM A;  5E4W A;  2TRX A;  2LUS A;  5B7C A;  4PUR A;  5HR0 A;  2DJ2 A;  4YH2 A;  2DBC A;  2L6C A;  3HZ8 A;  2XPE A;  2C0F A;  4MF5 A;  3HVV A;  5IMD A;  4XIH A;  4GQF A;  2JSZ A;  4OFM A;  4MZW A;  2VL2 C;  3O6T A;  5B6M A;  1Z7P A;  1K0N A;  3HJM A;  3GST A;  3VI7 A;  4Q5Q A;  2DC5 A;  3FHK A;  2HRF A;  4GTU A;  3IE3 A;  4HQZ A;  3F6F A;  1QK8 A;  1PRX A;  3RBT A;  4YAP A;  1R4W A;  1XWB A;  3EMP A;  1Z5Y E;  1G6W A;  2RUE A;  20GS A;  4WKW A;  1XWK A;  2K8V A;  2EC4 A;  3GFK A;  2FWH A;  4DVC A;  3TB2 A;  2OAC A;  3GV1 A;  4XCS A;  3TUE A;  1M9B A;  4J2F A;  4PNF A;  5ENU A;  2BMX A;  2YN1 A;  4Q5R A;  1EGO A;  2P5R A;  3CRT A;  3C71 A;  6GSY A;  3RDW A;  3HHV A;  4ML1 A;  4WET A;  4K6X A;  3ERW A;  3GA4 A;  4XS4 A;  3UVT A;  1GLP A;  3DIE A;  5IMC A;  14GS A;  1TJD A;  5GSS A;  3PGT A;  3VUR A;  1OC3 A;  9GSS A;  4L8E A;  1XXU A;  2LKU A;  2H76 A;  1OC9 A;  4GCI A;  1ACV A;  3UBK A;  3GIX A;  2VCW A;  4NHW A;  1GLQ A;  1E6B A;  4PXO A;  2L4Q A;  3D21 A;  2DJ3 A;  3UL3 A;  5IIZ A;  2VD0 A;  2WFC A;  1TP9 A;  1A0R P;  6GST A;  3VWW A;  2DJ1 A;  1I9D A;  3ZIT A;  1A8Y A;  1G6Y A;  4J56 E;  5AIV A;  4ML6 A;  3L9V A;  2YZH A;  1K0O A;  4V2L A;  1GUL A;  1X5D A;  2H75 A;  4IVF A;  1TW9 A;  5ELG A;  1OE7 A;  1MD3 A;  5CAX A;  3HA9 A;  4HZ2 A;  2DMM A;  2R3X A;  4I5Q A;  2JZT A;  1PQN A;  5ID2 A;  2LNT A;  4LMW A;  4TXO B;  1VRS D;  2JZS A;  3ME7 A;  4O7H A;  1XPV A;  2VM1 A;  2LV3 A;  3MWH A;  2J23 A;  3QAW A;  1NM3 A;  3BOA A;  3ZML A;  1LJR A;  3EIN A;  3F63 A;  4OWY A;  3ZVJ D;  4PGT A;  4POL A;  1NSW A;  4IQ1 A;  4WBJ A;  2GSS A;  3C73 A;  3C7M A;  2BTO T;  2WJU A;  2O89 A;  4GRF A;  3TOT A;  1BYE A;  2EIR A;  1Y6E A;  3ED3 A;  2H1B A;  4POK A;  5FWG A;  4MH3 A;  5GAN D;  1WE0 A;  1AXD A;  1VF3 A;  4LL4 B;  1KNG A;  3KGK A;  3FZ4 A;  4G2E A;  4HI7 A;  3TDG A;  4O5R A;  2YAN A;  3D4M A;  2VCT A;  1JLW A;  1X9W B;  2B5X A;  1GUH A;  4IGJ A;  2H0H A;  2AJQ B;  4EKZ A;  2C0E A;  3BJ5 A;  1XW6 A;  2RLI A;  2H70 A;  4HEA 2;  5FT3 A;  3N9J A;  4CW9 A;  2LEG A;  1TU8 A;  5IMV A;  1S3C A;  1RK4 A;  3ZFB A;  2E0Q A;  1Z6M A;  3M0F A;  2I1U A;  1DUG A;  1O7U A;  2ON7 A;  4V2M A;  1DSB A;  2QC7 A;  4O92 A;  1O85 A;  5LD0 A;  3IAS 2;  3IV4 A;  5IMA A;  2WS2 A;  5D8I A;  7GSS A;  2LRN A;  4ZXG A;  1EGR A;  5KN3 A;  5IO0 A;  4BA7 A;  1TRV A;  8GSS A;  1KEB A;  3ZYW A;  2IFQ B;  1PGT A;  4KA0 A;  3U6V A;  4IP1 A;  22GS A;  2NTO A;  3HY2 A;  6GSU A;  1K3L A;  4NV5 A;  1T1V A;  2XC2 A;  2QGV A;  2HZE A;  4IP6 A;  2V32 A;  4ZB8 A;  2CT6 A;  5JWR B;  2OJL A;  4N11 A;  4G19 A;  1U88 A;  4EF0 A;  2VLU A;  1K0C A;  2PVQ A;  3HD5 A;  4K2D A;  3G7Y A;  1PL2 A;  1O8W A;  3GUR A;  4J57 E;  2PUK C;  2DIY A;  2FA4 A;  4LMV A;  3TKS C;  1EWX A;  2PN8 A;  5HR3 A;  2I81 A;  2IN3 A;  3NIV A;  3HKR A;  3QCP A;  1SYR A;  1ZL9 A;  2FLS A;  5ECN B;  3KTL A;  2DIZ A;  3MNG A;  5HFG A;  2FY6 A;  4TKY A;  5JCW A;  1F2E A;  1Y25 A;  5J9B A;  4DSQ A;  1XBS A;  4MK3 A;  3DD3 A;  1YZX A;  2ES7 A;  1OAZ A;  4EXJ A;  1WWJ A;  3PH9 A;  3GH6 A;  5EPF A;  3GX0 A;  1WOU A;  3EC3 A;  4FYB A;  4K1F A;  4Q5F A;  1PX7 A;  1J9B A;  3CSH A;  3ZTL A;  3DKS A;  2HNL A;  3P8W A;  1ZGN A;  4XTS A;  1AQV A;  4GST A;  1OVN A;  1G7E A;  1EEM A;  2OA7 A;  2A2R A;  4GSN A;  4X1U A;  1AUC A;  3FR6 A;  3DWV A;  1PX6 A;  5DJM A;  3QOU A;  1EP8 A;  1CQH A;  1M0U A;  1X5E A;  3FR3 A;  1FOV A;  4CDO A;  2YWN A;  1NW2 A;  1B9X C;  2WZ9 A;  1AQW A;  3EVI A;  3H4K A;  1AAZ A;  2CX3 A;  2VCX A;  2CQ9 A;  1SL2 B;  2AB6 A;  5IOX A;  1JLV A;  1GSD A;  1SK0 A;  3BCK A;  3GX8 A;  2KUC A;  1U6T A;  3WGX A;  2R6K A;  1GL8 A;  3I9V 2;  4X0X A;  3TGZ A;  5IPH A;  1THO A;  2JAD A;  3LFL A;  3KMN A;  4I8B A;  3NOF A;  2WDU A;  1ABA A;  3QAG A;  3D6I A;  1YQ1 A;  4DSS A;  2HFD A;  2K6V A;  4PQI A;  1E2Y A;  5F8B A;  4PNG A;  2YP6 A;  3DRN A;  3IA1 A;  3LEF A;  1V9W A;  4N10 A;  4I6X A;  2C80 A;  2NDO A;  4IJ3 A;  5KN1 A;  1SYX A;  3UIW A;  4FYC A;  4HJ2 A;  1EOH A;  2GQK A;  2RII A;  1A2L A;  5IPG A;  1KTE A;  1V58 A;  5CYY A;  2QKE A;  1TK0 B;  13GS A;  4ACS A;  1HQO A;  5IM9 A;  3APO A;  3SWL A;  2L4C A;  5ECR B;  2IWT A;  2LS5 A;  2VCZ A;  4N30 A;  4P3Y B;  2XBQ A;  3UVH A;  2V41 A;  1SKW B;  1JZW A;  1YF1 A;  1CQG A;  1ZZY A;  5DAL B;  4O32 A;  3D5J A;  1WJK A;  3TJF A;  4MPF A;  3CMI A;  5KEJ A;  4MP4 A;  2HYX A;  3E3E A;  5C04 A;  4NHZ A;  1JZR A;  3HVX A;  2FNO A;  3BCI A;  3US3 A;  2VL3 A;  1HNB A;  5GST A;  4L0W A;  1G7O A;  4EL1 A;  3F0I A;  1XFL A;  2LJK A;  4OO5 A;  2LJA A;  2B6M A;  3RPN A;  1SD8 A;  3A5W A;  2F8A A;  2RM6 A;  2FA8 A;  5DJL A;  4ZIJ A;  3IBH A;  1EP7 A;  5HR2 A;  1AC1 A;  2VL9 A;  3HVS A;  2H0G A;  1O73 A;  2FWF A;  2A4V A;  4NXI A;  3TKQ A;  3H8Q A;  3RHB A;  2ZUP A;  3A2V A;  1LBK A;  1VF4 A;  1H75 A;  2H71 A;  2PPT A;  2YV7 A;  1FHE A;  1S3A A;  3Q18 A;  2DLX A;  1GUK A;  3ZRE A;  4F0C A;  3LG6 A;  2MYG A;  4BPY A;  2FD3 A;  3E0U A;  2Z9S A;  3L78 A;  2X8G A;  1YJ6 A;  1SK2 A;  4HUA A;  1AQX A;  1PKW A;  1YEP A;  3CBU A;  5COH A;  1SKR B;  3GKK A;  1YY7 A;  4KX4 A;  5DQS A;  4ZL9 A;  3ZMK A;  1M2B A;  4PUF C;  3L9S A;  1ERV A;  2OE3 A;  3A2W A;  5CNW A;  2FWG A;  4OCE A;  2H19 A;  4AJ7 A;  2P0G A;  3KH9 A;  2E2M A;  1SK1 A;  2VCV A;  5A5K A;  5LCZ A;  2F51 A;  1GSS A;  1GTB A;  3WYW A;  4MJA A;  4TR0 A;  3GSS A;  4MCU A;  4AGS A;  1M7T A;  2IMK A;  2HT9 A;  5HFK A;  2H6Z A;  2P5Q A;  4IBP A;  1T00 A;  3E9J B;  1ZCP A;  2VM2 A;  3K8N A;  4KE3 A;  2YWM A;  1YEX A;  2I3Y A;  2JZR A;  2C3Q A;  5DAK A;  2GT5 A;  3EWL A;  3IK7 A;  1ML6 A;  1EV9 A;  3Q6O A;  1THX A;  4NAX A;  4IHU A;  4RQX A;  4BL7 A; 
#chains in the Genus database with same CATH topology
 5ECO B;  2B5Y A;  3EU4 A;  4AJ8 A;  11GS A;  2HSH A;  3BBY A;  3WGD A;  5JCU A;  1HNA A;  2WB9 A;  1A8L A;  3KXO A;  4GXZ A;  1EOG A;  1YKA A;  2R5G A;  1UA5 A;  4GSS A;  5D9W A;  1X9S B;  1K0B A;  4V2N A;  3G7J A;  2EIO A;  1WP0 A;  4KND A;  2V6O A;  3M8N A;  1B9Y C;  2FHE A;  3LGC A;  3EMX A;  4OFT A;  4RUV A;  3UMA A;  5DCG A;  4ECJ A;  1OC9 B;  1GP1 A;  4TR1 A;  1GUM A;  1BED A;  4WXT A;  2IMF A;  2DSA A;  3FEU A;  1SJZ A;  1YKC A;  4TRX A;  3CXG A;  1H4O A;  2E7P A;  5G1K A;  1R7H A;  5DQY A;  5ECI B;  1ZMA A;  3F4R A;  4TR3 A;  16GS A;  2L57 A;  1M2D A;  1TI3 A;  3EUR A;  17GS A;  4GQC A;  1KBN A;  2M72 A;  3CRU A;  2FWE A;  1R5P A;  3FMW A;  1Q4J A;  5H5Q A;  1RW1 A;  3ZZX A;  3KM6 A;  1AW9 A;  2H66 A;  2IMD A;  4YQM A;  1T4Y A;  3DXB A;  4IS0 A;  4YKG A;  1NHO A;  2O8V B;  1XW5 A;  3UAP A;  1T7P B;  3HCZ A;  4WF4 A;  2NPB A;  5ID2 B;  2OBI A;  1VF1 A;  12GS A;  5H5R A;  2LRT A;  2JL4 A;  4BVX A;  3IOS A;  2MZC A;  2YJ7 A;  3W8S A;  5F0G A;  4ZB9 A;  2H1A A;  5ECM B;  1X0R A;  3LXT A;  3G7I A;  3EU3 A;  2NBS A;  1URM A;  3J7Y k;  3NZN A;  4L5L A;  5EL8 A;  4MAB A;  5C00 A;  3UOM A;  3UBL A;  2YZU A;  3M9J A;  1A0F A;  2K8S A;  2F3M A;  2OBK A;  2GST A;  2VUP A;  3ZIV A;  1S3R A;  1K3O A;  2YV9 A;  2LRC A;  1PL1 A;  1N8J A;  2VAF A;  1B4Q A;  2X8C A;  2IL3 A;  2DKI A;  5J9C A;  3P7X A;  18GS A;  4KW6 A;  1HYU A;  4XS6 A;  2B5E A;  3FZ5 A;  2B1K A;  2DML A;  5GZZ B;  3DVW A;  5ECK B;  4KUN A;  3GRX A;  3A5I A;  4ECB A;  1YDK A;  3MDK A;  3DEX A;  1AIU A;  3TKS E;  2X49 A;  2HRA A;  2L59 A;  4KSO A;  3A2X A;  2AV4 A;  1B48 A;  3VK9 A;  4IN0 A;  3KH7 A;  4ZBA A;  3QMX A;  1XVW A;  2PU9 C;  2YWO A;  1TRW A;  3VPT A;  5ELA A;  1XZO A;  4ZBD A;  1TKD B;  1N2A A;  1XCC A;  2XBI A;  4E8H A;  1F37 A;  4NWY A;  1JFU A;  1TK8 B;  1JZO A;  10GS A;  2N5F A;  4MZB A;  3IC4 A;  4A5P A;  5G5E A;  1BQ7 A;  4EDY A;  5A4V A;  3IR4 A;  3Q19 A;  1PKZ A;  4JZQ A;  3QFB C;  1TOF A;  3M3M A;  4ZBB A;  4HSC X;  4IJI A;  3C8E A;  3D4T A;  1SL1 B;  1BAY A;  2C4J A;  3TJG A;  4JR6 A;  4FO5 A;  4FH8 A;  1ILO A;  2CV4 A;  4K7N A;  2DJJ A;  2M80 A;  4YQV A;  5CRE A;  1Q98 A;  4PTS A;  1GNW A;  1TU7 A;  4YAV A;  2R2J A;  2WRT A;  2P31 A;  5D9X A;  2C0G A;  1PSQ A;  2WUL A;  2HZE B;  2HXK A;  3L0H A;  2HI7 A;  4HZ4 A;  3LQ7 A;  4K0N A;  3LYP A;  2X64 A;  3H93 A;  4K7I A;  3D22 A;  1C72 A;  1UVZ A;  3PIN A;  2YJH A;  1J08 A;  3CTG A;  4FYU A;  2YNX A;  1J0F A;  4KCE A;  1SL0 B;  2A2S A;  5DVB A;  3M1G A;  5INY A;  1U87 A;  2EIQ A;  4ZL8 A;  4K0G A;  2B1L A;  3RHC A;  3ZIJ A;  3P2A A;  1K0A A;  5CO3 A;  5AGY A;  2O87 A;  1DBY A;  1W4V A;  2GSR A;  1ZOF A;  1GSE A;  4Z2U A;  3IK9 A;  3EPT A;  2R4V A;  1O6J A;  1MD4 A;  5KOX A;  3EE2 A;  4TR4 A;  1PMT A;  1QGV A;  2V2G A;  1S3D A;  3FY7 A;  4EIQ A;  3GUS A;  4LL1 B;  3CTF A;  1M3I A;  1R26 A;  1A24 A;  3ZVJ A;  3DML A;  3GTU A;  3MSZ A;  2IPA A;  1GTI A;  1FB0 A;  1OKD A;  4QL9 A;  4G9H A;  2OE0 A;  3J7Y b;  2H1G A;  4D73 A;  2CVK A;  3WD6 A;  1V2A A;  3VI5 A;  5BMU A;  1UN2 A;  4BWS A;  1ERT A;  3HXS A;  4HS1 A;  3SBC A;  2AYT A;  2D2Z A;  4EC0 A;  3RAZ A;  2PER A;  1GNE A;  3F9U A;  4PUA A;  4IKH A;  2YOI A;  1OC8 A;  3QD9 A;  2LJR A;  3HVN A;  4OFN A;  1FB6 A;  3DGQ A;  3HJO A;  4LLR A;  1T3B A;  2ZNM A;  4LA1 A;  2OE1 A;  2I4A A;  1Z3E A;  4ZL7 A;  3IC8 A;  2N5B A;  4K5R A;  5F06 A;  2IJY A;  3WGE A;  1SD9 A;  4EDZ A;  4WF5 A;  1JZD A;  3APQ A;  4N0V A;  2MBT A;  2XHF A;  1GSQ A;  3C1R A;  4MNN A;  5EVO A;  5D93 A;  1GSU A;  1Z6N A;  6GSS A;  3GL3 A;  1RQM A;  3KIJ A;  4K7O A;  1MDK A;  1SJ6 A;  4PX1 A;  3VPQ A;  3U5R E;  5D9V A;  1UC7 A;  3JCM L;  5J5N A;  4QQ7 A;  1GRX A;  3R2Q A;  1ERU A;  3CQF A;  3TKR A;  1BG5 A;  1TXX A;  2R0C A;  2O85 A;  2DJ0 A;  2QA2 A;  4OD7 A;  4ID0 A;  2CVB A;  3IAM 2;  3HYP A;  4POM A;  1F3B A;  1T4Z A;  2H0I A;  1OYJ A;  1XW9 A;  3UEM A;  2GGT A;  5A4W A;  3F4T A;  4EVM A;  3ZFL A;  2JSY A;  4ILF A;  2B7K A;  2VL2 A;  3KJY A;  1SEN A;  3BD2 A;  4KCA A;  1K3Y A;  4X4J A;  3QAV A;  3GL5 A;  1PA3 A;  4DEJ A;  1YF0 A;  3GH9 A;  1GTA A;  4JRR A;  2VD1 A;  5DCH A;  5ECL B;  5G30 A;  1X5C A;  1GSF A;  1SJI A;  2C3N A;  4KAE A;  4K2X A;  3TRX A;  1F3A A;  3N5O A;  3HJP A;  4BWQ A;  1XWA A;  2LQQ A;  2GT6 A;  3F3R A;  1OKT A;  4OO4 A;  4X43 A;  3KEB A;  2CX4 A;  2O7K A;  4QL7 A;  3MYD A;  2R0P A;  4TXO A;  1DE2 A;  1SU9 A;  3ERG A;  2CA8 A;  3QFA C;  3O76 A;  4I2U A;  2WCI A;  5JCG A;  4USS A;  3TKP A;  1O81 A;  4YQU A;  2F8F A;  2V6K A;  2KP1 A;  3TRQ A;  2MMZ A;  5JWO B;  1Z7R A;  2GS3 A;  2HSY A;  1XWG A;  3H1N A;  4ZIL A;  1GTU A;  2PWJ A;  3GHA A;  1TRS A;  2KLX A;  5IMZ A;  2R37 A;  4MLY A;  2GVP A;  4I97 A;  2V1M A;  3L4N A;  4EUY A;  4F9Z A;  4KB3 A;  4PQ1 A;  4MZC A;  4JED A;  3WT2 A;  1DE1 A;  2H8L A;  1FAA A;  3VFI A;  4XS1 A;  2ON5 A;  3D0Z A;  1GSY A;  2HZF A;  2C1Y A;  5DBQ A;  2CVD A;  3WT1 A;  2LQO A;  2N5A A;  2IIY A;  2H01 A;  4CY6 A;  3ZLP A;  2L6D A;  3FZA A;  3Q74 A;  4XRA A;  4HOJ A;  3QR6 A;  3KMO A;  2AHE A;  3CYN A;  1PD2 1;  3L9U A;  2GQM A;  4L0U A;  4GLT A;  1O8X A;  5L71 A;  1MTC A;  3VWV A;  1WMJ A;  2HLS A;  5HQP A;  3AY8 A;  5JWQ B;  3LSZ A;  4HJM A;  3EYT A;  3IPZ A;  2CAI A;  1OE8 A;  5H5S A;  4XS4 B;  5KN2 A;  3GNJ A;  4MA9 A;  1FW1 A;  1R5A A;  1ZYN A;  3A3T A;  4K8M A;  1HD2 A;  4MJE A;  2GDR A;  2VLV A;  4G0I A;  1ZYE A;  2HSM A;  3CSI A;  3TRP A;  5AIS A;  2IME A;  1V40 A;  3F8U A;  2KHP A;  4MH2 A;  2PGT A;  1U3I A;  2X99 A;  3I69 A;  1XVQ A;  1B8X A;  5ECH B;  1QQ2 A;  4PQH A;  5DAK B;  3O3T A;  4RI6 A;  1V57 A;  4HQS A;  4JU5 A;  4POB A;  2AAW A;  5DDL A;  1V98 A;  2M46 A;  1I5G A;  4BL7 B;  1ZYQ B;  3G9B A;  4WR5 A;  5J41 A;  5CRH A;  2IFQ A;  4Q5N A;  5F07 A;  3FW2 A;  1FO5 A;  4F0B A;  4WEY A;  2C8U A;  4V1A p;  5ECS A;  2YCD A;  5ECQ B;  1MDI A;  2ALB A;  1TTZ A;  1TI1 A;  2FUG 2;  3GN3 A;  4MJB A;  3ZRD A;  3QPM A;  4RI7 A;  3GKX A;  1QFN A;  3MAK A;  4H86 A;  3IDV A;  1GH2 A;  2LST A;  3KZQ A;  3RPP A;  2HE3 A;  3APS A;  4ICY A;  2PMT A;  3I6A A;  3PR8 A;  1GWC A;  5ABR A;  5KN0 A;  3GKM A;  2F9S A;  4JR4 A;  5J3R A;  2MMN A;  2TIR A;  2XPD A;  3IXR A;  6GSX A;  2VCQ A;  1VF2 A;  5HR1 A;  5F05 A;  3KP9 A;  4TR1 B;  3TJK A;  4KDU A;  2CAQ A;  2ZCT A;  2MMA A;  2GZP A;  2L5O A;  1IYI A;  4E8E A;  3KTB A;  4XHM A;  5CRG A;  1WPI A;  5GAP D;  3QDN A;  3ISO A;  4O5U A;  5HFI A;  5D73 A;  2KOK A;  1M9A A;  2GZZ A;  3LWA A;  5IQY A;  1XOA A;  3OR5 A;  4EE0 A;  2K9F A;  3F3Q A;  2GZY A;  3GYK A;  2DJK A;  4FIW A;  2X8H A;  3UJ1 A;  2A2P A;  3C1S A;  2B7J A;  1TK5 B;  4G10 A;  5ECP B;  1Z9H A;  5A4U A;  1FVJ A;  2OAD A;  1A23 A;  4ECI A;  1TRU A;  2NVL A;  1M3J A;  5B8B A;  2YPM A;  4KSM A;  1USB A;  4BVX B;  5IMF A;  4HDE A;  5CRW A;  4WR4 A;  4L5O A;  1M99 A;  4NPB A;  2K18 A;  4GWR A;  2HRK A;  1M2A A;  2GQL A;  1FVK A;  4ECC A;  5EY6 A;  4TXV A;  4F03 A;  5B8A A;  6GSV A;  1PFO A;  4MJC A;  4DSR A;  2BJX A;  4XRD A;  1EV4 A;  2TRC P;  3S9F A;  2VIM A;  4F82 A;  4N0Z A;  2IMI A;  3ZL5 A;  1FOH A;  1WRY A;  4HU7 A;  5CRD A;  1QXH A;  4KH7 A;  3TKS A;  4CHS A;  3TJB A;  3HDC A;  3LOR A;  3LYK A;  3TJJ A;  1EEJ A;  2AUV A;  2JU5 A;  3M9K A;  4TVE A;  3IHQ A;  3W6G A;  1T8E B;  2CZ3 A;  2VLT A;  5FHI A;  2HRN A;  5D96 A;  3LXZ A;  3V1W A;  3TOU A;  4TN8 A;  2GTU A;  3UAR A;  1F6M C;  5J4U A;  1FG4 A;  3LJR A;  2GLR A;  3FKF A;  4KDX A;  5BRT A;  4AJ6 A;  2QA1 A;  2RM5 A;  1ON4 A;  4GF0 A;  5AIX A;  1U3A A;  1XWC A;  3P90 A;  3W8J A;  4K9Z A;  3FR9 A;  4IQA A;  2B3S A;  1BJX A;  1PN9 A;  3FZ9 A;  5AN1 A;  3VWU A;  4NV2 A;  3F6D A;  2PVO C;  4BVY A;  1LU4 A;  3FRC A;  2G2Q A;  2J9H A;  4V1A g;  1QUW A;  2H1D A;  5CP1 A;  3KP8 A;  2LTK A;  2VO4 A;  2OKA A;  2YWI A;  1B4P A;  1XOB A;  2PBJ A;  4ULX A;  4IW9 A;  4MDC A;  2JAC A;  5G2Z A;  2MBS A;  2WGR A;  3HZ4 A;  2REM A;  5IOW A;  2C3T A;  1MEK A;  4TW5 A;  4AF2 A;  5DAL A;  4EO3 A;  3KD0 A;  2KP2 A;  4MPG A;  2I9H A;  1HNC A;  3GKN A;  1K0M A;  1X9M B;  4F2I A;  1A2M A;  1WIK A;  3DYR A;  3I43 A;  2C0D A;  4WBR D;  1A2J A;  1QMV A;  2H73 A;  4OCF A;  5IO2 A;  4JE1 A;  1TDI A;  4K5S A;  5B6N A;  2H6X A;  4JBB A;  1K0D A;  4Z7X A;  1VGL A;  4KGI A;  4ZB6 A;  2H74 A;  6GSW A;  5G5F A;  4OMV A;  2LNS A;  4TOP A;  3F4S A;  3ME8 A;  4G0K A;  5G31 A;  2H30 A;  19GS A;  1F9M A;  1ST9 A;  5LNK e;  3CSJ A;  2A4H A;  1JHB A;  5D9T A;  3VWX A;  1IYH A;  1XIY A;  3ERF A;  1MDJ A;  2L5L A;  2H6Y A;  2FGX A;  3TCO A;  4ISD A;  2QSI A;  2RUF A;  4KDY A;  4NMU A;  1BX9 A;  1EZK A;  5E59 A;  4HU9 A;  2MMO A;  3FYG A;  3IRA A;  1SKS B;  3DVX A;  1G0T A;  2CZ2 A;  3GTU B;  2GSQ A;  2FCH A;  5KOW A;  3FK8 A;  2G0F A;  2VOC A;  3VLN A;  1W89 A;  5G1L A;  1ERW A;  3GMF A;  1NHY A;  2E2G A;  4RQR A;  4MF6 A;  4EIP A;  4IEL A;  3H79 A;  4DSS B;  4D73 B;  2H72 A;  3KCM A;  4I2T A;  4MF7 A;  4MMM A;  5E4W A;  2TRX A;  2LUS A;  5B7C A;  4PUR A;  5HR0 A;  2DJ2 A;  4YH2 A;  2DBC A;  2L6C A;  3HZ8 A;  2XPE A;  2C0F A;  4MF5 A;  3HVV A;  5IMD A;  4XIH A;  4GQF A;  2JSZ A;  4OFM A;  4MZW A;  2VL2 C;  3O6T A;  5B6M A;  1Z7P A;  1K0N A;  3HJM A;  3GST A;  3VI7 A;  4Q5Q A;  2DC5 A;  3FHK A;  2HRF A;  4GTU A;  3IE3 A;  4HQZ A;  3F6F A;  1QK8 A;  3MIX A;  1PRX A;  3RBT A;  4YAP A;  1R4W A;  1XWB A;  3EMP A;  1Z5Y E;  1G6W A;  2RUE A;  20GS A;  4WKW A;  1XWK A;  2K8V A;  2EC4 A;  3GFK A;  2FWH A;  4DVC A;  3TB2 A;  2OAC A;  3GV1 A;  4XCS A;  3TUE A;  4YKF A;  1M9B A;  4J2F A;  2X4A A;  4PNF A;  5ENU A;  2BMX A;  2YN1 A;  4Q5R A;  1EGO A;  2P5R A;  3CRT A;  3C71 A;  6GSY A;  3RDW A;  3HHV A;  4ML1 A;  4WET A;  4K6X A;  3ERW A;  3GA4 A;  4XS4 A;  3UVT A;  1GLP A;  3DIE A;  5IMC A;  14GS A;  1TJD A;  5GSS A;  3PGT A;  3VUR A;  1OC3 A;  9GSS A;  4L8E A;  1XXU A;  2LKU A;  2H76 A;  1OC9 A;  4GCI A;  1ACV A;  3UBK A;  3GIX A;  2VCW A;  4NHW A;  1GLQ A;  1E6B A;  4PXO A;  2L4Q A;  3D21 A;  2DJ3 A;  3UL3 A;  5IIZ A;  2VD0 A;  2WFC A;  1TP9 A;  1A0R P;  6GST A;  3VWW A;  2DJ1 A;  1I9D A;  3ZIT A;  1A8Y A;  1G6Y A;  4J56 E;  5AIV A;  4ML6 A;  3L9V A;  2YZH A;  1K0O A;  4V2L A;  1GUL A;  1X5D A;  2H75 A;  3PPU A;  4IVF A;  1TW9 A;  5ELG A;  1OE7 A;  1MD3 A;  5CAX A;  3HA9 A;  4HZ2 A;  2DMM A;  2R3X A;  4I5Q A;  2JZT A;  1PQN A;  5ID2 A;  2LNT A;  4LMW A;  4TXO B;  1VRS D;  2JZS A;  3ME7 A;  4O7H A;  1XPV A;  2VM1 A;  4O5Q A;  2LV3 A;  3MWH A;  2J23 A;  3QAW A;  1NM3 A;  3BOA A;  3ZML A;  1LJR A;  3EIN A;  3F63 A;  4OWY A;  3ZVJ D;  4PGT A;  4POL A;  1NSW A;  4IQ1 A;  4WBJ A;  2GSS A;  3C73 A;  3C7M A;  2BTO T;  2WJU A;  2O89 A;  4GRF A;  3TOT A;  1BYE A;  2EIR A;  1Y6E A;  3ED3 A;  2H1B A;  4POK A;  5FWG A;  4MH3 A;  5GAN D;  1WE0 A;  1AXD A;  1VF3 A;  4LL4 B;  1KNG A;  3KGK A;  3FZ4 A;  4G2E A;  4HI7 A;  3TDG A;  4O5R A;  2YAN A;  3D4M A;  2VCT A;  1JLW A;  1X9W B;  2B5X A;  1GUH A;  4IGJ A;  2H0H A;  2AJQ B;  4EKZ A;  2C0E A;  3BJ5 A;  1XW6 A;  2RLI A;  2H70 A;  4HEA 2;  5FT3 A;  3N9J A;  4CW9 A;  2LEG A;  1TU8 A;  5IMV A;  1S3C A;  1RK4 A;  3ZFB A;  2E0Q A;  1Z6M A;  3M0F A;  2I1U A;  1DUG A;  1O7U A;  2ON7 A;  4V2M A;  1DSB A;  2QC7 A;  4O92 A;  1O85 A;  5LD0 A;  4CY8 A;  3IAS 2;  3IV4 A;  5IMA A;  2WS2 A;  5D8I A;  7GSS A;  2LRN A;  4Z2R A;  4ZXG A;  1EGR A;  4KF9 A;  5KN3 A;  5IO0 A;  4BA7 A;  1TRV A;  8GSS A;  1KEB A;  3ZYW A;  2IFQ B;  1PGT A;  4KA0 A;  3U6V A;  4IP1 A;  22GS A;  2NTO A;  3HY2 A;  6GSU A;  1K3L A;  4NV5 A;  1T1V A;  2XC2 A;  2QGV A;  2HZE A;  4IP6 A;  2V32 A;  4ZB8 A;  2CT6 A;  5JWR B;  2OJL A;  4N11 A;  4G19 A;  1U88 A;  4EF0 A;  2VLU A;  1K0C A;  2PVQ A;  3HD5 A;  4K2D A;  3G7Y A;  1PL2 A;  1O8W A;  3GUR A;  4J57 E;  2PUK C;  2DIY A;  2FA4 A;  4LMV A;  3TKS C;  1EWX A;  2PN8 A;  5HR3 A;  2I81 A;  2IN3 A;  3NIV A;  3HKR A;  3QCP A;  1SYR A;  1ZL9 A;  2FLS A;  5ECN B;  3KTL A;  2DIZ A;  3MNG A;  5HFG A;  2FY6 A;  4TKY A;  5JCW A;  1F2E A;  1Y25 A;  5J9B A;  4DSQ A;  2R0G A;  1XBS A;  4MK3 A;  4Z2T A;  3DD3 A;  1YZX A;  2ES7 A;  1OAZ A;  4EXJ A;  1WWJ A;  3PH9 A;  3GH6 A;  5EPF A;  4BIK A;  3GX0 A;  1WOU A;  3EC3 A;  4FYB A;  4K1F A;  4Q5F A;  1PX7 A;  1J9B A;  3CSH A;  3ZTL A;  3DKS A;  2HNL A;  3P8W A;  1ZGN A;  4XTS A;  1AQV A;  4GST A;  1OVN A;  1G7E A;  1EEM A;  2OA7 A;  2A2R A;  4GSN A;  4X1U A;  1AUC A;  3FR6 A;  3DWV A;  1PX6 A;  5DJM A;  3QOU A;  1EP8 A;  1CQH A;  1M0U A;  1X5E A;  3FR3 A;  1FOV A;  4CDO A;  2YWN A;  2DKH A;  1NW2 A;  1B9X C;  2WZ9 A;  1AQW A;  3R3E A;  3EVI A;  3H4K A;  1AAZ A;  2CX3 A;  2VCX A;  2CQ9 A;  1XG8 A;  1SL2 B;  2AB6 A;  5IOX A;  1JLV A;  1GSD A;  1SK0 A;  3BCK A;  3GX8 A;  2KUC A;  1U6T A;  3IHG A;  3WGX A;  2R6K A;  1GL8 A;  3I9V 2;  4X0X A;  3TGZ A;  5IPH A;  1THO A;  2JAD A;  3LFL A;  3KMN A;  4I8B A;  3NOF A;  4G0L A;  2WDU A;  1ABA A;  3QAG A;  3D6I A;  1YQ1 A;  4DSS A;  1PN0 A;  2HFD A;  2K6V A;  4PQI A;  1E2Y A;  5F8B A;  4PNG A;  2YP6 A;  3DRN A;  3IA1 A;  3LEF A;  1V9W A;  4N10 A;  4I6X A;  2C80 A;  2NDO A;  4IJ3 A;  5KN1 A;  1SYX A;  3UIW A;  4FYC A;  4HJ2 A;  1EOH A;  2GQK A;  4BVY B;  2RII A;  1A2L A;  5IPG A;  1KTE A;  1V58 A;  5CYY A;  2QKE A;  3LW9 A;  1TK0 B;  13GS A;  4ACS A;  1HQO A;  5IM9 A;  3APO A;  3SWL A;  2L4C A;  5ECR B;  2IWT A;  4N30 A;  2LS5 A;  2VCZ A;  4P3Y B;  2XBQ A;  3UVH A;  2V41 A;  1SKW B;  1JZW A;  1YF1 A;  1CQG A;  1ZZY A;  5DAL B;  4O32 A;  3D5J A;  1WJK A;  3TJF A;  4MPF A;  3CMI A;  5KEJ A;  4MP4 A;  2HYX A;  3E3E A;  1ZYP A;  5C04 A;  4NHZ A;  1JZR A;  3HVX A;  2FNO A;  3BCI A;  3US3 A;  2VL3 A;  1HNB A;  5GST A;  4L0W A;  1G7O A;  4EL1 A;  3F0I A;  1XFL A;  2LJK A;  4OO5 A;  2LJA A;  2B6M A;  3RPN A;  1SD8 A;  3A5W A;  2F8A A;  2RM6 A;  2FA8 A;  5DJL A;  4ZIJ A;  3IBH A;  1EP7 A;  5HR2 A;  1AC1 A;  2VL9 A;  3HVS A;  2H0G A;  1O73 A;  2FWF A;  2A4V A;  4NXI A;  3TKQ A;  3H8Q A;  3RHB A;  2ZUP A;  3A2V A;  1LBK A;  1VF4 A;  1H75 A;  2H71 A;  2PPT A;  2YV7 A;  1FHE A;  1S3A A;  3Q18 A;  2DLX A;  1GUK A;  3ZRE A;  4F0C A;  3LG6 A;  2MYG A;  4BPY A;  2FD3 A;  3E0U A;  2Z9S A;  3L78 A;  2X8G A;  1YJ6 A;  1SK2 A;  4HUA A;  1AQX A;  1PKW A;  1YEP A;  3CBU A;  5COH A;  1SKR B;  3GKK A;  1YY7 A;  4KX4 A;  5DQS A;  4ZL9 A;  3ZMK A;  1M2B A;  4PUF C;  3L9S A;  1ERV A;  2OE3 A;  3A2W A;  5CNW A;  2UZ8 A;  2FWG A;  4OCE A;  2H19 A;  4AJ7 A;  2P0G A;  3KH9 A;  2E2M A;  1SK1 A;  2VCV A;  5A5K A;  5LCZ A;  2F51 A;  1GSS A;  1GTB A;  3WYW A;  4MJA A;  4TR0 A;  3GSS A;  4MCU A;  4AGS A;  1M7T A;  2IMK A;  2HT9 A;  5HFK A;  2H6Z A;  2P5Q A;  4IBP A;  1T00 A;  3E9J B;  1ZCP A;  2VM2 A;  3K8N A;  4KE3 A;  2YWM A;  1YEX A;  2I3Y A;  2JZR A;  2C3Q A;  5DAK A;  2GT5 A;  3EWL A;  4FQU A;  3IK7 A;  1ML6 A;  1EV9 A;  3Q6O A;  1THX A;  4NAX A;  4IHU A;  4RQX A;  4BL7 A; 
#chains in the Genus database with same CATH homology
 5ECO B;  2B5Y A;  3EU4 A;  4AJ8 A;  11GS A;  2HSH A;  3BBY A;  3WGD A;  5JCU A;  1HNA A;  2WB9 A;  1A8L A;  3KXO A;  4GXZ A;  1EOG A;  1YKA A;  2R5G A;  1UA5 A;  4GSS A;  5D9W A;  1X9S B;  1K0B A;  4V2N A;  3G7J A;  2EIO A;  1WP0 A;  4KND A;  2V6O A;  3M8N A;  1B9Y C;  2FHE A;  3LGC A;  3EMX A;  4OFT A;  4RUV A;  3UMA A;  5DCG A;  4ECJ A;  1OC9 B;  1GP1 A;  4TR1 A;  1GUM A;  1BED A;  4WXT A;  2IMF A;  2DSA A;  3FEU A;  1SJZ A;  1YKC A;  4TRX A;  3CXG A;  1H4O A;  2E7P A;  5G1K A;  1R7H A;  5DQY A;  5ECI B;  1ZMA A;  3F4R A;  4TR3 A;  16GS A;  2L57 A;  1M2D A;  1TI3 A;  3EUR A;  17GS A;  4GQC A;  1KBN A;  2M72 A;  3CRU A;  2FWE A;  1R5P A;  3FMW A;  1Q4J A;  5H5Q A;  1RW1 A;  3ZZX A;  3KM6 A;  1AW9 A;  2H66 A;  2IMD A;  4YQM A;  1T4Y A;  3DXB A;  4IS0 A;  4YKG A;  1NHO A;  2O8V B;  1XW5 A;  3UAP A;  1T7P B;  3HCZ A;  4WF4 A;  2NPB A;  5ID2 B;  2OBI A;  1VF1 A;  12GS A;  5H5R A;  2LRT A;  2JL4 A;  4BVX A;  3IOS A;  2MZC A;  2YJ7 A;  3W8S A;  5F0G A;  4ZB9 A;  2H1A A;  5ECM B;  1X0R A;  3LXT A;  3G7I A;  3EU3 A;  2NBS A;  1URM A;  3J7Y k;  3NZN A;  4L5L A;  5EL8 A;  4MAB A;  5C00 A;  3UOM A;  3UBL A;  2YZU A;  3M9J A;  1A0F A;  2K8S A;  2F3M A;  2OBK A;  2GST A;  2VUP A;  3ZIV A;  1K3O A;  2YV9 A;  2LRC A;  1PL1 A;  1N8J A;  2VAF A;  1B4Q A;  2X8C A;  2IL3 A;  2DKI A;  5J9C A;  3P7X A;  18GS A;  4KW6 A;  1HYU A;  4XS6 A;  2B5E A;  3FZ5 A;  2B1K A;  2DML A;  5GZZ B;  3DVW A;  5ECK B;  4KUN A;  3GRX A;  3A5I A;  4ECB A;  1YDK A;  3MDK A;  3DEX A;  1AIU A;  3TKS E;  2X49 A;  2HRA A;  2L59 A;  4KSO A;  3A2X A;  2AV4 A;  1B48 A;  3VK9 A;  4IN0 A;  3KH7 A;  4ZBA A;  3QMX A;  1XVW A;  2PU9 C;  2YWO A;  1TRW A;  3VPT A;  5ELA A;  1XZO A;  4ZBD A;  1TKD B;  1N2A A;  1XCC A;  2XBI A;  4E8H A;  1F37 A;  4NWY A;  1JFU A;  1TK8 B;  1JZO A;  10GS A;  2N5F A;  4MZB A;  3IC4 A;  4A5P A;  5G5E A;  1BQ7 A;  4EDY A;  5A4V A;  3IR4 A;  3Q19 A;  1PKZ A;  4JZQ A;  3QFB C;  1TOF A;  3M3M A;  4ZBB A;  4IJI A;  3C8E A;  3D4T A;  1SL1 B;  1BAY A;  2C4J A;  3TJG A;  4JR6 A;  4FO5 A;  4FH8 A;  1ILO A;  2CV4 A;  4K7N A;  2DJJ A;  2M80 A;  4YQV A;  5CRE A;  1Q98 A;  4PTS A;  4YAV A;  1GNW A;  1TU7 A;  2R2J A;  2WRT A;  2P31 A;  5D9X A;  2C0G A;  1PSQ A;  2WUL A;  2HZE B;  2HXK A;  3L0H A;  2HI7 A;  4HZ4 A;  3LQ7 A;  4K0N A;  3LYP A;  2X64 A;  3H93 A;  4K7I A;  3D22 A;  1C72 A;  1UVZ A;  3PIN A;  2YJH A;  1J08 A;  3CTG A;  4FYU A;  2YNX A;  1J0F A;  4KCE A;  1SL0 B;  2A2S A;  5DVB A;  3M1G A;  5INY A;  1U87 A;  2EIQ A;  4ZL8 A;  4K0G A;  2B1L A;  3RHC A;  3ZIJ A;  3P2A A;  1K0A A;  5CO3 A;  5AGY A;  2O87 A;  1DBY A;  1W4V A;  2GSR A;  1ZOF A;  1GSE A;  4Z2U A;  3IK9 A;  3EPT A;  2R4V A;  1O6J A;  1MD4 A;  5KOX A;  3EE2 A;  4TR4 A;  1PMT A;  1QGV A;  2V2G A;  1S3D A;  3FY7 A;  4EIQ A;  3GUS A;  4LL1 B;  3CTF A;  1R26 A;  1A24 A;  3ZVJ A;  3DML A;  3GTU A;  3MSZ A;  2IPA A;  1GTI A;  1FB0 A;  1OKD A;  4QL9 A;  4G9H A;  2OE0 A;  3J7Y b;  2H1G A;  4D73 A;  2CVK A;  3WD6 A;  1V2A A;  3VI5 A;  5BMU A;  1UN2 A;  4BWS A;  1ERT A;  3HXS A;  4HS1 A;  3SBC A;  2AYT A;  2D2Z A;  4EC0 A;  3RAZ A;  2PER A;  1GNE A;  3F9U A;  4PUA A;  4IKH A;  2YOI A;  1OC8 A;  3QD9 A;  2LJR A;  4OFN A;  1FB6 A;  3DGQ A;  3HJO A;  4LLR A;  1T3B A;  2ZNM A;  4LA1 A;  2OE1 A;  2I4A A;  1Z3E A;  4ZL7 A;  3IC8 A;  2N5B A;  4K5R A;  5F06 A;  2IJY A;  3WGE A;  1SD9 A;  4EDZ A;  4WF5 A;  1JZD A;  3APQ A;  4N0V A;  2MBT A;  2XHF A;  1GSQ A;  3C1R A;  4MNN A;  5EVO A;  5D93 A;  1GSU A;  1Z6N A;  6GSS A;  3GL3 A;  1RQM A;  3KIJ A;  4K7O A;  1MDK A;  1SJ6 A;  4PX1 A;  3VPQ A;  3U5R E;  5D9V A;  1UC7 A;  3JCM L;  5J5N A;  4QQ7 A;  1GRX A;  3R2Q A;  1ERU A;  3TKR A;  1BG5 A;  1TXX A;  2R0C A;  2O85 A;  2DJ0 A;  2QA2 A;  4OD7 A;  4ID0 A;  2CVB A;  3IAM 2;  3HYP A;  4POM A;  1F3B A;  1T4Z A;  2H0I A;  1OYJ A;  1XW9 A;  3UEM A;  2GGT A;  5A4W A;  3F4T A;  4EVM A;  3ZFL A;  2JSY A;  4ILF A;  2B7K A;  2VL2 A;  3KJY A;  1SEN A;  3BD2 A;  4KCA A;  1K3Y A;  4X4J A;  3QAV A;  3GL5 A;  1PA3 A;  4DEJ A;  1YF0 A;  3GH9 A;  1GTA A;  4JRR A;  2VD1 A;  5DCH A;  5ECL B;  5G30 A;  1X5C A;  1GSF A;  1SJI A;  2C3N A;  4KAE A;  4K2X A;  3TRX A;  1F3A A;  3N5O A;  3HJP A;  4BWQ A;  1XWA A;  2LQQ A;  2GT6 A;  3F3R A;  1OKT A;  4OO4 A;  4X43 A;  3KEB A;  2CX4 A;  2O7K A;  4QL7 A;  3MYD A;  2R0P A;  4TXO A;  1DE2 A;  1SU9 A;  3ERG A;  2CA8 A;  3QFA C;  3O76 A;  4I2U A;  2WCI A;  5JCG A;  4USS A;  3TKP A;  1O81 A;  4YQU A;  2F8F A;  2V6K A;  2KP1 A;  3TRQ A;  2MMZ A;  5JWO B;  1Z7R A;  2GS3 A;  2HSY A;  1XWG A;  3H1N A;  4ZIL A;  1GTU A;  2PWJ A;  3GHA A;  1TRS A;  2KLX A;  5IMZ A;  2R37 A;  4MLY A;  2GVP A;  4I97 A;  2V1M A;  3L4N A;  4EUY A;  4F9Z A;  4KB3 A;  4PQ1 A;  4MZC A;  4JED A;  3WT2 A;  1DE1 A;  2H8L A;  1FAA A;  3VFI A;  4XS1 A;  2ON5 A;  3D0Z A;  1GSY A;  2HZF A;  2C1Y A;  5DBQ A;  2CVD A;  3WT1 A;  2LQO A;  2N5A A;  2IIY A;  2H01 A;  4CY6 A;  3ZLP A;  2L6D A;  3FZA A;  3Q74 A;  4XRA A;  4HOJ A;  3QR6 A;  3KMO A;  2AHE A;  3CYN A;  1PD2 1;  3L9U A;  2GQM A;  4L0U A;  4GLT A;  1O8X A;  5L71 A;  1MTC A;  3VWV A;  1WMJ A;  2HLS A;  5HQP A;  3AY8 A;  5JWQ B;  3LSZ A;  4HJM A;  3EYT A;  3IPZ A;  2CAI A;  1OE8 A;  5H5S A;  4XS4 B;  5KN2 A;  3GNJ A;  4MA9 A;  1FW1 A;  1R5A A;  1ZYN A;  3A3T A;  4K8M A;  1HD2 A;  4MJE A;  2GDR A;  2VLV A;  4G0I A;  1ZYE A;  2HSM A;  3CSI A;  3TRP A;  5AIS A;  2IME A;  1V40 A;  3F8U A;  2KHP A;  4MH2 A;  2PGT A;  1U3I A;  2X99 A;  3I69 A;  1XVQ A;  1B8X A;  5ECH B;  1QQ2 A;  4PQH A;  5DAK B;  3O3T A;  4RI6 A;  1V57 A;  4HQS A;  4JU5 A;  4POB A;  2AAW A;  5DDL A;  1V98 A;  2M46 A;  1I5G A;  4BL7 B;  1ZYQ B;  3G9B A;  4WR5 A;  5J41 A;  5CRH A;  2IFQ A;  4Q5N A;  5F07 A;  3FW2 A;  1FO5 A;  4F0B A;  4WEY A;  2C8U A;  4V1A p;  5ECS A;  2YCD A;  5ECQ B;  1MDI A;  2ALB A;  1TTZ A;  1TI1 A;  2FUG 2;  3GN3 A;  4MJB A;  3ZRD A;  3QPM A;  4RI7 A;  3GKX A;  1QFN A;  3MAK A;  4H86 A;  3IDV A;  1GH2 A;  2LST A;  3KZQ A;  3RPP A;  2HE3 A;  3APS A;  4ICY A;  2PMT A;  3I6A A;  3PR8 A;  1GWC A;  5ABR A;  5KN0 A;  3GKM A;  2F9S A;  4JR4 A;  5J3R A;  2MMN A;  2TIR A;  2XPD A;  3IXR A;  6GSX A;  2VCQ A;  1VF2 A;  5HR1 A;  5F05 A;  3KP9 A;  4TR1 B;  3TJK A;  4KDU A;  2CAQ A;  2ZCT A;  2MMA A;  2GZP A;  2L5O A;  1IYI A;  4E8E A;  3KTB A;  4XHM A;  5CRG A;  1WPI A;  5GAP D;  3QDN A;  3ISO A;  4O5U A;  5HFI A;  5D73 A;  2KOK A;  1M9A A;  2GZZ A;  3LWA A;  5IQY A;  1XOA A;  3OR5 A;  4EE0 A;  2K9F A;  3F3Q A;  2GZY A;  3GYK A;  2DJK A;  4FIW A;  2X8H A;  3UJ1 A;  2A2P A;  3C1S A;  2B7J A;  1TK5 B;  4G10 A;  5ECP B;  1Z9H A;  5A4U A;  1FVJ A;  2OAD A;  1A23 A;  4ECI A;  1TRU A;  2NVL A;  5B8B A;  2YPM A;  4KSM A;  1USB A;  4BVX B;  5IMF A;  4HDE A;  5CRW A;  4WR4 A;  4L5O A;  1M99 A;  4NPB A;  2K18 A;  4GWR A;  2HRK A;  1M2A A;  2GQL A;  1FVK A;  4ECC A;  5EY6 A;  4TXV A;  4F03 A;  5B8A A;  6GSV A;  4MJC A;  4DSR A;  2BJX A;  4XRD A;  1EV4 A;  2TRC P;  3S9F A;  2VIM A;  4F82 A;  4N0Z A;  2IMI A;  3ZL5 A;  1FOH A;  1WRY A;  4HU7 A;  5CRD A;  1QXH A;  4KH7 A;  3TKS A;  4CHS A;  3TJB A;  3HDC A;  3LOR A;  3LYK A;  3TJJ A;  1EEJ A;  2AUV A;  2JU5 A;  3M9K A;  4TVE A;  3IHQ A;  3W6G A;  1T8E B;  2CZ3 A;  2VLT A;  5FHI A;  2HRN A;  5D96 A;  3LXZ A;  3V1W A;  3TOU A;  4TN8 A;  2GTU A;  3UAR A;  1F6M C;  5J4U A;  1FG4 A;  3LJR A;  2GLR A;  3FKF A;  4KDX A;  5BRT A;  4AJ6 A;  2QA1 A;  2RM5 A;  1ON4 A;  4GF0 A;  5AIX A;  1U3A A;  1XWC A;  3P90 A;  3W8J A;  4K9Z A;  3FR9 A;  4IQA A;  2B3S A;  1BJX A;  1PN9 A;  3FZ9 A;  5AN1 A;  3VWU A;  4NV2 A;  3F6D A;  2PVO C;  4BVY A;  1LU4 A;  3FRC A;  2G2Q A;  2J9H A;  4V1A g;  1QUW A;  2H1D A;  5CP1 A;  3KP8 A;  2LTK A;  2VO4 A;  2OKA A;  2YWI A;  1B4P A;  1XOB A;  2PBJ A;  4ULX A;  4IW9 A;  4MDC A;  2JAC A;  5G2Z A;  2MBS A;  2WGR A;  3HZ4 A;  2REM A;  5IOW A;  2C3T A;  1MEK A;  4TW5 A;  4AF2 A;  5DAL A;  4EO3 A;  3KD0 A;  2KP2 A;  4MPG A;  2I9H A;  1HNC A;  3GKN A;  1K0M A;  1X9M B;  4F2I A;  1A2M A;  1WIK A;  3DYR A;  3I43 A;  2C0D A;  4WBR D;  1A2J A;  1QMV A;  2H73 A;  4OCF A;  5IO2 A;  4JE1 A;  1TDI A;  4K5S A;  5B6N A;  2H6X A;  4JBB A;  1K0D A;  4Z7X A;  1VGL A;  4KGI A;  4ZB6 A;  2H74 A;  6GSW A;  5G5F A;  4OMV A;  2LNS A;  4TOP A;  3F4S A;  3ME8 A;  4G0K A;  5G31 A;  2H30 A;  19GS A;  1F9M A;  1ST9 A;  5LNK e;  3CSJ A;  2A4H A;  1JHB A;  5D9T A;  3VWX A;  1IYH A;  1XIY A;  3ERF A;  1MDJ A;  2L5L A;  2H6Y A;  2FGX A;  3TCO A;  4ISD A;  2QSI A;  2RUF A;  4KDY A;  4NMU A;  1BX9 A;  1EZK A;  5E59 A;  4HU9 A;  2MMO A;  3FYG A;  3IRA A;  1SKS B;  3DVX A;  1G0T A;  2CZ2 A;  3GTU B;  2GSQ A;  2FCH A;  5KOW A;  3FK8 A;  2G0F A;  2VOC A;  3VLN A;  1W89 A;  5G1L A;  1ERW A;  3GMF A;  1NHY A;  2E2G A;  4RQR A;  4MF6 A;  4EIP A;  4IEL A;  3H79 A;  4DSS B;  4D73 B;  2H72 A;  3KCM A;  4I2T A;  4MF7 A;  4MMM A;  5E4W A;  2TRX A;  2LUS A;  5B7C A;  4PUR A;  5HR0 A;  2DJ2 A;  4YH2 A;  2DBC A;  2L6C A;  3HZ8 A;  2XPE A;  2C0F A;  4MF5 A;  3HVV A;  5IMD A;  4XIH A;  4GQF A;  2JSZ A;  4OFM A;  4MZW A;  2VL2 C;  3O6T A;  5B6M A;  1Z7P A;  1K0N A;  3HJM A;  3GST A;  3VI7 A;  4Q5Q A;  2DC5 A;  3FHK A;  2HRF A;  4GTU A;  3IE3 A;  4HQZ A;  3F6F A;  1QK8 A;  3MIX A;  1PRX A;  3RBT A;  4YAP A;  1R4W A;  1XWB A;  3EMP A;  1Z5Y E;  1G6W A;  2RUE A;  20GS A;  4WKW A;  1XWK A;  2K8V A;  2EC4 A;  3GFK A;  2FWH A;  4DVC A;  3TB2 A;  2OAC A;  3GV1 A;  4XCS A;  3TUE A;  4YKF A;  1M9B A;  4J2F A;  2X4A A;  4PNF A;  5ENU A;  2BMX A;  2YN1 A;  4Q5R A;  1EGO A;  2P5R A;  3CRT A;  3C71 A;  6GSY A;  3RDW A;  3HHV A;  4ML1 A;  4WET A;  4K6X A;  3ERW A;  3GA4 A;  4XS4 A;  3UVT A;  1GLP A;  3DIE A;  5IMC A;  14GS A;  1TJD A;  5GSS A;  3PGT A;  3VUR A;  1OC3 A;  9GSS A;  4L8E A;  1XXU A;  2LKU A;  2H76 A;  1OC9 A;  4GCI A;  1ACV A;  3UBK A;  3GIX A;  2VCW A;  4NHW A;  1GLQ A;  1E6B A;  4PXO A;  2L4Q A;  3D21 A;  2DJ3 A;  3UL3 A;  5IIZ A;  2VD0 A;  2WFC A;  1TP9 A;  1A0R P;  6GST A;  3VWW A;  2DJ1 A;  1I9D A;  3ZIT A;  1A8Y A;  1G6Y A;  4J56 E;  5AIV A;  4ML6 A;  3L9V A;  2YZH A;  1K0O A;  4V2L A;  1GUL A;  1X5D A;  2H75 A;  3PPU A;  4IVF A;  1TW9 A;  5ELG A;  1OE7 A;  1MD3 A;  5CAX A;  3HA9 A;  4HZ2 A;  2DMM A;  2R3X A;  4I5Q A;  2JZT A;  1PQN A;  5ID2 A;  2LNT A;  4LMW A;  4TXO B;  1VRS D;  2JZS A;  3ME7 A;  4O7H A;  1XPV A;  2VM1 A;  4O5Q A;  2LV3 A;  3MWH A;  2J23 A;  3QAW A;  1NM3 A;  3BOA A;  3ZML A;  1LJR A;  3EIN A;  3F63 A;  4OWY A;  3ZVJ D;  4PGT A;  4POL A;  1NSW A;  4IQ1 A;  4WBJ A;  2GSS A;  3C73 A;  3C7M A;  2BTO T;  2WJU A;  2O89 A;  4GRF A;  3TOT A;  1BYE A;  2EIR A;  1Y6E A;  3ED3 A;  2H1B A;  4POK A;  5FWG A;  4MH3 A;  5GAN D;  1WE0 A;  1AXD A;  1VF3 A;  4LL4 B;  1KNG A;  3KGK A;  3FZ4 A;  4G2E A;  4HI7 A;  3TDG A;  4O5R A;  2YAN A;  3D4M A;  2VCT A;  1JLW A;  1X9W B;  2B5X A;  1GUH A;  4IGJ A;  2H0H A;  2AJQ B;  4EKZ A;  2C0E A;  3BJ5 A;  1XW6 A;  2RLI A;  2H70 A;  4HEA 2;  5FT3 A;  3N9J A;  4CW9 A;  2LEG A;  1TU8 A;  5IMV A;  1S3C A;  1RK4 A;  3ZFB A;  2E0Q A;  1Z6M A;  3M0F A;  2I1U A;  1DUG A;  1O7U A;  2ON7 A;  4V2M A;  1DSB A;  2QC7 A;  4O92 A;  1O85 A;  5LD0 A;  4CY8 A;  3IAS 2;  3IV4 A;  5IMA A;  2WS2 A;  5D8I A;  7GSS A;  2LRN A;  4Z2R A;  4ZXG A;  1EGR A;  4KF9 A;  5KN3 A;  5IO0 A;  4BA7 A;  1TRV A;  8GSS A;  1KEB A;  3ZYW A;  2IFQ B;  1PGT A;  4KA0 A;  3U6V A;  4IP1 A;  22GS A;  2NTO A;  3HY2 A;  6GSU A;  1K3L A;  4NV5 A;  1T1V A;  2XC2 A;  2QGV A;  2HZE A;  4IP6 A;  2V32 A;  4ZB8 A;  2CT6 A;  5JWR B;  2OJL A;  4N11 A;  4G19 A;  1U88 A;  4EF0 A;  2VLU A;  1K0C A;  2PVQ A;  3HD5 A;  4K2D A;  3G7Y A;  1PL2 A;  1O8W A;  3GUR A;  4J57 E;  2PUK C;  2DIY A;  2FA4 A;  4LMV A;  3TKS C;  1EWX A;  2PN8 A;  5HR3 A;  2I81 A;  2IN3 A;  3NIV A;  3HKR A;  3QCP A;  1SYR A;  1ZL9 A;  2FLS A;  5ECN B;  3KTL A;  2DIZ A;  3MNG A;  5HFG A;  2FY6 A;  4TKY A;  5JCW A;  1F2E A;  1Y25 A;  5J9B A;  4DSQ A;  2R0G A;  1XBS A;  4MK3 A;  4Z2T A;  3DD3 A;  1YZX A;  2ES7 A;  1OAZ A;  4EXJ A;  1WWJ A;  3PH9 A;  3GH6 A;  5EPF A;  3GX0 A;  1WOU A;  3EC3 A;  4FYB A;  4K1F A;  4Q5F A;  1PX7 A;  1J9B A;  3CSH A;  3ZTL A;  3DKS A;  2HNL A;  3P8W A;  1ZGN A;  4XTS A;  1AQV A;  4GST A;  1OVN A;  1G7E A;  1EEM A;  2OA7 A;  2A2R A;  4GSN A;  4X1U A;  1AUC A;  3FR6 A;  3DWV A;  1PX6 A;  5DJM A;  3QOU A;  1EP8 A;  1CQH A;  1M0U A;  1X5E A;  3FR3 A;  1FOV A;  4CDO A;  2YWN A;  2DKH A;  1NW2 A;  1B9X C;  2WZ9 A;  1AQW A;  3R3E A;  3EVI A;  3H4K A;  1AAZ A;  2CX3 A;  2VCX A;  2CQ9 A;  1SL2 B;  2AB6 A;  5IOX A;  1JLV A;  1GSD A;  1SK0 A;  3BCK A;  3GX8 A;  2KUC A;  1U6T A;  3IHG A;  3WGX A;  2R6K A;  1GL8 A;  3I9V 2;  4X0X A;  3TGZ A;  5IPH A;  1THO A;  2JAD A;  3LFL A;  3KMN A;  4I8B A;  3NOF A;  4G0L A;  2WDU A;  1ABA A;  3QAG A;  3D6I A;  1YQ1 A;  4DSS A;  1PN0 A;  2HFD A;  2K6V A;  4PQI A;  1E2Y A;  5F8B A;  4PNG A;  2YP6 A;  3DRN A;  3IA1 A;  3LEF A;  1V9W A;  4N10 A;  4I6X A;  2C80 A;  2NDO A;  4IJ3 A;  5KN1 A;  1SYX A;  3UIW A;  4FYC A;  4HJ2 A;  1EOH A;  2GQK A;  4BVY B;  2RII A;  1A2L A;  5IPG A;  1KTE A;  1V58 A;  5CYY A;  2QKE A;  3LW9 A;  1TK0 B;  13GS A;  4ACS A;  1HQO A;  5IM9 A;  3APO A;  3SWL A;  2L4C A;  5ECR B;  2IWT A;  4N30 A;  2LS5 A;  2VCZ A;  4P3Y B;  2XBQ A;  3UVH A;  2V41 A;  1SKW B;  1JZW A;  1YF1 A;  1CQG A;  1ZZY A;  5DAL B;  4O32 A;  3D5J A;  1WJK A;  3TJF A;  4MPF A;  3CMI A;  5KEJ A;  4MP4 A;  2HYX A;  3E3E A;  1ZYP A;  5C04 A;  4NHZ A;  1JZR A;  3HVX A;  2FNO A;  3BCI A;  3US3 A;  2VL3 A;  1HNB A;  5GST A;  4L0W A;  1G7O A;  4EL1 A;  3F0I A;  1XFL A;  2LJK A;  4OO5 A;  2LJA A;  2B6M A;  3RPN A;  1SD8 A;  3A5W A;  2F8A A;  2RM6 A;  2FA8 A;  5DJL A;  4ZIJ A;  3IBH A;  1EP7 A;  5HR2 A;  1AC1 A;  2VL9 A;  3HVS A;  2H0G A;  1O73 A;  2FWF A;  2A4V A;  4NXI A;  3TKQ A;  3H8Q A;  3RHB A;  2ZUP A;  3A2V A;  1LBK A;  1VF4 A;  1H75 A;  2H71 A;  2PPT A;  2YV7 A;  1FHE A;  1S3A A;  3Q18 A;  2DLX A;  1GUK A;  3ZRE A;  4F0C A;  3LG6 A;  2MYG A;  4BPY A;  2FD3 A;  3E0U A;  2Z9S A;  3L78 A;  2X8G A;  1YJ6 A;  1SK2 A;  4HUA A;  1AQX A;  1PKW A;  1YEP A;  3CBU A;  5COH A;  1SKR B;  3GKK A;  1YY7 A;  4KX4 A;  5DQS A;  4ZL9 A;  3ZMK A;  1M2B A;  4PUF C;  3L9S A;  1ERV A;  2OE3 A;  3A2W A;  5CNW A;  2UZ8 A;  2FWG A;  4OCE A;  2H19 A;  4AJ7 A;  2P0G A;  3KH9 A;  2E2M A;  1SK1 A;  2VCV A;  5A5K A;  5LCZ A;  2F51 A;  1GSS A;  1GTB A;  3WYW A;  4MJA A;  4TR0 A;  3GSS A;  4MCU A;  4AGS A;  1M7T A;  2IMK A;  2HT9 A;  5HFK A;  2H6Z A;  2P5Q A;  4IBP A;  1T00 A;  3E9J B;  1ZCP A;  2VM2 A;  3K8N A;  4KE3 A;  2YWM A;  1YEX A;  2I3Y A;  2JZR A;  2C3Q A;  5DAK A;  2GT5 A;  3EWL A;  4FQU A;  3IK7 A;  1ML6 A;  1EV9 A;  3Q6O A;  1THX A;  4NAX A;  4IHU A;  4RQX A;  4BL7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...