3TB2A

1-cys peroxidoxin from plasmodium yoelli
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
219
structure length
218
Chain Sequence
GYHLGATFPNFTAKASGIDGDFELYKYIENSWAILFSHPNDFTPVTTELAELGKMHEDFLKLNCKLIGFSCNSKESHDKWIEDIKYYGKLNKWEIPIVCDESRELANKLKIMDEQEKDITGLPLTCRCLFFISPEKKIKATVLYPATTGRNAHEILRVLKSLQLTYTTPVATPVNWNEGDKCCVIPTLQDDEISKHFKNEITKVEMPSKKKYLRFVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics,unknown function
molecule keywords 1-Cys peroxiredoxin
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Plasmodium yoelii
total genus 64
structure length 218
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1020.10 Alpha Beta 2-Layer Sandwich Antioxidant, Horf6; Chain A, domain 2 Antioxidant, Horf6; Chain A, domain2 3tb2A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tb2A01
2M72A 2YWNA 1G7EA 3GX8A 4L8EA 4KDUA 4Q5NA 2JL4A 2N5BA 3FR3A 2GQLA 1PKZA 4KA0A 1SYRA 3LXTA 3BCKA 4ZXGA 1GLQA 1ML6A 1K0MA 4KSMA 4MH2A 4PNGA 1SJ6A 3UVTA 2GZZA 5DCGA 2M46A 1DBYA 4YH2A 1FVJA 4DVCA 4ULXA 4QL9A 2NTOA 4EDZA 3ZREA 2H0IA 1M2DA 2XPEA 2LTKA 1KNGA 3OR5A 4RUVA 4KDXA 1JZDA 2L6DA 3IA1A 1NHYA 5A4WA 5ECMB 5A5KA 3HVXA 3TRPA 2AJQB 4RQXA 5AN1A 4MCUA 3M9JA 3QR6A 4GXZA 1VF4A 3GKNA 5KN2A 2L4CA 3EMXA 2GZPA 1IYIA 1T1VA 1F3BA 4NHWA 3TJGA 1I9DA 2AV4A 2X64A 1HD2A 3HJMA 3J7Yk 2C1YA 1MDJA 2H6YA 3GA4A 4PNFA 3A2WA 2DSAA 1JLWA 1X5CA 2H8LA 1A8LA 2LV3A 4F2IA 5E59A 2CX3A 5AIXA 2X8GA 5EY6A 1GP1A 3GL3A 4KE3A 3IHQA 3TGZA 3UJ1A 1XIYA 2DJJA 3H4KA 2DJKA 3TRQA 6GSXA 2IMIA 3ZMKA 2VCZA 3DVXA 4F03A 1AIUA 3KGKA 2IL3A 3KXOA 4O92A 3ED3A 4ZBAA 2B7KA 4MDCA 2H01A 1AC1A 3ME7A 3FK8A 1TK8B 1J0FA 2CA8A 2XPDA 2JACA 3GKKA 2GT6A 1NHOA 3EE2A 4NV2A 3C1SA 1BX9A 3QFAC 1JZRA 2CX4A 4WBJA 1GH2A 5ECHB 5H5RA 3W8SA 4HS1A 5D9XA 2ZUPA 1XW6A 1GTIA 3CXGA 3RAZA 2O89A 5CRDA 3UVHA 4XTSA 3VI5A 3GYKA 2H66A 3IK7A 3L9UA 2C8UA 4V1Ag 3WT1A 2AUVA 1TRSA 4HEA2 1OC9B 4KW6A 5J4UA 4HOJA 3H8QA 3L9SA 1X9SB 4NMUA 1LBKA 1PA3A 2HFDA 2YWOA 1UC7A 1ABAA 1SKSB 3Q6OA 3IPZA 1TRUA 4ML6A 2LRCA 4POKA 5H5SA 3KTLA 3BBYA 3G7YA 2HSHA 1YQ1A 2LRNA 3I43A 4X43A 3TKSC 1OAZA 1S3CA 1EOGA 3FR9A 3KTBA 5IMFA 2QSIA 2FWEA 3GHAA 2MYGA 5G1KA 1GSUA 1NM3A 3BJ5A 3Q18A 1FAAA 2YJHA 2DJ1A 3KMOA 4MABA 3GL5A 4O5RA 4TR1B 4GQFA 1PX6A 4ACSA 6GSYA 1TRWA 3W6GA 4IKHA 2IFQA 3H1NA 3U6VA 1TI3A 3PGTA 3TJKA 2GQKA 4ZB9A 5IIZA 4TOPA 2VL9A 4GQCA 2A4VA 3ZITA 2H19A 4K8MA 1VGLA 2I3YA 5IOXA 5D96A 1DSBA 1XZOA 3FEUA 2CVBA 5IMVA 2NVLA 3A3TA 3UEMA 1VF1A 5IMDA 1H75A 3P7XA 5GZZB 1BJXA 2EC4A 2G0FA 4AJ8A 4HU9A 1X9WB 2B7JA 4BVYA 2OE0A 5CAXA 3D4MA 5ID2B 3WYWA 4OCEA 2BTOT 1OC8A 2J9HA 2HRNA 3MDKA 4J56E 1TU8A 2O85A 1QQ2A 2CZ2A 2ON7A 3TJBA 4IHUA 4DSSA 1WPIA 1GLPA 4HDEA 3GH9A 1QFNA 3KMNA 2I81A 3TKSE 4GCIA 5CREA 1K3LA 3TUEA 3GTUA 1GSYA 14GSA 2RUEA 3EYTA 2XBIA 5JCUA 3TJFA 6GSSA 3U5RE 1T4ZA 2KHPA 3FKFA 3IAM2 5ECOB 4I97A 1A8YA 1TI1A 1K0BA 1A2LA 5HFGA 2GSSA 3EU3A 4YQVA 4MJCA 1QK8A 3GRXA 4TKYA 5J3RA 4QQ7A 5LCZA 3ZYWA 1YEXA 4ID0A 1YJ6A 4AJ6A 4K7NA 5G30A 1T8EB 5ECLB 1GTUA 4RI7A 1KTEA 5HR3A 4G10A 4RI6A 2B5EA 4TR4A 4WKWA 1QUWA 3TOUA 4AF2A 18GSA 1PL1A 1PMTA 2L59A 2HZEA 3TKRA 3UARA 4LMWA 2FNOA 1SJIA 2F8FA 2F8AA 5G2ZA 2YWIA 2CV4A 3K8NA 1E2YA 4K7OA 5CYYA 5GAND 1TK5B 4POMA 1UVZA 3A5WA 3MWHA 5IMAA 3RHBA 3VLNA 1V58A 3IE3A 3DXBA 1C72A 2OE3A 3GUSA 4DSQA 2HXKA 3UIWA 3C1RA 2JZTA 2H70A 3DRNA 2H73A 1T4YA 3AY8A 2L57A 4Q5RA 2PVQA 1O6JA 2QKEA 3ZMLA 4IS0A 2VCWA 5FHIA 2DIZA 4TR0A 1AQXA 4MLYA 2RUFA 2AAWA 4ECCA 3D4TA 2LRTA 3C71A 3TDGA 3ZIVA 5AIVA 3QMXA 2K18A 3WD6A 2GSQA 3S9FA 1SL1B 3LORA 4DSRA 1XVWA 5DALA 1N2AA 5ELAA 1S3DA 2LS5A 1GWCA 1SK2A 2FA8A 2LNTA 4ZL9A 4HU7A 1GTAA 4GWRA 3F4RA 2LQOA 1TXXA 2P31A 3IK9A 3HJPA 1XWKA 5G31A 4JU5A 2HNLA 2PWJA 1XOAA 1B9YC 2CT6A 3BOAA 4WR5A 1WE0A 2XC2A 3I9V2 2N5FA 3D6IA 3D21A 2HE3A 2DC5A 2H1DA 5F0GA 1VRSD 1XVQA 3G7IA 4EO3A 1USBA 3IOSA 5COHA 2GLRA 2TIRA 5KN3A 1ERTA 2IMDA 4ISDA 8GSSA 3ZLPA 3LQ7A 4FH8A 1BG5A 3D22A 1LU4A 2JSZA 1EEJA 1KEBA 3TCOA 4N10A 1V57A 5E4WA 1YZXA 2GVPA 1M7TA 1O73A 3VPQA 4J57E 3ERWA 3RDWA 5G1LA 3GNJA 3ZL5A 1A23A 1O81A 3LJRA 3GSSA 4ECJA 1PRXA 4ZILA 4CW9A 1ZCPA 3ERGA 4PQHA 1BYEA 4MP4A 2RM6A 4TW5A 3IRAA 4DEJA 4WBRD 3WGEA 2AB6A 1GULA 3ZVJD 3ISOA 4FO5A 4MH3A 2J23A 4GTUA 1EP8A 2NPBA 1XPVA 3KCMA 4LA1A 2ZNMA 1TRVA 1WJKA 2C3QA 2YZHA 5B8AA 1SL0B 2E0QA 1PGTA 1LJRA 2IFQB 1A2MA 2XHFA 1U6TA 1TP9A 2H1AA 1V2AA 5IMCA 4ZL8A 1OE8A 2CVKA 3TJJA 1XFLA 3UL3A 4OFTA 4JBBA 3FZAA 1IYHA 1F6MC 1JLVA 3ZIJA 2H1BA 1ERWA 3F4SA 3IR4A 4ZBBA 2HLSA 1UN2A 4PUFC 2PERA 2K8VA 3F6DA 1EOHA 4D73A 3CYNA 3L4NA 2ES7A 2FHEA 1EEMA 2FCHA 1U3IA 1VF2A 3GFKA 2C0FA 4DSSB 2LSTA 2DJ0A 5KN1A 2FWGA 2WRTA 2O87A 1Z5YE 3LWAA 2PUKC 4IQ1A 5B8BA 1PD21 3QAGA 2F3MA 1XBSA 2NDOA 4WF5A 3GTUB 1FO5A 1AUCA 1SD8A 4GRFA 1UA5A 1FW1A 5EPFA 5C04A 2WFCA 1GUHA 4K9ZA 2LJRA 3ZRDA 1ST9A 1GNEA 3VWWA 4G9HA 4YAPA 2GDRA 5FT3A 3QCPA 2FUG2 5F07A 2L5LA 4Q5QA 4E8HA 4XRDA 3GKMA 3BCIA 4TXOA 4N0ZA 3KP9A 2V6OA 3A2XA 1WOUA 4IQAA 5D93A 1EGRA 2O8VB 1PN9A 5ECNB 1QMVA 2MMZA 4EXJA 1I5GA 2HZEB 2C3TA 2VUPA 1ZOFA 3SBCA 5ELGA 3UAPA 1E6BA 2YWMA 2H76A 4OD7A 1PQNA 3H93A 4HI7A 5INYA 2P0GA 4JZQA 1O85A 1ILOA 2IWTA 2LJKA 5EVOA 5DVBA 5DDLA 4NHZA 1TOFA 3KP8A 2IJYA 2QC7A 5LNKe 5JWRB 1ZL9A 5KEJA 5H5QA 1GSSA 3NZNA 3N9JA 1PX7A 4XCSA 3HHVA 3EC3A 3US3A 4I2TA 4I5QA 2EIOA 2HT9A 4KGIA 3G7JA 2GS3A 4NWYA 2PGTA 3FW2A 1GSDA 5ABRA 3Q74A 3VI7A 4HJ2A 2KUCA 4OWYA 1F37A 4G19A 5IO0A 5CO3A 1HNBA 1K0AA 2WZ9A 2C0GA 5HFKA 2M80A 4WETA 1JZWA 4PXOA 2MMNA 1QXHA 3FZ4A 3ME8A 1TDIA 4IJIA 2GT5A 3UMAA 2MBTA 3KH9A 1B4PA 1ERUA 2VAFA 5DALB 2IMKA 2LEGA 3W8JA 16GSA 4IP1A 3Q19A 1T00A 4P3YB 4YQUA 1AQVA 1RW1A 3NOFA 1THOA 4I2UA 2H72A 4L5OA 5ECQB 3CTGA 3IV4A 1SD9A 4K7IA 2X8CA 1G0TA 2H6ZA 3KD0A 3FZ9A 13GSA 3E3EA 2H75A 4IBPA 4MPFA 4J2FA 4WXTA 3F9UA 1YKCA 3GV1A 2A2SA 2LUSA 3LXZA 2ZCTA 1R5PA 2B5XA 2WJUA 1YEPA 1HYUA 4GSSA 2OKAA 4QL7A 1K0OA 4BL7A 3KM6A 3DD3A 2WGRA 4PQIA 5HR2A 4G2EA 4Z7XA 2I1UA 3HZ4A 2VIMA 3F4TA 4F9ZA 1XWGA 2CZ3A 1BEDA 2B6MA 2VL2C 4LLRA 4TXVA 2OA7A 2K8SA 2PPTA 2HZFA 3IBHA 4WEYA 4OCFA 2NBSA 4JRRA 1U88A 2IMFA 3HVVA 1MTCA 3GIXA 4ZIJA 1U3AA 1O8WA 1SENA 2DMLA 5CNWA 5ENUA 2BJXA 2CAIA 3FHKA 2EIQA 1VF3A 3TKSA 3GMFA 3C7MA 3UOMA 1MD3A 1DE2A 2HYXA 2JZRA 2OBIA 4ECIA 4IW9A 4K1FA 4XRAA 3DWVA 4KUNA 4IN0A 3HYPA 2AYTA 5KN0A 1X5EA 3KEBA 2OJLA 2LJAA 4FYCA 4NV5A 4FYUA 4HZ2A 3EWLA 4KAEA 5J5NA 1EGOA 3CRTA 1ZMAA 3I69A 3DEXA 3P2AA 1ZYEA 2PN8A 2JU5A 2L5OA 3KZQA 2YOIA 4D73B 1O8XA 4MMMA 4KCAA 1SK1A 4POLA 4KB3A 4MZBA 4EKZA 4K6XA 2HI7A 4KNDA 3CRUA 10GSA 5GSSA 4F82A 1OKDA 2LQQA 4HQSA 3APSA 2WS2A 1Y25A 4MF5A 1X9MB 1A0RP 2IPAA 2B1LA 4NPBA 5A4UA 1PKWA 1K0DA 1YDKA 2GQMA 2R3XA 5F06A 2VO4A 5C00A 5D73A 1Y6EA 3D0ZA 2YZUA 1NSWA 4BPYA 4MZCA 1GSFA 1XWAA 3UBKA 5D9WA 4IGJA 2VOCA 2DLXA 1YF0A 3TRXA 2OADA 1X0RA 5IMZA 6GSVA 5J41A 4TXOB 4F0CA 4H86A 1A0FA 1TU7A 2P5QA 4ZBDA 3FR6A 4TR3A 1GNWA 3O76A 3APOA 2C4JA 2GGTA 4X1UA 3H79A 2A2RA 3R2QA 3VWUA 1TW9A 2WDUA 2KP1A 4V2LA 1WIKA 2D2ZA 4MPGA 2I4AA 2YV7A 1A2JA 1V9WA 2KLXA 2BMXA 1HNAA 3LFLA 1YKAA 3CBUA 3MSZA 5IQYA 3J7Yb 3LEFA 1FHEA 1M2AA 5IPHA 4ILFA 3L9VA 3F0IA 3QD9A 4PURA 5G5EA 2VLUA 3HA9A 5DQSA 2B1KA 5DAKA 1Z9HA 2X8HA 1XWBA 1Q98A 4KSOA 3HDCA 1Z6NA 2MMOA 3HY2A 4XS6A 4I6XA 11GSA 3APQA 5HFIA 2WB9A 4E8EA 2R4VA 1EP7A 2I9HA 1S3AA 3CTFA 5IPGA 1JZOA 2FA4A 4HQZA 1GSEA 1N8JA 1AXDA 3QAVA 4ECBA 1R26A 4OMVA 2FGXA 1W89A 2YV9A 3EU4A 3BD2A 5CP1A 4BWSA 3D5JA 2H6XA 1MDIA 1XOBA 1Z3EA 2VL3A 6GSUA 3KJYA 1W4VA 12GSA 4IJ3A 4OFMA 1GRXA 2IIYA 3DIEA 3F3RA 4EE0A 2E7PA 3ZFBA 5J9BA 5IOWA 2FD3A 2GZYA 3M1GA 4TN8A 4F0BA 5LD0A 1J08A 5DCHA 3M3MA 4EDYA 4BVXA 3IC4A 1R4WA 3ERFA 4N30A 2C0DA 3VFIA 3LYPA 1SKWB 2YN1A 4PUAA 2PMTA 1YF1A 2FLSA 4PGTA 4XS1A 4MJAA 3IAS2 1WMJA 3CSHA 1GUKA 5DBQA 1JFUA 1M0UA 5JCWA 1XXUA 2OACA 2IMEA 2VM1A 4KH7A 4XIHA 2VM2A 5ECKB 4K2DA 5D9VA 1R5AA 3CSJA 1MD4A 3GURA 2IN3A 4KCEA 4IP6A 4OFNA 3QOUA 2VCXA 5FWGA 3P8WA 1A24A 1T3BA 4HZ4A 2VCQA 2ON5A 2AHEA 2YJ7A 4AGSA 2C80A 2KP2A 5AGYA 3IDVA 3SWLA 3CMIA 4LL1B 5F05A 1AAZA 2RLIA 1FOVA 3MAKA 4MJBA 5ECSA 2RM5A 2F9SA 4V2MA 4HUAA 2Z9SA 1O7UA 3C8EA 3EVIA 3M8NA 4ML1A 1SKRB 1JHBA 1SU9A 1B9XC 2GSRA 3HVSA 1K0NA 3CSIA 17GSA 3HJOA 3QPMA 2DJ3A 3UBLA 5J9CA 1MDKA 1V98A 3F63A 1CQHA 2C3NA 1V40A 2FWFA 3G9BA 2DJ2A 4EUYA 4ZB8A 5B6NA 5JWOB 1SYXA 5ECIB 1TK0B 2FY6A 3F3QA 1ZGNA 1HQOA 4GF0A 2MBSA 4MF7A 4K0NA 4BA7A 2VLTA 2O7KA 1NW2A 5D9TA 4MK3A 3N5OA 6GSTA 1KBNA 3FZ5A 1B4QA 2VD0A 2VD1A 3ZZXA 19GSA 1GUMA 2YPMA 4KDYA 2PVOC 2FWHA 2QGVA 4EL1A 5G5FA 4NAXA 4L0UA 5CRWA 3VURA 1PL2A 4XS4A 4JEDA 1EV4A 4N0VA 2V41A 1GSQA 3DYRA 5AISA 3HXSA 5DQYA 3VWVA 1WRYA 5DJLA 5JWQB 2YANA 2K9FA 1HNCA 2JSYA 4GSTA 3V1WA 5DJMA 2JZSA 4AJ7A 1XW9A 4N11A 1ACVA 5EL8A 1K3YA 3RPNA 3M9KA 2XBQA 5CRHA 1SK0A 1Z6MA 1BAYA 4BWQA 1U87A 1TJDA 2H1GA 2R2JA 3A2VA 3TOTA 1H4OA 1ERVA 2VLVA 2TRXA 3DVWA 3TKPA 1RQMA 3FYGA 3ZTLA 2KOKA 5GAPD 3QDNA 3GH6A 4IELA 1SL2B 4GLTA 2DIYA 7GSSA 4EVMA 4YQMA 1F3AA 3PR8A 1DE1A 1M9AA 2V32A 3LG6A 2C0EA 1BQ7A 4O32A 5IM9A 3HCZA 3QAWA 3E9JB 5ECPB 4JR4A 1Q4JA 3WT2A 1CQGA 3DGQA 2DMMA 1ZZYA 6GSWA 3KIJA 1FB0A 4I8BA 3ZFLA 4WR4A 2HSYA 3LYKA 3TKQA 1YY7A 1OKTA 3O6TA 4GSNA 1M99A 5A4VA 2TRCP 2MZCA 2DBCA 3O3TA 3E0UA 4ZB6A 1ZYQB 4L0WA 2VCTA 2CQ9A 1SJZA 2R6KA 1R7HA 2H71A 4X0XA 2X99A 4WF4A 1THXA 5DAKB 5HR1A 2L6CA 1M9BA 1RK4A 5B6MA 5HQPA 3RHCA 2MMAA 1TKDB 2JADA 3JCML 1T7PB 5JCGA 4TVEA 2K6VA 2N5AA 3DKSA 1XWCA 2OE1A 1WP0A 9GSSA 3M0FA 1F9MA 1Z7PA 2H74A 2CVDA 4LL4B 2V2GA 3HZ8A 1X5DA 1WWJA 4EC0A 2HRFA 1XCCA 1EWXA 1B48A 2YNXA 1DUGA 5L71A 2LKUA 3DMLA 5CRGA 3EMPA 2REMA 3KH7A 1OC9A 3EINA 4L5LA 4YAVA 1M2BA 2F51A 5GSTA 4O7HA 4K0GA 2GSTA 3L78A 1B8XA 1EZKA 1EV9A 3EURA 4HJMA 3MNGA 4MA9A 3PH9A 4MJEA 3LSZA 5IO2A 2WCIA 1ON4A 1OVNA 5B7CA 3PINA 1QGVA 4ZL7A 1PSQA 2H30A 1J9BA 2YP6A 4MF6A 3F8UA 4FYBA 4POBA 3RBTA 3IXRA 4EF0A 3GN3A 3GSTA 5HR0A 1GL8A 5F8BA 1Z7RA 1AW9A 1G6WA 4TR1A 4TRXA 4CHSA 1OE7A 1FG4A 4V1Ap 4LMVA 2LNSA 3QFBC 2E2GA 3ZVJA 3NIVA 4PX1A 3WGXA 3I6AA 2H0HA 3WGDA 2V1MA 2B3SA 2PU9C 1F2EA 2P5RA 3L0HA 1G6YA 1URMA 1XW5A 2ALBA 4OO5A 3LGCA 1G7OA 2L4QA 4Q5FA 1OC3A 3VWXA 4KX4A 2VL2A 4XHMA 2PBJA 1FB6A 4CDOA 1AQWA 3GKXA 2WULA 4IVFA 4JR6A 3C73A 2RIIA 2OBKA 5ECRB 2G2QA 3FRCA 2CAQA 4NXIA 1GTBA 1TTZA 1MEKA 20GSA 5D8IA 5ID2A 2R37A 2VCVA 1K0CA 1K3OA 2V6KA 3TB2A 2GTUA 3HD5A 4OO4A 4MZWA 4JE1A 22GSA 3F6FA 3FY7A 3VPTA 2E2MA 2YCDA 4V2NA 2R5GA 4FIWA 1OYJA 4RQRA 3HKRA 3GX0A 2B5YA 1FVKA 4XS4B 3VK9A 2EIRA 3P90A 2H0GA 3RPPA 4PQ1A
chains in the Genus database with same CATH superfamily
2M72A 2YWNA 1G7EA 3GX8A 3EPTA 4L8EA 4KDUA 4Q5NA 2JL4A 2N5BA 3FR3A 2GQLA 1PKZA 4KA0A 1SYRA 3LXTA 3BCKA 4ZXGA 1GLQA 1ML6A 1K0MA 4KSMA 4MH2A 4PNGA 1SJ6A 3UVTA 2GZZA 5DCGA 2M46A 1DBYA 4YH2A 1FVJA 4DVCA 2X49A 4ULXA 4QL9A 2NTOA 4EDZA 3ZREA 2H0IA 1M2DA 2XPEA 2LTKA 1KNGA 3OR5A 4RUVA 4KDXA 1JZDA 2L6DA 3IA1A 1NHYA 5A4WA 5ECMB 5A5KA 3HVXA 3TRPA 2AJQB 4RQXA 5AN1A 4MCUA 3M9JA 3QR6A 4GXZA 1VF4A 3GKNA 5KN2A 2L4CA 3EMXA 2GZPA 1IYIA 1T1VA 1F3BA 4NHWA 3TJGA 1I9DA 2AV4A 2X64A 1HD2A 3HJMA 3J7Yk 2C1YA 1MDJA 2H6YA 3GA4A 4PNFA 3A2WA 2DSAA 1JLWA 1X5CA 2H8LA 1A8LA 2LV3A 4F2IA 5E59A 2CX3A 3MIXA 5AIXA 2X8GA 5EY6A 2UZ8A 1GP1A 3GL3A 4KE3A 3IHQA 3TGZA 3UJ1A 1XIYA 2DJJA 3H4KA 2DJKA 3TRQA 6GSXA 2IMIA 3ZMKA 2VCZA 3DVXA 4F03A 1AIUA 3KGKA 4K2XA 2IL3A 3KXOA 4O92A 3ED3A 4ZBAA 2B7KA 4MDCA 2H01A 1AC1A 3ME7A 3FK8A 1TK8B 1J0FA 2CA8A 2XPDA 2JACA 3GKKA 2GT6A 1NHOA 3EE2A 4NV2A 3C1SA 1BX9A 3QFAC 1JZRA 2CX4A 4WBJA 1GH2A 5ECHB 5H5RA 3W8SA 4HS1A 5D9XA 2ZUPA 1XW6A 1GTIA 3CXGA 3RAZA 2O89A 5CRDA 3UVHA 4XTSA 3VI5A 3GYKA 2H66A 3IK7A 3L9UA 2C8UA 4V1Ag 3WT1A 2AUVA 1TRSA 4HEA2 1OC9B 4KW6A 5J4UA 4HOJA 3H8QA 3L9SA 1X9SB 4NMUA 1LBKA 1PA3A 2HFDA 2YWOA 3LW9A 1UC7A 1ABAA 1SKSB 3Q6OA 3IPZA 1TRUA 4ML6A 2LRCA 4POKA 5H5SA 3KTLA 3BBYA 3G7YA 2HSHA 1YQ1A 2LRNA 3I43A 4X43A 3TKSC 1OAZA 1S3CA 1EOGA 3FR9A 3KTBA 4BIKA 5IMFA 2QSIA 2FWEA 3GHAA 2MYGA 5G1KA 1GSUA 1NM3A 3BJ5A 3Q18A 1FAAA 2YJHA 2DJ1A 3KMOA 4MABA 3GL5A 4O5RA 4TR1B 4GQFA 1PX6A 4ACSA 6GSYA 1TRWA 3W6GA 4IKHA 2IFQA 2HRAA 3H1NA 3U6VA 1TI3A 3PGTA 3TJKA 2GQKA 4ZB9A 5IIZA 4TOPA 2VL9A 4GQCA 2A4VA 3ZITA 2H19A 1M3JA 4K8MA 1VGLA 2I3YA 5IOXA 5D96A 1DSBA 1XZOA 3MYDA 3FEUA 2CVBA 5IMVA 2NVLA 3A3TA 3UEMA 1VF1A 5IMDA 1H75A 3P7XA 5GZZB 1BJXA 2EC4A 2G0FA 4AJ8A 4HU9A 1X9WB 2B7JA 4BVYA 2OE0A 5CAXA 3D4MA 5ID2B 3WYWA 4OCEA 2BTOT 1OC8A 2R0GA 2J9HA 2HRNA 3MDKA 4J56E 1TU8A 2O85A 1QQ2A 2CZ2A 2ON7A 3TJBA 4IHUA 4DSSA 1WPIA 1GLPA 4HDEA 3GH9A 1QFNA 2DKHA 3KMNA 2I81A 3TKSE 4GCIA 5CREA 1K3LA 3TUEA 3GTUA 1GSYA 14GSA 2RUEA 3EYTA 2XBIA 5JCUA 3TJFA 6GSSA 3U5RE 1T4ZA 2KHPA 3FKFA 3IAM2 5ECOB 4I97A 1A8YA 1TI1A 1K0BA 1A2LA 4X4JA 5HFGA 2GSSA 3EU3A 4YQVA 2QA2A 4MJCA 1QK8A 3GRXA 4TKYA 5J3RA 3FMWA 4QQ7A 5LCZA 3ZYWA 1YEXA 4ID0A 1YJ6A 4AJ6A 4K7NA 5G30A 1T8EB 5ECLB 1GTUA 4RI7A 1KTEA 5HR3A 4G10A 4RI6A 2B5EA 4TR4A 4WKWA 1QUWA 3TOUA 4AF2A 4ICYA 18GSA 1PL1A 1PMTA 2L59A 2HZEA 3TKRA 3UARA 4LMWA 2FNOA 1SJIA 2F8FA 2F8AA 5G2ZA 2YWIA 2CV4A 3K8NA 1E2YA 4K7OA 5CYYA 5GAND 1TK5B 4POMA 1UVZA 3A5WA 3MWHA 2HSMA 5IMAA 3RHBA 3VLNA 1V58A 3IE3A 3DXBA 1C72A 2OE3A 3GUSA 4DSQA 2HXKA 3UIWA 3C1RA 2JZTA 2H70A 4MNNA 3DRNA 2H73A 1T4YA 3AY8A 2L57A 4Q5RA 2PVQA 1O6JA 2QKEA 3ZMLA 4IS0A 2VCWA 5FHIA 2DIZA 4TR0A 1AQXA 4MLYA 2RUFA 2AAWA 4ECCA 3D4TA 2LRTA 3C71A 3TDGA 3ZIVA 5AIVA 3QMXA 2K18A 3WD6A 2GSQA 3S9FA 1SL1B 3LORA 4G0LA 4DSRA 1XVWA 5DALA 1N2AA 5ELAA 1S3DA 2LS5A 1GWCA 1SK2A 2FA8A 2LNTA 4ZL9A 4HU7A 1GTAA 4GWRA 3F4RA 2LQOA 1TXXA 2P31A 3IK9A 3HJPA 1XWKA 4EIQA 5G31A 4JU5A 2HNLA 2PWJA 1B9YC 1XOAA 2CT6A 3BOAA 4WR5A 1WE0A 2XC2A 3I9V2 2N5FA 3D6IA 3D21A 2HE3A 2DC5A 2H1DA 5F0GA 1VRSD 1XVQA 3G7IA 4EO3A 1USBA 3IOSA 5COHA 2GLRA 2TIRA 5KN3A 1ERTA 2IMDA 4ISDA 8GSSA 3ZLPA 3LQ7A 4FH8A 1BG5A 3D22A 1LU4A 2JSZA 1EEJA 1KEBA 3TCOA 4N10A 1V57A 5E4WA 1YZXA 2GVPA 1M7TA 1O73A 3VPQA 5BMUA 4J57E 3ERWA 1S3RA 3RDWA 5G1LA 3GNJA 3ZL5A 1A23A 1O81A 3LJRA 3GSSA 4ECJA 1PRXA 4ZILA 4CW9A 1ZCPA 3ERGA 4PQHA 1BYEA 4MP4A 2RM6A 4TW5A 3IRAA 4DEJA 4WBRD 3WGEA 4FQUA 2AB6A 1GULA 3ZVJD 3ISOA 4FO5A 4MH3A 2J23A 4GTUA 1EP8A 2NPBA 1PFOA 1XPVA 3KCMA 4LA1A 2ZNMA 1TRVA 1WJKA 2C3QA 2YZHA 5B8AA 1SL0B 2E0QA 1PGTA 1LJRA 2IFQB 1A2MA 2XHFA 1U6TA 1XG8A 1TP9A 2H1AA 1V2AA 5IMCA 4ZL8A 1OE8A 2DKIA 2CVKA 3TJJA 1XFLA 3UL3A 4OFTA 4JBBA 3FZAA 1IYHA 1F6MC 1JLVA 3ZIJA 2H1BA 1ERWA 3F4SA 3IR4A 4ZBBA 2HLSA 1UN2A 4BVYB 4PUFC 2PERA 2K8VA 3F6DA 1EOHA 4D73A 3CYNA 3L4NA 2ES7A 2FHEA 1EEMA 2FCHA 1U3IA 1VF2A 3GFKA 2C0FA 4DSSB 2LSTA 2DJ0A 5KN1A 2FWGA 2WRTA 2O87A 1Z5YE 3LWAA 2PUKC 4IQ1A 5B8BA 1PD21 3QAGA 2F3MA 1XBSA 2NDOA 4WF5A 3GTUB 1FO5A 1AUCA 1SD8A 4GRFA 1UA5A 1FW1A 2R0PA 5EPFA 5C04A 2WFCA 1GUHA 4K9ZA 2LJRA 3ZRDA 1ST9A 1GNEA 3VWWA 4G9HA 4YAPA 2GDRA 5FT3A 3QCPA 2FUG2 5F07A 2L5LA 4Q5QA 3IC8A 4E8HA 4XRDA 3GKMA 3BCIA 4TXOA 4N0ZA 3KP9A 3A2XA 2V6OA 1WOUA 4IQAA 5D93A 1EGRA 2O8VB 4Z2TA 1PN9A 5ECNB 1QMVA 2MMZA 4EXJA 1I5GA 2HZEB 2C3TA 2VUPA 1ZOFA 3SBCA 5ELGA 3UAPA 1E6BA 2YWMA 2H76A 4OD7A 1PQNA 3H93A 4HI7A 5INYA 2P0GA 4JZQA 1O85A 1ILOA 2IWTA 2LJKA 5EVOA 5DVBA 5DDLA 4NHZA 1TOFA 3KP8A 2IJYA 2QC7A 5LNKe 5JWRB 1ZL9A 5KEJA 5H5QA 1GSSA 3NZNA 3N9JA 1PX7A 4XCSA 3HHVA 3EC3A 3US3A 4I2TA 4I5QA 2EIOA 2HT9A 4KGIA 3G7JA 2GS3A 4NWYA 2PGTA 3FW2A 1GSDA 5ABRA 3Q74A 3VI7A 4HJ2A 2KUCA 4OWYA 1F37A 4G19A 5IO0A 5CO3A 1HNBA 1K0AA 2WZ9A 2C0GA 5HFKA 2M80A 4WETA 1JZWA 4PXOA 2MMNA 1QXHA 3FZ4A 3ME8A 1TDIA 2HRKA 4IJIA 2GT5A 3R3EA 3UMAA 2MBTA 3KH9A 1B4PA 1ERUA 2VAFA 5DALB 2IMKA 2LEGA 3W8JA 16GSA 4IP1A 3Q19A 1T00A 4P3YB 4YQUA 1AQVA 1RW1A 3NOFA 1THOA 4I2UA 2H72A 4L5OA 5ECQB 3CTGA 3IV4A 1SD9A 4K7IA 2X8CA 1G0TA 2H6ZA 3KD0A 3FZ9A 13GSA 3E3EA 2H75A 4IBPA 4MPFA 4J2FA 4WXTA 3F9UA 1YKCA 3GV1A 2A2SA 2LUSA 3LXZA 2ZCTA 1R5PA 2B5XA 2WJUA 1YEPA 1HYUA 4GSSA 2OKAA 4QL7A 3HVNA 1K0OA 4BL7A 3KM6A 3DD3A 2WGRA 4PQIA 5HR2A 4G2EA 4Z7XA 2I1UA 3HZ4A 2VIMA 3F4TA 4F9ZA 1XWGA 2CZ3A 1BEDA 2B6MA 2VL2C 4LLRA 4TXVA 2OA7A 2K8SA 2PPTA 2HZFA 3IBHA 4WEYA 4OCFA 2NBSA 4JRRA 1U88A 2IMFA 3HVVA 1MTCA 3GIXA 4ZIJA 1U3AA 1O8WA 1SENA 2DMLA 5CNWA 5ENUA 2BJXA 2CAIA 3FHKA 2EIQA 1VF3A 3TKSA 3GMFA 3C7MA 3UOMA 1MD3A 1DE2A 2HYXA 2JZRA 2OBIA 4ECIA 1PN0A 4IW9A 4K1FA 4XRAA 3DWVA 4KUNA 4IN0A 3HYPA 2AYTA 5KN0A 1X5EA 3KEBA 2OJLA 2LJAA 4FYCA 4NV5A 4FYUA 4HZ2A 3EWLA 4KAEA 5J5NA 1EGOA 3CRTA 1ZMAA 3I69A 3DEXA 3P2AA 1ZYEA 2PN8A 2JU5A 2L5OA 3KZQA 2YOIA 4D73B 1O8XA 4MMMA 4KCAA 1SK1A 4POLA 4KB3A 4MZBA 4EKZA 4K6XA 2HI7A 4KNDA 3CRUA 10GSA 5GSSA 4F82A 1OKDA 2LQQA 4HQSA 3APSA 2WS2A 1Y25A 4MF5A 1X9MB 1A0RP 2IPAA 2B1LA 4NPBA 5A4UA 1PKWA 1K0DA 1YDKA 2GQMA 2R3XA 5F06A 2VO4A 5C00A 5D73A 1Y6EA 3D0ZA 1M3IA 2YZUA 1NSWA 4BPYA 4MZCA 1GSFA 1XWAA 5KOXA 3UBKA 5D9WA 4IGJA 2VOCA 2DLXA 1YF0A 3TRXA 2OADA 1X0RA 5IMZA 6GSVA 5J41A 4TXOB 4F0CA 4H86A 1A0FA 1TU7A 4O5QA 2P5QA 4ZBDA 3FR6A 4TR3A 1GNWA 3O76A 3APOA 2C4JA 2GGTA 4X1UA 3H79A 2A2RA 3R2QA 4O5UA 3VWUA 1TW9A 2WDUA 2KP1A 4V2LA 1WIKA 2D2ZA 4MPGA 2I4AA 2YV7A 1A2JA 1V9WA 4CY8A 2KLXA 2BMXA 1HNAA 3LFLA 1YKAA 3CBUA 3MSZA 5IQYA 3J7Yb 3LEFA 1FHEA 1M2AA 5IPHA 4ILFA 3L9VA 3F0IA 3QD9A 4PURA 5G5EA 2VLUA 3HA9A 5DQSA 2B1KA 5DAKA 1Z9HA 2X8HA 1XWBA 1Q98A 4KSOA 2A4HA 3HDCA 1Z6NA 2MMOA 3HY2A 4XS6A 4I6XA 11GSA 3APQA 5HFIA 2WB9A 4E8EA 2R4VA 1EP7A 2I9HA 1S3AA 3CTFA 5IPGA 1JZOA 2FA4A 4K5SA 2R0CA 4HQZA 1GSEA 1N8JA 1AXDA 3QAVA 4ECBA 1FOHA 1R26A 4OMVA 2FGXA 1W89A 4Z2UA 2YV9A 3EU4A 3BD2A 5CP1A 4BWSA 3D5JA 2H6XA 1MDIA 1XOBA 1Z3EA 2VL3A 6GSUA 3KJYA 1W4VA 12GSA 4IJ3A 4OFMA 1GRXA 2IIYA 3DIEA 3F3RA 4EE0A 2E7PA 3ZFBA 5J9BA 5IOWA 2FD3A 2GZYA 3M1GA 4TN8A 4F0BA 5LD0A 1J08A 5DCHA 3M3MA 4EDYA 4BVXA 3IC4A 2X4AA 1R4WA 3ERFA 4N30A 2C0DA 3VFIA 3LYPA 1SKWB 2YN1A 4PUAA 2PMTA 1YF1A 2FLSA 4PGTA 4XS1A 4MJAA 3IAS2 1WMJA 3CSHA 4KF9A 1GUKA 5DBQA 1JFUA 1M0UA 5JCWA 1XXUA 2OACA 2IMEA 2VM1A 4BL7B 4KH7A 4XIHA 4K5RA 2VM2A 5ECKB 4K2DA 5D9VA 1R5AA 3CSJA 1MD4A 3GURA 2IN3A 4KCEA 4IP6A 4OFNA 3QOUA 2VCXA 5FWGA 3P8WA 1A24A 1T3BA 4HZ4A 2VCQA 2ON5A 2AHEA 2YJ7A 4AGSA 2C80A 2KP2A 5AGYA 3IDVA 3SWLA 3CMIA 4LL1B 5F05A 1AAZA 2RLIA 1FOVA 3MAKA 4MJBA 5ECSA 2RM5A 2F9SA 4V2MA 4HUAA 2Z9SA 1O7UA 3C8EA 3EVIA 3M8NA 4ML1A 1SKRB 1JHBA 1SU9A 1B9XC 2GSRA 3HVSA 1K0NA 3CSIA 4G0IA 17GSA 3HJOA 3QPMA 2DJ3A 3UBLA 5J9CA 1MDKA 1V98A 3F63A 1CQHA 2C3NA 1V40A 2FWFA 3G9BA 2DJ2A 4EUYA 4ZB8A 5B6NA 3IHGA 5JWOB 1SYXA 5ECIB 1TK0B 2FY6A 3F3QA 1ZGNA 1HQOA 4GF0A 2MBSA 4MF7A 4K0NA 4BA7A 2VLTA 2O7KA 1NW2A 5D9TA 4MK3A 3PPUA 3N5OA 6GSTA 1KBNA 3FZ5A 1B4QA 2VD0A 2VD1A 3ZZXA 19GSA 1GUMA 2YPMA 4KDYA 2PVOC 2FWHA 2QGVA 4EL1A 5G5FA 4NAXA 4L0UA 5CRWA 3VURA 1PL2A 4XS4A 4JEDA 1EV4A 4N0VA 2V41A 1GSQA 3DYRA 5AISA 3HXSA 5DQYA 3VWVA 1WRYA 5DJLA 5JWQB 2YANA 2K9FA 4PTSA 1HNCA 2JSYA 4GSTA 5KOWA 3V1WA 3CQFA 5DJMA 2JZSA 4AJ7A 1XW9A 4N11A 4YKFA 1ACVA 5EL8A 1K3YA 3RPNA 3M9KA 2XBQA 5CRHA 1SK0A 1Z6MA 1BAYA 4BWQA 1U87A 1TJDA 2H1GA 2R2JA 3A2VA 3TOTA 1H4OA 1ERVA 2VLVA 2TRXA 3DVWA 3TKPA 1RQMA 3FYGA 3ZTLA 2QA1A 2KOKA 5GAPD 3QDNA 3GH6A 1ZYPA 4IELA 1SL2B 4GLTA 2DIYA 7GSSA 4EVMA 4YQMA 1F3AA 3PR8A 1DE1A 1M9AA 2V32A 3LG6A 2C0EA 1BQ7A 4O32A 5IM9A 3HCZA 3QAWA 3E9JB 5ECPB 4JR4A 1Q4JA 3WT2A 1CQGA 3DGQA 2DMMA 4G0KA 1ZZYA 6GSWA 4CY6A 3KIJA 1FB0A 4I8BA 3ZFLA 4WR4A 2HSYA 3LYKA 3TKQA 1YY7A 1OKTA 3O6TA 4GSNA 1M99A 5A4VA 2TRCP 2MZCA 2DBCA 3O3TA 3E0UA 4ZB6A 1ZYQB 4L0WA 2VCTA 2CQ9A 4Z2RA 1SJZA 2R6KA 1R7HA 2H71A 4X0XA 2X99A 4WF4A 1THXA 5DAKB 5HR1A 2L6CA 1M9BA 1RK4A 5B6MA 5HQPA 3RHCA 2MMAA 1TKDB 2JADA 3JCML 1T7PB 5JCGA 4TVEA 2K6VA 2A2PA 2N5AA 3DKSA 1XWCA 2OE1A 1WP0A 9GSSA 3M0FA 1F9MA 1Z7PA 2H74A 2CVDA 4LL4B 2V2GA 3HZ8A 1X5DA 1WWJA 4EC0A 2HRFA 1XCCA 1EWXA 1B48A 2YNXA 1DUGA 4HSCX 5L71A 2LKUA 3DMLA 5CRGA 3EMPA 2REMA 3KH7A 1OC9A 3EINA 4L5LA 4YAVA 1M2BA 2F51A 5GSTA 4O7HA 4K0GA 4BVXB 2GSTA 3L78A 1B8XA 1EZKA 1EV9A 3EURA 4HJMA 3MNGA 4MA9A 3PH9A 4MJEA 3LSZA 5IO2A 3A5IA 2WCIA 1ON4A 1OVNA 5B7CA 3PINA 1QGVA 4ZL7A 1PSQA 2H30A 1J9BA 2YP6A 4MF6A 3F8UA 4FYBA 4POBA 3RBTA 3IXRA 4EF0A 3GN3A 3GSTA 5HR0A 1GL8A 5F8BA 1Z7RA 5BRTA 1AW9A 1G6WA 4TR1A 4TRXA 4CHSA 1OE7A 1FG4A 4V1Ap 4LMVA 2LNSA 3QFBC 2E2GA 3ZVJA 3NIVA 4PX1A 3WGXA 3I6AA 2H0HA 3WGDA 2V1MA 2B3SA 2PU9C 1F2EA 2P5RA 3L0HA 1G6YA 1URMA 1XW5A 2ALBA 4OO5A 3LGCA 1G7OA 2L4QA 4Q5FA 1OC3A 3VWXA 4KX4A 1ZYNA 2VL2A 4XHMA 2PBJA 1FB6A 4CDOA 1AQWA 3GKXA 2WULA 4IVFA 4JR6A 4A5PA 3C73A 2RIIA 2OBKA 5ECRB 2G2QA 3FRCA 2CAQA 4NXIA 1GTBA 1TTZA 1MEKA 20GSA 5D8IA 5ID2A 2R37A 2VCVA 1K0CA 1K3OA 2V6KA 3TB2A 2GTUA 3HD5A 4OO4A 4MZWA 4JE1A 4YKGA 22GSA 3F6FA 3FY7A 3VPTA 2E2MA 2YCDA 4V2NA 2R5GA 4FIWA 1OYJA 4RQRA 3HKRA 3GX0A 2B5YA 1FVKA 4XS4B 3VK9A 2EIRA 3P90A 4USSA 2H0GA 3RPPA 4PQ1A 4EIPA
chains in the Genus database with same CATH topology
2M72A 2YWNA 1G7EA 3GX8A 3EPTA 4L8EA 4KDUA 4Q5NA 2JL4A 2N5BA 3FR3A 2GQLA 1PKZA 4KA0A 1SYRA 3LXTA 3BCKA 4ZXGA 1GLQA 1ML6A 1K0MA 4KSMA 4MH2A 4PNGA 1SJ6A 3UVTA 2GZZA 5DCGA 2M46A 1DBYA 4YH2A 1FVJA 4DVCA 2X49A 4ULXA 4QL9A 2NTOA 4EDZA 3ZREA 2H0IA 1M2DA 2XPEA 2LTKA 1KNGA 3OR5A 4RUVA 4KDXA 1JZDA 2L6DA 3IA1A 1NHYA 5A4WA 5ECMB 5A5KA 3HVXA 3TRPA 2AJQB 4RQXA 5AN1A 4MCUA 3M9JA 3QR6A 4GXZA 1VF4A 3GKNA 5KN2A 2L4CA 3EMXA 2GZPA 1IYIA 1T1VA 1F3BA 4NHWA 3TJGA 1I9DA 2AV4A 2X64A 1HD2A 3HJMA 3J7Yk 2C1YA 1MDJA 2H6YA 3GA4A 4PNFA 3A2WA 2DSAA 1JLWA 1X5CA 2H8LA 1A8LA 2LV3A 4F2IA 5E59A 2CX3A 3MIXA 5AIXA 2X8GA 5EY6A 2UZ8A 1GP1A 3GL3A 4KE3A 3IHQA 3TGZA 3UJ1A 1XIYA 2DJJA 3H4KA 2DJKA 3TRQA 6GSXA 2IMIA 3ZMKA 2VCZA 3DVXA 4F03A 1AIUA 3KGKA 4K2XA 2IL3A 3KXOA 4O92A 3ED3A 4ZBAA 2B7KA 4MDCA 2H01A 1AC1A 3ME7A 3FK8A 1TK8B 1J0FA 2CA8A 2XPDA 2JACA 3GKKA 2GT6A 1NHOA 3EE2A 4NV2A 3C1SA 1BX9A 3QFAC 1JZRA 2CX4A 4WBJA 1GH2A 5ECHB 5H5RA 3W8SA 4HS1A 5D9XA 2ZUPA 1XW6A 1GTIA 3CXGA 3RAZA 2O89A 5CRDA 3UVHA 4XTSA 3VI5A 3GYKA 2H66A 3IK7A 3L9UA 2C8UA 4V1Ag 3WT1A 2AUVA 1TRSA 4HEA2 1OC9B 4KW6A 5J4UA 4HOJA 3H8QA 3L9SA 1X9SB 4NMUA 1LBKA 1PA3A 2HFDA 2YWOA 3LW9A 1UC7A 1ABAA 1SKSB 3Q6OA 3IPZA 1TRUA 4ML6A 2LRCA 4POKA 5H5SA 3KTLA 3BBYA 3G7YA 2HSHA 1YQ1A 2LRNA 3I43A 4X43A 3TKSC 1OAZA 1S3CA 1EOGA 3FR9A 3KTBA 5IMFA 2QSIA 2FWEA 3GHAA 2MYGA 5G1KA 1GSUA 1NM3A 3BJ5A 3Q18A 1FAAA 2YJHA 2DJ1A 3KMOA 4MABA 3GL5A 4O5RA 4TR1B 4GQFA 1PX6A 4ACSA 6GSYA 1TRWA 3W6GA 4IKHA 2IFQA 2HRAA 3H1NA 3U6VA 1TI3A 3PGTA 3TJKA 2GQKA 4ZB9A 5IIZA 4TOPA 2VL9A 4GQCA 2A4VA 3ZITA 2H19A 4K8MA 1VGLA 2I3YA 5IOXA 5D96A 1DSBA 1XZOA 3MYDA 3FEUA 2CVBA 5IMVA 2NVLA 3A3TA 3UEMA 1VF1A 5IMDA 1H75A 3P7XA 5GZZB 1BJXA 2EC4A 2G0FA 4AJ8A 4HU9A 1X9WB 2B7JA 4BVYA 2OE0A 5CAXA 3D4MA 5ID2B 3WYWA 4OCEA 2BTOT 1OC8A 2R0GA 2J9HA 2HRNA 3MDKA 4J56E 1TU8A 2O85A 1QQ2A 2CZ2A 2ON7A 3TJBA 4IHUA 4DSSA 1WPIA 1GLPA 4HDEA 3GH9A 1QFNA 2DKHA 3KMNA 2I81A 3TKSE 4GCIA 5CREA 1K3LA 3TUEA 3GTUA 1GSYA 14GSA 2RUEA 3EYTA 2XBIA 5JCUA 3TJFA 6GSSA 3U5RE 1T4ZA 2KHPA 3FKFA 3IAM2 5ECOB 4I97A 1A8YA 1TI1A 1K0BA 1A2LA 4X4JA 5HFGA 2GSSA 3EU3A 4YQVA 2QA2A 4MJCA 1QK8A 3GRXA 4TKYA 5J3RA 3FMWA 4QQ7A 5LCZA 3ZYWA 1YEXA 4ID0A 1YJ6A 4AJ6A 4K7NA 5G30A 1T8EB 5ECLB 1GTUA 4RI7A 1KTEA 5HR3A 4G10A 4RI6A 2B5EA 4TR4A 4WKWA 1QUWA 3TOUA 4AF2A 4ICYA 18GSA 1PL1A 1PMTA 2L59A 2HZEA 3TKRA 3UARA 4LMWA 2FNOA 1SJIA 2F8FA 2F8AA 5G2ZA 2YWIA 2CV4A 3K8NA 1E2YA 4K7OA 5CYYA 5GAND 1TK5B 4POMA 1UVZA 3A5WA 3MWHA 2HSMA 5IMAA 3RHBA 3VLNA 1V58A 3IE3A 3DXBA 1C72A 2OE3A 3GUSA 4DSQA 2HXKA 3UIWA 3C1RA 2JZTA 2H70A 4MNNA 3DRNA 2H73A 1T4YA 3AY8A 2L57A 4Q5RA 2PVQA 1O6JA 2QKEA 3ZMLA 4IS0A 2VCWA 5FHIA 2DIZA 4TR0A 1AQXA 4MLYA 2RUFA 2AAWA 4ECCA 3D4TA 2LRTA 3C71A 3TDGA 3ZIVA 5AIVA 3QMXA 2K18A 3WD6A 2GSQA 3S9FA 1SL1B 3LORA 4G0LA 4DSRA 1XVWA 5DALA 1N2AA 5ELAA 1S3DA 2LS5A 1GWCA 1SK2A 2FA8A 2LNTA 4ZL9A 4HU7A 1GTAA 4GWRA 3F4RA 2LQOA 1TXXA 2P31A 3IK9A 3HJPA 1XWKA 4EIQA 5G31A 4JU5A 2HNLA 2PWJA 1XOAA 1B9YC 2CT6A 3BOAA 4WR5A 1WE0A 2XC2A 3I9V2 2N5FA 3D6IA 3D21A 2HE3A 2DC5A 2H1DA 5F0GA 1VRSD 1XVQA 3G7IA 4EO3A 1USBA 3IOSA 5COHA 2GLRA 2TIRA 5KN3A 1ERTA 2IMDA 4ISDA 8GSSA 3ZLPA 3LQ7A 4FH8A 1BG5A 3D22A 1LU4A 2JSZA 1EEJA 1KEBA 3TCOA 4N10A 1V57A 5E4WA 1YZXA 2GVPA 1M7TA 1O73A 3VPQA 5BMUA 4J57E 3ERWA 3RDWA 5G1LA 3GNJA 3ZL5A 1A23A 1O81A 3LJRA 3GSSA 4ECJA 1PRXA 4ZILA 4CW9A 1ZCPA 3ERGA 4PQHA 1BYEA 4MP4A 2RM6A 4TW5A 3IRAA 4DEJA 4WBRD 3WGEA 4FQUA 2AB6A 1GULA 3ZVJD 3ISOA 4FO5A 4MH3A 2J23A 4GTUA 1EP8A 2NPBA 1XPVA 3KCMA 4LA1A 2ZNMA 1TRVA 1WJKA 2C3QA 2YZHA 5B8AA 1SL0B 2E0QA 1PGTA 1LJRA 2IFQB 1A2MA 2XHFA 1U6TA 1TP9A 2H1AA 1V2AA 5IMCA 4ZL8A 1OE8A 2DKIA 2CVKA 3TJJA 1XFLA 3UL3A 4OFTA 4JBBA 3FZAA 1IYHA 1F6MC 1JLVA 3ZIJA 2H1BA 1ERWA 3F4SA 3IR4A 4ZBBA 2HLSA 1UN2A 4BVYB 4PUFC 2PERA 2K8VA 3F6DA 1EOHA 4D73A 3CYNA 3L4NA 2ES7A 2FHEA 1EEMA 2FCHA 1U3IA 1VF2A 3GFKA 2C0FA 4DSSB 2LSTA 2DJ0A 5KN1A 2FWGA 2WRTA 2O87A 1Z5YE 3LWAA 2PUKC 4IQ1A 5B8BA 1PD21 3QAGA 2F3MA 1XBSA 2NDOA 4WF5A 3GTUB 1FO5A 1AUCA 1SD8A 4GRFA 1UA5A 1FW1A 2R0PA 5EPFA 5C04A 2WFCA 1GUHA 4K9ZA 2LJRA 3ZRDA 1ST9A 1GNEA 3VWWA 4G9HA 4YAPA 2GDRA 5FT3A 3QCPA 2FUG2 5F07A 2L5LA 4Q5QA 3IC8A 4E8HA 4XRDA 3GKMA 3BCIA 4TXOA 4N0ZA 3KP9A 2V6OA 3A2XA 1WOUA 4IQAA 5D93A 1EGRA 2O8VB 4Z2TA 1PN9A 5ECNB 1QMVA 2MMZA 4EXJA 1I5GA 2HZEB 2C3TA 2VUPA 1ZOFA 3SBCA 5ELGA 3UAPA 1E6BA 2YWMA 2H76A 4OD7A 1PQNA 3H93A 4HI7A 5INYA 2P0GA 4JZQA 1O85A 1ILOA 2IWTA 2LJKA 5EVOA 5DVBA 5DDLA 4NHZA 1TOFA 3KP8A 2IJYA 2QC7A 5LNKe 5JWRB 1ZL9A 5KEJA 5H5QA 1GSSA 3NZNA 3N9JA 1PX7A 4XCSA 3HHVA 3EC3A 3US3A 4I2TA 4I5QA 2EIOA 2HT9A 4KGIA 3G7JA 2GS3A 4NWYA 2PGTA 3FW2A 1GSDA 5ABRA 3Q74A 3VI7A 4HJ2A 2KUCA 4OWYA 1F37A 4G19A 5IO0A 5CO3A 1HNBA 1K0AA 2WZ9A 2C0GA 5HFKA 2M80A 4WETA 1JZWA 4PXOA 2MMNA 1QXHA 3FZ4A 3ME8A 1TDIA 2HRKA 4IJIA 2GT5A 3R3EA 3UMAA 2MBTA 3KH9A 1B4PA 1ERUA 2VAFA 5DALB 2IMKA 2LEGA 3W8JA 16GSA 4IP1A 3Q19A 1T00A 4P3YB 4YQUA 1AQVA 1RW1A 3NOFA 1THOA 4I2UA 2H72A 4L5OA 5ECQB 3CTGA 3IV4A 1SD9A 4K7IA 2X8CA 1G0TA 2H6ZA 3KD0A 3FZ9A 13GSA 3E3EA 2H75A 4IBPA 4MPFA 4J2FA 4WXTA 3F9UA 1YKCA 3GV1A 2A2SA 2LUSA 3LXZA 2ZCTA 1R5PA 2B5XA 2WJUA 1YEPA 1HYUA 4GSSA 2OKAA 4QL7A 1K0OA 4BL7A 3KM6A 3DD3A 2WGRA 4PQIA 5HR2A 4G2EA 4Z7XA 2I1UA 3HZ4A 2VIMA 3F4TA 4F9ZA 1XWGA 2CZ3A 1BEDA 2B6MA 2VL2C 4LLRA 4TXVA 2OA7A 2K8SA 2PPTA 2HZFA 3IBHA 4WEYA 4OCFA 2NBSA 4JRRA 1U88A 2IMFA 3HVVA 1MTCA 3GIXA 4ZIJA 1U3AA 1O8WA 1SENA 2DMLA 5CNWA 5ENUA 2BJXA 2CAIA 3FHKA 2EIQA 1VF3A 3TKSA 3GMFA 3C7MA 3UOMA 1MD3A 1DE2A 2HYXA 2JZRA 2OBIA 4ECIA 1PN0A 4IW9A 4K1FA 4XRAA 3DWVA 4KUNA 4IN0A 3HYPA 2AYTA 5KN0A 1X5EA 3KEBA 2OJLA 2LJAA 4FYCA 4NV5A 4FYUA 4HZ2A 3EWLA 4KAEA 5J5NA 1EGOA 3CRTA 1ZMAA 3I69A 3DEXA 3P2AA 1ZYEA 2PN8A 2JU5A 2L5OA 3KZQA 2YOIA 4D73B 1O8XA 4MMMA 4KCAA 1SK1A 4POLA 4KB3A 4MZBA 4EKZA 4K6XA 2HI7A 4KNDA 3CRUA 10GSA 5GSSA 4F82A 1OKDA 2LQQA 4HQSA 3APSA 2WS2A 1Y25A 4MF5A 1X9MB 1A0RP 2IPAA 2B1LA 4NPBA 5A4UA 1PKWA 1K0DA 1YDKA 2GQMA 2R3XA 5F06A 2VO4A 5C00A 5D73A 1Y6EA 3D0ZA 2YZUA 1NSWA 4BPYA 4MZCA 1GSFA 1XWAA 5KOXA 3UBKA 5D9WA 4IGJA 2VOCA 2DLXA 1YF0A 3TRXA 2OADA 1X0RA 5IMZA 6GSVA 5J41A 4TXOB 4F0CA 4H86A 1A0FA 1TU7A 4O5QA 2P5QA 4ZBDA 3FR6A 4TR3A 1GNWA 3O76A 3APOA 2C4JA 2GGTA 4X1UA 3H79A 2A2RA 3R2QA 4O5UA 3VWUA 1TW9A 2WDUA 2KP1A 4V2LA 1WIKA 2D2ZA 4MPGA 2I4AA 2YV7A 1A2JA 1V9WA 4CY8A 2KLXA 2BMXA 1HNAA 3LFLA 1YKAA 3CBUA 3MSZA 5IQYA 3J7Yb 3LEFA 1FHEA 1M2AA 5IPHA 4ILFA 3L9VA 3F0IA 3QD9A 4PURA 5G5EA 2VLUA 3HA9A 5DQSA 2B1KA 5DAKA 1Z9HA 2X8HA 1XWBA 1Q98A 4KSOA 2A4HA 3HDCA 1Z6NA 2MMOA 3HY2A 4XS6A 4I6XA 11GSA 3APQA 5HFIA 2WB9A 4E8EA 2R4VA 1EP7A 2I9HA 1S3AA 3CTFA 5IPGA 1JZOA 2FA4A 4K5SA 2R0CA 4HQZA 1GSEA 1N8JA 1AXDA 3QAVA 4ECBA 1FOHA 1R26A 4OMVA 2FGXA 1W89A 4Z2UA 2YV9A 3EU4A 3BD2A 5CP1A 4BWSA 3D5JA 2H6XA 1MDIA 1XOBA 1Z3EA 2VL3A 6GSUA 3KJYA 1W4VA 12GSA 4IJ3A 4OFMA 1GRXA 2IIYA 3DIEA 3F3RA 4EE0A 2E7PA 3ZFBA 5J9BA 5IOWA 2FD3A 2GZYA 3M1GA 4TN8A 4F0BA 5LD0A 1J08A 5DCHA 3M3MA 4EDYA 4BVXA 3IC4A 2X4AA 1R4WA 3ERFA 4N30A 2C0DA 3VFIA 3LYPA 1SKWB 2YN1A 4PUAA 2PMTA 1YF1A 2FLSA 4PGTA 4XS1A 4MJAA 3IAS2 1WMJA 3CSHA 4KF9A 1GUKA 5DBQA 1JFUA 1M0UA 5JCWA 1XXUA 2OACA 2IMEA 2VM1A 4BL7B 4KH7A 4XIHA 4K5RA 2VM2A 5ECKB 4K2DA 5D9VA 1R5AA 3CSJA 1MD4A 3GURA 2IN3A 4KCEA 4IP6A 4OFNA 3QOUA 2VCXA 5FWGA 3P8WA 1A24A 1T3BA 4HZ4A 2VCQA 2ON5A 2AHEA 2YJ7A 4AGSA 2C80A 2KP2A 5AGYA 3IDVA 3SWLA 3CMIA 4LL1B 5F05A 1AAZA 2RLIA 1FOVA 3MAKA 4MJBA 5ECSA 2RM5A 2F9SA 4V2MA 4HUAA 2Z9SA 1O7UA 3C8EA 3EVIA 3M8NA 4ML1A 1SKRB 1JHBA 1SU9A 1B9XC 2GSRA 3HVSA 1K0NA 3CSIA 4G0IA 17GSA 3HJOA 3QPMA 2DJ3A 3UBLA 5J9CA 1MDKA 1V98A 3F63A 1CQHA 2C3NA 1V40A 2FWFA 3G9BA 2DJ2A 4EUYA 4ZB8A 5B6NA 3IHGA 5JWOB 1SYXA 5ECIB 1TK0B 2FY6A 3F3QA 1ZGNA 1HQOA 4GF0A 2MBSA 4MF7A 4K0NA 4BA7A 2VLTA 2O7KA 1NW2A 5D9TA 4MK3A 3PPUA 3N5OA 6GSTA 1KBNA 3FZ5A 1B4QA 2VD0A 2VD1A 3ZZXA 19GSA 1GUMA 2YPMA 4KDYA 2PVOC 2FWHA 2QGVA 4EL1A 5G5FA 4NAXA 4L0UA 5CRWA 3VURA 1PL2A 4XS4A 4JEDA 1EV4A 4N0VA 2V41A 1GSQA 3DYRA 5AISA 3HXSA 5DQYA 3VWVA 1WRYA 5DJLA 5JWQB 2YANA 2K9FA 4PTSA 1HNCA 2JSYA 4GSTA 5KOWA 3V1WA 5DJMA 2JZSA 4AJ7A 1XW9A 4N11A 4YKFA 1ACVA 5EL8A 1K3YA 3RPNA 3M9KA 2XBQA 5CRHA 1SK0A 1Z6MA 1BAYA 4BWQA 1U87A 1TJDA 2H1GA 2R2JA 3A2VA 3TOTA 1H4OA 1ERVA 2VLVA 2TRXA 3DVWA 3TKPA 1RQMA 3FYGA 3ZTLA 2QA1A 2KOKA 5GAPD 3QDNA 3GH6A 1ZYPA 4IELA 1SL2B 4GLTA 2DIYA 7GSSA 4EVMA 4YQMA 1F3AA 3PR8A 1DE1A 1M9AA 2V32A 3LG6A 2C0EA 1BQ7A 4O32A 5IM9A 3HCZA 3QAWA 3E9JB 5ECPB 4JR4A 1Q4JA 3WT2A 1CQGA 3DGQA 2DMMA 4G0KA 1ZZYA 6GSWA 4CY6A 3KIJA 1FB0A 4I8BA 3ZFLA 4WR4A 2HSYA 3LYKA 3TKQA 1YY7A 1OKTA 3O6TA 4GSNA 1M99A 5A4VA 2TRCP 2MZCA 2DBCA 3O3TA 3E0UA 4ZB6A 1ZYQB 4L0WA 2VCTA 2CQ9A 4Z2RA 1SJZA 2R6KA 1R7HA 2H71A 4X0XA 2X99A 4WF4A 1THXA 5DAKB 5HR1A 2L6CA 1M9BA 1RK4A 5B6MA 5HQPA 3RHCA 2MMAA 1TKDB 2JADA 3JCML 1T7PB 5JCGA 4TVEA 2K6VA 2A2PA 2N5AA 3DKSA 1XWCA 2OE1A 1WP0A 9GSSA 3M0FA 1F9MA 1Z7PA 2H74A 2CVDA 4LL4B 2V2GA 3HZ8A 1X5DA 1WWJA 4EC0A 2HRFA 1XCCA 1EWXA 1B48A 2YNXA 1DUGA 5L71A 2LKUA 3DMLA 5CRGA 3EMPA 2REMA 3KH7A 1OC9A 3EINA 4L5LA 4YAVA 1M2BA 2F51A 5GSTA 4O7HA 4K0GA 4BVXB 2GSTA 3L78A 1B8XA 1EZKA 1EV9A 3EURA 4HJMA 3MNGA 4MA9A 3PH9A 4MJEA 3LSZA 5IO2A 3A5IA 2WCIA 1ON4A 1OVNA 5B7CA 3PINA 1QGVA 4ZL7A 1PSQA 2H30A 1J9BA 2YP6A 4MF6A 3F8UA 4FYBA 4POBA 3RBTA 3IXRA 4EF0A 3GN3A 3GSTA 5HR0A 1GL8A 5F8BA 1Z7RA 5BRTA 1AW9A 1G6WA 4TR1A 4TRXA 4CHSA 1OE7A 1FG4A 4V1Ap 4LMVA 2LNSA 3QFBC 2E2GA 3ZVJA 3NIVA 4PX1A 3WGXA 3I6AA 2H0HA 3WGDA 2V1MA 2B3SA 2PU9C 1F2EA 2P5RA 3L0HA 1G6YA 1URMA 1XW5A 2ALBA 4OO5A 3LGCA 1G7OA 2L4QA 4Q5FA 1OC3A 3VWXA 4KX4A 1ZYNA 2VL2A 4XHMA 2PBJA 1FB6A 4CDOA 1AQWA 3GKXA 2WULA 4IVFA 4JR6A 4A5PA 3C73A 2RIIA 2OBKA 5ECRB 2G2QA 3FRCA 2CAQA 4NXIA 1GTBA 1TTZA 1MEKA 20GSA 5D8IA 5ID2A 2R37A 2VCVA 1K0CA 1K3OA 2V6KA 3TB2A 2GTUA 3HD5A 4OO4A 4MZWA 4JE1A 4YKGA 22GSA 3F6FA 3FY7A 3VPTA 2E2MA 2YCDA 4V2NA 2R5GA 4FIWA 1OYJA 4RQRA 3HKRA 3GX0A 2B5YA 1FVKA 4XS4B 3VK9A 2EIRA 3P90A 4USSA 2H0GA 3RPPA 4PQ1A 4EIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M72 A;  2YWN A;  1G7E A;  3GX8 A;  4L8E A;  4KDU A;  4Q5N A;  2JL4 A;  2N5B A;  3FR3 A;  2GQL A;  1PKZ A;  4KA0 A;  1SYR A;  3LXT A;  3BCK A;  4ZXG A;  1GLQ A;  1ML6 A;  1K0M A;  4KSM A;  4MH2 A;  4PNG A;  1SJ6 A;  3UVT A;  2GZZ A;  5DCG A;  2M46 A;  1DBY A;  4YH2 A;  1FVJ A;  4DVC A;  4ULX A;  4QL9 A;  2NTO A;  4EDZ A;  3ZRE A;  2H0I A;  1M2D A;  2XPE A;  2LTK A;  1KNG A;  3OR5 A;  4RUV A;  4KDX A;  1JZD A;  2L6D A;  3IA1 A;  1NHY A;  5A4W A;  5ECM B;  5A5K A;  3HVX A;  3TRP A;  2AJQ B;  4RQX A;  5AN1 A;  4MCU A;  3M9J A;  3QR6 A;  4GXZ A;  1VF4 A;  3GKN A;  5KN2 A;  2L4C A;  3EMX A;  2GZP A;  1IYI A;  1T1V A;  1F3B A;  4NHW A;  3TJG A;  1I9D A;  2AV4 A;  2X64 A;  1HD2 A;  3HJM A;  3J7Y k;  2C1Y A;  1MDJ A;  2H6Y A;  3GA4 A;  4PNF A;  3A2W A;  2DSA A;  1JLW A;  1X5C A;  2H8L A;  1A8L A;  2LV3 A;  4F2I A;  5E59 A;  2CX3 A;  5AIX A;  2X8G A;  5EY6 A;  1GP1 A;  3GL3 A;  4KE3 A;  3IHQ A;  3TGZ A;  3UJ1 A;  1XIY A;  2DJJ A;  3H4K A;  2DJK A;  3TRQ A;  6GSX A;  2IMI A;  3ZMK A;  2VCZ A;  3DVX A;  4F03 A;  1AIU A;  3KGK A;  2IL3 A;  3KXO A;  4O92 A;  3ED3 A;  4ZBA A;  2B7K A;  4MDC A;  2H01 A;  1AC1 A;  3ME7 A;  3FK8 A;  1TK8 B;  1J0F A;  2CA8 A;  2XPD A;  2JAC A;  3GKK A;  2GT6 A;  1NHO A;  3EE2 A;  4NV2 A;  3C1S A;  1BX9 A;  3QFA C;  1JZR A;  2CX4 A;  4WBJ A;  1GH2 A;  5ECH B;  5H5R A;  3W8S A;  4HS1 A;  5D9X A;  2ZUP A;  1XW6 A;  1GTI A;  3CXG A;  3RAZ A;  2O89 A;  5CRD A;  3UVH A;  4XTS A;  3VI5 A;  3GYK A;  2H66 A;  3IK7 A;  3L9U A;  2C8U A;  4V1A g;  3WT1 A;  2AUV A;  1TRS A;  4HEA 2;  1OC9 B;  4KW6 A;  5J4U A;  4HOJ A;  3H8Q A;  3L9S A;  1X9S B;  4NMU A;  1LBK A;  1PA3 A;  2HFD A;  2YWO A;  1UC7 A;  1ABA A;  1SKS B;  3Q6O A;  3IPZ A;  1TRU A;  4ML6 A;  2LRC A;  4POK A;  5H5S A;  3KTL A;  3BBY A;  3G7Y A;  2HSH A;  1YQ1 A;  2LRN A;  3I43 A;  4X43 A;  3TKS C;  1OAZ A;  1S3C A;  1EOG A;  3FR9 A;  3KTB A;  5IMF A;  2QSI A;  2FWE A;  3GHA A;  2MYG A;  5G1K A;  1GSU A;  1NM3 A;  3BJ5 A;  3Q18 A;  1FAA A;  2YJH A;  2DJ1 A;  3KMO A;  4MAB A;  3GL5 A;  4O5R A;  4TR1 B;  4GQF A;  1PX6 A;  4ACS A;  6GSY A;  1TRW A;  3W6G A;  4IKH A;  2IFQ A;  3H1N A;  3U6V A;  1TI3 A;  3PGT A;  3TJK A;  2GQK A;  4ZB9 A;  5IIZ A;  4TOP A;  2VL9 A;  4GQC A;  2A4V A;  3ZIT A;  2H19 A;  4K8M A;  1VGL A;  2I3Y A;  5IOX A;  5D96 A;  1DSB A;  1XZO A;  3FEU A;  2CVB A;  5IMV A;  2NVL A;  3A3T A;  3UEM A;  1VF1 A;  5IMD A;  1H75 A;  3P7X A;  5GZZ B;  1BJX A;  2EC4 A;  2G0F A;  4AJ8 A;  4HU9 A;  1X9W B;  2B7J A;  4BVY A;  2OE0 A;  5CAX A;  3D4M A;  5ID2 B;  3WYW A;  4OCE A;  2BTO T;  1OC8 A;  2J9H A;  2HRN A;  3MDK A;  4J56 E;  1TU8 A;  2O85 A;  1QQ2 A;  2CZ2 A;  2ON7 A;  3TJB A;  4IHU A;  4DSS A;  1WPI A;  1GLP A;  4HDE A;  3GH9 A;  1QFN A;  3KMN A;  2I81 A;  3TKS E;  4GCI A;  5CRE A;  1K3L A;  3TUE A;  3GTU A;  1GSY A;  14GS A;  2RUE A;  3EYT A;  2XBI A;  5JCU A;  3TJF A;  6GSS A;  3U5R E;  1T4Z A;  2KHP A;  3FKF A;  3IAM 2;  5ECO B;  4I97 A;  1A8Y A;  1TI1 A;  1K0B A;  1A2L A;  5HFG A;  2GSS A;  3EU3 A;  4YQV A;  4MJC A;  1QK8 A;  3GRX A;  4TKY A;  5J3R A;  4QQ7 A;  5LCZ A;  3ZYW A;  1YEX A;  4ID0 A;  1YJ6 A;  4AJ6 A;  4K7N A;  5G30 A;  1T8E B;  5ECL B;  1GTU A;  4RI7 A;  1KTE A;  5HR3 A;  4G10 A;  4RI6 A;  2B5E A;  4TR4 A;  4WKW A;  1QUW A;  3TOU A;  4AF2 A;  18GS A;  1PL1 A;  1PMT A;  2L59 A;  2HZE A;  3TKR A;  3UAR A;  4LMW A;  2FNO A;  1SJI A;  2F8F A;  2F8A A;  5G2Z A;  2YWI A;  2CV4 A;  3K8N A;  1E2Y A;  4K7O A;  5CYY A;  5GAN D;  1TK5 B;  4POM A;  1UVZ A;  3A5W A;  3MWH A;  5IMA A;  3RHB A;  3VLN A;  1V58 A;  3IE3 A;  3DXB A;  1C72 A;  2OE3 A;  3GUS A;  4DSQ A;  2HXK A;  3UIW A;  3C1R A;  2JZT A;  2H70 A;  3DRN A;  2H73 A;  1T4Y A;  3AY8 A;  2L57 A;  4Q5R A;  2PVQ A;  1O6J A;  2QKE A;  3ZML A;  4IS0 A;  2VCW A;  5FHI A;  2DIZ A;  4TR0 A;  1AQX A;  4MLY A;  2RUF A;  2AAW A;  4ECC A;  3D4T A;  2LRT A;  3C71 A;  3TDG A;  3ZIV A;  5AIV A;  3QMX A;  2K18 A;  3WD6 A;  2GSQ A;  3S9F A;  1SL1 B;  3LOR A;  4DSR A;  1XVW A;  5DAL A;  1N2A A;  5ELA A;  1S3D A;  2LS5 A;  1GWC A;  1SK2 A;  2FA8 A;  2LNT A;  4ZL9 A;  4HU7 A;  1GTA A;  4GWR A;  3F4R A;  2LQO A;  1TXX A;  2P31 A;  3IK9 A;  3HJP A;  1XWK A;  5G31 A;  4JU5 A;  2HNL A;  2PWJ A;  1XOA A;  1B9Y C;  2CT6 A;  3BOA A;  4WR5 A;  1WE0 A;  2XC2 A;  3I9V 2;  2N5F A;  3D6I A;  3D21 A;  2HE3 A;  2DC5 A;  2H1D A;  5F0G A;  1VRS D;  1XVQ A;  3G7I A;  4EO3 A;  1USB A;  3IOS A;  5COH A;  2GLR A;  2TIR A;  5KN3 A;  1ERT A;  2IMD A;  4ISD A;  8GSS A;  3ZLP A;  3LQ7 A;  4FH8 A;  1BG5 A;  3D22 A;  1LU4 A;  2JSZ A;  1EEJ A;  1KEB A;  3TCO A;  4N10 A;  1V57 A;  5E4W A;  1YZX A;  2GVP A;  1M7T A;  1O73 A;  3VPQ A;  4J57 E;  3ERW A;  3RDW A;  5G1L A;  3GNJ A;  3ZL5 A;  1A23 A;  1O81 A;  3LJR A;  3GSS A;  4ECJ A;  1PRX A;  4ZIL A;  4CW9 A;  1ZCP A;  3ERG A;  4PQH A;  1BYE A;  4MP4 A;  2RM6 A;  4TW5 A;  3IRA A;  4DEJ A;  4WBR D;  3WGE A;  2AB6 A;  1GUL A;  3ZVJ D;  3ISO A;  4FO5 A;  4MH3 A;  2J23 A;  4GTU A;  1EP8 A;  2NPB A;  1XPV A;  3KCM A;  4LA1 A;  2ZNM A;  1TRV A;  1WJK A;  2C3Q A;  2YZH A;  5B8A A;  1SL0 B;  2E0Q A;  1PGT A;  1LJR A;  2IFQ B;  1A2M A;  2XHF A;  1U6T A;  1TP9 A;  2H1A A;  1V2A A;  5IMC A;  4ZL8 A;  1OE8 A;  2CVK A;  3TJJ A;  1XFL A;  3UL3 A;  4OFT A;  4JBB A;  3FZA A;  1IYH A;  1F6M C;  1JLV A;  3ZIJ A;  2H1B A;  1ERW A;  3F4S A;  3IR4 A;  4ZBB A;  2HLS A;  1UN2 A;  4PUF C;  2PER A;  2K8V A;  3F6D A;  1EOH A;  4D73 A;  3CYN A;  3L4N A;  2ES7 A;  2FHE A;  1EEM A;  2FCH A;  1U3I A;  1VF2 A;  3GFK A;  2C0F A;  4DSS B;  2LST A;  2DJ0 A;  5KN1 A;  2FWG A;  2WRT A;  2O87 A;  1Z5Y E;  3LWA A;  2PUK C;  4IQ1 A;  5B8B A;  1PD2 1;  3QAG A;  2F3M A;  1XBS A;  2NDO A;  4WF5 A;  3GTU B;  1FO5 A;  1AUC A;  1SD8 A;  4GRF A;  1UA5 A;  1FW1 A;  5EPF A;  5C04 A;  2WFC A;  1GUH A;  4K9Z A;  2LJR A;  3ZRD A;  1ST9 A;  1GNE A;  3VWW A;  4G9H A;  4YAP A;  2GDR A;  5FT3 A;  3QCP A;  2FUG 2;  5F07 A;  2L5L A;  4Q5Q A;  4E8H A;  4XRD A;  3GKM A;  3BCI A;  4TXO A;  4N0Z A;  3KP9 A;  2V6O A;  3A2X A;  1WOU A;  4IQA A;  5D93 A;  1EGR A;  2O8V B;  1PN9 A;  5ECN B;  1QMV A;  2MMZ A;  4EXJ A;  1I5G A;  2HZE B;  2C3T A;  2VUP A;  1ZOF A;  3SBC A;  5ELG A;  3UAP A;  1E6B A;  2YWM A;  2H76 A;  4OD7 A;  1PQN A;  3H93 A;  4HI7 A;  5INY A;  2P0G A;  4JZQ A;  1O85 A;  1ILO A;  2IWT A;  2LJK A;  5EVO A;  5DVB A;  5DDL A;  4NHZ A;  1TOF A;  3KP8 A;  2IJY A;  2QC7 A;  5LNK e;  5JWR B;  1ZL9 A;  5KEJ A;  5H5Q A;  1GSS A;  3NZN A;  3N9J A;  1PX7 A;  4XCS A;  3HHV A;  3EC3 A;  3US3 A;  4I2T A;  4I5Q A;  2EIO A;  2HT9 A;  4KGI A;  3G7J A;  2GS3 A;  4NWY A;  2PGT A;  3FW2 A;  1GSD A;  5ABR A;  3Q74 A;  3VI7 A;  4HJ2 A;  2KUC A;  4OWY A;  1F37 A;  4G19 A;  5IO0 A;  5CO3 A;  1HNB A;  1K0A A;  2WZ9 A;  2C0G A;  5HFK A;  2M80 A;  4WET A;  1JZW A;  4PXO A;  2MMN A;  1QXH A;  3FZ4 A;  3ME8 A;  1TDI A;  4IJI A;  2GT5 A;  3UMA A;  2MBT A;  3KH9 A;  1B4P A;  1ERU A;  2VAF A;  5DAL B;  2IMK A;  2LEG A;  3W8J A;  16GS A;  4IP1 A;  3Q19 A;  1T00 A;  4P3Y B;  4YQU A;  1AQV A;  1RW1 A;  3NOF A;  1THO A;  4I2U A;  2H72 A;  4L5O A;  5ECQ B;  3CTG A;  3IV4 A;  1SD9 A;  4K7I A;  2X8C A;  1G0T A;  2H6Z A;  3KD0 A;  3FZ9 A;  13GS A;  3E3E A;  2H75 A;  4IBP A;  4MPF A;  4J2F A;  4WXT A;  3F9U A;  1YKC A;  3GV1 A;  2A2S A;  2LUS A;  3LXZ A;  2ZCT A;  1R5P A;  2B5X A;  2WJU A;  1YEP A;  1HYU A;  4GSS A;  2OKA A;  4QL7 A;  1K0O A;  4BL7 A;  3KM6 A;  3DD3 A;  2WGR A;  4PQI A;  5HR2 A;  4G2E A;  4Z7X A;  2I1U A;  3HZ4 A;  2VIM A;  3F4T A;  4F9Z A;  1XWG A;  2CZ3 A;  1BED A;  2B6M A;  2VL2 C;  4LLR A;  4TXV A;  2OA7 A;  2K8S A;  2PPT A;  2HZF A;  3IBH A;  4WEY A;  4OCF A;  2NBS A;  4JRR A;  1U88 A;  2IMF A;  3HVV A;  1MTC A;  3GIX A;  4ZIJ A;  1U3A A;  1O8W A;  1SEN A;  2DML A;  5CNW A;  5ENU A;  2BJX A;  2CAI A;  3FHK A;  2EIQ A;  1VF3 A;  3TKS A;  3GMF A;  3C7M A;  3UOM A;  1MD3 A;  1DE2 A;  2HYX A;  2JZR A;  2OBI A;  4ECI A;  4IW9 A;  4K1F A;  4XRA A;  3DWV A;  4KUN A;  4IN0 A;  3HYP A;  2AYT A;  5KN0 A;  1X5E A;  3KEB A;  2OJL A;  2LJA A;  4FYC A;  4NV5 A;  4FYU A;  4HZ2 A;  3EWL A;  4KAE A;  5J5N A;  1EGO A;  3CRT A;  1ZMA A;  3I69 A;  3DEX A;  3P2A A;  1ZYE A;  2PN8 A;  2JU5 A;  2L5O A;  3KZQ A;  2YOI A;  4D73 B;  1O8X A;  4MMM A;  4KCA A;  1SK1 A;  4POL A;  4KB3 A;  4MZB A;  4EKZ A;  4K6X A;  2HI7 A;  4KND A;  3CRU A;  10GS A;  5GSS A;  4F82 A;  1OKD A;  2LQQ A;  4HQS A;  3APS A;  2WS2 A;  1Y25 A;  4MF5 A;  1X9M B;  1A0R P;  2IPA A;  2B1L A;  4NPB A;  5A4U A;  1PKW A;  1K0D A;  1YDK A;  2GQM A;  2R3X A;  5F06 A;  2VO4 A;  5C00 A;  5D73 A;  1Y6E A;  3D0Z A;  2YZU A;  1NSW A;  4BPY A;  4MZC A;  1GSF A;  1XWA A;  3UBK A;  5D9W A;  4IGJ A;  2VOC A;  2DLX A;  1YF0 A;  3TRX A;  2OAD A;  1X0R A;  5IMZ A;  6GSV A;  5J41 A;  4TXO B;  4F0C A;  4H86 A;  1A0F A;  1TU7 A;  2P5Q A;  4ZBD A;  3FR6 A;  4TR3 A;  1GNW A;  3O76 A;  3APO A;  2C4J A;  2GGT A;  4X1U A;  3H79 A;  2A2R A;  3R2Q A;  3VWU A;  1TW9 A;  2WDU A;  2KP1 A;  4V2L A;  1WIK A;  2D2Z A;  4MPG A;  2I4A A;  2YV7 A;  1A2J A;  1V9W A;  2KLX A;  2BMX A;  1HNA A;  3LFL A;  1YKA A;  3CBU A;  3MSZ A;  5IQY A;  3J7Y b;  3LEF A;  1FHE A;  1M2A A;  5IPH A;  4ILF A;  3L9V A;  3F0I A;  3QD9 A;  4PUR A;  5G5E A;  2VLU A;  3HA9 A;  5DQS A;  2B1K A;  5DAK A;  1Z9H A;  2X8H A;  1XWB A;  1Q98 A;  4KSO A;  3HDC A;  1Z6N A;  2MMO A;  3HY2 A;  4XS6 A;  4I6X A;  11GS A;  3APQ A;  5HFI A;  2WB9 A;  4E8E A;  2R4V A;  1EP7 A;  2I9H A;  1S3A A;  3CTF A;  5IPG A;  1JZO A;  2FA4 A;  4HQZ A;  1GSE A;  1N8J A;  1AXD A;  3QAV A;  4ECB A;  1R26 A;  4OMV A;  2FGX A;  1W89 A;  2YV9 A;  3EU4 A;  3BD2 A;  5CP1 A;  4BWS A;  3D5J A;  2H6X A;  1MDI A;  1XOB A;  1Z3E A;  2VL3 A;  6GSU A;  3KJY A;  1W4V A;  12GS A;  4IJ3 A;  4OFM A;  1GRX A;  2IIY A;  3DIE A;  3F3R A;  4EE0 A;  2E7P A;  3ZFB A;  5J9B A;  5IOW A;  2FD3 A;  2GZY A;  3M1G A;  4TN8 A;  4F0B A;  5LD0 A;  1J08 A;  5DCH A;  3M3M A;  4EDY A;  4BVX A;  3IC4 A;  1R4W A;  3ERF A;  4N30 A;  2C0D A;  3VFI A;  3LYP A;  1SKW B;  2YN1 A;  4PUA A;  2PMT A;  1YF1 A;  2FLS A;  4PGT A;  4XS1 A;  4MJA A;  3IAS 2;  1WMJ A;  3CSH A;  1GUK A;  5DBQ A;  1JFU A;  1M0U A;  5JCW A;  1XXU A;  2OAC A;  2IME A;  2VM1 A;  4KH7 A;  4XIH A;  2VM2 A;  5ECK B;  4K2D A;  5D9V A;  1R5A A;  3CSJ A;  1MD4 A;  3GUR A;  2IN3 A;  4KCE A;  4IP6 A;  4OFN A;  3QOU A;  2VCX A;  5FWG A;  3P8W A;  1A24 A;  1T3B A;  4HZ4 A;  2VCQ A;  2ON5 A;  2AHE A;  2YJ7 A;  4AGS A;  2C80 A;  2KP2 A;  5AGY A;  3IDV A;  3SWL A;  3CMI A;  4LL1 B;  5F05 A;  1AAZ A;  2RLI A;  1FOV A;  3MAK A;  4MJB A;  5ECS A;  2RM5 A;  2F9S A;  4V2M A;  4HUA A;  2Z9S A;  1O7U A;  3C8E A;  3EVI A;  3M8N A;  4ML1 A;  1SKR B;  1JHB A;  1SU9 A;  1B9X C;  2GSR A;  3HVS A;  1K0N A;  3CSI A;  17GS A;  3HJO A;  3QPM A;  2DJ3 A;  3UBL A;  5J9C A;  1MDK A;  1V98 A;  3F63 A;  1CQH A;  2C3N A;  1V40 A;  2FWF A;  3G9B A;  2DJ2 A;  4EUY A;  4ZB8 A;  5B6N A;  5JWO B;  1SYX A;  5ECI B;  1TK0 B;  2FY6 A;  3F3Q A;  1ZGN A;  1HQO A;  4GF0 A;  2MBS A;  4MF7 A;  4K0N A;  4BA7 A;  2VLT A;  2O7K A;  1NW2 A;  5D9T A;  4MK3 A;  3N5O A;  6GST A;  1KBN A;  3FZ5 A;  1B4Q A;  2VD0 A;  2VD1 A;  3ZZX A;  19GS A;  1GUM A;  2YPM A;  4KDY A;  2PVO C;  2FWH A;  2QGV A;  4EL1 A;  5G5F A;  4NAX A;  4L0U A;  5CRW A;  3VUR A;  1PL2 A;  4XS4 A;  4JED A;  1EV4 A;  4N0V A;  2V41 A;  1GSQ A;  3DYR A;  5AIS A;  3HXS A;  5DQY A;  3VWV A;  1WRY A;  5DJL A;  5JWQ B;  2YAN A;  2K9F A;  1HNC A;  2JSY A;  4GST A;  3V1W A;  5DJM A;  2JZS A;  4AJ7 A;  1XW9 A;  4N11 A;  1ACV A;  5EL8 A;  1K3Y A;  3RPN A;  3M9K A;  2XBQ A;  5CRH A;  1SK0 A;  1Z6M A;  1BAY A;  4BWQ A;  1U87 A;  1TJD A;  2H1G A;  2R2J A;  3A2V A;  3TOT A;  1H4O A;  1ERV A;  2VLV A;  2TRX A;  3DVW A;  3TKP A;  1RQM A;  3FYG A;  3ZTL A;  2KOK A;  5GAP D;  3QDN A;  3GH6 A;  4IEL A;  1SL2 B;  4GLT A;  2DIY A;  7GSS A;  4EVM A;  4YQM A;  1F3A A;  3PR8 A;  1DE1 A;  1M9A A;  2V32 A;  3LG6 A;  2C0E A;  1BQ7 A;  4O32 A;  5IM9 A;  3HCZ A;  3QAW A;  3E9J B;  5ECP B;  4JR4 A;  1Q4J A;  3WT2 A;  1CQG A;  3DGQ A;  2DMM A;  1ZZY A;  6GSW A;  3KIJ A;  1FB0 A;  4I8B A;  3ZFL A;  4WR4 A;  2HSY A;  3LYK A;  3TKQ A;  1YY7 A;  1OKT A;  3O6T A;  4GSN A;  1M99 A;  5A4V A;  2TRC P;  2MZC A;  2DBC A;  3O3T A;  3E0U A;  4ZB6 A;  1ZYQ B;  4L0W A;  2VCT A;  2CQ9 A;  1SJZ A;  2R6K A;  1R7H A;  2H71 A;  4X0X A;  2X99 A;  4WF4 A;  1THX A;  5DAK B;  5HR1 A;  2L6C A;  1M9B A;  1RK4 A;  5B6M A;  5HQP A;  3RHC A;  2MMA A;  1TKD B;  2JAD A;  3JCM L;  1T7P B;  5JCG A;  4TVE A;  2K6V A;  2N5A A;  3DKS A;  1XWC A;  2OE1 A;  1WP0 A;  9GSS A;  3M0F A;  1F9M A;  1Z7P A;  2H74 A;  2CVD A;  4LL4 B;  2V2G A;  3HZ8 A;  1X5D A;  1WWJ A;  4EC0 A;  2HRF A;  1XCC A;  1EWX A;  1B48 A;  2YNX A;  1DUG A;  5L71 A;  2LKU A;  3DML A;  5CRG A;  3EMP A;  2REM A;  3KH7 A;  1OC9 A;  3EIN A;  4L5L A;  4YAV A;  1M2B A;  2F51 A;  5GST A;  4O7H A;  4K0G A;  2GST A;  3L78 A;  1B8X A;  1EZK A;  1EV9 A;  3EUR A;  4HJM A;  3MNG A;  4MA9 A;  3PH9 A;  4MJE A;  3LSZ A;  5IO2 A;  2WCI A;  1ON4 A;  1OVN A;  5B7C A;  3PIN A;  1QGV A;  4ZL7 A;  1PSQ A;  2H30 A;  1J9B A;  2YP6 A;  4MF6 A;  3F8U A;  4FYB A;  4POB A;  3RBT A;  3IXR A;  4EF0 A;  3GN3 A;  3GST A;  5HR0 A;  1GL8 A;  5F8B A;  1Z7R A;  1AW9 A;  1G6W A;  4TR1 A;  4TRX A;  4CHS A;  1OE7 A;  1FG4 A;  4V1A p;  4LMV A;  2LNS A;  3QFB C;  2E2G A;  3ZVJ A;  3NIV A;  4PX1 A;  3WGX A;  3I6A A;  2H0H A;  3WGD A;  2V1M A;  2B3S A;  2PU9 C;  1F2E A;  2P5R A;  3L0H A;  1G6Y A;  1URM A;  1XW5 A;  2ALB A;  4OO5 A;  3LGC A;  1G7O A;  2L4Q A;  4Q5F A;  1OC3 A;  3VWX A;  4KX4 A;  2VL2 A;  4XHM A;  2PBJ A;  1FB6 A;  4CDO A;  1AQW A;  3GKX A;  2WUL A;  4IVF A;  4JR6 A;  3C73 A;  2RII A;  2OBK A;  5ECR B;  2G2Q A;  3FRC A;  2CAQ A;  4NXI A;  1GTB A;  1TTZ A;  1MEK A;  20GS A;  5D8I A;  5ID2 A;  2R37 A;  2VCV A;  1K0C A;  1K3O A;  2V6K A;  3TB2 A;  2GTU A;  3HD5 A;  4OO4 A;  4MZW A;  4JE1 A;  22GS A;  3F6F A;  3FY7 A;  3VPT A;  2E2M A;  2YCD A;  4V2N A;  2R5G A;  4FIW A;  1OYJ A;  4RQR A;  3HKR A;  3GX0 A;  2B5Y A;  1FVK A;  4XS4 B;  3VK9 A;  2EIR A;  3P90 A;  2H0G A;  3RPP A;  4PQ1 A; 
#chains in the Genus database with same CATH topology
 2M72 A;  2YWN A;  1G7E A;  3GX8 A;  3EPT A;  4L8E A;  4KDU A;  4Q5N A;  2JL4 A;  2N5B A;  3FR3 A;  2GQL A;  1PKZ A;  4KA0 A;  1SYR A;  3LXT A;  3BCK A;  4ZXG A;  1GLQ A;  1ML6 A;  1K0M A;  4KSM A;  4MH2 A;  4PNG A;  1SJ6 A;  3UVT A;  2GZZ A;  5DCG A;  2M46 A;  1DBY A;  4YH2 A;  1FVJ A;  4DVC A;  2X49 A;  4ULX A;  4QL9 A;  2NTO A;  4EDZ A;  3ZRE A;  2H0I A;  1M2D A;  2XPE A;  2LTK A;  1KNG A;  3OR5 A;  4RUV A;  4KDX A;  1JZD A;  2L6D A;  3IA1 A;  1NHY A;  5A4W A;  5ECM B;  5A5K A;  3HVX A;  3TRP A;  2AJQ B;  4RQX A;  5AN1 A;  4MCU A;  3M9J A;  3QR6 A;  4GXZ A;  1VF4 A;  3GKN A;  5KN2 A;  2L4C A;  3EMX A;  2GZP A;  1IYI A;  1T1V A;  1F3B A;  4NHW A;  3TJG A;  1I9D A;  2AV4 A;  2X64 A;  1HD2 A;  3HJM A;  3J7Y k;  2C1Y A;  1MDJ A;  2H6Y A;  3GA4 A;  4PNF A;  3A2W A;  2DSA A;  1JLW A;  1X5C A;  2H8L A;  1A8L A;  2LV3 A;  4F2I A;  5E59 A;  2CX3 A;  3MIX A;  5AIX A;  2X8G A;  5EY6 A;  2UZ8 A;  1GP1 A;  3GL3 A;  4KE3 A;  3IHQ A;  3TGZ A;  3UJ1 A;  1XIY A;  2DJJ A;  3H4K A;  2DJK A;  3TRQ A;  6GSX A;  2IMI A;  3ZMK A;  2VCZ A;  3DVX A;  4F03 A;  1AIU A;  3KGK A;  4K2X A;  2IL3 A;  3KXO A;  4O92 A;  3ED3 A;  4ZBA A;  2B7K A;  4MDC A;  2H01 A;  1AC1 A;  3ME7 A;  3FK8 A;  1TK8 B;  1J0F A;  2CA8 A;  2XPD A;  2JAC A;  3GKK A;  2GT6 A;  1NHO A;  3EE2 A;  4NV2 A;  3C1S A;  1BX9 A;  3QFA C;  1JZR A;  2CX4 A;  4WBJ A;  1GH2 A;  5ECH B;  5H5R A;  3W8S A;  4HS1 A;  5D9X A;  2ZUP A;  1XW6 A;  1GTI A;  3CXG A;  3RAZ A;  2O89 A;  5CRD A;  3UVH A;  4XTS A;  3VI5 A;  3GYK A;  2H66 A;  3IK7 A;  3L9U A;  2C8U A;  4V1A g;  3WT1 A;  2AUV A;  1TRS A;  4HEA 2;  1OC9 B;  4KW6 A;  5J4U A;  4HOJ A;  3H8Q A;  3L9S A;  1X9S B;  4NMU A;  1LBK A;  1PA3 A;  2HFD A;  2YWO A;  3LW9 A;  1UC7 A;  1ABA A;  1SKS B;  3Q6O A;  3IPZ A;  1TRU A;  4ML6 A;  2LRC A;  4POK A;  5H5S A;  3KTL A;  3BBY A;  3G7Y A;  2HSH A;  1YQ1 A;  2LRN A;  3I43 A;  4X43 A;  3TKS C;  1OAZ A;  1S3C A;  1EOG A;  3FR9 A;  3KTB A;  4BIK A;  5IMF A;  2QSI A;  2FWE A;  3GHA A;  2MYG A;  5G1K A;  1GSU A;  1NM3 A;  3BJ5 A;  3Q18 A;  1FAA A;  2YJH A;  2DJ1 A;  3KMO A;  4MAB A;  3GL5 A;  4O5R A;  4TR1 B;  4GQF A;  1PX6 A;  4ACS A;  6GSY A;  1TRW A;  3W6G A;  4IKH A;  2IFQ A;  2HRA A;  3H1N A;  3U6V A;  1TI3 A;  3PGT A;  3TJK A;  2GQK A;  4ZB9 A;  5IIZ A;  4TOP A;  2VL9 A;  4GQC A;  2A4V A;  3ZIT A;  2H19 A;  1M3J A;  4K8M A;  1VGL A;  2I3Y A;  5IOX A;  5D96 A;  1DSB A;  1XZO A;  3MYD A;  3FEU A;  2CVB A;  5IMV A;  2NVL A;  3A3T A;  3UEM A;  1VF1 A;  5IMD A;  1H75 A;  3P7X A;  5GZZ B;  1BJX A;  2EC4 A;  2G0F A;  4AJ8 A;  4HU9 A;  1X9W B;  2B7J A;  4BVY A;  2OE0 A;  5CAX A;  3D4M A;  5ID2 B;  3WYW A;  4OCE A;  2BTO T;  1OC8 A;  2R0G A;  2J9H A;  2HRN A;  3MDK A;  4J56 E;  1TU8 A;  2O85 A;  1QQ2 A;  2CZ2 A;  2ON7 A;  3TJB A;  4IHU A;  4DSS A;  1WPI A;  1GLP A;  4HDE A;  3GH9 A;  1QFN A;  2DKH A;  3KMN A;  2I81 A;  3TKS E;  4GCI A;  5CRE A;  1K3L A;  3TUE A;  3GTU A;  1GSY A;  14GS A;  2RUE A;  3EYT A;  2XBI A;  5JCU A;  3TJF A;  6GSS A;  3U5R E;  1T4Z A;  2KHP A;  3FKF A;  3IAM 2;  5ECO B;  4I97 A;  1A8Y A;  1TI1 A;  1K0B A;  1A2L A;  4X4J A;  5HFG A;  2GSS A;  3EU3 A;  4YQV A;  2QA2 A;  4MJC A;  1QK8 A;  3GRX A;  4TKY A;  5J3R A;  3FMW A;  4QQ7 A;  5LCZ A;  3ZYW A;  1YEX A;  4ID0 A;  1YJ6 A;  4AJ6 A;  4K7N A;  5G30 A;  1T8E B;  5ECL B;  1GTU A;  4RI7 A;  1KTE A;  5HR3 A;  4G10 A;  4RI6 A;  2B5E A;  4TR4 A;  4WKW A;  1QUW A;  3TOU A;  4AF2 A;  4ICY A;  18GS A;  1PL1 A;  1PMT A;  2L59 A;  2HZE A;  3TKR A;  3UAR A;  4LMW A;  2FNO A;  1SJI A;  2F8F A;  2F8A A;  5G2Z A;  2YWI A;  2CV4 A;  3K8N A;  1E2Y A;  4K7O A;  5CYY A;  5GAN D;  1TK5 B;  4POM A;  1UVZ A;  3A5W A;  3MWH A;  2HSM A;  5IMA A;  3RHB A;  3VLN A;  1V58 A;  3IE3 A;  3DXB A;  1C72 A;  2OE3 A;  3GUS A;  4DSQ A;  2HXK A;  3UIW A;  3C1R A;  2JZT A;  2H70 A;  4MNN A;  3DRN A;  2H73 A;  1T4Y A;  3AY8 A;  2L57 A;  4Q5R A;  2PVQ A;  1O6J A;  2QKE A;  3ZML A;  4IS0 A;  2VCW A;  5FHI A;  2DIZ A;  4TR0 A;  1AQX A;  4MLY A;  2RUF A;  2AAW A;  4ECC A;  3D4T A;  2LRT A;  3C71 A;  3TDG A;  3ZIV A;  5AIV A;  3QMX A;  2K18 A;  3WD6 A;  2GSQ A;  3S9F A;  1SL1 B;  3LOR A;  4G0L A;  4DSR A;  1XVW A;  5DAL A;  1N2A A;  5ELA A;  1S3D A;  2LS5 A;  1GWC A;  1SK2 A;  2FA8 A;  2LNT A;  4ZL9 A;  4HU7 A;  1GTA A;  4GWR A;  3F4R A;  2LQO A;  1TXX A;  2P31 A;  3IK9 A;  3HJP A;  1XWK A;  4EIQ A;  5G31 A;  4JU5 A;  2HNL A;  2PWJ A;  1B9Y C;  1XOA A;  2CT6 A;  3BOA A;  4WR5 A;  1WE0 A;  2XC2 A;  3I9V 2;  2N5F A;  3D6I A;  3D21 A;  2HE3 A;  2DC5 A;  2H1D A;  5F0G A;  1VRS D;  1XVQ A;  3G7I A;  4EO3 A;  1USB A;  3IOS A;  5COH A;  2GLR A;  2TIR A;  5KN3 A;  1ERT A;  2IMD A;  4ISD A;  8GSS A;  3ZLP A;  3LQ7 A;  4FH8 A;  1BG5 A;  3D22 A;  1LU4 A;  2JSZ A;  1EEJ A;  1KEB A;  3TCO A;  4N10 A;  1V57 A;  5E4W A;  1YZX A;  2GVP A;  1M7T A;  1O73 A;  3VPQ A;  5BMU A;  4J57 E;  3ERW A;  1S3R A;  3RDW A;  5G1L A;  3GNJ A;  3ZL5 A;  1A23 A;  1O81 A;  3LJR A;  3GSS A;  4ECJ A;  1PRX A;  4ZIL A;  4CW9 A;  1ZCP A;  3ERG A;  4PQH A;  1BYE A;  4MP4 A;  2RM6 A;  4TW5 A;  3IRA A;  4DEJ A;  4WBR D;  3WGE A;  4FQU A;  2AB6 A;  1GUL A;  3ZVJ D;  3ISO A;  4FO5 A;  4MH3 A;  2J23 A;  4GTU A;  1EP8 A;  2NPB A;  1PFO A;  1XPV A;  3KCM A;  4LA1 A;  2ZNM A;  1TRV A;  1WJK A;  2C3Q A;  2YZH A;  5B8A A;  1SL0 B;  2E0Q A;  1PGT A;  1LJR A;  2IFQ B;  1A2M A;  2XHF A;  1U6T A;  1XG8 A;  1TP9 A;  2H1A A;  1V2A A;  5IMC A;  4ZL8 A;  1OE8 A;  2DKI A;  2CVK A;  3TJJ A;  1XFL A;  3UL3 A;  4OFT A;  4JBB A;  3FZA A;  1IYH A;  1F6M C;  1JLV A;  3ZIJ A;  2H1B A;  1ERW A;  3F4S A;  3IR4 A;  4ZBB A;  2HLS A;  1UN2 A;  4BVY B;  4PUF C;  2PER A;  2K8V A;  3F6D A;  1EOH A;  4D73 A;  3CYN A;  3L4N A;  2ES7 A;  2FHE A;  1EEM A;  2FCH A;  1U3I A;  1VF2 A;  3GFK A;  2C0F A;  4DSS B;  2LST A;  2DJ0 A;  5KN1 A;  2FWG A;  2WRT A;  2O87 A;  1Z5Y E;  3LWA A;  2PUK C;  4IQ1 A;  5B8B A;  1PD2 1;  3QAG A;  2F3M A;  1XBS A;  2NDO A;  4WF5 A;  3GTU B;  1FO5 A;  1AUC A;  1SD8 A;  4GRF A;  1UA5 A;  1FW1 A;  2R0P A;  5EPF A;  5C04 A;  2WFC A;  1GUH A;  4K9Z A;  2LJR A;  3ZRD A;  1ST9 A;  1GNE A;  3VWW A;  4G9H A;  4YAP A;  2GDR A;  5FT3 A;  3QCP A;  2FUG 2;  5F07 A;  2L5L A;  4Q5Q A;  3IC8 A;  4E8H A;  4XRD A;  3GKM A;  3BCI A;  4TXO A;  4N0Z A;  3KP9 A;  3A2X A;  2V6O A;  1WOU A;  4IQA A;  5D93 A;  1EGR A;  2O8V B;  4Z2T A;  1PN9 A;  5ECN B;  1QMV A;  2MMZ A;  4EXJ A;  1I5G A;  2HZE B;  2C3T A;  2VUP A;  1ZOF A;  3SBC A;  5ELG A;  3UAP A;  1E6B A;  2YWM A;  2H76 A;  4OD7 A;  1PQN A;  3H93 A;  4HI7 A;  5INY A;  2P0G A;  4JZQ A;  1O85 A;  1ILO A;  2IWT A;  2LJK A;  5EVO A;  5DVB A;  5DDL A;  4NHZ A;  1TOF A;  3KP8 A;  2IJY A;  2QC7 A;  5LNK e;  5JWR B;  1ZL9 A;  5KEJ A;  5H5Q A;  1GSS A;  3NZN A;  3N9J A;  1PX7 A;  4XCS A;  3HHV A;  3EC3 A;  3US3 A;  4I2T A;  4I5Q A;  2EIO A;  2HT9 A;  4KGI A;  3G7J A;  2GS3 A;  4NWY A;  2PGT A;  3FW2 A;  1GSD A;  5ABR A;  3Q74 A;  3VI7 A;  4HJ2 A;  2KUC A;  4OWY A;  1F37 A;  4G19 A;  5IO0 A;  5CO3 A;  1HNB A;  1K0A A;  2WZ9 A;  2C0G A;  5HFK A;  2M80 A;  4WET A;  1JZW A;  4PXO A;  2MMN A;  1QXH A;  3FZ4 A;  3ME8 A;  1TDI A;  2HRK A;  4IJI A;  2GT5 A;  3R3E A;  3UMA A;  2MBT A;  3KH9 A;  1B4P A;  1ERU A;  2VAF A;  5DAL B;  2IMK A;  2LEG A;  3W8J A;  16GS A;  4IP1 A;  3Q19 A;  1T00 A;  4P3Y B;  4YQU A;  1AQV A;  1RW1 A;  3NOF A;  1THO A;  4I2U A;  2H72 A;  4L5O A;  5ECQ B;  3CTG A;  3IV4 A;  1SD9 A;  4K7I A;  2X8C A;  1G0T A;  2H6Z A;  3KD0 A;  3FZ9 A;  13GS A;  3E3E A;  2H75 A;  4IBP A;  4MPF A;  4J2F A;  4WXT A;  3F9U A;  1YKC A;  3GV1 A;  2A2S A;  2LUS A;  3LXZ A;  2ZCT A;  1R5P A;  2B5X A;  2WJU A;  1YEP A;  1HYU A;  4GSS A;  2OKA A;  4QL7 A;  3HVN A;  1K0O A;  4BL7 A;  3KM6 A;  3DD3 A;  2WGR A;  4PQI A;  5HR2 A;  4G2E A;  4Z7X A;  2I1U A;  3HZ4 A;  2VIM A;  3F4T A;  4F9Z A;  1XWG A;  2CZ3 A;  1BED A;  2B6M A;  2VL2 C;  4LLR A;  4TXV A;  2OA7 A;  2K8S A;  2PPT A;  2HZF A;  3IBH A;  4WEY A;  4OCF A;  2NBS A;  4JRR A;  1U88 A;  2IMF A;  3HVV A;  1MTC A;  3GIX A;  4ZIJ A;  1U3A A;  1O8W A;  1SEN A;  2DML A;  5CNW A;  5ENU A;  2BJX A;  2CAI A;  3FHK A;  2EIQ A;  1VF3 A;  3TKS A;  3GMF A;  3C7M A;  3UOM A;  1MD3 A;  1DE2 A;  2HYX A;  2JZR A;  2OBI A;  4ECI A;  1PN0 A;  4IW9 A;  4K1F A;  4XRA A;  3DWV A;  4KUN A;  4IN0 A;  3HYP A;  2AYT A;  5KN0 A;  1X5E A;  3KEB A;  2OJL A;  2LJA A;  4FYC A;  4NV5 A;  4FYU A;  4HZ2 A;  3EWL A;  4KAE A;  5J5N A;  1EGO A;  3CRT A;  1ZMA A;  3I69 A;  3DEX A;  3P2A A;  1ZYE A;  2PN8 A;  2JU5 A;  2L5O A;  3KZQ A;  2YOI A;  4D73 B;  1O8X A;  4MMM A;  4KCA A;  1SK1 A;  4POL A;  4KB3 A;  4MZB A;  4EKZ A;  4K6X A;  2HI7 A;  4KND A;  3CRU A;  10GS A;  5GSS A;  4F82 A;  1OKD A;  2LQQ A;  4HQS A;  3APS A;  2WS2 A;  1Y25 A;  4MF5 A;  1X9M B;  1A0R P;  2IPA A;  2B1L A;  4NPB A;  5A4U A;  1PKW A;  1K0D A;  1YDK A;  2GQM A;  2R3X A;  5F06 A;  2VO4 A;  5C00 A;  5D73 A;  1Y6E A;  3D0Z A;  1M3I A;  2YZU A;  1NSW A;  4BPY A;  4MZC A;  1GSF A;  1XWA A;  5KOX A;  3UBK A;  5D9W A;  4IGJ A;  2VOC A;  2DLX A;  1YF0 A;  3TRX A;  2OAD A;  1X0R A;  5IMZ A;  6GSV A;  5J41 A;  4TXO B;  4F0C A;  4H86 A;  1A0F A;  1TU7 A;  4O5Q A;  2P5Q A;  4ZBD A;  3FR6 A;  4TR3 A;  1GNW A;  3O76 A;  3APO A;  2C4J A;  2GGT A;  4X1U A;  3H79 A;  2A2R A;  3R2Q A;  4O5U A;  3VWU A;  1TW9 A;  2WDU A;  2KP1 A;  4V2L A;  1WIK A;  2D2Z A;  4MPG A;  2I4A A;  2YV7 A;  1A2J A;  1V9W A;  4CY8 A;  2KLX A;  2BMX A;  1HNA A;  3LFL A;  1YKA A;  3CBU A;  3MSZ A;  5IQY A;  3J7Y b;  3LEF A;  1FHE A;  1M2A A;  5IPH A;  4ILF A;  3L9V A;  3F0I A;  3QD9 A;  4PUR A;  5G5E A;  2VLU A;  3HA9 A;  5DQS A;  2B1K A;  5DAK A;  1Z9H A;  2X8H A;  1XWB A;  1Q98 A;  4KSO A;  2A4H A;  3HDC A;  1Z6N A;  2MMO A;  3HY2 A;  4XS6 A;  4I6X A;  11GS A;  3APQ A;  5HFI A;  2WB9 A;  4E8E A;  2R4V A;  1EP7 A;  2I9H A;  1S3A A;  3CTF A;  5IPG A;  1JZO A;  2FA4 A;  4K5S A;  2R0C A;  4HQZ A;  1GSE A;  1N8J A;  1AXD A;  3QAV A;  4ECB A;  1FOH A;  1R26 A;  4OMV A;  2FGX A;  1W89 A;  4Z2U A;  2YV9 A;  3EU4 A;  3BD2 A;  5CP1 A;  4BWS A;  3D5J A;  2H6X A;  1MDI A;  1XOB A;  1Z3E A;  2VL3 A;  6GSU A;  3KJY A;  1W4V A;  12GS A;  4IJ3 A;  4OFM A;  1GRX A;  2IIY A;  3DIE A;  3F3R A;  4EE0 A;  2E7P A;  3ZFB A;  5J9B A;  5IOW A;  2FD3 A;  2GZY A;  3M1G A;  4TN8 A;  4F0B A;  5LD0 A;  1J08 A;  5DCH A;  3M3M A;  4EDY A;  4BVX A;  3IC4 A;  2X4A A;  1R4W A;  3ERF A;  4N30 A;  2C0D A;  3VFI A;  3LYP A;  1SKW B;  2YN1 A;  4PUA A;  2PMT A;  1YF1 A;  2FLS A;  4PGT A;  4XS1 A;  4MJA A;  3IAS 2;  1WMJ A;  3CSH A;  4KF9 A;  1GUK A;  5DBQ A;  1JFU A;  1M0U A;  5JCW A;  1XXU A;  2OAC A;  2IME A;  2VM1 A;  4BL7 B;  4KH7 A;  4XIH A;  4K5R A;  2VM2 A;  5ECK B;  4K2D A;  5D9V A;  1R5A A;  3CSJ A;  1MD4 A;  3GUR A;  2IN3 A;  4KCE A;  4IP6 A;  4OFN A;  3QOU A;  2VCX A;  5FWG A;  3P8W A;  1A24 A;  1T3B A;  4HZ4 A;  2VCQ A;  2ON5 A;  2AHE A;  2YJ7 A;  4AGS A;  2C80 A;  2KP2 A;  5AGY A;  3IDV A;  3SWL A;  3CMI A;  4LL1 B;  5F05 A;  1AAZ A;  2RLI A;  1FOV A;  3MAK A;  4MJB A;  5ECS A;  2RM5 A;  2F9S A;  4V2M A;  4HUA A;  2Z9S A;  1O7U A;  3C8E A;  3EVI A;  3M8N A;  4ML1 A;  1SKR B;  1JHB A;  1SU9 A;  1B9X C;  2GSR A;  3HVS A;  1K0N A;  3CSI A;  4G0I A;  17GS A;  3HJO A;  3QPM A;  2DJ3 A;  3UBL A;  5J9C A;  1MDK A;  1V98 A;  3F63 A;  1CQH A;  2C3N A;  1V40 A;  2FWF A;  3G9B A;  2DJ2 A;  4EUY A;  4ZB8 A;  5B6N A;  3IHG A;  5JWO B;  1SYX A;  5ECI B;  1TK0 B;  2FY6 A;  3F3Q A;  1ZGN A;  1HQO A;  4GF0 A;  2MBS A;  4MF7 A;  4K0N A;  4BA7 A;  2VLT A;  2O7K A;  1NW2 A;  5D9T A;  4MK3 A;  3PPU A;  3N5O A;  6GST A;  1KBN A;  3FZ5 A;  1B4Q A;  2VD0 A;  2VD1 A;  3ZZX A;  19GS A;  1GUM A;  2YPM A;  4KDY A;  2PVO C;  2FWH A;  2QGV A;  4EL1 A;  5G5F A;  4NAX A;  4L0U A;  5CRW A;  3VUR A;  1PL2 A;  4XS4 A;  4JED A;  1EV4 A;  4N0V A;  2V41 A;  1GSQ A;  3DYR A;  5AIS A;  3HXS A;  5DQY A;  3VWV A;  1WRY A;  5DJL A;  5JWQ B;  2YAN A;  2K9F A;  4PTS A;  1HNC A;  2JSY A;  4GST A;  5KOW A;  3V1W A;  3CQF A;  5DJM A;  2JZS A;  4AJ7 A;  1XW9 A;  4N11 A;  4YKF A;  1ACV A;  5EL8 A;  1K3Y A;  3RPN A;  3M9K A;  2XBQ A;  5CRH A;  1SK0 A;  1Z6M A;  1BAY A;  4BWQ A;  1U87 A;  1TJD A;  2H1G A;  2R2J A;  3A2V A;  3TOT A;  1H4O A;  1ERV A;  2VLV A;  2TRX A;  3DVW A;  3TKP A;  1RQM A;  3FYG A;  3ZTL A;  2QA1 A;  2KOK A;  5GAP D;  3QDN A;  3GH6 A;  1ZYP A;  4IEL A;  1SL2 B;  4GLT A;  2DIY A;  7GSS A;  4EVM A;  4YQM A;  1F3A A;  3PR8 A;  1DE1 A;  1M9A A;  2V32 A;  3LG6 A;  2C0E A;  1BQ7 A;  4O32 A;  5IM9 A;  3HCZ A;  3QAW A;  3E9J B;  5ECP B;  4JR4 A;  1Q4J A;  3WT2 A;  1CQG A;  3DGQ A;  2DMM A;  4G0K A;  1ZZY A;  6GSW A;  4CY6 A;  3KIJ A;  1FB0 A;  4I8B A;  3ZFL A;  4WR4 A;  2HSY A;  3LYK A;  3TKQ A;  1YY7 A;  1OKT A;  3O6T A;  4GSN A;  1M99 A;  5A4V A;  2TRC P;  2MZC A;  2DBC A;  3O3T A;  3E0U A;  4ZB6 A;  1ZYQ B;  4L0W A;  2VCT A;  2CQ9 A;  4Z2R A;  1SJZ A;  2R6K A;  1R7H A;  2H71 A;  4X0X A;  2X99 A;  4WF4 A;  1THX A;  5DAK B;  5HR1 A;  2L6C A;  1M9B A;  1RK4 A;  5B6M A;  5HQP A;  3RHC A;  2MMA A;  1TKD B;  2JAD A;  3JCM L;  1T7P B;  5JCG A;  4TVE A;  2K6V A;  2A2P A;  2N5A A;  3DKS A;  1XWC A;  2OE1 A;  1WP0 A;  9GSS A;  3M0F A;  1F9M A;  1Z7P A;  2H74 A;  2CVD A;  4LL4 B;  2V2G A;  3HZ8 A;  1X5D A;  1WWJ A;  4EC0 A;  2HRF A;  1XCC A;  1EWX A;  1B48 A;  2YNX A;  1DUG A;  4HSC X;  5L71 A;  2LKU A;  3DML A;  5CRG A;  3EMP A;  2REM A;  3KH7 A;  1OC9 A;  3EIN A;  4L5L A;  4YAV A;  1M2B A;  2F51 A;  5GST A;  4O7H A;  4K0G A;  4BVX B;  2GST A;  3L78 A;  1B8X A;  1EZK A;  1EV9 A;  3EUR A;  4HJM A;  3MNG A;  4MA9 A;  3PH9 A;  4MJE A;  3LSZ A;  5IO2 A;  3A5I A;  2WCI A;  1ON4 A;  1OVN A;  5B7C A;  3PIN A;  1QGV A;  4ZL7 A;  1PSQ A;  2H30 A;  1J9B A;  2YP6 A;  4MF6 A;  3F8U A;  4FYB A;  4POB A;  3RBT A;  3IXR A;  4EF0 A;  3GN3 A;  3GST A;  5HR0 A;  1GL8 A;  5F8B A;  1Z7R A;  5BRT A;  1AW9 A;  1G6W A;  4TR1 A;  4TRX A;  4CHS A;  1OE7 A;  1FG4 A;  4V1A p;  4LMV A;  2LNS A;  3QFB C;  2E2G A;  3ZVJ A;  3NIV A;  4PX1 A;  3WGX A;  3I6A A;  2H0H A;  3WGD A;  2V1M A;  2B3S A;  2PU9 C;  1F2E A;  2P5R A;  3L0H A;  1G6Y A;  1URM A;  1XW5 A;  2ALB A;  4OO5 A;  3LGC A;  1G7O A;  2L4Q A;  4Q5F A;  1OC3 A;  3VWX A;  4KX4 A;  1ZYN A;  2VL2 A;  4XHM A;  2PBJ A;  1FB6 A;  4CDO A;  1AQW A;  3GKX A;  2WUL A;  4IVF A;  4JR6 A;  4A5P A;  3C73 A;  2RII A;  2OBK A;  5ECR B;  2G2Q A;  3FRC A;  2CAQ A;  4NXI A;  1GTB A;  1TTZ A;  1MEK A;  20GS A;  5D8I A;  5ID2 A;  2R37 A;  2VCV A;  1K0C A;  1K3O A;  2V6K A;  3TB2 A;  2GTU A;  3HD5 A;  4OO4 A;  4MZW A;  4JE1 A;  4YKG A;  22GS A;  3F6F A;  3FY7 A;  3VPT A;  2E2M A;  2YCD A;  4V2N A;  2R5G A;  4FIW A;  1OYJ A;  4RQR A;  3HKR A;  3GX0 A;  2B5Y A;  1FVK A;  4XS4 B;  3VK9 A;  2EIR A;  3P90 A;  4USS A;  2H0G A;  3RPP A;  4PQ1 A;  4EIP A; 
#chains in the Genus database with same CATH homology
 2M72 A;  2YWN A;  1G7E A;  3GX8 A;  3EPT A;  4L8E A;  4KDU A;  4Q5N A;  2JL4 A;  2N5B A;  3FR3 A;  2GQL A;  1PKZ A;  4KA0 A;  1SYR A;  3LXT A;  3BCK A;  4ZXG A;  1GLQ A;  1ML6 A;  1K0M A;  4KSM A;  4MH2 A;  4PNG A;  1SJ6 A;  3UVT A;  2GZZ A;  5DCG A;  2M46 A;  1DBY A;  4YH2 A;  1FVJ A;  4DVC A;  2X49 A;  4ULX A;  4QL9 A;  2NTO A;  4EDZ A;  3ZRE A;  2H0I A;  1M2D A;  2XPE A;  2LTK A;  1KNG A;  3OR5 A;  4RUV A;  4KDX A;  1JZD A;  2L6D A;  3IA1 A;  1NHY A;  5A4W A;  5ECM B;  5A5K A;  3HVX A;  3TRP A;  2AJQ B;  4RQX A;  5AN1 A;  4MCU A;  3M9J A;  3QR6 A;  4GXZ A;  1VF4 A;  3GKN A;  5KN2 A;  2L4C A;  3EMX A;  2GZP A;  1IYI A;  1T1V A;  1F3B A;  4NHW A;  3TJG A;  1I9D A;  2AV4 A;  2X64 A;  1HD2 A;  3HJM A;  3J7Y k;  2C1Y A;  1MDJ A;  2H6Y A;  3GA4 A;  4PNF A;  3A2W A;  2DSA A;  1JLW A;  1X5C A;  2H8L A;  1A8L A;  2LV3 A;  4F2I A;  5E59 A;  2CX3 A;  3MIX A;  5AIX A;  2X8G A;  5EY6 A;  2UZ8 A;  1GP1 A;  3GL3 A;  4KE3 A;  3IHQ A;  3TGZ A;  3UJ1 A;  1XIY A;  2DJJ A;  3H4K A;  2DJK A;  3TRQ A;  6GSX A;  2IMI A;  3ZMK A;  2VCZ A;  3DVX A;  4F03 A;  1AIU A;  3KGK A;  4K2X A;  2IL3 A;  3KXO A;  4O92 A;  3ED3 A;  4ZBA A;  2B7K A;  4MDC A;  2H01 A;  1AC1 A;  3ME7 A;  3FK8 A;  1TK8 B;  1J0F A;  2CA8 A;  2XPD A;  2JAC A;  3GKK A;  2GT6 A;  1NHO A;  3EE2 A;  4NV2 A;  3C1S A;  1BX9 A;  3QFA C;  1JZR A;  2CX4 A;  4WBJ A;  1GH2 A;  5ECH B;  5H5R A;  3W8S A;  4HS1 A;  5D9X A;  2ZUP A;  1XW6 A;  1GTI A;  3CXG A;  3RAZ A;  2O89 A;  5CRD A;  3UVH A;  4XTS A;  3VI5 A;  3GYK A;  2H66 A;  3IK7 A;  3L9U A;  2C8U A;  4V1A g;  3WT1 A;  2AUV A;  1TRS A;  4HEA 2;  1OC9 B;  4KW6 A;  5J4U A;  4HOJ A;  3H8Q A;  3L9S A;  1X9S B;  4NMU A;  1LBK A;  1PA3 A;  2HFD A;  2YWO A;  3LW9 A;  1UC7 A;  1ABA A;  1SKS B;  3Q6O A;  3IPZ A;  1TRU A;  4ML6 A;  2LRC A;  4POK A;  5H5S A;  3KTL A;  3BBY A;  3G7Y A;  2HSH A;  1YQ1 A;  2LRN A;  3I43 A;  4X43 A;  3TKS C;  1OAZ A;  1S3C A;  1EOG A;  3FR9 A;  3KTB A;  5IMF A;  2QSI A;  2FWE A;  3GHA A;  2MYG A;  5G1K A;  1GSU A;  1NM3 A;  3BJ5 A;  3Q18 A;  1FAA A;  2YJH A;  2DJ1 A;  3KMO A;  4MAB A;  3GL5 A;  4O5R A;  4TR1 B;  4GQF A;  1PX6 A;  4ACS A;  6GSY A;  1TRW A;  3W6G A;  4IKH A;  2IFQ A;  2HRA A;  3H1N A;  3U6V A;  1TI3 A;  3PGT A;  3TJK A;  2GQK A;  4ZB9 A;  5IIZ A;  4TOP A;  2VL9 A;  4GQC A;  2A4V A;  3ZIT A;  2H19 A;  4K8M A;  1VGL A;  2I3Y A;  5IOX A;  5D96 A;  1DSB A;  1XZO A;  3MYD A;  3FEU A;  2CVB A;  5IMV A;  2NVL A;  3A3T A;  3UEM A;  1VF1 A;  5IMD A;  1H75 A;  3P7X A;  5GZZ B;  1BJX A;  2EC4 A;  2G0F A;  4AJ8 A;  4HU9 A;  1X9W B;  2B7J A;  4BVY A;  2OE0 A;  5CAX A;  3D4M A;  5ID2 B;  3WYW A;  4OCE A;  2BTO T;  1OC8 A;  2R0G A;  2J9H A;  2HRN A;  3MDK A;  4J56 E;  1TU8 A;  2O85 A;  1QQ2 A;  2CZ2 A;  2ON7 A;  3TJB A;  4IHU A;  4DSS A;  1WPI A;  1GLP A;  4HDE A;  3GH9 A;  1QFN A;  2DKH A;  3KMN A;  2I81 A;  3TKS E;  4GCI A;  5CRE A;  1K3L A;  3TUE A;  3GTU A;  1GSY A;  14GS A;  2RUE A;  3EYT A;  2XBI A;  5JCU A;  3TJF A;  6GSS A;  3U5R E;  1T4Z A;  2KHP A;  3FKF A;  3IAM 2;  5ECO B;  4I97 A;  1A8Y A;  1TI1 A;  1K0B A;  1A2L A;  4X4J A;  5HFG A;  2GSS A;  3EU3 A;  4YQV A;  2QA2 A;  4MJC A;  1QK8 A;  3GRX A;  4TKY A;  5J3R A;  3FMW A;  4QQ7 A;  5LCZ A;  3ZYW A;  1YEX A;  4ID0 A;  1YJ6 A;  4AJ6 A;  4K7N A;  5G30 A;  1T8E B;  5ECL B;  1GTU A;  4RI7 A;  1KTE A;  5HR3 A;  4G10 A;  4RI6 A;  2B5E A;  4TR4 A;  4WKW A;  1QUW A;  3TOU A;  4AF2 A;  4ICY A;  18GS A;  1PL1 A;  1PMT A;  2L59 A;  2HZE A;  3TKR A;  3UAR A;  4LMW A;  2FNO A;  1SJI A;  2F8F A;  2F8A A;  5G2Z A;  2YWI A;  2CV4 A;  3K8N A;  1E2Y A;  4K7O A;  5CYY A;  5GAN D;  1TK5 B;  4POM A;  1UVZ A;  3A5W A;  3MWH A;  2HSM A;  5IMA A;  3RHB A;  3VLN A;  1V58 A;  3IE3 A;  3DXB A;  1C72 A;  2OE3 A;  3GUS A;  4DSQ A;  2HXK A;  3UIW A;  3C1R A;  2JZT A;  2H70 A;  4MNN A;  3DRN A;  2H73 A;  1T4Y A;  3AY8 A;  2L57 A;  4Q5R A;  2PVQ A;  1O6J A;  2QKE A;  3ZML A;  4IS0 A;  2VCW A;  5FHI A;  2DIZ A;  4TR0 A;  1AQX A;  4MLY A;  2RUF A;  2AAW A;  4ECC A;  3D4T A;  2LRT A;  3C71 A;  3TDG A;  3ZIV A;  5AIV A;  3QMX A;  2K18 A;  3WD6 A;  2GSQ A;  3S9F A;  1SL1 B;  3LOR A;  4G0L A;  4DSR A;  1XVW A;  5DAL A;  1N2A A;  5ELA A;  1S3D A;  2LS5 A;  1GWC A;  1SK2 A;  2FA8 A;  2LNT A;  4ZL9 A;  4HU7 A;  1GTA A;  4GWR A;  3F4R A;  2LQO A;  1TXX A;  2P31 A;  3IK9 A;  3HJP A;  1XWK A;  4EIQ A;  5G31 A;  4JU5 A;  2HNL A;  2PWJ A;  1XOA A;  1B9Y C;  2CT6 A;  3BOA A;  4WR5 A;  1WE0 A;  2XC2 A;  3I9V 2;  2N5F A;  3D6I A;  3D21 A;  2HE3 A;  2DC5 A;  2H1D A;  5F0G A;  1VRS D;  1XVQ A;  3G7I A;  4EO3 A;  1USB A;  3IOS A;  5COH A;  2GLR A;  2TIR A;  5KN3 A;  1ERT A;  2IMD A;  4ISD A;  8GSS A;  3ZLP A;  3LQ7 A;  4FH8 A;  1BG5 A;  3D22 A;  1LU4 A;  2JSZ A;  1EEJ A;  1KEB A;  3TCO A;  4N10 A;  1V57 A;  5E4W A;  1YZX A;  2GVP A;  1M7T A;  1O73 A;  3VPQ A;  5BMU A;  4J57 E;  3ERW A;  3RDW A;  5G1L A;  3GNJ A;  3ZL5 A;  1A23 A;  1O81 A;  3LJR A;  3GSS A;  4ECJ A;  1PRX A;  4ZIL A;  4CW9 A;  1ZCP A;  3ERG A;  4PQH A;  1BYE A;  4MP4 A;  2RM6 A;  4TW5 A;  3IRA A;  4DEJ A;  4WBR D;  3WGE A;  4FQU A;  2AB6 A;  1GUL A;  3ZVJ D;  3ISO A;  4FO5 A;  4MH3 A;  2J23 A;  4GTU A;  1EP8 A;  2NPB A;  1XPV A;  3KCM A;  4LA1 A;  2ZNM A;  1TRV A;  1WJK A;  2C3Q A;  2YZH A;  5B8A A;  1SL0 B;  2E0Q A;  1PGT A;  1LJR A;  2IFQ B;  1A2M A;  2XHF A;  1U6T A;  1TP9 A;  2H1A A;  1V2A A;  5IMC A;  4ZL8 A;  1OE8 A;  2DKI A;  2CVK A;  3TJJ A;  1XFL A;  3UL3 A;  4OFT A;  4JBB A;  3FZA A;  1IYH A;  1F6M C;  1JLV A;  3ZIJ A;  2H1B A;  1ERW A;  3F4S A;  3IR4 A;  4ZBB A;  2HLS A;  1UN2 A;  4BVY B;  4PUF C;  2PER A;  2K8V A;  3F6D A;  1EOH A;  4D73 A;  3CYN A;  3L4N A;  2ES7 A;  2FHE A;  1EEM A;  2FCH A;  1U3I A;  1VF2 A;  3GFK A;  2C0F A;  4DSS B;  2LST A;  2DJ0 A;  5KN1 A;  2FWG A;  2WRT A;  2O87 A;  1Z5Y E;  3LWA A;  2PUK C;  4IQ1 A;  5B8B A;  1PD2 1;  3QAG A;  2F3M A;  1XBS A;  2NDO A;  4WF5 A;  3GTU B;  1FO5 A;  1AUC A;  1SD8 A;  4GRF A;  1UA5 A;  1FW1 A;  2R0P A;  5EPF A;  5C04 A;  2WFC A;  1GUH A;  4K9Z A;  2LJR A;  3ZRD A;  1ST9 A;  1GNE A;  3VWW A;  4G9H A;  4YAP A;  2GDR A;  5FT3 A;  3QCP A;  2FUG 2;  5F07 A;  2L5L A;  4Q5Q A;  3IC8 A;  4E8H A;  4XRD A;  3GKM A;  3BCI A;  4TXO A;  4N0Z A;  3KP9 A;  2V6O A;  3A2X A;  1WOU A;  4IQA A;  5D93 A;  1EGR A;  2O8V B;  4Z2T A;  1PN9 A;  5ECN B;  1QMV A;  2MMZ A;  4EXJ A;  1I5G A;  2HZE B;  2C3T A;  2VUP A;  1ZOF A;  3SBC A;  5ELG A;  3UAP A;  1E6B A;  2YWM A;  2H76 A;  4OD7 A;  1PQN A;  3H93 A;  4HI7 A;  5INY A;  2P0G A;  4JZQ A;  1O85 A;  1ILO A;  2IWT A;  2LJK A;  5EVO A;  5DVB A;  5DDL A;  4NHZ A;  1TOF A;  3KP8 A;  2IJY A;  2QC7 A;  5LNK e;  5JWR B;  1ZL9 A;  5KEJ A;  5H5Q A;  1GSS A;  3NZN A;  3N9J A;  1PX7 A;  4XCS A;  3HHV A;  3EC3 A;  3US3 A;  4I2T A;  4I5Q A;  2EIO A;  2HT9 A;  4KGI A;  3G7J A;  2GS3 A;  4NWY A;  2PGT A;  3FW2 A;  1GSD A;  5ABR A;  3Q74 A;  3VI7 A;  4HJ2 A;  2KUC A;  4OWY A;  1F37 A;  4G19 A;  5IO0 A;  5CO3 A;  1HNB A;  1K0A A;  2WZ9 A;  2C0G A;  5HFK A;  2M80 A;  4WET A;  1JZW A;  4PXO A;  2MMN A;  1QXH A;  3FZ4 A;  3ME8 A;  1TDI A;  2HRK A;  4IJI A;  2GT5 A;  3R3E A;  3UMA A;  2MBT A;  3KH9 A;  1B4P A;  1ERU A;  2VAF A;  5DAL B;  2IMK A;  2LEG A;  3W8J A;  16GS A;  4IP1 A;  3Q19 A;  1T00 A;  4P3Y B;  4YQU A;  1AQV A;  1RW1 A;  3NOF A;  1THO A;  4I2U A;  2H72 A;  4L5O A;  5ECQ B;  3CTG A;  3IV4 A;  1SD9 A;  4K7I A;  2X8C A;  1G0T A;  2H6Z A;  3KD0 A;  3FZ9 A;  13GS A;  3E3E A;  2H75 A;  4IBP A;  4MPF A;  4J2F A;  4WXT A;  3F9U A;  1YKC A;  3GV1 A;  2A2S A;  2LUS A;  3LXZ A;  2ZCT A;  1R5P A;  2B5X A;  2WJU A;  1YEP A;  1HYU A;  4GSS A;  2OKA A;  4QL7 A;  1K0O A;  4BL7 A;  3KM6 A;  3DD3 A;  2WGR A;  4PQI A;  5HR2 A;  4G2E A;  4Z7X A;  2I1U A;  3HZ4 A;  2VIM A;  3F4T A;  4F9Z A;  1XWG A;  2CZ3 A;  1BED A;  2B6M A;  2VL2 C;  4LLR A;  4TXV A;  2OA7 A;  2K8S A;  2PPT A;  2HZF A;  3IBH A;  4WEY A;  4OCF A;  2NBS A;  4JRR A;  1U88 A;  2IMF A;  3HVV A;  1MTC A;  3GIX A;  4ZIJ A;  1U3A A;  1O8W A;  1SEN A;  2DML A;  5CNW A;  5ENU A;  2BJX A;  2CAI A;  3FHK A;  2EIQ A;  1VF3 A;  3TKS A;  3GMF A;  3C7M A;  3UOM A;  1MD3 A;  1DE2 A;  2HYX A;  2JZR A;  2OBI A;  4ECI A;  1PN0 A;  4IW9 A;  4K1F A;  4XRA A;  3DWV A;  4KUN A;  4IN0 A;  3HYP A;  2AYT A;  5KN0 A;  1X5E A;  3KEB A;  2OJL A;  2LJA A;  4FYC A;  4NV5 A;  4FYU A;  4HZ2 A;  3EWL A;  4KAE A;  5J5N A;  1EGO A;  3CRT A;  1ZMA A;  3I69 A;  3DEX A;  3P2A A;  1ZYE A;  2PN8 A;  2JU5 A;  2L5O A;  3KZQ A;  2YOI A;  4D73 B;  1O8X A;  4MMM A;  4KCA A;  1SK1 A;  4POL A;  4KB3 A;  4MZB A;  4EKZ A;  4K6X A;  2HI7 A;  4KND A;  3CRU A;  10GS A;  5GSS A;  4F82 A;  1OKD A;  2LQQ A;  4HQS A;  3APS A;  2WS2 A;  1Y25 A;  4MF5 A;  1X9M B;  1A0R P;  2IPA A;  2B1L A;  4NPB A;  5A4U A;  1PKW A;  1K0D A;  1YDK A;  2GQM A;  2R3X A;  5F06 A;  2VO4 A;  5C00 A;  5D73 A;  1Y6E A;  3D0Z A;  2YZU A;  1NSW A;  4BPY A;  4MZC A;  1GSF A;  1XWA A;  5KOX A;  3UBK A;  5D9W A;  4IGJ A;  2VOC A;  2DLX A;  1YF0 A;  3TRX A;  2OAD A;  1X0R A;  5IMZ A;  6GSV A;  5J41 A;  4TXO B;  4F0C A;  4H86 A;  1A0F A;  1TU7 A;  4O5Q A;  2P5Q A;  4ZBD A;  3FR6 A;  4TR3 A;  1GNW A;  3O76 A;  3APO A;  2C4J A;  2GGT A;  4X1U A;  3H79 A;  2A2R A;  3R2Q A;  4O5U A;  3VWU A;  1TW9 A;  2WDU A;  2KP1 A;  4V2L A;  1WIK A;  2D2Z A;  4MPG A;  2I4A A;  2YV7 A;  1A2J A;  1V9W A;  4CY8 A;  2KLX A;  2BMX A;  1HNA A;  3LFL A;  1YKA A;  3CBU A;  3MSZ A;  5IQY A;  3J7Y b;  3LEF A;  1FHE A;  1M2A A;  5IPH A;  4ILF A;  3L9V A;  3F0I A;  3QD9 A;  4PUR A;  5G5E A;  2VLU A;  3HA9 A;  5DQS A;  2B1K A;  5DAK A;  1Z9H A;  2X8H A;  1XWB A;  1Q98 A;  4KSO A;  2A4H A;  3HDC A;  1Z6N A;  2MMO A;  3HY2 A;  4XS6 A;  4I6X A;  11GS A;  3APQ A;  5HFI A;  2WB9 A;  4E8E A;  2R4V A;  1EP7 A;  2I9H A;  1S3A A;  3CTF A;  5IPG A;  1JZO A;  2FA4 A;  4K5S A;  2R0C A;  4HQZ A;  1GSE A;  1N8J A;  1AXD A;  3QAV A;  4ECB A;  1FOH A;  1R26 A;  4OMV A;  2FGX A;  1W89 A;  4Z2U A;  2YV9 A;  3EU4 A;  3BD2 A;  5CP1 A;  4BWS A;  3D5J A;  2H6X A;  1MDI A;  1XOB A;  1Z3E A;  2VL3 A;  6GSU A;  3KJY A;  1W4V A;  12GS A;  4IJ3 A;  4OFM A;  1GRX A;  2IIY A;  3DIE A;  3F3R A;  4EE0 A;  2E7P A;  3ZFB A;  5J9B A;  5IOW A;  2FD3 A;  2GZY A;  3M1G A;  4TN8 A;  4F0B A;  5LD0 A;  1J08 A;  5DCH A;  3M3M A;  4EDY A;  4BVX A;  3IC4 A;  2X4A A;  1R4W A;  3ERF A;  4N30 A;  2C0D A;  3VFI A;  3LYP A;  1SKW B;  2YN1 A;  4PUA A;  2PMT A;  1YF1 A;  2FLS A;  4PGT A;  4XS1 A;  4MJA A;  3IAS 2;  1WMJ A;  3CSH A;  4KF9 A;  1GUK A;  5DBQ A;  1JFU A;  1M0U A;  5JCW A;  1XXU A;  2OAC A;  2IME A;  2VM1 A;  4BL7 B;  4KH7 A;  4XIH A;  4K5R A;  2VM2 A;  5ECK B;  4K2D A;  5D9V A;  1R5A A;  3CSJ A;  1MD4 A;  3GUR A;  2IN3 A;  4KCE A;  4IP6 A;  4OFN A;  3QOU A;  2VCX A;  5FWG A;  3P8W A;  1A24 A;  1T3B A;  4HZ4 A;  2VCQ A;  2ON5 A;  2AHE A;  2YJ7 A;  4AGS A;  2C80 A;  2KP2 A;  5AGY A;  3IDV A;  3SWL A;  3CMI A;  4LL1 B;  5F05 A;  1AAZ A;  2RLI A;  1FOV A;  3MAK A;  4MJB A;  5ECS A;  2RM5 A;  2F9S A;  4V2M A;  4HUA A;  2Z9S A;  1O7U A;  3C8E A;  3EVI A;  3M8N A;  4ML1 A;  1SKR B;  1JHB A;  1SU9 A;  1B9X C;  2GSR A;  3HVS A;  1K0N A;  3CSI A;  4G0I A;  17GS A;  3HJO A;  3QPM A;  2DJ3 A;  3UBL A;  5J9C A;  1MDK A;  1V98 A;  3F63 A;  1CQH A;  2C3N A;  1V40 A;  2FWF A;  3G9B A;  2DJ2 A;  4EUY A;  4ZB8 A;  5B6N A;  3IHG A;  5JWO B;  1SYX A;  5ECI B;  1TK0 B;  2FY6 A;  3F3Q A;  1ZGN A;  1HQO A;  4GF0 A;  2MBS A;  4MF7 A;  4K0N A;  4BA7 A;  2VLT A;  2O7K A;  1NW2 A;  5D9T A;  4MK3 A;  3PPU A;  3N5O A;  6GST A;  1KBN A;  3FZ5 A;  1B4Q A;  2VD0 A;  2VD1 A;  3ZZX A;  19GS A;  1GUM A;  2YPM A;  4KDY A;  2PVO C;  2FWH A;  2QGV A;  4EL1 A;  5G5F A;  4NAX A;  4L0U A;  5CRW A;  3VUR A;  1PL2 A;  4XS4 A;  4JED A;  1EV4 A;  4N0V A;  2V41 A;  1GSQ A;  3DYR A;  5AIS A;  3HXS A;  5DQY A;  3VWV A;  1WRY A;  5DJL A;  5JWQ B;  2YAN A;  2K9F A;  4PTS A;  1HNC A;  2JSY A;  4GST A;  5KOW A;  3V1W A;  5DJM A;  2JZS A;  4AJ7 A;  1XW9 A;  4N11 A;  4YKF A;  1ACV A;  5EL8 A;  1K3Y A;  3RPN A;  3M9K A;  2XBQ A;  5CRH A;  1SK0 A;  1Z6M A;  1BAY A;  4BWQ A;  1U87 A;  1TJD A;  2H1G A;  2R2J A;  3A2V A;  3TOT A;  1H4O A;  1ERV A;  2VLV A;  2TRX A;  3DVW A;  3TKP A;  1RQM A;  3FYG A;  3ZTL A;  2QA1 A;  2KOK A;  5GAP D;  3QDN A;  3GH6 A;  1ZYP A;  4IEL A;  1SL2 B;  4GLT A;  2DIY A;  7GSS A;  4EVM A;  4YQM A;  1F3A A;  3PR8 A;  1DE1 A;  1M9A A;  2V32 A;  3LG6 A;  2C0E A;  1BQ7 A;  4O32 A;  5IM9 A;  3HCZ A;  3QAW A;  3E9J B;  5ECP B;  4JR4 A;  1Q4J A;  3WT2 A;  1CQG A;  3DGQ A;  2DMM A;  4G0K A;  1ZZY A;  6GSW A;  4CY6 A;  3KIJ A;  1FB0 A;  4I8B A;  3ZFL A;  4WR4 A;  2HSY A;  3LYK A;  3TKQ A;  1YY7 A;  1OKT A;  3O6T A;  4GSN A;  1M99 A;  5A4V A;  2TRC P;  2MZC A;  2DBC A;  3O3T A;  3E0U A;  4ZB6 A;  1ZYQ B;  4L0W A;  2VCT A;  2CQ9 A;  4Z2R A;  1SJZ A;  2R6K A;  1R7H A;  2H71 A;  4X0X A;  2X99 A;  4WF4 A;  1THX A;  5DAK B;  5HR1 A;  2L6C A;  1M9B A;  1RK4 A;  5B6M A;  5HQP A;  3RHC A;  2MMA A;  1TKD B;  2JAD A;  3JCM L;  1T7P B;  5JCG A;  4TVE A;  2K6V A;  2A2P A;  2N5A A;  3DKS A;  1XWC A;  2OE1 A;  1WP0 A;  9GSS A;  3M0F A;  1F9M A;  1Z7P A;  2H74 A;  2CVD A;  4LL4 B;  2V2G A;  3HZ8 A;  1X5D A;  1WWJ A;  4EC0 A;  2HRF A;  1XCC A;  1EWX A;  1B48 A;  2YNX A;  1DUG A;  5L71 A;  2LKU A;  3DML A;  5CRG A;  3EMP A;  2REM A;  3KH7 A;  1OC9 A;  3EIN A;  4L5L A;  4YAV A;  1M2B A;  2F51 A;  5GST A;  4O7H A;  4K0G A;  4BVX B;  2GST A;  3L78 A;  1B8X A;  1EZK A;  1EV9 A;  3EUR A;  4HJM A;  3MNG A;  4MA9 A;  3PH9 A;  4MJE A;  3LSZ A;  5IO2 A;  3A5I A;  2WCI A;  1ON4 A;  1OVN A;  5B7C A;  3PIN A;  1QGV A;  4ZL7 A;  1PSQ A;  2H30 A;  1J9B A;  2YP6 A;  4MF6 A;  3F8U A;  4FYB A;  4POB A;  3RBT A;  3IXR A;  4EF0 A;  3GN3 A;  3GST A;  5HR0 A;  1GL8 A;  5F8B A;  1Z7R A;  5BRT A;  1AW9 A;  1G6W A;  4TR1 A;  4TRX A;  4CHS A;  1OE7 A;  1FG4 A;  4V1A p;  4LMV A;  2LNS A;  3QFB C;  2E2G A;  3ZVJ A;  3NIV A;  4PX1 A;  3WGX A;  3I6A A;  2H0H A;  3WGD A;  2V1M A;  2B3S A;  2PU9 C;  1F2E A;  2P5R A;  3L0H A;  1G6Y A;  1URM A;  1XW5 A;  2ALB A;  4OO5 A;  3LGC A;  1G7O A;  2L4Q A;  4Q5F A;  1OC3 A;  3VWX A;  4KX4 A;  1ZYN A;  2VL2 A;  4XHM A;  2PBJ A;  1FB6 A;  4CDO A;  1AQW A;  3GKX A;  2WUL A;  4IVF A;  4JR6 A;  4A5P A;  3C73 A;  2RII A;  2OBK A;  5ECR B;  2G2Q A;  3FRC A;  2CAQ A;  4NXI A;  1GTB A;  1TTZ A;  1MEK A;  20GS A;  5D8I A;  5ID2 A;  2R37 A;  2VCV A;  1K0C A;  1K3O A;  2V6K A;  3TB2 A;  2GTU A;  3HD5 A;  4OO4 A;  4MZW A;  4JE1 A;  4YKG A;  22GS A;  3F6F A;  3FY7 A;  3VPT A;  2E2M A;  2YCD A;  4V2N A;  2R5G A;  4FIW A;  1OYJ A;  4RQR A;  3HKR A;  3GX0 A;  2B5Y A;  1FVK A;  4XS4 B;  3VK9 A;  2EIR A;  3P90 A;  4USS A;  2H0G A;  3RPP A;  4PQ1 A;  4EIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...