3TB2A

1-cys peroxidoxin from plasmodium yoelli
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
219
structure length
218
Chain Sequence
GYHLGATFPNFTAKASGIDGDFELYKYIENSWAILFSHPNDFTPVTTELAELGKMHEDFLKLNCKLIGFSCNSKESHDKWIEDIKYYGKLNKWEIPIVCDESRELANKLKIMDEQEKDITGLPLTCRCLFFISPEKKIKATVLYPATTGRNAHEILRVLKSLQLTYTTPVATPVNWNEGDKCCVIPTLQDDEISKHFKNEITKVEMPSKKKYLRFVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1-Cys peroxiredoxin
publication title Genome-scale protein expression and structural biology of Plasmodium falciparum and related Apicomplexan organisms.
pubmed doi rcsb
source organism Plasmodium yoelii
molecule tags Structural genomics,unknown function
total genus 64
structure length 218
sequence length 219
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
A PF10417 1-cysPrx_C C-terminal domain of 1-Cys peroxiredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1020.10 Alpha Beta 2-Layer Sandwich Antioxidant, Horf6; Chain A, domain 2 Antioxidant, Horf6; Chain A, domain2 3tb2A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3tb2A01
2GTUA 2IPAA 3BOAA 5FWGA 1Y25A 4TR0A 3GX0A 1X5DA 1SL2B 4GTUA 5CNWA 4YAPA 3NIVA 3GHAA 4MABA 2PMTA 2VCXA 16GSA 3EU4A 4AJ7A 3DXBA 2HI7A 5FHIA 4XS4A 2VCZA 2XPEA 1FVKA 5J9CA 1WRYA 2LJKA 3LFLA 2H0HA 4WKWA 3F9UA 4GQCA 1NW2A 2E2MA 3M9KA 4MZCA 3N9JA 3GH9A 4GQFA 1HYUA 4XRDA 5F05A 2FHEA 2TIRA 1CQHA 2LSTA 4J56E 1M9BA 2KUCA 5J5NA 1TI1A 3ZITA 1TKDB 2R3XA 2VO4A 3D4MA 3GRXA 4WBJA 1EV9A 2GZZA 5F07A 3EU3A 5GZZB 3RHBA 1PQNA 2VCWA 2IIYA 3TKSE 1X9SB 3GMFA 2ZNMA 3FZ4A 3Q6OA 4WF4A 4IQ1A 1HD2A 1T1VA 2WJUA 4D73B 2AB6A 2B7KA 3GV1A 4EE0A 3FHKA 3O6TA 5ELGA 5KN0A 3E3EA 1ABAA 5D9XA 2FA8A 1Z5YE 3P8WA 5KN2A 2GSQA 3APOA 1GSDA 3GSSA 1GUHA 1XWKA 3CRUA 3QAWA 4F9ZA 2PPTA 2IFQA 5IMDA 1MTCA 1G0TA 3CRTA 3F8UA 3EWLA 4XS4B 1V40A 5HFIA 3UIWA 2X8HA 1IYHA 2LTKA 1SL0B 1EP7A 3F4SA 3VK9A 1QUWA 1TU8A 4HS1A 3I9V2 3VFIA 1GWCA 2IMIA 2AV4A 3DRNA 4K8MA 2QGVA 2WDUA 3BJ5A 1J9BA 2V6OA 4KDXA 2VL2C 3GYKA 2L6DA 1S3DA 2GSRA 5G30A 4MH2A 3GA4A 3IE3A 1O81A 2PBJA 2VM2A 5HFKA 2XC2A 2V2GA 1XWGA 4V1Ag 4LLRA 3LYPA 3HZ4A 3VLNA 17GSA 3KCMA 3C8EA 2HRNA 5DCGA 1V57A 3BCIA 4GWRA 4N11A 2TRCP 3HDCA 3ME8A 3UMAA 5IQYA 4K9ZA 3L4NA 3ZVJA 4WXTA 1OE8A 4ECCA 1RK4A 3QR6A 3LSZA 4LL4B 3GKKA 4ILFA 4RQRA 2WGRA 2CZ3A 1R26A 3A2VA 4HJMA 3EINA 4OFNA 4PX1A 2IFQB 1K3OA 1HQOA 2CT6A 3TOUA 2F9SA 4ZILA 2KP2A 3QDNA 3WD6A 6GSXA 4K6XA 1TI3A 1Q4JA 2O89A 3KJYA 3M8NA 5B6MA 4XCSA 4HZ2A 1XPVA 4DSSA 1FB6A 1SJ6A 2MYGA 2HNLA 4HQZA 2B5EA 2GT6A 2PN8A 1UC7A 3KP9A 2H19A 3FZ9A 3IPZA 4FO5A 4IJIA 2C3TA 3MSZA 5J3RA 3PGTA 5G5FA 4ECJA 4PQIA 1WE0A 5COHA 5IOXA 3JCML 2MMOA 4X0XA 1GTIA 1KNGA 1V2AA 2BTOT 4ZBAA 4CHSA 1I9DA 2CAQA 1OVNA 5IO0A 4KB3A 1K0MA 2M72A 4HUAA 4I2TA 5HR2A 1J0FA 1EOHA 1ACVA 4YQMA 1XWAA 2P31A 1ILOA 1ST9A 3MAKA 1WOUA 1BQ7A 2GSTA 4JU5A 3TB2A 5AN1A 2R37A 3CSJA 2C80A 3A2XA 2LS5A 1SYRA 5KN3A 4IBPA 3Q18A 2LRTA 2DIYA 4CDOA 3VPQA 4F0BA 3G7JA 3UJ1A 1B9YC 4MF5A 3QD9A 4ZL9A 1PKZA 3OR5A 1PKWA 4RI7A 3F4RA 3LYKA 4OCFA 2J9HA 2YOIA 2KLXA 4PQ1A 1SJIA 1K0BA 3LORA 4NXIA 1TW9A 3E0UA 3EYTA 3I69A 1SK1A 3TKPA 2LNTA 2B1LA 3FY7A 4DSSB 2OACA 3CSHA 1SENA 5HR0A 3APSA 3J7Yb 5IMFA 2DMLA 4I5QA 4XS6A 2OE1A 2AUVA 4POBA 3VWUA 2B1KA 5ECOB 4KSOA 1TK0B 4Q5FA 3F3RA 3ZZXA 3FR3A 3DMLA 1BX9A 1K0CA 1F6MC 3ZL5A 3TGZA 5ECSA 4N0VA 3L9SA 1K3YA 1B48A 3LWAA 2H1GA 1A23A 4MF7A 5H5RA 4HOJA 5DAKA 3UOMA 1A0FA 2LQQA 5IPGA 4MP4A 2P5QA 3SBCA 2R2JA 3DVXA 3LG6A 4RUVA 1YJ6A 1G7EA 4OO5A 4MJCA 1B8XA 1IYIA 5ENUA 2DJJA 2CVDA 3IOSA 3EVIA 3WGDA 2X64A 1K3LA 1PRXA 2FY6A 4NMUA 3P7XA 4ZB9A 4ULXA 1N8JA 3HVVA 2B7JA 4O32A 4KCAA 4KGIA 4ECIA 4N0ZA 1Z6NA 5DJMA 5C00A 5HR1A 3R2QA 2D2ZA 4WF5A 1DE1A 4PNGA 3VURA 4GSSA 4HQSA 3TJFA 1G7OA 4Q5RA 4EL1A 3CMIA 4G9HA 1AC1A 5FT3A 3IDVA 2C3QA 1X5CA 6GSUA 2EIQA 4NV2A 3GN3A 2A2RA 4TOPA 3F4TA 3QCPA 1BJXA 1TRWA 2JZRA 3FZ5A 3F6DA 3CTFA 1OC9A 2ZUPA 1M7TA 3VI5A 3APQA 3WYWA 4G2EA 2FWHA 2VL2A 1WP0A 2CX4A 2WB9A 2YJHA 2WCIA 4XTSA 4XS1A 4IP6A 5DAKB 1QXHA 1JZRA 1AQVA 1K0DA 1G6YA 3L9VA 3ZYWA 1E2YA 3HVSA 1T7PB 1MEKA 1TK8B 1QMVA 2K8VA 4BVYA 2PERA 2VAFA 5H5QA 4I6XA 1EP8A 1AAZA 6GSWA 5CAXA 1DE2A 4MF6A 4I8BA 3CSIA 2TRXA 3GTUA 2CQ9A 3H1NA 5GAND 2RLIA 1EOGA 1WMJA 1HNCA 3SWLA 1A2LA 3M1GA 3HY2A 6GSYA 5ECMB 4MK3A 4F2IA 2C0EA 1USBA 3BBYA 2A2SA 3VWXA 2RUFA 5D9VA 2AYTA 1WIKA 1MDKA 4TW5A 4JEDA 4KUNA 1EWXA 2HZFA 2ES7A 3C73A 1VF4A 2VD0A 2P0GA 4FH8A 1VF1A 3IR4A 5IIZA 2PWJA 4K2DA 5G31A 2B3SA 2K6VA 4K1FA 5A5KA 4ML1A 2HT9A 3KZQA 1XCCA 2H74A 2H6XA 2WRTA 1OC9B 2YN1A 1U88A 2L59A 3TKQA 4ZL7A 3H8QA 2F3MA 1THOA 4IJ3A 3C7MA 3D0ZA 2GSSA 3L9UA 2FWEA 2YZUA 3ZREA 1W89A 4BL7A 1YEXA 3DD3A 3WGXA 1ERVA 1ERUA 5ECLB 4HEA2 1OC3A 3O76A 4BA7A 5HFGA 4BPYA 1PMTA 3ED3A 1ZCPA 1OKDA 1K0OA 4EO3A 2JSZA 1YY7A 2HXKA 1OC8A 2C0DA 2FCHA 1XOBA 5L71A 4OWYA 2B6MA 1XFLA 1RQMA 2VLVA 4ZB6A 3A5WA 4G10A 4TKYA 2AHEA 4K7IA 4HU7A 1GSQA 1H4OA 3GTUB 1WPIA 2V32A 4AF2A 2WFCA 1OKTA 5IMCA 1U87A 1GULA 4LL1B 5G5EA 4K7OA 1ON4A 1YKCA 4N10A 3I6AA 4ZXGA 1W4VA 1SK0A 2JU5A 4GF0A 4K0NA 4TRXA 4EKZA 2NBSA 4EC0A 2GS3A 4L0WA 1JLVA 1OE7A 4WETA 2V6KA 4F03A 5DQSA 1X9MB 3RAZA 2GZPA 4GRFA 19GSA 2H75A 4EDYA 4PUFC 2V1MA 4IW9A 2OJLA 1PN9A 4PXOA 1GTAA 3QAVA 1TDIA 2OKAA 1UA5A 5IMZA 1U6TA 3A3TA 4K0GA 1R4WA 3D4TA 3TJKA 1A0RP 1Y6EA 3HVXA 3RBTA 1AUCA 2YP6A 4NHWA 4XRAA 2OE3A 3PINA 1JLWA 4F0CA 2KHPA 6GSSA 4MJAA 3LJRA 3QFAC 2DIZA 5ECQB 2GLRA 2YCDA 5A4UA 3DWVA 3IHQA 3GSTA 2MMAA 5ECPB 1PA3A 1OYJA 3W8SA 1F3BA 3KD0A 1ZOFA 2PUKC 4HJ2A 4WBRD 1Z9HA 5B8AA 3TDGA 1XXUA 3GKXA 4KDUA 5JWRB 2DLXA 2NPBA 3KM6A 5CO3A 4GXZA 3V1WA 4XIHA 2PGTA 2GDRA 2LQOA 4GLTA 1XW6A 5KN1A 2HLSA 3CYNA 4JBBA 5DCHA 5DALA 3TCOA 1M2DA 1ZYEA 4RI6A 3CTGA 9GSSA 4NV5A 3J7Yk 3DYRA 4POLA 4ML6A 1R5AA 1AW9A 4PNFA 5IM9A 1ZMAA 2PU9C 5G2ZA 4E8HA 1HNBA 1T4ZA 4EUYA 4L0UA 2MMNA 4JZQA 3GL5A 1AXDA 2GVPA 3ZVJD 2DSAA 2H71A 2MMZA 1JZDA 4POKA 5D9WA 5JWOB 2FWFA 5F0GA 1S3CA 1AQWA 1JHBA 5JWQB 4BVXA 5GSSA 3AY8A 8GSSA 3TUEA 3M3MA 5E59A 1N2AA 4HDEA 3NZNA 3Q74A 4MZWA 4MA9A 2QKEA 2CA8A 3IAM2 3PH9A 1MD4A 4YQUA 1V9WA 1SK2A 5INYA 3LQ7A 4ID0A 3DKSA 4H86A 1O85A 2YWNA 4CW9A 3ERGA 5J9BA 2R6KA 2RUEA 3RDWA 3HYPA 2CVBA 2O7KA 3H93A 4YAVA 3ISOA 1NHYA 5DALB 2XPDA 5DBQA 1ERTA 3E9JB 1PGTA 2N5BA 4X43A 2YWIA 4LMVA 4TXOA 3UEMA 3G7IA 2MZCA 4KDYA 3KMOA 1X5EA 2LRNA 1ZL9A 1ZGNA 5DJLA 4WEYA 5ECNB 5A4VA 3FRCA 2GT5A 1GH2A 4OCEA 3GX8A 1A24A 2I4AA 1U3IA 2M46A 2EIRA 1GLQA 2C0FA 3P2AA 4PUAA 4ISDA 4KCEA 4IELA 3FW2A 1AQXA 2CAIA 3C71A 1GSUA 2OADA 2OA7A 1T4YA 4FIWA 4GSTA 3DVWA 4OFTA 3CXGA 1SKSB 2EC4A 2HSYA 1A2JA 2K8SA 1EV4A 2B5XA 2WS2A 4QL9A 3S9FA 2REMA 1PSQA 4EF0A 4RQXA 1KEBA 3IAS2 1GNWA 3KIJA 1GSSA 3FKFA 1T3BA 5JCWA 3VWVA 2JL4A 4MLYA 3CBUA 3KH7A 2ON5A 1TRVA 2FLSA 2MBSA 1E6BA 4DEJA 1T00A 5CRDA 5EPFA 4BWSA 2ON7A 4O92A 2VLUA 1Z3EA 3RPPA 1O8WA 1LBKA 2YJ7A 2NVLA 3TKSA 2XBQA 4O5RA 1XBSA 1TP9A 4TXOB 1VGLA 2N5FA 1M0UA 3GFKA 4J2FA 2G0FA 4L5OA 1EGRA 1O8XA 5ID2A 1EZKA 1O6JA 2J23A 4QQ7A 2H0IA 18GSA 3UARA 5DDLA 1URMA 3LGCA 4JR6A 2YV9A 4L5LA 3H4KA 2O87A 3QPMA 4IKHA 1TJDA 3UVTA 2MBTA 2OE0A 1FAAA 2V41A 5KEJA 3QMXA 4HI7A 3IXRA 3FR9A 1A2MA 2QC7A 2HSHA 4MPGA 12GSA 3ME7A 3ZMLA 4YH2A 1WJKA 3FYGA 2BJXA 2VCVA 5DQYA 4MDCA 2FGXA 2PVQA 4PQHA 2VCTA 3PR8A 2NDOA 4OMVA 5HQPA 2JADA 2O85A 3IV4A 4FYUA 4KH7A 5IMVA 5CYYA 1DSBA 4X1UA 3ZIJA 2YV7A 4MMMA 2CZ2A 2F8FA 1B9XC 3Q19A 2H1BA 5A4WA 2C0GA 1DUGA 2KOKA 2ZCTA 1ZYQB 1B4PA 2Z9SA 3A2WA 5G1KA 4V1Ap 3US3A 3C1SA 5LD0A 4JR4A 2LJRA 1GNEA 2L6CA 2L57A 3LXTA 2H01A 4MJBA 3P90A 1GUMA 4KX4A 2RIIA 2L4CA 2A4VA 4Q5NA 6GSTA 4TR1A 2C3NA 2X8GA 3GKNA 4IHUA 2BMXA 1BYEA 1DBYA 1GUKA 3U6VA 5AISA 2PVOC 5AGYA 5C04A 3UL3A 5B6NA 2LUSA 5JCGA 1G6WA 4KSMA 4KNDA 3TRQA 1XOAA 4KAEA 1R5PA 3F0IA 3HKRA 1NM3A 2YANA 3C1RA 2HZEA 2C1YA 2LRCA 2IMFA 3KP8A 2R4VA 1MDIA 3HJMA 1QK8A 5IMAA 1J08A 2VIMA 1X9WB 3D22A 1F37A 5CRWA 3EMXA 4TVEA 1R7HA 4NWYA 1JFUA 3KGKA 1XVQA 3ZMKA 2WZ9A 4AJ8A 1H75A 2HRFA 2DJ3A 4JE1A 2H6YA 1TOFA 3EMPA 4TN8A 1ERWA 3EURA 1XW9A 3TKSC 1FO5A 2VLTA 3HZ8A 2LNSA 4MH3A 2L4QA 4TR1B 3DEXA 3HJPA 3WT2A 2CX3A 4MCUA 2H30A 3I43A 2FA4A 1BEDA 2E7PA 1NSWA 1K0NA 4IN0A 4V2MA 1KBNA 3EE2A 4GSNA 5HR3A 3GKMA 3KH9A 2JZTA 1M99A 1OAZA 22GSA 1CQGA 2C4JA 3O3TA 2H73A 2VL3A 2IMDA 2IWTA 2VM1A 1PL2A 2RM5A 1M2AA 3M9JA 1YDKA 2RM6A 2HZEB 1GLPA 1MD3A 3KTBA 5CREA 2N5AA 1ML6A 5AIXA 2P5RA 2VOCA 4KA0A 1TU7A 1EEMA 1XWCA 4ZIJA 2FUG2 1M2BA 3N5OA 3GUSA 1O73A 2QSIA 5D73A 3ZIVA 4E8EA 2IN3A 4TR3A 3FK8A 3L0HA 1T8EB 4POMA 2IJYA 5ECHB 1KTEA 5GSTA 4ZBDA 1LJRA 3VPTA 1SKRB 1A8YA 1I5GA 2H6ZA 4LMWA 5G1LA 4IVFA 3M0FA 2DJKA 3GL3A 4KE3A 1XW5A 6GSVA 1LU4A 5ECKB 1WWJA 1FVJA 2K18A 1SU9A 2VL9A 1TRSA 2XBIA 1VF3A 1BG5A 4DSQA 3FZAA 2DJ1A 2DMMA 1GTUA 1Z7PA 1U3AA 2B5YA 3HJOA 3K8NA 3D5JA 1SD9A 4AGSA 1THXA 1GRXA 1YEPA 3QOUA 3BD2A 3IC4A 3ERFA 5GAPD 4IGJA 3FR6A 3HD5A 4N30A 4V2NA 1PX7A 5CP1A 2FD3A 3MDKA 3IK9A 20GSA 4OO4A 3TOTA 4MPFA 5ELAA 2H0GA 3HXSA 2FWGA 2LEGA 2I9HA 3L78A 1PL1A 3ZLPA 1TRUA 5B8BA 1EEJA 2I1UA 4HU9A 3G9BA 2F8AA 1GSFA 1QQ2A 1FOVA 3LEFA 4OFMA 4EVMA 5D9TA 5JCUA 1GSYA 4ZBBA 3W8JA 4TXVA 4O7HA 1X0RA 3UAPA 2R5GA 2LKUA 3KMNA 4ECBA 3ZFBA 5J41A 1YKAA 4WR5A 4HZ4A 4AJ6A 5CRGA 2GZYA 3DIEA 1V58A 4L8EA 1SYXA 2YNXA 4IP1A 5F8BA 4J57E 1BAYA 3GNJA 2HFDA 2YWMA 5D93A 3EC3A 1PD21 2M80A 5D8IA 2DJ0A 3MWHA 5H5SA 3WGEA 2IMKA 5CRHA 1XIYA 2OBKA 3HHVA 3F63A 1XWBA 4P3YB 2YPMA 2YZHA 1F3AA 3HCZA 5IOWA 2VUPA 3TRXA 1AIUA 1GTBA 2E2GA 5ECRB 3IRAA 2F51A 1A8LA 13GSA 3LXZA 2JACA 4PURA 2ALBA 3UBKA 3WT1A 3D21A 2GQKA 2G2QA 4EDZA 1SL1B 3UVHA 1V98A 1HNAA 1S3AA 1TTZA 4KW6A 1M9AA 1RW1A 1XVWA 4LA1A 4MZBA 1JZWA 1ZZYA 5DVBA 2IMEA 3KXOA 4I2UA 3H79A 2DJ2A 3FEUA 3BCKA 1EGOA 2K9FA 2OBIA 1F2EA 1F9MA 3ERWA 4DVCA 4Q5QA 2FNOA 4DSRA 1FB0A 5J4UA 3F6FA 3TRPA 4EXJA 3TJBA 4Z7XA 1VRSD 3DGQA 4F82A 3NOFA 3ZTLA 1K0AA 1JZOA 5B7CA 1SJZA 5ABRA 4NAXA 3KTLA 1SKWB 4IQAA 5LCZA 1UN2A 3TJGA 4BWQA 4FYBA 2X8CA 1FG4A 5EVOA 14GSA 4I97A 1VF2A 4V2LA 5D96A 2GQMA 5AIVA 4TR4A 3IA1A 3ZFLA 3G7YA 3VI7A 3QFBC 2JZSA 11GSA 2C8UA 4FYCA 1YF1A 4K7NA 2GQLA 1QFNA 2H66A 3IBHA 1B4QA 1PX6A 1Z7RA 4OD7A 2CV4A 3F3QA 4ACSA 2HYXA 4YQVA 1SD8A 4XHMA 4PGTA 4IS0A 2H8LA 4MJEA 2XHFA 2GGTA 2X99A 1GSEA 4JRRA 4WR4A 2CVKA 1YZXA 1YQ1A 5LNKe 7GSSA 5EL8A 2I81A 3QAGA 4NHZA 1NHOA 2O8VB 2HE3A 3GIXA 3VWWA 1GL8A 3D6IA 2IL3A 3U5RE 4ZB8A 1Z6MA 5IO2A 2H72A 2YWOA 5E4WA 1XZOA 2H70A 2AJQB 3GURA 2DBCA 1C72A 3MNGA 3UBLA 1FHEA 5F06A 2H1DA 2AAWA 5IPHA 10GSA 2H1AA 3GH6A 1FW1A 2DC5A 2WULA 2EIOA 2L5OA 5ECIB 1YF0A 3RHCA 1Q98A 2VCQA 1UVZA 1O7UA 4ZL8A 2L5LA 2I3YA 3W6GA 1TXXA 5ID2B 4GCIA 1TK5B 4G19A 4QL7A 2VD1A 2KP1A 3HA9A 2LV3A 2JSYA 2NTOA 3ZRDA 2E0QA 3RPNA 2LJAA 4NPBA 1MDJA 5EY6A 3TJJA 1GP1A 2H76A 4D73A 1QGVA 3IK7A 3KEBA 3TKRA
chains in the Genus database with same CATH superfamily
2GTUA 2IPAA 3BOAA 5FWGA 1Y25A 4TR0A 3GX0A 1X5DA 1SL2B 4GTUA 5CNWA 4YAPA 3NIVA 3GHAA 4MABA 2PMTA 2VCXA 16GSA 3EU4A 4AJ7A 3DXBA 2HI7A 5FHIA 4XS4A 2VCZA 2XPEA 1FVKA 5J9CA 1WRYA 2LJKA 3LFLA 1ZYPA 2H0HA 4WKWA 3F9UA 4GQCA 1NW2A 2E2MA 3M9KA 4MZCA 3N9JA 3GH9A 4GQFA 1HYUA 4XRDA 5F05A 2FHEA 2TIRA 1CQHA 2LSTA 4J56E 1M9BA 2KUCA 5J5NA 1TI1A 3ZITA 1TKDB 2R3XA 2VO4A 3D4MA 3GRXA 4WBJA 1EV9A 2GZZA 5F07A 3EU3A 5GZZB 3RHBA 1PQNA 2VCWA 2IIYA 3TKSE 1X9SB 3GMFA 2ZNMA 3FZ4A 3Q6OA 4WF4A 4IQ1A 1HD2A 1T1VA 2WJUA 4D73B 2AB6A 2B7KA 3GV1A 4EE0A 3FHKA 3O6TA 5ELGA 5KN0A 3E3EA 1ABAA 5D9XA 2FA8A 1Z5YE 3P8WA 5KN2A 2GSQA 3APOA 1GSDA 3GSSA 1GUHA 1XWKA 3CRUA 3QAWA 4F9ZA 2PPTA 2IFQA 5IMDA 1MTCA 1G0TA 3CRTA 3F8UA 4G0IA 3EWLA 4XS4B 1V40A 5HFIA 3UIWA 2X8HA 1IYHA 4G0KA 2LTKA 1SL0B 1EP7A 3F4SA 3VK9A 1QUWA 1TU8A 4HS1A 3I9V2 3VFIA 1GWCA 2IMIA 2AV4A 3DRNA 4K8MA 2QGVA 2WDUA 3BJ5A 1J9BA 2V6OA 4KDXA 2VL2C 3GYKA 2L6DA 1S3DA 2GSRA 5G30A 4MH2A 3GA4A 3IE3A 1O81A 2PBJA 2VM2A 5HFKA 2XC2A 4O5QA 2V2GA 1XWGA 4V1Ag 4EIPA 4LLRA 3LYPA 4HSCX 3HZ4A 3VLNA 17GSA 3KCMA 3C8EA 2HRNA 5DCGA 1V57A 3BCIA 4GWRA 4PTSA 4N11A 2TRCP 3HDCA 3ME8A 3UMAA 5IQYA 4K9ZA 3L4NA 3ZVJA 4WXTA 1OE8A 4ECCA 1RK4A 3QR6A 3LSZA 4LL4B 3GKKA 4ILFA 4RQRA 2WGRA 2CZ3A 3A2VA 1R26A 4HJMA 3HVNA 3EINA 4OFNA 4PX1A 2IFQB 1K3OA 1HQOA 2CT6A 3TOUA 2F9SA 4ZILA 2KP2A 3QDNA 3WD6A 6GSXA 4K6XA 1TI3A 1Q4JA 2O89A 3KJYA 3M8NA 5B6MA 4XCSA 4HZ2A 1XPVA 4DSSA 1FB6A 1SJ6A 2MYGA 2HNLA 3EPTA 4HQZA 3LW9A 2B5EA 2GT6A 2PN8A 1UC7A 3KP9A 2H19A 3FZ9A 3IPZA 4FO5A 4IJIA 2C3TA 3MSZA 5J3RA 3PGTA 5G5FA 4ECJA 4PQIA 1WE0A 5COHA 5IOXA 3JCML 2MMOA 4X0XA 1GTIA 1KNGA 1V2AA 2BTOT 4ZBAA 4CHSA 1I9DA 2CAQA 1OVNA 5IO0A 4KB3A 1K0MA 2M72A 4HUAA 4I2TA 5HR2A 1J0FA 1EOHA 1ACVA 4YKFA 4YQMA 1XWAA 2P31A 1ILOA 1ST9A 3MAKA 1WOUA 1BQ7A 2GSTA 4JU5A 3TB2A 5AN1A 2R37A 3CSJA 2C80A 3A2XA 2LS5A 1SYRA 5KN3A 4IBPA 3Q18A 2LRTA 2DIYA 4CDOA 3VPQA 4F0BA 3G7JA 3UJ1A 2R0CA 1B9YC 4MF5A 3QD9A 4ZL9A 1PKZA 3OR5A 1PKWA 4RI7A 3F4RA 3LYKA 4OCFA 2J9HA 2YOIA 2KLXA 4PQ1A 1SJIA 1K0BA 3LORA 4NXIA 1TW9A 3E0UA 3EYTA 3I69A 1SK1A 3TKPA 2LNTA 1ZYNA 2B1LA 3FY7A 4DSSB 2OACA 3CSHA 1SENA 5HR0A 3APSA 3J7Yb 5IMFA 2DMLA 4I5QA 4XS6A 2OE1A 2AUVA 4POBA 3VWUA 2B1KA 5ECOB 4KSOA 1TK0B 4Q5FA 3F3RA 3ZZXA 3FR3A 3DMLA 1BX9A 1K0CA 1F6MC 3ZL5A 4X4JA 3TGZA 5ECSA 4N0VA 3L9SA 1K3YA 1B48A 3LWAA 2H1GA 1A23A 4MF7A 5H5RA 4HOJA 5DAKA 3UOMA 1A0FA 2LQQA 5IPGA 4MP4A 2P5QA 3SBCA 2R2JA 3DVXA 3LG6A 4RUVA 1YJ6A 1G7EA 4OO5A 4MJCA 1B8XA 1IYIA 5ENUA 2DJJA 2CVDA 3IOSA 3EVIA 3WGDA 2X64A 1K3LA 1PRXA 2FY6A 4NMUA 3P7XA 4ZB9A 4ULXA 1N8JA 3HVVA 2B7JA 4O32A 4KCAA 4KGIA 4ECIA 4N0ZA 1Z6NA 5DJMA 5C00A 1M3IA 5HR1A 3R2QA 2D2ZA 4WF5A 1DE1A 4PNGA 3VURA 2R0GA 4GSSA 4HQSA 3TJFA 1G7OA 4Q5RA 4EL1A 3CMIA 4G9HA 1AC1A 5FT3A 3IDVA 2C3QA 1X5CA 4Z2RA 6GSUA 2EIQA 4NV2A 3GN3A 2A2RA 4TOPA 3F4TA 3QCPA 1BJXA 1TRWA 2JZRA 3FZ5A 3F6DA 3CTFA 1OC9A 2ZUPA 1M7TA 3VI5A 3APQA 3WYWA 4G2EA 2FWHA 2VL2A 1WP0A 2CX4A 2WB9A 2YJHA 2WCIA 4XTSA 4XS1A 4IP6A 5DAKB 1QXHA 1JZRA 1AQVA 1K0DA 1G6YA 3L9VA 3ZYWA 1E2YA 3HVSA 1T7PB 1MEKA 1TK8B 1QMVA 2K8VA 4BVYA 2PERA 2VAFA 5H5QA 4I6XA 1EP8A 1AAZA 6GSWA 5CAXA 1DE2A 4MF6A 4I8BA 3CSIA 2TRXA 3GTUA 2CQ9A 3H1NA 5GAND 2RLIA 1EOGA 1WMJA 1HNCA 3SWLA 1A2LA 3M1GA 3HY2A 6GSYA 5ECMB 4MK3A 4F2IA 2C0EA 1USBA 3BBYA 2A2SA 3VWXA 2RUFA 5D9VA 2AYTA 1WIKA 1MDKA 4TW5A 4JEDA 4KUNA 1EWXA 2HZFA 2ES7A 3C73A 1VF4A 2VD0A 2P0GA 4FH8A 3MYDA 1VF1A 3IR4A 5IIZA 2PWJA 4K2DA 5G31A 2B3SA 2K6VA 4K1FA 5A5KA 4ML1A 2HT9A 3KZQA 1XCCA 2H74A 5KOWA 2H6XA 2WRTA 1OC9B 2YN1A 1U88A 2L59A 3TKQA 4ZL7A 3H8QA 2F3MA 1THOA 4IJ3A 3C7MA 3D0ZA 2GSSA 3L9UA 2FWEA 2YZUA 3ZREA 1W89A 4BL7A 1YEXA 3DD3A 3WGXA 1ERVA 1ERUA 5ECLB 4HEA2 4ICYA 1OC3A 3O76A 4BA7A 5HFGA 4BPYA 4Z2TA 1PMTA 3ED3A 1ZCPA 1OKDA 1K0OA 4EO3A 2JSZA 1YY7A 2HXKA 1OC8A 2C0DA 2FCHA 2UZ8A 1XOBA 5L71A 4OWYA 2B6MA 2A2PA 4BVYB 1XFLA 1RQMA 2VLVA 4ZB6A 3A5WA 4G10A 4TKYA 2AHEA 4K7IA 4HU7A 1GSQA 1H4OA 3GTUB 1WPIA 2V32A 4AF2A 2WFCA 1OKTA 5IMCA 1U87A 1GULA 4LL1B 5G5EA 4K7OA 1ON4A 1YKCA 4N10A 3I6AA 4ZXGA 1W4VA 1SK0A 2JU5A 4GF0A 4USSA 4K0NA 4TRXA 2HRKA 4YKGA 4EKZA 2NBSA 4EC0A 2GS3A 4L0WA 1JLVA 1OE7A 4WETA 2V6KA 4F03A 5DQSA 1X9MB 3RAZA 2GZPA 4GRFA 19GSA 2H75A 4EDYA 4PUFC 2V1MA 4IW9A 2OJLA 3PPUA 1PN9A 4PXOA 1GTAA 3QAVA 1TDIA 2OKAA 1UA5A 5IMZA 1U6TA 3A3TA 4K0GA 1R4WA 3D4TA 3TJKA 4O5UA 1A0RP 1Y6EA 3HVXA 3RBTA 2R0PA 1AUCA 2YP6A 4NHWA 4XRAA 2OE3A 3PINA 1JLWA 4F0CA 2KHPA 3IC8A 6GSSA 4MJAA 3LJRA 3QFAC 2DIZA 5ECQB 2GLRA 2YCDA 5A4UA 3DWVA 3IHQA 3GSTA 2MMAA 5ECPB 1PA3A 1OYJA 3W8SA 4K5RA 1F3BA 3KD0A 1ZOFA 2PUKC 4HJ2A 4WBRD 1Z9HA 5B8AA 3TDGA 1XXUA 3GKXA 4KDUA 5JWRB 2DLXA 2NPBA 3KM6A 5CO3A 4GXZA 3V1WA 4XIHA 2PGTA 2GDRA 2LQOA 4GLTA 1XW6A 5KN1A 2HLSA 3CYNA 4JBBA 5DCHA 5DALA 2QA2A 3TCOA 1M2DA 1ZYEA 2X4AA 4RI6A 3CTGA 9GSSA 4NV5A 3J7Yk 3DYRA 4POLA 4ML6A 1R5AA 1AW9A 4PNFA 5IM9A 1ZMAA 2PU9C 5G2ZA 4E8HA 1HNBA 1T4ZA 4EUYA 4L0UA 2MMNA 4JZQA 1PN0A 3GL5A 1AXDA 2GVPA 3ZVJD 2DSAA 2H71A 2MMZA 1JZDA 4POKA 5D9WA 5JWOB 2FWFA 5F0GA 1S3CA 4K2XA 1AQWA 1JHBA 5JWQB 4BVXA 5GSSA 3AY8A 8GSSA 1FOHA 3TUEA 3M3MA 5E59A 1XG8A 1N2AA 4CY6A 4HDEA 3NZNA 3Q74A 4MZWA 4MA9A 2QKEA 2CA8A 3IAM2 3PH9A 1MD4A 4YQUA 1V9WA 1SK2A 5INYA 3LQ7A 4ID0A 3DKSA 4H86A 1O85A 2YWNA 4CW9A 3ERGA 5J9BA 2R6KA 2RUEA 3RDWA 3HYPA 2CVBA 2O7KA 3H93A 4YAVA 3ISOA 1NHYA 5DALB 2XPDA 5DBQA 1ERTA 3E9JB 1PGTA 2N5BA 4X43A 2YWIA 4LMVA 4TXOA 3UEMA 3G7IA 2MZCA 4KDYA 3KMOA 4MNNA 1X5EA 2LRNA 1ZL9A 1ZGNA 5DJLA 4WEYA 5ECNB 5A4VA 3FRCA 2GT5A 1GH2A 4OCEA 3GX8A 1A24A 2I4AA 1U3IA 2M46A 2EIRA 1GLQA 2C0FA 3P2AA 4PUAA 4ISDA 4KCEA 4IELA 3FW2A 1AQXA 2CAIA 3C71A 1GSUA 2OADA 4BVXB 2OA7A 1T4YA 4FIWA 4GSTA 3DVWA 4OFTA 4A5PA 3CXGA 1SKSB 2EC4A 2HSYA 1A2JA 2K8SA 1EV4A 2B5XA 2WS2A 4QL9A 3S9FA 2REMA 1PSQA 4EF0A 4RQXA 1KEBA 3IAS2 1GNWA 3KIJA 4BIKA 1GSSA 3FKFA 1T3BA 5JCWA 3VWVA 2JL4A 4MLYA 3CBUA 3KH7A 2ON5A 1TRVA 2FLSA 2MBSA 1E6BA 4DEJA 1T00A 5CRDA 5EPFA 4BWSA 2ON7A 4O92A 2VLUA 1Z3EA 3RPPA 1O8WA 1LBKA 2YJ7A 2NVLA 3TKSA 2XBQA 4O5RA 1XBSA 1TP9A 4TXOB 1VGLA 2N5FA 1M0UA 3GFKA 4J2FA 2G0FA 4L5OA 1EGRA 1O8XA 5ID2A 1EZKA 1O6JA 2J23A 4QQ7A 2H0IA 18GSA 2QA1A 3A5IA 4FQUA 3UARA 5DDLA 1URMA 3LGCA 4JR6A 2YV9A 4L5LA 3H4KA 2O87A 3QPMA 4IKHA 1TJDA 3UVTA 2MBTA 2OE0A 1FAAA 2V41A 5KEJA 3QMXA 4HI7A 3IXRA 3FR9A 1A2MA 2QC7A 2HSHA 4MPGA 12GSA 3ME7A 3ZMLA 4YH2A 1WJKA 3FYGA 2BJXA 2VCVA 5DQYA 4MDCA 2FGXA 2PVQA 4PQHA 2VCTA 3PR8A 2NDOA 4OMVA 5HQPA 2JADA 2O85A 3IV4A 4FYUA 4KH7A 5IMVA 5CYYA 1DSBA 4X1UA 3ZIJA 2YV7A 4MMMA 2CZ2A 2F8FA 1B9XC 3Q19A 2H1BA 5A4WA 2C0GA 1DUGA 2KOKA 2ZCTA 1ZYQB 1B4PA 2Z9SA 3A2WA 5G1KA 4V1Ap 3US3A 3C1SA 5LD0A 4JR4A 2LJRA 4G0LA 1GNEA 2L6CA 2L57A 3LXTA 4CY8A 2H01A 4MJBA 3P90A 1GUMA 4KX4A 2RIIA 2L4CA 2A4VA 4Q5NA 6GSTA 4TR1A 2C3NA 2X8GA 3GKNA 4IHUA 2BMXA 1BYEA 1DBYA 1GUKA 3U6VA 5AISA 2PVOC 5AGYA 5C04A 3UL3A 5B6NA 2LUSA 5JCGA 3R3EA 1G6WA 4KSMA 4KNDA 3TRQA 1XOAA 4KAEA 1R5PA 3F0IA 3HKRA 1NM3A 2YANA 3C1RA 2HZEA 2C1YA 2LRCA 2IMFA 3KP8A 2R4VA 1MDIA 3HJMA 1QK8A 5IMAA 1J08A 2HSMA 5BRTA 2VIMA 1X9WB 3D22A 1F37A 5CRWA 3EMXA 4TVEA 1R7HA 4NWYA 1JFUA 3KGKA 3IHGA 1XVQA 3ZMKA 2WZ9A 4AJ8A 1H75A 2HRFA 2DJ3A 4JE1A 2H6YA 1TOFA 3EMPA 4TN8A 1ERWA 3EURA 1XW9A 3TKSC 1FO5A 2VLTA 3HZ8A 2LNSA 4MH3A 2L4QA 4TR1B 3DEXA 3HJPA 3WT2A 2CX3A 4MCUA 2H30A 3I43A 2FA4A 1BEDA 2E7PA 3FMWA 1NSWA 1K0NA 4IN0A 4V2MA 1KBNA 3EE2A 4GSNA 5HR3A 3GKMA 3KH9A 2JZTA 1M99A 1OAZA 22GSA 1CQGA 2C4JA 3O3TA 2H73A 2VL3A 2IMDA 2IWTA 2VM1A 1PL2A 2RM5A 1M2AA 4BL7B 3M9JA 1YDKA 2RM6A 2HZEB 1GLPA 1MD3A 3KTBA 5CREA 2N5AA 1ML6A 5AIXA 2P5RA 2VOCA 4KA0A 4EIQA 1TU7A 1EEMA 1XWCA 4ZIJA 2FUG2 1M2BA 3N5OA 3GUSA 1O73A 2QSIA 5D73A 3ZIVA 3MIXA 4E8EA 2IN3A 4TR3A 3FK8A 3L0HA 1T8EB 4POMA 2IJYA 1PFOA 5ECHB 1KTEA 5GSTA 4ZBDA 1LJRA 3VPTA 1SKRB 1A8YA 1I5GA 2H6ZA 4LMWA 5G1LA 4IVFA 3M0FA 2DJKA 3GL3A 4KE3A 1XW5A 6GSVA 1LU4A 5ECKB 1WWJA 1FVJA 2K18A 1SU9A 2VL9A 1TRSA 2XBIA 1VF3A 1BG5A 4DSQA 3FZAA 2DJ1A 2DMMA 1GTUA 1S3RA 1Z7PA 3CQFA 1U3AA 2B5YA 3HJOA 3K8NA 3D5JA 1SD9A 4AGSA 1THXA 1GRXA 1YEPA 3QOUA 3BD2A 3IC4A 2DKIA 3ERFA 5GAPD 4IGJA 3FR6A 3HD5A 4N30A 4V2NA 1PX7A 5CP1A 2FD3A 3MDKA 3IK9A 20GSA 4OO4A 3TOTA 4MPFA 5ELAA 2H0GA 3HXSA 2FWGA 2LEGA 2I9HA 3L78A 1PL1A 3ZLPA 1TRUA 5B8BA 1EEJA 2I1UA 4HU9A 3G9BA 2F8AA 1GSFA 1QQ2A 1FOVA 3LEFA 4OFMA 4EVMA 5D9TA 5JCUA 1GSYA 4ZBBA 3W8JA 4TXVA 4O7HA 1X0RA 3UAPA 2R5GA 2LKUA 3KMNA 4ECBA 3ZFBA 5J41A 1YKAA 4WR5A 4HZ4A 4AJ6A 5CRGA 2GZYA 3DIEA 1V58A 4L8EA 1SYXA 2YNXA 4IP1A 5F8BA 4J57E 1BAYA 5KOXA 3GNJA 2HFDA 2YWMA 5D93A 3EC3A 1PD21 2M80A 5D8IA 2DJ0A 3MWHA 5H5SA 3WGEA 2IMKA 5CRHA 1XIYA 2OBKA 3HHVA 3F63A 1XWBA 5BMUA 4P3YB 2YPMA 2YZHA 1F3AA 3HCZA 5IOWA 2VUPA 3TRXA 1AIUA 1GTBA 2E2GA 5ECRB 3IRAA 2F51A 1A8LA 13GSA 3LXZA 2HRAA 2JACA 4PURA 2ALBA 3UBKA 3WT1A 3D21A 2GQKA 2G2QA 4EDZA 1SL1B 3UVHA 1V98A 1HNAA 1S3AA 1TTZA 4KW6A 1M9AA 1RW1A 1XVWA 4LA1A 4MZBA 1JZWA 1ZZYA 5DVBA 2IMEA 3KXOA 4I2UA 3H79A 2DJ2A 3FEUA 3BCKA 1EGOA 2K9FA 4KF9A 2OBIA 1F2EA 1F9MA 3ERWA 4DVCA 4Q5QA 2FNOA 4DSRA 1FB0A 2A4HA 5J4UA 3F6FA 3TRPA 4EXJA 3TJBA 4Z7XA 1VRSD 3DGQA 4F82A 3NOFA 3ZTLA 1K0AA 1JZOA 5B7CA 4K5SA 1SJZA 5ABRA 4NAXA 3KTLA 1SKWB 4IQAA 5LCZA 1UN2A 3TJGA 4BWQA 4FYBA 2X8CA 1FG4A 5EVOA 14GSA 4I97A 1VF2A 4V2LA 5D96A 2GQMA 5AIVA 4TR4A 3IA1A 3ZFLA 3G7YA 3VI7A 3QFBC 2JZSA 11GSA 2C8UA 4FYCA 1YF1A 4K7NA 2GQLA 1QFNA 2H66A 1M3JA 3IBHA 1B4QA 1PX6A 1Z7RA 4OD7A 2CV4A 3F3QA 4ACSA 2HYXA 4YQVA 1SD8A 4XHMA 4PGTA 4IS0A 2H8LA 4MJEA 2XHFA 2GGTA 2X99A 1GSEA 4JRRA 4WR4A 2CVKA 1YZXA 1YQ1A 5LNKe 7GSSA 5EL8A 2I81A 3QAGA 4NHZA 1NHOA 2O8VB 2HE3A 3GIXA 3VWWA 1GL8A 3D6IA 2IL3A 3U5RE 4ZB8A 1Z6MA 5IO2A 2H72A 2YWOA 5E4WA 1XZOA 2H70A 2AJQB 3GURA 2DBCA 1C72A 3MNGA 3UBLA 1FHEA 5F06A 2H1DA 2AAWA 5IPHA 10GSA 2H1AA 3GH6A 1FW1A 2DC5A 2WULA 2EIOA 2L5OA 5ECIB 1YF0A 3RHCA 1Q98A 2VCQA 1UVZA 1O7UA 4ZL8A 2L5LA 2I3YA 3W6GA 1TXXA 5ID2B 4GCIA 4Z2UA 1TK5B 2X49A 4G19A 4QL7A 2VD1A 2KP1A 3HA9A 2LV3A 2JSYA 2NTOA 3ZRDA 2E0QA 3RPNA 2LJAA 4NPBA 1MDJA 5EY6A 2DKHA 3TJJA 1GP1A 2H76A 4D73A 1QGVA 3IK7A 3KEBA 3TKRA
chains in the Genus database with same CATH topology
2GTUA 2IPAA 3BOAA 5FWGA 1Y25A 4TR0A 3GX0A 1X5DA 1SL2B 4GTUA 5CNWA 4YAPA 3NIVA 3GHAA 4MABA 2PMTA 2VCXA 16GSA 3EU4A 4AJ7A 3DXBA 2HI7A 5FHIA 4XS4A 2VCZA 2XPEA 1FVKA 5J9CA 1WRYA 2LJKA 3LFLA 1ZYPA 2H0HA 4WKWA 3F9UA 4GQCA 1NW2A 2E2MA 3M9KA 4MZCA 3N9JA 3GH9A 4GQFA 1HYUA 4XRDA 5F05A 2FHEA 2TIRA 1CQHA 2LSTA 4J56E 1M9BA 2KUCA 5J5NA 1TI1A 3ZITA 1TKDB 2R3XA 2VO4A 3D4MA 3GRXA 4WBJA 1EV9A 2GZZA 5F07A 3EU3A 5GZZB 3RHBA 1PQNA 2VCWA 2IIYA 3TKSE 1X9SB 3GMFA 2ZNMA 3FZ4A 3Q6OA 4WF4A 4IQ1A 1HD2A 1T1VA 2WJUA 4D73B 2AB6A 2B7KA 3GV1A 4EE0A 3FHKA 3O6TA 5ELGA 5KN0A 3E3EA 1ABAA 5D9XA 2FA8A 1Z5YE 3P8WA 5KN2A 2GSQA 3APOA 1GSDA 3GSSA 1GUHA 1XWKA 3CRUA 3QAWA 4F9ZA 2PPTA 2IFQA 5IMDA 1MTCA 1G0TA 3CRTA 3F8UA 4G0IA 3EWLA 4XS4B 1V40A 5HFIA 3UIWA 2X8HA 1IYHA 4G0KA 2LTKA 1SL0B 1EP7A 3F4SA 3VK9A 1QUWA 1TU8A 4HS1A 3I9V2 3VFIA 1GWCA 2IMIA 2AV4A 3DRNA 4K8MA 2QGVA 2WDUA 3BJ5A 1J9BA 2V6OA 4KDXA 2VL2C 3GYKA 2L6DA 1S3DA 2GSRA 5G30A 4MH2A 3GA4A 3IE3A 1O81A 2PBJA 2VM2A 5HFKA 2XC2A 4O5QA 2V2GA 1XWGA 4V1Ag 4EIPA 4LLRA 3LYPA 3HZ4A 3VLNA 17GSA 3KCMA 3C8EA 2HRNA 5DCGA 1V57A 3BCIA 4GWRA 4PTSA 4N11A 2TRCP 3HDCA 3ME8A 3UMAA 5IQYA 4K9ZA 3L4NA 3ZVJA 4WXTA 1OE8A 4ECCA 1RK4A 3QR6A 3LSZA 4LL4B 3GKKA 4ILFA 4RQRA 2WGRA 2CZ3A 1R26A 3A2VA 4HJMA 3EINA 4OFNA 4PX1A 2IFQB 1K3OA 1HQOA 2CT6A 3TOUA 2F9SA 4ZILA 2KP2A 3QDNA 3WD6A 6GSXA 4K6XA 1TI3A 1Q4JA 2O89A 3KJYA 3M8NA 5B6MA 4XCSA 4HZ2A 1XPVA 4DSSA 1FB6A 1SJ6A 2MYGA 2HNLA 3EPTA 4HQZA 3LW9A 2B5EA 2GT6A 2PN8A 1UC7A 3KP9A 2H19A 3FZ9A 3IPZA 4FO5A 4IJIA 2C3TA 3MSZA 5J3RA 3PGTA 5G5FA 4ECJA 4PQIA 1WE0A 5COHA 5IOXA 3JCML 2MMOA 4X0XA 1GTIA 1KNGA 1V2AA 2BTOT 4ZBAA 4CHSA 1I9DA 2CAQA 1OVNA 5IO0A 4KB3A 1K0MA 2M72A 4HUAA 4I2TA 5HR2A 1J0FA 1EOHA 1ACVA 4YKFA 4YQMA 1XWAA 2P31A 1ILOA 1ST9A 3MAKA 1WOUA 1BQ7A 2GSTA 4JU5A 3TB2A 5AN1A 2R37A 3CSJA 2C80A 3A2XA 2LS5A 1SYRA 5KN3A 4IBPA 3Q18A 2LRTA 2DIYA 4CDOA 3VPQA 4F0BA 3G7JA 3UJ1A 2R0CA 1B9YC 4MF5A 3QD9A 4ZL9A 1PKZA 3OR5A 1PKWA 4RI7A 3F4RA 3LYKA 4OCFA 2J9HA 2YOIA 2KLXA 4PQ1A 1SJIA 1K0BA 3LORA 4NXIA 1TW9A 3E0UA 3EYTA 3I69A 1SK1A 3TKPA 2LNTA 1ZYNA 2B1LA 3FY7A 4DSSB 2OACA 3CSHA 1SENA 5HR0A 3APSA 3J7Yb 5IMFA 2DMLA 4I5QA 4XS6A 2OE1A 2AUVA 4POBA 3VWUA 2B1KA 5ECOB 4KSOA 1TK0B 4Q5FA 3F3RA 3ZZXA 3FR3A 3DMLA 1BX9A 1K0CA 1F6MC 3ZL5A 4X4JA 3TGZA 5ECSA 4N0VA 3L9SA 1K3YA 1B48A 3LWAA 2H1GA 1A23A 4MF7A 5H5RA 4HOJA 5DAKA 3UOMA 1A0FA 2LQQA 5IPGA 4MP4A 2P5QA 3SBCA 2R2JA 3DVXA 3LG6A 4RUVA 1YJ6A 1G7EA 4OO5A 4MJCA 1B8XA 1IYIA 5ENUA 2DJJA 2CVDA 3IOSA 3EVIA 3WGDA 2X64A 1K3LA 1PRXA 2FY6A 4NMUA 3P7XA 4ZB9A 4ULXA 1N8JA 3HVVA 2B7JA 4O32A 4KCAA 4KGIA 4ECIA 4N0ZA 1Z6NA 5DJMA 5C00A 5HR1A 3R2QA 2D2ZA 4WF5A 1DE1A 4PNGA 3VURA 2R0GA 4GSSA 4HQSA 3TJFA 1G7OA 4Q5RA 4EL1A 3CMIA 4G9HA 1AC1A 5FT3A 3IDVA 2C3QA 1X5CA 4Z2RA 6GSUA 2EIQA 4NV2A 3GN3A 2A2RA 4TOPA 3F4TA 3QCPA 1BJXA 1TRWA 2JZRA 3FZ5A 3F6DA 3CTFA 1OC9A 2ZUPA 1M7TA 3VI5A 3APQA 3WYWA 4G2EA 2FWHA 2VL2A 1WP0A 2CX4A 2WB9A 2YJHA 2WCIA 4XTSA 4XS1A 4IP6A 5DAKB 1QXHA 1JZRA 1AQVA 1K0DA 1G6YA 3L9VA 3ZYWA 1E2YA 3HVSA 1T7PB 1MEKA 1TK8B 1QMVA 2K8VA 4BVYA 2PERA 2VAFA 5H5QA 4I6XA 1EP8A 1AAZA 6GSWA 5CAXA 1DE2A 4MF6A 4I8BA 3CSIA 2TRXA 3GTUA 2CQ9A 3H1NA 5GAND 2RLIA 1EOGA 1WMJA 1HNCA 3SWLA 1A2LA 3M1GA 3HY2A 6GSYA 5ECMB 4MK3A 4F2IA 2C0EA 1USBA 3BBYA 2A2SA 3VWXA 2RUFA 5D9VA 2AYTA 1WIKA 1MDKA 4TW5A 4JEDA 4KUNA 1EWXA 2HZFA 2ES7A 3C73A 1VF4A 2VD0A 2P0GA 4FH8A 3MYDA 1VF1A 3IR4A 5IIZA 2PWJA 4K2DA 5G31A 2B3SA 2K6VA 4K1FA 5A5KA 4ML1A 2HT9A 3KZQA 1XCCA 2H74A 5KOWA 2H6XA 2WRTA 1OC9B 2YN1A 1U88A 2L59A 3TKQA 4ZL7A 3H8QA 2F3MA 1THOA 4IJ3A 3C7MA 3D0ZA 2GSSA 3L9UA 2FWEA 2YZUA 3ZREA 1W89A 4BL7A 1YEXA 3DD3A 3WGXA 1ERVA 1ERUA 5ECLB 4HEA2 4ICYA 1OC3A 3O76A 4BA7A 5HFGA 4BPYA 4Z2TA 1PMTA 3ED3A 1ZCPA 1OKDA 1K0OA 4EO3A 2JSZA 1YY7A 2HXKA 1OC8A 2C0DA 2FCHA 2UZ8A 1XOBA 5L71A 4OWYA 2B6MA 2A2PA 4BVYB 1XFLA 1RQMA 2VLVA 4ZB6A 3A5WA 4G10A 4TKYA 2AHEA 4K7IA 4HU7A 1GSQA 1H4OA 3GTUB 1WPIA 2V32A 4AF2A 2WFCA 1OKTA 5IMCA 1U87A 1GULA 4LL1B 5G5EA 4K7OA 1ON4A 1YKCA 4N10A 3I6AA 4ZXGA 1W4VA 1SK0A 2JU5A 4GF0A 4USSA 4K0NA 4TRXA 2HRKA 4YKGA 4EKZA 2NBSA 4EC0A 2GS3A 4L0WA 1JLVA 1OE7A 4WETA 2V6KA 4F03A 5DQSA 1X9MB 3RAZA 2GZPA 4GRFA 19GSA 2H75A 4EDYA 4PUFC 2V1MA 4IW9A 2OJLA 3PPUA 1PN9A 4PXOA 1GTAA 3QAVA 1TDIA 2OKAA 1UA5A 5IMZA 1U6TA 3A3TA 4K0GA 1R4WA 3D4TA 3TJKA 4O5UA 1A0RP 1Y6EA 3HVXA 3RBTA 2R0PA 1AUCA 2YP6A 4NHWA 4XRAA 2OE3A 3PINA 1JLWA 4F0CA 2KHPA 3IC8A 6GSSA 4MJAA 3LJRA 3QFAC 2DIZA 5ECQB 2GLRA 2YCDA 5A4UA 3DWVA 3IHQA 3GSTA 2MMAA 5ECPB 1PA3A 1OYJA 3W8SA 4K5RA 1F3BA 3KD0A 1ZOFA 2PUKC 4HJ2A 4WBRD 1Z9HA 5B8AA 3TDGA 1XXUA 3GKXA 4KDUA 5JWRB 2DLXA 2NPBA 3KM6A 5CO3A 4GXZA 3V1WA 4XIHA 2PGTA 2GDRA 2LQOA 4GLTA 1XW6A 5KN1A 2HLSA 3CYNA 4JBBA 5DCHA 5DALA 2QA2A 3TCOA 1M2DA 1ZYEA 2X4AA 4RI6A 3CTGA 9GSSA 4NV5A 3J7Yk 3DYRA 4POLA 4ML6A 1R5AA 1AW9A 4PNFA 5IM9A 1ZMAA 2PU9C 5G2ZA 4E8HA 1HNBA 1T4ZA 4EUYA 4L0UA 2MMNA 4JZQA 1PN0A 3GL5A 1AXDA 2GVPA 3ZVJD 2DSAA 2H71A 2MMZA 1JZDA 4POKA 5D9WA 5JWOB 2FWFA 5F0GA 1S3CA 4K2XA 1AQWA 1JHBA 5JWQB 4BVXA 5GSSA 3AY8A 8GSSA 1FOHA 3TUEA 3M3MA 5E59A 1N2AA 4CY6A 4HDEA 3NZNA 3Q74A 4MZWA 4MA9A 2QKEA 2CA8A 3IAM2 3PH9A 1MD4A 4YQUA 1V9WA 1SK2A 5INYA 3LQ7A 4ID0A 3DKSA 4H86A 1O85A 2YWNA 4CW9A 3ERGA 5J9BA 2R6KA 2RUEA 3RDWA 3HYPA 2CVBA 2O7KA 3H93A 4YAVA 3ISOA 1NHYA 5DALB 2XPDA 5DBQA 1ERTA 3E9JB 1PGTA 2N5BA 4X43A 2YWIA 4LMVA 4TXOA 3UEMA 3G7IA 2MZCA 4KDYA 3KMOA 4MNNA 1X5EA 2LRNA 1ZL9A 1ZGNA 5DJLA 4WEYA 5ECNB 5A4VA 3FRCA 2GT5A 1GH2A 4OCEA 3GX8A 1A24A 2I4AA 1U3IA 2M46A 2EIRA 1GLQA 2C0FA 3P2AA 4PUAA 4ISDA 4KCEA 4IELA 3FW2A 1AQXA 2CAIA 3C71A 1GSUA 2OADA 4BVXB 2OA7A 1T4YA 4FIWA 4GSTA 3DVWA 4OFTA 4A5PA 3CXGA 1SKSB 2EC4A 2HSYA 1A2JA 2K8SA 1EV4A 2B5XA 2WS2A 4QL9A 3S9FA 2REMA 1PSQA 4EF0A 4RQXA 1KEBA 3IAS2 1GNWA 3KIJA 1GSSA 3FKFA 1T3BA 5JCWA 3VWVA 2JL4A 4MLYA 3CBUA 3KH7A 2ON5A 1TRVA 2FLSA 2MBSA 1E6BA 4DEJA 1T00A 5CRDA 5EPFA 4BWSA 2ON7A 4O92A 2VLUA 1Z3EA 3RPPA 1O8WA 1LBKA 2YJ7A 2NVLA 3TKSA 2XBQA 4O5RA 1XBSA 1TP9A 4TXOB 1VGLA 2N5FA 1M0UA 3GFKA 4J2FA 2G0FA 4L5OA 1EGRA 1O8XA 5ID2A 1EZKA 1O6JA 2J23A 4QQ7A 2H0IA 18GSA 2QA1A 3A5IA 4FQUA 3UARA 5DDLA 1URMA 3LGCA 4JR6A 2YV9A 4L5LA 3H4KA 2O87A 3QPMA 4IKHA 1TJDA 3UVTA 2MBTA 2OE0A 1FAAA 2V41A 5KEJA 3QMXA 4HI7A 3IXRA 3FR9A 1A2MA 2QC7A 2HSHA 4MPGA 12GSA 3ME7A 3ZMLA 4YH2A 1WJKA 3FYGA 2BJXA 2VCVA 5DQYA 4MDCA 2FGXA 2PVQA 4PQHA 2VCTA 3PR8A 2NDOA 4OMVA 5HQPA 2JADA 2O85A 3IV4A 4FYUA 4KH7A 5IMVA 5CYYA 1DSBA 4X1UA 3ZIJA 2YV7A 4MMMA 2CZ2A 2F8FA 1B9XC 3Q19A 2H1BA 5A4WA 2C0GA 1DUGA 2KOKA 2ZCTA 1ZYQB 1B4PA 2Z9SA 3A2WA 5G1KA 4V1Ap 3US3A 3C1SA 5LD0A 4JR4A 2LJRA 4G0LA 1GNEA 2L6CA 2L57A 3LXTA 4CY8A 2H01A 4MJBA 3P90A 1GUMA 4KX4A 2RIIA 2L4CA 2A4VA 4Q5NA 6GSTA 4TR1A 2C3NA 2X8GA 3GKNA 4IHUA 2BMXA 1BYEA 1DBYA 1GUKA 3U6VA 5AISA 2PVOC 5AGYA 5C04A 3UL3A 5B6NA 2LUSA 5JCGA 3R3EA 1G6WA 4KSMA 4KNDA 3TRQA 1XOAA 4KAEA 1R5PA 3F0IA 3HKRA 1NM3A 2YANA 3C1RA 2HZEA 2C1YA 2LRCA 2IMFA 3KP8A 2R4VA 1MDIA 3HJMA 1QK8A 5IMAA 1J08A 2HSMA 5BRTA 2VIMA 1X9WB 3D22A 1F37A 5CRWA 3EMXA 4TVEA 1R7HA 4NWYA 1JFUA 3KGKA 3IHGA 1XVQA 3ZMKA 2WZ9A 4AJ8A 1H75A 2HRFA 2DJ3A 4JE1A 2H6YA 1TOFA 3EMPA 4TN8A 1ERWA 3EURA 1XW9A 3TKSC 1FO5A 2VLTA 3HZ8A 2LNSA 4MH3A 2L4QA 4TR1B 3DEXA 3HJPA 3WT2A 2CX3A 4MCUA 2H30A 3I43A 2FA4A 1BEDA 2E7PA 3FMWA 1NSWA 1K0NA 4IN0A 4V2MA 1KBNA 3EE2A 4GSNA 5HR3A 3GKMA 3KH9A 2JZTA 1M99A 1OAZA 22GSA 1CQGA 2C4JA 3O3TA 2H73A 2VL3A 2IMDA 2IWTA 2VM1A 1PL2A 2RM5A 1M2AA 4BL7B 3M9JA 1YDKA 2RM6A 2HZEB 1GLPA 1MD3A 3KTBA 5CREA 2N5AA 1ML6A 5AIXA 2P5RA 2VOCA 4KA0A 4EIQA 1TU7A 1EEMA 1XWCA 4ZIJA 2FUG2 1M2BA 3N5OA 3GUSA 1O73A 2QSIA 5D73A 3ZIVA 3MIXA 4E8EA 2IN3A 4TR3A 3FK8A 3L0HA 1T8EB 4POMA 2IJYA 5ECHB 1KTEA 5GSTA 4ZBDA 1LJRA 3VPTA 1SKRB 1A8YA 1I5GA 2H6ZA 4LMWA 5G1LA 4IVFA 3M0FA 2DJKA 3GL3A 4KE3A 1XW5A 6GSVA 1LU4A 5ECKB 1WWJA 1FVJA 2K18A 1SU9A 2VL9A 1TRSA 2XBIA 1VF3A 1BG5A 4DSQA 3FZAA 2DJ1A 2DMMA 1GTUA 1Z7PA 1U3AA 2B5YA 3HJOA 3K8NA 3D5JA 1SD9A 4AGSA 1THXA 1GRXA 1YEPA 3QOUA 3BD2A 3IC4A 2DKIA 3ERFA 5GAPD 4IGJA 3FR6A 3HD5A 4N30A 4V2NA 1PX7A 5CP1A 2FD3A 3MDKA 3IK9A 20GSA 4OO4A 3TOTA 4MPFA 5ELAA 2H0GA 3HXSA 2FWGA 2LEGA 2I9HA 3L78A 1PL1A 3ZLPA 1TRUA 5B8BA 1EEJA 2I1UA 4HU9A 3G9BA 2F8AA 1GSFA 1QQ2A 1FOVA 3LEFA 4OFMA 4EVMA 5D9TA 5JCUA 1GSYA 4ZBBA 3W8JA 4TXVA 4O7HA 1X0RA 3UAPA 2R5GA 2LKUA 3KMNA 4ECBA 3ZFBA 5J41A 1YKAA 4WR5A 4HZ4A 4AJ6A 5CRGA 2GZYA 3DIEA 1V58A 4L8EA 1SYXA 2YNXA 4IP1A 5F8BA 4J57E 1BAYA 5KOXA 3GNJA 2HFDA 2YWMA 5D93A 3EC3A 1PD21 2M80A 5D8IA 2DJ0A 3MWHA 5H5SA 3WGEA 2IMKA 5CRHA 1XIYA 2OBKA 3HHVA 3F63A 1XWBA 5BMUA 4P3YB 2YPMA 2YZHA 1F3AA 3HCZA 5IOWA 2VUPA 3TRXA 1AIUA 1GTBA 2E2GA 5ECRB 3IRAA 2F51A 1A8LA 13GSA 3LXZA 2HRAA 2JACA 4PURA 2ALBA 3UBKA 3WT1A 3D21A 2GQKA 2G2QA 4EDZA 1SL1B 3UVHA 1V98A 1HNAA 1S3AA 1TTZA 4KW6A 1M9AA 1RW1A 1XVWA 4LA1A 4MZBA 1JZWA 1ZZYA 5DVBA 2IMEA 3KXOA 4I2UA 3H79A 2DJ2A 3FEUA 3BCKA 1EGOA 2K9FA 4KF9A 2OBIA 1F2EA 1F9MA 3ERWA 4DVCA 4Q5QA 2FNOA 4DSRA 1FB0A 2A4HA 5J4UA 3F6FA 3TRPA 4EXJA 3TJBA 4Z7XA 1VRSD 3DGQA 4F82A 3NOFA 3ZTLA 1K0AA 1JZOA 5B7CA 4K5SA 1SJZA 5ABRA 4NAXA 3KTLA 1SKWB 4IQAA 5LCZA 1UN2A 3TJGA 4BWQA 4FYBA 2X8CA 1FG4A 5EVOA 14GSA 4I97A 1VF2A 4V2LA 5D96A 2GQMA 5AIVA 4TR4A 3IA1A 3ZFLA 3G7YA 3VI7A 3QFBC 2JZSA 11GSA 2C8UA 4FYCA 1YF1A 4K7NA 2GQLA 1QFNA 2H66A 3IBHA 1B4QA 1PX6A 1Z7RA 4OD7A 2CV4A 3F3QA 4ACSA 2HYXA 4YQVA 1SD8A 4XHMA 4PGTA 4IS0A 2H8LA 4MJEA 2XHFA 2GGTA 2X99A 1GSEA 4JRRA 4WR4A 2CVKA 1YZXA 1YQ1A 5LNKe 7GSSA 5EL8A 2I81A 3QAGA 4NHZA 1NHOA 2O8VB 2HE3A 3GIXA 3VWWA 1GL8A 3D6IA 2IL3A 3U5RE 4ZB8A 1Z6MA 5IO2A 2H72A 2YWOA 5E4WA 1XZOA 2H70A 2AJQB 3GURA 2DBCA 1C72A 3MNGA 3UBLA 1FHEA 5F06A 2H1DA 2AAWA 5IPHA 10GSA 2H1AA 3GH6A 1FW1A 2DC5A 2WULA 2EIOA 2L5OA 5ECIB 1YF0A 3RHCA 1Q98A 2VCQA 1UVZA 1O7UA 4ZL8A 2L5LA 2I3YA 3W6GA 1TXXA 5ID2B 4GCIA 4Z2UA 1TK5B 2X49A 4G19A 4QL7A 2VD1A 2KP1A 3HA9A 2LV3A 2JSYA 2NTOA 3ZRDA 2E0QA 3RPNA 2LJAA 4NPBA 1MDJA 5EY6A 2DKHA 3TJJA 1GP1A 2H76A 4D73A 1QGVA 3IK7A 3KEBA 3TKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GTU A;  2IPA A;  3BOA A;  5FWG A;  1Y25 A;  4TR0 A;  3GX0 A;  1X5D A;  1SL2 B;  4GTU A;  5CNW A;  4YAP A;  3NIV A;  3GHA A;  4MAB A;  2PMT A;  2VCX A;  16GS A;  3EU4 A;  4AJ7 A;  3DXB A;  2HI7 A;  5FHI A;  4XS4 A;  2VCZ A;  2XPE A;  1FVK A;  5J9C A;  1WRY A;  2LJK A;  3LFL A;  2H0H A;  4WKW A;  3F9U A;  4GQC A;  1NW2 A;  2E2M A;  3M9K A;  4MZC A;  3N9J A;  3GH9 A;  4GQF A;  1HYU A;  4XRD A;  5F05 A;  2FHE A;  2TIR A;  1CQH A;  2LST A;  4J56 E;  1M9B A;  2KUC A;  5J5N A;  1TI1 A;  3ZIT A;  1TKD B;  2R3X A;  2VO4 A;  3D4M A;  3GRX A;  4WBJ A;  1EV9 A;  2GZZ A;  5F07 A;  3EU3 A;  5GZZ B;  3RHB A;  1PQN A;  2VCW A;  2IIY A;  3TKS E;  1X9S B;  3GMF A;  2ZNM A;  3FZ4 A;  3Q6O A;  4WF4 A;  4IQ1 A;  1HD2 A;  1T1V A;  2WJU A;  4D73 B;  2AB6 A;  2B7K A;  3GV1 A;  4EE0 A;  3FHK A;  3O6T A;  5ELG A;  5KN0 A;  3E3E A;  1ABA A;  5D9X A;  2FA8 A;  1Z5Y E;  3P8W A;  5KN2 A;  2GSQ A;  3APO A;  1GSD A;  3GSS A;  1GUH A;  1XWK A;  3CRU A;  3QAW A;  4F9Z A;  2PPT A;  2IFQ A;  5IMD A;  1MTC A;  1G0T A;  3CRT A;  3F8U A;  3EWL A;  4XS4 B;  1V40 A;  5HFI A;  3UIW A;  2X8H A;  1IYH A;  2LTK A;  1SL0 B;  1EP7 A;  3F4S A;  3VK9 A;  1QUW A;  1TU8 A;  4HS1 A;  3I9V 2;  3VFI A;  1GWC A;  2IMI A;  2AV4 A;  3DRN A;  4K8M A;  2QGV A;  2WDU A;  3BJ5 A;  1J9B A;  2V6O A;  4KDX A;  2VL2 C;  3GYK A;  2L6D A;  1S3D A;  2GSR A;  5G30 A;  4MH2 A;  3GA4 A;  3IE3 A;  1O81 A;  2PBJ A;  2VM2 A;  5HFK A;  2XC2 A;  2V2G A;  1XWG A;  4V1A g;  4LLR A;  3LYP A;  3HZ4 A;  3VLN A;  17GS A;  3KCM A;  3C8E A;  2HRN A;  5DCG A;  1V57 A;  3BCI A;  4GWR A;  4N11 A;  2TRC P;  3HDC A;  3ME8 A;  3UMA A;  5IQY A;  4K9Z A;  3L4N A;  3ZVJ A;  4WXT A;  1OE8 A;  4ECC A;  1RK4 A;  3QR6 A;  3LSZ A;  4LL4 B;  3GKK A;  4ILF A;  4RQR A;  2WGR A;  2CZ3 A;  1R26 A;  3A2V A;  4HJM A;  3EIN A;  4OFN A;  4PX1 A;  2IFQ B;  1K3O A;  1HQO A;  2CT6 A;  3TOU A;  2F9S A;  4ZIL A;  2KP2 A;  3QDN A;  3WD6 A;  6GSX A;  4K6X A;  1TI3 A;  1Q4J A;  2O89 A;  3KJY A;  3M8N A;  5B6M A;  4XCS A;  4HZ2 A;  1XPV A;  4DSS A;  1FB6 A;  1SJ6 A;  2MYG A;  2HNL A;  4HQZ A;  2B5E A;  2GT6 A;  2PN8 A;  1UC7 A;  3KP9 A;  2H19 A;  3FZ9 A;  3IPZ A;  4FO5 A;  4IJI A;  2C3T A;  3MSZ A;  5J3R A;  3PGT A;  5G5F A;  4ECJ A;  4PQI A;  1WE0 A;  5COH A;  5IOX A;  3JCM L;  2MMO A;  4X0X A;  1GTI A;  1KNG A;  1V2A A;  2BTO T;  4ZBA A;  4CHS A;  1I9D A;  2CAQ A;  1OVN A;  5IO0 A;  4KB3 A;  1K0M A;  2M72 A;  4HUA A;  4I2T A;  5HR2 A;  1J0F A;  1EOH A;  1ACV A;  4YQM A;  1XWA A;  2P31 A;  1ILO A;  1ST9 A;  3MAK A;  1WOU A;  1BQ7 A;  2GST A;  4JU5 A;  3TB2 A;  5AN1 A;  2R37 A;  3CSJ A;  2C80 A;  3A2X A;  2LS5 A;  1SYR A;  5KN3 A;  4IBP A;  3Q18 A;  2LRT A;  2DIY A;  4CDO A;  3VPQ A;  4F0B A;  3G7J A;  3UJ1 A;  1B9Y C;  4MF5 A;  3QD9 A;  4ZL9 A;  1PKZ A;  3OR5 A;  1PKW A;  4RI7 A;  3F4R A;  3LYK A;  4OCF A;  2J9H A;  2YOI A;  2KLX A;  4PQ1 A;  1SJI A;  1K0B A;  3LOR A;  4NXI A;  1TW9 A;  3E0U A;  3EYT A;  3I69 A;  1SK1 A;  3TKP A;  2LNT A;  2B1L A;  3FY7 A;  4DSS B;  2OAC A;  3CSH A;  1SEN A;  5HR0 A;  3APS A;  3J7Y b;  5IMF A;  2DML A;  4I5Q A;  4XS6 A;  2OE1 A;  2AUV A;  4POB A;  3VWU A;  2B1K A;  5ECO B;  4KSO A;  1TK0 B;  4Q5F A;  3F3R A;  3ZZX A;  3FR3 A;  3DML A;  1BX9 A;  1K0C A;  1F6M C;  3ZL5 A;  3TGZ A;  5ECS A;  4N0V A;  3L9S A;  1K3Y A;  1B48 A;  3LWA A;  2H1G A;  1A23 A;  4MF7 A;  5H5R A;  4HOJ A;  5DAK A;  3UOM A;  1A0F A;  2LQQ A;  5IPG A;  4MP4 A;  2P5Q A;  3SBC A;  2R2J A;  3DVX A;  3LG6 A;  4RUV A;  1YJ6 A;  1G7E A;  4OO5 A;  4MJC A;  1B8X A;  1IYI A;  5ENU A;  2DJJ A;  2CVD A;  3IOS A;  3EVI A;  3WGD A;  2X64 A;  1K3L A;  1PRX A;  2FY6 A;  4NMU A;  3P7X A;  4ZB9 A;  4ULX A;  1N8J A;  3HVV A;  2B7J A;  4O32 A;  4KCA A;  4KGI A;  4ECI A;  4N0Z A;  1Z6N A;  5DJM A;  5C00 A;  5HR1 A;  3R2Q A;  2D2Z A;  4WF5 A;  1DE1 A;  4PNG A;  3VUR A;  4GSS A;  4HQS A;  3TJF A;  1G7O A;  4Q5R A;  4EL1 A;  3CMI A;  4G9H A;  1AC1 A;  5FT3 A;  3IDV A;  2C3Q A;  1X5C A;  6GSU A;  2EIQ A;  4NV2 A;  3GN3 A;  2A2R A;  4TOP A;  3F4T A;  3QCP A;  1BJX A;  1TRW A;  2JZR A;  3FZ5 A;  3F6D A;  3CTF A;  1OC9 A;  2ZUP A;  1M7T A;  3VI5 A;  3APQ A;  3WYW A;  4G2E A;  2FWH A;  2VL2 A;  1WP0 A;  2CX4 A;  2WB9 A;  2YJH A;  2WCI A;  4XTS A;  4XS1 A;  4IP6 A;  5DAK B;  1QXH A;  1JZR A;  1AQV A;  1K0D A;  1G6Y A;  3L9V A;  3ZYW A;  1E2Y A;  3HVS A;  1T7P B;  1MEK A;  1TK8 B;  1QMV A;  2K8V A;  4BVY A;  2PER A;  2VAF A;  5H5Q A;  4I6X A;  1EP8 A;  1AAZ A;  6GSW A;  5CAX A;  1DE2 A;  4MF6 A;  4I8B A;  3CSI A;  2TRX A;  3GTU A;  2CQ9 A;  3H1N A;  5GAN D;  2RLI A;  1EOG A;  1WMJ A;  1HNC A;  3SWL A;  1A2L A;  3M1G A;  3HY2 A;  6GSY A;  5ECM B;  4MK3 A;  4F2I A;  2C0E A;  1USB A;  3BBY A;  2A2S A;  3VWX A;  2RUF A;  5D9V A;  2AYT A;  1WIK A;  1MDK A;  4TW5 A;  4JED A;  4KUN A;  1EWX A;  2HZF A;  2ES7 A;  3C73 A;  1VF4 A;  2VD0 A;  2P0G A;  4FH8 A;  1VF1 A;  3IR4 A;  5IIZ A;  2PWJ A;  4K2D A;  5G31 A;  2B3S A;  2K6V A;  4K1F A;  5A5K A;  4ML1 A;  2HT9 A;  3KZQ A;  1XCC A;  2H74 A;  2H6X A;  2WRT A;  1OC9 B;  2YN1 A;  1U88 A;  2L59 A;  3TKQ A;  4ZL7 A;  3H8Q A;  2F3M A;  1THO A;  4IJ3 A;  3C7M A;  3D0Z A;  2GSS A;  3L9U A;  2FWE A;  2YZU A;  3ZRE A;  1W89 A;  4BL7 A;  1YEX A;  3DD3 A;  3WGX A;  1ERV A;  1ERU A;  5ECL B;  4HEA 2;  1OC3 A;  3O76 A;  4BA7 A;  5HFG A;  4BPY A;  1PMT A;  3ED3 A;  1ZCP A;  1OKD A;  1K0O A;  4EO3 A;  2JSZ A;  1YY7 A;  2HXK A;  1OC8 A;  2C0D A;  2FCH A;  1XOB A;  5L71 A;  4OWY A;  2B6M A;  1XFL A;  1RQM A;  2VLV A;  4ZB6 A;  3A5W A;  4G10 A;  4TKY A;  2AHE A;  4K7I A;  4HU7 A;  1GSQ A;  1H4O A;  3GTU B;  1WPI A;  2V32 A;  4AF2 A;  2WFC A;  1OKT A;  5IMC A;  1U87 A;  1GUL A;  4LL1 B;  5G5E A;  4K7O A;  1ON4 A;  1YKC A;  4N10 A;  3I6A A;  4ZXG A;  1W4V A;  1SK0 A;  2JU5 A;  4GF0 A;  4K0N A;  4TRX A;  4EKZ A;  2NBS A;  4EC0 A;  2GS3 A;  4L0W A;  1JLV A;  1OE7 A;  4WET A;  2V6K A;  4F03 A;  5DQS A;  1X9M B;  3RAZ A;  2GZP A;  4GRF A;  19GS A;  2H75 A;  4EDY A;  4PUF C;  2V1M A;  4IW9 A;  2OJL A;  1PN9 A;  4PXO A;  1GTA A;  3QAV A;  1TDI A;  2OKA A;  1UA5 A;  5IMZ A;  1U6T A;  3A3T A;  4K0G A;  1R4W A;  3D4T A;  3TJK A;  1A0R P;  1Y6E A;  3HVX A;  3RBT A;  1AUC A;  2YP6 A;  4NHW A;  4XRA A;  2OE3 A;  3PIN A;  1JLW A;  4F0C A;  2KHP A;  6GSS A;  4MJA A;  3LJR A;  3QFA C;  2DIZ A;  5ECQ B;  2GLR A;  2YCD A;  5A4U A;  3DWV A;  3IHQ A;  3GST A;  2MMA A;  5ECP B;  1PA3 A;  1OYJ A;  3W8S A;  1F3B A;  3KD0 A;  1ZOF A;  2PUK C;  4HJ2 A;  4WBR D;  1Z9H A;  5B8A A;  3TDG A;  1XXU A;  3GKX A;  4KDU A;  5JWR B;  2DLX A;  2NPB A;  3KM6 A;  5CO3 A;  4GXZ A;  3V1W A;  4XIH A;  2PGT A;  2GDR A;  2LQO A;  4GLT A;  1XW6 A;  5KN1 A;  2HLS A;  3CYN A;  4JBB A;  5DCH A;  5DAL A;  3TCO A;  1M2D A;  1ZYE A;  4RI6 A;  3CTG A;  9GSS A;  4NV5 A;  3J7Y k;  3DYR A;  4POL A;  4ML6 A;  1R5A A;  1AW9 A;  4PNF A;  5IM9 A;  1ZMA A;  2PU9 C;  5G2Z A;  4E8H A;  1HNB A;  1T4Z A;  4EUY A;  4L0U A;  2MMN A;  4JZQ A;  3GL5 A;  1AXD A;  2GVP A;  3ZVJ D;  2DSA A;  2H71 A;  2MMZ A;  1JZD A;  4POK A;  5D9W A;  5JWO B;  2FWF A;  5F0G A;  1S3C A;  1AQW A;  1JHB A;  5JWQ B;  4BVX A;  5GSS A;  3AY8 A;  8GSS A;  3TUE A;  3M3M A;  5E59 A;  1N2A A;  4HDE A;  3NZN A;  3Q74 A;  4MZW A;  4MA9 A;  2QKE A;  2CA8 A;  3IAM 2;  3PH9 A;  1MD4 A;  4YQU A;  1V9W A;  1SK2 A;  5INY A;  3LQ7 A;  4ID0 A;  3DKS A;  4H86 A;  1O85 A;  2YWN A;  4CW9 A;  3ERG A;  5J9B A;  2R6K A;  2RUE A;  3RDW A;  3HYP A;  2CVB A;  2O7K A;  3H93 A;  4YAV A;  3ISO A;  1NHY A;  5DAL B;  2XPD A;  5DBQ A;  1ERT A;  3E9J B;  1PGT A;  2N5B A;  4X43 A;  2YWI A;  4LMV A;  4TXO A;  3UEM A;  3G7I A;  2MZC A;  4KDY A;  3KMO A;  1X5E A;  2LRN A;  1ZL9 A;  1ZGN A;  5DJL A;  4WEY A;  5ECN B;  5A4V A;  3FRC A;  2GT5 A;  1GH2 A;  4OCE A;  3GX8 A;  1A24 A;  2I4A A;  1U3I A;  2M46 A;  2EIR A;  1GLQ A;  2C0F A;  3P2A A;  4PUA A;  4ISD A;  4KCE A;  4IEL A;  3FW2 A;  1AQX A;  2CAI A;  3C71 A;  1GSU A;  2OAD A;  2OA7 A;  1T4Y A;  4FIW A;  4GST A;  3DVW A;  4OFT A;  3CXG A;  1SKS B;  2EC4 A;  2HSY A;  1A2J A;  2K8S A;  1EV4 A;  2B5X A;  2WS2 A;  4QL9 A;  3S9F A;  2REM A;  1PSQ A;  4EF0 A;  4RQX A;  1KEB A;  3IAS 2;  1GNW A;  3KIJ A;  1GSS A;  3FKF A;  1T3B A;  5JCW A;  3VWV A;  2JL4 A;  4MLY A;  3CBU A;  3KH7 A;  2ON5 A;  1TRV A;  2FLS A;  2MBS A;  1E6B A;  4DEJ A;  1T00 A;  5CRD A;  5EPF A;  4BWS A;  2ON7 A;  4O92 A;  2VLU A;  1Z3E A;  3RPP A;  1O8W A;  1LBK A;  2YJ7 A;  2NVL A;  3TKS A;  2XBQ A;  4O5R A;  1XBS A;  1TP9 A;  4TXO B;  1VGL A;  2N5F A;  1M0U A;  3GFK A;  4J2F A;  2G0F A;  4L5O A;  1EGR A;  1O8X A;  5ID2 A;  1EZK A;  1O6J A;  2J23 A;  4QQ7 A;  2H0I A;  18GS A;  3UAR A;  5DDL A;  1URM A;  3LGC A;  4JR6 A;  2YV9 A;  4L5L A;  3H4K A;  2O87 A;  3QPM A;  4IKH A;  1TJD A;  3UVT A;  2MBT A;  2OE0 A;  1FAA A;  2V41 A;  5KEJ A;  3QMX A;  4HI7 A;  3IXR A;  3FR9 A;  1A2M A;  2QC7 A;  2HSH A;  4MPG A;  12GS A;  3ME7 A;  3ZML A;  4YH2 A;  1WJK A;  3FYG A;  2BJX A;  2VCV A;  5DQY A;  4MDC A;  2FGX A;  2PVQ A;  4PQH A;  2VCT A;  3PR8 A;  2NDO A;  4OMV A;  5HQP A;  2JAD A;  2O85 A;  3IV4 A;  4FYU A;  4KH7 A;  5IMV A;  5CYY A;  1DSB A;  4X1U A;  3ZIJ A;  2YV7 A;  4MMM A;  2CZ2 A;  2F8F A;  1B9X C;  3Q19 A;  2H1B A;  5A4W A;  2C0G A;  1DUG A;  2KOK A;  2ZCT A;  1ZYQ B;  1B4P A;  2Z9S A;  3A2W A;  5G1K A;  4V1A p;  3US3 A;  3C1S A;  5LD0 A;  4JR4 A;  2LJR A;  1GNE A;  2L6C A;  2L57 A;  3LXT A;  2H01 A;  4MJB A;  3P90 A;  1GUM A;  4KX4 A;  2RII A;  2L4C A;  2A4V A;  4Q5N A;  6GST A;  4TR1 A;  2C3N A;  2X8G A;  3GKN A;  4IHU A;  2BMX A;  1BYE A;  1DBY A;  1GUK A;  3U6V A;  5AIS A;  2PVO C;  5AGY A;  5C04 A;  3UL3 A;  5B6N A;  2LUS A;  5JCG A;  1G6W A;  4KSM A;  4KND A;  3TRQ A;  1XOA A;  4KAE A;  1R5P A;  3F0I A;  3HKR A;  1NM3 A;  2YAN A;  3C1R A;  2HZE A;  2C1Y A;  2LRC A;  2IMF A;  3KP8 A;  2R4V A;  1MDI A;  3HJM A;  1QK8 A;  5IMA A;  1J08 A;  2VIM A;  1X9W B;  3D22 A;  1F37 A;  5CRW A;  3EMX A;  4TVE A;  1R7H A;  4NWY A;  1JFU A;  3KGK A;  1XVQ A;  3ZMK A;  2WZ9 A;  4AJ8 A;  1H75 A;  2HRF A;  2DJ3 A;  4JE1 A;  2H6Y A;  1TOF A;  3EMP A;  4TN8 A;  1ERW A;  3EUR A;  1XW9 A;  3TKS C;  1FO5 A;  2VLT A;  3HZ8 A;  2LNS A;  4MH3 A;  2L4Q A;  4TR1 B;  3DEX A;  3HJP A;  3WT2 A;  2CX3 A;  4MCU A;  2H30 A;  3I43 A;  2FA4 A;  1BED A;  2E7P A;  1NSW A;  1K0N A;  4IN0 A;  4V2M A;  1KBN A;  3EE2 A;  4GSN A;  5HR3 A;  3GKM A;  3KH9 A;  2JZT A;  1M99 A;  1OAZ A;  22GS A;  1CQG A;  2C4J A;  3O3T A;  2H73 A;  2VL3 A;  2IMD A;  2IWT A;  2VM1 A;  1PL2 A;  2RM5 A;  1M2A A;  3M9J A;  1YDK A;  2RM6 A;  2HZE B;  1GLP A;  1MD3 A;  3KTB A;  5CRE A;  2N5A A;  1ML6 A;  5AIX A;  2P5R A;  2VOC A;  4KA0 A;  1TU7 A;  1EEM A;  1XWC A;  4ZIJ A;  2FUG 2;  1M2B A;  3N5O A;  3GUS A;  1O73 A;  2QSI A;  5D73 A;  3ZIV A;  4E8E A;  2IN3 A;  4TR3 A;  3FK8 A;  3L0H A;  1T8E B;  4POM A;  2IJY A;  5ECH B;  1KTE A;  5GST A;  4ZBD A;  1LJR A;  3VPT A;  1SKR B;  1A8Y A;  1I5G A;  2H6Z A;  4LMW A;  5G1L A;  4IVF A;  3M0F A;  2DJK A;  3GL3 A;  4KE3 A;  1XW5 A;  6GSV A;  1LU4 A;  5ECK B;  1WWJ A;  1FVJ A;  2K18 A;  1SU9 A;  2VL9 A;  1TRS A;  2XBI A;  1VF3 A;  1BG5 A;  4DSQ A;  3FZA A;  2DJ1 A;  2DMM A;  1GTU A;  1Z7P A;  1U3A A;  2B5Y A;  3HJO A;  3K8N A;  3D5J A;  1SD9 A;  4AGS A;  1THX A;  1GRX A;  1YEP A;  3QOU A;  3BD2 A;  3IC4 A;  3ERF A;  5GAP D;  4IGJ A;  3FR6 A;  3HD5 A;  4N30 A;  4V2N A;  1PX7 A;  5CP1 A;  2FD3 A;  3MDK A;  3IK9 A;  20GS A;  4OO4 A;  3TOT A;  4MPF A;  5ELA A;  2H0G A;  3HXS A;  2FWG A;  2LEG A;  2I9H A;  3L78 A;  1PL1 A;  3ZLP A;  1TRU A;  5B8B A;  1EEJ A;  2I1U A;  4HU9 A;  3G9B A;  2F8A A;  1GSF A;  1QQ2 A;  1FOV A;  3LEF A;  4OFM A;  4EVM A;  5D9T A;  5JCU A;  1GSY A;  4ZBB A;  3W8J A;  4TXV A;  4O7H A;  1X0R A;  3UAP A;  2R5G A;  2LKU A;  3KMN A;  4ECB A;  3ZFB A;  5J41 A;  1YKA A;  4WR5 A;  4HZ4 A;  4AJ6 A;  5CRG A;  2GZY A;  3DIE A;  1V58 A;  4L8E A;  1SYX A;  2YNX A;  4IP1 A;  5F8B A;  4J57 E;  1BAY A;  3GNJ A;  2HFD A;  2YWM A;  5D93 A;  3EC3 A;  1PD2 1;  2M80 A;  5D8I A;  2DJ0 A;  3MWH A;  5H5S A;  3WGE A;  2IMK A;  5CRH A;  1XIY A;  2OBK A;  3HHV A;  3F63 A;  1XWB A;  4P3Y B;  2YPM A;  2YZH A;  1F3A A;  3HCZ A;  5IOW A;  2VUP A;  3TRX A;  1AIU A;  1GTB A;  2E2G A;  5ECR B;  3IRA A;  2F51 A;  1A8L A;  13GS A;  3LXZ A;  2JAC A;  4PUR A;  2ALB A;  3UBK A;  3WT1 A;  3D21 A;  2GQK A;  2G2Q A;  4EDZ A;  1SL1 B;  3UVH A;  1V98 A;  1HNA A;  1S3A A;  1TTZ A;  4KW6 A;  1M9A A;  1RW1 A;  1XVW A;  4LA1 A;  4MZB A;  1JZW A;  1ZZY A;  5DVB A;  2IME A;  3KXO A;  4I2U A;  3H79 A;  2DJ2 A;  3FEU A;  3BCK A;  1EGO A;  2K9F A;  2OBI A;  1F2E A;  1F9M A;  3ERW A;  4DVC A;  4Q5Q A;  2FNO A;  4DSR A;  1FB0 A;  5J4U A;  3F6F A;  3TRP A;  4EXJ A;  3TJB A;  4Z7X A;  1VRS D;  3DGQ A;  4F82 A;  3NOF A;  3ZTL A;  1K0A A;  1JZO A;  5B7C A;  1SJZ A;  5ABR A;  4NAX A;  3KTL A;  1SKW B;  4IQA A;  5LCZ A;  1UN2 A;  3TJG A;  4BWQ A;  4FYB A;  2X8C A;  1FG4 A;  5EVO A;  14GS A;  4I97 A;  1VF2 A;  4V2L A;  5D96 A;  2GQM A;  5AIV A;  4TR4 A;  3IA1 A;  3ZFL A;  3G7Y A;  3VI7 A;  3QFB C;  2JZS A;  11GS A;  2C8U A;  4FYC A;  1YF1 A;  4K7N A;  2GQL A;  1QFN A;  2H66 A;  3IBH A;  1B4Q A;  1PX6 A;  1Z7R A;  4OD7 A;  2CV4 A;  3F3Q A;  4ACS A;  2HYX A;  4YQV A;  1SD8 A;  4XHM A;  4PGT A;  4IS0 A;  2H8L A;  4MJE A;  2XHF A;  2GGT A;  2X99 A;  1GSE A;  4JRR A;  4WR4 A;  2CVK A;  1YZX A;  1YQ1 A;  5LNK e;  7GSS A;  5EL8 A;  2I81 A;  3QAG A;  4NHZ A;  1NHO A;  2O8V B;  2HE3 A;  3GIX A;  3VWW A;  1GL8 A;  3D6I A;  2IL3 A;  3U5R E;  4ZB8 A;  1Z6M A;  5IO2 A;  2H72 A;  2YWO A;  5E4W A;  1XZO A;  2H70 A;  2AJQ B;  3GUR A;  2DBC A;  1C72 A;  3MNG A;  3UBL A;  1FHE A;  5F06 A;  2H1D A;  2AAW A;  5IPH A;  10GS A;  2H1A A;  3GH6 A;  1FW1 A;  2DC5 A;  2WUL A;  2EIO A;  2L5O A;  5ECI B;  1YF0 A;  3RHC A;  1Q98 A;  2VCQ A;  1UVZ A;  1O7U A;  4ZL8 A;  2L5L A;  2I3Y A;  3W6G A;  1TXX A;  5ID2 B;  4GCI A;  1TK5 B;  4G19 A;  4QL7 A;  2VD1 A;  2KP1 A;  3HA9 A;  2LV3 A;  2JSY A;  2NTO A;  3ZRD A;  2E0Q A;  3RPN A;  2LJA A;  4NPB A;  1MDJ A;  5EY6 A;  3TJJ A;  1GP1 A;  2H76 A;  4D73 A;  1QGV A;  3IK7 A;  3KEB A;  3TKR A; 
#chains in the Genus database with same CATH topology
 2GTU A;  2IPA A;  3BOA A;  5FWG A;  1Y25 A;  4TR0 A;  3GX0 A;  1X5D A;  1SL2 B;  4GTU A;  5CNW A;  4YAP A;  3NIV A;  3GHA A;  4MAB A;  2PMT A;  2VCX A;  16GS A;  3EU4 A;  4AJ7 A;  3DXB A;  2HI7 A;  5FHI A;  4XS4 A;  2VCZ A;  2XPE A;  1FVK A;  5J9C A;  1WRY A;  2LJK A;  3LFL A;  1ZYP A;  2H0H A;  4WKW A;  3F9U A;  4GQC A;  1NW2 A;  2E2M A;  3M9K A;  4MZC A;  3N9J A;  3GH9 A;  4GQF A;  1HYU A;  4XRD A;  5F05 A;  2FHE A;  2TIR A;  1CQH A;  2LST A;  4J56 E;  1M9B A;  2KUC A;  5J5N A;  1TI1 A;  3ZIT A;  1TKD B;  2R3X A;  2VO4 A;  3D4M A;  3GRX A;  4WBJ A;  1EV9 A;  2GZZ A;  5F07 A;  3EU3 A;  5GZZ B;  3RHB A;  1PQN A;  2VCW A;  2IIY A;  3TKS E;  1X9S B;  3GMF A;  2ZNM A;  3FZ4 A;  3Q6O A;  4WF4 A;  4IQ1 A;  1HD2 A;  1T1V A;  2WJU A;  4D73 B;  2AB6 A;  2B7K A;  3GV1 A;  4EE0 A;  3FHK A;  3O6T A;  5ELG A;  5KN0 A;  3E3E A;  1ABA A;  5D9X A;  2FA8 A;  1Z5Y E;  3P8W A;  5KN2 A;  2GSQ A;  3APO A;  1GSD A;  3GSS A;  1GUH A;  1XWK A;  3CRU A;  3QAW A;  4F9Z A;  2PPT A;  2IFQ A;  5IMD A;  1MTC A;  1G0T A;  3CRT A;  3F8U A;  4G0I A;  3EWL A;  4XS4 B;  1V40 A;  5HFI A;  3UIW A;  2X8H A;  1IYH A;  4G0K A;  2LTK A;  1SL0 B;  1EP7 A;  3F4S A;  3VK9 A;  1QUW A;  1TU8 A;  4HS1 A;  3I9V 2;  3VFI A;  1GWC A;  2IMI A;  2AV4 A;  3DRN A;  4K8M A;  2QGV A;  2WDU A;  3BJ5 A;  1J9B A;  2V6O A;  4KDX A;  2VL2 C;  3GYK A;  2L6D A;  1S3D A;  2GSR A;  5G30 A;  4MH2 A;  3GA4 A;  3IE3 A;  1O81 A;  2PBJ A;  2VM2 A;  5HFK A;  2XC2 A;  4O5Q A;  2V2G A;  1XWG A;  4V1A g;  4EIP A;  4LLR A;  3LYP A;  4HSC X;  3HZ4 A;  3VLN A;  17GS A;  3KCM A;  3C8E A;  2HRN A;  5DCG A;  1V57 A;  3BCI A;  4GWR A;  4PTS A;  4N11 A;  2TRC P;  3HDC A;  3ME8 A;  3UMA A;  5IQY A;  4K9Z A;  3L4N A;  3ZVJ A;  4WXT A;  1OE8 A;  4ECC A;  1RK4 A;  3QR6 A;  3LSZ A;  4LL4 B;  3GKK A;  4ILF A;  4RQR A;  2WGR A;  2CZ3 A;  3A2V A;  1R26 A;  4HJM A;  3HVN A;  3EIN A;  4OFN A;  4PX1 A;  2IFQ B;  1K3O A;  1HQO A;  2CT6 A;  3TOU A;  2F9S A;  4ZIL A;  2KP2 A;  3QDN A;  3WD6 A;  6GSX A;  4K6X A;  1TI3 A;  1Q4J A;  2O89 A;  3KJY A;  3M8N A;  5B6M A;  4XCS A;  4HZ2 A;  1XPV A;  4DSS A;  1FB6 A;  1SJ6 A;  2MYG A;  2HNL A;  3EPT A;  4HQZ A;  3LW9 A;  2B5E A;  2GT6 A;  2PN8 A;  1UC7 A;  3KP9 A;  2H19 A;  3FZ9 A;  3IPZ A;  4FO5 A;  4IJI A;  2C3T A;  3MSZ A;  5J3R A;  3PGT A;  5G5F A;  4ECJ A;  4PQI A;  1WE0 A;  5COH A;  5IOX A;  3JCM L;  2MMO A;  4X0X A;  1GTI A;  1KNG A;  1V2A A;  2BTO T;  4ZBA A;  4CHS A;  1I9D A;  2CAQ A;  1OVN A;  5IO0 A;  4KB3 A;  1K0M A;  2M72 A;  4HUA A;  4I2T A;  5HR2 A;  1J0F A;  1EOH A;  1ACV A;  4YKF A;  4YQM A;  1XWA A;  2P31 A;  1ILO A;  1ST9 A;  3MAK A;  1WOU A;  1BQ7 A;  2GST A;  4JU5 A;  3TB2 A;  5AN1 A;  2R37 A;  3CSJ A;  2C80 A;  3A2X A;  2LS5 A;  1SYR A;  5KN3 A;  4IBP A;  3Q18 A;  2LRT A;  2DIY A;  4CDO A;  3VPQ A;  4F0B A;  3G7J A;  3UJ1 A;  2R0C A;  1B9Y C;  4MF5 A;  3QD9 A;  4ZL9 A;  1PKZ A;  3OR5 A;  1PKW A;  4RI7 A;  3F4R A;  3LYK A;  4OCF A;  2J9H A;  2YOI A;  2KLX A;  4PQ1 A;  1SJI A;  1K0B A;  3LOR A;  4NXI A;  1TW9 A;  3E0U A;  3EYT A;  3I69 A;  1SK1 A;  3TKP A;  2LNT A;  1ZYN A;  2B1L A;  3FY7 A;  4DSS B;  2OAC A;  3CSH A;  1SEN A;  5HR0 A;  3APS A;  3J7Y b;  5IMF A;  2DML A;  4I5Q A;  4XS6 A;  2OE1 A;  2AUV A;  4POB A;  3VWU A;  2B1K A;  5ECO B;  4KSO A;  1TK0 B;  4Q5F A;  3F3R A;  3ZZX A;  3FR3 A;  3DML A;  1BX9 A;  1K0C A;  1F6M C;  3ZL5 A;  4X4J A;  3TGZ A;  5ECS A;  4N0V A;  3L9S A;  1K3Y A;  1B48 A;  3LWA A;  2H1G A;  1A23 A;  4MF7 A;  5H5R A;  4HOJ A;  5DAK A;  3UOM A;  1A0F A;  2LQQ A;  5IPG A;  4MP4 A;  2P5Q A;  3SBC A;  2R2J A;  3DVX A;  3LG6 A;  4RUV A;  1YJ6 A;  1G7E A;  4OO5 A;  4MJC A;  1B8X A;  1IYI A;  5ENU A;  2DJJ A;  2CVD A;  3IOS A;  3EVI A;  3WGD A;  2X64 A;  1K3L A;  1PRX A;  2FY6 A;  4NMU A;  3P7X A;  4ZB9 A;  4ULX A;  1N8J A;  3HVV A;  2B7J A;  4O32 A;  4KCA A;  4KGI A;  4ECI A;  4N0Z A;  1Z6N A;  5DJM A;  5C00 A;  1M3I A;  5HR1 A;  3R2Q A;  2D2Z A;  4WF5 A;  1DE1 A;  4PNG A;  3VUR A;  2R0G A;  4GSS A;  4HQS A;  3TJF A;  1G7O A;  4Q5R A;  4EL1 A;  3CMI A;  4G9H A;  1AC1 A;  5FT3 A;  3IDV A;  2C3Q A;  1X5C A;  4Z2R A;  6GSU A;  2EIQ A;  4NV2 A;  3GN3 A;  2A2R A;  4TOP A;  3F4T A;  3QCP A;  1BJX A;  1TRW A;  2JZR A;  3FZ5 A;  3F6D A;  3CTF A;  1OC9 A;  2ZUP A;  1M7T A;  3VI5 A;  3APQ A;  3WYW A;  4G2E A;  2FWH A;  2VL2 A;  1WP0 A;  2CX4 A;  2WB9 A;  2YJH A;  2WCI A;  4XTS A;  4XS1 A;  4IP6 A;  5DAK B;  1QXH A;  1JZR A;  1AQV A;  1K0D A;  1G6Y A;  3L9V A;  3ZYW A;  1E2Y A;  3HVS A;  1T7P B;  1MEK A;  1TK8 B;  1QMV A;  2K8V A;  4BVY A;  2PER A;  2VAF A;  5H5Q A;  4I6X A;  1EP8 A;  1AAZ A;  6GSW A;  5CAX A;  1DE2 A;  4MF6 A;  4I8B A;  3CSI A;  2TRX A;  3GTU A;  2CQ9 A;  3H1N A;  5GAN D;  2RLI A;  1EOG A;  1WMJ A;  1HNC A;  3SWL A;  1A2L A;  3M1G A;  3HY2 A;  6GSY A;  5ECM B;  4MK3 A;  4F2I A;  2C0E A;  1USB A;  3BBY A;  2A2S A;  3VWX A;  2RUF A;  5D9V A;  2AYT A;  1WIK A;  1MDK A;  4TW5 A;  4JED A;  4KUN A;  1EWX A;  2HZF A;  2ES7 A;  3C73 A;  1VF4 A;  2VD0 A;  2P0G A;  4FH8 A;  3MYD A;  1VF1 A;  3IR4 A;  5IIZ A;  2PWJ A;  4K2D A;  5G31 A;  2B3S A;  2K6V A;  4K1F A;  5A5K A;  4ML1 A;  2HT9 A;  3KZQ A;  1XCC A;  2H74 A;  5KOW A;  2H6X A;  2WRT A;  1OC9 B;  2YN1 A;  1U88 A;  2L59 A;  3TKQ A;  4ZL7 A;  3H8Q A;  2F3M A;  1THO A;  4IJ3 A;  3C7M A;  3D0Z A;  2GSS A;  3L9U A;  2FWE A;  2YZU A;  3ZRE A;  1W89 A;  4BL7 A;  1YEX A;  3DD3 A;  3WGX A;  1ERV A;  1ERU A;  5ECL B;  4HEA 2;  4ICY A;  1OC3 A;  3O76 A;  4BA7 A;  5HFG A;  4BPY A;  4Z2T A;  1PMT A;  3ED3 A;  1ZCP A;  1OKD A;  1K0O A;  4EO3 A;  2JSZ A;  1YY7 A;  2HXK A;  1OC8 A;  2C0D A;  2FCH A;  2UZ8 A;  1XOB A;  5L71 A;  4OWY A;  2B6M A;  2A2P A;  4BVY B;  1XFL A;  1RQM A;  2VLV A;  4ZB6 A;  3A5W A;  4G10 A;  4TKY A;  2AHE A;  4K7I A;  4HU7 A;  1GSQ A;  1H4O A;  3GTU B;  1WPI A;  2V32 A;  4AF2 A;  2WFC A;  1OKT A;  5IMC A;  1U87 A;  1GUL A;  4LL1 B;  5G5E A;  4K7O A;  1ON4 A;  1YKC A;  4N10 A;  3I6A A;  4ZXG A;  1W4V A;  1SK0 A;  2JU5 A;  4GF0 A;  4USS A;  4K0N A;  4TRX A;  2HRK A;  4YKG A;  4EKZ A;  2NBS A;  4EC0 A;  2GS3 A;  4L0W A;  1JLV A;  1OE7 A;  4WET A;  2V6K A;  4F03 A;  5DQS A;  1X9M B;  3RAZ A;  2GZP A;  4GRF A;  19GS A;  2H75 A;  4EDY A;  4PUF C;  2V1M A;  4IW9 A;  2OJL A;  3PPU A;  1PN9 A;  4PXO A;  1GTA A;  3QAV A;  1TDI A;  2OKA A;  1UA5 A;  5IMZ A;  1U6T A;  3A3T A;  4K0G A;  1R4W A;  3D4T A;  3TJK A;  4O5U A;  1A0R P;  1Y6E A;  3HVX A;  3RBT A;  2R0P A;  1AUC A;  2YP6 A;  4NHW A;  4XRA A;  2OE3 A;  3PIN A;  1JLW A;  4F0C A;  2KHP A;  3IC8 A;  6GSS A;  4MJA A;  3LJR A;  3QFA C;  2DIZ A;  5ECQ B;  2GLR A;  2YCD A;  5A4U A;  3DWV A;  3IHQ A;  3GST A;  2MMA A;  5ECP B;  1PA3 A;  1OYJ A;  3W8S A;  4K5R A;  1F3B A;  3KD0 A;  1ZOF A;  2PUK C;  4HJ2 A;  4WBR D;  1Z9H A;  5B8A A;  3TDG A;  1XXU A;  3GKX A;  4KDU A;  5JWR B;  2DLX A;  2NPB A;  3KM6 A;  5CO3 A;  4GXZ A;  3V1W A;  4XIH A;  2PGT A;  2GDR A;  2LQO A;  4GLT A;  1XW6 A;  5KN1 A;  2HLS A;  3CYN A;  4JBB A;  5DCH A;  5DAL A;  2QA2 A;  3TCO A;  1M2D A;  1ZYE A;  2X4A A;  4RI6 A;  3CTG A;  9GSS A;  4NV5 A;  3J7Y k;  3DYR A;  4POL A;  4ML6 A;  1R5A A;  1AW9 A;  4PNF A;  5IM9 A;  1ZMA A;  2PU9 C;  5G2Z A;  4E8H A;  1HNB A;  1T4Z A;  4EUY A;  4L0U A;  2MMN A;  4JZQ A;  1PN0 A;  3GL5 A;  1AXD A;  2GVP A;  3ZVJ D;  2DSA A;  2H71 A;  2MMZ A;  1JZD A;  4POK A;  5D9W A;  5JWO B;  2FWF A;  5F0G A;  1S3C A;  4K2X A;  1AQW A;  1JHB A;  5JWQ B;  4BVX A;  5GSS A;  3AY8 A;  8GSS A;  1FOH A;  3TUE A;  3M3M A;  5E59 A;  1XG8 A;  1N2A A;  4CY6 A;  4HDE A;  3NZN A;  3Q74 A;  4MZW A;  4MA9 A;  2QKE A;  2CA8 A;  3IAM 2;  3PH9 A;  1MD4 A;  4YQU A;  1V9W A;  1SK2 A;  5INY A;  3LQ7 A;  4ID0 A;  3DKS A;  4H86 A;  1O85 A;  2YWN A;  4CW9 A;  3ERG A;  5J9B A;  2R6K A;  2RUE A;  3RDW A;  3HYP A;  2CVB A;  2O7K A;  3H93 A;  4YAV A;  3ISO A;  1NHY A;  5DAL B;  2XPD A;  5DBQ A;  1ERT A;  3E9J B;  1PGT A;  2N5B A;  4X43 A;  2YWI A;  4LMV A;  4TXO A;  3UEM A;  3G7I A;  2MZC A;  4KDY A;  3KMO A;  4MNN A;  1X5E A;  2LRN A;  1ZL9 A;  1ZGN A;  5DJL A;  4WEY A;  5ECN B;  5A4V A;  3FRC A;  2GT5 A;  1GH2 A;  4OCE A;  3GX8 A;  1A24 A;  2I4A A;  1U3I A;  2M46 A;  2EIR A;  1GLQ A;  2C0F A;  3P2A A;  4PUA A;  4ISD A;  4KCE A;  4IEL A;  3FW2 A;  1AQX A;  2CAI A;  3C71 A;  1GSU A;  2OAD A;  4BVX B;  2OA7 A;  1T4Y A;  4FIW A;  4GST A;  3DVW A;  4OFT A;  4A5P A;  3CXG A;  1SKS B;  2EC4 A;  2HSY A;  1A2J A;  2K8S A;  1EV4 A;  2B5X A;  2WS2 A;  4QL9 A;  3S9F A;  2REM A;  1PSQ A;  4EF0 A;  4RQX A;  1KEB A;  3IAS 2;  1GNW A;  3KIJ A;  4BIK A;  1GSS A;  3FKF A;  1T3B A;  5JCW A;  3VWV A;  2JL4 A;  4MLY A;  3CBU A;  3KH7 A;  2ON5 A;  1TRV A;  2FLS A;  2MBS A;  1E6B A;  4DEJ A;  1T00 A;  5CRD A;  5EPF A;  4BWS A;  2ON7 A;  4O92 A;  2VLU A;  1Z3E A;  3RPP A;  1O8W A;  1LBK A;  2YJ7 A;  2NVL A;  3TKS A;  2XBQ A;  4O5R A;  1XBS A;  1TP9 A;  4TXO B;  1VGL A;  2N5F A;  1M0U A;  3GFK A;  4J2F A;  2G0F A;  4L5O A;  1EGR A;  1O8X A;  5ID2 A;  1EZK A;  1O6J A;  2J23 A;  4QQ7 A;  2H0I A;  18GS A;  2QA1 A;  3A5I A;  4FQU A;  3UAR A;  5DDL A;  1URM A;  3LGC A;  4JR6 A;  2YV9 A;  4L5L A;  3H4K A;  2O87 A;  3QPM A;  4IKH A;  1TJD A;  3UVT A;  2MBT A;  2OE0 A;  1FAA A;  2V41 A;  5KEJ A;  3QMX A;  4HI7 A;  3IXR A;  3FR9 A;  1A2M A;  2QC7 A;  2HSH A;  4MPG A;  12GS A;  3ME7 A;  3ZML A;  4YH2 A;  1WJK A;  3FYG A;  2BJX A;  2VCV A;  5DQY A;  4MDC A;  2FGX A;  2PVQ A;  4PQH A;  2VCT A;  3PR8 A;  2NDO A;  4OMV A;  5HQP A;  2JAD A;  2O85 A;  3IV4 A;  4FYU A;  4KH7 A;  5IMV A;  5CYY A;  1DSB A;  4X1U A;  3ZIJ A;  2YV7 A;  4MMM A;  2CZ2 A;  2F8F A;  1B9X C;  3Q19 A;  2H1B A;  5A4W A;  2C0G A;  1DUG A;  2KOK A;  2ZCT A;  1ZYQ B;  1B4P A;  2Z9S A;  3A2W A;  5G1K A;  4V1A p;  3US3 A;  3C1S A;  5LD0 A;  4JR4 A;  2LJR A;  4G0L A;  1GNE A;  2L6C A;  2L57 A;  3LXT A;  4CY8 A;  2H01 A;  4MJB A;  3P90 A;  1GUM A;  4KX4 A;  2RII A;  2L4C A;  2A4V A;  4Q5N A;  6GST A;  4TR1 A;  2C3N A;  2X8G A;  3GKN A;  4IHU A;  2BMX A;  1BYE A;  1DBY A;  1GUK A;  3U6V A;  5AIS A;  2PVO C;  5AGY A;  5C04 A;  3UL3 A;  5B6N A;  2LUS A;  5JCG A;  3R3E A;  1G6W A;  4KSM A;  4KND A;  3TRQ A;  1XOA A;  4KAE A;  1R5P A;  3F0I A;  3HKR A;  1NM3 A;  2YAN A;  3C1R A;  2HZE A;  2C1Y A;  2LRC A;  2IMF A;  3KP8 A;  2R4V A;  1MDI A;  3HJM A;  1QK8 A;  5IMA A;  1J08 A;  2HSM A;  5BRT A;  2VIM A;  1X9W B;  3D22 A;  1F37 A;  5CRW A;  3EMX A;  4TVE A;  1R7H A;  4NWY A;  1JFU A;  3KGK A;  3IHG A;  1XVQ A;  3ZMK A;  2WZ9 A;  4AJ8 A;  1H75 A;  2HRF A;  2DJ3 A;  4JE1 A;  2H6Y A;  1TOF A;  3EMP A;  4TN8 A;  1ERW A;  3EUR A;  1XW9 A;  3TKS C;  1FO5 A;  2VLT A;  3HZ8 A;  2LNS A;  4MH3 A;  2L4Q A;  4TR1 B;  3DEX A;  3HJP A;  3WT2 A;  2CX3 A;  4MCU A;  2H30 A;  3I43 A;  2FA4 A;  1BED A;  2E7P A;  3FMW A;  1NSW A;  1K0N A;  4IN0 A;  4V2M A;  1KBN A;  3EE2 A;  4GSN A;  5HR3 A;  3GKM A;  3KH9 A;  2JZT A;  1M99 A;  1OAZ A;  22GS A;  1CQG A;  2C4J A;  3O3T A;  2H73 A;  2VL3 A;  2IMD A;  2IWT A;  2VM1 A;  1PL2 A;  2RM5 A;  1M2A A;  4BL7 B;  3M9J A;  1YDK A;  2RM6 A;  2HZE B;  1GLP A;  1MD3 A;  3KTB A;  5CRE A;  2N5A A;  1ML6 A;  5AIX A;  2P5R A;  2VOC A;  4KA0 A;  4EIQ A;  1TU7 A;  1EEM A;  1XWC A;  4ZIJ A;  2FUG 2;  1M2B A;  3N5O A;  3GUS A;  1O73 A;  2QSI A;  5D73 A;  3ZIV A;  3MIX A;  4E8E A;  2IN3 A;  4TR3 A;  3FK8 A;  3L0H A;  1T8E B;  4POM A;  2IJY A;  1PFO A;  5ECH B;  1KTE A;  5GST A;  4ZBD A;  1LJR A;  3VPT A;  1SKR B;  1A8Y A;  1I5G A;  2H6Z A;  4LMW A;  5G1L A;  4IVF A;  3M0F A;  2DJK A;  3GL3 A;  4KE3 A;  1XW5 A;  6GSV A;  1LU4 A;  5ECK B;  1WWJ A;  1FVJ A;  2K18 A;  1SU9 A;  2VL9 A;  1TRS A;  2XBI A;  1VF3 A;  1BG5 A;  4DSQ A;  3FZA A;  2DJ1 A;  2DMM A;  1GTU A;  1S3R A;  1Z7P A;  3CQF A;  1U3A A;  2B5Y A;  3HJO A;  3K8N A;  3D5J A;  1SD9 A;  4AGS A;  1THX A;  1GRX A;  1YEP A;  3QOU A;  3BD2 A;  3IC4 A;  2DKI A;  3ERF A;  5GAP D;  4IGJ A;  3FR6 A;  3HD5 A;  4N30 A;  4V2N A;  1PX7 A;  5CP1 A;  2FD3 A;  3MDK A;  3IK9 A;  20GS A;  4OO4 A;  3TOT A;  4MPF A;  5ELA A;  2H0G A;  3HXS A;  2FWG A;  2LEG A;  2I9H A;  3L78 A;  1PL1 A;  3ZLP A;  1TRU A;  5B8B A;  1EEJ A;  2I1U A;  4HU9 A;  3G9B A;  2F8A A;  1GSF A;  1QQ2 A;  1FOV A;  3LEF A;  4OFM A;  4EVM A;  5D9T A;  5JCU A;  1GSY A;  4ZBB A;  3W8J A;  4TXV A;  4O7H A;  1X0R A;  3UAP A;  2R5G A;  2LKU A;  3KMN A;  4ECB A;  3ZFB A;  5J41 A;  1YKA A;  4WR5 A;  4HZ4 A;  4AJ6 A;  5CRG A;  2GZY A;  3DIE A;  1V58 A;  4L8E A;  1SYX A;  2YNX A;  4IP1 A;  5F8B A;  4J57 E;  1BAY A;  5KOX A;  3GNJ A;  2HFD A;  2YWM A;  5D93 A;  3EC3 A;  1PD2 1;  2M80 A;  5D8I A;  2DJ0 A;  3MWH A;  5H5S A;  3WGE A;  2IMK A;  5CRH A;  1XIY A;  2OBK A;  3HHV A;  3F63 A;  1XWB A;  5BMU A;  4P3Y B;  2YPM A;  2YZH A;  1F3A A;  3HCZ A;  5IOW A;  2VUP A;  3TRX A;  1AIU A;  1GTB A;  2E2G A;  5ECR B;  3IRA A;  2F51 A;  1A8L A;  13GS A;  3LXZ A;  2HRA A;  2JAC A;  4PUR A;  2ALB A;  3UBK A;  3WT1 A;  3D21 A;  2GQK A;  2G2Q A;  4EDZ A;  1SL1 B;  3UVH A;  1V98 A;  1HNA A;  1S3A A;  1TTZ A;  4KW6 A;  1M9A A;  1RW1 A;  1XVW A;  4LA1 A;  4MZB A;  1JZW A;  1ZZY A;  5DVB A;  2IME A;  3KXO A;  4I2U A;  3H79 A;  2DJ2 A;  3FEU A;  3BCK A;  1EGO A;  2K9F A;  4KF9 A;  2OBI A;  1F2E A;  1F9M A;  3ERW A;  4DVC A;  4Q5Q A;  2FNO A;  4DSR A;  1FB0 A;  2A4H A;  5J4U A;  3F6F A;  3TRP A;  4EXJ A;  3TJB A;  4Z7X A;  1VRS D;  3DGQ A;  4F82 A;  3NOF A;  3ZTL A;  1K0A A;  1JZO A;  5B7C A;  4K5S A;  1SJZ A;  5ABR A;  4NAX A;  3KTL A;  1SKW B;  4IQA A;  5LCZ A;  1UN2 A;  3TJG A;  4BWQ A;  4FYB A;  2X8C A;  1FG4 A;  5EVO A;  14GS A;  4I97 A;  1VF2 A;  4V2L A;  5D96 A;  2GQM A;  5AIV A;  4TR4 A;  3IA1 A;  3ZFL A;  3G7Y A;  3VI7 A;  3QFB C;  2JZS A;  11GS A;  2C8U A;  4FYC A;  1YF1 A;  4K7N A;  2GQL A;  1QFN A;  2H66 A;  1M3J A;  3IBH A;  1B4Q A;  1PX6 A;  1Z7R A;  4OD7 A;  2CV4 A;  3F3Q A;  4ACS A;  2HYX A;  4YQV A;  1SD8 A;  4XHM A;  4PGT A;  4IS0 A;  2H8L A;  4MJE A;  2XHF A;  2GGT A;  2X99 A;  1GSE A;  4JRR A;  4WR4 A;  2CVK A;  1YZX A;  1YQ1 A;  5LNK e;  7GSS A;  5EL8 A;  2I81 A;  3QAG A;  4NHZ A;  1NHO A;  2O8V B;  2HE3 A;  3GIX A;  3VWW A;  1GL8 A;  3D6I A;  2IL3 A;  3U5R E;  4ZB8 A;  1Z6M A;  5IO2 A;  2H72 A;  2YWO A;  5E4W A;  1XZO A;  2H70 A;  2AJQ B;  3GUR A;  2DBC A;  1C72 A;  3MNG A;  3UBL A;  1FHE A;  5F06 A;  2H1D A;  2AAW A;  5IPH A;  10GS A;  2H1A A;  3GH6 A;  1FW1 A;  2DC5 A;  2WUL A;  2EIO A;  2L5O A;  5ECI B;  1YF0 A;  3RHC A;  1Q98 A;  2VCQ A;  1UVZ A;  1O7U A;  4ZL8 A;  2L5L A;  2I3Y A;  3W6G A;  1TXX A;  5ID2 B;  4GCI A;  4Z2U A;  1TK5 B;  2X49 A;  4G19 A;  4QL7 A;  2VD1 A;  2KP1 A;  3HA9 A;  2LV3 A;  2JSY A;  2NTO A;  3ZRD A;  2E0Q A;  3RPN A;  2LJA A;  4NPB A;  1MDJ A;  5EY6 A;  2DKH A;  3TJJ A;  1GP1 A;  2H76 A;  4D73 A;  1QGV A;  3IK7 A;  3KEB A;  3TKR A; 
#chains in the Genus database with same CATH homology
 2GTU A;  2IPA A;  3BOA A;  5FWG A;  1Y25 A;  4TR0 A;  3GX0 A;  1X5D A;  1SL2 B;  4GTU A;  5CNW A;  4YAP A;  3NIV A;  3GHA A;  4MAB A;  2PMT A;  2VCX A;  16GS A;  3EU4 A;  4AJ7 A;  3DXB A;  2HI7 A;  5FHI A;  4XS4 A;  2VCZ A;  2XPE A;  1FVK A;  5J9C A;  1WRY A;  2LJK A;  3LFL A;  1ZYP A;  2H0H A;  4WKW A;  3F9U A;  4GQC A;  1NW2 A;  2E2M A;  3M9K A;  4MZC A;  3N9J A;  3GH9 A;  4GQF A;  1HYU A;  4XRD A;  5F05 A;  2FHE A;  2TIR A;  1CQH A;  2LST A;  4J56 E;  1M9B A;  2KUC A;  5J5N A;  1TI1 A;  3ZIT A;  1TKD B;  2R3X A;  2VO4 A;  3D4M A;  3GRX A;  4WBJ A;  1EV9 A;  2GZZ A;  5F07 A;  3EU3 A;  5GZZ B;  3RHB A;  1PQN A;  2VCW A;  2IIY A;  3TKS E;  1X9S B;  3GMF A;  2ZNM A;  3FZ4 A;  3Q6O A;  4WF4 A;  4IQ1 A;  1HD2 A;  1T1V A;  2WJU A;  4D73 B;  2AB6 A;  2B7K A;  3GV1 A;  4EE0 A;  3FHK A;  3O6T A;  5ELG A;  5KN0 A;  3E3E A;  1ABA A;  5D9X A;  2FA8 A;  1Z5Y E;  3P8W A;  5KN2 A;  2GSQ A;  3APO A;  1GSD A;  3GSS A;  1GUH A;  1XWK A;  3CRU A;  3QAW A;  4F9Z A;  2PPT A;  2IFQ A;  5IMD A;  1MTC A;  1G0T A;  3CRT A;  3F8U A;  4G0I A;  3EWL A;  4XS4 B;  1V40 A;  5HFI A;  3UIW A;  2X8H A;  1IYH A;  4G0K A;  2LTK A;  1SL0 B;  1EP7 A;  3F4S A;  3VK9 A;  1QUW A;  1TU8 A;  4HS1 A;  3I9V 2;  3VFI A;  1GWC A;  2IMI A;  2AV4 A;  3DRN A;  4K8M A;  2QGV A;  2WDU A;  3BJ5 A;  1J9B A;  2V6O A;  4KDX A;  2VL2 C;  3GYK A;  2L6D A;  1S3D A;  2GSR A;  5G30 A;  4MH2 A;  3GA4 A;  3IE3 A;  1O81 A;  2PBJ A;  2VM2 A;  5HFK A;  2XC2 A;  4O5Q A;  2V2G A;  1XWG A;  4V1A g;  4EIP A;  4LLR A;  3LYP A;  3HZ4 A;  3VLN A;  17GS A;  3KCM A;  3C8E A;  2HRN A;  5DCG A;  1V57 A;  3BCI A;  4GWR A;  4PTS A;  4N11 A;  2TRC P;  3HDC A;  3ME8 A;  3UMA A;  5IQY A;  4K9Z A;  3L4N A;  3ZVJ A;  4WXT A;  1OE8 A;  4ECC A;  1RK4 A;  3QR6 A;  3LSZ A;  4LL4 B;  3GKK A;  4ILF A;  4RQR A;  2WGR A;  2CZ3 A;  1R26 A;  3A2V A;  4HJM A;  3EIN A;  4OFN A;  4PX1 A;  2IFQ B;  1K3O A;  1HQO A;  2CT6 A;  3TOU A;  2F9S A;  4ZIL A;  2KP2 A;  3QDN A;  3WD6 A;  6GSX A;  4K6X A;  1TI3 A;  1Q4J A;  2O89 A;  3KJY A;  3M8N A;  5B6M A;  4XCS A;  4HZ2 A;  1XPV A;  4DSS A;  1FB6 A;  1SJ6 A;  2MYG A;  2HNL A;  3EPT A;  4HQZ A;  3LW9 A;  2B5E A;  2GT6 A;  2PN8 A;  1UC7 A;  3KP9 A;  2H19 A;  3FZ9 A;  3IPZ A;  4FO5 A;  4IJI A;  2C3T A;  3MSZ A;  5J3R A;  3PGT A;  5G5F A;  4ECJ A;  4PQI A;  1WE0 A;  5COH A;  5IOX A;  3JCM L;  2MMO A;  4X0X A;  1GTI A;  1KNG A;  1V2A A;  2BTO T;  4ZBA A;  4CHS A;  1I9D A;  2CAQ A;  1OVN A;  5IO0 A;  4KB3 A;  1K0M A;  2M72 A;  4HUA A;  4I2T A;  5HR2 A;  1J0F A;  1EOH A;  1ACV A;  4YKF A;  4YQM A;  1XWA A;  2P31 A;  1ILO A;  1ST9 A;  3MAK A;  1WOU A;  1BQ7 A;  2GST A;  4JU5 A;  3TB2 A;  5AN1 A;  2R37 A;  3CSJ A;  2C80 A;  3A2X A;  2LS5 A;  1SYR A;  5KN3 A;  4IBP A;  3Q18 A;  2LRT A;  2DIY A;  4CDO A;  3VPQ A;  4F0B A;  3G7J A;  3UJ1 A;  2R0C A;  1B9Y C;  4MF5 A;  3QD9 A;  4ZL9 A;  1PKZ A;  3OR5 A;  1PKW A;  4RI7 A;  3F4R A;  3LYK A;  4OCF A;  2J9H A;  2YOI A;  2KLX A;  4PQ1 A;  1SJI A;  1K0B A;  3LOR A;  4NXI A;  1TW9 A;  3E0U A;  3EYT A;  3I69 A;  1SK1 A;  3TKP A;  2LNT A;  1ZYN A;  2B1L A;  3FY7 A;  4DSS B;  2OAC A;  3CSH A;  1SEN A;  5HR0 A;  3APS A;  3J7Y b;  5IMF A;  2DML A;  4I5Q A;  4XS6 A;  2OE1 A;  2AUV A;  4POB A;  3VWU A;  2B1K A;  5ECO B;  4KSO A;  1TK0 B;  4Q5F A;  3F3R A;  3ZZX A;  3FR3 A;  3DML A;  1BX9 A;  1K0C A;  1F6M C;  3ZL5 A;  4X4J A;  3TGZ A;  5ECS A;  4N0V A;  3L9S A;  1K3Y A;  1B48 A;  3LWA A;  2H1G A;  1A23 A;  4MF7 A;  5H5R A;  4HOJ A;  5DAK A;  3UOM A;  1A0F A;  2LQQ A;  5IPG A;  4MP4 A;  2P5Q A;  3SBC A;  2R2J A;  3DVX A;  3LG6 A;  4RUV A;  1YJ6 A;  1G7E A;  4OO5 A;  4MJC A;  1B8X A;  1IYI A;  5ENU A;  2DJJ A;  2CVD A;  3IOS A;  3EVI A;  3WGD A;  2X64 A;  1K3L A;  1PRX A;  2FY6 A;  4NMU A;  3P7X A;  4ZB9 A;  4ULX A;  1N8J A;  3HVV A;  2B7J A;  4O32 A;  4KCA A;  4KGI A;  4ECI A;  4N0Z A;  1Z6N A;  5DJM A;  5C00 A;  5HR1 A;  3R2Q A;  2D2Z A;  4WF5 A;  1DE1 A;  4PNG A;  3VUR A;  2R0G A;  4GSS A;  4HQS A;  3TJF A;  1G7O A;  4Q5R A;  4EL1 A;  3CMI A;  4G9H A;  1AC1 A;  5FT3 A;  3IDV A;  2C3Q A;  1X5C A;  4Z2R A;  6GSU A;  2EIQ A;  4NV2 A;  3GN3 A;  2A2R A;  4TOP A;  3F4T A;  3QCP A;  1BJX A;  1TRW A;  2JZR A;  3FZ5 A;  3F6D A;  3CTF A;  1OC9 A;  2ZUP A;  1M7T A;  3VI5 A;  3APQ A;  3WYW A;  4G2E A;  2FWH A;  2VL2 A;  1WP0 A;  2CX4 A;  2WB9 A;  2YJH A;  2WCI A;  4XTS A;  4XS1 A;  4IP6 A;  5DAK B;  1QXH A;  1JZR A;  1AQV A;  1K0D A;  1G6Y A;  3L9V A;  3ZYW A;  1E2Y A;  3HVS A;  1T7P B;  1MEK A;  1TK8 B;  1QMV A;  2K8V A;  4BVY A;  2PER A;  2VAF A;  5H5Q A;  4I6X A;  1EP8 A;  1AAZ A;  6GSW A;  5CAX A;  1DE2 A;  4MF6 A;  4I8B A;  3CSI A;  2TRX A;  3GTU A;  2CQ9 A;  3H1N A;  5GAN D;  2RLI A;  1EOG A;  1WMJ A;  1HNC A;  3SWL A;  1A2L A;  3M1G A;  3HY2 A;  6GSY A;  5ECM B;  4MK3 A;  4F2I A;  2C0E A;  1USB A;  3BBY A;  2A2S A;  3VWX A;  2RUF A;  5D9V A;  2AYT A;  1WIK A;  1MDK A;  4TW5 A;  4JED A;  4KUN A;  1EWX A;  2HZF A;  2ES7 A;  3C73 A;  1VF4 A;  2VD0 A;  2P0G A;  4FH8 A;  3MYD A;  1VF1 A;  3IR4 A;  5IIZ A;  2PWJ A;  4K2D A;  5G31 A;  2B3S A;  2K6V A;  4K1F A;  5A5K A;  4ML1 A;  2HT9 A;  3KZQ A;  1XCC A;  2H74 A;  5KOW A;  2H6X A;  2WRT A;  1OC9 B;  2YN1 A;  1U88 A;  2L59 A;  3TKQ A;  4ZL7 A;  3H8Q A;  2F3M A;  1THO A;  4IJ3 A;  3C7M A;  3D0Z A;  2GSS A;  3L9U A;  2FWE A;  2YZU A;  3ZRE A;  1W89 A;  4BL7 A;  1YEX A;  3DD3 A;  3WGX A;  1ERV A;  1ERU A;  5ECL B;  4HEA 2;  4ICY A;  1OC3 A;  3O76 A;  4BA7 A;  5HFG A;  4BPY A;  4Z2T A;  1PMT A;  3ED3 A;  1ZCP A;  1OKD A;  1K0O A;  4EO3 A;  2JSZ A;  1YY7 A;  2HXK A;  1OC8 A;  2C0D A;  2FCH A;  2UZ8 A;  1XOB A;  5L71 A;  4OWY A;  2B6M A;  2A2P A;  4BVY B;  1XFL A;  1RQM A;  2VLV A;  4ZB6 A;  3A5W A;  4G10 A;  4TKY A;  2AHE A;  4K7I A;  4HU7 A;  1GSQ A;  1H4O A;  3GTU B;  1WPI A;  2V32 A;  4AF2 A;  2WFC A;  1OKT A;  5IMC A;  1U87 A;  1GUL A;  4LL1 B;  5G5E A;  4K7O A;  1ON4 A;  1YKC A;  4N10 A;  3I6A A;  4ZXG A;  1W4V A;  1SK0 A;  2JU5 A;  4GF0 A;  4USS A;  4K0N A;  4TRX A;  2HRK A;  4YKG A;  4EKZ A;  2NBS A;  4EC0 A;  2GS3 A;  4L0W A;  1JLV A;  1OE7 A;  4WET A;  2V6K A;  4F03 A;  5DQS A;  1X9M B;  3RAZ A;  2GZP A;  4GRF A;  19GS A;  2H75 A;  4EDY A;  4PUF C;  2V1M A;  4IW9 A;  2OJL A;  3PPU A;  1PN9 A;  4PXO A;  1GTA A;  3QAV A;  1TDI A;  2OKA A;  1UA5 A;  5IMZ A;  1U6T A;  3A3T A;  4K0G A;  1R4W A;  3D4T A;  3TJK A;  4O5U A;  1A0R P;  1Y6E A;  3HVX A;  3RBT A;  2R0P A;  1AUC A;  2YP6 A;  4NHW A;  4XRA A;  2OE3 A;  3PIN A;  1JLW A;  4F0C A;  2KHP A;  3IC8 A;  6GSS A;  4MJA A;  3LJR A;  3QFA C;  2DIZ A;  5ECQ B;  2GLR A;  2YCD A;  5A4U A;  3DWV A;  3IHQ A;  3GST A;  2MMA A;  5ECP B;  1PA3 A;  1OYJ A;  3W8S A;  4K5R A;  1F3B A;  3KD0 A;  1ZOF A;  2PUK C;  4HJ2 A;  4WBR D;  1Z9H A;  5B8A A;  3TDG A;  1XXU A;  3GKX A;  4KDU A;  5JWR B;  2DLX A;  2NPB A;  3KM6 A;  5CO3 A;  4GXZ A;  3V1W A;  4XIH A;  2PGT A;  2GDR A;  2LQO A;  4GLT A;  1XW6 A;  5KN1 A;  2HLS A;  3CYN A;  4JBB A;  5DCH A;  5DAL A;  2QA2 A;  3TCO A;  1M2D A;  1ZYE A;  2X4A A;  4RI6 A;  3CTG A;  9GSS A;  4NV5 A;  3J7Y k;  3DYR A;  4POL A;  4ML6 A;  1R5A A;  1AW9 A;  4PNF A;  5IM9 A;  1ZMA A;  2PU9 C;  5G2Z A;  4E8H A;  1HNB A;  1T4Z A;  4EUY A;  4L0U A;  2MMN A;  4JZQ A;  1PN0 A;  3GL5 A;  1AXD A;  2GVP A;  3ZVJ D;  2DSA A;  2H71 A;  2MMZ A;  1JZD A;  4POK A;  5D9W A;  5JWO B;  2FWF A;  5F0G A;  1S3C A;  4K2X A;  1AQW A;  1JHB A;  5JWQ B;  4BVX A;  5GSS A;  3AY8 A;  8GSS A;  1FOH A;  3TUE A;  3M3M A;  5E59 A;  1N2A A;  4CY6 A;  4HDE A;  3NZN A;  3Q74 A;  4MZW A;  4MA9 A;  2QKE A;  2CA8 A;  3IAM 2;  3PH9 A;  1MD4 A;  4YQU A;  1V9W A;  1SK2 A;  5INY A;  3LQ7 A;  4ID0 A;  3DKS A;  4H86 A;  1O85 A;  2YWN A;  4CW9 A;  3ERG A;  5J9B A;  2R6K A;  2RUE A;  3RDW A;  3HYP A;  2CVB A;  2O7K A;  3H93 A;  4YAV A;  3ISO A;  1NHY A;  5DAL B;  2XPD A;  5DBQ A;  1ERT A;  3E9J B;  1PGT A;  2N5B A;  4X43 A;  2YWI A;  4LMV A;  4TXO A;  3UEM A;  3G7I A;  2MZC A;  4KDY A;  3KMO A;  4MNN A;  1X5E A;  2LRN A;  1ZL9 A;  1ZGN A;  5DJL A;  4WEY A;  5ECN B;  5A4V A;  3FRC A;  2GT5 A;  1GH2 A;  4OCE A;  3GX8 A;  1A24 A;  2I4A A;  1U3I A;  2M46 A;  2EIR A;  1GLQ A;  2C0F A;  3P2A A;  4PUA A;  4ISD A;  4KCE A;  4IEL A;  3FW2 A;  1AQX A;  2CAI A;  3C71 A;  1GSU A;  2OAD A;  4BVX B;  2OA7 A;  1T4Y A;  4FIW A;  4GST A;  3DVW A;  4OFT A;  4A5P A;  3CXG A;  1SKS B;  2EC4 A;  2HSY A;  1A2J A;  2K8S A;  1EV4 A;  2B5X A;  2WS2 A;  4QL9 A;  3S9F A;  2REM A;  1PSQ A;  4EF0 A;  4RQX A;  1KEB A;  3IAS 2;  1GNW A;  3KIJ A;  1GSS A;  3FKF A;  1T3B A;  5JCW A;  3VWV A;  2JL4 A;  4MLY A;  3CBU A;  3KH7 A;  2ON5 A;  1TRV A;  2FLS A;  2MBS A;  1E6B A;  4DEJ A;  1T00 A;  5CRD A;  5EPF A;  4BWS A;  2ON7 A;  4O92 A;  2VLU A;  1Z3E A;  3RPP A;  1O8W A;  1LBK A;  2YJ7 A;  2NVL A;  3TKS A;  2XBQ A;  4O5R A;  1XBS A;  1TP9 A;  4TXO B;  1VGL A;  2N5F A;  1M0U A;  3GFK A;  4J2F A;  2G0F A;  4L5O A;  1EGR A;  1O8X A;  5ID2 A;  1EZK A;  1O6J A;  2J23 A;  4QQ7 A;  2H0I A;  18GS A;  2QA1 A;  3A5I A;  4FQU A;  3UAR A;  5DDL A;  1URM A;  3LGC A;  4JR6 A;  2YV9 A;  4L5L A;  3H4K A;  2O87 A;  3QPM A;  4IKH A;  1TJD A;  3UVT A;  2MBT A;  2OE0 A;  1FAA A;  2V41 A;  5KEJ A;  3QMX A;  4HI7 A;  3IXR A;  3FR9 A;  1A2M A;  2QC7 A;  2HSH A;  4MPG A;  12GS A;  3ME7 A;  3ZML A;  4YH2 A;  1WJK A;  3FYG A;  2BJX A;  2VCV A;  5DQY A;  4MDC A;  2FGX A;  2PVQ A;  4PQH A;  2VCT A;  3PR8 A;  2NDO A;  4OMV A;  5HQP A;  2JAD A;  2O85 A;  3IV4 A;  4FYU A;  4KH7 A;  5IMV A;  5CYY A;  1DSB A;  4X1U A;  3ZIJ A;  2YV7 A;  4MMM A;  2CZ2 A;  2F8F A;  1B9X C;  3Q19 A;  2H1B A;  5A4W A;  2C0G A;  1DUG A;  2KOK A;  2ZCT A;  1ZYQ B;  1B4P A;  2Z9S A;  3A2W A;  5G1K A;  4V1A p;  3US3 A;  3C1S A;  5LD0 A;  4JR4 A;  2LJR A;  4G0L A;  1GNE A;  2L6C A;  2L57 A;  3LXT A;  4CY8 A;  2H01 A;  4MJB A;  3P90 A;  1GUM A;  4KX4 A;  2RII A;  2L4C A;  2A4V A;  4Q5N A;  6GST A;  4TR1 A;  2C3N A;  2X8G A;  3GKN A;  4IHU A;  2BMX A;  1BYE A;  1DBY A;  1GUK A;  3U6V A;  5AIS A;  2PVO C;  5AGY A;  5C04 A;  3UL3 A;  5B6N A;  2LUS A;  5JCG A;  3R3E A;  1G6W A;  4KSM A;  4KND A;  3TRQ A;  1XOA A;  4KAE A;  1R5P A;  3F0I A;  3HKR A;  1NM3 A;  2YAN A;  3C1R A;  2HZE A;  2C1Y A;  2LRC A;  2IMF A;  3KP8 A;  2R4V A;  1MDI A;  3HJM A;  1QK8 A;  5IMA A;  1J08 A;  2HSM A;  5BRT A;  2VIM A;  1X9W B;  3D22 A;  1F37 A;  5CRW A;  3EMX A;  4TVE A;  1R7H A;  4NWY A;  1JFU A;  3KGK A;  3IHG A;  1XVQ A;  3ZMK A;  2WZ9 A;  4AJ8 A;  1H75 A;  2HRF A;  2DJ3 A;  4JE1 A;  2H6Y A;  1TOF A;  3EMP A;  4TN8 A;  1ERW A;  3EUR A;  1XW9 A;  3TKS C;  1FO5 A;  2VLT A;  3HZ8 A;  2LNS A;  4MH3 A;  2L4Q A;  4TR1 B;  3DEX A;  3HJP A;  3WT2 A;  2CX3 A;  4MCU A;  2H30 A;  3I43 A;  2FA4 A;  1BED A;  2E7P A;  3FMW A;  1NSW A;  1K0N A;  4IN0 A;  4V2M A;  1KBN A;  3EE2 A;  4GSN A;  5HR3 A;  3GKM A;  3KH9 A;  2JZT A;  1M99 A;  1OAZ A;  22GS A;  1CQG A;  2C4J A;  3O3T A;  2H73 A;  2VL3 A;  2IMD A;  2IWT A;  2VM1 A;  1PL2 A;  2RM5 A;  1M2A A;  4BL7 B;  3M9J A;  1YDK A;  2RM6 A;  2HZE B;  1GLP A;  1MD3 A;  3KTB A;  5CRE A;  2N5A A;  1ML6 A;  5AIX A;  2P5R A;  2VOC A;  4KA0 A;  4EIQ A;  1TU7 A;  1EEM A;  1XWC A;  4ZIJ A;  2FUG 2;  1M2B A;  3N5O A;  3GUS A;  1O73 A;  2QSI A;  5D73 A;  3ZIV A;  3MIX A;  4E8E A;  2IN3 A;  4TR3 A;  3FK8 A;  3L0H A;  1T8E B;  4POM A;  2IJY A;  5ECH B;  1KTE A;  5GST A;  4ZBD A;  1LJR A;  3VPT A;  1SKR B;  1A8Y A;  1I5G A;  2H6Z A;  4LMW A;  5G1L A;  4IVF A;  3M0F A;  2DJK A;  3GL3 A;  4KE3 A;  1XW5 A;  6GSV A;  1LU4 A;  5ECK B;  1WWJ A;  1FVJ A;  2K18 A;  1SU9 A;  2VL9 A;  1TRS A;  2XBI A;  1VF3 A;  1BG5 A;  4DSQ A;  3FZA A;  2DJ1 A;  2DMM A;  1GTU A;  1Z7P A;  1U3A A;  2B5Y A;  3HJO A;  3K8N A;  3D5J A;  1SD9 A;  4AGS A;  1THX A;  1GRX A;  1YEP A;  3QOU A;  3BD2 A;  3IC4 A;  2DKI A;  3ERF A;  5GAP D;  4IGJ A;  3FR6 A;  3HD5 A;  4N30 A;  4V2N A;  1PX7 A;  5CP1 A;  2FD3 A;  3MDK A;  3IK9 A;  20GS A;  4OO4 A;  3TOT A;  4MPF A;  5ELA A;  2H0G A;  3HXS A;  2FWG A;  2LEG A;  2I9H A;  3L78 A;  1PL1 A;  3ZLP A;  1TRU A;  5B8B A;  1EEJ A;  2I1U A;  4HU9 A;  3G9B A;  2F8A A;  1GSF A;  1QQ2 A;  1FOV A;  3LEF A;  4OFM A;  4EVM A;  5D9T A;  5JCU A;  1GSY A;  4ZBB A;  3W8J A;  4TXV A;  4O7H A;  1X0R A;  3UAP A;  2R5G A;  2LKU A;  3KMN A;  4ECB A;  3ZFB A;  5J41 A;  1YKA A;  4WR5 A;  4HZ4 A;  4AJ6 A;  5CRG A;  2GZY A;  3DIE A;  1V58 A;  4L8E A;  1SYX A;  2YNX A;  4IP1 A;  5F8B A;  4J57 E;  1BAY A;  5KOX A;  3GNJ A;  2HFD A;  2YWM A;  5D93 A;  3EC3 A;  1PD2 1;  2M80 A;  5D8I A;  2DJ0 A;  3MWH A;  5H5S A;  3WGE A;  2IMK A;  5CRH A;  1XIY A;  2OBK A;  3HHV A;  3F63 A;  1XWB A;  5BMU A;  4P3Y B;  2YPM A;  2YZH A;  1F3A A;  3HCZ A;  5IOW A;  2VUP A;  3TRX A;  1AIU A;  1GTB A;  2E2G A;  5ECR B;  3IRA A;  2F51 A;  1A8L A;  13GS A;  3LXZ A;  2HRA A;  2JAC A;  4PUR A;  2ALB A;  3UBK A;  3WT1 A;  3D21 A;  2GQK A;  2G2Q A;  4EDZ A;  1SL1 B;  3UVH A;  1V98 A;  1HNA A;  1S3A A;  1TTZ A;  4KW6 A;  1M9A A;  1RW1 A;  1XVW A;  4LA1 A;  4MZB A;  1JZW A;  1ZZY A;  5DVB A;  2IME A;  3KXO A;  4I2U A;  3H79 A;  2DJ2 A;  3FEU A;  3BCK A;  1EGO A;  2K9F A;  4KF9 A;  2OBI A;  1F2E A;  1F9M A;  3ERW A;  4DVC A;  4Q5Q A;  2FNO A;  4DSR A;  1FB0 A;  2A4H A;  5J4U A;  3F6F A;  3TRP A;  4EXJ A;  3TJB A;  4Z7X A;  1VRS D;  3DGQ A;  4F82 A;  3NOF A;  3ZTL A;  1K0A A;  1JZO A;  5B7C A;  4K5S A;  1SJZ A;  5ABR A;  4NAX A;  3KTL A;  1SKW B;  4IQA A;  5LCZ A;  1UN2 A;  3TJG A;  4BWQ A;  4FYB A;  2X8C A;  1FG4 A;  5EVO A;  14GS A;  4I97 A;  1VF2 A;  4V2L A;  5D96 A;  2GQM A;  5AIV A;  4TR4 A;  3IA1 A;  3ZFL A;  3G7Y A;  3VI7 A;  3QFB C;  2JZS A;  11GS A;  2C8U A;  4FYC A;  1YF1 A;  4K7N A;  2GQL A;  1QFN A;  2H66 A;  3IBH A;  1B4Q A;  1PX6 A;  1Z7R A;  4OD7 A;  2CV4 A;  3F3Q A;  4ACS A;  2HYX A;  4YQV A;  1SD8 A;  4XHM A;  4PGT A;  4IS0 A;  2H8L A;  4MJE A;  2XHF A;  2GGT A;  2X99 A;  1GSE A;  4JRR A;  4WR4 A;  2CVK A;  1YZX A;  1YQ1 A;  5LNK e;  7GSS A;  5EL8 A;  2I81 A;  3QAG A;  4NHZ A;  1NHO A;  2O8V B;  2HE3 A;  3GIX A;  3VWW A;  1GL8 A;  3D6I A;  2IL3 A;  3U5R E;  4ZB8 A;  1Z6M A;  5IO2 A;  2H72 A;  2YWO A;  5E4W A;  1XZO A;  2H70 A;  2AJQ B;  3GUR A;  2DBC A;  1C72 A;  3MNG A;  3UBL A;  1FHE A;  5F06 A;  2H1D A;  2AAW A;  5IPH A;  10GS A;  2H1A A;  3GH6 A;  1FW1 A;  2DC5 A;  2WUL A;  2EIO A;  2L5O A;  5ECI B;  1YF0 A;  3RHC A;  1Q98 A;  2VCQ A;  1UVZ A;  1O7U A;  4ZL8 A;  2L5L A;  2I3Y A;  3W6G A;  1TXX A;  5ID2 B;  4GCI A;  4Z2U A;  1TK5 B;  2X49 A;  4G19 A;  4QL7 A;  2VD1 A;  2KP1 A;  3HA9 A;  2LV3 A;  2JSY A;  2NTO A;  3ZRD A;  2E0Q A;  3RPN A;  2LJA A;  4NPB A;  1MDJ A;  5EY6 A;  2DKH A;  3TJJ A;  1GP1 A;  2H76 A;  4D73 A;  1QGV A;  3IK7 A;  3KEB A;  3TKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...