2M46A

Solution nmr structure of sacol0876 from staphylococcus aureus col, nesg target zr353 and csgid target idp00841
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
118
structure length
118
Chain Sequence
MIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTHGAKYRELDLKNKLQTLSDDEKLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Arsenate reductase, putative
publication title Solution NMR structure of SACOL0876 from Staphylococcus aureus COL, NESG target ZR353 and CSGID target IDP00841
rcsb
source organism Staphylococcus aureus subsp. aureus col
total genus 33
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2013-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03960 ArsC ArsC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 2m46A00
1MDIA 3GKXA 4PNGA 5A4VA 2JACA 4ML6A 3F6FA 6GSUA 2VLUA 2NDOA 3WGXA 3VWVA 5HFIA 1BQ7A 1FHEA 2E2MA 4J2FA 1PA3A 4PGTA 3F6DA 5EL8A 1OE7A 5B7CA 3QR6A 2CX4A 4MF5A 1XWKA 2KP2A 1R4WA 3N9JA 2JL4A 3HDCA 2AV4A 1QUWA 11GSA 4HJMA 2MBSA 3TJJA 1R7HA 3WGDA 4GQFA 2R4VA 1XOAA 5G5EA 1TRVA 2KUCA 4TR0A 3GTUB 2H0IA 5J9BA 4YAPA 1U3IA 2DJJA 13GSA 1KTEA 4KDUA 2VLTA 2RUFA 1YF0A 3GIXA 1S3CA 3ZITA 4GTUA 5B6NA 1FW1A 2DC5A 1YKCA 3NIVA 5DDLA 3HCZA 2I1UA 3ERGA 5HR0A 2LS5A 2K8VA 4D73B 2HI7A 4MF6A 4PQ1A 3CRUA 4JBBA 4TVEA 3LWAA 3ZVJA 2C80A 3HJMA 3IV4A 3UIWA 2CX3A 2IIYA 2H30A 4POBA 2VD1A 3C8EA 3QPMA 4PQIA 4KGIA 4K6XA 3ME8A 1IYIA 3VWUA 3KTLA 5D93A 1DE2A 2LRCA 2YZUA 3TGZA 4FIWA 5AIXA 4MZCA 1XZOA 1U88A 3CSHA 2VLVA 3CRTA 4JR4A 2V1MA 3GH9A 2P0GA 12GSA 4AGSA 1AQXA 1TI3A 1PD21 2GZZA 3ZMLA 2AYTA 3FK8A 1SKWB 2H75A 2GSTA 2A4VA 1T3BA 1OC9B 1HD2A 2FWEA 2V6KA 1WJKA 16GSA 4V2MA 1LU4A 5HR3A 4WEYA 1TDIA 3QFBC 4NMUA 19GSA 4WKWA 4NV5A 4Q5RA 3GFKA 4GQCA 4XS6A 1J08A 1G7EA 2HRNA 1USBA 2LUSA 5LD0A 5DAKA 4EDYA 3L9SA 3VWWA 4NPBA 1T8EB 3HJPA 3HD5A 4HZ2A 3M3MA 3WT2A 5INYA 3ZFLA 5G1LA 1AQVA 1QK8A 2FHEA 5ENUA 2H6ZA 4D73A 5H5QA 3FZ5A 1K3OA 2H73A 3F4SA 5HR1A 2YV7A 3ZFBA 1W89A 3CYNA 2MZCA 5J9CA 2LJRA 1SU9A 5IOWA 1K3YA 3IK9A 3HA9A 3QMXA 2F8FA 3CXGA 4XRAA 5B8AA 2H19A 3IAM2 3UJ1A 2YWNA 1OYJA 2PGTA 2IN3A 4H86A 3EWLA 2M80A 5ECOB 2X8CA 3L9VA 2N5AA 3GX8A 2OKAA 3GA4A 4N10A 3M1GA 4ACSA 1O6JA 3J7Yk 3D0ZA 4Z7XA 2HFDA 2VCQA 2I4AA 1GTUA 3TKSC 4G10A 1BEDA 3HVXA 3W8SA 1TXXA 1BX9A 5DVBA 2PMTA 1I9DA 3VI5A 1FOVA 5G30A 3EE2A 2DIZA 1OC9A 4O92A 1R26A 4KSMA 2F3MA 4ZBAA 1MTCA 2CVDA 3SBCA 3D6IA 6GSTA 1Q4JA 5ELAA 4PUAA 1JZDA 2PBJA 5IOXA 4FO5A 1B8XA 1YKAA 2DSAA 5JCUA 1NW2A 4TOPA 2OBKA 2GQMA 1GSSA 5IQYA 1GULA 1M9BA 3EURA 1XW5A 1F37A 1JLVA 2CVKA 2WB9A 4KDYA 2MBTA 1O73A 1HNCA 1TRUA 2YJHA 3UL3A 3TKSA 2CAIA 4ZXGA 2HLSA 5D9XA 1A2JA 2L4CA 4V2LA 2H72A 2HRFA 2GSSA 4L5LA 1QMVA 1ZMAA 1KBNA 4XTSA 3VI7A 4XHMA 1ON4A 2V2GA 1ERWA 1B9YC 4I6XA 1YQ1A 3F8UA 4AJ6A 3TUEA 2X8HA 2JU5A 4YQUA 5A4WA 2X99A 3KZQA 2JZTA 3BOAA 2EIQA 1A2LA 5IMAA 5H5SA 3HY2A 1VF3A 2FNOA 1C72A 1JHBA 2CZ2A 2AHEA 2FY6A 3M0FA 1V57A 2H0GA 2ZCTA 1TI1A 5KN1A 3BD2A 1T00A 3LEFA 5IMZA 3HYPA 3BCIA 3HJOA 1U87A 4CDOA 4POLA 1XVQA 4IGJA 5J3RA 2GQKA 2GQLA 2RLIA 1CQHA 3UOMA 4XS4B 3I69A 3TJKA 3TOUA 1WRYA 1BAYA 5AIVA 4JU5A 3LFLA 4O5RA 1V40A 3QCPA 4KCEA 1QGVA 4LL4B 1B48A 2HZFA 3NZNA 20GSA 5HFKA 3UVTA 4GWRA 5ECHB 2WGRA 1UVZA 1SJ6A 1EEMA 6GSSA 1AXDA 4ECJA 4KNDA 1XPVA 2YWOA 2CAQA 2O8VB 1GP1A 1JLWA 14GSA 4RUVA 1GRXA 4WR4A 3ZLPA 1UC7A 4N11A 4ECIA 4PUFC 1X5EA 2HXKA 3TKQA 1AW9A 3KJYA 2QKEA 4TKYA 4ML1A 3RBTA 5H5RA 2DJ3A 1LJRA 3QD9A 3DGQA 3VFIA 1M2DA 4GCIA 4IELA 4KE3A 2WULA 4NHZA 2VM2A 5KEJA 3ZVJD 1WPIA 1XXUA 4QL7A 3FR6A 1TOFA 4F03A 1F9MA 1CQGA 4V2NA 1GUMA 2DJ2A 1A8LA 2CV4A 5LCZA 5B8BA 8GSSA 4MJAA 4ZB9A 5IM9A 3TCOA 4F9ZA 1Z3EA 3KCMA 3TRXA 2O89A 4AJ7A 1IYHA 3VPTA 4LMWA 1TW9A 3C1SA 4L0WA 4WF4A 4WBRD 2LJKA 2FD3A 2IMFA 3WGEA 2H71A 3KXOA 4KSOA 3TRPA 5DQYA 4K9ZA 3PH9A 2OE3A 2C0DA 4XS4A 4MPGA 1K0OA 5DCHA 3KIJA 2TRXA 3CTGA 3VPQA 2L59A 5LNKe 3DMLA 4F0BA 2WJUA 1X0RA 5ECMB 4HJ2A 3WT1A 2WDUA 1TK5B 3FZ9A 3Q74A 4YQMA 3I43A 4EO3A 3E3EA 4ZBBA 2G2QA 3GHAA 1EP7A 5ECPB 1SENA 4BWQA 1V2AA 1GTBA 1JZWA 3ERWA 3A2WA 1A0FA 4HS1A 2I81A 5D96A 3TOTA 4HU9A 5ID2A 4TXOA 1S3DA 4TR1B 2FCHA 1V58A 5A4UA 1V9WA 4FYUA 1EP8A 1SL2B 2PN8A 2AJQB 2OJLA 3GKKA 1T4YA 3RHBA 1OVNA 3MDKA 4PNFA 3TKSE 5HQPA 1TU8A 5D8IA 4IQ1A 3KGKA 3EVIA 3L4NA 5IMVA 3Q6OA 2LNTA 4BA7A 3GSTA 3CSJA 5IIZA 3BBYA 1XWGA 4RI6A 5J41A 1GSDA 1DE1A 3QOUA 4GLTA 2DIYA 4MJEA 1O85A 2N5BA 2V32A 2I3YA 4E8EA 4O7HA 1PX7A 1MEKA 2RUEA 3KM6A 3M9JA 3IHQA 4EUYA 5ABRA 4NHWA 1YDKA 4DSSB 4KB3A 1EOHA 2IMDA 4DVCA 3DYRA 2GZYA 4EL1A 2GLRA 2V41A 4OCEA 4LL1B 1GSQA 1GLQA 1EV4A 2YOIA 5CRWA 2GZPA 3DVXA 6GSXA 4NWYA 2AAWA 4G2EA 3PR8A 1DBYA 3TJBA 4TXVA 2XBIA 4NV2A 2H1AA 2MMNA 5HR2A 1B4QA 3FW2A 2L5OA 3UEMA 3LG6A 4PX1A 3UBLA 3L78A 5COHA 4K2DA 1QFNA 3FZ4A 3QFAC 4X1UA 2ES7A 4J57E 3D21A 4XCSA 3CSIA 3PINA 1NSWA 1YZXA 1BYEA 5E4WA 3LJRA 4AJ8A 4OFNA 2F51A 1TRSA 4BL7A 3Q18A 5FHIA 2N5FA 1BG5A 1HNBA 4OO5A 2IPAA 3Q19A 4IHUA 2J23A 1EEJA 3OR5A 2MYGA 1ZL9A 3BCKA 1SJZA 4ECCA 1F3BA 3ZTLA 5DBQA 4P3YB 1UA5A 1W4VA 4RQXA 5GSSA 2YCDA 2GTUA 3GTUA 3DD3A 2ALBA 2VAFA 2P5QA 3ISOA 1K0DA 4FYCA 5G2ZA 1PMTA 1VF1A 3IRAA 3IOSA 4MCUA 4IKHA 2HT9A 3DIEA 1U6TA 4HZ4A 5JCGA 2NTOA 3WD6A 3NOFA 2EIOA 4ZL7A 5F07A 5CRDA 5DJMA 1FVKA 3SWLA 3IBHA 2IFQB 4MZWA 2RM6A 1K0NA 3HKRA 1J0FA 2H01A 4EXJA 2P31A 4GRFA 3LXTA 3ZMKA 1K0BA 3G7IA 3TKPA 4KA0A 1VRSD 1M2AA 2FLSA 2LQOA 2DJ0A 3C71A 1AUCA 3IXRA 2WFCA 5FWGA 2M72A 1WE0A 1ZOFA 5CYYA 1O81A 3H79A 2REMA 1O8WA 2IJYA 5F8BA 3U6VA 3HVSA 1J9BA 2HYXA 1ZYEA 3ZREA 3D4MA 1M9AA 3FEUA 1R5AA 2HSYA 4RI7A 4JEDA 4KX4A 1PSQA 3P7XA 1OE8A 2PVQA 4N30A 1TJDA 1ZGNA 4MA9A 4K8MA 5B6MA 3FYGA 2LTKA 3EYTA 1A8YA 3KP8A 4MK3A 5AISA 2EIRA 1OC3A 1X9MB 2LSTA 2DMLA 1XIYA 2R2JA 4HEA2 2EC4A 3LYPA 1DUGA 1EZKA 3GH6A 1Z7RA 3HZ4A 3HHVA 4ULXA 1G6YA 4V1Ap 1EOGA 3ZRDA 2H8LA 4Q5QA 2VCVA 2CZ3A 4IVFA 2TIRA 2XPEA 3QAVA 2MMOA 1N2AA 4TR4A 1K0CA 1T1VA 2B6MA 2C3NA 4TR3A 1LBKA 1SL0B 4WETA 2R5GA 2OADA 2YN1A 1PN9A 3E0UA 4JRRA 2GVPA 3F63A 2DBCA 5EVOA 4XS1A 1Z6NA 4K0GA 2AB6A 2B5EA 2LRNA 4IS0A 5IPGA 3APSA 9GSSA 3DRNA 3M8NA 2KOKA 4X43A 5IO0A 2OE0A 2XC2A 4QL9A 2DJKA 2O87A 5F06A 5EY6A 4V1Ag 3US3A 2FWHA 3GMFA 2DLXA 3ZIJA 1O8XA 5EPFA 4MF7A 5ECSA 1GH2A 5ECQB 3FKFA 1F2EA 4K1FA 5E59A 2LRTA 2HNLA 1NHOA 2NPBA 3CTFA 1X5CA 4KW6A 2JADA 2VCWA 1H75A 3F4RA 2VD0A 3EMPA 4MPFA 1MD3A 4MABA 2B3SA 3H1NA 4IW9A 3FHKA 1THOA 3C73A 3VURA 4GSSA 2VCTA 3QDNA 3DKSA 4ZB8A 1FG4A 1X5DA 2HZEB 5IPHA 5JWQB 4WF5A 1TKDB 3W6GA 3MSZA 2X8GA 3VK9A 1NHYA 4ZL9A 5IMDA 2NBSA 4MZBA 1WIKA 1A24A 4F2IA 3KMNA 2K9FA 4HQSA 2GGTA 4GXZA 1M99A 3FR3A 2WCIA 1VGLA 2K8SA 2LNSA 2GT6A 3E9JB 2H70A 4IP1A 2C0FA 2FA8A 5G1KA 2LQQA 3UAPA 5D9WA 5CAXA 2YPMA 4ZL8A 5IMCA 4OWYA 2L5LA 5ECIB 3IPZA 5F05A 2BTOT 2E7PA 1XFLA 1OC8A 5G5FA 1EGRA 5CRGA 1ILOA 2VOCA 3G9BA 3RDWA 3HZ8A 5CO3A 2PPTA 2YWIA 1M0UA 3N5OA 1PL2A 4ZB6A 4CHSA 2NVLA 2PERA 4WR5A 1H4OA 2B1KA 4MLYA 5CREA 4EKZA 1F3AA 3JCML 1YEXA 5HFGA 4EVMA 2QGVA 3A2VA 4KH7A 2QSIA 1EWXA 1PQNA 2CVBA 5IO2A 4ZIJA 3RPNA 1GTIA 1YF1A 2JSYA 2B5XA 3PGTA 2H66A 3IE3A 1MDKA 6GSWA 1GNWA 3IC4A 3EINA 1ERUA 2VIMA 1GUKA 5J5NA 4YH2A 3ED3A 3FRCA 2H1DA 4BVYA 2JSZA 5J4UA 4IN0A 3O76A 4BVXA 4N0VA 4IJIA 5KN0A 1AAZA 4G9HA 1BJXA 4LA1A 2KP1A 3GURA 1VF4A 1TK0B 1SK1A 3D5JA 3KTBA 2YNXA 4I5QA 2OE1A 5DALB 1G0TA 4KAEA 2XPDA 4ZILA 1MDJA 3VLNA 3UMAA 2YWMA 2GSQA 1AIUA 2J9HA 1SKSB 3GNJA 4KUNA 3GV1A 2VL9A 2O7KA 3TKRA 1AQWA 4J56E 4OD7A 1XOBA 4MDCA 1M7TA 1NM3A 4MJCA 1K3LA 4HUAA 3M9KA 5JWOB 1KNGA 1R5PA 3WYWA 4MJBA 4ECBA 1GSFA 1FB0A 3MNGA 1UN2A 1TK8B 2H74A 3GKMA 2H0HA 3GYKA 4MP4A 5AGYA 3GSSA 10GSA 3ME7A 22GSA 3MWHA 2GS3A 4POKA 3GL5A 2R3XA 2IMEA 1WP0A 5CRHA 1HNAA 5DAKB 4N0ZA 4K7NA 4BWSA 2P5RA 3CMIA 4LMVA 2K6VA 3ERFA 3IR4A 4Q5NA 4L8EA 1JZOA 1PL1A 3GX0A 3V1WA 1XW9A 4TW5A 1PKWA 1Y6EA 3KP9A 4ISDA 1SL1B 1F6MC 2L6DA 2MMAA 3KH9A 4K7IA 4HQZA 2GT5A 2VCXA 1DSBA 1ABAA 4OFTA 3DVWA 3ZL5A 4EF0A 5DALA 4EE0A 2B7JA 2ON5A 3A3TA 2B1LA 1B4PA 3LORA 2LKUA 3EU4A 3LYKA 3QAWA 4OO4A 4I97A 4OCFA 1MD4A 3LSZA 2JZSA 4AF2A 1Z6MA 3KD0A 4WBJA 1Y25A 5D73A 2RIIA 3C7MA 4I2TA 2ZUPA 1A2MA 2H76A 4I2UA 1XBSA 2IMIA 3F4TA 7GSSA 3LQ7A 1THXA 3GUSA 1RQMA 3D4TA 2Z9SA 2QC7A 1G7OA 4TR1A 5GAND 4JE1A 1K0MA 2X64A 2ON7A 3GRXA 1X9WB 1T4ZA 1GNEA 4PURA 4DEJA 2RM5A 2H1BA 2VO4A 4QQ7A 1GUHA 3HXSA 3VWXA 4F0CA 5C00A 1Z7PA 4MMMA 3GL3A 3ZIVA 1EV9A 2GDRA 5A5KA 3EU3A 6GSVA 2C1YA 4IQAA 3H93A 1HYUA 4MH2A 3HVVA 4GF0A 2XHFA 1PKZA 1M2BA 4IBPA 1ACVA 2I9HA 3ZZXA 4IJ3A 1T7PB 3O6TA 1TTZA 17GSA 2HSHA 2BMXA 2ZNMA 4CW9A 4GSNA 5IMFA 5GAPD 4ID0A 4I8BA 1SKRB 5DJLA 3APOA 1ZYQB 1GSEA 4DSSA 1XWBA 2F8AA 1FAAA 3QAGA 3IAS2 1JFUA 3C1RA 4KCAA 3AY8A 2G0FA 3RAZA 3KH7A 2OBIA 2C3TA 2R6KA 2WRTA 1XW6A 3I9V2 1VF2A 4O32A 5ECNB 1RW1A 1O7UA 2YV9A 1Q98A 2C3QA 5GSTA 4XIHA 4TRXA 1GL8A 1RK4A 5L71A 2LEGA 3IA1A 4JR6A 1GWCA 2A2RA 1XWAA 2VL3A 2K18A 3MAKA 5ECRB 5KN2A 2PWJA 5JCWA 4GSTA 3TDGA 3L9UA 2C0EA 3CBUA 3IK7A 1URMA 4DSQA 1FO5A 3H8QA 1OKTA 3D22A 3F3QA 3FR9A 3IDVA 2V6OA 2FGXA 3UBKA 1SK0A 1X9SB 4E8HA 2KLXA 3FZAA 2WS2A 4HU7A 4XRDA 4K0NA 4RQRA 3TRQA 3TB2A 3P2AA 3EMXA 3J7Yb 3TJFA 3A5WA 2PVOC 1V98A 5F0GA 2FA4A 3P90A 4POMA 1ST9A 2L57A 3F3RA 1HQOA 2VCZA 1ML6A 2MMZA 1B9XC 2CT6A 3APQA 3EC3A 5JWRB 5FT3A 3DEXA 1SD8A 2VL2C 2IFQA 2IWTA 2FUG2 1TRWA 2M46A 1N8JA 1XCCA 4OMVA 1WMJA 2IMKA 2LV3A 6GSYA 2C0GA 2R37A 5CP1A 2JZRA 2B5YA 5ECKB 3LGCA 2H6YA 1GSUA 1WWJA 4MH3A 1I5GA 2E0QA 3L0HA 3DXBA 5AN1A 4G19A 1PGTA 2XBQA 4HI7A 1ZZYA 1G6WA 3G7JA 1WOUA 4NAXA 5G31A 5C04A 3K8NA 1KEBA 2L6CA 3UARA 1XWCA 2B7KA 3F0IA 1A0RP 1YJ6A 3H4KA 18GSA 3P8WA 3RPPA 2L4QA 1QXHA 2VL2A 3F9UA 5GZZB 5KN3A 1A23A 1SJIA 3GKNA 3R2QA 1YY7A 2O85A 4YAVA 1ZCPA 1E6BA 1XVWA 5ECLB 1EGOA 3KEBA 4PQHA 4YQVA 1PRXA 2H6XA 2A2SA 4HOJA 2D2ZA 3KMOA 3G7YA 5D9VA 4BPYA 4IP6A 1PX6A 2OACA 1SYXA 3BJ5A 3LXZA 2CQ9A 4Q5FA 1TU7A 2KHPA 1U3AA 3I6AA 2FWGA 5ID2B 1K0AA 3UVHA 4TXOB 4ILFA 4FYBA 4ZBDA 1QQ2A 2F9SA 4L0UA 1YEPA 2YANA 1GSYA 5DCGA 1FVJA 1SD9A 4L5OA 2VM1A 4WXTA 2LJAA 2PU9C 3DWVA 2GSRA 2PUKC 2DJ1A 2OA7A 1FB6A 2YJ7A 4KDXA 3O3TA 4PXOA 4FH8A 4OFMA 4EC0A 4TN8A 2VUPA 2E2GA 2BJXA 1JZRA 1OKDA 5CNWA 3A2XA 1AC1A 1Z5YE 4NXIA 5ELGA 1TP9A 5D9TA 3U5RE 2IL3A 2HZEA 4X0XA 3FY7A 2YP6A 2AUVA 1SK2A 4LLRA 5DQSA 3TJGA 1GLPA 4HDEA 1OAZA 4K7OA 2YZHA 2HE3A 4EDZA 1SYRA 3W8JA 2DMMA 2C4JA 1S3AA 2TRCP 4DSRA 4JZQA 1E2YA 3GN3A 2WZ9A 1ERVA 3ZYWA 1ERTA 2C8UA 2H1GA 1Z9HA 4F82A 1GTAA 2FWFA 3RHCA 3S9FA 2CA8A
chains in the Genus database with same CATH superfamily
1MDIA 3GKXA 4PNGA 5A4VA 2JACA 4ML6A 3F6FA 6GSUA 2VLUA 2NDOA 3WGXA 3VWVA 5HFIA 1BQ7A 1FHEA 2E2MA 4J2FA 1PA3A 4PGTA 3F6DA 5EL8A 1OE7A 5B7CA 3QR6A 2CX4A 4MF5A 1XWKA 2KP2A 3MIXA 1R4WA 3N9JA 2JL4A 3HDCA 2AV4A 1QUWA 3LW9A 11GSA 4HJMA 2MBSA 3TJJA 1R7HA 3WGDA 4GQFA 2R4VA 1XOAA 5G5EA 1TRVA 2KUCA 4TR0A 3GTUB 2H0IA 5J9BA 4YAPA 1U3IA 2DJJA 13GSA 1KTEA 4KDUA 2VLTA 2RUFA 1YF0A 3GIXA 1S3CA 3ZITA 4GTUA 5B6NA 1FW1A 2DC5A 1YKCA 3NIVA 5DDLA 3HCZA 2I1UA 3ERGA 5HR0A 2LS5A 2K8VA 4D73B 1ZYNA 2HI7A 4MF6A 4PQ1A 3CRUA 4JBBA 4TVEA 3LWAA 3ZVJA 2C80A 3HJMA 3IV4A 3UIWA 2CX3A 2R0PA 2IIYA 2H30A 4POBA 2VD1A 3C8EA 3QPMA 4PQIA 4KGIA 4K6XA 2HRAA 3ME8A 1IYIA 3VWUA 3KTLA 5D93A 1DE2A 2LRCA 2YZUA 3TGZA 4FIWA 5AIXA 4MZCA 1XZOA 1U88A 3CSHA 2VLVA 3CRTA 4JR4A 2V1MA 3GH9A 2P0GA 12GSA 4AGSA 1AQXA 1TI3A 1PD21 2GZZA 3ZMLA 2AYTA 3FK8A 1SKWB 2H75A 2GSTA 2A4VA 1T3BA 1OC9B 4G0KA 1HD2A 2FWEA 2V6KA 1WJKA 16GSA 4V2MA 1LU4A 5HR3A 4WEYA 1TDIA 3QFBC 4NMUA 2R0GA 19GSA 4WKWA 4NV5A 4Q5RA 3GFKA 4GQCA 4XS6A 1J08A 1G7EA 2HRNA 1USBA 2LUSA 5LD0A 5DAKA 4EDYA 4K2XA 3L9SA 3VWWA 4NPBA 1T8EB 3HJPA 3HD5A 4HZ2A 3M3MA 3WT2A 4Z2TA 5INYA 3ZFLA 5G1LA 1AQVA 1QK8A 2FHEA 5ENUA 2H6ZA 4D73A 5H5QA 3FZ5A 1K3OA 2H73A 3F4SA 3IHGA 5HR1A 2YV7A 3ZFBA 1W89A 3CYNA 2MZCA 5J9CA 2LJRA 1SU9A 5IOWA 1K3YA 3IK9A 3HA9A 3QMXA 2F8FA 3CXGA 4XRAA 5B8AA 2H19A 3IAM2 3UJ1A 2YWNA 1OYJA 2PGTA 2IN3A 4H86A 3EWLA 2M80A 5ECOB 2X8CA 3L9VA 2N5AA 3GX8A 2OKAA 3GA4A 4N10A 3M1GA 4ACSA 1O6JA 3J7Yk 3D0ZA 4Z7XA 2HFDA 2VCQA 2I4AA 1GTUA 3TKSC 4G10A 1BEDA 3HVXA 3W8SA 1TXXA 1BX9A 5DVBA 2R0CA 2PMTA 1I9DA 3VI5A 1FOVA 5G30A 3EE2A 2DIZA 1OC9A 4O92A 1R26A 4KSMA 2F3MA 4ZBAA 1MTCA 2CVDA 3SBCA 3D6IA 6GSTA 1Q4JA 5ELAA 4PUAA 1JZDA 1PFOA 2PBJA 5IOXA 4FO5A 1B8XA 1YKAA 2DSAA 5JCUA 1NW2A 4TOPA 2OBKA 2GQMA 1GSSA 5IQYA 1GULA 1M9BA 3EURA 1XW5A 1F37A 1JLVA 2CVKA 2WB9A 4KDYA 2MBTA 1O73A 1HNCA 1TRUA 2YJHA 3UL3A 3TKSA 2CAIA 4ZXGA 2HLSA 5D9XA 1A2JA 2L4CA 4V2LA 2H72A 2HRFA 2GSSA 4L5LA 1QMVA 1XG8A 1ZMAA 1KBNA 4XTSA 3VI7A 4XHMA 1ON4A 2V2GA 1ERWA 1B9YC 4I6XA 1YQ1A 3F8UA 4AJ6A 3TUEA 2X8HA 2JU5A 4YQUA 5A4WA 2X99A 3KZQA 2JZTA 3BOAA 2EIQA 1A2LA 5IMAA 5H5SA 3HY2A 1VF3A 2FNOA 1C72A 1JHBA 4BVYB 2CZ2A 2AHEA 2FY6A 3M0FA 1V57A 2H0GA 2ZCTA 4BVXB 2A2PA 1TI1A 5KN1A 3BD2A 1T00A 3LEFA 5IMZA 3HYPA 3BCIA 3HJOA 1U87A 4CDOA 4POLA 5BMUA 1XVQA 4IGJA 5J3RA 2GQKA 2GQLA 2RLIA 1CQHA 3UOMA 4XS4B 3I69A 3TJKA 3TOUA 1WRYA 1BAYA 5AIVA 4JU5A 3LFLA 4O5RA 1V40A 3QCPA 4KCEA 1QGVA 4LL4B 1B48A 2HZFA 3NZNA 4FQUA 20GSA 5HFKA 3UVTA 4GWRA 5ECHB 2WGRA 1UVZA 1SJ6A 4CY8A 1EEMA 6GSSA 1AXDA 4ECJA 2HRKA 4KNDA 1XPVA 2YWOA 2CAQA 2O8VB 1GP1A 1JLWA 14GSA 4RUVA 1GRXA 4WR4A 3ZLPA 1UC7A 4N11A 4ECIA 4PUFC 1X5EA 2HXKA 3TKQA 1AW9A 3KJYA 2QKEA 4TKYA 4ML1A 3RBTA 5H5RA 2DJ3A 1LJRA 3QD9A 3DGQA 3VFIA 1M2DA 4GCIA 4IELA 4KE3A 2WULA 4NHZA 2VM2A 5KEJA 3ZVJD 1WPIA 1XXUA 4QL7A 3FR6A 1TOFA 4F03A 1F9MA 1CQGA 4V2NA 1GUMA 2DJ2A 1A8LA 2CV4A 5LCZA 5B8BA 8GSSA 4MJAA 4ZB9A 5IM9A 3TCOA 4F9ZA 1Z3EA 3KCMA 3TRXA 2O89A 4AJ7A 1IYHA 3VPTA 4LMWA 1TW9A 3C1SA 4L0WA 4WF4A 4WBRD 2LJKA 2FD3A 2IMFA 3WGEA 2H71A 3KXOA 4KSOA 3TRPA 5DQYA 4K9ZA 3PH9A 2OE3A 2C0DA 4XS4A 4MPGA 1K0OA 5DCHA 3KIJA 2TRXA 3CTGA 3VPQA 2L59A 5LNKe 3DMLA 4F0BA 2WJUA 1X0RA 5ECMB 4HJ2A 3WT1A 2WDUA 1TK5B 3FZ9A 3Q74A 4YQMA 3I43A 4EO3A 3E3EA 4ZBBA 2G2QA 3GHAA 1EP7A 5ECPB 1SENA 4BWQA 1V2AA 1GTBA 1JZWA 3ERWA 3A2WA 1A0FA 4HS1A 2I81A 5D96A 3TOTA 4HU9A 5ID2A 4TXOA 1S3DA 4TR1B 2FCHA 1V58A 5A4UA 1V9WA 4FYUA 1EP8A 4BL7B 1SL2B 2PN8A 2AJQB 2OJLA 3GKKA 1T4YA 3RHBA 1OVNA 3MDKA 4PNFA 3TKSE 5HQPA 1TU8A 5D8IA 4IQ1A 3KGKA 3EVIA 3L4NA 5IMVA 2UZ8A 3Q6OA 2LNTA 4BA7A 3GSTA 3CSJA 5IIZA 3BBYA 1XWGA 4RI6A 5J41A 1GSDA 1DE1A 3QOUA 4GLTA 2DIYA 4MJEA 1O85A 4A5PA 2N5BA 2V32A 2I3YA 4E8EA 4O7HA 1PX7A 1MEKA 2RUEA 3KM6A 3M9JA 3IHQA 4EUYA 5ABRA 4NHWA 4USSA 1YDKA 4DSSB 4KB3A 1EOHA 2IMDA 4DVCA 3DYRA 2GZYA 4EL1A 2GLRA 2V41A 4OCEA 4LL1B 1GSQA 1GLQA 1EV4A 2YOIA 5CRWA 2GZPA 3DVXA 6GSXA 4NWYA 2AAWA 4G2EA 3PR8A 1DBYA 3TJBA 4TXVA 2XBIA 2A4HA 4NV2A 2H1AA 2MMNA 5HR2A 1B4QA 3FW2A 2L5OA 3UEMA 3LG6A 4HSCX 4PX1A 3UBLA 3L78A 5COHA 4K2DA 1QFNA 3FZ4A 3QFAC 4X1UA 2ES7A 4J57E 3D21A 4XCSA 3CSIA 3PINA 1NSWA 1YZXA 1BYEA 5E4WA 3LJRA 4AJ8A 4OFNA 2F51A 1TRSA 4BL7A 3Q18A 5FHIA 2N5FA 1BG5A 1HNBA 4OO5A 2IPAA 3Q19A 4IHUA 2J23A 1EEJA 3OR5A 2MYGA 1ZL9A 3BCKA 1SJZA 4ECCA 1F3BA 3ZTLA 5DBQA 4P3YB 1UA5A 1W4VA 4RQXA 5GSSA 2YCDA 2GTUA 3GTUA 3DD3A 2ALBA 2VAFA 2P5QA 3ISOA 1K0DA 4FYCA 5G2ZA 1PMTA 1VF1A 3IRAA 3IOSA 4MCUA 4IKHA 2HT9A 3DIEA 1U6TA 4HZ4A 5JCGA 4PTSA 2NTOA 3WD6A 3NOFA 2EIOA 4ZL7A 5F07A 5CRDA 5DJMA 1FVKA 3SWLA 3IBHA 2IFQB 4MZWA 2RM6A 1K0NA 3HKRA 1J0FA 2H01A 4EXJA 2P31A 4GRFA 3LXTA 3ZMKA 1K0BA 3G7IA 3TKPA 4KA0A 4Z2UA 1VRSD 1M2AA 2FLSA 2LQOA 2DJ0A 3C71A 1AUCA 3IXRA 2WFCA 5FWGA 2M72A 1WE0A 1ZOFA 5CYYA 1O81A 3H79A 2REMA 4KF9A 1O8WA 2IJYA 5F8BA 3U6VA 3HVSA 1J9BA 2HYXA 1ZYEA 3ZREA 3D4MA 1M9AA 3FEUA 1R5AA 2HSYA 4RI7A 4JEDA 4KX4A 1PSQA 3P7XA 1OE8A 2PVQA 4N30A 1TJDA 1ZGNA 4MA9A 4K8MA 5B6MA 3FYGA 2LTKA 3EYTA 1A8YA 3KP8A 4MK3A 5AISA 2EIRA 1OC3A 1X9MB 2LSTA 2DMLA 1XIYA 2R2JA 4HEA2 2EC4A 3LYPA 1DUGA 1EZKA 3GH6A 1Z7RA 3HZ4A 3HHVA 4ULXA 1G6YA 4V1Ap 1EOGA 3ZRDA 2H8LA 4Q5QA 2VCVA 2CZ3A 4IVFA 2TIRA 2XPEA 3QAVA 2MMOA 1N2AA 4TR4A 1K0CA 1T1VA 2B6MA 2C3NA 4TR3A 1LBKA 1SL0B 4WETA 2R5GA 2OADA 2YN1A 1PN9A 3E0UA 4JRRA 2GVPA 3F63A 2DBCA 3FMWA 5EVOA 4XS1A 1Z6NA 4K0GA 2AB6A 2B5EA 2LRNA 4IS0A 5IPGA 3APSA 9GSSA 3DRNA 3M8NA 2KOKA 4X43A 5IO0A 2OE0A 2XC2A 4QL9A 2DJKA 2O87A 5F06A 5EY6A 4V1Ag 3US3A 2FWHA 3GMFA 2DLXA 3ZIJA 4O5QA 1O8XA 5EPFA 4MF7A 5ECSA 1GH2A 5ECQB 3FKFA 1F2EA 4K1FA 5E59A 2LRTA 2HNLA 1NHOA 2NPBA 3CTFA 1X5CA 4KW6A 2JADA 2VCWA 1H75A 3F4RA 2VD0A 3EMPA 4Z2RA 4MPFA 1MD3A 4MABA 2B3SA 3H1NA 4IW9A 3FHKA 1THOA 3C73A 3VURA 4GSSA 2VCTA 3QDNA 3DKSA 4ZB8A 1FG4A 1X5DA 2HZEB 5IPHA 5JWQB 4WF5A 1TKDB 3W6GA 3MSZA 2X8GA 3VK9A 1NHYA 4ZL9A 5IMDA 2NBSA 4MZBA 1WIKA 1A24A 4F2IA 3KMNA 2K9FA 4HQSA 2GGTA 4GXZA 1M99A 3FR3A 2WCIA 1VGLA 2K8SA 2LNSA 2GT6A 3E9JB 2H70A 4IP1A 2C0FA 2FA8A 5G1KA 2LQQA 4EIPA 3UAPA 5D9WA 5CAXA 2YPMA 4ZL8A 5IMCA 4OWYA 2L5LA 5ECIB 3IPZA 5F05A 2BTOT 2E7PA 1S3RA 1XFLA 1OC8A 5BRTA 5G5FA 1EGRA 5CRGA 1ILOA 2VOCA 3G9BA 3RDWA 3HZ8A 5CO3A 2PPTA 2YWIA 1M0UA 3N5OA 1PL2A 4ZB6A 4CHSA 2NVLA 2PERA 4WR5A 1H4OA 2B1KA 4MLYA 5CREA 4EKZA 1F3AA 3JCML 1YEXA 5HFGA 4EVMA 2QGVA 3A2VA 4KH7A 2QSIA 1EWXA 1PQNA 2CVBA 5IO2A 4ZIJA 3RPNA 1GTIA 1YF1A 2JSYA 2B5XA 3PGTA 2H66A 3IE3A 1MDKA 6GSWA 1GNWA 3IC4A 3EINA 1ERUA 2VIMA 1GUKA 5J5NA 4YH2A 3ED3A 3FRCA 2H1DA 2DKHA 4BVYA 2JSZA 5J4UA 4IN0A 3O76A 4BVXA 4N0VA 4IJIA 5KN0A 1AAZA 4G9HA 1BJXA 4LA1A 2KP1A 3GURA 1VF4A 1TK0B 1SK1A 3D5JA 3KTBA 2YNXA 4I5QA 1ZYPA 2OE1A 5DALB 1G0TA 4KAEA 2XPDA 4ZILA 1MDJA 3VLNA 3UMAA 2YWMA 2GSQA 4G0IA 1AIUA 2J9HA 1SKSB 3GNJA 4KUNA 3GV1A 2VL9A 2O7KA 3TKRA 1AQWA 4J56E 4OD7A 1XOBA 4MDCA 1M7TA 1NM3A 4MJCA 1K3LA 4HUAA 3M9KA 5JWOB 1KNGA 1R5PA 3WYWA 4MJBA 4ECBA 1GSFA 1FB0A 3MNGA 1UN2A 1TK8B 2H74A 3GKMA 2H0HA 3GYKA 4MP4A 5AGYA 3GSSA 10GSA 3ME7A 22GSA 3MWHA 4O5UA 2GS3A 4POKA 3GL5A 2R3XA 2IMEA 1WP0A 5CRHA 1HNAA 5DAKB 4N0ZA 4K7NA 4BWSA 2P5RA 3CMIA 4LMVA 2K6VA 3ERFA 3IR4A 4Q5NA 4L8EA 1JZOA 1PL1A 3GX0A 3V1WA 1XW9A 4TW5A 1PKWA 1Y6EA 3KP9A 4ISDA 1SL1B 1F6MC 2L6DA 2MMAA 3KH9A 4K7IA 4HQZA 2GT5A 2VCXA 1DSBA 1ABAA 1M3IA 4OFTA 3R3EA 3DVWA 2HSMA 3ZL5A 4EF0A 5DALA 4EE0A 2B7JA 2ON5A 3A3TA 2B1LA 1B4PA 3LORA 2LKUA 2QA2A 3EU4A 3A5IA 3LYKA 3QAWA 4OO4A 4MNNA 4OCFA 4I97A 1MD4A 3LSZA 2JZSA 4AF2A 4ICYA 1Z6MA 3MYDA 3KD0A 4WBJA 1Y25A 5D73A 2RIIA 3C7MA 4K5RA 4I2TA 2ZUPA 1A2MA 2H76A 4I2UA 1XBSA 2IMIA 3F4TA 7GSSA 3LQ7A 1THXA 3GUSA 1RQMA 3D4TA 2Z9SA 2QC7A 1PN0A 1G7OA 4TR1A 5GAND 4JE1A 1K0MA 2X64A 2ON7A 3GRXA 1X9WB 1T4ZA 1GNEA 4PURA 4DEJA 2RM5A 2H1BA 2VO4A 4QQ7A 1GUHA 3HXSA 3VWXA 4F0CA 5C00A 1Z7PA 4MMMA 3GL3A 3ZIVA 1EV9A 2GDRA 5A5KA 3EU3A 6GSVA 2C1YA 4IQAA 3H93A 1HYUA 4MH2A 3HVVA 4GF0A 2XHFA 1PKZA 1M2BA 4IBPA 1ACVA 2I9HA 3PPUA 3ZZXA 4IJ3A 1T7PB 3O6TA 1TTZA 17GSA 2HSHA 2BMXA 2ZNMA 4CW9A 4GSNA 5IMFA 5GAPD 4ID0A 4I8BA 1SKRB 5DJLA 3APOA 1ZYQB 1GSEA 4DSSA 1XWBA 4EIQA 2F8AA 5KOXA 1FAAA 3QAGA 1M3JA 3IAS2 1JFUA 3C1RA 4KCAA 3AY8A 2G0FA 3RAZA 3KH7A 2OBIA 2C3TA 2R6KA 2WRTA 1XW6A 4X4JA 3I9V2 1VF2A 1FOHA 4O32A 5ECNB 1RW1A 1O7UA 4YKGA 2YV9A 1Q98A 2C3QA 4YKFA 4XIHA 5GSTA 4TRXA 1GL8A 1RK4A 5L71A 2LEGA 3IA1A 4JR6A 1GWCA 2A2RA 1XWAA 2VL3A 2K18A 3MAKA 5ECRB 5KN2A 2PWJA 5JCWA 4GSTA 3TDGA 3L9UA 2C0EA 3CBUA 3IK7A 1URMA 4DSQA 1FO5A 3H8QA 1OKTA 3D22A 3F3QA 3FR9A 5KOWA 3IDVA 2V6OA 2FGXA 3UBKA 4CY6A 1SK0A 1X9SB 4E8HA 2KLXA 3FZAA 2WS2A 4HU7A 4XRDA 4K0NA 4RQRA 3TRQA 4K5SA 3TB2A 3P2AA 3EMXA 3J7Yb 2X4AA 3TJFA 3A5WA 2PVOC 1V98A 5F0GA 2FA4A 3P90A 4POMA 1ST9A 2L57A 3F3RA 1HQOA 2VCZA 1ML6A 2MMZA 1B9XC 2CT6A 3APQA 3EC3A 5JWRB 5FT3A 3DEXA 1SD8A 2VL2C 2IFQA 2IWTA 2FUG2 1TRWA 2M46A 1N8JA 1XCCA 4OMVA 1WMJA 2IMKA 2LV3A 6GSYA 2C0GA 2R37A 4G0LA 5CP1A 2JZRA 2B5YA 5ECKB 3LGCA 2H6YA 1GSUA 1WWJA 4MH3A 1I5GA 2E0QA 3L0HA 3DXBA 5AN1A 4G19A 1PGTA 2XBQA 4HI7A 1ZZYA 1G6WA 3G7JA 1WOUA 4NAXA 5G31A 5C04A 3K8NA 1KEBA 2L6CA 3UARA 1XWCA 2B7KA 3F0IA 1A0RP 1YJ6A 3H4KA 18GSA 3P8WA 3RPPA 2L4QA 1QXHA 2VL2A 3F9UA 5GZZB 5KN3A 1A23A 1SJIA 3GKNA 3R2QA 1YY7A 2O85A 4YAVA 1ZCPA 1E6BA 1XVWA 5ECLB 1EGOA 3KEBA 4PQHA 4YQVA 1PRXA 2H6XA 2A2SA 4HOJA 2D2ZA 3KMOA 3G7YA 5D9VA 4BPYA 4IP6A 1PX6A 2OACA 1SYXA 3BJ5A 3LXZA 2CQ9A 4Q5FA 3HVNA 1TU7A 2KHPA 2X49A 1U3AA 3I6AA 2FWGA 5ID2B 1K0AA 3UVHA 4TXOB 2QA1A 4ILFA 4FYBA 4ZBDA 1QQ2A 2F9SA 4L0UA 1YEPA 3EPTA 2YANA 1GSYA 5DCGA 1FVJA 1SD9A 4L5OA 2VM1A 4WXTA 2LJAA 2PU9C 3DWVA 2GSRA 2PUKC 2DJ1A 3CQFA 2OA7A 1FB6A 2YJ7A 4KDXA 3O3TA 4PXOA 4FH8A 4OFMA 2DKIA 4EC0A 4TN8A 2VUPA 2E2GA 2BJXA 1JZRA 1OKDA 5CNWA 3A2XA 1AC1A 1Z5YE 4NXIA 5ELGA 1TP9A 5D9TA 3U5RE 2IL3A 2HZEA 4X0XA 3FY7A 2YP6A 2AUVA 1SK2A 4LLRA 5DQSA 3TJGA 1GLPA 4HDEA 1OAZA 4K7OA 2YZHA 2HE3A 4EDZA 4BIKA 1SYRA 3W8JA 2DMMA 3IC8A 2C4JA 1S3AA 2TRCP 4DSRA 4JZQA 1E2YA 3GN3A 2WZ9A 1ERVA 3ZYWA 1ERTA 2C8UA 2H1GA 1Z9HA 4F82A 1GTAA 2FWFA 3RHCA 3S9FA 2CA8A
chains in the Genus database with same CATH topology
1MDIA 3GKXA 4PNGA 5A4VA 2JACA 4ML6A 3F6FA 6GSUA 2VLUA 2NDOA 3WGXA 3VWVA 5HFIA 1BQ7A 1FHEA 2E2MA 4J2FA 1PA3A 4PGTA 3F6DA 5EL8A 1OE7A 5B7CA 3QR6A 2CX4A 4MF5A 1XWKA 2KP2A 3MIXA 1R4WA 3N9JA 2JL4A 3HDCA 2AV4A 1QUWA 3LW9A 11GSA 4HJMA 2MBSA 3TJJA 1R7HA 3WGDA 4GQFA 2R4VA 1XOAA 5G5EA 1TRVA 2KUCA 4TR0A 3GTUB 2H0IA 5J9BA 4YAPA 1U3IA 2DJJA 13GSA 1KTEA 4KDUA 2VLTA 2RUFA 1YF0A 3GIXA 1S3CA 3ZITA 4GTUA 5B6NA 1FW1A 2DC5A 1YKCA 3NIVA 5DDLA 3HCZA 2I1UA 3ERGA 5HR0A 2LS5A 2K8VA 4D73B 1ZYNA 2HI7A 4MF6A 4PQ1A 3CRUA 4JBBA 4TVEA 3LWAA 3ZVJA 2C80A 3HJMA 3IV4A 3UIWA 2CX3A 2R0PA 2IIYA 2H30A 4POBA 2VD1A 3C8EA 3QPMA 4PQIA 4KGIA 4K6XA 2HRAA 3ME8A 1IYIA 3VWUA 3KTLA 5D93A 1DE2A 2LRCA 2YZUA 3TGZA 4FIWA 5AIXA 4MZCA 1XZOA 1U88A 3CSHA 2VLVA 3CRTA 4JR4A 2V1MA 3GH9A 2P0GA 12GSA 4AGSA 1AQXA 1TI3A 1PD21 2GZZA 3ZMLA 2AYTA 3FK8A 1SKWB 2H75A 2GSTA 2A4VA 1T3BA 1OC9B 4G0KA 1HD2A 2FWEA 2V6KA 1WJKA 16GSA 4V2MA 1LU4A 5HR3A 4WEYA 1TDIA 3QFBC 4NMUA 2R0GA 19GSA 4WKWA 4NV5A 4Q5RA 3GFKA 4GQCA 4XS6A 1J08A 1G7EA 2HRNA 1USBA 2LUSA 5LD0A 5DAKA 4EDYA 4K2XA 3L9SA 3VWWA 4NPBA 1T8EB 3HJPA 3HD5A 4HZ2A 3M3MA 3WT2A 4Z2TA 5INYA 3ZFLA 5G1LA 1AQVA 1QK8A 2FHEA 5ENUA 2H6ZA 4D73A 5H5QA 3FZ5A 1K3OA 2H73A 3F4SA 3IHGA 5HR1A 2YV7A 3ZFBA 1W89A 3CYNA 2MZCA 5J9CA 2LJRA 1SU9A 5IOWA 1K3YA 3IK9A 3HA9A 3QMXA 2F8FA 3CXGA 4XRAA 5B8AA 2H19A 3IAM2 3UJ1A 2YWNA 1OYJA 2PGTA 2IN3A 4H86A 3EWLA 2M80A 5ECOB 2X8CA 3L9VA 2N5AA 3GX8A 2OKAA 3GA4A 4N10A 3M1GA 4ACSA 1O6JA 3J7Yk 3D0ZA 4Z7XA 2HFDA 2VCQA 2I4AA 1GTUA 3TKSC 4G10A 1BEDA 3HVXA 3W8SA 1TXXA 1BX9A 5DVBA 2R0CA 2PMTA 1I9DA 3VI5A 1FOVA 5G30A 3EE2A 2DIZA 1OC9A 4O92A 1R26A 4KSMA 2F3MA 4ZBAA 1MTCA 2CVDA 3SBCA 3D6IA 6GSTA 1Q4JA 5ELAA 4PUAA 1JZDA 2PBJA 5IOXA 4FO5A 1B8XA 1YKAA 2DSAA 5JCUA 1NW2A 4TOPA 2OBKA 2GQMA 1GSSA 5IQYA 1GULA 1M9BA 3EURA 1XW5A 1F37A 1JLVA 2CVKA 2WB9A 4KDYA 2MBTA 1O73A 1HNCA 1TRUA 2YJHA 3UL3A 3TKSA 2CAIA 4ZXGA 2HLSA 5D9XA 1A2JA 2L4CA 4V2LA 2H72A 2HRFA 2GSSA 4L5LA 1QMVA 1ZMAA 1KBNA 4XTSA 3VI7A 4XHMA 1ON4A 2V2GA 1ERWA 1B9YC 4I6XA 1YQ1A 3F8UA 4AJ6A 3TUEA 2X8HA 2JU5A 4YQUA 5A4WA 2X99A 3KZQA 2JZTA 3BOAA 2EIQA 1A2LA 5IMAA 5H5SA 3HY2A 1VF3A 2FNOA 1C72A 1JHBA 4BVYB 2CZ2A 2AHEA 2FY6A 3M0FA 1V57A 2H0GA 2ZCTA 4BVXB 2A2PA 1TI1A 5KN1A 3BD2A 1T00A 3LEFA 5IMZA 3HYPA 3BCIA 3HJOA 1U87A 4CDOA 4POLA 5BMUA 1XVQA 4IGJA 5J3RA 2GQKA 2GQLA 2RLIA 1CQHA 3UOMA 4XS4B 3I69A 3TJKA 3TOUA 1WRYA 1BAYA 5AIVA 4JU5A 3LFLA 4O5RA 1V40A 3QCPA 4KCEA 1QGVA 4LL4B 1B48A 2HZFA 3NZNA 4FQUA 20GSA 5HFKA 3UVTA 4GWRA 5ECHB 2WGRA 1UVZA 1SJ6A 4CY8A 1EEMA 6GSSA 1AXDA 4ECJA 2HRKA 4KNDA 1XPVA 2YWOA 2CAQA 2O8VB 1GP1A 1JLWA 14GSA 4RUVA 1GRXA 4WR4A 3ZLPA 1UC7A 4N11A 4ECIA 4PUFC 1X5EA 2HXKA 3TKQA 1AW9A 3KJYA 2QKEA 4TKYA 4ML1A 3RBTA 5H5RA 2DJ3A 1LJRA 3QD9A 3DGQA 3VFIA 1M2DA 4GCIA 4IELA 4KE3A 2WULA 4NHZA 2VM2A 5KEJA 3ZVJD 1WPIA 1XXUA 4QL7A 3FR6A 1TOFA 4F03A 1F9MA 1CQGA 4V2NA 1GUMA 2DJ2A 1A8LA 2CV4A 5LCZA 5B8BA 8GSSA 4MJAA 4ZB9A 5IM9A 3TCOA 4F9ZA 1Z3EA 3KCMA 3TRXA 2O89A 4AJ7A 1IYHA 3VPTA 4LMWA 1TW9A 3C1SA 4L0WA 4WF4A 4WBRD 2LJKA 2FD3A 2IMFA 3WGEA 2H71A 3KXOA 4KSOA 3TRPA 5DQYA 4K9ZA 3PH9A 2OE3A 2C0DA 4XS4A 4MPGA 1K0OA 5DCHA 3KIJA 2TRXA 3CTGA 3VPQA 2L59A 5LNKe 3DMLA 4F0BA 2WJUA 1X0RA 5ECMB 4HJ2A 3WT1A 2WDUA 1TK5B 3FZ9A 3Q74A 4YQMA 3I43A 4EO3A 3E3EA 4ZBBA 2G2QA 3GHAA 1EP7A 5ECPB 1SENA 4BWQA 1V2AA 1GTBA 1JZWA 3ERWA 3A2WA 1A0FA 4HS1A 2I81A 5D96A 3TOTA 4HU9A 5ID2A 4TXOA 1S3DA 4TR1B 2FCHA 1V58A 5A4UA 1V9WA 4FYUA 1EP8A 4BL7B 1SL2B 2PN8A 2AJQB 2OJLA 3GKKA 1T4YA 3RHBA 1OVNA 3MDKA 4PNFA 3TKSE 5HQPA 1TU8A 5D8IA 4IQ1A 3KGKA 3EVIA 3L4NA 5IMVA 2UZ8A 3Q6OA 2LNTA 4BA7A 3GSTA 3CSJA 5IIZA 3BBYA 1XWGA 4RI6A 5J41A 1GSDA 1DE1A 3QOUA 4GLTA 2DIYA 4MJEA 1O85A 4A5PA 2N5BA 2V32A 2I3YA 4E8EA 4O7HA 1PX7A 1MEKA 2RUEA 3KM6A 3M9JA 3IHQA 4EUYA 5ABRA 4NHWA 4USSA 1YDKA 4DSSB 4KB3A 1EOHA 2IMDA 4DVCA 3DYRA 2GZYA 4EL1A 2GLRA 2V41A 4OCEA 4LL1B 1GSQA 1GLQA 1EV4A 2YOIA 5CRWA 2GZPA 3DVXA 6GSXA 4NWYA 2AAWA 4G2EA 3PR8A 1DBYA 3TJBA 4TXVA 2XBIA 2A4HA 4NV2A 2H1AA 2MMNA 5HR2A 1B4QA 3FW2A 2L5OA 3UEMA 3LG6A 4PX1A 3UBLA 3L78A 5COHA 4K2DA 1QFNA 3FZ4A 3QFAC 4X1UA 2ES7A 4J57E 3D21A 4XCSA 3CSIA 3PINA 1NSWA 1YZXA 1BYEA 5E4WA 3LJRA 4AJ8A 4OFNA 2F51A 1TRSA 4BL7A 3Q18A 5FHIA 2N5FA 1BG5A 1HNBA 4OO5A 2IPAA 3Q19A 4IHUA 2J23A 1EEJA 3OR5A 2MYGA 1ZL9A 3BCKA 1SJZA 4ECCA 1F3BA 3ZTLA 5DBQA 4P3YB 1UA5A 1W4VA 4RQXA 5GSSA 2YCDA 2GTUA 3GTUA 3DD3A 2ALBA 2VAFA 2P5QA 3ISOA 1K0DA 4FYCA 5G2ZA 1PMTA 1VF1A 3IRAA 3IOSA 4MCUA 4IKHA 2HT9A 3DIEA 1U6TA 4HZ4A 5JCGA 4PTSA 2NTOA 3WD6A 3NOFA 2EIOA 4ZL7A 5F07A 5CRDA 5DJMA 1FVKA 3SWLA 3IBHA 2IFQB 4MZWA 2RM6A 1K0NA 3HKRA 1J0FA 2H01A 4EXJA 2P31A 4GRFA 3LXTA 3ZMKA 1K0BA 3G7IA 3TKPA 4KA0A 4Z2UA 1VRSD 1M2AA 2FLSA 2LQOA 2DJ0A 3C71A 1AUCA 3IXRA 2WFCA 5FWGA 2M72A 1WE0A 1ZOFA 5CYYA 1O81A 3H79A 2REMA 4KF9A 1O8WA 2IJYA 5F8BA 3U6VA 3HVSA 1J9BA 2HYXA 1ZYEA 3ZREA 3D4MA 1M9AA 3FEUA 1R5AA 2HSYA 4RI7A 4JEDA 4KX4A 1PSQA 3P7XA 1OE8A 2PVQA 4N30A 1TJDA 1ZGNA 4MA9A 4K8MA 5B6MA 3FYGA 2LTKA 3EYTA 1A8YA 3KP8A 4MK3A 5AISA 2EIRA 1OC3A 1X9MB 2LSTA 2DMLA 1XIYA 2R2JA 4HEA2 2EC4A 3LYPA 1DUGA 1EZKA 3GH6A 1Z7RA 3HZ4A 3HHVA 4ULXA 1G6YA 4V1Ap 1EOGA 3ZRDA 2H8LA 4Q5QA 2VCVA 2CZ3A 4IVFA 2TIRA 2XPEA 3QAVA 2MMOA 1N2AA 4TR4A 1K0CA 1T1VA 2B6MA 2C3NA 4TR3A 1LBKA 1SL0B 4WETA 2R5GA 2OADA 2YN1A 1PN9A 3E0UA 4JRRA 2GVPA 3F63A 2DBCA 3FMWA 5EVOA 4XS1A 1Z6NA 4K0GA 2AB6A 2B5EA 2LRNA 4IS0A 5IPGA 3APSA 9GSSA 3DRNA 3M8NA 2KOKA 4X43A 5IO0A 2OE0A 2XC2A 4QL9A 2DJKA 2O87A 5F06A 5EY6A 4V1Ag 3US3A 2FWHA 3GMFA 2DLXA 3ZIJA 4O5QA 1O8XA 5EPFA 4MF7A 5ECSA 1GH2A 5ECQB 3FKFA 1F2EA 4K1FA 5E59A 2LRTA 2HNLA 1NHOA 2NPBA 3CTFA 1X5CA 4KW6A 2JADA 2VCWA 1H75A 3F4RA 2VD0A 3EMPA 4Z2RA 4MPFA 1MD3A 4MABA 2B3SA 3H1NA 4IW9A 3FHKA 1THOA 3C73A 3VURA 4GSSA 2VCTA 3QDNA 3DKSA 4ZB8A 1FG4A 1X5DA 2HZEB 5IPHA 5JWQB 4WF5A 1TKDB 3W6GA 3MSZA 2X8GA 3VK9A 1NHYA 4ZL9A 5IMDA 2NBSA 4MZBA 1WIKA 1A24A 4F2IA 3KMNA 2K9FA 4HQSA 2GGTA 4GXZA 1M99A 3FR3A 2WCIA 1VGLA 2K8SA 2LNSA 2GT6A 3E9JB 2H70A 4IP1A 2C0FA 2FA8A 5G1KA 2LQQA 4EIPA 3UAPA 5D9WA 5CAXA 2YPMA 4ZL8A 5IMCA 4OWYA 2L5LA 5ECIB 3IPZA 5F05A 2BTOT 2E7PA 1XFLA 1OC8A 5BRTA 5G5FA 1EGRA 5CRGA 1ILOA 2VOCA 3G9BA 3RDWA 3HZ8A 5CO3A 2PPTA 2YWIA 1M0UA 3N5OA 1PL2A 4ZB6A 4CHSA 2NVLA 2PERA 4WR5A 1H4OA 2B1KA 4MLYA 5CREA 4EKZA 1F3AA 3JCML 1YEXA 5HFGA 4EVMA 2QGVA 3A2VA 4KH7A 2QSIA 1EWXA 1PQNA 2CVBA 5IO2A 4ZIJA 3RPNA 1GTIA 1YF1A 2JSYA 2B5XA 3PGTA 2H66A 3IE3A 1MDKA 6GSWA 1GNWA 3IC4A 3EINA 1ERUA 2VIMA 1GUKA 5J5NA 4YH2A 3ED3A 3FRCA 2H1DA 2DKHA 4BVYA 2JSZA 5J4UA 4IN0A 3O76A 4BVXA 4N0VA 4IJIA 5KN0A 1AAZA 4G9HA 1BJXA 4LA1A 2KP1A 3GURA 1VF4A 1TK0B 1SK1A 3D5JA 3KTBA 2YNXA 4I5QA 1ZYPA 2OE1A 5DALB 1G0TA 4KAEA 2XPDA 4ZILA 1MDJA 3VLNA 3UMAA 2YWMA 2GSQA 4G0IA 1AIUA 2J9HA 1SKSB 3GNJA 4KUNA 3GV1A 2VL9A 2O7KA 3TKRA 1AQWA 4J56E 4OD7A 1XOBA 4MDCA 1M7TA 1NM3A 4MJCA 1K3LA 4HUAA 3M9KA 5JWOB 1KNGA 1R5PA 3WYWA 4MJBA 4ECBA 1GSFA 1FB0A 3MNGA 1UN2A 1TK8B 2H74A 3GKMA 2H0HA 3GYKA 4MP4A 5AGYA 3GSSA 10GSA 3ME7A 22GSA 3MWHA 4O5UA 2GS3A 4POKA 3GL5A 2R3XA 2IMEA 1WP0A 5CRHA 1HNAA 5DAKB 4N0ZA 4K7NA 4BWSA 2P5RA 3CMIA 4LMVA 2K6VA 3ERFA 3IR4A 4Q5NA 4L8EA 1JZOA 1PL1A 3GX0A 3V1WA 1XW9A 4TW5A 1PKWA 1Y6EA 3KP9A 4ISDA 1SL1B 1F6MC 2L6DA 2MMAA 3KH9A 4K7IA 4HQZA 2GT5A 2VCXA 1DSBA 1ABAA 4OFTA 3R3EA 3DVWA 2HSMA 3ZL5A 4EF0A 5DALA 4EE0A 2B7JA 2ON5A 3A3TA 2B1LA 1B4PA 3LORA 2LKUA 2QA2A 3EU4A 3A5IA 3LYKA 3QAWA 4OO4A 4MNNA 4OCFA 4I97A 1MD4A 3LSZA 2JZSA 4AF2A 4ICYA 1Z6MA 3MYDA 3KD0A 4WBJA 1Y25A 5D73A 2RIIA 3C7MA 4K5RA 4I2TA 2ZUPA 1A2MA 2H76A 4I2UA 1XBSA 2IMIA 3F4TA 7GSSA 3LQ7A 1THXA 3GUSA 1RQMA 3D4TA 2Z9SA 2QC7A 1PN0A 1G7OA 4TR1A 5GAND 4JE1A 1K0MA 2X64A 2ON7A 3GRXA 1X9WB 1T4ZA 1GNEA 4PURA 4DEJA 2RM5A 2H1BA 2VO4A 4QQ7A 1GUHA 3HXSA 3VWXA 4F0CA 5C00A 1Z7PA 4MMMA 3GL3A 3ZIVA 1EV9A 2GDRA 5A5KA 3EU3A 6GSVA 2C1YA 4IQAA 3H93A 1HYUA 4MH2A 3HVVA 4GF0A 2XHFA 1PKZA 1M2BA 4IBPA 1ACVA 2I9HA 3PPUA 3ZZXA 4IJ3A 1T7PB 3O6TA 1TTZA 17GSA 2HSHA 2BMXA 2ZNMA 4CW9A 4GSNA 5IMFA 5GAPD 4ID0A 4I8BA 1SKRB 5DJLA 3APOA 1ZYQB 1GSEA 4DSSA 1XWBA 4EIQA 2F8AA 5KOXA 1FAAA 3QAGA 3IAS2 1JFUA 3C1RA 4KCAA 3AY8A 2G0FA 3RAZA 3KH7A 2OBIA 2C3TA 2R6KA 2WRTA 1XW6A 4X4JA 3I9V2 1VF2A 1FOHA 4O32A 5ECNB 1RW1A 1O7UA 4YKGA 2YV9A 1Q98A 2C3QA 4YKFA 4XIHA 5GSTA 4TRXA 1GL8A 1RK4A 5L71A 2LEGA 3IA1A 4JR6A 1GWCA 2A2RA 1XWAA 2VL3A 2K18A 3MAKA 5ECRB 5KN2A 2PWJA 5JCWA 4GSTA 3TDGA 3L9UA 2C0EA 3CBUA 3IK7A 1URMA 4DSQA 1FO5A 3H8QA 1OKTA 3D22A 3F3QA 3FR9A 5KOWA 3IDVA 2V6OA 2FGXA 3UBKA 4CY6A 1SK0A 1X9SB 4E8HA 2KLXA 3FZAA 2WS2A 4HU7A 4XRDA 4K0NA 4RQRA 3TRQA 4K5SA 3TB2A 3P2AA 3EMXA 3J7Yb 2X4AA 3TJFA 3A5WA 2PVOC 1V98A 5F0GA 2FA4A 3P90A 4POMA 1ST9A 2L57A 3F3RA 1HQOA 2VCZA 1ML6A 2MMZA 1B9XC 2CT6A 3APQA 3EC3A 5JWRB 5FT3A 3DEXA 1SD8A 2VL2C 2IFQA 2IWTA 2FUG2 1TRWA 2M46A 1N8JA 1XCCA 4OMVA 1WMJA 2IMKA 2LV3A 6GSYA 2C0GA 2R37A 4G0LA 5CP1A 2JZRA 2B5YA 5ECKB 3LGCA 2H6YA 1GSUA 1WWJA 4MH3A 1I5GA 2E0QA 3L0HA 3DXBA 5AN1A 4G19A 1PGTA 2XBQA 4HI7A 1ZZYA 1G6WA 3G7JA 1WOUA 4NAXA 5G31A 5C04A 3K8NA 1KEBA 2L6CA 3UARA 1XWCA 2B7KA 3F0IA 1A0RP 1YJ6A 3H4KA 18GSA 3P8WA 3RPPA 2L4QA 1QXHA 2VL2A 3F9UA 5GZZB 5KN3A 1A23A 1SJIA 3GKNA 3R2QA 1YY7A 2O85A 4YAVA 1ZCPA 1E6BA 1XVWA 5ECLB 1EGOA 3KEBA 4PQHA 4YQVA 1PRXA 2H6XA 2A2SA 4HOJA 2D2ZA 3KMOA 3G7YA 5D9VA 4BPYA 4IP6A 1PX6A 2OACA 1SYXA 3BJ5A 3LXZA 2CQ9A 4Q5FA 1TU7A 2KHPA 2X49A 1U3AA 3I6AA 2FWGA 5ID2B 1K0AA 3UVHA 4TXOB 2QA1A 4ILFA 4FYBA 4ZBDA 1QQ2A 2F9SA 4L0UA 1YEPA 3EPTA 2YANA 1GSYA 5DCGA 1FVJA 1SD9A 4L5OA 2VM1A 4WXTA 2LJAA 2PU9C 3DWVA 2GSRA 2PUKC 2DJ1A 2OA7A 1FB6A 2YJ7A 4KDXA 3O3TA 4PXOA 4FH8A 4OFMA 2DKIA 4EC0A 4TN8A 2VUPA 2E2GA 2BJXA 1JZRA 1OKDA 5CNWA 3A2XA 1AC1A 1Z5YE 4NXIA 5ELGA 1TP9A 5D9TA 3U5RE 2IL3A 2HZEA 4X0XA 3FY7A 2YP6A 2AUVA 1SK2A 4LLRA 5DQSA 3TJGA 1GLPA 4HDEA 1OAZA 4K7OA 2YZHA 2HE3A 4EDZA 1SYRA 3W8JA 2DMMA 3IC8A 2C4JA 1S3AA 2TRCP 4DSRA 4JZQA 1E2YA 3GN3A 2WZ9A 1ERVA 3ZYWA 1ERTA 2C8UA 2H1GA 1Z9HA 4F82A 1GTAA 2FWFA 3RHCA 3S9FA 2CA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDI A;  3GKX A;  4PNG A;  5A4V A;  2JAC A;  4ML6 A;  3F6F A;  6GSU A;  2VLU A;  2NDO A;  3WGX A;  3VWV A;  5HFI A;  1BQ7 A;  1FHE A;  2E2M A;  4J2F A;  1PA3 A;  4PGT A;  3F6D A;  5EL8 A;  1OE7 A;  5B7C A;  3QR6 A;  2CX4 A;  4MF5 A;  1XWK A;  2KP2 A;  1R4W A;  3N9J A;  2JL4 A;  3HDC A;  2AV4 A;  1QUW A;  11GS A;  4HJM A;  2MBS A;  3TJJ A;  1R7H A;  3WGD A;  4GQF A;  2R4V A;  1XOA A;  5G5E A;  1TRV A;  2KUC A;  4TR0 A;  3GTU B;  2H0I A;  5J9B A;  4YAP A;  1U3I A;  2DJJ A;  13GS A;  1KTE A;  4KDU A;  2VLT A;  2RUF A;  1YF0 A;  3GIX A;  1S3C A;  3ZIT A;  4GTU A;  5B6N A;  1FW1 A;  2DC5 A;  1YKC A;  3NIV A;  5DDL A;  3HCZ A;  2I1U A;  3ERG A;  5HR0 A;  2LS5 A;  2K8V A;  4D73 B;  2HI7 A;  4MF6 A;  4PQ1 A;  3CRU A;  4JBB A;  4TVE A;  3LWA A;  3ZVJ A;  2C80 A;  3HJM A;  3IV4 A;  3UIW A;  2CX3 A;  2IIY A;  2H30 A;  4POB A;  2VD1 A;  3C8E A;  3QPM A;  4PQI A;  4KGI A;  4K6X A;  3ME8 A;  1IYI A;  3VWU A;  3KTL A;  5D93 A;  1DE2 A;  2LRC A;  2YZU A;  3TGZ A;  4FIW A;  5AIX A;  4MZC A;  1XZO A;  1U88 A;  3CSH A;  2VLV A;  3CRT A;  4JR4 A;  2V1M A;  3GH9 A;  2P0G A;  12GS A;  4AGS A;  1AQX A;  1TI3 A;  1PD2 1;  2GZZ A;  3ZML A;  2AYT A;  3FK8 A;  1SKW B;  2H75 A;  2GST A;  2A4V A;  1T3B A;  1OC9 B;  1HD2 A;  2FWE A;  2V6K A;  1WJK A;  16GS A;  4V2M A;  1LU4 A;  5HR3 A;  4WEY A;  1TDI A;  3QFB C;  4NMU A;  19GS A;  4WKW A;  4NV5 A;  4Q5R A;  3GFK A;  4GQC A;  4XS6 A;  1J08 A;  1G7E A;  2HRN A;  1USB A;  2LUS A;  5LD0 A;  5DAK A;  4EDY A;  3L9S A;  3VWW A;  4NPB A;  1T8E B;  3HJP A;  3HD5 A;  4HZ2 A;  3M3M A;  3WT2 A;  5INY A;  3ZFL A;  5G1L A;  1AQV A;  1QK8 A;  2FHE A;  5ENU A;  2H6Z A;  4D73 A;  5H5Q A;  3FZ5 A;  1K3O A;  2H73 A;  3F4S A;  5HR1 A;  2YV7 A;  3ZFB A;  1W89 A;  3CYN A;  2MZC A;  5J9C A;  2LJR A;  1SU9 A;  5IOW A;  1K3Y A;  3IK9 A;  3HA9 A;  3QMX A;  2F8F A;  3CXG A;  4XRA A;  5B8A A;  2H19 A;  3IAM 2;  3UJ1 A;  2YWN A;  1OYJ A;  2PGT A;  2IN3 A;  4H86 A;  3EWL A;  2M80 A;  5ECO B;  2X8C A;  3L9V A;  2N5A A;  3GX8 A;  2OKA A;  3GA4 A;  4N10 A;  3M1G A;  4ACS A;  1O6J A;  3J7Y k;  3D0Z A;  4Z7X A;  2HFD A;  2VCQ A;  2I4A A;  1GTU A;  3TKS C;  4G10 A;  1BED A;  3HVX A;  3W8S A;  1TXX A;  1BX9 A;  5DVB A;  2PMT A;  1I9D A;  3VI5 A;  1FOV A;  5G30 A;  3EE2 A;  2DIZ A;  1OC9 A;  4O92 A;  1R26 A;  4KSM A;  2F3M A;  4ZBA A;  1MTC A;  2CVD A;  3SBC A;  3D6I A;  6GST A;  1Q4J A;  5ELA A;  4PUA A;  1JZD A;  2PBJ A;  5IOX A;  4FO5 A;  1B8X A;  1YKA A;  2DSA A;  5JCU A;  1NW2 A;  4TOP A;  2OBK A;  2GQM A;  1GSS A;  5IQY A;  1GUL A;  1M9B A;  3EUR A;  1XW5 A;  1F37 A;  1JLV A;  2CVK A;  2WB9 A;  4KDY A;  2MBT A;  1O73 A;  1HNC A;  1TRU A;  2YJH A;  3UL3 A;  3TKS A;  2CAI A;  4ZXG A;  2HLS A;  5D9X A;  1A2J A;  2L4C A;  4V2L A;  2H72 A;  2HRF A;  2GSS A;  4L5L A;  1QMV A;  1ZMA A;  1KBN A;  4XTS A;  3VI7 A;  4XHM A;  1ON4 A;  2V2G A;  1ERW A;  1B9Y C;  4I6X A;  1YQ1 A;  3F8U A;  4AJ6 A;  3TUE A;  2X8H A;  2JU5 A;  4YQU A;  5A4W A;  2X99 A;  3KZQ A;  2JZT A;  3BOA A;  2EIQ A;  1A2L A;  5IMA A;  5H5S A;  3HY2 A;  1VF3 A;  2FNO A;  1C72 A;  1JHB A;  2CZ2 A;  2AHE A;  2FY6 A;  3M0F A;  1V57 A;  2H0G A;  2ZCT A;  1TI1 A;  5KN1 A;  3BD2 A;  1T00 A;  3LEF A;  5IMZ A;  3HYP A;  3BCI A;  3HJO A;  1U87 A;  4CDO A;  4POL A;  1XVQ A;  4IGJ A;  5J3R A;  2GQK A;  2GQL A;  2RLI A;  1CQH A;  3UOM A;  4XS4 B;  3I69 A;  3TJK A;  3TOU A;  1WRY A;  1BAY A;  5AIV A;  4JU5 A;  3LFL A;  4O5R A;  1V40 A;  3QCP A;  4KCE A;  1QGV A;  4LL4 B;  1B48 A;  2HZF A;  3NZN A;  20GS A;  5HFK A;  3UVT A;  4GWR A;  5ECH B;  2WGR A;  1UVZ A;  1SJ6 A;  1EEM A;  6GSS A;  1AXD A;  4ECJ A;  4KND A;  1XPV A;  2YWO A;  2CAQ A;  2O8V B;  1GP1 A;  1JLW A;  14GS A;  4RUV A;  1GRX A;  4WR4 A;  3ZLP A;  1UC7 A;  4N11 A;  4ECI A;  4PUF C;  1X5E A;  2HXK A;  3TKQ A;  1AW9 A;  3KJY A;  2QKE A;  4TKY A;  4ML1 A;  3RBT A;  5H5R A;  2DJ3 A;  1LJR A;  3QD9 A;  3DGQ A;  3VFI A;  1M2D A;  4GCI A;  4IEL A;  4KE3 A;  2WUL A;  4NHZ A;  2VM2 A;  5KEJ A;  3ZVJ D;  1WPI A;  1XXU A;  4QL7 A;  3FR6 A;  1TOF A;  4F03 A;  1F9M A;  1CQG A;  4V2N A;  1GUM A;  2DJ2 A;  1A8L A;  2CV4 A;  5LCZ A;  5B8B A;  8GSS A;  4MJA A;  4ZB9 A;  5IM9 A;  3TCO A;  4F9Z A;  1Z3E A;  3KCM A;  3TRX A;  2O89 A;  4AJ7 A;  1IYH A;  3VPT A;  4LMW A;  1TW9 A;  3C1S A;  4L0W A;  4WF4 A;  4WBR D;  2LJK A;  2FD3 A;  2IMF A;  3WGE A;  2H71 A;  3KXO A;  4KSO A;  3TRP A;  5DQY A;  4K9Z A;  3PH9 A;  2OE3 A;  2C0D A;  4XS4 A;  4MPG A;  1K0O A;  5DCH A;  3KIJ A;  2TRX A;  3CTG A;  3VPQ A;  2L59 A;  5LNK e;  3DML A;  4F0B A;  2WJU A;  1X0R A;  5ECM B;  4HJ2 A;  3WT1 A;  2WDU A;  1TK5 B;  3FZ9 A;  3Q74 A;  4YQM A;  3I43 A;  4EO3 A;  3E3E A;  4ZBB A;  2G2Q A;  3GHA A;  1EP7 A;  5ECP B;  1SEN A;  4BWQ A;  1V2A A;  1GTB A;  1JZW A;  3ERW A;  3A2W A;  1A0F A;  4HS1 A;  2I81 A;  5D96 A;  3TOT A;  4HU9 A;  5ID2 A;  4TXO A;  1S3D A;  4TR1 B;  2FCH A;  1V58 A;  5A4U A;  1V9W A;  4FYU A;  1EP8 A;  1SL2 B;  2PN8 A;  2AJQ B;  2OJL A;  3GKK A;  1T4Y A;  3RHB A;  1OVN A;  3MDK A;  4PNF A;  3TKS E;  5HQP A;  1TU8 A;  5D8I A;  4IQ1 A;  3KGK A;  3EVI A;  3L4N A;  5IMV A;  3Q6O A;  2LNT A;  4BA7 A;  3GST A;  3CSJ A;  5IIZ A;  3BBY A;  1XWG A;  4RI6 A;  5J41 A;  1GSD A;  1DE1 A;  3QOU A;  4GLT A;  2DIY A;  4MJE A;  1O85 A;  2N5B A;  2V32 A;  2I3Y A;  4E8E A;  4O7H A;  1PX7 A;  1MEK A;  2RUE A;  3KM6 A;  3M9J A;  3IHQ A;  4EUY A;  5ABR A;  4NHW A;  1YDK A;  4DSS B;  4KB3 A;  1EOH A;  2IMD A;  4DVC A;  3DYR A;  2GZY A;  4EL1 A;  2GLR A;  2V41 A;  4OCE A;  4LL1 B;  1GSQ A;  1GLQ A;  1EV4 A;  2YOI A;  5CRW A;  2GZP A;  3DVX A;  6GSX A;  4NWY A;  2AAW A;  4G2E A;  3PR8 A;  1DBY A;  3TJB A;  4TXV A;  2XBI A;  4NV2 A;  2H1A A;  2MMN A;  5HR2 A;  1B4Q A;  3FW2 A;  2L5O A;  3UEM A;  3LG6 A;  4PX1 A;  3UBL A;  3L78 A;  5COH A;  4K2D A;  1QFN A;  3FZ4 A;  3QFA C;  4X1U A;  2ES7 A;  4J57 E;  3D21 A;  4XCS A;  3CSI A;  3PIN A;  1NSW A;  1YZX A;  1BYE A;  5E4W A;  3LJR A;  4AJ8 A;  4OFN A;  2F51 A;  1TRS A;  4BL7 A;  3Q18 A;  5FHI A;  2N5F A;  1BG5 A;  1HNB A;  4OO5 A;  2IPA A;  3Q19 A;  4IHU A;  2J23 A;  1EEJ A;  3OR5 A;  2MYG A;  1ZL9 A;  3BCK A;  1SJZ A;  4ECC A;  1F3B A;  3ZTL A;  5DBQ A;  4P3Y B;  1UA5 A;  1W4V A;  4RQX A;  5GSS A;  2YCD A;  2GTU A;  3GTU A;  3DD3 A;  2ALB A;  2VAF A;  2P5Q A;  3ISO A;  1K0D A;  4FYC A;  5G2Z A;  1PMT A;  1VF1 A;  3IRA A;  3IOS A;  4MCU A;  4IKH A;  2HT9 A;  3DIE A;  1U6T A;  4HZ4 A;  5JCG A;  2NTO A;  3WD6 A;  3NOF A;  2EIO A;  4ZL7 A;  5F07 A;  5CRD A;  5DJM A;  1FVK A;  3SWL A;  3IBH A;  2IFQ B;  4MZW A;  2RM6 A;  1K0N A;  3HKR A;  1J0F A;  2H01 A;  4EXJ A;  2P31 A;  4GRF A;  3LXT A;  3ZMK A;  1K0B A;  3G7I A;  3TKP A;  4KA0 A;  1VRS D;  1M2A A;  2FLS A;  2LQO A;  2DJ0 A;  3C71 A;  1AUC A;  3IXR A;  2WFC A;  5FWG A;  2M72 A;  1WE0 A;  1ZOF A;  5CYY A;  1O81 A;  3H79 A;  2REM A;  1O8W A;  2IJY A;  5F8B A;  3U6V A;  3HVS A;  1J9B A;  2HYX A;  1ZYE A;  3ZRE A;  3D4M A;  1M9A A;  3FEU A;  1R5A A;  2HSY A;  4RI7 A;  4JED A;  4KX4 A;  1PSQ A;  3P7X A;  1OE8 A;  2PVQ A;  4N30 A;  1TJD A;  1ZGN A;  4MA9 A;  4K8M A;  5B6M A;  3FYG A;  2LTK A;  3EYT A;  1A8Y A;  3KP8 A;  4MK3 A;  5AIS A;  2EIR A;  1OC3 A;  1X9M B;  2LST A;  2DML A;  1XIY A;  2R2J A;  4HEA 2;  2EC4 A;  3LYP A;  1DUG A;  1EZK A;  3GH6 A;  1Z7R A;  3HZ4 A;  3HHV A;  4ULX A;  1G6Y A;  4V1A p;  1EOG A;  3ZRD A;  2H8L A;  4Q5Q A;  2VCV A;  2CZ3 A;  4IVF A;  2TIR A;  2XPE A;  3QAV A;  2MMO A;  1N2A A;  4TR4 A;  1K0C A;  1T1V A;  2B6M A;  2C3N A;  4TR3 A;  1LBK A;  1SL0 B;  4WET A;  2R5G A;  2OAD A;  2YN1 A;  1PN9 A;  3E0U A;  4JRR A;  2GVP A;  3F63 A;  2DBC A;  5EVO A;  4XS1 A;  1Z6N A;  4K0G A;  2AB6 A;  2B5E A;  2LRN A;  4IS0 A;  5IPG A;  3APS A;  9GSS A;  3DRN A;  3M8N A;  2KOK A;  4X43 A;  5IO0 A;  2OE0 A;  2XC2 A;  4QL9 A;  2DJK A;  2O87 A;  5F06 A;  5EY6 A;  4V1A g;  3US3 A;  2FWH A;  3GMF A;  2DLX A;  3ZIJ A;  1O8X A;  5EPF A;  4MF7 A;  5ECS A;  1GH2 A;  5ECQ B;  3FKF A;  1F2E A;  4K1F A;  5E59 A;  2LRT A;  2HNL A;  1NHO A;  2NPB A;  3CTF A;  1X5C A;  4KW6 A;  2JAD A;  2VCW A;  1H75 A;  3F4R A;  2VD0 A;  3EMP A;  4MPF A;  1MD3 A;  4MAB A;  2B3S A;  3H1N A;  4IW9 A;  3FHK A;  1THO A;  3C73 A;  3VUR A;  4GSS A;  2VCT A;  3QDN A;  3DKS A;  4ZB8 A;  1FG4 A;  1X5D A;  2HZE B;  5IPH A;  5JWQ B;  4WF5 A;  1TKD B;  3W6G A;  3MSZ A;  2X8G A;  3VK9 A;  1NHY A;  4ZL9 A;  5IMD A;  2NBS A;  4MZB A;  1WIK A;  1A24 A;  4F2I A;  3KMN A;  2K9F A;  4HQS A;  2GGT A;  4GXZ A;  1M99 A;  3FR3 A;  2WCI A;  1VGL A;  2K8S A;  2LNS A;  2GT6 A;  3E9J B;  2H70 A;  4IP1 A;  2C0F A;  2FA8 A;  5G1K A;  2LQQ A;  3UAP A;  5D9W A;  5CAX A;  2YPM A;  4ZL8 A;  5IMC A;  4OWY A;  2L5L A;  5ECI B;  3IPZ A;  5F05 A;  2BTO T;  2E7P A;  1XFL A;  1OC8 A;  5G5F A;  1EGR A;  5CRG A;  1ILO A;  2VOC A;  3G9B A;  3RDW A;  3HZ8 A;  5CO3 A;  2PPT A;  2YWI A;  1M0U A;  3N5O A;  1PL2 A;  4ZB6 A;  4CHS A;  2NVL A;  2PER A;  4WR5 A;  1H4O A;  2B1K A;  4MLY A;  5CRE A;  4EKZ A;  1F3A A;  3JCM L;  1YEX A;  5HFG A;  4EVM A;  2QGV A;  3A2V A;  4KH7 A;  2QSI A;  1EWX A;  1PQN A;  2CVB A;  5IO2 A;  4ZIJ A;  3RPN A;  1GTI A;  1YF1 A;  2JSY A;  2B5X A;  3PGT A;  2H66 A;  3IE3 A;  1MDK A;  6GSW A;  1GNW A;  3IC4 A;  3EIN A;  1ERU A;  2VIM A;  1GUK A;  5J5N A;  4YH2 A;  3ED3 A;  3FRC A;  2H1D A;  4BVY A;  2JSZ A;  5J4U A;  4IN0 A;  3O76 A;  4BVX A;  4N0V A;  4IJI A;  5KN0 A;  1AAZ A;  4G9H A;  1BJX A;  4LA1 A;  2KP1 A;  3GUR A;  1VF4 A;  1TK0 B;  1SK1 A;  3D5J A;  3KTB A;  2YNX A;  4I5Q A;  2OE1 A;  5DAL B;  1G0T A;  4KAE A;  2XPD A;  4ZIL A;  1MDJ A;  3VLN A;  3UMA A;  2YWM A;  2GSQ A;  1AIU A;  2J9H A;  1SKS B;  3GNJ A;  4KUN A;  3GV1 A;  2VL9 A;  2O7K A;  3TKR A;  1AQW A;  4J56 E;  4OD7 A;  1XOB A;  4MDC A;  1M7T A;  1NM3 A;  4MJC A;  1K3L A;  4HUA A;  3M9K A;  5JWO B;  1KNG A;  1R5P A;  3WYW A;  4MJB A;  4ECB A;  1GSF A;  1FB0 A;  3MNG A;  1UN2 A;  1TK8 B;  2H74 A;  3GKM A;  2H0H A;  3GYK A;  4MP4 A;  5AGY A;  3GSS A;  10GS A;  3ME7 A;  22GS A;  3MWH A;  2GS3 A;  4POK A;  3GL5 A;  2R3X A;  2IME A;  1WP0 A;  5CRH A;  1HNA A;  5DAK B;  4N0Z A;  4K7N A;  4BWS A;  2P5R A;  3CMI A;  4LMV A;  2K6V A;  3ERF A;  3IR4 A;  4Q5N A;  4L8E A;  1JZO A;  1PL1 A;  3GX0 A;  3V1W A;  1XW9 A;  4TW5 A;  1PKW A;  1Y6E A;  3KP9 A;  4ISD A;  1SL1 B;  1F6M C;  2L6D A;  2MMA A;  3KH9 A;  4K7I A;  4HQZ A;  2GT5 A;  2VCX A;  1DSB A;  1ABA A;  4OFT A;  3DVW A;  3ZL5 A;  4EF0 A;  5DAL A;  4EE0 A;  2B7J A;  2ON5 A;  3A3T A;  2B1L A;  1B4P A;  3LOR A;  2LKU A;  3EU4 A;  3LYK A;  3QAW A;  4OO4 A;  4I97 A;  4OCF A;  1MD4 A;  3LSZ A;  2JZS A;  4AF2 A;  1Z6M A;  3KD0 A;  4WBJ A;  1Y25 A;  5D73 A;  2RII A;  3C7M A;  4I2T A;  2ZUP A;  1A2M A;  2H76 A;  4I2U A;  1XBS A;  2IMI A;  3F4T A;  7GSS A;  3LQ7 A;  1THX A;  3GUS A;  1RQM A;  3D4T A;  2Z9S A;  2QC7 A;  1G7O A;  4TR1 A;  5GAN D;  4JE1 A;  1K0M A;  2X64 A;  2ON7 A;  3GRX A;  1X9W B;  1T4Z A;  1GNE A;  4PUR A;  4DEJ A;  2RM5 A;  2H1B A;  2VO4 A;  4QQ7 A;  1GUH A;  3HXS A;  3VWX A;  4F0C A;  5C00 A;  1Z7P A;  4MMM A;  3GL3 A;  3ZIV A;  1EV9 A;  2GDR A;  5A5K A;  3EU3 A;  6GSV A;  2C1Y A;  4IQA A;  3H93 A;  1HYU A;  4MH2 A;  3HVV A;  4GF0 A;  2XHF A;  1PKZ A;  1M2B A;  4IBP A;  1ACV A;  2I9H A;  3ZZX A;  4IJ3 A;  1T7P B;  3O6T A;  1TTZ A;  17GS A;  2HSH A;  2BMX A;  2ZNM A;  4CW9 A;  4GSN A;  5IMF A;  5GAP D;  4ID0 A;  4I8B A;  1SKR B;  5DJL A;  3APO A;  1ZYQ B;  1GSE A;  4DSS A;  1XWB A;  2F8A A;  1FAA A;  3QAG A;  3IAS 2;  1JFU A;  3C1R A;  4KCA A;  3AY8 A;  2G0F A;  3RAZ A;  3KH7 A;  2OBI A;  2C3T A;  2R6K A;  2WRT A;  1XW6 A;  3I9V 2;  1VF2 A;  4O32 A;  5ECN B;  1RW1 A;  1O7U A;  2YV9 A;  1Q98 A;  2C3Q A;  5GST A;  4XIH A;  4TRX A;  1GL8 A;  1RK4 A;  5L71 A;  2LEG A;  3IA1 A;  4JR6 A;  1GWC A;  2A2R A;  1XWA A;  2VL3 A;  2K18 A;  3MAK A;  5ECR B;  5KN2 A;  2PWJ A;  5JCW A;  4GST A;  3TDG A;  3L9U A;  2C0E A;  3CBU A;  3IK7 A;  1URM A;  4DSQ A;  1FO5 A;  3H8Q A;  1OKT A;  3D22 A;  3F3Q A;  3FR9 A;  3IDV A;  2V6O A;  2FGX A;  3UBK A;  1SK0 A;  1X9S B;  4E8H A;  2KLX A;  3FZA A;  2WS2 A;  4HU7 A;  4XRD A;  4K0N A;  4RQR A;  3TRQ A;  3TB2 A;  3P2A A;  3EMX A;  3J7Y b;  3TJF A;  3A5W A;  2PVO C;  1V98 A;  5F0G A;  2FA4 A;  3P90 A;  4POM A;  1ST9 A;  2L57 A;  3F3R A;  1HQO A;  2VCZ A;  1ML6 A;  2MMZ A;  1B9X C;  2CT6 A;  3APQ A;  3EC3 A;  5JWR B;  5FT3 A;  3DEX A;  1SD8 A;  2VL2 C;  2IFQ A;  2IWT A;  2FUG 2;  1TRW A;  2M46 A;  1N8J A;  1XCC A;  4OMV A;  1WMJ A;  2IMK A;  2LV3 A;  6GSY A;  2C0G A;  2R37 A;  5CP1 A;  2JZR A;  2B5Y A;  5ECK B;  3LGC A;  2H6Y A;  1GSU A;  1WWJ A;  4MH3 A;  1I5G A;  2E0Q A;  3L0H A;  3DXB A;  5AN1 A;  4G19 A;  1PGT A;  2XBQ A;  4HI7 A;  1ZZY A;  1G6W A;  3G7J A;  1WOU A;  4NAX A;  5G31 A;  5C04 A;  3K8N A;  1KEB A;  2L6C A;  3UAR A;  1XWC A;  2B7K A;  3F0I A;  1A0R P;  1YJ6 A;  3H4K A;  18GS A;  3P8W A;  3RPP A;  2L4Q A;  1QXH A;  2VL2 A;  3F9U A;  5GZZ B;  5KN3 A;  1A23 A;  1SJI A;  3GKN A;  3R2Q A;  1YY7 A;  2O85 A;  4YAV A;  1ZCP A;  1E6B A;  1XVW A;  5ECL B;  1EGO A;  3KEB A;  4PQH A;  4YQV A;  1PRX A;  2H6X A;  2A2S A;  4HOJ A;  2D2Z A;  3KMO A;  3G7Y A;  5D9V A;  4BPY A;  4IP6 A;  1PX6 A;  2OAC A;  1SYX A;  3BJ5 A;  3LXZ A;  2CQ9 A;  4Q5F A;  1TU7 A;  2KHP A;  1U3A A;  3I6A A;  2FWG A;  5ID2 B;  1K0A A;  3UVH A;  4TXO B;  4ILF A;  4FYB A;  4ZBD A;  1QQ2 A;  2F9S A;  4L0U A;  1YEP A;  2YAN A;  1GSY A;  5DCG A;  1FVJ A;  1SD9 A;  4L5O A;  2VM1 A;  4WXT A;  2LJA A;  2PU9 C;  3DWV A;  2GSR A;  2PUK C;  2DJ1 A;  2OA7 A;  1FB6 A;  2YJ7 A;  4KDX A;  3O3T A;  4PXO A;  4FH8 A;  4OFM A;  4EC0 A;  4TN8 A;  2VUP A;  2E2G A;  2BJX A;  1JZR A;  1OKD A;  5CNW A;  3A2X A;  1AC1 A;  1Z5Y E;  4NXI A;  5ELG A;  1TP9 A;  5D9T A;  3U5R E;  2IL3 A;  2HZE A;  4X0X A;  3FY7 A;  2YP6 A;  2AUV A;  1SK2 A;  4LLR A;  5DQS A;  3TJG A;  1GLP A;  4HDE A;  1OAZ A;  4K7O A;  2YZH A;  2HE3 A;  4EDZ A;  1SYR A;  3W8J A;  2DMM A;  2C4J A;  1S3A A;  2TRC P;  4DSR A;  4JZQ A;  1E2Y A;  3GN3 A;  2WZ9 A;  1ERV A;  3ZYW A;  1ERT A;  2C8U A;  2H1G A;  1Z9H A;  4F82 A;  1GTA A;  2FWF A;  3RHC A;  3S9F A;  2CA8 A; 
#chains in the Genus database with same CATH topology
 1MDI A;  3GKX A;  4PNG A;  5A4V A;  2JAC A;  4ML6 A;  3F6F A;  6GSU A;  2VLU A;  2NDO A;  3WGX A;  3VWV A;  5HFI A;  1BQ7 A;  1FHE A;  2E2M A;  4J2F A;  1PA3 A;  4PGT A;  3F6D A;  5EL8 A;  1OE7 A;  5B7C A;  3QR6 A;  2CX4 A;  4MF5 A;  1XWK A;  2KP2 A;  3MIX A;  1R4W A;  3N9J A;  2JL4 A;  3HDC A;  2AV4 A;  1QUW A;  3LW9 A;  11GS A;  4HJM A;  2MBS A;  3TJJ A;  1R7H A;  3WGD A;  4GQF A;  2R4V A;  1XOA A;  5G5E A;  1TRV A;  2KUC A;  4TR0 A;  3GTU B;  2H0I A;  5J9B A;  4YAP A;  1U3I A;  2DJJ A;  13GS A;  1KTE A;  4KDU A;  2VLT A;  2RUF A;  1YF0 A;  3GIX A;  1S3C A;  3ZIT A;  4GTU A;  5B6N A;  1FW1 A;  2DC5 A;  1YKC A;  3NIV A;  5DDL A;  3HCZ A;  2I1U A;  3ERG A;  5HR0 A;  2LS5 A;  2K8V A;  4D73 B;  1ZYN A;  2HI7 A;  4MF6 A;  4PQ1 A;  3CRU A;  4JBB A;  4TVE A;  3LWA A;  3ZVJ A;  2C80 A;  3HJM A;  3IV4 A;  3UIW A;  2CX3 A;  2R0P A;  2IIY A;  2H30 A;  4POB A;  2VD1 A;  3C8E A;  3QPM A;  4PQI A;  4KGI A;  4K6X A;  2HRA A;  3ME8 A;  1IYI A;  3VWU A;  3KTL A;  5D93 A;  1DE2 A;  2LRC A;  2YZU A;  3TGZ A;  4FIW A;  5AIX A;  4MZC A;  1XZO A;  1U88 A;  3CSH A;  2VLV A;  3CRT A;  4JR4 A;  2V1M A;  3GH9 A;  2P0G A;  12GS A;  4AGS A;  1AQX A;  1TI3 A;  1PD2 1;  2GZZ A;  3ZML A;  2AYT A;  3FK8 A;  1SKW B;  2H75 A;  2GST A;  2A4V A;  1T3B A;  1OC9 B;  4G0K A;  1HD2 A;  2FWE A;  2V6K A;  1WJK A;  16GS A;  4V2M A;  1LU4 A;  5HR3 A;  4WEY A;  1TDI A;  3QFB C;  4NMU A;  2R0G A;  19GS A;  4WKW A;  4NV5 A;  4Q5R A;  3GFK A;  4GQC A;  4XS6 A;  1J08 A;  1G7E A;  2HRN A;  1USB A;  2LUS A;  5LD0 A;  5DAK A;  4EDY A;  4K2X A;  3L9S A;  3VWW A;  4NPB A;  1T8E B;  3HJP A;  3HD5 A;  4HZ2 A;  3M3M A;  3WT2 A;  4Z2T A;  5INY A;  3ZFL A;  5G1L A;  1AQV A;  1QK8 A;  2FHE A;  5ENU A;  2H6Z A;  4D73 A;  5H5Q A;  3FZ5 A;  1K3O A;  2H73 A;  3F4S A;  3IHG A;  5HR1 A;  2YV7 A;  3ZFB A;  1W89 A;  3CYN A;  2MZC A;  5J9C A;  2LJR A;  1SU9 A;  5IOW A;  1K3Y A;  3IK9 A;  3HA9 A;  3QMX A;  2F8F A;  3CXG A;  4XRA A;  5B8A A;  2H19 A;  3IAM 2;  3UJ1 A;  2YWN A;  1OYJ A;  2PGT A;  2IN3 A;  4H86 A;  3EWL A;  2M80 A;  5ECO B;  2X8C A;  3L9V A;  2N5A A;  3GX8 A;  2OKA A;  3GA4 A;  4N10 A;  3M1G A;  4ACS A;  1O6J A;  3J7Y k;  3D0Z A;  4Z7X A;  2HFD A;  2VCQ A;  2I4A A;  1GTU A;  3TKS C;  4G10 A;  1BED A;  3HVX A;  3W8S A;  1TXX A;  1BX9 A;  5DVB A;  2R0C A;  2PMT A;  1I9D A;  3VI5 A;  1FOV A;  5G30 A;  3EE2 A;  2DIZ A;  1OC9 A;  4O92 A;  1R26 A;  4KSM A;  2F3M A;  4ZBA A;  1MTC A;  2CVD A;  3SBC A;  3D6I A;  6GST A;  1Q4J A;  5ELA A;  4PUA A;  1JZD A;  1PFO A;  2PBJ A;  5IOX A;  4FO5 A;  1B8X A;  1YKA A;  2DSA A;  5JCU A;  1NW2 A;  4TOP A;  2OBK A;  2GQM A;  1GSS A;  5IQY A;  1GUL A;  1M9B A;  3EUR A;  1XW5 A;  1F37 A;  1JLV A;  2CVK A;  2WB9 A;  4KDY A;  2MBT A;  1O73 A;  1HNC A;  1TRU A;  2YJH A;  3UL3 A;  3TKS A;  2CAI A;  4ZXG A;  2HLS A;  5D9X A;  1A2J A;  2L4C A;  4V2L A;  2H72 A;  2HRF A;  2GSS A;  4L5L A;  1QMV A;  1XG8 A;  1ZMA A;  1KBN A;  4XTS A;  3VI7 A;  4XHM A;  1ON4 A;  2V2G A;  1ERW A;  1B9Y C;  4I6X A;  1YQ1 A;  3F8U A;  4AJ6 A;  3TUE A;  2X8H A;  2JU5 A;  4YQU A;  5A4W A;  2X99 A;  3KZQ A;  2JZT A;  3BOA A;  2EIQ A;  1A2L A;  5IMA A;  5H5S A;  3HY2 A;  1VF3 A;  2FNO A;  1C72 A;  1JHB A;  4BVY B;  2CZ2 A;  2AHE A;  2FY6 A;  3M0F A;  1V57 A;  2H0G A;  2ZCT A;  4BVX B;  2A2P A;  1TI1 A;  5KN1 A;  3BD2 A;  1T00 A;  3LEF A;  5IMZ A;  3HYP A;  3BCI A;  3HJO A;  1U87 A;  4CDO A;  4POL A;  5BMU A;  1XVQ A;  4IGJ A;  5J3R A;  2GQK A;  2GQL A;  2RLI A;  1CQH A;  3UOM A;  4XS4 B;  3I69 A;  3TJK A;  3TOU A;  1WRY A;  1BAY A;  5AIV A;  4JU5 A;  3LFL A;  4O5R A;  1V40 A;  3QCP A;  4KCE A;  1QGV A;  4LL4 B;  1B48 A;  2HZF A;  3NZN A;  4FQU A;  20GS A;  5HFK A;  3UVT A;  4GWR A;  5ECH B;  2WGR A;  1UVZ A;  1SJ6 A;  4CY8 A;  1EEM A;  6GSS A;  1AXD A;  4ECJ A;  2HRK A;  4KND A;  1XPV A;  2YWO A;  2CAQ A;  2O8V B;  1GP1 A;  1JLW A;  14GS A;  4RUV A;  1GRX A;  4WR4 A;  3ZLP A;  1UC7 A;  4N11 A;  4ECI A;  4PUF C;  1X5E A;  2HXK A;  3TKQ A;  1AW9 A;  3KJY A;  2QKE A;  4TKY A;  4ML1 A;  3RBT A;  5H5R A;  2DJ3 A;  1LJR A;  3QD9 A;  3DGQ A;  3VFI A;  1M2D A;  4GCI A;  4IEL A;  4KE3 A;  2WUL A;  4NHZ A;  2VM2 A;  5KEJ A;  3ZVJ D;  1WPI A;  1XXU A;  4QL7 A;  3FR6 A;  1TOF A;  4F03 A;  1F9M A;  1CQG A;  4V2N A;  1GUM A;  2DJ2 A;  1A8L A;  2CV4 A;  5LCZ A;  5B8B A;  8GSS A;  4MJA A;  4ZB9 A;  5IM9 A;  3TCO A;  4F9Z A;  1Z3E A;  3KCM A;  3TRX A;  2O89 A;  4AJ7 A;  1IYH A;  3VPT A;  4LMW A;  1TW9 A;  3C1S A;  4L0W A;  4WF4 A;  4WBR D;  2LJK A;  2FD3 A;  2IMF A;  3WGE A;  2H71 A;  3KXO A;  4KSO A;  3TRP A;  5DQY A;  4K9Z A;  3PH9 A;  2OE3 A;  2C0D A;  4XS4 A;  4MPG A;  1K0O A;  5DCH A;  3KIJ A;  2TRX A;  3CTG A;  3VPQ A;  2L59 A;  5LNK e;  3DML A;  4F0B A;  2WJU A;  1X0R A;  5ECM B;  4HJ2 A;  3WT1 A;  2WDU A;  1TK5 B;  3FZ9 A;  3Q74 A;  4YQM A;  3I43 A;  4EO3 A;  3E3E A;  4ZBB A;  2G2Q A;  3GHA A;  1EP7 A;  5ECP B;  1SEN A;  4BWQ A;  1V2A A;  1GTB A;  1JZW A;  3ERW A;  3A2W A;  1A0F A;  4HS1 A;  2I81 A;  5D96 A;  3TOT A;  4HU9 A;  5ID2 A;  4TXO A;  1S3D A;  4TR1 B;  2FCH A;  1V58 A;  5A4U A;  1V9W A;  4FYU A;  1EP8 A;  4BL7 B;  1SL2 B;  2PN8 A;  2AJQ B;  2OJL A;  3GKK A;  1T4Y A;  3RHB A;  1OVN A;  3MDK A;  4PNF A;  3TKS E;  5HQP A;  1TU8 A;  5D8I A;  4IQ1 A;  3KGK A;  3EVI A;  3L4N A;  5IMV A;  2UZ8 A;  3Q6O A;  2LNT A;  4BA7 A;  3GST A;  3CSJ A;  5IIZ A;  3BBY A;  1XWG A;  4RI6 A;  5J41 A;  1GSD A;  1DE1 A;  3QOU A;  4GLT A;  2DIY A;  4MJE A;  1O85 A;  4A5P A;  2N5B A;  2V32 A;  2I3Y A;  4E8E A;  4O7H A;  1PX7 A;  1MEK A;  2RUE A;  3KM6 A;  3M9J A;  3IHQ A;  4EUY A;  5ABR A;  4NHW A;  4USS A;  1YDK A;  4DSS B;  4KB3 A;  1EOH A;  2IMD A;  4DVC A;  3DYR A;  2GZY A;  4EL1 A;  2GLR A;  2V41 A;  4OCE A;  4LL1 B;  1GSQ A;  1GLQ A;  1EV4 A;  2YOI A;  5CRW A;  2GZP A;  3DVX A;  6GSX A;  4NWY A;  2AAW A;  4G2E A;  3PR8 A;  1DBY A;  3TJB A;  4TXV A;  2XBI A;  2A4H A;  4NV2 A;  2H1A A;  2MMN A;  5HR2 A;  1B4Q A;  3FW2 A;  2L5O A;  3UEM A;  3LG6 A;  4HSC X;  4PX1 A;  3UBL A;  3L78 A;  5COH A;  4K2D A;  1QFN A;  3FZ4 A;  3QFA C;  4X1U A;  2ES7 A;  4J57 E;  3D21 A;  4XCS A;  3CSI A;  3PIN A;  1NSW A;  1YZX A;  1BYE A;  5E4W A;  3LJR A;  4AJ8 A;  4OFN A;  2F51 A;  1TRS A;  4BL7 A;  3Q18 A;  5FHI A;  2N5F A;  1BG5 A;  1HNB A;  4OO5 A;  2IPA A;  3Q19 A;  4IHU A;  2J23 A;  1EEJ A;  3OR5 A;  2MYG A;  1ZL9 A;  3BCK A;  1SJZ A;  4ECC A;  1F3B A;  3ZTL A;  5DBQ A;  4P3Y B;  1UA5 A;  1W4V A;  4RQX A;  5GSS A;  2YCD A;  2GTU A;  3GTU A;  3DD3 A;  2ALB A;  2VAF A;  2P5Q A;  3ISO A;  1K0D A;  4FYC A;  5G2Z A;  1PMT A;  1VF1 A;  3IRA A;  3IOS A;  4MCU A;  4IKH A;  2HT9 A;  3DIE A;  1U6T A;  4HZ4 A;  5JCG A;  4PTS A;  2NTO A;  3WD6 A;  3NOF A;  2EIO A;  4ZL7 A;  5F07 A;  5CRD A;  5DJM A;  1FVK A;  3SWL A;  3IBH A;  2IFQ B;  4MZW A;  2RM6 A;  1K0N A;  3HKR A;  1J0F A;  2H01 A;  4EXJ A;  2P31 A;  4GRF A;  3LXT A;  3ZMK A;  1K0B A;  3G7I A;  3TKP A;  4KA0 A;  4Z2U A;  1VRS D;  1M2A A;  2FLS A;  2LQO A;  2DJ0 A;  3C71 A;  1AUC A;  3IXR A;  2WFC A;  5FWG A;  2M72 A;  1WE0 A;  1ZOF A;  5CYY A;  1O81 A;  3H79 A;  2REM A;  4KF9 A;  1O8W A;  2IJY A;  5F8B A;  3U6V A;  3HVS A;  1J9B A;  2HYX A;  1ZYE A;  3ZRE A;  3D4M A;  1M9A A;  3FEU A;  1R5A A;  2HSY A;  4RI7 A;  4JED A;  4KX4 A;  1PSQ A;  3P7X A;  1OE8 A;  2PVQ A;  4N30 A;  1TJD A;  1ZGN A;  4MA9 A;  4K8M A;  5B6M A;  3FYG A;  2LTK A;  3EYT A;  1A8Y A;  3KP8 A;  4MK3 A;  5AIS A;  2EIR A;  1OC3 A;  1X9M B;  2LST A;  2DML A;  1XIY A;  2R2J A;  4HEA 2;  2EC4 A;  3LYP A;  1DUG A;  1EZK A;  3GH6 A;  1Z7R A;  3HZ4 A;  3HHV A;  4ULX A;  1G6Y A;  4V1A p;  1EOG A;  3ZRD A;  2H8L A;  4Q5Q A;  2VCV A;  2CZ3 A;  4IVF A;  2TIR A;  2XPE A;  3QAV A;  2MMO A;  1N2A A;  4TR4 A;  1K0C A;  1T1V A;  2B6M A;  2C3N A;  4TR3 A;  1LBK A;  1SL0 B;  4WET A;  2R5G A;  2OAD A;  2YN1 A;  1PN9 A;  3E0U A;  4JRR A;  2GVP A;  3F63 A;  2DBC A;  3FMW A;  5EVO A;  4XS1 A;  1Z6N A;  4K0G A;  2AB6 A;  2B5E A;  2LRN A;  4IS0 A;  5IPG A;  3APS A;  9GSS A;  3DRN A;  3M8N A;  2KOK A;  4X43 A;  5IO0 A;  2OE0 A;  2XC2 A;  4QL9 A;  2DJK A;  2O87 A;  5F06 A;  5EY6 A;  4V1A g;  3US3 A;  2FWH A;  3GMF A;  2DLX A;  3ZIJ A;  4O5Q A;  1O8X A;  5EPF A;  4MF7 A;  5ECS A;  1GH2 A;  5ECQ B;  3FKF A;  1F2E A;  4K1F A;  5E59 A;  2LRT A;  2HNL A;  1NHO A;  2NPB A;  3CTF A;  1X5C A;  4KW6 A;  2JAD A;  2VCW A;  1H75 A;  3F4R A;  2VD0 A;  3EMP A;  4Z2R A;  4MPF A;  1MD3 A;  4MAB A;  2B3S A;  3H1N A;  4IW9 A;  3FHK A;  1THO A;  3C73 A;  3VUR A;  4GSS A;  2VCT A;  3QDN A;  3DKS A;  4ZB8 A;  1FG4 A;  1X5D A;  2HZE B;  5IPH A;  5JWQ B;  4WF5 A;  1TKD B;  3W6G A;  3MSZ A;  2X8G A;  3VK9 A;  1NHY A;  4ZL9 A;  5IMD A;  2NBS A;  4MZB A;  1WIK A;  1A24 A;  4F2I A;  3KMN A;  2K9F A;  4HQS A;  2GGT A;  4GXZ A;  1M99 A;  3FR3 A;  2WCI A;  1VGL A;  2K8S A;  2LNS A;  2GT6 A;  3E9J B;  2H70 A;  4IP1 A;  2C0F A;  2FA8 A;  5G1K A;  2LQQ A;  4EIP A;  3UAP A;  5D9W A;  5CAX A;  2YPM A;  4ZL8 A;  5IMC A;  4OWY A;  2L5L A;  5ECI B;  3IPZ A;  5F05 A;  2BTO T;  2E7P A;  1S3R A;  1XFL A;  1OC8 A;  5BRT A;  5G5F A;  1EGR A;  5CRG A;  1ILO A;  2VOC A;  3G9B A;  3RDW A;  3HZ8 A;  5CO3 A;  2PPT A;  2YWI A;  1M0U A;  3N5O A;  1PL2 A;  4ZB6 A;  4CHS A;  2NVL A;  2PER A;  4WR5 A;  1H4O A;  2B1K A;  4MLY A;  5CRE A;  4EKZ A;  1F3A A;  3JCM L;  1YEX A;  5HFG A;  4EVM A;  2QGV A;  3A2V A;  4KH7 A;  2QSI A;  1EWX A;  1PQN A;  2CVB A;  5IO2 A;  4ZIJ A;  3RPN A;  1GTI A;  1YF1 A;  2JSY A;  2B5X A;  3PGT A;  2H66 A;  3IE3 A;  1MDK A;  6GSW A;  1GNW A;  3IC4 A;  3EIN A;  1ERU A;  2VIM A;  1GUK A;  5J5N A;  4YH2 A;  3ED3 A;  3FRC A;  2H1D A;  2DKH A;  4BVY A;  2JSZ A;  5J4U A;  4IN0 A;  3O76 A;  4BVX A;  4N0V A;  4IJI A;  5KN0 A;  1AAZ A;  4G9H A;  1BJX A;  4LA1 A;  2KP1 A;  3GUR A;  1VF4 A;  1TK0 B;  1SK1 A;  3D5J A;  3KTB A;  2YNX A;  4I5Q A;  1ZYP A;  2OE1 A;  5DAL B;  1G0T A;  4KAE A;  2XPD A;  4ZIL A;  1MDJ A;  3VLN A;  3UMA A;  2YWM A;  2GSQ A;  4G0I A;  1AIU A;  2J9H A;  1SKS B;  3GNJ A;  4KUN A;  3GV1 A;  2VL9 A;  2O7K A;  3TKR A;  1AQW A;  4J56 E;  4OD7 A;  1XOB A;  4MDC A;  1M7T A;  1NM3 A;  4MJC A;  1K3L A;  4HUA A;  3M9K A;  5JWO B;  1KNG A;  1R5P A;  3WYW A;  4MJB A;  4ECB A;  1GSF A;  1FB0 A;  3MNG A;  1UN2 A;  1TK8 B;  2H74 A;  3GKM A;  2H0H A;  3GYK A;  4MP4 A;  5AGY A;  3GSS A;  10GS A;  3ME7 A;  22GS A;  3MWH A;  4O5U A;  2GS3 A;  4POK A;  3GL5 A;  2R3X A;  2IME A;  1WP0 A;  5CRH A;  1HNA A;  5DAK B;  4N0Z A;  4K7N A;  4BWS A;  2P5R A;  3CMI A;  4LMV A;  2K6V A;  3ERF A;  3IR4 A;  4Q5N A;  4L8E A;  1JZO A;  1PL1 A;  3GX0 A;  3V1W A;  1XW9 A;  4TW5 A;  1PKW A;  1Y6E A;  3KP9 A;  4ISD A;  1SL1 B;  1F6M C;  2L6D A;  2MMA A;  3KH9 A;  4K7I A;  4HQZ A;  2GT5 A;  2VCX A;  1DSB A;  1ABA A;  1M3I A;  4OFT A;  3R3E A;  3DVW A;  2HSM A;  3ZL5 A;  4EF0 A;  5DAL A;  4EE0 A;  2B7J A;  2ON5 A;  3A3T A;  2B1L A;  1B4P A;  3LOR A;  2LKU A;  2QA2 A;  3EU4 A;  3A5I A;  3LYK A;  3QAW A;  4OO4 A;  4MNN A;  4OCF A;  4I97 A;  1MD4 A;  3LSZ A;  2JZS A;  4AF2 A;  4ICY A;  1Z6M A;  3MYD A;  3KD0 A;  4WBJ A;  1Y25 A;  5D73 A;  2RII A;  3C7M A;  4K5R A;  4I2T A;  2ZUP A;  1A2M A;  2H76 A;  4I2U A;  1XBS A;  2IMI A;  3F4T A;  7GSS A;  3LQ7 A;  1THX A;  3GUS A;  1RQM A;  3D4T A;  2Z9S A;  2QC7 A;  1PN0 A;  1G7O A;  4TR1 A;  5GAN D;  4JE1 A;  1K0M A;  2X64 A;  2ON7 A;  3GRX A;  1X9W B;  1T4Z A;  1GNE A;  4PUR A;  4DEJ A;  2RM5 A;  2H1B A;  2VO4 A;  4QQ7 A;  1GUH A;  3HXS A;  3VWX A;  4F0C A;  5C00 A;  1Z7P A;  4MMM A;  3GL3 A;  3ZIV A;  1EV9 A;  2GDR A;  5A5K A;  3EU3 A;  6GSV A;  2C1Y A;  4IQA A;  3H93 A;  1HYU A;  4MH2 A;  3HVV A;  4GF0 A;  2XHF A;  1PKZ A;  1M2B A;  4IBP A;  1ACV A;  2I9H A;  3PPU A;  3ZZX A;  4IJ3 A;  1T7P B;  3O6T A;  1TTZ A;  17GS A;  2HSH A;  2BMX A;  2ZNM A;  4CW9 A;  4GSN A;  5IMF A;  5GAP D;  4ID0 A;  4I8B A;  1SKR B;  5DJL A;  3APO A;  1ZYQ B;  1GSE A;  4DSS A;  1XWB A;  4EIQ A;  2F8A A;  5KOX A;  1FAA A;  3QAG A;  1M3J A;  3IAS 2;  1JFU A;  3C1R A;  4KCA A;  3AY8 A;  2G0F A;  3RAZ A;  3KH7 A;  2OBI A;  2C3T A;  2R6K A;  2WRT A;  1XW6 A;  4X4J A;  3I9V 2;  1VF2 A;  1FOH A;  4O32 A;  5ECN B;  1RW1 A;  1O7U A;  4YKG A;  2YV9 A;  1Q98 A;  2C3Q A;  4YKF A;  4XIH A;  5GST A;  4TRX A;  1GL8 A;  1RK4 A;  5L71 A;  2LEG A;  3IA1 A;  4JR6 A;  1GWC A;  2A2R A;  1XWA A;  2VL3 A;  2K18 A;  3MAK A;  5ECR B;  5KN2 A;  2PWJ A;  5JCW A;  4GST A;  3TDG A;  3L9U A;  2C0E A;  3CBU A;  3IK7 A;  1URM A;  4DSQ A;  1FO5 A;  3H8Q A;  1OKT A;  3D22 A;  3F3Q A;  3FR9 A;  5KOW A;  3IDV A;  2V6O A;  2FGX A;  3UBK A;  4CY6 A;  1SK0 A;  1X9S B;  4E8H A;  2KLX A;  3FZA A;  2WS2 A;  4HU7 A;  4XRD A;  4K0N A;  4RQR A;  3TRQ A;  4K5S A;  3TB2 A;  3P2A A;  3EMX A;  3J7Y b;  2X4A A;  3TJF A;  3A5W A;  2PVO C;  1V98 A;  5F0G A;  2FA4 A;  3P90 A;  4POM A;  1ST9 A;  2L57 A;  3F3R A;  1HQO A;  2VCZ A;  1ML6 A;  2MMZ A;  1B9X C;  2CT6 A;  3APQ A;  3EC3 A;  5JWR B;  5FT3 A;  3DEX A;  1SD8 A;  2VL2 C;  2IFQ A;  2IWT A;  2FUG 2;  1TRW A;  2M46 A;  1N8J A;  1XCC A;  4OMV A;  1WMJ A;  2IMK A;  2LV3 A;  6GSY A;  2C0G A;  2R37 A;  4G0L A;  5CP1 A;  2JZR A;  2B5Y A;  5ECK B;  3LGC A;  2H6Y A;  1GSU A;  1WWJ A;  4MH3 A;  1I5G A;  2E0Q A;  3L0H A;  3DXB A;  5AN1 A;  4G19 A;  1PGT A;  2XBQ A;  4HI7 A;  1ZZY A;  1G6W A;  3G7J A;  1WOU A;  4NAX A;  5G31 A;  5C04 A;  3K8N A;  1KEB A;  2L6C A;  3UAR A;  1XWC A;  2B7K A;  3F0I A;  1A0R P;  1YJ6 A;  3H4K A;  18GS A;  3P8W A;  3RPP A;  2L4Q A;  1QXH A;  2VL2 A;  3F9U A;  5GZZ B;  5KN3 A;  1A23 A;  1SJI A;  3GKN A;  3R2Q A;  1YY7 A;  2O85 A;  4YAV A;  1ZCP A;  1E6B A;  1XVW A;  5ECL B;  1EGO A;  3KEB A;  4PQH A;  4YQV A;  1PRX A;  2H6X A;  2A2S A;  4HOJ A;  2D2Z A;  3KMO A;  3G7Y A;  5D9V A;  4BPY A;  4IP6 A;  1PX6 A;  2OAC A;  1SYX A;  3BJ5 A;  3LXZ A;  2CQ9 A;  4Q5F A;  3HVN A;  1TU7 A;  2KHP A;  2X49 A;  1U3A A;  3I6A A;  2FWG A;  5ID2 B;  1K0A A;  3UVH A;  4TXO B;  2QA1 A;  4ILF A;  4FYB A;  4ZBD A;  1QQ2 A;  2F9S A;  4L0U A;  1YEP A;  3EPT A;  2YAN A;  1GSY A;  5DCG A;  1FVJ A;  1SD9 A;  4L5O A;  2VM1 A;  4WXT A;  2LJA A;  2PU9 C;  3DWV A;  2GSR A;  2PUK C;  2DJ1 A;  3CQF A;  2OA7 A;  1FB6 A;  2YJ7 A;  4KDX A;  3O3T A;  4PXO A;  4FH8 A;  4OFM A;  2DKI A;  4EC0 A;  4TN8 A;  2VUP A;  2E2G A;  2BJX A;  1JZR A;  1OKD A;  5CNW A;  3A2X A;  1AC1 A;  1Z5Y E;  4NXI A;  5ELG A;  1TP9 A;  5D9T A;  3U5R E;  2IL3 A;  2HZE A;  4X0X A;  3FY7 A;  2YP6 A;  2AUV A;  1SK2 A;  4LLR A;  5DQS A;  3TJG A;  1GLP A;  4HDE A;  1OAZ A;  4K7O A;  2YZH A;  2HE3 A;  4EDZ A;  4BIK A;  1SYR A;  3W8J A;  2DMM A;  3IC8 A;  2C4J A;  1S3A A;  2TRC P;  4DSR A;  4JZQ A;  1E2Y A;  3GN3 A;  2WZ9 A;  1ERV A;  3ZYW A;  1ERT A;  2C8U A;  2H1G A;  1Z9H A;  4F82 A;  1GTA A;  2FWF A;  3RHC A;  3S9F A;  2CA8 A; 
#chains in the Genus database with same CATH homology
 1MDI A;  3GKX A;  4PNG A;  5A4V A;  2JAC A;  4ML6 A;  3F6F A;  6GSU A;  2VLU A;  2NDO A;  3WGX A;  3VWV A;  5HFI A;  1BQ7 A;  1FHE A;  2E2M A;  4J2F A;  1PA3 A;  4PGT A;  3F6D A;  5EL8 A;  1OE7 A;  5B7C A;  3QR6 A;  2CX4 A;  4MF5 A;  1XWK A;  2KP2 A;  3MIX A;  1R4W A;  3N9J A;  2JL4 A;  3HDC A;  2AV4 A;  1QUW A;  3LW9 A;  11GS A;  4HJM A;  2MBS A;  3TJJ A;  1R7H A;  3WGD A;  4GQF A;  2R4V A;  1XOA A;  5G5E A;  1TRV A;  2KUC A;  4TR0 A;  3GTU B;  2H0I A;  5J9B A;  4YAP A;  1U3I A;  2DJJ A;  13GS A;  1KTE A;  4KDU A;  2VLT A;  2RUF A;  1YF0 A;  3GIX A;  1S3C A;  3ZIT A;  4GTU A;  5B6N A;  1FW1 A;  2DC5 A;  1YKC A;  3NIV A;  5DDL A;  3HCZ A;  2I1U A;  3ERG A;  5HR0 A;  2LS5 A;  2K8V A;  4D73 B;  1ZYN A;  2HI7 A;  4MF6 A;  4PQ1 A;  3CRU A;  4JBB A;  4TVE A;  3LWA A;  3ZVJ A;  2C80 A;  3HJM A;  3IV4 A;  3UIW A;  2CX3 A;  2R0P A;  2IIY A;  2H30 A;  4POB A;  2VD1 A;  3C8E A;  3QPM A;  4PQI A;  4KGI A;  4K6X A;  2HRA A;  3ME8 A;  1IYI A;  3VWU A;  3KTL A;  5D93 A;  1DE2 A;  2LRC A;  2YZU A;  3TGZ A;  4FIW A;  5AIX A;  4MZC A;  1XZO A;  1U88 A;  3CSH A;  2VLV A;  3CRT A;  4JR4 A;  2V1M A;  3GH9 A;  2P0G A;  12GS A;  4AGS A;  1AQX A;  1TI3 A;  1PD2 1;  2GZZ A;  3ZML A;  2AYT A;  3FK8 A;  1SKW B;  2H75 A;  2GST A;  2A4V A;  1T3B A;  1OC9 B;  4G0K A;  1HD2 A;  2FWE A;  2V6K A;  1WJK A;  16GS A;  4V2M A;  1LU4 A;  5HR3 A;  4WEY A;  1TDI A;  3QFB C;  4NMU A;  2R0G A;  19GS A;  4WKW A;  4NV5 A;  4Q5R A;  3GFK A;  4GQC A;  4XS6 A;  1J08 A;  1G7E A;  2HRN A;  1USB A;  2LUS A;  5LD0 A;  5DAK A;  4EDY A;  4K2X A;  3L9S A;  3VWW A;  4NPB A;  1T8E B;  3HJP A;  3HD5 A;  4HZ2 A;  3M3M A;  3WT2 A;  4Z2T A;  5INY A;  3ZFL A;  5G1L A;  1AQV A;  1QK8 A;  2FHE A;  5ENU A;  2H6Z A;  4D73 A;  5H5Q A;  3FZ5 A;  1K3O A;  2H73 A;  3F4S A;  3IHG A;  5HR1 A;  2YV7 A;  3ZFB A;  1W89 A;  3CYN A;  2MZC A;  5J9C A;  2LJR A;  1SU9 A;  5IOW A;  1K3Y A;  3IK9 A;  3HA9 A;  3QMX A;  2F8F A;  3CXG A;  4XRA A;  5B8A A;  2H19 A;  3IAM 2;  3UJ1 A;  2YWN A;  1OYJ A;  2PGT A;  2IN3 A;  4H86 A;  3EWL A;  2M80 A;  5ECO B;  2X8C A;  3L9V A;  2N5A A;  3GX8 A;  2OKA A;  3GA4 A;  4N10 A;  3M1G A;  4ACS A;  1O6J A;  3J7Y k;  3D0Z A;  4Z7X A;  2HFD A;  2VCQ A;  2I4A A;  1GTU A;  3TKS C;  4G10 A;  1BED A;  3HVX A;  3W8S A;  1TXX A;  1BX9 A;  5DVB A;  2R0C A;  2PMT A;  1I9D A;  3VI5 A;  1FOV A;  5G30 A;  3EE2 A;  2DIZ A;  1OC9 A;  4O92 A;  1R26 A;  4KSM A;  2F3M A;  4ZBA A;  1MTC A;  2CVD A;  3SBC A;  3D6I A;  6GST A;  1Q4J A;  5ELA A;  4PUA A;  1JZD A;  2PBJ A;  5IOX A;  4FO5 A;  1B8X A;  1YKA A;  2DSA A;  5JCU A;  1NW2 A;  4TOP A;  2OBK A;  2GQM A;  1GSS A;  5IQY A;  1GUL A;  1M9B A;  3EUR A;  1XW5 A;  1F37 A;  1JLV A;  2CVK A;  2WB9 A;  4KDY A;  2MBT A;  1O73 A;  1HNC A;  1TRU A;  2YJH A;  3UL3 A;  3TKS A;  2CAI A;  4ZXG A;  2HLS A;  5D9X A;  1A2J A;  2L4C A;  4V2L A;  2H72 A;  2HRF A;  2GSS A;  4L5L A;  1QMV A;  1ZMA A;  1KBN A;  4XTS A;  3VI7 A;  4XHM A;  1ON4 A;  2V2G A;  1ERW A;  1B9Y C;  4I6X A;  1YQ1 A;  3F8U A;  4AJ6 A;  3TUE A;  2X8H A;  2JU5 A;  4YQU A;  5A4W A;  2X99 A;  3KZQ A;  2JZT A;  3BOA A;  2EIQ A;  1A2L A;  5IMA A;  5H5S A;  3HY2 A;  1VF3 A;  2FNO A;  1C72 A;  1JHB A;  4BVY B;  2CZ2 A;  2AHE A;  2FY6 A;  3M0F A;  1V57 A;  2H0G A;  2ZCT A;  4BVX B;  2A2P A;  1TI1 A;  5KN1 A;  3BD2 A;  1T00 A;  3LEF A;  5IMZ A;  3HYP A;  3BCI A;  3HJO A;  1U87 A;  4CDO A;  4POL A;  5BMU A;  1XVQ A;  4IGJ A;  5J3R A;  2GQK A;  2GQL A;  2RLI A;  1CQH A;  3UOM A;  4XS4 B;  3I69 A;  3TJK A;  3TOU A;  1WRY A;  1BAY A;  5AIV A;  4JU5 A;  3LFL A;  4O5R A;  1V40 A;  3QCP A;  4KCE A;  1QGV A;  4LL4 B;  1B48 A;  2HZF A;  3NZN A;  4FQU A;  20GS A;  5HFK A;  3UVT A;  4GWR A;  5ECH B;  2WGR A;  1UVZ A;  1SJ6 A;  4CY8 A;  1EEM A;  6GSS A;  1AXD A;  4ECJ A;  2HRK A;  4KND A;  1XPV A;  2YWO A;  2CAQ A;  2O8V B;  1GP1 A;  1JLW A;  14GS A;  4RUV A;  1GRX A;  4WR4 A;  3ZLP A;  1UC7 A;  4N11 A;  4ECI A;  4PUF C;  1X5E A;  2HXK A;  3TKQ A;  1AW9 A;  3KJY A;  2QKE A;  4TKY A;  4ML1 A;  3RBT A;  5H5R A;  2DJ3 A;  1LJR A;  3QD9 A;  3DGQ A;  3VFI A;  1M2D A;  4GCI A;  4IEL A;  4KE3 A;  2WUL A;  4NHZ A;  2VM2 A;  5KEJ A;  3ZVJ D;  1WPI A;  1XXU A;  4QL7 A;  3FR6 A;  1TOF A;  4F03 A;  1F9M A;  1CQG A;  4V2N A;  1GUM A;  2DJ2 A;  1A8L A;  2CV4 A;  5LCZ A;  5B8B A;  8GSS A;  4MJA A;  4ZB9 A;  5IM9 A;  3TCO A;  4F9Z A;  1Z3E A;  3KCM A;  3TRX A;  2O89 A;  4AJ7 A;  1IYH A;  3VPT A;  4LMW A;  1TW9 A;  3C1S A;  4L0W A;  4WF4 A;  4WBR D;  2LJK A;  2FD3 A;  2IMF A;  3WGE A;  2H71 A;  3KXO A;  4KSO A;  3TRP A;  5DQY A;  4K9Z A;  3PH9 A;  2OE3 A;  2C0D A;  4XS4 A;  4MPG A;  1K0O A;  5DCH A;  3KIJ A;  2TRX A;  3CTG A;  3VPQ A;  2L59 A;  5LNK e;  3DML A;  4F0B A;  2WJU A;  1X0R A;  5ECM B;  4HJ2 A;  3WT1 A;  2WDU A;  1TK5 B;  3FZ9 A;  3Q74 A;  4YQM A;  3I43 A;  4EO3 A;  3E3E A;  4ZBB A;  2G2Q A;  3GHA A;  1EP7 A;  5ECP B;  1SEN A;  4BWQ A;  1V2A A;  1GTB A;  1JZW A;  3ERW A;  3A2W A;  1A0F A;  4HS1 A;  2I81 A;  5D96 A;  3TOT A;  4HU9 A;  5ID2 A;  4TXO A;  1S3D A;  4TR1 B;  2FCH A;  1V58 A;  5A4U A;  1V9W A;  4FYU A;  1EP8 A;  4BL7 B;  1SL2 B;  2PN8 A;  2AJQ B;  2OJL A;  3GKK A;  1T4Y A;  3RHB A;  1OVN A;  3MDK A;  4PNF A;  3TKS E;  5HQP A;  1TU8 A;  5D8I A;  4IQ1 A;  3KGK A;  3EVI A;  3L4N A;  5IMV A;  2UZ8 A;  3Q6O A;  2LNT A;  4BA7 A;  3GST A;  3CSJ A;  5IIZ A;  3BBY A;  1XWG A;  4RI6 A;  5J41 A;  1GSD A;  1DE1 A;  3QOU A;  4GLT A;  2DIY A;  4MJE A;  1O85 A;  4A5P A;  2N5B A;  2V32 A;  2I3Y A;  4E8E A;  4O7H A;  1PX7 A;  1MEK A;  2RUE A;  3KM6 A;  3M9J A;  3IHQ A;  4EUY A;  5ABR A;  4NHW A;  4USS A;  1YDK A;  4DSS B;  4KB3 A;  1EOH A;  2IMD A;  4DVC A;  3DYR A;  2GZY A;  4EL1 A;  2GLR A;  2V41 A;  4OCE A;  4LL1 B;  1GSQ A;  1GLQ A;  1EV4 A;  2YOI A;  5CRW A;  2GZP A;  3DVX A;  6GSX A;  4NWY A;  2AAW A;  4G2E A;  3PR8 A;  1DBY A;  3TJB A;  4TXV A;  2XBI A;  2A4H A;  4NV2 A;  2H1A A;  2MMN A;  5HR2 A;  1B4Q A;  3FW2 A;  2L5O A;  3UEM A;  3LG6 A;  4PX1 A;  3UBL A;  3L78 A;  5COH A;  4K2D A;  1QFN A;  3FZ4 A;  3QFA C;  4X1U A;  2ES7 A;  4J57 E;  3D21 A;  4XCS A;  3CSI A;  3PIN A;  1NSW A;  1YZX A;  1BYE A;  5E4W A;  3LJR A;  4AJ8 A;  4OFN A;  2F51 A;  1TRS A;  4BL7 A;  3Q18 A;  5FHI A;  2N5F A;  1BG5 A;  1HNB A;  4OO5 A;  2IPA A;  3Q19 A;  4IHU A;  2J23 A;  1EEJ A;  3OR5 A;  2MYG A;  1ZL9 A;  3BCK A;  1SJZ A;  4ECC A;  1F3B A;  3ZTL A;  5DBQ A;  4P3Y B;  1UA5 A;  1W4V A;  4RQX A;  5GSS A;  2YCD A;  2GTU A;  3GTU A;  3DD3 A;  2ALB A;  2VAF A;  2P5Q A;  3ISO A;  1K0D A;  4FYC A;  5G2Z A;  1PMT A;  1VF1 A;  3IRA A;  3IOS A;  4MCU A;  4IKH A;  2HT9 A;  3DIE A;  1U6T A;  4HZ4 A;  5JCG A;  4PTS A;  2NTO A;  3WD6 A;  3NOF A;  2EIO A;  4ZL7 A;  5F07 A;  5CRD A;  5DJM A;  1FVK A;  3SWL A;  3IBH A;  2IFQ B;  4MZW A;  2RM6 A;  1K0N A;  3HKR A;  1J0F A;  2H01 A;  4EXJ A;  2P31 A;  4GRF A;  3LXT A;  3ZMK A;  1K0B A;  3G7I A;  3TKP A;  4KA0 A;  4Z2U A;  1VRS D;  1M2A A;  2FLS A;  2LQO A;  2DJ0 A;  3C71 A;  1AUC A;  3IXR A;  2WFC A;  5FWG A;  2M72 A;  1WE0 A;  1ZOF A;  5CYY A;  1O81 A;  3H79 A;  2REM A;  4KF9 A;  1O8W A;  2IJY A;  5F8B A;  3U6V A;  3HVS A;  1J9B A;  2HYX A;  1ZYE A;  3ZRE A;  3D4M A;  1M9A A;  3FEU A;  1R5A A;  2HSY A;  4RI7 A;  4JED A;  4KX4 A;  1PSQ A;  3P7X A;  1OE8 A;  2PVQ A;  4N30 A;  1TJD A;  1ZGN A;  4MA9 A;  4K8M A;  5B6M A;  3FYG A;  2LTK A;  3EYT A;  1A8Y A;  3KP8 A;  4MK3 A;  5AIS A;  2EIR A;  1OC3 A;  1X9M B;  2LST A;  2DML A;  1XIY A;  2R2J A;  4HEA 2;  2EC4 A;  3LYP A;  1DUG A;  1EZK A;  3GH6 A;  1Z7R A;  3HZ4 A;  3HHV A;  4ULX A;  1G6Y A;  4V1A p;  1EOG A;  3ZRD A;  2H8L A;  4Q5Q A;  2VCV A;  2CZ3 A;  4IVF A;  2TIR A;  2XPE A;  3QAV A;  2MMO A;  1N2A A;  4TR4 A;  1K0C A;  1T1V A;  2B6M A;  2C3N A;  4TR3 A;  1LBK A;  1SL0 B;  4WET A;  2R5G A;  2OAD A;  2YN1 A;  1PN9 A;  3E0U A;  4JRR A;  2GVP A;  3F63 A;  2DBC A;  3FMW A;  5EVO A;  4XS1 A;  1Z6N A;  4K0G A;  2AB6 A;  2B5E A;  2LRN A;  4IS0 A;  5IPG A;  3APS A;  9GSS A;  3DRN A;  3M8N A;  2KOK A;  4X43 A;  5IO0 A;  2OE0 A;  2XC2 A;  4QL9 A;  2DJK A;  2O87 A;  5F06 A;  5EY6 A;  4V1A g;  3US3 A;  2FWH A;  3GMF A;  2DLX A;  3ZIJ A;  4O5Q A;  1O8X A;  5EPF A;  4MF7 A;  5ECS A;  1GH2 A;  5ECQ B;  3FKF A;  1F2E A;  4K1F A;  5E59 A;  2LRT A;  2HNL A;  1NHO A;  2NPB A;  3CTF A;  1X5C A;  4KW6 A;  2JAD A;  2VCW A;  1H75 A;  3F4R A;  2VD0 A;  3EMP A;  4Z2R A;  4MPF A;  1MD3 A;  4MAB A;  2B3S A;  3H1N A;  4IW9 A;  3FHK A;  1THO A;  3C73 A;  3VUR A;  4GSS A;  2VCT A;  3QDN A;  3DKS A;  4ZB8 A;  1FG4 A;  1X5D A;  2HZE B;  5IPH A;  5JWQ B;  4WF5 A;  1TKD B;  3W6G A;  3MSZ A;  2X8G A;  3VK9 A;  1NHY A;  4ZL9 A;  5IMD A;  2NBS A;  4MZB A;  1WIK A;  1A24 A;  4F2I A;  3KMN A;  2K9F A;  4HQS A;  2GGT A;  4GXZ A;  1M99 A;  3FR3 A;  2WCI A;  1VGL A;  2K8S A;  2LNS A;  2GT6 A;  3E9J B;  2H70 A;  4IP1 A;  2C0F A;  2FA8 A;  5G1K A;  2LQQ A;  4EIP A;  3UAP A;  5D9W A;  5CAX A;  2YPM A;  4ZL8 A;  5IMC A;  4OWY A;  2L5L A;  5ECI B;  3IPZ A;  5F05 A;  2BTO T;  2E7P A;  1XFL A;  1OC8 A;  5BRT A;  5G5F A;  1EGR A;  5CRG A;  1ILO A;  2VOC A;  3G9B A;  3RDW A;  3HZ8 A;  5CO3 A;  2PPT A;  2YWI A;  1M0U A;  3N5O A;  1PL2 A;  4ZB6 A;  4CHS A;  2NVL A;  2PER A;  4WR5 A;  1H4O A;  2B1K A;  4MLY A;  5CRE A;  4EKZ A;  1F3A A;  3JCM L;  1YEX A;  5HFG A;  4EVM A;  2QGV A;  3A2V A;  4KH7 A;  2QSI A;  1EWX A;  1PQN A;  2CVB A;  5IO2 A;  4ZIJ A;  3RPN A;  1GTI A;  1YF1 A;  2JSY A;  2B5X A;  3PGT A;  2H66 A;  3IE3 A;  1MDK A;  6GSW A;  1GNW A;  3IC4 A;  3EIN A;  1ERU A;  2VIM A;  1GUK A;  5J5N A;  4YH2 A;  3ED3 A;  3FRC A;  2H1D A;  2DKH A;  4BVY A;  2JSZ A;  5J4U A;  4IN0 A;  3O76 A;  4BVX A;  4N0V A;  4IJI A;  5KN0 A;  1AAZ A;  4G9H A;  1BJX A;  4LA1 A;  2KP1 A;  3GUR A;  1VF4 A;  1TK0 B;  1SK1 A;  3D5J A;  3KTB A;  2YNX A;  4I5Q A;  1ZYP A;  2OE1 A;  5DAL B;  1G0T A;  4KAE A;  2XPD A;  4ZIL A;  1MDJ A;  3VLN A;  3UMA A;  2YWM A;  2GSQ A;  4G0I A;  1AIU A;  2J9H A;  1SKS B;  3GNJ A;  4KUN A;  3GV1 A;  2VL9 A;  2O7K A;  3TKR A;  1AQW A;  4J56 E;  4OD7 A;  1XOB A;  4MDC A;  1M7T A;  1NM3 A;  4MJC A;  1K3L A;  4HUA A;  3M9K A;  5JWO B;  1KNG A;  1R5P A;  3WYW A;  4MJB A;  4ECB A;  1GSF A;  1FB0 A;  3MNG A;  1UN2 A;  1TK8 B;  2H74 A;  3GKM A;  2H0H A;  3GYK A;  4MP4 A;  5AGY A;  3GSS A;  10GS A;  3ME7 A;  22GS A;  3MWH A;  4O5U A;  2GS3 A;  4POK A;  3GL5 A;  2R3X A;  2IME A;  1WP0 A;  5CRH A;  1HNA A;  5DAK B;  4N0Z A;  4K7N A;  4BWS A;  2P5R A;  3CMI A;  4LMV A;  2K6V A;  3ERF A;  3IR4 A;  4Q5N A;  4L8E A;  1JZO A;  1PL1 A;  3GX0 A;  3V1W A;  1XW9 A;  4TW5 A;  1PKW A;  1Y6E A;  3KP9 A;  4ISD A;  1SL1 B;  1F6M C;  2L6D A;  2MMA A;  3KH9 A;  4K7I A;  4HQZ A;  2GT5 A;  2VCX A;  1DSB A;  1ABA A;  4OFT A;  3R3E A;  3DVW A;  2HSM A;  3ZL5 A;  4EF0 A;  5DAL A;  4EE0 A;  2B7J A;  2ON5 A;  3A3T A;  2B1L A;  1B4P A;  3LOR A;  2LKU A;  2QA2 A;  3EU4 A;  3A5I A;  3LYK A;  3QAW A;  4OO4 A;  4MNN A;  4OCF A;  4I97 A;  1MD4 A;  3LSZ A;  2JZS A;  4AF2 A;  4ICY A;  1Z6M A;  3MYD A;  3KD0 A;  4WBJ A;  1Y25 A;  5D73 A;  2RII A;  3C7M A;  4K5R A;  4I2T A;  2ZUP A;  1A2M A;  2H76 A;  4I2U A;  1XBS A;  2IMI A;  3F4T A;  7GSS A;  3LQ7 A;  1THX A;  3GUS A;  1RQM A;  3D4T A;  2Z9S A;  2QC7 A;  1PN0 A;  1G7O A;  4TR1 A;  5GAN D;  4JE1 A;  1K0M A;  2X64 A;  2ON7 A;  3GRX A;  1X9W B;  1T4Z A;  1GNE A;  4PUR A;  4DEJ A;  2RM5 A;  2H1B A;  2VO4 A;  4QQ7 A;  1GUH A;  3HXS A;  3VWX A;  4F0C A;  5C00 A;  1Z7P A;  4MMM A;  3GL3 A;  3ZIV A;  1EV9 A;  2GDR A;  5A5K A;  3EU3 A;  6GSV A;  2C1Y A;  4IQA A;  3H93 A;  1HYU A;  4MH2 A;  3HVV A;  4GF0 A;  2XHF A;  1PKZ A;  1M2B A;  4IBP A;  1ACV A;  2I9H A;  3PPU A;  3ZZX A;  4IJ3 A;  1T7P B;  3O6T A;  1TTZ A;  17GS A;  2HSH A;  2BMX A;  2ZNM A;  4CW9 A;  4GSN A;  5IMF A;  5GAP D;  4ID0 A;  4I8B A;  1SKR B;  5DJL A;  3APO A;  1ZYQ B;  1GSE A;  4DSS A;  1XWB A;  4EIQ A;  2F8A A;  5KOX A;  1FAA A;  3QAG A;  3IAS 2;  1JFU A;  3C1R A;  4KCA A;  3AY8 A;  2G0F A;  3RAZ A;  3KH7 A;  2OBI A;  2C3T A;  2R6K A;  2WRT A;  1XW6 A;  4X4J A;  3I9V 2;  1VF2 A;  1FOH A;  4O32 A;  5ECN B;  1RW1 A;  1O7U A;  4YKG A;  2YV9 A;  1Q98 A;  2C3Q A;  4YKF A;  4XIH A;  5GST A;  4TRX A;  1GL8 A;  1RK4 A;  5L71 A;  2LEG A;  3IA1 A;  4JR6 A;  1GWC A;  2A2R A;  1XWA A;  2VL3 A;  2K18 A;  3MAK A;  5ECR B;  5KN2 A;  2PWJ A;  5JCW A;  4GST A;  3TDG A;  3L9U A;  2C0E A;  3CBU A;  3IK7 A;  1URM A;  4DSQ A;  1FO5 A;  3H8Q A;  1OKT A;  3D22 A;  3F3Q A;  3FR9 A;  5KOW A;  3IDV A;  2V6O A;  2FGX A;  3UBK A;  4CY6 A;  1SK0 A;  1X9S B;  4E8H A;  2KLX A;  3FZA A;  2WS2 A;  4HU7 A;  4XRD A;  4K0N A;  4RQR A;  3TRQ A;  4K5S A;  3TB2 A;  3P2A A;  3EMX A;  3J7Y b;  2X4A A;  3TJF A;  3A5W A;  2PVO C;  1V98 A;  5F0G A;  2FA4 A;  3P90 A;  4POM A;  1ST9 A;  2L57 A;  3F3R A;  1HQO A;  2VCZ A;  1ML6 A;  2MMZ A;  1B9X C;  2CT6 A;  3APQ A;  3EC3 A;  5JWR B;  5FT3 A;  3DEX A;  1SD8 A;  2VL2 C;  2IFQ A;  2IWT A;  2FUG 2;  1TRW A;  2M46 A;  1N8J A;  1XCC A;  4OMV A;  1WMJ A;  2IMK A;  2LV3 A;  6GSY A;  2C0G A;  2R37 A;  4G0L A;  5CP1 A;  2JZR A;  2B5Y A;  5ECK B;  3LGC A;  2H6Y A;  1GSU A;  1WWJ A;  4MH3 A;  1I5G A;  2E0Q A;  3L0H A;  3DXB A;  5AN1 A;  4G19 A;  1PGT A;  2XBQ A;  4HI7 A;  1ZZY A;  1G6W A;  3G7J A;  1WOU A;  4NAX A;  5G31 A;  5C04 A;  3K8N A;  1KEB A;  2L6C A;  3UAR A;  1XWC A;  2B7K A;  3F0I A;  1A0R P;  1YJ6 A;  3H4K A;  18GS A;  3P8W A;  3RPP A;  2L4Q A;  1QXH A;  2VL2 A;  3F9U A;  5GZZ B;  5KN3 A;  1A23 A;  1SJI A;  3GKN A;  3R2Q A;  1YY7 A;  2O85 A;  4YAV A;  1ZCP A;  1E6B A;  1XVW A;  5ECL B;  1EGO A;  3KEB A;  4PQH A;  4YQV A;  1PRX A;  2H6X A;  2A2S A;  4HOJ A;  2D2Z A;  3KMO A;  3G7Y A;  5D9V A;  4BPY A;  4IP6 A;  1PX6 A;  2OAC A;  1SYX A;  3BJ5 A;  3LXZ A;  2CQ9 A;  4Q5F A;  1TU7 A;  2KHP A;  2X49 A;  1U3A A;  3I6A A;  2FWG A;  5ID2 B;  1K0A A;  3UVH A;  4TXO B;  2QA1 A;  4ILF A;  4FYB A;  4ZBD A;  1QQ2 A;  2F9S A;  4L0U A;  1YEP A;  3EPT A;  2YAN A;  1GSY A;  5DCG A;  1FVJ A;  1SD9 A;  4L5O A;  2VM1 A;  4WXT A;  2LJA A;  2PU9 C;  3DWV A;  2GSR A;  2PUK C;  2DJ1 A;  2OA7 A;  1FB6 A;  2YJ7 A;  4KDX A;  3O3T A;  4PXO A;  4FH8 A;  4OFM A;  2DKI A;  4EC0 A;  4TN8 A;  2VUP A;  2E2G A;  2BJX A;  1JZR A;  1OKD A;  5CNW A;  3A2X A;  1AC1 A;  1Z5Y E;  4NXI A;  5ELG A;  1TP9 A;  5D9T A;  3U5R E;  2IL3 A;  2HZE A;  4X0X A;  3FY7 A;  2YP6 A;  2AUV A;  1SK2 A;  4LLR A;  5DQS A;  3TJG A;  1GLP A;  4HDE A;  1OAZ A;  4K7O A;  2YZH A;  2HE3 A;  4EDZ A;  1SYR A;  3W8J A;  2DMM A;  3IC8 A;  2C4J A;  1S3A A;  2TRC P;  4DSR A;  4JZQ A;  1E2Y A;  3GN3 A;  2WZ9 A;  1ERV A;  3ZYW A;  1ERT A;  2C8U A;  2H1G A;  1Z9H A;  4F82 A;  1GTA A;  2FWF A;  3RHC A;  3S9F A;  2CA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...