4POKA

Crystal structures of thioredoxin with mesna at 2.5a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
106
structure length
106
Chain Sequence
TMVKQIESKTAFQKALKAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKKKLEATINKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin
publication title BNP7787 Forms Novel Covalent Adducts on Human Thioredoxin and Modulates Thioredoxin Activity
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 35
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4pokA00
3GKXA 2FHEA 2KHPA 4EDZA 2G0FA 3GYKA 3LGCA 2H74A 2HFDA 3TOUA 3KTBA 3TKPA 5EL8A 3GA4A 2OJLA 3TJJA 3G7JA 4L8EA 1O85A 1O6JA 4BL7A 4TOPA 2L6DA 1B4QA 3TB2A 1JZOA 3VWVA 3D0ZA 2IWTA 3RPNA 2YWNA 3KMNA 5CO3A 1AQWA 4FIWA 1YZXA 2F8FA 1V58A 5FWGA 2VCZA 2N5FA 1NHOA 4KA0A 2QKEA 2HZEA 1T8EB 2AHEA 5HR1A 3RPPA 4EF0A 2ZUPA 1Y6EA 5HQPA 3KH9A 3BOAA 3UJ1A 2C8UA 5D9VA 5DCGA 2MZCA 2WB9A 5IM9A 2C80A 4BVXA 4MPFA 3ED3A 4Z7XA 2WDUA 2L4CA 4WETA 5G1KA 2E2MA 2IMKA 1HNBA 2YWIA 4TXVA 1CQHA 4F0BA 3TUEA 3HJOA 1GSEA 4HI7A 2VD1A 1C72A 2C3QA 2VL2A 3CTGA 4NWYA 3G7YA 4TR4A 2KUCA 4HEA2 1XXUA 1TRUA 3RHBA 2GT5A 2X8CA 2LEGA 2FUG2 1GNEA 1F9MA 4D73B 3Q19A 5DJMA 3EURA 2LJAA 4IBPA 3J7Yk 2VL3A 4HS1A 2PVQA 4MCUA 1EGRA 1M9AA 3C71A 5F06A 3PINA 1X5CA 4BVYA 2LTKA 4I8BA 1SU9A 4OWYA 2RM6A 4ZB8A 1EEMA 3EE2A 3GHAA 4ZBDA 3DEXA 2R2JA 3WT2A 4ULXA 3TKRA 1SKRB 3JCML 1VGLA 2ZNMA 5EVOA 1H75A 3UBKA 4XS4B 1FHEA 1A0FA 3F8UA 5J5NA 2V32A 3KTLA 2YV9A 1TK8B 1DBYA 2H19A 2H71A 3TKSA 2IJYA 4CDOA 3D6IA 2MMOA 3GV1A 4EE0A 1HYUA 2K9FA 4MABA 3DGQA 5DALB 5AIXA 4JEDA 4JR6A 1SL0B 1URMA 1TK5B 1A8LA 1TXXA 3E9JB 4IN0A 3QCPA 1YQ1A 4POMA 3BCKA 5CREA 4Q5NA 5HFGA 2ON5A 4LL4B 1JHBA 2AV4A 5D9XA 3F6FA 5L71A 1J0FA 1O81A 3GKKA 2F3MA 1PKZA 1DUGA 3LYKA 4YH2A 1BAYA 2X64A 4WF4A 3BD2A 4ML6A 5D9WA 2P0GA 1GULA 2QSIA 2VCVA 3KH7A 4L0UA 5CRWA 3US3A 5IIZA 4TR1B 4YQMA 5ECLB 3KXOA 2VM1A 4EVMA 4YAPA 1J08A 2NDOA 5JCWA 1H4OA 2C3TA 4DSSB 1A23A 1OKTA 1GP1A 1GUKA 3ZMKA 1B9YC 1Z6MA 2LS5A 1YEPA 1JZDA 2DSAA 4MZWA 1U6TA 1MEKA 4F9ZA 2L4QA 3AY8A 1X5EA 2PERA 1O8XA 4MLYA 2LKUA 2YWOA 2VL2C 4PGTA 3MSZA 2C0FA 4RI7A 5E59A 2R37A 3LSZA 5IMVA 4GQFA 4GTUA 1XOBA 2PN8A 1BG5A 3UL3A 1N8JA 3O3TA 4RQXA 1PX7A 1AC1A 2B1LA 4PQHA 5ECQB 5HFIA 2F51A 2TRXA 4WBJA 2JZRA 4MJCA 2IMEA 1K0AA 1GSQA 2C0EA 4ZBAA 2H75A 3QMXA 2GQMA 5DQSA 1S3DA 2VCQA 5B8AA 3EWLA 1KNGA 1JLVA 5IMCA 3ZITA 4ZB9A 2H1DA 5DAKA 4PNGA 1JZRA 1R26A 3A2VA 3FZ5A 4ZL9A 3GL5A 2HE3A 3IR4A 1KEBA 1M9BA 5DQYA 4BWQA 3DXBA 2R6KA 3FR6A 3U6VA 1XW5A 4ECBA 3UVTA 2FLSA 2CAIA 6GSVA 2V6OA 4EDYA 3E0UA 4K9ZA 5GSSA 4F2IA 1V2AA 1G0TA 2WGRA 3UVHA 1GTAA 2HRNA 3ZL5A 1EZKA 2RLIA 3VK9A 1TI3A 3ERWA 1TI1A 2AYTA 4WBRD 5HR2A 2L5OA 5G5FA 2CX3A 1HNAA 3KJYA 2OBKA 1OC9B 1ZGNA 4IJIA 2HSYA 1THXA 3J7Yb 3CBUA 3RHCA 2AJQB 2DJ1A 2XBQA 4MF6A 3OR5A 2JL4A 1PMTA 3EYTA 4OFTA 2YANA 3CRUA 5AN1A 1E2YA 5JWQB 4AF2A 4ECIA 1OYJA 5INYA 2LRNA 4XCSA 1ZYEA 5DJLA 9GSSA 1AUCA 4KB3A 1TK0B 4NV2A 5KN0A 3FW2A 3H79A 2H66A 2DMMA 1G7OA 1JLWA 1ABAA 3C8EA 4IQ1A 5ID2B 2DJJA 3VWWA 1GLQA 1ERUA 1XVQA 2VM2A 3APQA 2TRCP 3FKFA 1U88A 3L78A 2HRFA 2JZSA 3UBLA 4RQRA 2ON7A 4BA7A 4CW9A 5G5EA 1EEJA 2ALBA 2AAWA 4NHZA 4TW5A 4POBA 2O8VB 2WRTA 1GH2A 4I97A 1UC7A 3HZ4A 2K8SA 1XFLA 2H72A 3TOTA 1FB6A 4F82A 4QL9A 3D4MA 4XTSA 4F0CA 3GIXA 4ZB6A 1SKWB 1XVWA 5ECNB 4G9HA 2E0QA 3IV4A 2WFCA 2JSYA 1G7EA 3UMAA 2J9HA 3M3MA 2X8HA 3VI5A 2FWGA 4HZ2A 3GTUA 5ELGA 1OC3A 4JR4A 4CHSA 1M7TA 1QGVA 4ZIJA 1PD21 4KDUA 5H5QA 3IAS2 1OVNA 3GNJA 2YV7A 3F4TA 3R2QA 1XZOA 2VD0A 1GLPA 3IK7A 2R4VA 1IYHA 3H4KA 4KX4A 3D4TA 3HVVA 3LXTA 1TU7A 2DIYA 1YDKA 1Q98A 3RAZA 2IFQB 1B8XA 1KTEA 2GSTA 3A5WA 4X43A 3VWUA 5G1LA 4NMUA 4IGJA 4OCEA 3ERFA 3QAGA 3VWXA 2H0HA 4J57E 5H5SA 1FO5A 1PSQA 1ZCPA 2RUFA 1XPVA 17GSA 3L9VA 1V57A 2HLSA 2PBJA 1JZWA 2YOIA 1XWGA 1EV9A 2C1YA 5CNWA 1F3BA 1Z6NA 2MBTA 2TIRA 3QFBC 5GZZB 2D2ZA 1K0BA 3DIEA 3M0FA 12GSA 3HZ8A 2XBIA 2FA4A 3GX8A 4ACSA 2CZ2A 1Z5YE 2KP1A 2X8GA 1XBSA 5CRDA 1R5AA 3EC3A 2H1AA 3WYWA 1QXHA 3IDVA 3FHKA 1XCCA 2IL3A 4IP6A 2B5YA 1PN9A 2CAQA 5J3RA 3FRCA 4OD7A 1T4YA 3PGTA 2B7JA 2E7PA 3NOFA 3ZYWA 1Z7PA 1GSDA 1ZL9A 5DDLA 4XS1A 4WR5A 4EUYA 2BJXA 3LWAA 4V1Ap 2H1BA 3F4SA 2REMA 4GSNA 2VLUA 4KNDA 3ZVJD 10GSA 3TCOA 4GQCA 1G6YA 2R5GA 2OA7A 2LRTA 2GVPA 2PWJA 4LLRA 2HNLA 4L5OA 1Z7RA 4E8HA 2O89A 1Z3EA 2LQQA 3U5RE 2HZEB 5ELAA 2F8AA 4HU9A 2A4VA 1BX9A 1WPIA 1N2AA 2NVLA 4KUNA 1SJ6A 2ES7A 2H70A 3C7MA 2NBSA 3UAPA 5B8BA 4BWSA 2CV4A 2FWEA 3DD3A 3WD6A 3ZVJA 4GRFA 5GAND 1SK1A 3ME8A 4NHWA 3VPQA 3Q18A 5IPHA 4V1Ag 3MNGA 1BYEA 2LSTA 1MDKA 1GTIA 3DKSA 1TTZA 3H93A 1V98A 1GUHA 3CTFA 5ECPB 5D73A 2EC4A 1T7PB 4KCAA 4ECJA 2OADA 3L4NA 2HT9A 4KSOA 3ZREA 1B48A 4POLA 1ACVA 1ERVA 5AISA 2GDRA 5IMAA 2CVDA 4K8MA 3GFKA 2KLXA 2FNOA 3QR6A 5LD0A 2OKAA 4XRAA 1CQGA 1ZMAA 3I69A 4KE3A 1T1VA 3HD5A 1BQ7A 2VLVA 3KD0A 4FH8A 4MF7A 3VPTA 3RBTA 4PNFA 3HA9A 3P7XA 2CA8A 1WP0A 2HI7A 3KP9A 1F37A 4MZBA 1KBNA 4JZQA 5DCHA 2VO4A 5F05A 2CX4A 3F9UA 3WGDA 1K0OA 3A3TA 5IMZA 1FG4A 1VF2A 2PPTA 1J9BA 1NSWA 3GH6A 5ECKB 4J56E 1R5PA 4IHUA 2AB6A 3Q6OA 4L5LA 4IVFA 4YAVA 2DLXA 1FOVA 2BMXA 2PMTA 4GCIA 2VAFA 5F07A 1DE1A 2PVOC 5F0GA 5C04A 4MPGA 1K3YA 2MYGA 3FZ4A 2PUKC 2K6VA 1BEDA 1XW6A 3P90A 2VCWA 4OO5A 3KIJA 1AQVA 4NPBA 2I81A 2YN1A 4DEJA 4ZBBA 1ST9A 3W8JA 3N5OA 3KM6A 2P5RA 4MP4A 3F3RA 1G6WA 4K0NA 2L57A 2RIIA 1RQMA 2H73A 5KEJA 2DJ2A 3IA1A 2DIZA 1FVKA 4X0XA 1Q4JA 2N5BA 5ECRB 1E6BA 1MDJA 4WR4A 1MTCA 1PQNA 1B4PA 4FO5A 4PUFC 3HHVA 4PURA 1LBKA 3BJ5A 1ERWA 1GUMA 3DVXA 3EMXA 2FGXA 2JSZA 5JWOB 1JFUA 3TRXA 2V2GA 4XHMA 4GXZA 5COHA 3HJMA 1YEXA 3PH9A 2GQKA 1AAZA 1PGTA 2DMLA 2KP2A 3CRTA 1SJZA 3ZFBA 1YY7A 1WJKA 3FR9A 3BBYA 3EU4A 2MMNA 3GUSA 4PUAA 3DYRA 3TKQA 3CXGA 4AJ6A 4G10A 4L0WA 2GZYA 1GTBA 1AIUA 4V2MA 5AGYA 4MJEA 3NZNA 1WOUA 1TOFA 4KGIA 4E8EA 6GSUA 2IMDA 3A2WA 1UA5A 2CT6A 4XRDA 4JU5A 2I3YA 3QAVA 4F03A 1ZYQB 3FEUA 5HR3A 2H30A 4NV5A 1T4ZA 4GSSA 5DAKB 3IAM2 4JE1A 1GSUA 3W8SA 4J2FA 1LJRA 2G2QA 4TXOA 1SK2A 3CMIA 3FZAA 1K0MA 1XWAA 3IC4A 2I1UA 1Z9HA 3TJFA 3IOSA 6GSYA 2RM5A 1QMVA 5ECIB 4XS6A 1X9WB 4HU7A 3N9JA 1TRVA 5CAXA 2XPEA 2GZPA 4GLTA 3FR3A 1I5GA 3O6TA 3QAWA 4N11A 2MBSA 3KMOA 2L6CA 3W6GA 3QPMA 4K7OA 4XIHA 2JADA 4LMVA 3TRPA 4ZILA 1FAAA 3E3EA 3GL3A 1AQXA 3FK8A 2H6XA 4N10A 4POKA 5KN3A 4FYUA 1ON4A 1AW9A 3HKRA 2XHFA 1QQ2A 1T3BA 4IP1A 1TW9A 1FVJA 13GSA 4KDYA 5LCZA 4X1UA 2HYXA 3G7IA 1K0CA 1GTUA 11GSA 2LUSA 1YKCA 3M9JA 4WKWA 5FT3A 4JRRA 2OE0A 2LRCA 1K0DA 1MDIA 3V1WA 3C1SA 5IOXA 1XIYA 4ILFA 1VF1A 2DJ3A 5D8IA 4LA1A 2IMFA 3LQ7A 3ERGA 5IO0A 3I9V2 2VOCA 4MZCA 1TKDB 6GSSA 1PX6A 4ISDA 2I9HA 3K8NA 1V9WA 1OC8A 2CVBA 4NXIA 1PA3A 3F6DA 4TKYA 4MK3A 5ABRA 3F3QA 1EOGA 4Q5QA 2IPAA 3D5JA 4HQZA 3HY2A 4V2NA 2NTOA 3UARA 2N5AA 5IQYA 5DVBA 4TR0A 4ZL8A 2LNTA 4I5QA 2FWHA 5CRHA 1WIKA 3FZ9A 4GF0A 3TKSE 1V40A 5H5RA 2FD3A 3G9BA 3VLNA 5ECHB 1X5DA 1EV4A 1IYIA 5HR0A 4V2LA 2VCXA 1A2JA 2WS2A 2XPDA 4OCFA 3L9SA 5D93A 2HZFA 3QFAC 2M80A 2LJKA 3SBCA 3H1NA 2NPBA 5KN2A 2C0GA 2H0GA 4IJ3A 1TJDA 2EIQA 2EIOA 4N0ZA 2H6YA 1PL2A 3ZRDA 3IPZA 1HQOA 3PR8A 4O5RA 2CZ3A 1OKDA 1S3CA 3DWVA 2DJ0A 16GSA 3D21A 3EU3A 4JBBA 1OE8A 4NAXA 1VF4A 14GSA 2JU5A 4AGSA 3GKMA 3ZMLA 4K0GA 2P5QA 4BPYA 2GSSA 4K7IA 2WZ9A 5F8BA 2PU9C 2FCHA 1PKWA 5CRGA 5G30A 1A0RP 4EL1A 3VURA 4FYBA 1BJXA 8GSSA 5J9BA 4IELA 5A5KA 3NIVA 1TU8A 4K6XA 5J4UA 2GS3A 3LXZA 3IHQA 3L9UA 4ML1A 3F63A 1SYRA 3DMLA 3ZIJA 3C73A 1VRSD 3LJRA 3ME7A 4GWRA 3UEMA 3IRAA 1MD4A 3DRNA 4O92A 3C1RA 1SYXA 2M72A 1MD3A 2B3SA 2DC5A 4HZ4A 2K18A 1XWKA 1GSSA 1A24A 1X0RA 5ENUA 3IBHA 3GN3A 1K0NA 4QQ7A 2I4AA 4AJ8A 1FB0A 4D73A 1WRYA 5ECOB 2ZCTA 3LFLA 4EKZA 1HNCA 1F6MC 2LJRA 19GSA 1XOAA 3M9KA 2K8VA 5KN1A 2V41A 1DSBA 4TN8A 1SJIA 2B7KA 2L5LA 3GRXA 4Q5RA 4MF5A 1AXDA 2IIYA 2V6KA 4XS4A 2A2RA 5G2ZA 5J41A 1I9DA 4WXTA 4K7NA 1LU4A 1B9XC 2VUPA 2FA8A 2GTUA 1M2BA 2DBCA 1NM3A 6GSXA 5DALA 4G19A 4OO4A 2IN3A 1U3AA 4MA9A 3CSIA 3LORA 20GSA 3P2AA 1XWCA 1M2AA 1EOHA 2DJKA 1GSFA 3TJKA 2M46A 1M99A 3GSTA 1T00A 1K3OA 1XWBA 3IK9A 1TDIA 1X9SB 1X9MB 1XW9A 1A2LA 1R4WA 3F0IA 4TR1A 1THOA 3ZIVA 4DSSA 3QD9A 1NHYA 5DBQA 1YKAA 3I43A 5AIVA 1EP8A 2RUEA 2F9SA 2FWFA 2H01A 5JCUA 2YJHA 2YCDA 3VFIA 3DVWA 3GH9A 2C3NA 3TDGA 4DSRA 2YJ7A 4ID0A 1WE0A 4RUVA 1TP9A 3QOUA 4HJ2A 3LG6A 2LQOA 4OMVA 4QL7A 2IMIA 3BCIA 4PQIA 4HJMA 1UN2A 2OE1A 3WGEA 2H8LA 3HVSA 2JZTA 1QK8A 5GSTA 1FW1A 1QFNA 4ZXGA 4O32A 1RK4A 3HJPA 2B5EA 1GNWA 5CYYA 2H0IA 2H6ZA 5LNKe 2YPMA 2YZUA 2A2SA 3M8NA 1UVZA 5JCGA 2GZZA 4TVEA 4PQ1A 5ECMB 5A4UA 1R7HA 1WWJA 18GSA 3MWHA 3IE3A 3UOMA 4GSTA 1PRXA 4YQUA 1YJ6A 4PXOA 3KZQA 2FY6A 2GT6A 4IKHA 1ERTA 3IXRA 3GX0A 5A4WA 1YF1A 4EXJA 4MH3A 5C00A 4IS0A 2YZHA 5ECSA 2L59A 3GURA 3ZZXA 3HCZA 5D96A 4ECCA 4KH7A 4I6XA 4WF5A 2CVKA 3TJBA 1NW2A 3H8QA 2Z9SA 3VI7A 2GSQA 5IO2A 4RI6A 2WCIA 1EGOA 5IMDA 4MJAA 3RDWA 1GSYA 2GSRA 5B6MA 1ZZYA 3HXSA 22GSA 4Q5FA 1RW1A 2BTOT 2PGTA 3GMFA 1O8WA 5GAPD 3TKSC 2OE3A 2VL9A 4LMWA 3TRQA 1Y25A 2GQLA 1M0UA 4O7HA 1GL8A 4K2DA 5J9CA 4IQAA 1A2MA 3APSA 4MJBA 1OC9A 2O87A 4H86A 2V1MA 4YQVA 1SL2B 1USBA 4P3YB 4HDEA 2GGTA 5JWRB 4HQSA 3D22A 4LL1B 3GSSA 2J23A 2LNSA 5D9TA 3S9FA 3EVIA 2JACA 1OAZA 2C4JA 2WJUA 3M1GA 4HUAA 3GKNA 3Q74A 2OACA 6GSTA 3F4RA 3O76A 4WEYA 5G31A 5E4WA 2LV3A 2WULA 1SL1B 3EINA 1S3AA 2B5XA 2MMAA 1SD8A 5ID2A 3KP8A 4MDCA 4TXOB 5B7CA 3KCMA 2YP6A 1PL1A 4TRXA 2OBIA 3FY7A 5FHIA 2KOKA 1F3AA 7GSSA 1ZOFA 4MH2A 4I2UA 1TRSA 4OFNA 4KDXA 2MMZA 1OE7A 5B6NA 3UIWA 2HXKA 3LYPA 1O7UA 4G2EA 3QDNA 2EIRA 3KGKA 3ZTLA 5CP1A 3WGXA 1VF3A 3WT1A 2O85A 2H1GA 3LEFA 2C0DA 3CYNA 1K3LA 1SENA 1SD9A 2VCTA 3I6AA 4IW9A 2QGVA 6GSWA 3EMPA 3TGZA 2GLRA 5HFKA 2YNXA 3MAKA 1WMJA 1GWCA 1M2DA 3ZFLA 1QUWA 1GRXA 2B1KA 2R3XA 1YF0A 4I2TA 4EO3A 3APOA 4KSMA 2YWMA 1U87A 3HDCA 3MDKA 4N0VA 1O73A 1EWXA 1A8YA 4PX1A 2XC2A 4N30A 2IFQA 5IMFA 4OFMA 3HYPA 1SKSB 1EP7A 2CQ9A 5EPFA 4AJ7A 2VLTA 2QC7A 2B6MA 2HSHA 2X99A 3KEBA 3GTUB 3ISOA 5EY6A 1TRWA 1SK0A 2AUVA 3TJGA 3P8WA 3L0HA 1ILOA 4KAEA 4EC0A 3ZLPA 2H76A 3HVXA 2VIMA 4KW6A 1DE2A 4FYCA 3A2XA 3CSHA 5IPGA 1W4VA 1U3IA 4DSQA 1HD2A 5A4VA 4MMMA 3FYGA 4K1FA 1W89A 2P31A 1ML6A 5IOWA 4HOJA 4ZL7A 1F2EA 2E2GA 2O7KA 4TR3A 4DVCA 3CSJA 4KCEA 3SWLA
chains in the Genus database with same CATH superfamily
3GKXA 2FHEA 2KHPA 4EDZA 2G0FA 3GYKA 3LGCA 2H74A 2HFDA 3TOUA 3KTBA 3TKPA 5EL8A 3GA4A 2OJLA 3TJJA 3G7JA 4L8EA 1O85A 1O6JA 4BL7A 4TOPA 2L6DA 1B4QA 3TB2A 1JZOA 3VWVA 3D0ZA 2IWTA 3RPNA 2YWNA 3KMNA 5CO3A 1AQWA 4FIWA 1YZXA 2F8FA 1V58A 5FWGA 2VCZA 2N5FA 1NHOA 4KA0A 2QKEA 2HZEA 2HSMA 1T8EB 2AHEA 5HR1A 3RPPA 4EF0A 2ZUPA 1Y6EA 5HQPA 3KH9A 3BOAA 3UJ1A 2C8UA 5D9VA 5DCGA 5KOWA 2MZCA 2WB9A 5IM9A 2C80A 4BVXA 4MPFA 3ED3A 4Z7XA 2WDUA 2L4CA 4WETA 5G1KA 2E2MA 2IMKA 1HNBA 2YWIA 4TXVA 1CQHA 4F0BA 3TUEA 3HJOA 4YKGA 1GSEA 4HI7A 2VD1A 1C72A 2C3QA 2VL2A 3CTGA 4NWYA 3G7YA 4TR4A 2KUCA 4HEA2 3R3EA 1XXUA 1TRUA 3RHBA 2GT5A 2X8CA 2LEGA 2FUG2 1GNEA 1F9MA 3FMWA 4D73B 3Q19A 5DJMA 3EURA 2LJAA 4IBPA 3J7Yk 2VL3A 4HS1A 2PVQA 4MCUA 1EGRA 1M9AA 3C71A 5F06A 3PINA 1X5CA 4BVYA 2LTKA 4I8BA 1SU9A 4OWYA 2RM6A 4ZB8A 1EEMA 3EE2A 3GHAA 4ZBDA 3DEXA 2R2JA 2A2PA 4PTSA 3WT2A 4ULXA 3TKRA 1SKRB 3JCML 1VGLA 2ZNMA 5EVOA 1H75A 3UBKA 4XS4B 1FHEA 1A0FA 3F8UA 5J5NA 2V32A 3KTLA 2YV9A 3MYDA 1TK8B 1DBYA 2H19A 2H71A 3TKSA 2IJYA 4CDOA 3D6IA 2MMOA 3GV1A 4EE0A 1HYUA 2K9FA 4MABA 3DGQA 5DALB 5AIXA 4JEDA 4JR6A 1SL0B 1URMA 1TK5B 1A8LA 1TXXA 3E9JB 4IN0A 3QCPA 1YQ1A 1PN0A 4POMA 3BCKA 5CREA 4Q5NA 5HFGA 2ON5A 4LL4B 1JHBA 2AV4A 5D9XA 3F6FA 5L71A 1J0FA 1O81A 3GKKA 2F3MA 1PKZA 1DUGA 3LYKA 4YH2A 1BAYA 2X64A 4WF4A 3BD2A 4ML6A 5D9WA 2P0GA 1GULA 2QSIA 2VCVA 3KH7A 4L0UA 5CRWA 3US3A 5IIZA 4TR1B 4YQMA 5ECLB 3KXOA 2VM1A 1PFOA 4EVMA 4YAPA 1J08A 2NDOA 5JCWA 1H4OA 2C3TA 4DSSB 1A23A 1OKTA 1GP1A 1GUKA 3ZMKA 1B9YC 1Z6MA 2LS5A 1YEPA 1JZDA 2DSAA 4MZWA 1U6TA 1MEKA 4CY8A 4F9ZA 2L4QA 3AY8A 1X5EA 4K5RA 2PERA 1O8XA 4MLYA 2LKUA 2YWOA 2VL2C 4PGTA 3MSZA 2C0FA 4RI7A 5E59A 2R37A 3LSZA 5IMVA 4GQFA 4GTUA 1XOBA 2UZ8A 2PN8A 1BG5A 3UL3A 1N8JA 3O3TA 4RQXA 1PX7A 1AC1A 2B1LA 4PQHA 5ECQB 5HFIA 2F51A 2TRXA 4WBJA 2JZRA 4MJCA 2IMEA 1K0AA 1GSQA 2C0EA 4ZBAA 2H75A 3QMXA 2HRKA 2GQMA 5DQSA 1S3DA 2VCQA 5B8AA 3EWLA 1KNGA 1JLVA 5IMCA 3ZITA 4ZB9A 2H1DA 5DAKA 4PNGA 1JZRA 1R26A 3A2VA 3FZ5A 4ZL9A 3GL5A 2HE3A 3IR4A 1KEBA 1M9BA 5DQYA 4BWQA 3DXBA 2R6KA 3FR6A 3U6VA 1XW5A 4ECBA 3UVTA 2FLSA 2CAIA 6GSVA 2V6OA 4EDYA 3E0UA 4K9ZA 5GSSA 4F2IA 1V2AA 1G0TA 2WGRA 3UVHA 1GTAA 2HRNA 3ZL5A 1EZKA 2RLIA 3VK9A 1TI3A 3ERWA 1TI1A 2AYTA 4WBRD 5HR2A 2L5OA 5G5FA 2CX3A 1HNAA 3KJYA 2OBKA 1OC9B 1ZGNA 4IJIA 2HSYA 3CQFA 1THXA 3J7Yb 3CBUA 3RHCA 2AJQB 2DJ1A 2XBQA 4MF6A 3OR5A 2JL4A 1PMTA 3EYTA 4OFTA 2YANA 3CRUA 5AN1A 1E2YA 5JWQB 4AF2A 4ECIA 1OYJA 5INYA 2LRNA 5BMUA 4XCSA 1ZYEA 5DJLA 9GSSA 1AUCA 4KB3A 1TK0B 4NV2A 5KN0A 3FW2A 3H79A 2H66A 2DMMA 1G7OA 1JLWA 1ABAA 3C8EA 4IQ1A 5ID2B 2DJJA 3VWWA 1GLQA 1ERUA 1XVQA 2VM2A 3APQA 2TRCP 3FKFA 1U88A 3L78A 2HRFA 2JZSA 3UBLA 4RQRA 2ON7A 4BA7A 4CW9A 4O5QA 5G5EA 1EEJA 2ALBA 2AAWA 2R0PA 4NHZA 4TW5A 4POBA 2O8VB 2WRTA 1GH2A 4I97A 1UC7A 3HZ4A 2K8SA 1XFLA 2H72A 3TOTA 1FB6A 4G0IA 4F82A 4QL9A 3D4MA 4XTSA 4F0CA 3GIXA 4ZB6A 1SKWB 1XVWA 5ECNB 4G9HA 2E0QA 3IV4A 2WFCA 2JSYA 1G7EA 3UMAA 2J9HA 3M3MA 2X8HA 3VI5A 2FWGA 4HZ2A 3GTUA 5ELGA 1OC3A 4JR4A 4CHSA 1M7TA 1QGVA 4ZIJA 1PD21 4KDUA 5H5QA 3IAS2 1OVNA 3GNJA 2YV7A 3F4TA 3R2QA 1XZOA 2VD0A 1GLPA 3IK7A 2R4VA 1IYHA 3H4KA 4KX4A 3D4TA 3HVVA 3IC8A 3LXTA 1TU7A 2DIYA 1YDKA 1Q98A 3RAZA 2IFQB 1B8XA 1KTEA 2GSTA 3A5WA 4X43A 3VWUA 5G1LA 4NMUA 4IGJA 4BIKA 4OCEA 3ERFA 3QAGA 3VWXA 2H0HA 4J57E 5H5SA 1FO5A 1PSQA 1ZCPA 2RUFA 1XPVA 17GSA 3L9VA 1V57A 2HLSA 2PBJA 1JZWA 2YOIA 1XWGA 4HSCX 1EV9A 2C1YA 5CNWA 1F3BA 1Z6NA 2MBTA 2TIRA 3QFBC 5GZZB 2D2ZA 1K0BA 3DIEA 3M0FA 12GSA 3HZ8A 5KOXA 4YKFA 2XBIA 2FA4A 3GX8A 4ACSA 2CZ2A 1Z5YE 2KP1A 2X8GA 1XBSA 5CRDA 1R5AA 3EC3A 2H1AA 3WYWA 1QXHA 3IDVA 3FHKA 1XCCA 2IL3A 4IP6A 2B5YA 1PN9A 2CAQA 5J3RA 3FRCA 4OD7A 1T4YA 3PGTA 2B7JA 2E7PA 3NOFA 3ZYWA 1Z7PA 1GSDA 1ZL9A 4BL7B 5DDLA 4XS1A 4WR5A 4EUYA 2BJXA 3LWAA 4V1Ap 2H1BA 3F4SA 2REMA 4GSNA 2VLUA 4KNDA 3ZVJD 10GSA 3TCOA 4GQCA 1G6YA 2R5GA 2OA7A 2LRTA 2GVPA 2PWJA 4LLRA 2HNLA 4L5OA 1Z7RA 4E8HA 2O89A 1Z3EA 2LQQA 3U5RE 2HZEB 5ELAA 2F8AA 4HU9A 2A4VA 1BX9A 1M3JA 1WPIA 1N2AA 2NVLA 4KUNA 1SJ6A 2ES7A 1XG8A 2H70A 3C7MA 2NBSA 4BVXB 3UAPA 5B8BA 4BWSA 2CV4A 2FWEA 3DD3A 3WD6A 3ZVJA 1FOHA 4GRFA 5GAND 1SK1A 3ME8A 4NHWA 4USSA 3VPQA 3Q18A 5IPHA 4V1Ag 3MNGA 1BYEA 2LSTA 1MDKA 1GTIA 3DKSA 1TTZA 3H93A 1V98A 1GUHA 3CTFA 5ECPB 5D73A 2EC4A 1T7PB 4KCAA 4ECJA 2OADA 3L4NA 2HT9A 4KSOA 3ZREA 1B48A 5BRTA 4POLA 1ACVA 1ERVA 5AISA 2GDRA 5IMAA 2CVDA 4K8MA 3GFKA 2KLXA 2FNOA 3QR6A 5LD0A 4Z2RA 2OKAA 4XRAA 1CQGA 1ZMAA 3I69A 4KE3A 1T1VA 3HD5A 1BQ7A 2VLVA 3KD0A 4FH8A 4MF7A 3VPTA 3RBTA 4EIPA 4PNFA 4BVYB 3HA9A 3P7XA 2CA8A 1WP0A 2HI7A 3KP9A 1F37A 4MZBA 1KBNA 4JZQA 5DCHA 4CY6A 2VO4A 5F05A 2CX4A 2HRAA 3F9UA 3WGDA 1K0OA 3A3TA 5IMZA 1FG4A 1VF2A 2PPTA 1J9BA 1NSWA 3GH6A 5ECKB 4J56E 1R5PA 4IHUA 2AB6A 3Q6OA 4L5LA 4IVFA 4YAVA 2DLXA 1FOVA 2BMXA 2PMTA 4GCIA 2VAFA 5F07A 1DE1A 2PVOC 5F0GA 5C04A 4MPGA 1K3YA 2MYGA 1ZYNA 3FZ4A 2PUKC 2K6VA 1BEDA 1XW6A 3P90A 2VCWA 4OO5A 3KIJA 1AQVA 4NPBA 2I81A 4KF9A 2YN1A 4DEJA 4ZBBA 1ST9A 3W8JA 3N5OA 3KM6A 2P5RA 4MP4A 3F3RA 1G6WA 4K0NA 2L57A 2RIIA 1RQMA 2H73A 5KEJA 2DJ2A 3IA1A 2DIZA 1FVKA 4X0XA 1Q4JA 2N5BA 5ECRB 1E6BA 1MDJA 4WR4A 1MTCA 1PQNA 1B4PA 4FO5A 4PUFC 3HHVA 4PURA 2R0GA 1LBKA 3BJ5A 1ERWA 4Z2UA 1GUMA 3DVXA 3EMXA 2FGXA 2JSZA 5JWOB 1JFUA 3TRXA 3EPTA 2V2GA 4XHMA 4GXZA 5COHA 3HJMA 1YEXA 3PH9A 2GQKA 1AAZA 1PGTA 2DMLA 2KP2A 3CRTA 1SJZA 2A4HA 3ZFBA 1YY7A 1WJKA 3IHGA 3FR9A 3BBYA 3EU4A 2MMNA 3GUSA 4PUAA 3DYRA 3TKQA 3CXGA 4AJ6A 4G10A 4L0WA 2GZYA 1GTBA 1AIUA 4V2MA 5AGYA 4MJEA 3NZNA 1WOUA 1TOFA 4KGIA 4E8EA 6GSUA 2IMDA 3A2WA 1UA5A 2CT6A 4XRDA 4JU5A 2I3YA 1M3IA 3QAVA 4F03A 1ZYQB 3FEUA 5HR3A 2H30A 4NV5A 1T4ZA 4GSSA 5DAKB 3IAM2 4JE1A 1GSUA 3W8SA 4J2FA 1LJRA 2G2QA 4TXOA 1SK2A 3CMIA 3FZAA 1K0MA 1XWAA 3IC4A 2DKIA 2I1UA 1Z9HA 3TJFA 3IOSA 6GSYA 2RM5A 1QMVA 5ECIB 4XS6A 1X9WB 4HU7A 3N9JA 1TRVA 5CAXA 2XPEA 2GZPA 4GLTA 3FR3A 1I5GA 3O6TA 3QAWA 4N11A 2MBSA 3KMOA 2L6CA 3W6GA 3QPMA 4K7OA 4XIHA 2JADA 4LMVA 3TRPA 4ZILA 1FAAA 3E3EA 3GL3A 1AQXA 3FK8A 2H6XA 4N10A 4POKA 5KN3A 4FYUA 1ON4A 1AW9A 3HKRA 2XHFA 1QQ2A 1T3BA 4IP1A 1TW9A 1FVJA 13GSA 4KDYA 5LCZA 4X1UA 2HYXA 3G7IA 1K0CA 1GTUA 11GSA 2LUSA 1YKCA 3M9JA 4WKWA 5FT3A 4JRRA 2OE0A 2LRCA 1K0DA 1MDIA 3V1WA 3C1SA 5IOXA 1XIYA 4ILFA 1VF1A 2DJ3A 5D8IA 4LA1A 2IMFA 3LQ7A 3ERGA 5IO0A 3I9V2 2VOCA 4MZCA 1TKDB 6GSSA 1PX6A 4ISDA 2I9HA 3K8NA 1V9WA 1OC8A 2CVBA 4NXIA 1PA3A 3F6DA 4TKYA 4MK3A 5ABRA 3F3QA 1EOGA 4Q5QA 2IPAA 3D5JA 4HQZA 3HY2A 4A5PA 4V2NA 2NTOA 3UARA 2N5AA 5IQYA 5DVBA 4TR0A 4ZL8A 2LNTA 4I5QA 2FWHA 5CRHA 1WIKA 3FZ9A 2QA2A 4GF0A 1S3RA 3TKSE 1V40A 5H5RA 2FD3A 3G9BA 3VLNA 5ECHB 1X5DA 1EV4A 1IYIA 5HR0A 4V2LA 2VCXA 1A2JA 2WS2A 2XPDA 4OCFA 3L9SA 5D93A 2HZFA 3QFAC 2M80A 2LJKA 3SBCA 3H1NA 2NPBA 5KN2A 2C0GA 2H0GA 4IJ3A 1TJDA 2EIQA 2EIOA 4N0ZA 2H6YA 1PL2A 3ZRDA 3IPZA 1HQOA 3PR8A 4O5RA 2CZ3A 1OKDA 1S3CA 3DWVA 2DJ0A 16GSA 3D21A 3EU3A 4JBBA 1OE8A 4NAXA 1VF4A 14GSA 2JU5A 4AGSA 3GKMA 3ZMLA 4K0GA 2P5QA 4BPYA 2GSSA 4K7IA 2WZ9A 5F8BA 2PU9C 2FCHA 1PKWA 5CRGA 5G30A 1A0RP 4EL1A 3VURA 4FYBA 1BJXA 8GSSA 5J9BA 4IELA 5A5KA 3NIVA 1TU8A 4K6XA 5J4UA 2GS3A 3LXZA 3IHQA 3L9UA 4ML1A 3F63A 1SYRA 3DMLA 3ZIJA 3C73A 1VRSD 3LJRA 3ME7A 4GWRA 3UEMA 3IRAA 4K2XA 1MD4A 3DRNA 4O92A 3C1RA 1SYXA 2M72A 1MD3A 2B3SA 2DC5A 4HZ4A 2K18A 1XWKA 1GSSA 1A24A 1X0RA 5ENUA 3IBHA 3GN3A 1K0NA 4QQ7A 2I4AA 4AJ8A 1FB0A 4D73A 1WRYA 5ECOB 2ZCTA 3LFLA 4EKZA 1HNCA 1F6MC 2LJRA 19GSA 1XOAA 4O5UA 3M9KA 2K8VA 5KN1A 2V41A 1DSBA 4TN8A 1SJIA 2B7KA 2L5LA 3GRXA 4Q5RA 4MF5A 1AXDA 2IIYA 2V6KA 4XS4A 4Z2TA 2A2RA 5G2ZA 5J41A 1I9DA 4WXTA 4K7NA 1LU4A 1B9XC 2R0CA 2VUPA 2FA8A 2GTUA 3PPUA 1M2BA 2DBCA 1NM3A 6GSXA 5DALA 4G19A 4OO4A 2IN3A 1U3AA 4MA9A 3CSIA 3LORA 20GSA 3P2AA 1XWCA 1M2AA 2DKHA 3MIXA 1EOHA 2DJKA 1GSFA 3TJKA 2M46A 1M99A 3GSTA 1T00A 1K3OA 1XWBA 3IK9A 1TDIA 1X9SB 1X9MB 1XW9A 1A2LA 1R4WA 3F0IA 4TR1A 1THOA 2QA1A 3ZIVA 4DSSA 3QD9A 1NHYA 5DBQA 1YKAA 3I43A 5AIVA 1EP8A 2RUEA 2F9SA 2FWFA 2H01A 5JCUA 2YJHA 2YCDA 3VFIA 3DVWA 3GH9A 2C3NA 3TDGA 4DSRA 2YJ7A 4ID0A 1WE0A 3HVNA 1TP9A 4RUVA 3QOUA 4HJ2A 3LG6A 2LQOA 4OMVA 4QL7A 2X4AA 2IMIA 3BCIA 4PQIA 4HJMA 1UN2A 2OE1A 3WGEA 2H8LA 3HVSA 2JZTA 1QK8A 5GSTA 1FW1A 1QFNA 4ZXGA 4O32A 1RK4A 3HJPA 2B5EA 1GNWA 5CYYA 2H0IA 2H6ZA 5LNKe 2YPMA 2YZUA 2A2SA 3M8NA 1UVZA 5JCGA 2GZZA 4TVEA 4PQ1A 5ECMB 2X49A 5A4UA 1ZYPA 1R7HA 1WWJA 18GSA 3MWHA 3IE3A 4FQUA 3UOMA 4GSTA 4EIQA 1PRXA 4YQUA 1YJ6A 4PXOA 3KZQA 2FY6A 2GT6A 4IKHA 1ERTA 3IXRA 3GX0A 5A4WA 1YF1A 4EXJA 4MH3A 5C00A 4IS0A 2YZHA 5ECSA 2L59A 3GURA 3ZZXA 3HCZA 5D96A 4ECCA 4KH7A 4I6XA 4WF5A 2CVKA 3TJBA 1NW2A 3H8QA 2Z9SA 3VI7A 2GSQA 5IO2A 4RI6A 2WCIA 1EGOA 5IMDA 4MJAA 3RDWA 1GSYA 2GSRA 5B6MA 1ZZYA 3HXSA 22GSA 4Q5FA 1RW1A 2BTOT 2PGTA 3GMFA 1O8WA 5GAPD 4X4JA 3TKSC 2OE3A 2VL9A 4LMWA 3TRQA 1Y25A 2GQLA 1M0UA 4O7HA 1GL8A 4K2DA 5J9CA 4IQAA 1A2MA 3APSA 4MJBA 1OC9A 2O87A 4H86A 2V1MA 4YQVA 1SL2B 1USBA 4P3YB 4HDEA 2GGTA 5JWRB 4HQSA 3D22A 4LL1B 3GSSA 2J23A 2LNSA 5D9TA 3S9FA 3EVIA 2JACA 1OAZA 2C4JA 2WJUA 3M1GA 4HUAA 3GKNA 3A5IA 3Q74A 2OACA 6GSTA 3F4RA 3O76A 4WEYA 5G31A 5E4WA 2LV3A 2WULA 1SL1B 3EINA 1S3AA 2B5XA 2MMAA 1SD8A 5ID2A 3KP8A 4MDCA 4TXOB 5B7CA 3KCMA 2YP6A 1PL1A 4TRXA 2OBIA 3FY7A 5FHIA 2KOKA 1F3AA 4G0LA 7GSSA 1ZOFA 4MH2A 4I2UA 1TRSA 4OFNA 4KDXA 2MMZA 1OE7A 4MNNA 5B6NA 3UIWA 2HXKA 3LYPA 1O7UA 4G2EA 3QDNA 2EIRA 3KGKA 3ZTLA 5CP1A 3WGXA 1VF3A 3WT1A 2O85A 2H1GA 3LEFA 2C0DA 3CYNA 1K3LA 1SENA 1SD9A 2VCTA 3I6AA 4IW9A 2QGVA 6GSWA 3EMPA 3TGZA 2GLRA 5HFKA 2YNXA 3MAKA 1WMJA 1GWCA 1M2DA 3ZFLA 1QUWA 1GRXA 4G0KA 2B1KA 2R3XA 1YF0A 4I2TA 4EO3A 3APOA 4KSMA 2YWMA 1U87A 3HDCA 3MDKA 4N0VA 1O73A 1EWXA 1A8YA 4PX1A 4K5SA 2XC2A 4N30A 2IFQA 5IMFA 4OFMA 3HYPA 1SKSB 1EP7A 2CQ9A 5EPFA 4AJ7A 2VLTA 2QC7A 4ICYA 2B6MA 2HSHA 2X99A 3KEBA 3GTUB 3ISOA 5EY6A 1TRWA 1SK0A 2AUVA 3TJGA 3P8WA 3L0HA 1ILOA 4KAEA 4EC0A 3ZLPA 3LW9A 2H76A 3HVXA 2VIMA 4KW6A 1DE2A 4FYCA 3A2XA 3CSHA 5IPGA 1W4VA 1U3IA 4DSQA 1HD2A 5A4VA 4MMMA 3FYGA 4K1FA 1W89A 2P31A 1ML6A 5IOWA 4HOJA 4ZL7A 1F2EA 2E2GA 2O7KA 4TR3A 4DVCA 3CSJA 4KCEA 3SWLA
chains in the Genus database with same CATH topology
3GKXA 2FHEA 2KHPA 4EDZA 2G0FA 3GYKA 3LGCA 2H74A 2HFDA 3TOUA 3KTBA 3TKPA 5EL8A 3GA4A 2OJLA 3TJJA 3G7JA 4L8EA 1O85A 1O6JA 4BL7A 4TOPA 2L6DA 1B4QA 3TB2A 1JZOA 3VWVA 3D0ZA 2IWTA 3RPNA 2YWNA 3KMNA 5CO3A 1AQWA 4FIWA 1YZXA 2F8FA 1V58A 5FWGA 2VCZA 2N5FA 1NHOA 4KA0A 2QKEA 2HZEA 2HSMA 1T8EB 2AHEA 5HR1A 3RPPA 4EF0A 2ZUPA 1Y6EA 5HQPA 3KH9A 3BOAA 3UJ1A 2C8UA 5D9VA 5DCGA 5KOWA 2MZCA 2WB9A 5IM9A 2C80A 4BVXA 4MPFA 3ED3A 4Z7XA 2WDUA 2L4CA 4WETA 5G1KA 2E2MA 2IMKA 1HNBA 2YWIA 4TXVA 1CQHA 4F0BA 3TUEA 3HJOA 4YKGA 1GSEA 4HI7A 2VD1A 1C72A 2C3QA 2VL2A 3CTGA 4NWYA 3G7YA 4TR4A 2KUCA 4HEA2 3R3EA 1XXUA 1TRUA 3RHBA 2GT5A 2X8CA 2LEGA 2FUG2 1GNEA 1F9MA 3FMWA 4D73B 3Q19A 5DJMA 3EURA 2LJAA 4IBPA 3J7Yk 2VL3A 4HS1A 2PVQA 4MCUA 1EGRA 1M9AA 3C71A 5F06A 3PINA 1X5CA 4BVYA 2LTKA 4I8BA 1SU9A 4OWYA 2RM6A 4ZB8A 1EEMA 3EE2A 3GHAA 4ZBDA 3DEXA 2R2JA 2A2PA 4PTSA 3WT2A 4ULXA 3TKRA 1SKRB 3JCML 1VGLA 2ZNMA 5EVOA 1H75A 3UBKA 4XS4B 1FHEA 1A0FA 3F8UA 5J5NA 2V32A 3KTLA 2YV9A 3MYDA 1TK8B 1DBYA 2H19A 2H71A 3TKSA 2IJYA 4CDOA 3D6IA 2MMOA 3GV1A 4EE0A 1HYUA 2K9FA 4MABA 3DGQA 5DALB 5AIXA 4JEDA 4JR6A 1SL0B 1URMA 1TK5B 1A8LA 1TXXA 3E9JB 4IN0A 3QCPA 1YQ1A 1PN0A 4POMA 3BCKA 5CREA 4Q5NA 5HFGA 2ON5A 4LL4B 1JHBA 2AV4A 5D9XA 3F6FA 5L71A 1J0FA 1O81A 3GKKA 2F3MA 1PKZA 1DUGA 3LYKA 4YH2A 1BAYA 2X64A 4WF4A 3BD2A 4ML6A 5D9WA 2P0GA 1GULA 2QSIA 2VCVA 3KH7A 4L0UA 5CRWA 3US3A 5IIZA 4TR1B 4YQMA 5ECLB 3KXOA 2VM1A 4EVMA 4YAPA 1J08A 2NDOA 5JCWA 1H4OA 2C3TA 4DSSB 1A23A 1OKTA 1GP1A 1GUKA 3ZMKA 1B9YC 1Z6MA 2LS5A 1YEPA 1JZDA 2DSAA 4MZWA 1U6TA 1MEKA 4CY8A 4F9ZA 2L4QA 3AY8A 1X5EA 4K5RA 2PERA 1O8XA 4MLYA 2LKUA 2YWOA 2VL2C 4PGTA 3MSZA 2C0FA 4RI7A 5E59A 2R37A 3LSZA 5IMVA 4GQFA 4GTUA 1XOBA 2UZ8A 2PN8A 1BG5A 3UL3A 1N8JA 3O3TA 4RQXA 1PX7A 1AC1A 2B1LA 4PQHA 5ECQB 5HFIA 2F51A 2TRXA 4WBJA 2JZRA 4MJCA 2IMEA 1K0AA 1GSQA 2C0EA 4ZBAA 2H75A 3QMXA 2HRKA 2GQMA 5DQSA 1S3DA 2VCQA 5B8AA 3EWLA 1KNGA 1JLVA 5IMCA 3ZITA 4ZB9A 2H1DA 5DAKA 4PNGA 1JZRA 1R26A 3A2VA 3FZ5A 4ZL9A 3GL5A 2HE3A 3IR4A 1KEBA 1M9BA 5DQYA 4BWQA 3DXBA 2R6KA 3FR6A 3U6VA 1XW5A 4ECBA 3UVTA 2FLSA 2CAIA 6GSVA 2V6OA 4EDYA 3E0UA 4K9ZA 5GSSA 4F2IA 1V2AA 1G0TA 2WGRA 3UVHA 1GTAA 2HRNA 3ZL5A 1EZKA 2RLIA 3VK9A 1TI3A 3ERWA 1TI1A 2AYTA 4WBRD 5HR2A 2L5OA 5G5FA 2CX3A 1HNAA 3KJYA 2OBKA 1OC9B 1ZGNA 4IJIA 2HSYA 1THXA 3J7Yb 3CBUA 3RHCA 2AJQB 2DJ1A 2XBQA 4MF6A 3OR5A 2JL4A 1PMTA 3EYTA 4OFTA 2YANA 3CRUA 5AN1A 1E2YA 5JWQB 4AF2A 4ECIA 1OYJA 5INYA 2LRNA 5BMUA 4XCSA 1ZYEA 5DJLA 9GSSA 1AUCA 4KB3A 1TK0B 4NV2A 5KN0A 3FW2A 3H79A 2H66A 2DMMA 1G7OA 1JLWA 1ABAA 3C8EA 4IQ1A 5ID2B 2DJJA 3VWWA 1GLQA 1ERUA 1XVQA 2VM2A 3APQA 2TRCP 3FKFA 1U88A 3L78A 2HRFA 2JZSA 3UBLA 4RQRA 2ON7A 4BA7A 4CW9A 4O5QA 5G5EA 1EEJA 2ALBA 2AAWA 2R0PA 4NHZA 4TW5A 4POBA 2O8VB 2WRTA 1GH2A 4I97A 1UC7A 3HZ4A 2K8SA 1XFLA 2H72A 3TOTA 1FB6A 4G0IA 4F82A 4QL9A 3D4MA 4XTSA 4F0CA 3GIXA 4ZB6A 1SKWB 1XVWA 5ECNB 4G9HA 2E0QA 3IV4A 2WFCA 2JSYA 1G7EA 3UMAA 2J9HA 3M3MA 2X8HA 3VI5A 2FWGA 4HZ2A 3GTUA 5ELGA 1OC3A 4JR4A 4CHSA 1M7TA 1QGVA 4ZIJA 1PD21 4KDUA 5H5QA 3IAS2 1OVNA 3GNJA 2YV7A 3F4TA 3R2QA 1XZOA 2VD0A 1GLPA 3IK7A 2R4VA 1IYHA 3H4KA 4KX4A 3D4TA 3HVVA 3IC8A 3LXTA 1TU7A 2DIYA 1YDKA 1Q98A 3RAZA 2IFQB 1B8XA 1KTEA 2GSTA 3A5WA 4X43A 3VWUA 5G1LA 4NMUA 4IGJA 4OCEA 3ERFA 3QAGA 3VWXA 2H0HA 4J57E 5H5SA 1FO5A 1PSQA 1ZCPA 2RUFA 1XPVA 17GSA 3L9VA 1V57A 2HLSA 2PBJA 1JZWA 2YOIA 1XWGA 1EV9A 2C1YA 5CNWA 1F3BA 1Z6NA 2MBTA 2TIRA 3QFBC 5GZZB 2D2ZA 1K0BA 3DIEA 3M0FA 12GSA 3HZ8A 5KOXA 4YKFA 2XBIA 2FA4A 3GX8A 4ACSA 2CZ2A 1Z5YE 2KP1A 2X8GA 1XBSA 5CRDA 1R5AA 3EC3A 2H1AA 3WYWA 1QXHA 3IDVA 3FHKA 1XCCA 2IL3A 4IP6A 2B5YA 1PN9A 2CAQA 5J3RA 3FRCA 4OD7A 1T4YA 3PGTA 2B7JA 2E7PA 3NOFA 3ZYWA 1Z7PA 1GSDA 1ZL9A 4BL7B 5DDLA 4XS1A 4WR5A 4EUYA 2BJXA 3LWAA 4V1Ap 2H1BA 3F4SA 2REMA 4GSNA 2VLUA 4KNDA 3ZVJD 10GSA 3TCOA 4GQCA 1G6YA 2R5GA 2OA7A 2LRTA 2GVPA 2PWJA 4LLRA 2HNLA 4L5OA 1Z7RA 4E8HA 2O89A 1Z3EA 2LQQA 3U5RE 2HZEB 5ELAA 2F8AA 4HU9A 2A4VA 1BX9A 1WPIA 1N2AA 2NVLA 4KUNA 1SJ6A 2ES7A 2H70A 3C7MA 2NBSA 4BVXB 3UAPA 5B8BA 4BWSA 2CV4A 2FWEA 3DD3A 3WD6A 3ZVJA 1FOHA 4GRFA 5GAND 1SK1A 3ME8A 4NHWA 4USSA 3VPQA 3Q18A 5IPHA 4V1Ag 3MNGA 1BYEA 2LSTA 1MDKA 1GTIA 3DKSA 1TTZA 3H93A 1V98A 1GUHA 3CTFA 5ECPB 5D73A 2EC4A 1T7PB 4KCAA 4ECJA 2OADA 3L4NA 2HT9A 4KSOA 3ZREA 1B48A 5BRTA 4POLA 1ACVA 1ERVA 5AISA 2GDRA 5IMAA 2CVDA 4K8MA 3GFKA 2KLXA 2FNOA 3QR6A 5LD0A 4Z2RA 2OKAA 4XRAA 1CQGA 1ZMAA 3I69A 4KE3A 1T1VA 3HD5A 1BQ7A 2VLVA 3KD0A 4FH8A 4MF7A 3VPTA 3RBTA 4EIPA 4PNFA 4BVYB 3HA9A 3P7XA 2CA8A 1WP0A 2HI7A 3KP9A 1F37A 4MZBA 1KBNA 4JZQA 5DCHA 4CY6A 2VO4A 5F05A 2CX4A 2HRAA 3F9UA 3WGDA 1K0OA 3A3TA 5IMZA 1FG4A 1VF2A 2PPTA 1J9BA 1NSWA 3GH6A 5ECKB 4J56E 1R5PA 4IHUA 2AB6A 3Q6OA 4L5LA 4IVFA 4YAVA 2DLXA 1FOVA 2BMXA 2PMTA 4GCIA 2VAFA 5F07A 1DE1A 2PVOC 5F0GA 5C04A 4MPGA 1K3YA 2MYGA 1ZYNA 3FZ4A 2PUKC 2K6VA 1BEDA 1XW6A 3P90A 2VCWA 4OO5A 3KIJA 1AQVA 4NPBA 2I81A 4KF9A 2YN1A 4DEJA 4ZBBA 1ST9A 3W8JA 3N5OA 3KM6A 2P5RA 4MP4A 3F3RA 1G6WA 4K0NA 2L57A 2RIIA 1RQMA 2H73A 5KEJA 2DJ2A 3IA1A 2DIZA 1FVKA 4X0XA 1Q4JA 2N5BA 5ECRB 1E6BA 1MDJA 4WR4A 1MTCA 1PQNA 1B4PA 4FO5A 4PUFC 3HHVA 4PURA 2R0GA 1LBKA 3BJ5A 1ERWA 4Z2UA 1GUMA 3DVXA 3EMXA 2FGXA 2JSZA 5JWOB 1JFUA 3TRXA 3EPTA 2V2GA 4XHMA 4GXZA 5COHA 3HJMA 1YEXA 3PH9A 2GQKA 1AAZA 1PGTA 2DMLA 2KP2A 3CRTA 1SJZA 2A4HA 3ZFBA 1YY7A 1WJKA 3IHGA 3FR9A 3BBYA 3EU4A 2MMNA 3GUSA 4PUAA 3DYRA 3TKQA 3CXGA 4AJ6A 4G10A 4L0WA 2GZYA 1GTBA 1AIUA 4V2MA 5AGYA 4MJEA 3NZNA 1WOUA 1TOFA 4KGIA 4E8EA 6GSUA 2IMDA 3A2WA 1UA5A 2CT6A 4XRDA 4JU5A 2I3YA 3QAVA 4F03A 1ZYQB 3FEUA 5HR3A 2H30A 4NV5A 1T4ZA 4GSSA 5DAKB 3IAM2 4JE1A 1GSUA 3W8SA 4J2FA 1LJRA 2G2QA 4TXOA 1SK2A 3CMIA 3FZAA 1K0MA 1XWAA 3IC4A 2DKIA 2I1UA 1Z9HA 3TJFA 3IOSA 6GSYA 2RM5A 1QMVA 5ECIB 4XS6A 1X9WB 4HU7A 3N9JA 1TRVA 5CAXA 2XPEA 2GZPA 4GLTA 3FR3A 1I5GA 3O6TA 3QAWA 4N11A 2MBSA 3KMOA 2L6CA 3W6GA 3QPMA 4K7OA 4XIHA 2JADA 4LMVA 3TRPA 4ZILA 1FAAA 3E3EA 3GL3A 1AQXA 3FK8A 2H6XA 4N10A 4POKA 5KN3A 4FYUA 1ON4A 1AW9A 3HKRA 2XHFA 1QQ2A 1T3BA 4IP1A 1TW9A 1FVJA 13GSA 4KDYA 5LCZA 4X1UA 2HYXA 3G7IA 1K0CA 1GTUA 11GSA 2LUSA 1YKCA 3M9JA 4WKWA 5FT3A 4JRRA 2OE0A 2LRCA 1K0DA 1MDIA 3V1WA 3C1SA 5IOXA 1XIYA 4ILFA 1VF1A 2DJ3A 5D8IA 4LA1A 2IMFA 3LQ7A 3ERGA 5IO0A 3I9V2 2VOCA 4MZCA 1TKDB 6GSSA 1PX6A 4ISDA 2I9HA 3K8NA 1V9WA 1OC8A 2CVBA 4NXIA 1PA3A 3F6DA 4TKYA 4MK3A 5ABRA 3F3QA 1EOGA 4Q5QA 2IPAA 3D5JA 4HQZA 3HY2A 4A5PA 4V2NA 2NTOA 3UARA 2N5AA 5IQYA 5DVBA 4TR0A 4ZL8A 2LNTA 4I5QA 2FWHA 5CRHA 1WIKA 3FZ9A 2QA2A 4GF0A 3TKSE 1V40A 5H5RA 2FD3A 3G9BA 3VLNA 5ECHB 1X5DA 1EV4A 1IYIA 5HR0A 4V2LA 2VCXA 1A2JA 2WS2A 2XPDA 4OCFA 3L9SA 5D93A 2HZFA 3QFAC 2M80A 2LJKA 3SBCA 3H1NA 2NPBA 5KN2A 2C0GA 2H0GA 4IJ3A 1TJDA 2EIQA 2EIOA 4N0ZA 2H6YA 1PL2A 3ZRDA 3IPZA 1HQOA 3PR8A 4O5RA 2CZ3A 1OKDA 1S3CA 3DWVA 2DJ0A 16GSA 3D21A 3EU3A 4JBBA 1OE8A 4NAXA 1VF4A 14GSA 2JU5A 4AGSA 3GKMA 3ZMLA 4K0GA 2P5QA 4BPYA 2GSSA 4K7IA 2WZ9A 5F8BA 2PU9C 2FCHA 1PKWA 5CRGA 5G30A 1A0RP 4EL1A 3VURA 4FYBA 1BJXA 8GSSA 5J9BA 4IELA 5A5KA 3NIVA 1TU8A 4K6XA 5J4UA 2GS3A 3LXZA 3IHQA 3L9UA 4ML1A 3F63A 1SYRA 3DMLA 3ZIJA 3C73A 1VRSD 3LJRA 3ME7A 4GWRA 3UEMA 3IRAA 4K2XA 1MD4A 3DRNA 4O92A 3C1RA 1SYXA 2M72A 1MD3A 2B3SA 2DC5A 4HZ4A 2K18A 1XWKA 1GSSA 1A24A 1X0RA 5ENUA 3IBHA 3GN3A 1K0NA 4QQ7A 2I4AA 4AJ8A 1FB0A 4D73A 1WRYA 5ECOB 2ZCTA 3LFLA 4EKZA 1HNCA 1F6MC 2LJRA 19GSA 1XOAA 4O5UA 3M9KA 2K8VA 5KN1A 2V41A 1DSBA 4TN8A 1SJIA 2B7KA 2L5LA 3GRXA 4Q5RA 4MF5A 1AXDA 2IIYA 2V6KA 4XS4A 4Z2TA 2A2RA 5G2ZA 5J41A 1I9DA 4WXTA 4K7NA 1LU4A 1B9XC 2R0CA 2VUPA 2FA8A 2GTUA 3PPUA 1M2BA 2DBCA 1NM3A 6GSXA 5DALA 4G19A 4OO4A 2IN3A 1U3AA 4MA9A 3CSIA 3LORA 20GSA 3P2AA 1XWCA 1M2AA 2DKHA 3MIXA 1EOHA 2DJKA 1GSFA 3TJKA 2M46A 1M99A 3GSTA 1T00A 1K3OA 1XWBA 3IK9A 1TDIA 1X9SB 1X9MB 1XW9A 1A2LA 1R4WA 3F0IA 4TR1A 1THOA 2QA1A 3ZIVA 4DSSA 3QD9A 1NHYA 5DBQA 1YKAA 3I43A 5AIVA 1EP8A 2RUEA 2F9SA 2FWFA 2H01A 5JCUA 2YJHA 2YCDA 3VFIA 3DVWA 3GH9A 2C3NA 3TDGA 4DSRA 2YJ7A 4ID0A 1WE0A 4RUVA 1TP9A 3QOUA 4HJ2A 3LG6A 2LQOA 4OMVA 4QL7A 2X4AA 2IMIA 3BCIA 4PQIA 4HJMA 1UN2A 2OE1A 3WGEA 2H8LA 3HVSA 2JZTA 1QK8A 5GSTA 1FW1A 1QFNA 4ZXGA 4O32A 1RK4A 3HJPA 2B5EA 1GNWA 5CYYA 2H0IA 2H6ZA 5LNKe 2YPMA 2YZUA 2A2SA 3M8NA 1UVZA 5JCGA 2GZZA 4TVEA 4PQ1A 5ECMB 2X49A 5A4UA 1ZYPA 1R7HA 1WWJA 18GSA 3MWHA 3IE3A 4FQUA 3UOMA 4GSTA 4EIQA 1PRXA 4YQUA 1YJ6A 4PXOA 3KZQA 2FY6A 2GT6A 4IKHA 1ERTA 3IXRA 3GX0A 5A4WA 1YF1A 4EXJA 4MH3A 5C00A 4IS0A 2YZHA 5ECSA 2L59A 3GURA 3ZZXA 3HCZA 5D96A 4ECCA 4KH7A 4I6XA 4WF5A 2CVKA 3TJBA 1NW2A 3H8QA 2Z9SA 3VI7A 2GSQA 5IO2A 4RI6A 2WCIA 1EGOA 5IMDA 4MJAA 3RDWA 1GSYA 2GSRA 5B6MA 1ZZYA 3HXSA 22GSA 4Q5FA 1RW1A 2BTOT 2PGTA 3GMFA 1O8WA 5GAPD 4X4JA 3TKSC 2OE3A 2VL9A 4LMWA 3TRQA 1Y25A 2GQLA 1M0UA 4O7HA 1GL8A 4K2DA 5J9CA 4IQAA 1A2MA 3APSA 4MJBA 1OC9A 2O87A 4H86A 2V1MA 4YQVA 1SL2B 1USBA 4P3YB 4HDEA 2GGTA 5JWRB 4HQSA 3D22A 4LL1B 3GSSA 2J23A 2LNSA 5D9TA 3S9FA 3EVIA 2JACA 1OAZA 2C4JA 2WJUA 3M1GA 4HUAA 3GKNA 3A5IA 3Q74A 2OACA 6GSTA 3F4RA 3O76A 4WEYA 5G31A 5E4WA 2LV3A 2WULA 1SL1B 3EINA 1S3AA 2B5XA 2MMAA 1SD8A 5ID2A 3KP8A 4MDCA 4TXOB 5B7CA 3KCMA 2YP6A 1PL1A 4TRXA 2OBIA 3FY7A 5FHIA 2KOKA 1F3AA 4G0LA 7GSSA 1ZOFA 4MH2A 4I2UA 1TRSA 4OFNA 4KDXA 2MMZA 1OE7A 4MNNA 5B6NA 3UIWA 2HXKA 3LYPA 1O7UA 4G2EA 3QDNA 2EIRA 3KGKA 3ZTLA 5CP1A 3WGXA 1VF3A 3WT1A 2O85A 2H1GA 3LEFA 2C0DA 3CYNA 1K3LA 1SENA 1SD9A 2VCTA 3I6AA 4IW9A 2QGVA 6GSWA 3EMPA 3TGZA 2GLRA 5HFKA 2YNXA 3MAKA 1WMJA 1GWCA 1M2DA 3ZFLA 1QUWA 1GRXA 4G0KA 2B1KA 2R3XA 1YF0A 4I2TA 4EO3A 3APOA 4KSMA 2YWMA 1U87A 3HDCA 3MDKA 4N0VA 1O73A 1EWXA 1A8YA 4PX1A 4K5SA 2XC2A 4N30A 2IFQA 5IMFA 4OFMA 3HYPA 1SKSB 1EP7A 2CQ9A 5EPFA 4AJ7A 2VLTA 2QC7A 4ICYA 2B6MA 2HSHA 2X99A 3KEBA 3GTUB 3ISOA 5EY6A 1TRWA 1SK0A 2AUVA 3TJGA 3P8WA 3L0HA 1ILOA 4KAEA 4EC0A 3ZLPA 3LW9A 2H76A 3HVXA 2VIMA 4KW6A 1DE2A 4FYCA 3A2XA 3CSHA 5IPGA 1W4VA 1U3IA 4DSQA 1HD2A 5A4VA 4MMMA 3FYGA 4K1FA 1W89A 2P31A 1ML6A 5IOWA 4HOJA 4ZL7A 1F2EA 2E2GA 2O7KA 4TR3A 4DVCA 3CSJA 4KCEA 3SWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GKX A;  2FHE A;  2KHP A;  4EDZ A;  2G0F A;  3GYK A;  3LGC A;  2H74 A;  2HFD A;  3TOU A;  3KTB A;  3TKP A;  5EL8 A;  3GA4 A;  2OJL A;  3TJJ A;  3G7J A;  4L8E A;  1O85 A;  1O6J A;  4BL7 A;  4TOP A;  2L6D A;  1B4Q A;  3TB2 A;  1JZO A;  3VWV A;  3D0Z A;  2IWT A;  3RPN A;  2YWN A;  3KMN A;  5CO3 A;  1AQW A;  4FIW A;  1YZX A;  2F8F A;  1V58 A;  5FWG A;  2VCZ A;  2N5F A;  1NHO A;  4KA0 A;  2QKE A;  2HZE A;  1T8E B;  2AHE A;  5HR1 A;  3RPP A;  4EF0 A;  2ZUP A;  1Y6E A;  5HQP A;  3KH9 A;  3BOA A;  3UJ1 A;  2C8U A;  5D9V A;  5DCG A;  2MZC A;  2WB9 A;  5IM9 A;  2C80 A;  4BVX A;  4MPF A;  3ED3 A;  4Z7X A;  2WDU A;  2L4C A;  4WET A;  5G1K A;  2E2M A;  2IMK A;  1HNB A;  2YWI A;  4TXV A;  1CQH A;  4F0B A;  3TUE A;  3HJO A;  1GSE A;  4HI7 A;  2VD1 A;  1C72 A;  2C3Q A;  2VL2 A;  3CTG A;  4NWY A;  3G7Y A;  4TR4 A;  2KUC A;  4HEA 2;  1XXU A;  1TRU A;  3RHB A;  2GT5 A;  2X8C A;  2LEG A;  2FUG 2;  1GNE A;  1F9M A;  4D73 B;  3Q19 A;  5DJM A;  3EUR A;  2LJA A;  4IBP A;  3J7Y k;  2VL3 A;  4HS1 A;  2PVQ A;  4MCU A;  1EGR A;  1M9A A;  3C71 A;  5F06 A;  3PIN A;  1X5C A;  4BVY A;  2LTK A;  4I8B A;  1SU9 A;  4OWY A;  2RM6 A;  4ZB8 A;  1EEM A;  3EE2 A;  3GHA A;  4ZBD A;  3DEX A;  2R2J A;  3WT2 A;  4ULX A;  3TKR A;  1SKR B;  3JCM L;  1VGL A;  2ZNM A;  5EVO A;  1H75 A;  3UBK A;  4XS4 B;  1FHE A;  1A0F A;  3F8U A;  5J5N A;  2V32 A;  3KTL A;  2YV9 A;  1TK8 B;  1DBY A;  2H19 A;  2H71 A;  3TKS A;  2IJY A;  4CDO A;  3D6I A;  2MMO A;  3GV1 A;  4EE0 A;  1HYU A;  2K9F A;  4MAB A;  3DGQ A;  5DAL B;  5AIX A;  4JED A;  4JR6 A;  1SL0 B;  1URM A;  1TK5 B;  1A8L A;  1TXX A;  3E9J B;  4IN0 A;  3QCP A;  1YQ1 A;  4POM A;  3BCK A;  5CRE A;  4Q5N A;  5HFG A;  2ON5 A;  4LL4 B;  1JHB A;  2AV4 A;  5D9X A;  3F6F A;  5L71 A;  1J0F A;  1O81 A;  3GKK A;  2F3M A;  1PKZ A;  1DUG A;  3LYK A;  4YH2 A;  1BAY A;  2X64 A;  4WF4 A;  3BD2 A;  4ML6 A;  5D9W A;  2P0G A;  1GUL A;  2QSI A;  2VCV A;  3KH7 A;  4L0U A;  5CRW A;  3US3 A;  5IIZ A;  4TR1 B;  4YQM A;  5ECL B;  3KXO A;  2VM1 A;  4EVM A;  4YAP A;  1J08 A;  2NDO A;  5JCW A;  1H4O A;  2C3T A;  4DSS B;  1A23 A;  1OKT A;  1GP1 A;  1GUK A;  3ZMK A;  1B9Y C;  1Z6M A;  2LS5 A;  1YEP A;  1JZD A;  2DSA A;  4MZW A;  1U6T A;  1MEK A;  4F9Z A;  2L4Q A;  3AY8 A;  1X5E A;  2PER A;  1O8X A;  4MLY A;  2LKU A;  2YWO A;  2VL2 C;  4PGT A;  3MSZ A;  2C0F A;  4RI7 A;  5E59 A;  2R37 A;  3LSZ A;  5IMV A;  4GQF A;  4GTU A;  1XOB A;  2PN8 A;  1BG5 A;  3UL3 A;  1N8J A;  3O3T A;  4RQX A;  1PX7 A;  1AC1 A;  2B1L A;  4PQH A;  5ECQ B;  5HFI A;  2F51 A;  2TRX A;  4WBJ A;  2JZR A;  4MJC A;  2IME A;  1K0A A;  1GSQ A;  2C0E A;  4ZBA A;  2H75 A;  3QMX A;  2GQM A;  5DQS A;  1S3D A;  2VCQ A;  5B8A A;  3EWL A;  1KNG A;  1JLV A;  5IMC A;  3ZIT A;  4ZB9 A;  2H1D A;  5DAK A;  4PNG A;  1JZR A;  1R26 A;  3A2V A;  3FZ5 A;  4ZL9 A;  3GL5 A;  2HE3 A;  3IR4 A;  1KEB A;  1M9B A;  5DQY A;  4BWQ A;  3DXB A;  2R6K A;  3FR6 A;  3U6V A;  1XW5 A;  4ECB A;  3UVT A;  2FLS A;  2CAI A;  6GSV A;  2V6O A;  4EDY A;  3E0U A;  4K9Z A;  5GSS A;  4F2I A;  1V2A A;  1G0T A;  2WGR A;  3UVH A;  1GTA A;  2HRN A;  3ZL5 A;  1EZK A;  2RLI A;  3VK9 A;  1TI3 A;  3ERW A;  1TI1 A;  2AYT A;  4WBR D;  5HR2 A;  2L5O A;  5G5F A;  2CX3 A;  1HNA A;  3KJY A;  2OBK A;  1OC9 B;  1ZGN A;  4IJI A;  2HSY A;  1THX A;  3J7Y b;  3CBU A;  3RHC A;  2AJQ B;  2DJ1 A;  2XBQ A;  4MF6 A;  3OR5 A;  2JL4 A;  1PMT A;  3EYT A;  4OFT A;  2YAN A;  3CRU A;  5AN1 A;  1E2Y A;  5JWQ B;  4AF2 A;  4ECI A;  1OYJ A;  5INY A;  2LRN A;  4XCS A;  1ZYE A;  5DJL A;  9GSS A;  1AUC A;  4KB3 A;  1TK0 B;  4NV2 A;  5KN0 A;  3FW2 A;  3H79 A;  2H66 A;  2DMM A;  1G7O A;  1JLW A;  1ABA A;  3C8E A;  4IQ1 A;  5ID2 B;  2DJJ A;  3VWW A;  1GLQ A;  1ERU A;  1XVQ A;  2VM2 A;  3APQ A;  2TRC P;  3FKF A;  1U88 A;  3L78 A;  2HRF A;  2JZS A;  3UBL A;  4RQR A;  2ON7 A;  4BA7 A;  4CW9 A;  5G5E A;  1EEJ A;  2ALB A;  2AAW A;  4NHZ A;  4TW5 A;  4POB A;  2O8V B;  2WRT A;  1GH2 A;  4I97 A;  1UC7 A;  3HZ4 A;  2K8S A;  1XFL A;  2H72 A;  3TOT A;  1FB6 A;  4F82 A;  4QL9 A;  3D4M A;  4XTS A;  4F0C A;  3GIX A;  4ZB6 A;  1SKW B;  1XVW A;  5ECN B;  4G9H A;  2E0Q A;  3IV4 A;  2WFC A;  2JSY A;  1G7E A;  3UMA A;  2J9H A;  3M3M A;  2X8H A;  3VI5 A;  2FWG A;  4HZ2 A;  3GTU A;  5ELG A;  1OC3 A;  4JR4 A;  4CHS A;  1M7T A;  1QGV A;  4ZIJ A;  1PD2 1;  4KDU A;  5H5Q A;  3IAS 2;  1OVN A;  3GNJ A;  2YV7 A;  3F4T A;  3R2Q A;  1XZO A;  2VD0 A;  1GLP A;  3IK7 A;  2R4V A;  1IYH A;  3H4K A;  4KX4 A;  3D4T A;  3HVV A;  3LXT A;  1TU7 A;  2DIY A;  1YDK A;  1Q98 A;  3RAZ A;  2IFQ B;  1B8X A;  1KTE A;  2GST A;  3A5W A;  4X43 A;  3VWU A;  5G1L A;  4NMU A;  4IGJ A;  4OCE A;  3ERF A;  3QAG A;  3VWX A;  2H0H A;  4J57 E;  5H5S A;  1FO5 A;  1PSQ A;  1ZCP A;  2RUF A;  1XPV A;  17GS A;  3L9V A;  1V57 A;  2HLS A;  2PBJ A;  1JZW A;  2YOI A;  1XWG A;  1EV9 A;  2C1Y A;  5CNW A;  1F3B A;  1Z6N A;  2MBT A;  2TIR A;  3QFB C;  5GZZ B;  2D2Z A;  1K0B A;  3DIE A;  3M0F A;  12GS A;  3HZ8 A;  2XBI A;  2FA4 A;  3GX8 A;  4ACS A;  2CZ2 A;  1Z5Y E;  2KP1 A;  2X8G A;  1XBS A;  5CRD A;  1R5A A;  3EC3 A;  2H1A A;  3WYW A;  1QXH A;  3IDV A;  3FHK A;  1XCC A;  2IL3 A;  4IP6 A;  2B5Y A;  1PN9 A;  2CAQ A;  5J3R A;  3FRC A;  4OD7 A;  1T4Y A;  3PGT A;  2B7J A;  2E7P A;  3NOF A;  3ZYW A;  1Z7P A;  1GSD A;  1ZL9 A;  5DDL A;  4XS1 A;  4WR5 A;  4EUY A;  2BJX A;  3LWA A;  4V1A p;  2H1B A;  3F4S A;  2REM A;  4GSN A;  2VLU A;  4KND A;  3ZVJ D;  10GS A;  3TCO A;  4GQC A;  1G6Y A;  2R5G A;  2OA7 A;  2LRT A;  2GVP A;  2PWJ A;  4LLR A;  2HNL A;  4L5O A;  1Z7R A;  4E8H A;  2O89 A;  1Z3E A;  2LQQ A;  3U5R E;  2HZE B;  5ELA A;  2F8A A;  4HU9 A;  2A4V A;  1BX9 A;  1WPI A;  1N2A A;  2NVL A;  4KUN A;  1SJ6 A;  2ES7 A;  2H70 A;  3C7M A;  2NBS A;  3UAP A;  5B8B A;  4BWS A;  2CV4 A;  2FWE A;  3DD3 A;  3WD6 A;  3ZVJ A;  4GRF A;  5GAN D;  1SK1 A;  3ME8 A;  4NHW A;  3VPQ A;  3Q18 A;  5IPH A;  4V1A g;  3MNG A;  1BYE A;  2LST A;  1MDK A;  1GTI A;  3DKS A;  1TTZ A;  3H93 A;  1V98 A;  1GUH A;  3CTF A;  5ECP B;  5D73 A;  2EC4 A;  1T7P B;  4KCA A;  4ECJ A;  2OAD A;  3L4N A;  2HT9 A;  4KSO A;  3ZRE A;  1B48 A;  4POL A;  1ACV A;  1ERV A;  5AIS A;  2GDR A;  5IMA A;  2CVD A;  4K8M A;  3GFK A;  2KLX A;  2FNO A;  3QR6 A;  5LD0 A;  2OKA A;  4XRA A;  1CQG A;  1ZMA A;  3I69 A;  4KE3 A;  1T1V A;  3HD5 A;  1BQ7 A;  2VLV A;  3KD0 A;  4FH8 A;  4MF7 A;  3VPT A;  3RBT A;  4PNF A;  3HA9 A;  3P7X A;  2CA8 A;  1WP0 A;  2HI7 A;  3KP9 A;  1F37 A;  4MZB A;  1KBN A;  4JZQ A;  5DCH A;  2VO4 A;  5F05 A;  2CX4 A;  3F9U A;  3WGD A;  1K0O A;  3A3T A;  5IMZ A;  1FG4 A;  1VF2 A;  2PPT A;  1J9B A;  1NSW A;  3GH6 A;  5ECK B;  4J56 E;  1R5P A;  4IHU A;  2AB6 A;  3Q6O A;  4L5L A;  4IVF A;  4YAV A;  2DLX A;  1FOV A;  2BMX A;  2PMT A;  4GCI A;  2VAF A;  5F07 A;  1DE1 A;  2PVO C;  5F0G A;  5C04 A;  4MPG A;  1K3Y A;  2MYG A;  3FZ4 A;  2PUK C;  2K6V A;  1BED A;  1XW6 A;  3P90 A;  2VCW A;  4OO5 A;  3KIJ A;  1AQV A;  4NPB A;  2I81 A;  2YN1 A;  4DEJ A;  4ZBB A;  1ST9 A;  3W8J A;  3N5O A;  3KM6 A;  2P5R A;  4MP4 A;  3F3R A;  1G6W A;  4K0N A;  2L57 A;  2RII A;  1RQM A;  2H73 A;  5KEJ A;  2DJ2 A;  3IA1 A;  2DIZ A;  1FVK A;  4X0X A;  1Q4J A;  2N5B A;  5ECR B;  1E6B A;  1MDJ A;  4WR4 A;  1MTC A;  1PQN A;  1B4P A;  4FO5 A;  4PUF C;  3HHV A;  4PUR A;  1LBK A;  3BJ5 A;  1ERW A;  1GUM A;  3DVX A;  3EMX A;  2FGX A;  2JSZ A;  5JWO B;  1JFU A;  3TRX A;  2V2G A;  4XHM A;  4GXZ A;  5COH A;  3HJM A;  1YEX A;  3PH9 A;  2GQK A;  1AAZ A;  1PGT A;  2DML A;  2KP2 A;  3CRT A;  1SJZ A;  3ZFB A;  1YY7 A;  1WJK A;  3FR9 A;  3BBY A;  3EU4 A;  2MMN A;  3GUS A;  4PUA A;  3DYR A;  3TKQ A;  3CXG A;  4AJ6 A;  4G10 A;  4L0W A;  2GZY A;  1GTB A;  1AIU A;  4V2M A;  5AGY A;  4MJE A;  3NZN A;  1WOU A;  1TOF A;  4KGI A;  4E8E A;  6GSU A;  2IMD A;  3A2W A;  1UA5 A;  2CT6 A;  4XRD A;  4JU5 A;  2I3Y A;  3QAV A;  4F03 A;  1ZYQ B;  3FEU A;  5HR3 A;  2H30 A;  4NV5 A;  1T4Z A;  4GSS A;  5DAK B;  3IAM 2;  4JE1 A;  1GSU A;  3W8S A;  4J2F A;  1LJR A;  2G2Q A;  4TXO A;  1SK2 A;  3CMI A;  3FZA A;  1K0M A;  1XWA A;  3IC4 A;  2I1U A;  1Z9H A;  3TJF A;  3IOS A;  6GSY A;  2RM5 A;  1QMV A;  5ECI B;  4XS6 A;  1X9W B;  4HU7 A;  3N9J A;  1TRV A;  5CAX A;  2XPE A;  2GZP A;  4GLT A;  3FR3 A;  1I5G A;  3O6T A;  3QAW A;  4N11 A;  2MBS A;  3KMO A;  2L6C A;  3W6G A;  3QPM A;  4K7O A;  4XIH A;  2JAD A;  4LMV A;  3TRP A;  4ZIL A;  1FAA A;  3E3E A;  3GL3 A;  1AQX A;  3FK8 A;  2H6X A;  4N10 A;  4POK A;  5KN3 A;  4FYU A;  1ON4 A;  1AW9 A;  3HKR A;  2XHF A;  1QQ2 A;  1T3B A;  4IP1 A;  1TW9 A;  1FVJ A;  13GS A;  4KDY A;  5LCZ A;  4X1U A;  2HYX A;  3G7I A;  1K0C A;  1GTU A;  11GS A;  2LUS A;  1YKC A;  3M9J A;  4WKW A;  5FT3 A;  4JRR A;  2OE0 A;  2LRC A;  1K0D A;  1MDI A;  3V1W A;  3C1S A;  5IOX A;  1XIY A;  4ILF A;  1VF1 A;  2DJ3 A;  5D8I A;  4LA1 A;  2IMF A;  3LQ7 A;  3ERG A;  5IO0 A;  3I9V 2;  2VOC A;  4MZC A;  1TKD B;  6GSS A;  1PX6 A;  4ISD A;  2I9H A;  3K8N A;  1V9W A;  1OC8 A;  2CVB A;  4NXI A;  1PA3 A;  3F6D A;  4TKY A;  4MK3 A;  5ABR A;  3F3Q A;  1EOG A;  4Q5Q A;  2IPA A;  3D5J A;  4HQZ A;  3HY2 A;  4V2N A;  2NTO A;  3UAR A;  2N5A A;  5IQY A;  5DVB A;  4TR0 A;  4ZL8 A;  2LNT A;  4I5Q A;  2FWH A;  5CRH A;  1WIK A;  3FZ9 A;  4GF0 A;  3TKS E;  1V40 A;  5H5R A;  2FD3 A;  3G9B A;  3VLN A;  5ECH B;  1X5D A;  1EV4 A;  1IYI A;  5HR0 A;  4V2L A;  2VCX A;  1A2J A;  2WS2 A;  2XPD A;  4OCF A;  3L9S A;  5D93 A;  2HZF A;  3QFA C;  2M80 A;  2LJK A;  3SBC A;  3H1N A;  2NPB A;  5KN2 A;  2C0G A;  2H0G A;  4IJ3 A;  1TJD A;  2EIQ A;  2EIO A;  4N0Z A;  2H6Y A;  1PL2 A;  3ZRD A;  3IPZ A;  1HQO A;  3PR8 A;  4O5R A;  2CZ3 A;  1OKD A;  1S3C A;  3DWV A;  2DJ0 A;  16GS A;  3D21 A;  3EU3 A;  4JBB A;  1OE8 A;  4NAX A;  1VF4 A;  14GS A;  2JU5 A;  4AGS A;  3GKM A;  3ZML A;  4K0G A;  2P5Q A;  4BPY A;  2GSS A;  4K7I A;  2WZ9 A;  5F8B A;  2PU9 C;  2FCH A;  1PKW A;  5CRG A;  5G30 A;  1A0R P;  4EL1 A;  3VUR A;  4FYB A;  1BJX A;  8GSS A;  5J9B A;  4IEL A;  5A5K A;  3NIV A;  1TU8 A;  4K6X A;  5J4U A;  2GS3 A;  3LXZ A;  3IHQ A;  3L9U A;  4ML1 A;  3F63 A;  1SYR A;  3DML A;  3ZIJ A;  3C73 A;  1VRS D;  3LJR A;  3ME7 A;  4GWR A;  3UEM A;  3IRA A;  1MD4 A;  3DRN A;  4O92 A;  3C1R A;  1SYX A;  2M72 A;  1MD3 A;  2B3S A;  2DC5 A;  4HZ4 A;  2K18 A;  1XWK A;  1GSS A;  1A24 A;  1X0R A;  5ENU A;  3IBH A;  3GN3 A;  1K0N A;  4QQ7 A;  2I4A A;  4AJ8 A;  1FB0 A;  4D73 A;  1WRY A;  5ECO B;  2ZCT A;  3LFL A;  4EKZ A;  1HNC A;  1F6M C;  2LJR A;  19GS A;  1XOA A;  3M9K A;  2K8V A;  5KN1 A;  2V41 A;  1DSB A;  4TN8 A;  1SJI A;  2B7K A;  2L5L A;  3GRX A;  4Q5R A;  4MF5 A;  1AXD A;  2IIY A;  2V6K A;  4XS4 A;  2A2R A;  5G2Z A;  5J41 A;  1I9D A;  4WXT A;  4K7N A;  1LU4 A;  1B9X C;  2VUP A;  2FA8 A;  2GTU A;  1M2B A;  2DBC A;  1NM3 A;  6GSX A;  5DAL A;  4G19 A;  4OO4 A;  2IN3 A;  1U3A A;  4MA9 A;  3CSI A;  3LOR A;  20GS A;  3P2A A;  1XWC A;  1M2A A;  1EOH A;  2DJK A;  1GSF A;  3TJK A;  2M46 A;  1M99 A;  3GST A;  1T00 A;  1K3O A;  1XWB A;  3IK9 A;  1TDI A;  1X9S B;  1X9M B;  1XW9 A;  1A2L A;  1R4W A;  3F0I A;  4TR1 A;  1THO A;  3ZIV A;  4DSS A;  3QD9 A;  1NHY A;  5DBQ A;  1YKA A;  3I43 A;  5AIV A;  1EP8 A;  2RUE A;  2F9S A;  2FWF A;  2H01 A;  5JCU A;  2YJH A;  2YCD A;  3VFI A;  3DVW A;  3GH9 A;  2C3N A;  3TDG A;  4DSR A;  2YJ7 A;  4ID0 A;  1WE0 A;  4RUV A;  1TP9 A;  3QOU A;  4HJ2 A;  3LG6 A;  2LQO A;  4OMV A;  4QL7 A;  2IMI A;  3BCI A;  4PQI A;  4HJM A;  1UN2 A;  2OE1 A;  3WGE A;  2H8L A;  3HVS A;  2JZT A;  1QK8 A;  5GST A;  1FW1 A;  1QFN A;  4ZXG A;  4O32 A;  1RK4 A;  3HJP A;  2B5E A;  1GNW A;  5CYY A;  2H0I A;  2H6Z A;  5LNK e;  2YPM A;  2YZU A;  2A2S A;  3M8N A;  1UVZ A;  5JCG A;  2GZZ A;  4TVE A;  4PQ1 A;  5ECM B;  5A4U A;  1R7H A;  1WWJ A;  18GS A;  3MWH A;  3IE3 A;  3UOM A;  4GST A;  1PRX A;  4YQU A;  1YJ6 A;  4PXO A;  3KZQ A;  2FY6 A;  2GT6 A;  4IKH A;  1ERT A;  3IXR A;  3GX0 A;  5A4W A;  1YF1 A;  4EXJ A;  4MH3 A;  5C00 A;  4IS0 A;  2YZH A;  5ECS A;  2L59 A;  3GUR A;  3ZZX A;  3HCZ A;  5D96 A;  4ECC A;  4KH7 A;  4I6X A;  4WF5 A;  2CVK A;  3TJB A;  1NW2 A;  3H8Q A;  2Z9S A;  3VI7 A;  2GSQ A;  5IO2 A;  4RI6 A;  2WCI A;  1EGO A;  5IMD A;  4MJA A;  3RDW A;  1GSY A;  2GSR A;  5B6M A;  1ZZY A;  3HXS A;  22GS A;  4Q5F A;  1RW1 A;  2BTO T;  2PGT A;  3GMF A;  1O8W A;  5GAP D;  3TKS C;  2OE3 A;  2VL9 A;  4LMW A;  3TRQ A;  1Y25 A;  2GQL A;  1M0U A;  4O7H A;  1GL8 A;  4K2D A;  5J9C A;  4IQA A;  1A2M A;  3APS A;  4MJB A;  1OC9 A;  2O87 A;  4H86 A;  2V1M A;  4YQV A;  1SL2 B;  1USB A;  4P3Y B;  4HDE A;  2GGT A;  5JWR B;  4HQS A;  3D22 A;  4LL1 B;  3GSS A;  2J23 A;  2LNS A;  5D9T A;  3S9F A;  3EVI A;  2JAC A;  1OAZ A;  2C4J A;  2WJU A;  3M1G A;  4HUA A;  3GKN A;  3Q74 A;  2OAC A;  6GST A;  3F4R A;  3O76 A;  4WEY A;  5G31 A;  5E4W A;  2LV3 A;  2WUL A;  1SL1 B;  3EIN A;  1S3A A;  2B5X A;  2MMA A;  1SD8 A;  5ID2 A;  3KP8 A;  4MDC A;  4TXO B;  5B7C A;  3KCM A;  2YP6 A;  1PL1 A;  4TRX A;  2OBI A;  3FY7 A;  5FHI A;  2KOK A;  1F3A A;  7GSS A;  1ZOF A;  4MH2 A;  4I2U A;  1TRS A;  4OFN A;  4KDX A;  2MMZ A;  1OE7 A;  5B6N A;  3UIW A;  2HXK A;  3LYP A;  1O7U A;  4G2E A;  3QDN A;  2EIR A;  3KGK A;  3ZTL A;  5CP1 A;  3WGX A;  1VF3 A;  3WT1 A;  2O85 A;  2H1G A;  3LEF A;  2C0D A;  3CYN A;  1K3L A;  1SEN A;  1SD9 A;  2VCT A;  3I6A A;  4IW9 A;  2QGV A;  6GSW A;  3EMP A;  3TGZ A;  2GLR A;  5HFK A;  2YNX A;  3MAK A;  1WMJ A;  1GWC A;  1M2D A;  3ZFL A;  1QUW A;  1GRX A;  2B1K A;  2R3X A;  1YF0 A;  4I2T A;  4EO3 A;  3APO A;  4KSM A;  2YWM A;  1U87 A;  3HDC A;  3MDK A;  4N0V A;  1O73 A;  1EWX A;  1A8Y A;  4PX1 A;  2XC2 A;  4N30 A;  2IFQ A;  5IMF A;  4OFM A;  3HYP A;  1SKS B;  1EP7 A;  2CQ9 A;  5EPF A;  4AJ7 A;  2VLT A;  2QC7 A;  2B6M A;  2HSH A;  2X99 A;  3KEB A;  3GTU B;  3ISO A;  5EY6 A;  1TRW A;  1SK0 A;  2AUV A;  3TJG A;  3P8W A;  3L0H A;  1ILO A;  4KAE A;  4EC0 A;  3ZLP A;  2H76 A;  3HVX A;  2VIM A;  4KW6 A;  1DE2 A;  4FYC A;  3A2X A;  3CSH A;  5IPG A;  1W4V A;  1U3I A;  4DSQ A;  1HD2 A;  5A4V A;  4MMM A;  3FYG A;  4K1F A;  1W89 A;  2P31 A;  1ML6 A;  5IOW A;  4HOJ A;  4ZL7 A;  1F2E A;  2E2G A;  2O7K A;  4TR3 A;  4DVC A;  3CSJ A;  4KCE A;  3SWL A; 
#chains in the Genus database with same CATH topology
 3GKX A;  2FHE A;  2KHP A;  4EDZ A;  2G0F A;  3GYK A;  3LGC A;  2H74 A;  2HFD A;  3TOU A;  3KTB A;  3TKP A;  5EL8 A;  3GA4 A;  2OJL A;  3TJJ A;  3G7J A;  4L8E A;  1O85 A;  1O6J A;  4BL7 A;  4TOP A;  2L6D A;  1B4Q A;  3TB2 A;  1JZO A;  3VWV A;  3D0Z A;  2IWT A;  3RPN A;  2YWN A;  3KMN A;  5CO3 A;  1AQW A;  4FIW A;  1YZX A;  2F8F A;  1V58 A;  5FWG A;  2VCZ A;  2N5F A;  1NHO A;  4KA0 A;  2QKE A;  2HZE A;  2HSM A;  1T8E B;  2AHE A;  5HR1 A;  3RPP A;  4EF0 A;  2ZUP A;  1Y6E A;  5HQP A;  3KH9 A;  3BOA A;  3UJ1 A;  2C8U A;  5D9V A;  5DCG A;  5KOW A;  2MZC A;  2WB9 A;  5IM9 A;  2C80 A;  4BVX A;  4MPF A;  3ED3 A;  4Z7X A;  2WDU A;  2L4C A;  4WET A;  5G1K A;  2E2M A;  2IMK A;  1HNB A;  2YWI A;  4TXV A;  1CQH A;  4F0B A;  3TUE A;  3HJO A;  4YKG A;  1GSE A;  4HI7 A;  2VD1 A;  1C72 A;  2C3Q A;  2VL2 A;  3CTG A;  4NWY A;  3G7Y A;  4TR4 A;  2KUC A;  4HEA 2;  3R3E A;  1XXU A;  1TRU A;  3RHB A;  2GT5 A;  2X8C A;  2LEG A;  2FUG 2;  1GNE A;  1F9M A;  3FMW A;  4D73 B;  3Q19 A;  5DJM A;  3EUR A;  2LJA A;  4IBP A;  3J7Y k;  2VL3 A;  4HS1 A;  2PVQ A;  4MCU A;  1EGR A;  1M9A A;  3C71 A;  5F06 A;  3PIN A;  1X5C A;  4BVY A;  2LTK A;  4I8B A;  1SU9 A;  4OWY A;  2RM6 A;  4ZB8 A;  1EEM A;  3EE2 A;  3GHA A;  4ZBD A;  3DEX A;  2R2J A;  2A2P A;  4PTS A;  3WT2 A;  4ULX A;  3TKR A;  1SKR B;  3JCM L;  1VGL A;  2ZNM A;  5EVO A;  1H75 A;  3UBK A;  4XS4 B;  1FHE A;  1A0F A;  3F8U A;  5J5N A;  2V32 A;  3KTL A;  2YV9 A;  3MYD A;  1TK8 B;  1DBY A;  2H19 A;  2H71 A;  3TKS A;  2IJY A;  4CDO A;  3D6I A;  2MMO A;  3GV1 A;  4EE0 A;  1HYU A;  2K9F A;  4MAB A;  3DGQ A;  5DAL B;  5AIX A;  4JED A;  4JR6 A;  1SL0 B;  1URM A;  1TK5 B;  1A8L A;  1TXX A;  3E9J B;  4IN0 A;  3QCP A;  1YQ1 A;  1PN0 A;  4POM A;  3BCK A;  5CRE A;  4Q5N A;  5HFG A;  2ON5 A;  4LL4 B;  1JHB A;  2AV4 A;  5D9X A;  3F6F A;  5L71 A;  1J0F A;  1O81 A;  3GKK A;  2F3M A;  1PKZ A;  1DUG A;  3LYK A;  4YH2 A;  1BAY A;  2X64 A;  4WF4 A;  3BD2 A;  4ML6 A;  5D9W A;  2P0G A;  1GUL A;  2QSI A;  2VCV A;  3KH7 A;  4L0U A;  5CRW A;  3US3 A;  5IIZ A;  4TR1 B;  4YQM A;  5ECL B;  3KXO A;  2VM1 A;  1PFO A;  4EVM A;  4YAP A;  1J08 A;  2NDO A;  5JCW A;  1H4O A;  2C3T A;  4DSS B;  1A23 A;  1OKT A;  1GP1 A;  1GUK A;  3ZMK A;  1B9Y C;  1Z6M A;  2LS5 A;  1YEP A;  1JZD A;  2DSA A;  4MZW A;  1U6T A;  1MEK A;  4CY8 A;  4F9Z A;  2L4Q A;  3AY8 A;  1X5E A;  4K5R A;  2PER A;  1O8X A;  4MLY A;  2LKU A;  2YWO A;  2VL2 C;  4PGT A;  3MSZ A;  2C0F A;  4RI7 A;  5E59 A;  2R37 A;  3LSZ A;  5IMV A;  4GQF A;  4GTU A;  1XOB A;  2UZ8 A;  2PN8 A;  1BG5 A;  3UL3 A;  1N8J A;  3O3T A;  4RQX A;  1PX7 A;  1AC1 A;  2B1L A;  4PQH A;  5ECQ B;  5HFI A;  2F51 A;  2TRX A;  4WBJ A;  2JZR A;  4MJC A;  2IME A;  1K0A A;  1GSQ A;  2C0E A;  4ZBA A;  2H75 A;  3QMX A;  2HRK A;  2GQM A;  5DQS A;  1S3D A;  2VCQ A;  5B8A A;  3EWL A;  1KNG A;  1JLV A;  5IMC A;  3ZIT A;  4ZB9 A;  2H1D A;  5DAK A;  4PNG A;  1JZR A;  1R26 A;  3A2V A;  3FZ5 A;  4ZL9 A;  3GL5 A;  2HE3 A;  3IR4 A;  1KEB A;  1M9B A;  5DQY A;  4BWQ A;  3DXB A;  2R6K A;  3FR6 A;  3U6V A;  1XW5 A;  4ECB A;  3UVT A;  2FLS A;  2CAI A;  6GSV A;  2V6O A;  4EDY A;  3E0U A;  4K9Z A;  5GSS A;  4F2I A;  1V2A A;  1G0T A;  2WGR A;  3UVH A;  1GTA A;  2HRN A;  3ZL5 A;  1EZK A;  2RLI A;  3VK9 A;  1TI3 A;  3ERW A;  1TI1 A;  2AYT A;  4WBR D;  5HR2 A;  2L5O A;  5G5F A;  2CX3 A;  1HNA A;  3KJY A;  2OBK A;  1OC9 B;  1ZGN A;  4IJI A;  2HSY A;  3CQF A;  1THX A;  3J7Y b;  3CBU A;  3RHC A;  2AJQ B;  2DJ1 A;  2XBQ A;  4MF6 A;  3OR5 A;  2JL4 A;  1PMT A;  3EYT A;  4OFT A;  2YAN A;  3CRU A;  5AN1 A;  1E2Y A;  5JWQ B;  4AF2 A;  4ECI A;  1OYJ A;  5INY A;  2LRN A;  5BMU A;  4XCS A;  1ZYE A;  5DJL A;  9GSS A;  1AUC A;  4KB3 A;  1TK0 B;  4NV2 A;  5KN0 A;  3FW2 A;  3H79 A;  2H66 A;  2DMM A;  1G7O A;  1JLW A;  1ABA A;  3C8E A;  4IQ1 A;  5ID2 B;  2DJJ A;  3VWW A;  1GLQ A;  1ERU A;  1XVQ A;  2VM2 A;  3APQ A;  2TRC P;  3FKF A;  1U88 A;  3L78 A;  2HRF A;  2JZS A;  3UBL A;  4RQR A;  2ON7 A;  4BA7 A;  4CW9 A;  4O5Q A;  5G5E A;  1EEJ A;  2ALB A;  2AAW A;  2R0P A;  4NHZ A;  4TW5 A;  4POB A;  2O8V B;  2WRT A;  1GH2 A;  4I97 A;  1UC7 A;  3HZ4 A;  2K8S A;  1XFL A;  2H72 A;  3TOT A;  1FB6 A;  4G0I A;  4F82 A;  4QL9 A;  3D4M A;  4XTS A;  4F0C A;  3GIX A;  4ZB6 A;  1SKW B;  1XVW A;  5ECN B;  4G9H A;  2E0Q A;  3IV4 A;  2WFC A;  2JSY A;  1G7E A;  3UMA A;  2J9H A;  3M3M A;  2X8H A;  3VI5 A;  2FWG A;  4HZ2 A;  3GTU A;  5ELG A;  1OC3 A;  4JR4 A;  4CHS A;  1M7T A;  1QGV A;  4ZIJ A;  1PD2 1;  4KDU A;  5H5Q A;  3IAS 2;  1OVN A;  3GNJ A;  2YV7 A;  3F4T A;  3R2Q A;  1XZO A;  2VD0 A;  1GLP A;  3IK7 A;  2R4V A;  1IYH A;  3H4K A;  4KX4 A;  3D4T A;  3HVV A;  3IC8 A;  3LXT A;  1TU7 A;  2DIY A;  1YDK A;  1Q98 A;  3RAZ A;  2IFQ B;  1B8X A;  1KTE A;  2GST A;  3A5W A;  4X43 A;  3VWU A;  5G1L A;  4NMU A;  4IGJ A;  4BIK A;  4OCE A;  3ERF A;  3QAG A;  3VWX A;  2H0H A;  4J57 E;  5H5S A;  1FO5 A;  1PSQ A;  1ZCP A;  2RUF A;  1XPV A;  17GS A;  3L9V A;  1V57 A;  2HLS A;  2PBJ A;  1JZW A;  2YOI A;  1XWG A;  4HSC X;  1EV9 A;  2C1Y A;  5CNW A;  1F3B A;  1Z6N A;  2MBT A;  2TIR A;  3QFB C;  5GZZ B;  2D2Z A;  1K0B A;  3DIE A;  3M0F A;  12GS A;  3HZ8 A;  5KOX A;  4YKF A;  2XBI A;  2FA4 A;  3GX8 A;  4ACS A;  2CZ2 A;  1Z5Y E;  2KP1 A;  2X8G A;  1XBS A;  5CRD A;  1R5A A;  3EC3 A;  2H1A A;  3WYW A;  1QXH A;  3IDV A;  3FHK A;  1XCC A;  2IL3 A;  4IP6 A;  2B5Y A;  1PN9 A;  2CAQ A;  5J3R A;  3FRC A;  4OD7 A;  1T4Y A;  3PGT A;  2B7J A;  2E7P A;  3NOF A;  3ZYW A;  1Z7P A;  1GSD A;  1ZL9 A;  4BL7 B;  5DDL A;  4XS1 A;  4WR5 A;  4EUY A;  2BJX A;  3LWA A;  4V1A p;  2H1B A;  3F4S A;  2REM A;  4GSN A;  2VLU A;  4KND A;  3ZVJ D;  10GS A;  3TCO A;  4GQC A;  1G6Y A;  2R5G A;  2OA7 A;  2LRT A;  2GVP A;  2PWJ A;  4LLR A;  2HNL A;  4L5O A;  1Z7R A;  4E8H A;  2O89 A;  1Z3E A;  2LQQ A;  3U5R E;  2HZE B;  5ELA A;  2F8A A;  4HU9 A;  2A4V A;  1BX9 A;  1M3J A;  1WPI A;  1N2A A;  2NVL A;  4KUN A;  1SJ6 A;  2ES7 A;  1XG8 A;  2H70 A;  3C7M A;  2NBS A;  4BVX B;  3UAP A;  5B8B A;  4BWS A;  2CV4 A;  2FWE A;  3DD3 A;  3WD6 A;  3ZVJ A;  1FOH A;  4GRF A;  5GAN D;  1SK1 A;  3ME8 A;  4NHW A;  4USS A;  3VPQ A;  3Q18 A;  5IPH A;  4V1A g;  3MNG A;  1BYE A;  2LST A;  1MDK A;  1GTI A;  3DKS A;  1TTZ A;  3H93 A;  1V98 A;  1GUH A;  3CTF A;  5ECP B;  5D73 A;  2EC4 A;  1T7P B;  4KCA A;  4ECJ A;  2OAD A;  3L4N A;  2HT9 A;  4KSO A;  3ZRE A;  1B48 A;  5BRT A;  4POL A;  1ACV A;  1ERV A;  5AIS A;  2GDR A;  5IMA A;  2CVD A;  4K8M A;  3GFK A;  2KLX A;  2FNO A;  3QR6 A;  5LD0 A;  4Z2R A;  2OKA A;  4XRA A;  1CQG A;  1ZMA A;  3I69 A;  4KE3 A;  1T1V A;  3HD5 A;  1BQ7 A;  2VLV A;  3KD0 A;  4FH8 A;  4MF7 A;  3VPT A;  3RBT A;  4EIP A;  4PNF A;  4BVY B;  3HA9 A;  3P7X A;  2CA8 A;  1WP0 A;  2HI7 A;  3KP9 A;  1F37 A;  4MZB A;  1KBN A;  4JZQ A;  5DCH A;  4CY6 A;  2VO4 A;  5F05 A;  2CX4 A;  2HRA A;  3F9U A;  3WGD A;  1K0O A;  3A3T A;  5IMZ A;  1FG4 A;  1VF2 A;  2PPT A;  1J9B A;  1NSW A;  3GH6 A;  5ECK B;  4J56 E;  1R5P A;  4IHU A;  2AB6 A;  3Q6O A;  4L5L A;  4IVF A;  4YAV A;  2DLX A;  1FOV A;  2BMX A;  2PMT A;  4GCI A;  2VAF A;  5F07 A;  1DE1 A;  2PVO C;  5F0G A;  5C04 A;  4MPG A;  1K3Y A;  2MYG A;  1ZYN A;  3FZ4 A;  2PUK C;  2K6V A;  1BED A;  1XW6 A;  3P90 A;  2VCW A;  4OO5 A;  3KIJ A;  1AQV A;  4NPB A;  2I81 A;  4KF9 A;  2YN1 A;  4DEJ A;  4ZBB A;  1ST9 A;  3W8J A;  3N5O A;  3KM6 A;  2P5R A;  4MP4 A;  3F3R A;  1G6W A;  4K0N A;  2L57 A;  2RII A;  1RQM A;  2H73 A;  5KEJ A;  2DJ2 A;  3IA1 A;  2DIZ A;  1FVK A;  4X0X A;  1Q4J A;  2N5B A;  5ECR B;  1E6B A;  1MDJ A;  4WR4 A;  1MTC A;  1PQN A;  1B4P A;  4FO5 A;  4PUF C;  3HHV A;  4PUR A;  2R0G A;  1LBK A;  3BJ5 A;  1ERW A;  4Z2U A;  1GUM A;  3DVX A;  3EMX A;  2FGX A;  2JSZ A;  5JWO B;  1JFU A;  3TRX A;  3EPT A;  2V2G A;  4XHM A;  4GXZ A;  5COH A;  3HJM A;  1YEX A;  3PH9 A;  2GQK A;  1AAZ A;  1PGT A;  2DML A;  2KP2 A;  3CRT A;  1SJZ A;  2A4H A;  3ZFB A;  1YY7 A;  1WJK A;  3IHG A;  3FR9 A;  3BBY A;  3EU4 A;  2MMN A;  3GUS A;  4PUA A;  3DYR A;  3TKQ A;  3CXG A;  4AJ6 A;  4G10 A;  4L0W A;  2GZY A;  1GTB A;  1AIU A;  4V2M A;  5AGY A;  4MJE A;  3NZN A;  1WOU A;  1TOF A;  4KGI A;  4E8E A;  6GSU A;  2IMD A;  3A2W A;  1UA5 A;  2CT6 A;  4XRD A;  4JU5 A;  2I3Y A;  1M3I A;  3QAV A;  4F03 A;  1ZYQ B;  3FEU A;  5HR3 A;  2H30 A;  4NV5 A;  1T4Z A;  4GSS A;  5DAK B;  3IAM 2;  4JE1 A;  1GSU A;  3W8S A;  4J2F A;  1LJR A;  2G2Q A;  4TXO A;  1SK2 A;  3CMI A;  3FZA A;  1K0M A;  1XWA A;  3IC4 A;  2DKI A;  2I1U A;  1Z9H A;  3TJF A;  3IOS A;  6GSY A;  2RM5 A;  1QMV A;  5ECI B;  4XS6 A;  1X9W B;  4HU7 A;  3N9J A;  1TRV A;  5CAX A;  2XPE A;  2GZP A;  4GLT A;  3FR3 A;  1I5G A;  3O6T A;  3QAW A;  4N11 A;  2MBS A;  3KMO A;  2L6C A;  3W6G A;  3QPM A;  4K7O A;  4XIH A;  2JAD A;  4LMV A;  3TRP A;  4ZIL A;  1FAA A;  3E3E A;  3GL3 A;  1AQX A;  3FK8 A;  2H6X A;  4N10 A;  4POK A;  5KN3 A;  4FYU A;  1ON4 A;  1AW9 A;  3HKR A;  2XHF A;  1QQ2 A;  1T3B A;  4IP1 A;  1TW9 A;  1FVJ A;  13GS A;  4KDY A;  5LCZ A;  4X1U A;  2HYX A;  3G7I A;  1K0C A;  1GTU A;  11GS A;  2LUS A;  1YKC A;  3M9J A;  4WKW A;  5FT3 A;  4JRR A;  2OE0 A;  2LRC A;  1K0D A;  1MDI A;  3V1W A;  3C1S A;  5IOX A;  1XIY A;  4ILF A;  1VF1 A;  2DJ3 A;  5D8I A;  4LA1 A;  2IMF A;  3LQ7 A;  3ERG A;  5IO0 A;  3I9V 2;  2VOC A;  4MZC A;  1TKD B;  6GSS A;  1PX6 A;  4ISD A;  2I9H A;  3K8N A;  1V9W A;  1OC8 A;  2CVB A;  4NXI A;  1PA3 A;  3F6D A;  4TKY A;  4MK3 A;  5ABR A;  3F3Q A;  1EOG A;  4Q5Q A;  2IPA A;  3D5J A;  4HQZ A;  3HY2 A;  4A5P A;  4V2N A;  2NTO A;  3UAR A;  2N5A A;  5IQY A;  5DVB A;  4TR0 A;  4ZL8 A;  2LNT A;  4I5Q A;  2FWH A;  5CRH A;  1WIK A;  3FZ9 A;  2QA2 A;  4GF0 A;  1S3R A;  3TKS E;  1V40 A;  5H5R A;  2FD3 A;  3G9B A;  3VLN A;  5ECH B;  1X5D A;  1EV4 A;  1IYI A;  5HR0 A;  4V2L A;  2VCX A;  1A2J A;  2WS2 A;  2XPD A;  4OCF A;  3L9S A;  5D93 A;  2HZF A;  3QFA C;  2M80 A;  2LJK A;  3SBC A;  3H1N A;  2NPB A;  5KN2 A;  2C0G A;  2H0G A;  4IJ3 A;  1TJD A;  2EIQ A;  2EIO A;  4N0Z A;  2H6Y A;  1PL2 A;  3ZRD A;  3IPZ A;  1HQO A;  3PR8 A;  4O5R A;  2CZ3 A;  1OKD A;  1S3C A;  3DWV A;  2DJ0 A;  16GS A;  3D21 A;  3EU3 A;  4JBB A;  1OE8 A;  4NAX A;  1VF4 A;  14GS A;  2JU5 A;  4AGS A;  3GKM A;  3ZML A;  4K0G A;  2P5Q A;  4BPY A;  2GSS A;  4K7I A;  2WZ9 A;  5F8B A;  2PU9 C;  2FCH A;  1PKW A;  5CRG A;  5G30 A;  1A0R P;  4EL1 A;  3VUR A;  4FYB A;  1BJX A;  8GSS A;  5J9B A;  4IEL A;  5A5K A;  3NIV A;  1TU8 A;  4K6X A;  5J4U A;  2GS3 A;  3LXZ A;  3IHQ A;  3L9U A;  4ML1 A;  3F63 A;  1SYR A;  3DML A;  3ZIJ A;  3C73 A;  1VRS D;  3LJR A;  3ME7 A;  4GWR A;  3UEM A;  3IRA A;  4K2X A;  1MD4 A;  3DRN A;  4O92 A;  3C1R A;  1SYX A;  2M72 A;  1MD3 A;  2B3S A;  2DC5 A;  4HZ4 A;  2K18 A;  1XWK A;  1GSS A;  1A24 A;  1X0R A;  5ENU A;  3IBH A;  3GN3 A;  1K0N A;  4QQ7 A;  2I4A A;  4AJ8 A;  1FB0 A;  4D73 A;  1WRY A;  5ECO B;  2ZCT A;  3LFL A;  4EKZ A;  1HNC A;  1F6M C;  2LJR A;  19GS A;  1XOA A;  4O5U A;  3M9K A;  2K8V A;  5KN1 A;  2V41 A;  1DSB A;  4TN8 A;  1SJI A;  2B7K A;  2L5L A;  3GRX A;  4Q5R A;  4MF5 A;  1AXD A;  2IIY A;  2V6K A;  4XS4 A;  4Z2T A;  2A2R A;  5G2Z A;  5J41 A;  1I9D A;  4WXT A;  4K7N A;  1LU4 A;  1B9X C;  2R0C A;  2VUP A;  2FA8 A;  2GTU A;  3PPU A;  1M2B A;  2DBC A;  1NM3 A;  6GSX A;  5DAL A;  4G19 A;  4OO4 A;  2IN3 A;  1U3A A;  4MA9 A;  3CSI A;  3LOR A;  20GS A;  3P2A A;  1XWC A;  1M2A A;  2DKH A;  3MIX A;  1EOH A;  2DJK A;  1GSF A;  3TJK A;  2M46 A;  1M99 A;  3GST A;  1T00 A;  1K3O A;  1XWB A;  3IK9 A;  1TDI A;  1X9S B;  1X9M B;  1XW9 A;  1A2L A;  1R4W A;  3F0I A;  4TR1 A;  1THO A;  2QA1 A;  3ZIV A;  4DSS A;  3QD9 A;  1NHY A;  5DBQ A;  1YKA A;  3I43 A;  5AIV A;  1EP8 A;  2RUE A;  2F9S A;  2FWF A;  2H01 A;  5JCU A;  2YJH A;  2YCD A;  3VFI A;  3DVW A;  3GH9 A;  2C3N A;  3TDG A;  4DSR A;  2YJ7 A;  4ID0 A;  1WE0 A;  3HVN A;  1TP9 A;  4RUV A;  3QOU A;  4HJ2 A;  3LG6 A;  2LQO A;  4OMV A;  4QL7 A;  2X4A A;  2IMI A;  3BCI A;  4PQI A;  4HJM A;  1UN2 A;  2OE1 A;  3WGE A;  2H8L A;  3HVS A;  2JZT A;  1QK8 A;  5GST A;  1FW1 A;  1QFN A;  4ZXG A;  4O32 A;  1RK4 A;  3HJP A;  2B5E A;  1GNW A;  5CYY A;  2H0I A;  2H6Z A;  5LNK e;  2YPM A;  2YZU A;  2A2S A;  3M8N A;  1UVZ A;  5JCG A;  2GZZ A;  4TVE A;  4PQ1 A;  5ECM B;  2X49 A;  5A4U A;  1ZYP A;  1R7H A;  1WWJ A;  18GS A;  3MWH A;  3IE3 A;  4FQU A;  3UOM A;  4GST A;  4EIQ A;  1PRX A;  4YQU A;  1YJ6 A;  4PXO A;  3KZQ A;  2FY6 A;  2GT6 A;  4IKH A;  1ERT A;  3IXR A;  3GX0 A;  5A4W A;  1YF1 A;  4EXJ A;  4MH3 A;  5C00 A;  4IS0 A;  2YZH A;  5ECS A;  2L59 A;  3GUR A;  3ZZX A;  3HCZ A;  5D96 A;  4ECC A;  4KH7 A;  4I6X A;  4WF5 A;  2CVK A;  3TJB A;  1NW2 A;  3H8Q A;  2Z9S A;  3VI7 A;  2GSQ A;  5IO2 A;  4RI6 A;  2WCI A;  1EGO A;  5IMD A;  4MJA A;  3RDW A;  1GSY A;  2GSR A;  5B6M A;  1ZZY A;  3HXS A;  22GS A;  4Q5F A;  1RW1 A;  2BTO T;  2PGT A;  3GMF A;  1O8W A;  5GAP D;  4X4J A;  3TKS C;  2OE3 A;  2VL9 A;  4LMW A;  3TRQ A;  1Y25 A;  2GQL A;  1M0U A;  4O7H A;  1GL8 A;  4K2D A;  5J9C A;  4IQA A;  1A2M A;  3APS A;  4MJB A;  1OC9 A;  2O87 A;  4H86 A;  2V1M A;  4YQV A;  1SL2 B;  1USB A;  4P3Y B;  4HDE A;  2GGT A;  5JWR B;  4HQS A;  3D22 A;  4LL1 B;  3GSS A;  2J23 A;  2LNS A;  5D9T A;  3S9F A;  3EVI A;  2JAC A;  1OAZ A;  2C4J A;  2WJU A;  3M1G A;  4HUA A;  3GKN A;  3A5I A;  3Q74 A;  2OAC A;  6GST A;  3F4R A;  3O76 A;  4WEY A;  5G31 A;  5E4W A;  2LV3 A;  2WUL A;  1SL1 B;  3EIN A;  1S3A A;  2B5X A;  2MMA A;  1SD8 A;  5ID2 A;  3KP8 A;  4MDC A;  4TXO B;  5B7C A;  3KCM A;  2YP6 A;  1PL1 A;  4TRX A;  2OBI A;  3FY7 A;  5FHI A;  2KOK A;  1F3A A;  4G0L A;  7GSS A;  1ZOF A;  4MH2 A;  4I2U A;  1TRS A;  4OFN A;  4KDX A;  2MMZ A;  1OE7 A;  4MNN A;  5B6N A;  3UIW A;  2HXK A;  3LYP A;  1O7U A;  4G2E A;  3QDN A;  2EIR A;  3KGK A;  3ZTL A;  5CP1 A;  3WGX A;  1VF3 A;  3WT1 A;  2O85 A;  2H1G A;  3LEF A;  2C0D A;  3CYN A;  1K3L A;  1SEN A;  1SD9 A;  2VCT A;  3I6A A;  4IW9 A;  2QGV A;  6GSW A;  3EMP A;  3TGZ A;  2GLR A;  5HFK A;  2YNX A;  3MAK A;  1WMJ A;  1GWC A;  1M2D A;  3ZFL A;  1QUW A;  1GRX A;  4G0K A;  2B1K A;  2R3X A;  1YF0 A;  4I2T A;  4EO3 A;  3APO A;  4KSM A;  2YWM A;  1U87 A;  3HDC A;  3MDK A;  4N0V A;  1O73 A;  1EWX A;  1A8Y A;  4PX1 A;  4K5S A;  2XC2 A;  4N30 A;  2IFQ A;  5IMF A;  4OFM A;  3HYP A;  1SKS B;  1EP7 A;  2CQ9 A;  5EPF A;  4AJ7 A;  2VLT A;  2QC7 A;  4ICY A;  2B6M A;  2HSH A;  2X99 A;  3KEB A;  3GTU B;  3ISO A;  5EY6 A;  1TRW A;  1SK0 A;  2AUV A;  3TJG A;  3P8W A;  3L0H A;  1ILO A;  4KAE A;  4EC0 A;  3ZLP A;  3LW9 A;  2H76 A;  3HVX A;  2VIM A;  4KW6 A;  1DE2 A;  4FYC A;  3A2X A;  3CSH A;  5IPG A;  1W4V A;  1U3I A;  4DSQ A;  1HD2 A;  5A4V A;  4MMM A;  3FYG A;  4K1F A;  1W89 A;  2P31 A;  1ML6 A;  5IOW A;  4HOJ A;  4ZL7 A;  1F2E A;  2E2G A;  2O7K A;  4TR3 A;  4DVC A;  3CSJ A;  4KCE A;  3SWL A; 
#chains in the Genus database with same CATH homology
 3GKX A;  2FHE A;  2KHP A;  4EDZ A;  2G0F A;  3GYK A;  3LGC A;  2H74 A;  2HFD A;  3TOU A;  3KTB A;  3TKP A;  5EL8 A;  3GA4 A;  2OJL A;  3TJJ A;  3G7J A;  4L8E A;  1O85 A;  1O6J A;  4BL7 A;  4TOP A;  2L6D A;  1B4Q A;  3TB2 A;  1JZO A;  3VWV A;  3D0Z A;  2IWT A;  3RPN A;  2YWN A;  3KMN A;  5CO3 A;  1AQW A;  4FIW A;  1YZX A;  2F8F A;  1V58 A;  5FWG A;  2VCZ A;  2N5F A;  1NHO A;  4KA0 A;  2QKE A;  2HZE A;  2HSM A;  1T8E B;  2AHE A;  5HR1 A;  3RPP A;  4EF0 A;  2ZUP A;  1Y6E A;  5HQP A;  3KH9 A;  3BOA A;  3UJ1 A;  2C8U A;  5D9V A;  5DCG A;  5KOW A;  2MZC A;  2WB9 A;  5IM9 A;  2C80 A;  4BVX A;  4MPF A;  3ED3 A;  4Z7X A;  2WDU A;  2L4C A;  4WET A;  5G1K A;  2E2M A;  2IMK A;  1HNB A;  2YWI A;  4TXV A;  1CQH A;  4F0B A;  3TUE A;  3HJO A;  4YKG A;  1GSE A;  4HI7 A;  2VD1 A;  1C72 A;  2C3Q A;  2VL2 A;  3CTG A;  4NWY A;  3G7Y A;  4TR4 A;  2KUC A;  4HEA 2;  3R3E A;  1XXU A;  1TRU A;  3RHB A;  2GT5 A;  2X8C A;  2LEG A;  2FUG 2;  1GNE A;  1F9M A;  3FMW A;  4D73 B;  3Q19 A;  5DJM A;  3EUR A;  2LJA A;  4IBP A;  3J7Y k;  2VL3 A;  4HS1 A;  2PVQ A;  4MCU A;  1EGR A;  1M9A A;  3C71 A;  5F06 A;  3PIN A;  1X5C A;  4BVY A;  2LTK A;  4I8B A;  1SU9 A;  4OWY A;  2RM6 A;  4ZB8 A;  1EEM A;  3EE2 A;  3GHA A;  4ZBD A;  3DEX A;  2R2J A;  2A2P A;  4PTS A;  3WT2 A;  4ULX A;  3TKR A;  1SKR B;  3JCM L;  1VGL A;  2ZNM A;  5EVO A;  1H75 A;  3UBK A;  4XS4 B;  1FHE A;  1A0F A;  3F8U A;  5J5N A;  2V32 A;  3KTL A;  2YV9 A;  3MYD A;  1TK8 B;  1DBY A;  2H19 A;  2H71 A;  3TKS A;  2IJY A;  4CDO A;  3D6I A;  2MMO A;  3GV1 A;  4EE0 A;  1HYU A;  2K9F A;  4MAB A;  3DGQ A;  5DAL B;  5AIX A;  4JED A;  4JR6 A;  1SL0 B;  1URM A;  1TK5 B;  1A8L A;  1TXX A;  3E9J B;  4IN0 A;  3QCP A;  1YQ1 A;  1PN0 A;  4POM A;  3BCK A;  5CRE A;  4Q5N A;  5HFG A;  2ON5 A;  4LL4 B;  1JHB A;  2AV4 A;  5D9X A;  3F6F A;  5L71 A;  1J0F A;  1O81 A;  3GKK A;  2F3M A;  1PKZ A;  1DUG A;  3LYK A;  4YH2 A;  1BAY A;  2X64 A;  4WF4 A;  3BD2 A;  4ML6 A;  5D9W A;  2P0G A;  1GUL A;  2QSI A;  2VCV A;  3KH7 A;  4L0U A;  5CRW A;  3US3 A;  5IIZ A;  4TR1 B;  4YQM A;  5ECL B;  3KXO A;  2VM1 A;  4EVM A;  4YAP A;  1J08 A;  2NDO A;  5JCW A;  1H4O A;  2C3T A;  4DSS B;  1A23 A;  1OKT A;  1GP1 A;  1GUK A;  3ZMK A;  1B9Y C;  1Z6M A;  2LS5 A;  1YEP A;  1JZD A;  2DSA A;  4MZW A;  1U6T A;  1MEK A;  4CY8 A;  4F9Z A;  2L4Q A;  3AY8 A;  1X5E A;  4K5R A;  2PER A;  1O8X A;  4MLY A;  2LKU A;  2YWO A;  2VL2 C;  4PGT A;  3MSZ A;  2C0F A;  4RI7 A;  5E59 A;  2R37 A;  3LSZ A;  5IMV A;  4GQF A;  4GTU A;  1XOB A;  2UZ8 A;  2PN8 A;  1BG5 A;  3UL3 A;  1N8J A;  3O3T A;  4RQX A;  1PX7 A;  1AC1 A;  2B1L A;  4PQH A;  5ECQ B;  5HFI A;  2F51 A;  2TRX A;  4WBJ A;  2JZR A;  4MJC A;  2IME A;  1K0A A;  1GSQ A;  2C0E A;  4ZBA A;  2H75 A;  3QMX A;  2HRK A;  2GQM A;  5DQS A;  1S3D A;  2VCQ A;  5B8A A;  3EWL A;  1KNG A;  1JLV A;  5IMC A;  3ZIT A;  4ZB9 A;  2H1D A;  5DAK A;  4PNG A;  1JZR A;  1R26 A;  3A2V A;  3FZ5 A;  4ZL9 A;  3GL5 A;  2HE3 A;  3IR4 A;  1KEB A;  1M9B A;  5DQY A;  4BWQ A;  3DXB A;  2R6K A;  3FR6 A;  3U6V A;  1XW5 A;  4ECB A;  3UVT A;  2FLS A;  2CAI A;  6GSV A;  2V6O A;  4EDY A;  3E0U A;  4K9Z A;  5GSS A;  4F2I A;  1V2A A;  1G0T A;  2WGR A;  3UVH A;  1GTA A;  2HRN A;  3ZL5 A;  1EZK A;  2RLI A;  3VK9 A;  1TI3 A;  3ERW A;  1TI1 A;  2AYT A;  4WBR D;  5HR2 A;  2L5O A;  5G5F A;  2CX3 A;  1HNA A;  3KJY A;  2OBK A;  1OC9 B;  1ZGN A;  4IJI A;  2HSY A;  1THX A;  3J7Y b;  3CBU A;  3RHC A;  2AJQ B;  2DJ1 A;  2XBQ A;  4MF6 A;  3OR5 A;  2JL4 A;  1PMT A;  3EYT A;  4OFT A;  2YAN A;  3CRU A;  5AN1 A;  1E2Y A;  5JWQ B;  4AF2 A;  4ECI A;  1OYJ A;  5INY A;  2LRN A;  5BMU A;  4XCS A;  1ZYE A;  5DJL A;  9GSS A;  1AUC A;  4KB3 A;  1TK0 B;  4NV2 A;  5KN0 A;  3FW2 A;  3H79 A;  2H66 A;  2DMM A;  1G7O A;  1JLW A;  1ABA A;  3C8E A;  4IQ1 A;  5ID2 B;  2DJJ A;  3VWW A;  1GLQ A;  1ERU A;  1XVQ A;  2VM2 A;  3APQ A;  2TRC P;  3FKF A;  1U88 A;  3L78 A;  2HRF A;  2JZS A;  3UBL A;  4RQR A;  2ON7 A;  4BA7 A;  4CW9 A;  4O5Q A;  5G5E A;  1EEJ A;  2ALB A;  2AAW A;  2R0P A;  4NHZ A;  4TW5 A;  4POB A;  2O8V B;  2WRT A;  1GH2 A;  4I97 A;  1UC7 A;  3HZ4 A;  2K8S A;  1XFL A;  2H72 A;  3TOT A;  1FB6 A;  4G0I A;  4F82 A;  4QL9 A;  3D4M A;  4XTS A;  4F0C A;  3GIX A;  4ZB6 A;  1SKW B;  1XVW A;  5ECN B;  4G9H A;  2E0Q A;  3IV4 A;  2WFC A;  2JSY A;  1G7E A;  3UMA A;  2J9H A;  3M3M A;  2X8H A;  3VI5 A;  2FWG A;  4HZ2 A;  3GTU A;  5ELG A;  1OC3 A;  4JR4 A;  4CHS A;  1M7T A;  1QGV A;  4ZIJ A;  1PD2 1;  4KDU A;  5H5Q A;  3IAS 2;  1OVN A;  3GNJ A;  2YV7 A;  3F4T A;  3R2Q A;  1XZO A;  2VD0 A;  1GLP A;  3IK7 A;  2R4V A;  1IYH A;  3H4K A;  4KX4 A;  3D4T A;  3HVV A;  3IC8 A;  3LXT A;  1TU7 A;  2DIY A;  1YDK A;  1Q98 A;  3RAZ A;  2IFQ B;  1B8X A;  1KTE A;  2GST A;  3A5W A;  4X43 A;  3VWU A;  5G1L A;  4NMU A;  4IGJ A;  4OCE A;  3ERF A;  3QAG A;  3VWX A;  2H0H A;  4J57 E;  5H5S A;  1FO5 A;  1PSQ A;  1ZCP A;  2RUF A;  1XPV A;  17GS A;  3L9V A;  1V57 A;  2HLS A;  2PBJ A;  1JZW A;  2YOI A;  1XWG A;  1EV9 A;  2C1Y A;  5CNW A;  1F3B A;  1Z6N A;  2MBT A;  2TIR A;  3QFB C;  5GZZ B;  2D2Z A;  1K0B A;  3DIE A;  3M0F A;  12GS A;  3HZ8 A;  5KOX A;  4YKF A;  2XBI A;  2FA4 A;  3GX8 A;  4ACS A;  2CZ2 A;  1Z5Y E;  2KP1 A;  2X8G A;  1XBS A;  5CRD A;  1R5A A;  3EC3 A;  2H1A A;  3WYW A;  1QXH A;  3IDV A;  3FHK A;  1XCC A;  2IL3 A;  4IP6 A;  2B5Y A;  1PN9 A;  2CAQ A;  5J3R A;  3FRC A;  4OD7 A;  1T4Y A;  3PGT A;  2B7J A;  2E7P A;  3NOF A;  3ZYW A;  1Z7P A;  1GSD A;  1ZL9 A;  4BL7 B;  5DDL A;  4XS1 A;  4WR5 A;  4EUY A;  2BJX A;  3LWA A;  4V1A p;  2H1B A;  3F4S A;  2REM A;  4GSN A;  2VLU A;  4KND A;  3ZVJ D;  10GS A;  3TCO A;  4GQC A;  1G6Y A;  2R5G A;  2OA7 A;  2LRT A;  2GVP A;  2PWJ A;  4LLR A;  2HNL A;  4L5O A;  1Z7R A;  4E8H A;  2O89 A;  1Z3E A;  2LQQ A;  3U5R E;  2HZE B;  5ELA A;  2F8A A;  4HU9 A;  2A4V A;  1BX9 A;  1WPI A;  1N2A A;  2NVL A;  4KUN A;  1SJ6 A;  2ES7 A;  2H70 A;  3C7M A;  2NBS A;  4BVX B;  3UAP A;  5B8B A;  4BWS A;  2CV4 A;  2FWE A;  3DD3 A;  3WD6 A;  3ZVJ A;  1FOH A;  4GRF A;  5GAN D;  1SK1 A;  3ME8 A;  4NHW A;  4USS A;  3VPQ A;  3Q18 A;  5IPH A;  4V1A g;  3MNG A;  1BYE A;  2LST A;  1MDK A;  1GTI A;  3DKS A;  1TTZ A;  3H93 A;  1V98 A;  1GUH A;  3CTF A;  5ECP B;  5D73 A;  2EC4 A;  1T7P B;  4KCA A;  4ECJ A;  2OAD A;  3L4N A;  2HT9 A;  4KSO A;  3ZRE A;  1B48 A;  5BRT A;  4POL A;  1ACV A;  1ERV A;  5AIS A;  2GDR A;  5IMA A;  2CVD A;  4K8M A;  3GFK A;  2KLX A;  2FNO A;  3QR6 A;  5LD0 A;  4Z2R A;  2OKA A;  4XRA A;  1CQG A;  1ZMA A;  3I69 A;  4KE3 A;  1T1V A;  3HD5 A;  1BQ7 A;  2VLV A;  3KD0 A;  4FH8 A;  4MF7 A;  3VPT A;  3RBT A;  4EIP A;  4PNF A;  4BVY B;  3HA9 A;  3P7X A;  2CA8 A;  1WP0 A;  2HI7 A;  3KP9 A;  1F37 A;  4MZB A;  1KBN A;  4JZQ A;  5DCH A;  4CY6 A;  2VO4 A;  5F05 A;  2CX4 A;  2HRA A;  3F9U A;  3WGD A;  1K0O A;  3A3T A;  5IMZ A;  1FG4 A;  1VF2 A;  2PPT A;  1J9B A;  1NSW A;  3GH6 A;  5ECK B;  4J56 E;  1R5P A;  4IHU A;  2AB6 A;  3Q6O A;  4L5L A;  4IVF A;  4YAV A;  2DLX A;  1FOV A;  2BMX A;  2PMT A;  4GCI A;  2VAF A;  5F07 A;  1DE1 A;  2PVO C;  5F0G A;  5C04 A;  4MPG A;  1K3Y A;  2MYG A;  1ZYN A;  3FZ4 A;  2PUK C;  2K6V A;  1BED A;  1XW6 A;  3P90 A;  2VCW A;  4OO5 A;  3KIJ A;  1AQV A;  4NPB A;  2I81 A;  4KF9 A;  2YN1 A;  4DEJ A;  4ZBB A;  1ST9 A;  3W8J A;  3N5O A;  3KM6 A;  2P5R A;  4MP4 A;  3F3R A;  1G6W A;  4K0N A;  2L57 A;  2RII A;  1RQM A;  2H73 A;  5KEJ A;  2DJ2 A;  3IA1 A;  2DIZ A;  1FVK A;  4X0X A;  1Q4J A;  2N5B A;  5ECR B;  1E6B A;  1MDJ A;  4WR4 A;  1MTC A;  1PQN A;  1B4P A;  4FO5 A;  4PUF C;  3HHV A;  4PUR A;  2R0G A;  1LBK A;  3BJ5 A;  1ERW A;  4Z2U A;  1GUM A;  3DVX A;  3EMX A;  2FGX A;  2JSZ A;  5JWO B;  1JFU A;  3TRX A;  3EPT A;  2V2G A;  4XHM A;  4GXZ A;  5COH A;  3HJM A;  1YEX A;  3PH9 A;  2GQK A;  1AAZ A;  1PGT A;  2DML A;  2KP2 A;  3CRT A;  1SJZ A;  2A4H A;  3ZFB A;  1YY7 A;  1WJK A;  3IHG A;  3FR9 A;  3BBY A;  3EU4 A;  2MMN A;  3GUS A;  4PUA A;  3DYR A;  3TKQ A;  3CXG A;  4AJ6 A;  4G10 A;  4L0W A;  2GZY A;  1GTB A;  1AIU A;  4V2M A;  5AGY A;  4MJE A;  3NZN A;  1WOU A;  1TOF A;  4KGI A;  4E8E A;  6GSU A;  2IMD A;  3A2W A;  1UA5 A;  2CT6 A;  4XRD A;  4JU5 A;  2I3Y A;  3QAV A;  4F03 A;  1ZYQ B;  3FEU A;  5HR3 A;  2H30 A;  4NV5 A;  1T4Z A;  4GSS A;  5DAK B;  3IAM 2;  4JE1 A;  1GSU A;  3W8S A;  4J2F A;  1LJR A;  2G2Q A;  4TXO A;  1SK2 A;  3CMI A;  3FZA A;  1K0M A;  1XWA A;  3IC4 A;  2DKI A;  2I1U A;  1Z9H A;  3TJF A;  3IOS A;  6GSY A;  2RM5 A;  1QMV A;  5ECI B;  4XS6 A;  1X9W B;  4HU7 A;  3N9J A;  1TRV A;  5CAX A;  2XPE A;  2GZP A;  4GLT A;  3FR3 A;  1I5G A;  3O6T A;  3QAW A;  4N11 A;  2MBS A;  3KMO A;  2L6C A;  3W6G A;  3QPM A;  4K7O A;  4XIH A;  2JAD A;  4LMV A;  3TRP A;  4ZIL A;  1FAA A;  3E3E A;  3GL3 A;  1AQX A;  3FK8 A;  2H6X A;  4N10 A;  4POK A;  5KN3 A;  4FYU A;  1ON4 A;  1AW9 A;  3HKR A;  2XHF A;  1QQ2 A;  1T3B A;  4IP1 A;  1TW9 A;  1FVJ A;  13GS A;  4KDY A;  5LCZ A;  4X1U A;  2HYX A;  3G7I A;  1K0C A;  1GTU A;  11GS A;  2LUS A;  1YKC A;  3M9J A;  4WKW A;  5FT3 A;  4JRR A;  2OE0 A;  2LRC A;  1K0D A;  1MDI A;  3V1W A;  3C1S A;  5IOX A;  1XIY A;  4ILF A;  1VF1 A;  2DJ3 A;  5D8I A;  4LA1 A;  2IMF A;  3LQ7 A;  3ERG A;  5IO0 A;  3I9V 2;  2VOC A;  4MZC A;  1TKD B;  6GSS A;  1PX6 A;  4ISD A;  2I9H A;  3K8N A;  1V9W A;  1OC8 A;  2CVB A;  4NXI A;  1PA3 A;  3F6D A;  4TKY A;  4MK3 A;  5ABR A;  3F3Q A;  1EOG A;  4Q5Q A;  2IPA A;  3D5J A;  4HQZ A;  3HY2 A;  4A5P A;  4V2N A;  2NTO A;  3UAR A;  2N5A A;  5IQY A;  5DVB A;  4TR0 A;  4ZL8 A;  2LNT A;  4I5Q A;  2FWH A;  5CRH A;  1WIK A;  3FZ9 A;  2QA2 A;  4GF0 A;  3TKS E;  1V40 A;  5H5R A;  2FD3 A;  3G9B A;  3VLN A;  5ECH B;  1X5D A;  1EV4 A;  1IYI A;  5HR0 A;  4V2L A;  2VCX A;  1A2J A;  2WS2 A;  2XPD A;  4OCF A;  3L9S A;  5D93 A;  2HZF A;  3QFA C;  2M80 A;  2LJK A;  3SBC A;  3H1N A;  2NPB A;  5KN2 A;  2C0G A;  2H0G A;  4IJ3 A;  1TJD A;  2EIQ A;  2EIO A;  4N0Z A;  2H6Y A;  1PL2 A;  3ZRD A;  3IPZ A;  1HQO A;  3PR8 A;  4O5R A;  2CZ3 A;  1OKD A;  1S3C A;  3DWV A;  2DJ0 A;  16GS A;  3D21 A;  3EU3 A;  4JBB A;  1OE8 A;  4NAX A;  1VF4 A;  14GS A;  2JU5 A;  4AGS A;  3GKM A;  3ZML A;  4K0G A;  2P5Q A;  4BPY A;  2GSS A;  4K7I A;  2WZ9 A;  5F8B A;  2PU9 C;  2FCH A;  1PKW A;  5CRG A;  5G30 A;  1A0R P;  4EL1 A;  3VUR A;  4FYB A;  1BJX A;  8GSS A;  5J9B A;  4IEL A;  5A5K A;  3NIV A;  1TU8 A;  4K6X A;  5J4U A;  2GS3 A;  3LXZ A;  3IHQ A;  3L9U A;  4ML1 A;  3F63 A;  1SYR A;  3DML A;  3ZIJ A;  3C73 A;  1VRS D;  3LJR A;  3ME7 A;  4GWR A;  3UEM A;  3IRA A;  4K2X A;  1MD4 A;  3DRN A;  4O92 A;  3C1R A;  1SYX A;  2M72 A;  1MD3 A;  2B3S A;  2DC5 A;  4HZ4 A;  2K18 A;  1XWK A;  1GSS A;  1A24 A;  1X0R A;  5ENU A;  3IBH A;  3GN3 A;  1K0N A;  4QQ7 A;  2I4A A;  4AJ8 A;  1FB0 A;  4D73 A;  1WRY A;  5ECO B;  2ZCT A;  3LFL A;  4EKZ A;  1HNC A;  1F6M C;  2LJR A;  19GS A;  1XOA A;  4O5U A;  3M9K A;  2K8V A;  5KN1 A;  2V41 A;  1DSB A;  4TN8 A;  1SJI A;  2B7K A;  2L5L A;  3GRX A;  4Q5R A;  4MF5 A;  1AXD A;  2IIY A;  2V6K A;  4XS4 A;  4Z2T A;  2A2R A;  5G2Z A;  5J41 A;  1I9D A;  4WXT A;  4K7N A;  1LU4 A;  1B9X C;  2R0C A;  2VUP A;  2FA8 A;  2GTU A;  3PPU A;  1M2B A;  2DBC A;  1NM3 A;  6GSX A;  5DAL A;  4G19 A;  4OO4 A;  2IN3 A;  1U3A A;  4MA9 A;  3CSI A;  3LOR A;  20GS A;  3P2A A;  1XWC A;  1M2A A;  2DKH A;  3MIX A;  1EOH A;  2DJK A;  1GSF A;  3TJK A;  2M46 A;  1M99 A;  3GST A;  1T00 A;  1K3O A;  1XWB A;  3IK9 A;  1TDI A;  1X9S B;  1X9M B;  1XW9 A;  1A2L A;  1R4W A;  3F0I A;  4TR1 A;  1THO A;  2QA1 A;  3ZIV A;  4DSS A;  3QD9 A;  1NHY A;  5DBQ A;  1YKA A;  3I43 A;  5AIV A;  1EP8 A;  2RUE A;  2F9S A;  2FWF A;  2H01 A;  5JCU A;  2YJH A;  2YCD A;  3VFI A;  3DVW A;  3GH9 A;  2C3N A;  3TDG A;  4DSR A;  2YJ7 A;  4ID0 A;  1WE0 A;  4RUV A;  1TP9 A;  3QOU A;  4HJ2 A;  3LG6 A;  2LQO A;  4OMV A;  4QL7 A;  2X4A A;  2IMI A;  3BCI A;  4PQI A;  4HJM A;  1UN2 A;  2OE1 A;  3WGE A;  2H8L A;  3HVS A;  2JZT A;  1QK8 A;  5GST A;  1FW1 A;  1QFN A;  4ZXG A;  4O32 A;  1RK4 A;  3HJP A;  2B5E A;  1GNW A;  5CYY A;  2H0I A;  2H6Z A;  5LNK e;  2YPM A;  2YZU A;  2A2S A;  3M8N A;  1UVZ A;  5JCG A;  2GZZ A;  4TVE A;  4PQ1 A;  5ECM B;  2X49 A;  5A4U A;  1ZYP A;  1R7H A;  1WWJ A;  18GS A;  3MWH A;  3IE3 A;  4FQU A;  3UOM A;  4GST A;  4EIQ A;  1PRX A;  4YQU A;  1YJ6 A;  4PXO A;  3KZQ A;  2FY6 A;  2GT6 A;  4IKH A;  1ERT A;  3IXR A;  3GX0 A;  5A4W A;  1YF1 A;  4EXJ A;  4MH3 A;  5C00 A;  4IS0 A;  2YZH A;  5ECS A;  2L59 A;  3GUR A;  3ZZX A;  3HCZ A;  5D96 A;  4ECC A;  4KH7 A;  4I6X A;  4WF5 A;  2CVK A;  3TJB A;  1NW2 A;  3H8Q A;  2Z9S A;  3VI7 A;  2GSQ A;  5IO2 A;  4RI6 A;  2WCI A;  1EGO A;  5IMD A;  4MJA A;  3RDW A;  1GSY A;  2GSR A;  5B6M A;  1ZZY A;  3HXS A;  22GS A;  4Q5F A;  1RW1 A;  2BTO T;  2PGT A;  3GMF A;  1O8W A;  5GAP D;  4X4J A;  3TKS C;  2OE3 A;  2VL9 A;  4LMW A;  3TRQ A;  1Y25 A;  2GQL A;  1M0U A;  4O7H A;  1GL8 A;  4K2D A;  5J9C A;  4IQA A;  1A2M A;  3APS A;  4MJB A;  1OC9 A;  2O87 A;  4H86 A;  2V1M A;  4YQV A;  1SL2 B;  1USB A;  4P3Y B;  4HDE A;  2GGT A;  5JWR B;  4HQS A;  3D22 A;  4LL1 B;  3GSS A;  2J23 A;  2LNS A;  5D9T A;  3S9F A;  3EVI A;  2JAC A;  1OAZ A;  2C4J A;  2WJU A;  3M1G A;  4HUA A;  3GKN A;  3A5I A;  3Q74 A;  2OAC A;  6GST A;  3F4R A;  3O76 A;  4WEY A;  5G31 A;  5E4W A;  2LV3 A;  2WUL A;  1SL1 B;  3EIN A;  1S3A A;  2B5X A;  2MMA A;  1SD8 A;  5ID2 A;  3KP8 A;  4MDC A;  4TXO B;  5B7C A;  3KCM A;  2YP6 A;  1PL1 A;  4TRX A;  2OBI A;  3FY7 A;  5FHI A;  2KOK A;  1F3A A;  4G0L A;  7GSS A;  1ZOF A;  4MH2 A;  4I2U A;  1TRS A;  4OFN A;  4KDX A;  2MMZ A;  1OE7 A;  4MNN A;  5B6N A;  3UIW A;  2HXK A;  3LYP A;  1O7U A;  4G2E A;  3QDN A;  2EIR A;  3KGK A;  3ZTL A;  5CP1 A;  3WGX A;  1VF3 A;  3WT1 A;  2O85 A;  2H1G A;  3LEF A;  2C0D A;  3CYN A;  1K3L A;  1SEN A;  1SD9 A;  2VCT A;  3I6A A;  4IW9 A;  2QGV A;  6GSW A;  3EMP A;  3TGZ A;  2GLR A;  5HFK A;  2YNX A;  3MAK A;  1WMJ A;  1GWC A;  1M2D A;  3ZFL A;  1QUW A;  1GRX A;  4G0K A;  2B1K A;  2R3X A;  1YF0 A;  4I2T A;  4EO3 A;  3APO A;  4KSM A;  2YWM A;  1U87 A;  3HDC A;  3MDK A;  4N0V A;  1O73 A;  1EWX A;  1A8Y A;  4PX1 A;  4K5S A;  2XC2 A;  4N30 A;  2IFQ A;  5IMF A;  4OFM A;  3HYP A;  1SKS B;  1EP7 A;  2CQ9 A;  5EPF A;  4AJ7 A;  2VLT A;  2QC7 A;  4ICY A;  2B6M A;  2HSH A;  2X99 A;  3KEB A;  3GTU B;  3ISO A;  5EY6 A;  1TRW A;  1SK0 A;  2AUV A;  3TJG A;  3P8W A;  3L0H A;  1ILO A;  4KAE A;  4EC0 A;  3ZLP A;  3LW9 A;  2H76 A;  3HVX A;  2VIM A;  4KW6 A;  1DE2 A;  4FYC A;  3A2X A;  3CSH A;  5IPG A;  1W4V A;  1U3I A;  4DSQ A;  1HD2 A;  5A4V A;  4MMM A;  3FYG A;  4K1F A;  1W89 A;  2P31 A;  1ML6 A;  5IOW A;  4HOJ A;  4ZL7 A;  1F2E A;  2E2G A;  2O7K A;  4TR3 A;  4DVC A;  3CSJ A;  4KCE A;  3SWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...