4POKA

Crystal structures of thioredoxin with mesna at 2.5a resolution
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
106
structure length
106
Chain Sequence
TMVKQIESKTAFQKALKAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKKKLEATINKLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin
publication title BNP7787 Forms Novel Covalent Adducts on Human Thioredoxin and Modulates Thioredoxin Activity
rcsb
source organism Homo sapiens
total genus 35
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00085 Thioredoxin Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4pokA00
3OR5A 4KDYA 4E8HA 1OAZA 2OKAA 3HY2A 2B5YA 4X43A 4I6XA 1Q98A 3DVXA 3IDVA 5GSTA 1B9XC 2HSYA 1Z7PA 5IMZA 2VIMA 1R4WA 3CYNA 4N0VA 3GV1A 3RBTA 5A4UA 2GVPA 3V1WA 4GSTA 2VCZA 3I69A 2PPTA 4TR1A 1BAYA 2F9SA 3D6IA 4HDEA 4OWYA 3R2QA 2VCWA 3C1RA 3CMIA 4LMVA 5B6NA 2YJHA 1A0RP 3WT2A 4MJCA 5JWOB 2F8FA 1YF1A 2VCTA 5J9CA 4X1UA 1S3AA 4JU5A 1KTEA 3CXGA 1Z5YE 3Q6OA 1ERWA 2C3NA 2YZUA 4IQ1A 4PUFC 1GP1A 3GX8A 1ZCPA 5ECSA 3F9UA 1TK5B 1ZMAA 1XVQA 3ZFLA 2KOKA 2H1GA 3ZIJA 1OC9B 1AC1A 4XS6A 2GDRA 4KGIA 3A2XA 4EF0A 3P2AA 2QC7A 1H4OA 4EVMA 4POMA 5AIXA 1YF0A 5DAKA 3VWUA 3UVTA 4JEDA 3PR8A 4MF5A 1WP0A 1EP8A 13GSA 6GSYA 2G2QA 4PQHA 3KP8A 2PERA 4JE1A 2OE0A 4GCIA 1SK2A 2YWNA 1UC7A 3ZIVA 3HJMA 4TXOA 4KW6A 5DALA 5F06A 5ECMB 4EDZA 3GMFA 5KN0A 3ZMLA 3S9FA 4XTSA 2B5EA 5IOXA 1ERTA 2PGTA 3KD0A 1YJ6A 2PUKC 2XC2A 3ZVJA 2IFQA 3VI7A 5ID2A 4KNDA 5ECPB 2R37A 2R4VA 1JFUA 5IIZA 3I43A 2YJ7A 5EPFA 3TJFA 4IBPA 3FZ4A 2RUEA 5ABRA 1IYIA 3D21A 2B7KA 4EC0A 1S3DA 1X9MB 4KSOA 5IOWA 3HKRA 4KCAA 3CSIA 3D4TA 2YWMA 3KJYA 1EEMA 3IXRA 5G1LA 2MMOA 2CVKA 3J7Yb 2J9HA 4HU9A 3DMLA 4J56E 4P3YB 1GUKA 4K7NA 2I4AA 2JL4A 1U3IA 2JZSA 1DUGA 5B6MA 1BX9A 1N2AA 5CRGA 1GUHA 2I81A 1F6MC 1PMTA 1R5AA 6GSWA 3TKSC 2WGRA 1OYJA 3A3TA 2M46A 1NM3A 2QGVA 1VF2A 4MP4A 1QMVA 1JZDA 1JLVA 2E2GA 4Q5FA 3EC3A 1ZGNA 3ZYWA 4O5RA 2HZEA 3P90A 5F8BA 3F6FA 3UMAA 2XBIA 4YQUA 12GSA 5ELGA 1AUCA 5COHA 3HJOA 4RQRA 5FWGA 2JADA 1B9YC 3C73A 3IA1A 2WRTA 1NHYA 1XWCA 3GN3A 4K6XA 2R6KA 4XCSA 5KN1A 2R3XA 3HYPA 1BEDA 4MJEA 5B7CA 2D2ZA 1EGOA 2G0FA 1HNBA 4MF6A 5GAPD 3IBHA 1SKRB 1AIUA 1M0UA 1BJXA 1WMJA 3GKKA 2DIYA 1GH2A 3GUSA 4MK3A 1URMA 4KH7A 4ECJA 3APOA 5A4VA 1A24A 2IL3A 1WRYA 2YANA 4LL1B 1X9SB 4WBJA 2DIZA 5ECLB 5G31A 2ZCTA 3ME8A 2C0GA 2P0GA 2YWIA 2FD3A 3TRXA 3TOTA 1SL0B 1T4YA 5G30A 2V32A 2ON5A 2CAIA 2B1KA 1DE1A 2V41A 3CRTA 3DEXA 1QFNA 5DJMA 3TDGA 5IO2A 2BJXA 1Y25A 5DQYA 3GKNA 3LXZA 2ON7A 5HR3A 2IJYA 1GUMA 1ERVA 3UJ1A 3TKSA 1TP9A 3TRPA 3VURA 1THXA 4EXJA 4JZQA 2VD0A 2K18A 1A2LA 4IELA 2N5FA 3IOSA 1YEPA 2MBTA 1WWJA 2AB6A 1VF1A 2PWJA 2TIRA 1GNEA 4WR5A 1BG5A 2PBJA 1OC9A 2C8UA 3EYTA 3SWLA 2CA8A 3GKXA 1A2MA 3ERFA 1LBKA 3MWHA 4ACSA 1GLQA 1A2JA 1WE0A 4TVEA 1XWKA 4CDOA 1YQ1A 5ECHB 1Y6EA 3BJ5A 2PMTA 2PN8A 3IPZA 2RM6A 3HJPA 1FW1A 2CAQA 5DVBA 2O8VB 3E3EA 8GSSA 4O32A 2KP2A 3DD3A 2RUFA 4WF5A 2K8VA 3LQ7A 5LD0A 1V2AA 2O7KA 2LNSA 3UL3A 3DIEA 3APQA 3RPPA 3D0ZA 5CNWA 2WCIA 4KX4A 4F03A 3LYPA 3QD9A 2HNLA 2WS2A 2OADA 2H6YA 4IJ3A 1FHEA 2K8SA 3E0UA 4NMUA 4GLTA 1M99A 5G2ZA 1TW9A 3GH6A 4ECIA 3F6DA 1F2EA 1EEJA 1K3YA 2CQ9A 3P8WA 5CP1A 2HXKA 4HU7A 5JCUA 5AGYA 1TTZA 5CRHA 10GSA 5ENUA 4MH2A 4IP6A 1BYEA 1O8XA 4HZ2A 2GQKA 1V57A 3EWLA 4I2TA 2YZHA 3GNJA 2H73A 3EMXA 4MPFA 3GURA 4G10A 2LRCA 1EOGA 1NW2A 2B7JA 2NBSA 4POLA 4MJAA 1M9BA 1YKCA 4V1Ag 2VCQA 2M80A 3U6VA 3APSA 4OCFA 1C72A 3TKRA 4GTUA 4KUNA 3IK7A 1U3AA 3LORA 1TK8B 1K0OA 3GRXA 1B8XA 4PX1A 2LQQA 1XW5A 1B4QA 1XVWA 3GIXA 2KUCA 1T8EB 1FB0A 3DYRA 1XXUA 1ZYEA 2L4CA 2MMNA 2Z9SA 1LU4A 5IMAA 4LA1A 1PA3A 4MZCA 1TXXA 2HYXA 4I5QA 3M1GA 4DEJA 20GSA 3P7XA 2YOIA 4AJ7A 1Q4JA 4KE3A 1AQXA 2VM2A 5IQYA 2YV7A 4I8BA 4XRAA 4K7OA 4EUYA 2JZTA 3WYWA 4DSSB 6GSUA 1T4ZA 5A5KA 2YWOA 3O6TA 4ZB9A 4BL7A 3C8EA 2FWEA 1MDIA 5D9VA 4AGSA 1XZOA 1JZWA 1GTBA 4OFTA 2H6ZA 5CO3A 4N11A 3W6GA 1PL2A 1XOBA 1FB6A 2FCHA 1SK0A 3KM6A 4JRRA 5D9TA 4MMMA 3I6AA 1J9BA 2R2JA 1WOUA 2L4QA 1U6TA 4PQ1A 4HZ4A 3H79A 1UA5A 4MZWA 1MDKA 1K3LA 2HRFA 5DQSA 3GFKA 3LGCA 5HR0A 3GYKA 2DC5A 4YQVA 2L6CA 1K0DA 3QCPA 4YAPA 5HR1A 3ZMKA 5LNKe 2DMMA 1PX6A 2HI7A 4K1FA 5ECNB 5D9WA 1Z6NA 4OFNA 4TR4A 3EMPA 3GL3A 1OVNA 5AISA 1OKTA 1PKZA 1MDJA 2ZUPA 1TI3A 4DVCA 3FRCA 4MPGA 2V1MA 2IIYA 2J23A 3FR9A 2O87A 3HD5A 4ZXGA 3L4NA 4GQCA 1GTUA 3UBKA 4QL7A 4N0ZA 1O7UA 4O7HA 1TK0B 1SYXA 3HA9A 2H72A 1SJZA 2E2MA 3EE2A 2IMDA 1GTAA 2NTOA 1M2DA 5D96A 2GT6A 2MYGA 3F3QA 4TXVA 4PQIA 1CQGA 4ZBDA 1V9WA 1FG4A 2IMEA 2GZPA 1AXDA 3LYKA 2P5QA 2F3MA 5D8IA 3HVVA 1H75A 4LL4B 4ZL7A 1J08A 2I3YA 2C3QA 2H75A 3PINA 1USBA 4L8EA 1B4PA 1PRXA 2LV3A 2X99A 1I9DA 2JSZA 1CQHA 4TN8A 2CT6A 4GRFA 3FHKA 3CSJA 5EL8A 2JU5A 2P5RA 2VLVA 1B48A 2REMA 2CZ3A 1OE7A 5J41A 3PH9A 2FGXA 1O81A 3F63A 1ST9A 3ZREA 2X8CA 1YEXA 3TKPA 3A5WA 1O8WA 2GGTA 1OE8A 4NAXA 3WGDA 3VWVA 1N8JA 1GSYA 5J4UA 1G6YA 2I1UA 1AAZA 1XWAA 3TCOA 4IJIA 2TRCP 1UN2A 5LCZA 1XWBA 5D93A 2YV9A 3VPQA 3ME7A 6GSXA 4ZB8A 4KB3A 5F05A 3N5OA 4PXOA 1A0FA 2H01A 2VL2C 2HZFA 5HFGA 4NV5A 2AV4A 3MNGA 3UVHA 4ML6A 3QOUA 3GA4A 5IMVA 1Z9HA 4POKA 2LUSA 2BMXA 4IVFA 4EE0A 4NWYA 5G1KA 3GSSA 1ZOFA 4XRDA 4RUVA 5G5FA 2XPEA 3GTUB 4MA9A 4TKYA 5E59A 4DSSA 1OKDA 1GLPA 1PX7A 2WFCA 3QAGA 1TU7A 2AJQB 1HNAA 4MABA 2H0HA 3FKFA 2N5BA 2EC4A 1M2BA 3JCML 2IN3A 3HVSA 3ISOA 4PNFA 2YPMA 2H66A 1F9MA 4G9HA 1GULA 3KH7A 3TOUA 7GSSA 1VF4A 2GZYA 4O92A 2DMLA 3CBUA 1JHBA 2H1BA 5G5EA 1IYHA 4MCUA 4OO4A 2EIQA 2OBKA 4F0CA 1HD2A 1E2YA 3FR6A 2R5GA 3EINA 5H5QA 4MF7A 4ULXA 3CTGA 5GZZB 3IV4A 2VL2A 1M7TA 3G7JA 1W89A 2VD1A 2GZZA 4QQ7A 3H8QA 1E6BA 3EURA 3M0FA 1TRVA 4XS1A 5H5RA 2PVOC 1XWGA 3KCMA 3TUEA 1FOVA 2VM1A 4YQMA 2DJ1A 4TR0A 2LJRA 2HSHA 1SENA 17GSA 4OMVA 2JSYA 4ZL9A 1V58A 3DGQA 1TI1A 1ABAA 1ZYQB 1YKAA 3G7YA 4J57E 4AJ6A 3KMOA 2GSRA 3M8NA 4HJ2A 4TOPA 1YY7A 3FZAA 3FZ5A 4FH8A 3UBLA 2LQOA 1EV9A 4CW9A 2H19A 1EV4A 4KDXA 3KMNA 4I97A 1U88A 4ZB6A 3KH9A 5DJLA 1TRWA 4DSQA 2RM5A 3UIWA 4TRXA 1K0CA 1TRUA 2P31A 2XPDA 3TJGA 1SKWB 1KBNA 1GSUA 1NHOA 2PVQA 1XW9A 2VLUA 3H4KA 3KZQA 2GT5A 3C7MA 4N10A 4WETA 5A4WA 2GQMA 2E7PA 1U87A 4BA7A 1X5CA 2GSSA 18GSA 1TDIA 2ALBA 4ZIJA 4BVXA 2L57A 2LJKA 5C00A 2LJAA 5JCGA 1QXHA 5CYYA 4V2LA 2WZ9A 2VO4A 1T00A 4IGJA 1Z3EA 4HQZA 4OFMA 2A2SA 3TGZA 2A4VA 2AAWA 3FR3A 3GSTA 4BVYA 2OE1A 1EP7A 3NZNA 1G6WA 1DSBA 1TRSA 3RHCA 2EIOA 4NHZA 2HLSA 2XHFA 1TKDB 3BOAA 3C71A 1AQVA 1SJ6A 5CRWA 2O85A 2N5AA 3TB2A 3MDKA 1G0TA 2YCDA 1FO5A 3WD6A 3KXOA 3FY7A 1AW9A 2DSAA 2VLTA 4G19A 3IE3A 4IP1A 2FA4A 5ECOB 2H71A 1XOAA 5GSSA 3F4TA 3ZL5A 4K2DA 1EZKA 1JZOA 3IC4A 1K3OA 1X5EA 1QK8A 16GSA 2CV4A 3CSHA 2A2RA 3K8NA 1TOFA 2H74A 1V98A 4G2EA 2VOCA 2DJKA 3GTUA 1SL2B 4ZL8A 3QFAC 2B3SA 2L5OA 3L9UA 4EO3A 2LTKA 4WBRD 2OE3A 3QR6A 1MTCA 3SBCA 4Z7XA 2K9FA 4NV2A 2MMAA 4Q5QA 2HRNA 4H86A 1SU9A 3KTLA 5GAND 2WULA 3KEBA 1SJIA 6GSTA 3US3A 1GL8A 3W8SA 4KSMA 4V1Ap 4L0UA 1GNWA 2MZCA 3HVXA 2F8AA 1PL1A 3M3MA 4CHSA 2CVDA 3L9SA 4OCEA 4EDYA 1I5GA 4OD7A 2FUG2 2KP1A 4HI7A 4YAVA 1FVJA 2ZNMA 1WIKA 4WXTA 1DE2A 1PGTA 5J9BA 1R5PA 2F51A 3M9JA 4ZILA 4MJBA 3KGKA 4Q5NA 3VPTA 4F82A 1G7OA 2GS3A 3G9BA 2H8LA 1ERUA 2PU9C 1LJRA 4IQAA 2M72A 2V2GA 1XCCA 1XIYA 1F3AA 4K0NA 3WGEA 2FLSA 1F3BA 1GSSA 5ECKB 3QMXA 4LLRA 2KLXA 2C4JA 6GSSA 2OA7A 4ILFA 3QFBC 2X8HA 3N9JA 2VAFA 4XS4B 4JR4A 4FYCA 2FA8A 4KAEA 1MD3A 4DSRA 4XIHA 5C04A 2YP6A 5EY6A 3DVWA 3GX0A 1WPIA 3IAM2 1NSWA 4IHUA 4NXIA 3BCIA 2LS5A 1O73A 3GKMA 2WB9A 4YH2A 4KCEA 1GWCA 4IKHA 3LXTA 2FY6A 1OC3A 1O85A 5JWRB 2FWGA 2IMIA 3LSZA 5HR2A 4F9ZA 1QUWA 2GTUA 1K0MA 2IMKA 5F0GA 3UAPA 3WGXA 4PNGA 1A8YA 3ZTLA 2YNXA 3GHAA 2L59A 4ZBBA 5L71A 3MSZA 2QKEA 3ED3A 5CREA 1HYUA 2FHEA 4LMWA 4Q5RA 2EIRA 1XBSA 1PKWA 5D73A 3NIVA 3D22A 3O76A 2LRTA 4L5LA 2B6MA 1M2AA 1RQMA 3ZFBA 2V6KA 1R7HA 4FIWA 1YDKA 1HQOA 4WF4A 5FHIA 2H1AA 1VRSD 3DXBA 3ZITA 3FEUA 3HXSA 2V6OA 4ECBA 2H70A 3UEMA 22GSA 1A8LA 1W4VA 3RDWA 19GSA 4ID0A 4WEYA 4N30A 1SKSB 4HOJA 3DWVA 1VF3A 3ERWA 2RLIA 3Q18A 4K7IA 3IHQA 3PGTA 4MZBA 2X64A 1GSDA 1JLWA 2H1DA 4X0XA 1WJKA 2C3TA 1V40A 2I9HA 3L0HA 3VWXA 4GF0A 5DCHA 2AUVA 4BPYA 3F0IA 2OJLA 3FK8A 5IPHA 2QSIA 4ML1A 2DJ0A 1SD8A 1KEBA 5CAXA 4OO5A 5DCGA 1GSFA 2JZRA 1QGVA 5KN3A 4TW5A 2L5LA 2C0FA 4RI6A 1JZRA 2C0DA 1OC8A 2MBSA 3A2WA 1SYRA 2NDOA 5IMCA 3TKSE 3IK9A 3Q19A 3VI5A 2LRNA 1UVZA 4IS0A 3HHVA 5KN2A 1QQ2A 3ZZXA 2WJUA 2H76A 4GXZA 4L0WA 4D73B 4RQXA 4J2FA 4F2IA 4K0GA 2E0QA 3LJRA 3RHBA 5B8BA 1R26A 1J0FA 1EGRA 3UARA 1GTIA 3FZ9A 5IO0A 5AIVA 3QAWA 3IRAA 2BTOT 5AN1A 3H93A 4ZBAA 1HNCA 1RK4A 3IAS2 2KHPA 3F4SA 2LEGA 4NHWA 4BWSA 4RI7A 1GSQA 4MH3A 5IMDA 4IN0A 1M9AA 1THOA 3M9KA 3F3RA 2IMFA 1PN9A 2NVLA 3NOFA 2LSTA 2K6VA 1K0NA 3BCKA 3HZ8A 4HJMA 3L9VA 4TR1B 2VUPA 5HFKA 4POBA 3CTFA 4F0BA 1SK1A 2JACA 5H5SA 2MMZA 3EVIA 2DJ3A 4V2NA 5EVOA 4ECCA 4WKWA 4XHMA 1ZZYA 3J7Yk 2C1YA 4HS1A 1DBYA 3IR4A 4NPBA 2AYTA 1A23A 1KNGA 1MD4A 3TKQA 1XPVA 2AHEA 4XS4A 2B5XA 2FNOA 3F8UA 1X0RA 4PUAA 4V2MA 4EL1A 3HDCA 5B8AA 4EKZA 3C1SA 1PQNA 2TRXA 4WR4A 3FW2A 3QAVA 3BD2A 3DKSA 4GSNA 5INYA 3D4MA 4FYUA 3WT1A 4PURA 3QDNA 4BWQA 3KIJA 3W8JA 4FYBA 1XW6A 4KA0A 3HZ4A 5DAKB 1TU8A 2VCXA 2B1LA 3GL5A 4IW9A 4K9ZA 2NPBA 5F07A 3A2VA 2ES7A 2IWTA 1SD9A 5HFIA 3Q74A 3O3TA 2H0GA 4HQSA 11GSA 3ZVJD 2FWHA 5IM9A 1EOHA 1EWXA 4GWRA 3UOMA 2X8GA 1MEKA 3H1NA 1FVKA 2LKUA 3VFIA 2C0EA 1T1VA 2VL9A 3RAZA 4TXOB 2HE3A 4TR3A 5DALB 5KEJA 3RPNA 1PD21 4KDUA 1ML6A 1AQWA 3E9JB 3TJKA 5ECRB 1XFLA 1Z7RA 3MAKA 2IFQB 4AJ8A 2FWFA 2DLXA 2GQLA 4E8EA 5ID2B 1K0AA 3ERGA 5ECIB 3TJJA 3I9V2 3ZLPA 1SL1B 3LG6A 2H0IA 5DBQA 1F37A 3LEFA 5JCWA 4ISDA 1Z6MA 5ELAA 2CZ2A 1T3BA 2C80A 3CRUA 4GSSA 3DRNA 2HFDA 5CRDA 1TJDA 4JR6A 4GQFA 3EU4A 5ECQB 3KP9A 3QPMA 1X5DA 3EU3A 1ACVA 6GSVA 1T7PB 1ILOA 2LNTA 5DDLA 2H30A 4AF2A 2HT9A 4JBBA 3BBYA 3TRQA 3VK9A 2CVBA 14GSA 1S3CA 9GSSA 2RIIA 4HUAA 3VLNA 5FT3A 1G7EA 5E4WA 5D9XA 4FO5A 3KTBA 1GSEA 5J5NA 5IPGA 2XBQA 1ON4A 5J3RA 3VWWA 2WDUA 2DBCA 5IMFA 1K0BA 3D5JA 2GSQA 1BQ7A 2OBIA 3G7IA 4HEA2 2VL3A 3LFLA 1YZXA 3HCZA 3L78A 1RW1A 2DJJA 3AY8A 1FAAA 4MLYA 1ZL9A 1O6JA 2OACA 3ZRDA 2O89A 2IPAA 3FYGA 2CX3A 2HZEB 2YN1A 1PSQA 2DJ2A 4MDCA 4D73A 3TJBA 4I2UA 2GLRA 3GH9A 1GRXA 3U5RE 2CX4A 3LWAA 5JWQB 4QL9A 1VGLA 4K8MA 4PGTA 2GSTA 5HQPA 2VCVA 3F4RA 2L6DA 1X9WB 4L5OA 2H6XA
chains in the Genus database with same CATH superfamily
3OR5A 4KDYA 4E8HA 1OAZA 2OKAA 3HY2A 3MYDA 2B5YA 4X43A 4I6XA 1Q98A 3DVXA 3IDVA 5GSTA 1B9XC 2HSYA 1Z7PA 1M3IA 5IMZA 2VIMA 1R4WA 3CYNA 4N0VA 3GV1A 3RBTA 5A4UA 2GVPA 3V1WA 4GSTA 2VCZA 3I69A 2PPTA 4TR1A 1BAYA 2F9SA 3D6IA 4HDEA 4OWYA 3R2QA 2VCWA 3C1RA 3CMIA 4LMVA 5B6NA 2YJHA 1A0RP 3WT2A 4MJCA 5JWOB 2F8FA 1YF1A 2VCTA 5J9CA 4X1UA 1S3AA 4JU5A 4K5RA 1KTEA 3CXGA 1Z5YE 3Q6OA 1ERWA 2C3NA 2YZUA 4IQ1A 4PUFC 1GP1A 3GX8A 1ZCPA 1S3RA 5ECSA 3F9UA 1TK5B 1ZMAA 1XVQA 3ZFLA 2KOKA 2H1GA 3ZIJA 1OC9B 1AC1A 4XS6A 2GDRA 4KGIA 3A2XA 4EF0A 3P2AA 2QC7A 1H4OA 4EVMA 4POMA 5AIXA 1YF0A 5DAKA 3VWUA 3UVTA 4JEDA 3PR8A 4MF5A 1WP0A 1EP8A 13GSA 6GSYA 2G2QA 4PQHA 3KP8A 2PERA 4JE1A 2OE0A 4GCIA 1SK2A 2YWNA 1UC7A 3ZIVA 3HJMA 4TXOA 4KW6A 5DALA 5F06A 5ECMB 4EDZA 3GMFA 5KN0A 3ZMLA 3S9FA 4XTSA 2B5EA 5IOXA 1ERTA 2PGTA 3KD0A 1YJ6A 2PUKC 2XC2A 3ZVJA 2IFQA 3VI7A 5ID2A 4KNDA 5ECPB 2R37A 2R4VA 1JFUA 5IIZA 3I43A 2YJ7A 5EPFA 3TJFA 4IBPA 3FZ4A 4Z2TA 2RUEA 5ABRA 2X49A 1IYIA 3D21A 2B7KA 4EC0A 1S3DA 1X9MB 4KSOA 4BVYB 5IOWA 3HKRA 4KCAA 3CSIA 3D4TA 2YWMA 3KJYA 1EEMA 3IXRA 5G1LA 2MMOA 2CVKA 3J7Yb 2J9HA 4HU9A 3DMLA 4J56E 4P3YB 1GUKA 4K7NA 2I4AA 2R0GA 2JL4A 1U3IA 2JZSA 1DUGA 5B6MA 1BX9A 1N2AA 5CRGA 1FOHA 1GUHA 2I81A 1F6MC 1PMTA 1R5AA 6GSWA 3TKSC 2WGRA 1OYJA 3A3TA 2M46A 1NM3A 2QGVA 1VF2A 4MP4A 1QMVA 1JZDA 1JLVA 2E2GA 4Q5FA 3EC3A 1ZGNA 3ZYWA 4O5RA 2HZEA 3P90A 5F8BA 3F6FA 3UMAA 2XBIA 4ICYA 4YQUA 12GSA 5ELGA 1AUCA 5COHA 3HJOA 4RQRA 5FWGA 2JADA 1B9YC 3C73A 5BMUA 3IA1A 2WRTA 1NHYA 1XWCA 3GN3A 4K6XA 2R6KA 4XCSA 5KN1A 2R3XA 3HYPA 1BEDA 4MJEA 5B7CA 4BL7B 2D2ZA 1EGOA 2G0FA 1HNBA 4MF6A 5GAPD 3IBHA 1SKRB 1AIUA 1M0UA 1BJXA 3CQFA 1WMJA 3GKKA 2DIYA 1GH2A 3GUSA 4MK3A 1URMA 4KH7A 4ECJA 3APOA 5A4VA 1A24A 2IL3A 4BIKA 1WRYA 2YANA 4LL1B 1X9SB 4WBJA 2DIZA 5ECLB 5G31A 2ZCTA 3ME8A 2C0GA 1PFOA 2P0GA 2YWIA 2FD3A 3TRXA 3TOTA 1SL0B 1T4YA 5G30A 2V32A 2ON5A 2CAIA 2B1KA 1DE1A 2V41A 3CRTA 3DEXA 1QFNA 5DJMA 3TDGA 5IO2A 2BJXA 1Y25A 5DQYA 3GKNA 3LXZA 2ON7A 5HR3A 2IJYA 1GUMA 1ERVA 3UJ1A 3TKSA 1TP9A 4K5SA 3TRPA 3VURA 1THXA 4EXJA 4JZQA 4MNNA 2VD0A 2K18A 1A2LA 4IELA 2DKIA 2N5FA 3IOSA 1YEPA 2MBTA 1PN0A 1WWJA 2AB6A 1VF1A 2PWJA 2TIRA 1GNEA 4WR5A 1BG5A 2PBJA 1OC9A 2C8UA 5KOWA 3EYTA 3SWLA 2HRKA 2CA8A 3GKXA 1A2MA 3ERFA 1LBKA 3MWHA 4ACSA 1GLQA 1A2JA 1WE0A 4TVEA 1XWKA 4CDOA 1YQ1A 1Y6EA 5ECHB 3BJ5A 2PMTA 2PN8A 3IPZA 2RM6A 3HJPA 1FW1A 2CAQA 5DVBA 2O8VB 3E3EA 8GSSA 4O32A 2KP2A 3DD3A 2RUFA 4K2XA 4WF5A 2K8VA 3LQ7A 5LD0A 1V2AA 2O7KA 2LNSA 3UL3A 3DIEA 3APQA 3RPPA 3D0ZA 5CNWA 2WCIA 4KX4A 4F03A 3LYPA 3QD9A 2HNLA 2WS2A 2OADA 2H6YA 4IJ3A 1FHEA 2K8SA 3E0UA 4NMUA 4GLTA 1M99A 5G2ZA 1TW9A 3GH6A 4ECIA 3F6DA 1F2EA 1EEJA 1K3YA 2CQ9A 3P8WA 5CP1A 2HXKA 4HU7A 5JCUA 5AGYA 1TTZA 5CRHA 10GSA 5ENUA 4MH2A 4IP6A 1BYEA 1O8XA 4HZ2A 2GQKA 1V57A 3EWLA 4I2TA 2YZHA 3GNJA 2H73A 3EMXA 4MPFA 3GURA 4G10A 2LRCA 1EOGA 1NW2A 2B7JA 2NBSA 4POLA 4MJAA 1M9BA 1YKCA 4V1Ag 2VCQA 2M80A 3U6VA 3APSA 4OCFA 1C72A 3TKRA 4GTUA 4KUNA 3IK7A 1U3AA 3LORA 1TK8B 1K0OA 3GRXA 1B8XA 4PX1A 2LQQA 1XW5A 1B4QA 1XVWA 3GIXA 2KUCA 1T8EB 1FB0A 3DYRA 1XXUA 1ZYEA 2L4CA 2MMNA 2Z9SA 1LU4A 5IMAA 4LA1A 1PA3A 4MZCA 1TXXA 2HYXA 4I5QA 3M1GA 4DEJA 20GSA 3P7XA 2YOIA 4AJ7A 1Q4JA 4KE3A 1AQXA 2VM2A 5IQYA 2X4AA 2YV7A 4I8BA 4XRAA 4K7OA 4EUYA 2JZTA 3WYWA 4DSSB 6GSUA 1T4ZA 5A5KA 2YWOA 3O6TA 4ZB9A 4BL7A 3C8EA 2FWEA 1MDIA 5D9VA 4AGSA 1XZOA 1JZWA 1GTBA 4OFTA 2H6ZA 5CO3A 4N11A 3W6GA 1PL2A 1XOBA 1FB6A 2FCHA 1SK0A 3KM6A 4JRRA 5D9TA 4MMMA 3I6AA 1J9BA 2R2JA 1WOUA 2L4QA 1U6TA 4PQ1A 4HZ4A 3H79A 1UA5A 4MZWA 1MDKA 1K3LA 2HRFA 5DQSA 3GFKA 3LGCA 5HR0A 3GYKA 2DC5A 4YQVA 2L6CA 1K0DA 3QCPA 4YAPA 5HR1A 3ZMKA 5LNKe 2DMMA 1PX6A 2HI7A 4K1FA 5ECNB 5D9WA 1Z6NA 3PPUA 4OFNA 4TR4A 4USSA 5BRTA 3EMPA 3GL3A 1OVNA 5AISA 1OKTA 4Z2UA 1PKZA 3IC8A 1MDJA 2ZUPA 1TI3A 4PTSA 4DVCA 3FRCA 4MPGA 2V1MA 2IIYA 2J23A 3FR9A 2O87A 3HD5A 4ZXGA 3L4NA 4GQCA 1GTUA 3UBKA 4QL7A 4N0ZA 1O7UA 4O7HA 1TK0B 1SYXA 3HA9A 2H72A 1SJZA 2E2MA 3EE2A 2IMDA 1GTAA 2NTOA 1M2DA 5D96A 2GT6A 2MYGA 3F3QA 4TXVA 4PQIA 1CQGA 4ZBDA 1V9WA 1FG4A 2IMEA 2GZPA 1AXDA 3LYKA 2P5QA 2F3MA 5D8IA 3HVVA 1H75A 4LL4B 4ZL7A 1J08A 2I3YA 2C3QA 2H75A 3PINA 1USBA 4L8EA 4X4JA 1B4PA 1PRXA 2LV3A 2X99A 1I9DA 2JSZA 1CQHA 4TN8A 2CT6A 4GRFA 4BVXB 3FHKA 3CSJA 5EL8A 2JU5A 2P5RA 2VLVA 1B48A 2REMA 2CZ3A 1OE7A 5J41A 3PH9A 2FGXA 1O81A 3F63A 1ST9A 3ZREA 2X8CA 1YEXA 3TKPA 3A5WA 2A2PA 1O8WA 2GGTA 1OE8A 4NAXA 3WGDA 3VWVA 1N8JA 1GSYA 5J4UA 1G6YA 2I1UA 1AAZA 1XWAA 3TCOA 4IJIA 2TRCP 1UN2A 5LCZA 1XWBA 5D93A 2YV9A 3VPQA 3ME7A 4EIPA 6GSXA 4ZB8A 3LW9A 4KB3A 5F05A 3N5OA 4PXOA 1A0FA 2H01A 2VL2C 2HZFA 5HFGA 4NV5A 2AV4A 2A4HA 3MNGA 3UVHA 4ML6A 3QOUA 3GA4A 5IMVA 1Z9HA 4POKA 2LUSA 2BMXA 4IVFA 4EE0A 4NWYA 5G1KA 3GSSA 1ZOFA 4XRDA 4RUVA 5G5FA 2XPEA 3GTUB 4MA9A 4TKYA 5E59A 4DSSA 1OKDA 1GLPA 1PX7A 2WFCA 3QAGA 1TU7A 2AJQB 1HNAA 4MABA 2H0HA 3FKFA 2N5BA 2EC4A 1M2BA 3JCML 2IN3A 3HVSA 3ISOA 4PNFA 2YPMA 2H66A 1F9MA 4G9HA 1GULA 3KH7A 3TOUA 7GSSA 1ZYNA 1VF4A 2GZYA 4O92A 2DMLA 3CBUA 1JHBA 2H1BA 5G5EA 1IYHA 4MCUA 4OO4A 2EIQA 2OBKA 4F0CA 1HD2A 1E2YA 3FR6A 2R5GA 3EINA 5H5QA 4MF7A 4ULXA 3CTGA 5GZZB 3IV4A 2VL2A 1M7TA 3G7JA 1W89A 2VD1A 2GZZA 4QQ7A 3H8QA 3IHGA 1E6BA 3EURA 3M0FA 1TRVA 4XS1A 5H5RA 2PVOC 1XWGA 3KCMA 3TUEA 1FOVA 2VM1A 4YQMA 2DJ1A 4TR0A 2LJRA 2HSHA 2QA1A 1SENA 17GSA 4OMVA 2JSYA 4ZL9A 1V58A 3DGQA 1TI1A 1ABAA 1ZYQB 1YKAA 3G7YA 4J57E 4AJ6A 3KMOA 2GSRA 3M8NA 4HJ2A 4TOPA 1YY7A 3FZAA 3FZ5A 4FH8A 3UBLA 2LQOA 1EV9A 4CW9A 2H19A 1EV4A 4KDXA 3KMNA 4I97A 1U88A 4ZB6A 3KH9A 5DJLA 1TRWA 4DSQA 2RM5A 3UIWA 4TRXA 1K0CA 1TRUA 2P31A 2XPDA 3TJGA 1SKWB 1KBNA 1GSUA 1NHOA 2PVQA 1XW9A 2VLUA 3H4KA 3KZQA 2GT5A 3C7MA 4N10A 4WETA 5A4WA 2GQMA 3EPTA 2DKHA 2E7PA 1U87A 4BA7A 1X5CA 2GSSA 18GSA 1TDIA 2ALBA 4ZIJA 4BVXA 2L57A 2LJKA 5C00A 2LJAA 5JCGA 3A5IA 1QXHA 5CYYA 4V2LA 2WZ9A 2VO4A 1T00A 4IGJA 1Z3EA 4HQZA 4OFMA 2A2SA 3TGZA 2A4VA 2AAWA 3FR3A 3GSTA 4BVYA 2OE1A 1EP7A 3NZNA 1G6WA 1DSBA 1TRSA 3RHCA 2EIOA 4NHZA 2HLSA 2XHFA 1TKDB 3BOAA 3C71A 1AQVA 1SJ6A 5CRWA 2O85A 2N5AA 3TB2A 3MDKA 1G0TA 2YCDA 1FO5A 3WD6A 3KXOA 3FY7A 1AW9A 2DSAA 2VLTA 4G19A 3IE3A 4IP1A 2FA4A 5ECOB 2H71A 1XOAA 5GSSA 3F4TA 3ZL5A 4K2DA 1EZKA 1JZOA 3IC4A 1K3OA 1X5EA 1QK8A 16GSA 2CV4A 3CSHA 2A2RA 3K8NA 1TOFA 2H74A 1V98A 1M3JA 4G2EA 2VOCA 2DJKA 3GTUA 1SL2B 4ZL8A 2QA2A 3QFAC 2B3SA 2L5OA 3L9UA 4EO3A 2LTKA 4WBRD 2OE3A 2R0PA 3QR6A 1MTCA 3SBCA 4Z7XA 2K9FA 4NV2A 2MMAA 4Q5QA 2HRNA 4H86A 1SU9A 2UZ8A 3KTLA 5GAND 4G0LA 4FQUA 2WULA 3KEBA 1SJIA 6GSTA 3US3A 1GL8A 3W8SA 4KSMA 3MIXA 4V1Ap 4L0UA 1GNWA 2MZCA 3HVXA 4Z2RA 2F8AA 1PL1A 3M3MA 4CHSA 2CVDA 3L9SA 4OCEA 4EDYA 1I5GA 4OD7A 2FUG2 2KP1A 4HI7A 4YAVA 1FVJA 2ZNMA 1WIKA 4WXTA 1DE2A 1PGTA 5J9BA 1R5PA 2F51A 3M9JA 4ZILA 4MJBA 3KGKA 4Q5NA 3VPTA 4F82A 1G7OA 2GS3A 3G9BA 2H8LA 1ERUA 2PU9C 1LJRA 4IQAA 2M72A 2V2GA 1XCCA 1XIYA 1F3AA 4K0NA 3WGEA 2FLSA 1F3BA 1GSSA 5ECKB 3QMXA 4LLRA 2KLXA 2C4JA 6GSSA 2OA7A 4ILFA 3QFBC 2X8HA 3N9JA 2VAFA 4XS4B 4JR4A 4FYCA 2FA8A 4KAEA 1MD3A 4DSRA 4XIHA 5C04A 2YP6A 4CY8A 5EY6A 3DVWA 3GX0A 1WPIA 3IAM2 1NSWA 4IHUA 4NXIA 3BCIA 2LS5A 1O73A 3GKMA 2WB9A 4YH2A 4KCEA 1GWCA 4IKHA 3LXTA 2FY6A 1OC3A 1O85A 5JWRB 2FWGA 2IMIA 3LSZA 5HR2A 4F9ZA 1QUWA 2GTUA 1K0MA 2IMKA 5F0GA 3UAPA 3WGXA 4PNGA 1A8YA 3ZTLA 2R0CA 2YNXA 3GHAA 2L59A 4ZBBA 5L71A 3MSZA 2QKEA 3ED3A 5CREA 1HYUA 2FHEA 4LMWA 4Q5RA 2EIRA 1XBSA 1PKWA 5D73A 3NIVA 3D22A 3O76A 2LRTA 4L5LA 2B6MA 1M2AA 1RQMA 3ZFBA 2V6KA 1R7HA 4FIWA 1YDKA 3FMWA 1HQOA 4WF4A 5FHIA 2H1AA 1VRSD 3DXBA 3ZITA 3R3EA 3FEUA 3HXSA 2V6OA 4ECBA 2H70A 3UEMA 22GSA 1A8LA 1W4VA 3RDWA 19GSA 4ID0A 4WEYA 4N30A 4YKFA 1SKSB 1XG8A 4HOJA 3DWVA 1VF3A 3ERWA 2RLIA 3Q18A 4K7IA 3IHQA 3PGTA 4MZBA 2X64A 1GSDA 1JLWA 2H1DA 4X0XA 1WJKA 2C3TA 1V40A 2I9HA 3L0HA 3VWXA 4GF0A 5DCHA 2AUVA 4G0KA 4BPYA 3F0IA 2OJLA 3FK8A 5IPHA 2QSIA 4ML1A 2DJ0A 1SD8A 1KEBA 5CAXA 4OO5A 5DCGA 1GSFA 2JZRA 1QGVA 5KN3A 4TW5A 2L5LA 2C0FA 4RI6A 1JZRA 2C0DA 1OC8A 2MBSA 3A2WA 1SYRA 4YKGA 2NDOA 5IMCA 3TKSE 3IK9A 3Q19A 3VI5A 2LRNA 1UVZA 4IS0A 4A5PA 3HHVA 5KN2A 1QQ2A 3ZZXA 2WJUA 2H76A 4GXZA 4L0WA 4D73B 4RQXA 4J2FA 4F2IA 4K0GA 2E0QA 3LJRA 3RHBA 5B8BA 1R26A 1J0FA 1EGRA 3UARA 1GTIA 3FZ9A 5IO0A 5AIVA 3QAWA 3IRAA 2BTOT 5AN1A 3H93A 4ZBAA 1HNCA 1RK4A 3IAS2 2KHPA 3F4SA 2LEGA 4NHWA 4BWSA 4RI7A 1GSQA 4MH3A 5IMDA 4IN0A 1M9AA 1THOA 3M9KA 3F3RA 2IMFA 1PN9A 2NVLA 3NOFA 2LSTA 2K6VA 1K0NA 3BCKA 3HZ8A 4HJMA 2HSMA 3L9VA 4TR1B 2VUPA 5HFKA 4POBA 3CTFA 4F0BA 1SK1A 2JACA 5H5SA 2MMZA 3EVIA 2DJ3A 4V2NA 5EVOA 4ECCA 4WKWA 5KOXA 4XHMA 1ZZYA 3J7Yk 2C1YA 4HS1A 1DBYA 3IR4A 4NPBA 2AYTA 1A23A 1KNGA 1MD4A 3TKQA 4HSCX 1XPVA 2AHEA 4XS4A 2B5XA 2FNOA 3F8UA 1X0RA 4PUAA 4V2MA 4EL1A 3HDCA 5B8AA 4EKZA 3C1SA 1PQNA 2TRXA 4WR4A 3FW2A 3QAVA 3BD2A 3DKSA 4GSNA 5INYA 3D4MA 4FYUA 3WT1A 4PURA 3QDNA 4BWQA 3KIJA 3W8JA 4FYBA 1XW6A 4KA0A 3HZ4A 5DAKB 1TU8A 2VCXA 2B1LA 3GL5A 4IW9A 4K9ZA 2NPBA 3A2VA 5F07A 2ES7A 2IWTA 1SD9A 5HFIA 3Q74A 3O3TA 2H0GA 4HQSA 11GSA 3ZVJD 2FWHA 5IM9A 1EOHA 1EWXA 4GWRA 3UOMA 2X8GA 1MEKA 3H1NA 1FVKA 2LKUA 3VFIA 2C0EA 1T1VA 2VL9A 3RAZA 1ZYPA 4TXOB 2HE3A 4TR3A 5DALB 5KEJA 3RPNA 1PD21 4KDUA 1ML6A 1AQWA 3E9JB 3TJKA 5ECRB 1XFLA 1Z7RA 3MAKA 4KF9A 2IFQB 4AJ8A 2FWFA 2DLXA 2GQLA 4EIQA 4E8EA 5ID2B 1K0AA 3ERGA 5ECIB 3TJJA 3I9V2 3ZLPA 1SL1B 3LG6A 2H0IA 5DBQA 1F37A 3LEFA 5JCWA 4ISDA 1Z6MA 5ELAA 2CZ2A 4CY6A 1T3BA 2C80A 3CRUA 4GSSA 3DRNA 2HFDA 4O5QA 5CRDA 4G0IA 1TJDA 4JR6A 4GQFA 3EU4A 5ECQB 3KP9A 3QPMA 1X5DA 3EU3A 1ACVA 6GSVA 1T7PB 1ILOA 2LNTA 5DDLA 2H30A 4AF2A 2HT9A 4JBBA 3BBYA 3TRQA 3VK9A 2CVBA 14GSA 1S3CA 9GSSA 2RIIA 4HUAA 3VLNA 5FT3A 1G7EA 5E4WA 5D9XA 4FO5A 3KTBA 1GSEA 5J5NA 5IPGA 2XBQA 3HVNA 1ON4A 5J3RA 3VWWA 2WDUA 2DBCA 5IMFA 2HRAA 1K0BA 3D5JA 2GSQA 1BQ7A 2OBIA 3G7IA 4HEA2 2VL3A 3LFLA 1YZXA 3HCZA 3L78A 1RW1A 2DJJA 3AY8A 1FAAA 4MLYA 1ZL9A 1O6JA 2OACA 3ZRDA 2O89A 2IPAA 3FYGA 2CX3A 2HZEB 2YN1A 1PSQA 2DJ2A 4MDCA 4D73A 3TJBA 4I2UA 2GLRA 3GH9A 1GRXA 3U5RE 2CX4A 3LWAA 5JWQB 4QL9A 1VGLA 4K8MA 4PGTA 2GSTA 5HQPA 2VCVA 3F4RA 2L6DA 1X9WB 4O5UA 4L5OA 2H6XA
chains in the Genus database with same CATH topology
3OR5A 4KDYA 4E8HA 1OAZA 2OKAA 3HY2A 3MYDA 2B5YA 4X43A 4I6XA 1Q98A 3DVXA 3IDVA 5GSTA 1B9XC 2HSYA 1Z7PA 5IMZA 2VIMA 1R4WA 3CYNA 4N0VA 3GV1A 3RBTA 5A4UA 2GVPA 3V1WA 4GSTA 2VCZA 3I69A 2PPTA 4TR1A 1BAYA 2F9SA 3D6IA 4HDEA 4OWYA 3R2QA 2VCWA 3C1RA 3CMIA 4LMVA 5B6NA 2YJHA 1A0RP 3WT2A 4MJCA 5JWOB 2F8FA 1YF1A 2VCTA 5J9CA 4X1UA 1S3AA 4JU5A 4K5RA 1KTEA 3CXGA 1Z5YE 3Q6OA 1ERWA 2C3NA 2YZUA 4IQ1A 4PUFC 1GP1A 3GX8A 1ZCPA 5ECSA 3F9UA 1TK5B 1ZMAA 1XVQA 3ZFLA 2KOKA 2H1GA 3ZIJA 1OC9B 1AC1A 4XS6A 2GDRA 4KGIA 3A2XA 4EF0A 3P2AA 2QC7A 1H4OA 4EVMA 4POMA 5AIXA 1YF0A 5DAKA 3VWUA 3UVTA 4JEDA 3PR8A 4MF5A 1WP0A 1EP8A 13GSA 6GSYA 2G2QA 4PQHA 3KP8A 2PERA 4JE1A 2OE0A 4GCIA 1SK2A 2YWNA 1UC7A 3ZIVA 3HJMA 4TXOA 4KW6A 5DALA 5F06A 5ECMB 4EDZA 3GMFA 5KN0A 3ZMLA 3S9FA 4XTSA 2B5EA 5IOXA 1ERTA 2PGTA 3KD0A 1YJ6A 2PUKC 2XC2A 3ZVJA 2IFQA 3VI7A 5ID2A 4KNDA 5ECPB 2R37A 2R4VA 1JFUA 5IIZA 3I43A 2YJ7A 5EPFA 3TJFA 4IBPA 3FZ4A 4Z2TA 2RUEA 5ABRA 2X49A 1IYIA 3D21A 2B7KA 4EC0A 1S3DA 1X9MB 4KSOA 4BVYB 5IOWA 3HKRA 4KCAA 3CSIA 3D4TA 2YWMA 3KJYA 1EEMA 3IXRA 5G1LA 2MMOA 2CVKA 3J7Yb 2J9HA 4HU9A 3DMLA 4J56E 4P3YB 1GUKA 4K7NA 2I4AA 2R0GA 2JL4A 1U3IA 2JZSA 1DUGA 5B6MA 1BX9A 1N2AA 5CRGA 1FOHA 1GUHA 2I81A 1F6MC 1PMTA 1R5AA 6GSWA 3TKSC 2WGRA 1OYJA 3A3TA 2M46A 1NM3A 2QGVA 1VF2A 4MP4A 1QMVA 1JZDA 1JLVA 2E2GA 4Q5FA 3EC3A 1ZGNA 3ZYWA 4O5RA 2HZEA 3P90A 5F8BA 3F6FA 3UMAA 2XBIA 4ICYA 4YQUA 12GSA 5ELGA 1AUCA 5COHA 3HJOA 4RQRA 5FWGA 2JADA 1B9YC 3C73A 5BMUA 3IA1A 2WRTA 1NHYA 1XWCA 3GN3A 4K6XA 2R6KA 4XCSA 5KN1A 2R3XA 3HYPA 1BEDA 4MJEA 5B7CA 4BL7B 2D2ZA 1EGOA 2G0FA 1HNBA 4MF6A 5GAPD 3IBHA 1SKRB 1AIUA 1M0UA 1BJXA 1WMJA 3GKKA 2DIYA 1GH2A 3GUSA 4MK3A 1URMA 4KH7A 4ECJA 3APOA 5A4VA 1A24A 2IL3A 1WRYA 2YANA 4LL1B 1X9SB 4WBJA 2DIZA 5ECLB 5G31A 2ZCTA 3ME8A 2C0GA 2P0GA 2YWIA 2FD3A 3TRXA 3TOTA 1SL0B 1T4YA 5G30A 2V32A 2ON5A 2CAIA 2B1KA 1DE1A 2V41A 3CRTA 3DEXA 1QFNA 5DJMA 3TDGA 5IO2A 2BJXA 1Y25A 5DQYA 3GKNA 3LXZA 2ON7A 5HR3A 2IJYA 1GUMA 1ERVA 3UJ1A 3TKSA 1TP9A 4K5SA 3TRPA 3VURA 1THXA 4EXJA 4JZQA 4MNNA 2VD0A 2K18A 1A2LA 4IELA 2DKIA 2N5FA 3IOSA 1YEPA 2MBTA 1PN0A 1WWJA 2AB6A 1VF1A 2PWJA 2TIRA 1GNEA 4WR5A 1BG5A 2PBJA 1OC9A 2C8UA 5KOWA 3EYTA 3SWLA 2HRKA 2CA8A 3GKXA 1A2MA 3ERFA 1LBKA 3MWHA 4ACSA 1GLQA 1A2JA 1WE0A 4TVEA 1XWKA 4CDOA 1YQ1A 1Y6EA 5ECHB 3BJ5A 2PMTA 2PN8A 3IPZA 2RM6A 3HJPA 1FW1A 2CAQA 5DVBA 2O8VB 3E3EA 8GSSA 4O32A 2KP2A 3DD3A 2RUFA 4K2XA 4WF5A 2K8VA 3LQ7A 5LD0A 1V2AA 2O7KA 2LNSA 3UL3A 3DIEA 3APQA 3RPPA 3D0ZA 5CNWA 2WCIA 4KX4A 4F03A 3LYPA 3QD9A 2HNLA 2WS2A 2OADA 2H6YA 4IJ3A 1FHEA 2K8SA 3E0UA 4NMUA 4GLTA 1M99A 5G2ZA 1TW9A 3GH6A 4ECIA 3F6DA 1F2EA 1EEJA 1K3YA 2CQ9A 3P8WA 5CP1A 2HXKA 4HU7A 5JCUA 5AGYA 1TTZA 5CRHA 10GSA 5ENUA 4MH2A 4IP6A 1BYEA 1O8XA 4HZ2A 2GQKA 1V57A 3EWLA 4I2TA 2YZHA 3GNJA 2H73A 3EMXA 4MPFA 3GURA 4G10A 2LRCA 1EOGA 1NW2A 2B7JA 2NBSA 4POLA 4MJAA 1M9BA 1YKCA 4V1Ag 2VCQA 2M80A 3U6VA 3APSA 4OCFA 1C72A 3TKRA 4GTUA 4KUNA 3IK7A 1U3AA 3LORA 1TK8B 1K0OA 3GRXA 1B8XA 4PX1A 2LQQA 1XW5A 1B4QA 1XVWA 3GIXA 2KUCA 1T8EB 1FB0A 3DYRA 1XXUA 1ZYEA 2L4CA 2MMNA 2Z9SA 1LU4A 5IMAA 4LA1A 1PA3A 4MZCA 1TXXA 2HYXA 4I5QA 3M1GA 4DEJA 20GSA 3P7XA 2YOIA 4AJ7A 1Q4JA 4KE3A 1AQXA 2VM2A 5IQYA 2X4AA 2YV7A 4I8BA 4XRAA 4K7OA 4EUYA 2JZTA 3WYWA 4DSSB 6GSUA 1T4ZA 5A5KA 2YWOA 3O6TA 4ZB9A 4BL7A 3C8EA 2FWEA 1MDIA 5D9VA 4AGSA 1XZOA 1JZWA 1GTBA 4OFTA 2H6ZA 5CO3A 4N11A 3W6GA 1PL2A 1XOBA 1FB6A 2FCHA 1SK0A 3KM6A 4JRRA 5D9TA 4MMMA 3I6AA 1J9BA 2R2JA 1WOUA 2L4QA 1U6TA 4PQ1A 4HZ4A 3H79A 1UA5A 4MZWA 1MDKA 1K3LA 2HRFA 5DQSA 3GFKA 3LGCA 5HR0A 3GYKA 2DC5A 4YQVA 2L6CA 1K0DA 3QCPA 4YAPA 5HR1A 3ZMKA 5LNKe 2DMMA 1PX6A 2HI7A 4K1FA 5ECNB 5D9WA 1Z6NA 3PPUA 4OFNA 4TR4A 4USSA 5BRTA 3EMPA 3GL3A 1OVNA 5AISA 1OKTA 4Z2UA 1PKZA 3IC8A 1MDJA 2ZUPA 1TI3A 4PTSA 4DVCA 3FRCA 4MPGA 2V1MA 2IIYA 2J23A 3FR9A 2O87A 3HD5A 4ZXGA 3L4NA 4GQCA 1GTUA 3UBKA 4QL7A 4N0ZA 1O7UA 4O7HA 1TK0B 1SYXA 3HA9A 2H72A 1SJZA 2E2MA 3EE2A 2IMDA 1GTAA 2NTOA 1M2DA 5D96A 2GT6A 2MYGA 3F3QA 4TXVA 4PQIA 1CQGA 4ZBDA 1V9WA 1FG4A 2IMEA 2GZPA 1AXDA 3LYKA 2P5QA 2F3MA 5D8IA 3HVVA 1H75A 4LL4B 4ZL7A 1J08A 2I3YA 2C3QA 2H75A 3PINA 1USBA 4L8EA 4X4JA 1B4PA 1PRXA 2LV3A 2X99A 1I9DA 2JSZA 1CQHA 4TN8A 2CT6A 4GRFA 4BVXB 3FHKA 3CSJA 5EL8A 2JU5A 2P5RA 2VLVA 1B48A 2REMA 2CZ3A 1OE7A 5J41A 3PH9A 2FGXA 1O81A 3F63A 1ST9A 3ZREA 2X8CA 1YEXA 3TKPA 3A5WA 2A2PA 1O8WA 2GGTA 1OE8A 4NAXA 3WGDA 3VWVA 1N8JA 1GSYA 5J4UA 1G6YA 2I1UA 1AAZA 1XWAA 3TCOA 4IJIA 2TRCP 1UN2A 5LCZA 1XWBA 5D93A 2YV9A 3VPQA 3ME7A 4EIPA 6GSXA 4ZB8A 3LW9A 4KB3A 5F05A 3N5OA 4PXOA 1A0FA 2H01A 2VL2C 2HZFA 5HFGA 4NV5A 2AV4A 2A4HA 3MNGA 3UVHA 4ML6A 3QOUA 3GA4A 5IMVA 1Z9HA 4POKA 2LUSA 2BMXA 4IVFA 4EE0A 4NWYA 5G1KA 3GSSA 1ZOFA 4XRDA 4RUVA 5G5FA 2XPEA 3GTUB 4MA9A 4TKYA 5E59A 4DSSA 1OKDA 1GLPA 1PX7A 2WFCA 3QAGA 1TU7A 2AJQB 1HNAA 4MABA 2H0HA 3FKFA 2N5BA 2EC4A 1M2BA 3JCML 2IN3A 3HVSA 3ISOA 4PNFA 2YPMA 2H66A 1F9MA 4G9HA 1GULA 3KH7A 3TOUA 7GSSA 1ZYNA 1VF4A 2GZYA 4O92A 2DMLA 3CBUA 1JHBA 2H1BA 5G5EA 1IYHA 4MCUA 4OO4A 2EIQA 2OBKA 4F0CA 1HD2A 1E2YA 3FR6A 2R5GA 3EINA 5H5QA 4MF7A 4ULXA 3CTGA 5GZZB 3IV4A 2VL2A 1M7TA 3G7JA 1W89A 2VD1A 2GZZA 4QQ7A 3H8QA 3IHGA 1E6BA 3EURA 3M0FA 1TRVA 4XS1A 5H5RA 2PVOC 1XWGA 3KCMA 3TUEA 1FOVA 2VM1A 4YQMA 2DJ1A 4TR0A 2LJRA 2HSHA 2QA1A 1SENA 17GSA 4OMVA 2JSYA 4ZL9A 1V58A 3DGQA 1TI1A 1ABAA 1ZYQB 1YKAA 3G7YA 4J57E 4AJ6A 3KMOA 2GSRA 3M8NA 4HJ2A 4TOPA 1YY7A 3FZAA 3FZ5A 4FH8A 3UBLA 2LQOA 1EV9A 4CW9A 2H19A 1EV4A 4KDXA 3KMNA 4I97A 1U88A 4ZB6A 3KH9A 5DJLA 1TRWA 4DSQA 2RM5A 3UIWA 4TRXA 1K0CA 1TRUA 2P31A 2XPDA 3TJGA 1SKWB 1KBNA 1GSUA 1NHOA 2PVQA 1XW9A 2VLUA 3H4KA 3KZQA 2GT5A 3C7MA 4N10A 4WETA 5A4WA 2GQMA 3EPTA 2DKHA 2E7PA 1U87A 4BA7A 1X5CA 2GSSA 18GSA 1TDIA 2ALBA 4ZIJA 4BVXA 2L57A 2LJKA 5C00A 2LJAA 5JCGA 3A5IA 1QXHA 5CYYA 4V2LA 2WZ9A 2VO4A 1T00A 4IGJA 1Z3EA 4HQZA 4OFMA 2A2SA 3TGZA 2A4VA 2AAWA 3FR3A 3GSTA 4BVYA 2OE1A 1EP7A 3NZNA 1G6WA 1DSBA 1TRSA 3RHCA 2EIOA 4NHZA 2HLSA 2XHFA 1TKDB 3BOAA 3C71A 1AQVA 1SJ6A 5CRWA 2O85A 2N5AA 3TB2A 3MDKA 1G0TA 2YCDA 1FO5A 3WD6A 3KXOA 3FY7A 1AW9A 2DSAA 2VLTA 4G19A 3IE3A 4IP1A 2FA4A 5ECOB 2H71A 1XOAA 5GSSA 3F4TA 3ZL5A 4K2DA 1EZKA 1JZOA 3IC4A 1K3OA 1X5EA 1QK8A 16GSA 2CV4A 3CSHA 2A2RA 3K8NA 1TOFA 2H74A 1V98A 4G2EA 2VOCA 2DJKA 3GTUA 1SL2B 4ZL8A 2QA2A 3QFAC 2B3SA 2L5OA 3L9UA 4EO3A 2LTKA 4WBRD 2OE3A 2R0PA 3QR6A 1MTCA 3SBCA 4Z7XA 2K9FA 4NV2A 2MMAA 4Q5QA 2HRNA 4H86A 1SU9A 2UZ8A 3KTLA 5GAND 4G0LA 4FQUA 2WULA 3KEBA 1SJIA 6GSTA 3US3A 1GL8A 3W8SA 4KSMA 3MIXA 4V1Ap 4L0UA 1GNWA 2MZCA 3HVXA 4Z2RA 2F8AA 1PL1A 3M3MA 4CHSA 2CVDA 3L9SA 4OCEA 4EDYA 1I5GA 4OD7A 2FUG2 2KP1A 4HI7A 4YAVA 1FVJA 2ZNMA 1WIKA 4WXTA 1DE2A 1PGTA 5J9BA 1R5PA 2F51A 3M9JA 4ZILA 4MJBA 3KGKA 4Q5NA 3VPTA 4F82A 1G7OA 2GS3A 3G9BA 2H8LA 1ERUA 2PU9C 1LJRA 4IQAA 2M72A 2V2GA 1XCCA 1XIYA 1F3AA 4K0NA 3WGEA 2FLSA 1F3BA 1GSSA 5ECKB 3QMXA 4LLRA 2KLXA 2C4JA 6GSSA 2OA7A 4ILFA 3QFBC 2X8HA 3N9JA 2VAFA 4XS4B 4JR4A 4FYCA 2FA8A 4KAEA 1MD3A 4DSRA 4XIHA 5C04A 2YP6A 4CY8A 5EY6A 3DVWA 3GX0A 1WPIA 3IAM2 1NSWA 4IHUA 4NXIA 3BCIA 2LS5A 1O73A 3GKMA 2WB9A 4YH2A 4KCEA 1GWCA 4IKHA 3LXTA 2FY6A 1OC3A 1O85A 5JWRB 2FWGA 2IMIA 3LSZA 5HR2A 4F9ZA 1QUWA 2GTUA 1K0MA 2IMKA 5F0GA 3UAPA 3WGXA 4PNGA 1A8YA 3ZTLA 2R0CA 2YNXA 3GHAA 2L59A 4ZBBA 5L71A 3MSZA 2QKEA 3ED3A 5CREA 1HYUA 2FHEA 4LMWA 4Q5RA 2EIRA 1XBSA 1PKWA 5D73A 3NIVA 3D22A 3O76A 2LRTA 4L5LA 2B6MA 1M2AA 1RQMA 3ZFBA 2V6KA 1R7HA 4FIWA 1YDKA 3FMWA 1HQOA 4WF4A 5FHIA 2H1AA 1VRSD 3DXBA 3ZITA 3R3EA 3FEUA 3HXSA 2V6OA 4ECBA 2H70A 3UEMA 22GSA 1A8LA 1W4VA 3RDWA 19GSA 4ID0A 4WEYA 4N30A 4YKFA 1SKSB 4HOJA 3DWVA 1VF3A 3ERWA 2RLIA 3Q18A 4K7IA 3IHQA 3PGTA 4MZBA 2X64A 1GSDA 1JLWA 2H1DA 4X0XA 1WJKA 2C3TA 1V40A 2I9HA 3L0HA 3VWXA 4GF0A 5DCHA 2AUVA 4G0KA 4BPYA 3F0IA 2OJLA 3FK8A 5IPHA 2QSIA 4ML1A 2DJ0A 1SD8A 1KEBA 5CAXA 4OO5A 5DCGA 1GSFA 2JZRA 1QGVA 5KN3A 4TW5A 2L5LA 2C0FA 4RI6A 1JZRA 2C0DA 1OC8A 2MBSA 3A2WA 1SYRA 4YKGA 2NDOA 5IMCA 3TKSE 3IK9A 3Q19A 3VI5A 2LRNA 1UVZA 4IS0A 4A5PA 3HHVA 5KN2A 1QQ2A 3ZZXA 2WJUA 2H76A 4GXZA 4L0WA 4D73B 4RQXA 4J2FA 4F2IA 4K0GA 2E0QA 3LJRA 3RHBA 5B8BA 1R26A 1J0FA 1EGRA 3UARA 1GTIA 3FZ9A 5IO0A 5AIVA 3QAWA 3IRAA 2BTOT 5AN1A 3H93A 4ZBAA 1HNCA 1RK4A 3IAS2 2KHPA 3F4SA 2LEGA 4NHWA 4BWSA 4RI7A 1GSQA 4MH3A 5IMDA 4IN0A 1M9AA 1THOA 3M9KA 3F3RA 2IMFA 1PN9A 2NVLA 3NOFA 2LSTA 2K6VA 1K0NA 3BCKA 3HZ8A 4HJMA 2HSMA 3L9VA 4TR1B 2VUPA 5HFKA 4POBA 3CTFA 4F0BA 1SK1A 2JACA 5H5SA 2MMZA 3EVIA 2DJ3A 4V2NA 5EVOA 4ECCA 4WKWA 5KOXA 4XHMA 1ZZYA 3J7Yk 2C1YA 4HS1A 1DBYA 3IR4A 4NPBA 2AYTA 1A23A 1KNGA 1MD4A 3TKQA 1XPVA 2AHEA 4XS4A 2B5XA 2FNOA 3F8UA 1X0RA 4PUAA 4V2MA 4EL1A 3HDCA 5B8AA 4EKZA 3C1SA 1PQNA 2TRXA 4WR4A 3FW2A 3QAVA 3BD2A 3DKSA 4GSNA 5INYA 3D4MA 4FYUA 3WT1A 4PURA 3QDNA 4BWQA 3KIJA 3W8JA 4FYBA 1XW6A 4KA0A 3HZ4A 5DAKB 1TU8A 2VCXA 2B1LA 3GL5A 4IW9A 4K9ZA 2NPBA 3A2VA 5F07A 2ES7A 2IWTA 1SD9A 5HFIA 3Q74A 3O3TA 2H0GA 4HQSA 11GSA 3ZVJD 2FWHA 5IM9A 1EOHA 1EWXA 4GWRA 3UOMA 2X8GA 1MEKA 3H1NA 1FVKA 2LKUA 3VFIA 2C0EA 1T1VA 2VL9A 3RAZA 1ZYPA 4TXOB 2HE3A 4TR3A 5DALB 5KEJA 3RPNA 1PD21 4KDUA 1ML6A 1AQWA 3E9JB 3TJKA 5ECRB 1XFLA 1Z7RA 3MAKA 4KF9A 2IFQB 4AJ8A 2FWFA 2DLXA 2GQLA 4EIQA 4E8EA 5ID2B 1K0AA 3ERGA 5ECIB 3TJJA 3I9V2 3ZLPA 1SL1B 3LG6A 2H0IA 5DBQA 1F37A 3LEFA 5JCWA 4ISDA 1Z6MA 5ELAA 2CZ2A 4CY6A 1T3BA 2C80A 3CRUA 4GSSA 3DRNA 2HFDA 4O5QA 5CRDA 4G0IA 1TJDA 4JR6A 4GQFA 3EU4A 5ECQB 3KP9A 3QPMA 1X5DA 3EU3A 1ACVA 6GSVA 1T7PB 1ILOA 2LNTA 5DDLA 2H30A 4AF2A 2HT9A 4JBBA 3BBYA 3TRQA 3VK9A 2CVBA 14GSA 1S3CA 9GSSA 2RIIA 4HUAA 3VLNA 5FT3A 1G7EA 5E4WA 5D9XA 4FO5A 3KTBA 1GSEA 5J5NA 5IPGA 2XBQA 1ON4A 5J3RA 3VWWA 2WDUA 2DBCA 5IMFA 2HRAA 1K0BA 3D5JA 2GSQA 1BQ7A 2OBIA 3G7IA 4HEA2 2VL3A 3LFLA 1YZXA 3HCZA 3L78A 1RW1A 2DJJA 3AY8A 1FAAA 4MLYA 1ZL9A 1O6JA 2OACA 3ZRDA 2O89A 2IPAA 3FYGA 2CX3A 2HZEB 2YN1A 1PSQA 2DJ2A 4MDCA 4D73A 3TJBA 4I2UA 2GLRA 3GH9A 1GRXA 3U5RE 2CX4A 3LWAA 5JWQB 4QL9A 1VGLA 4K8MA 4PGTA 2GSTA 5HQPA 2VCVA 3F4RA 2L6DA 1X9WB 4O5UA 4L5OA 2H6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OR5 A;  4KDY A;  4E8H A;  1OAZ A;  2OKA A;  3HY2 A;  2B5Y A;  4X43 A;  4I6X A;  1Q98 A;  3DVX A;  3IDV A;  5GST A;  1B9X C;  2HSY A;  1Z7P A;  5IMZ A;  2VIM A;  1R4W A;  3CYN A;  4N0V A;  3GV1 A;  3RBT A;  5A4U A;  2GVP A;  3V1W A;  4GST A;  2VCZ A;  3I69 A;  2PPT A;  4TR1 A;  1BAY A;  2F9S A;  3D6I A;  4HDE A;  4OWY A;  3R2Q A;  2VCW A;  3C1R A;  3CMI A;  4LMV A;  5B6N A;  2YJH A;  1A0R P;  3WT2 A;  4MJC A;  5JWO B;  2F8F A;  1YF1 A;  2VCT A;  5J9C A;  4X1U A;  1S3A A;  4JU5 A;  1KTE A;  3CXG A;  1Z5Y E;  3Q6O A;  1ERW A;  2C3N A;  2YZU A;  4IQ1 A;  4PUF C;  1GP1 A;  3GX8 A;  1ZCP A;  5ECS A;  3F9U A;  1TK5 B;  1ZMA A;  1XVQ A;  3ZFL A;  2KOK A;  2H1G A;  3ZIJ A;  1OC9 B;  1AC1 A;  4XS6 A;  2GDR A;  4KGI A;  3A2X A;  4EF0 A;  3P2A A;  2QC7 A;  1H4O A;  4EVM A;  4POM A;  5AIX A;  1YF0 A;  5DAK A;  3VWU A;  3UVT A;  4JED A;  3PR8 A;  4MF5 A;  1WP0 A;  1EP8 A;  13GS A;  6GSY A;  2G2Q A;  4PQH A;  3KP8 A;  2PER A;  4JE1 A;  2OE0 A;  4GCI A;  1SK2 A;  2YWN A;  1UC7 A;  3ZIV A;  3HJM A;  4TXO A;  4KW6 A;  5DAL A;  5F06 A;  5ECM B;  4EDZ A;  3GMF A;  5KN0 A;  3ZML A;  3S9F A;  4XTS A;  2B5E A;  5IOX A;  1ERT A;  2PGT A;  3KD0 A;  1YJ6 A;  2PUK C;  2XC2 A;  3ZVJ A;  2IFQ A;  3VI7 A;  5ID2 A;  4KND A;  5ECP B;  2R37 A;  2R4V A;  1JFU A;  5IIZ A;  3I43 A;  2YJ7 A;  5EPF A;  3TJF A;  4IBP A;  3FZ4 A;  2RUE A;  5ABR A;  1IYI A;  3D21 A;  2B7K A;  4EC0 A;  1S3D A;  1X9M B;  4KSO A;  5IOW A;  3HKR A;  4KCA A;  3CSI A;  3D4T A;  2YWM A;  3KJY A;  1EEM A;  3IXR A;  5G1L A;  2MMO A;  2CVK A;  3J7Y b;  2J9H A;  4HU9 A;  3DML A;  4J56 E;  4P3Y B;  1GUK A;  4K7N A;  2I4A A;  2JL4 A;  1U3I A;  2JZS A;  1DUG A;  5B6M A;  1BX9 A;  1N2A A;  5CRG A;  1GUH A;  2I81 A;  1F6M C;  1PMT A;  1R5A A;  6GSW A;  3TKS C;  2WGR A;  1OYJ A;  3A3T A;  2M46 A;  1NM3 A;  2QGV A;  1VF2 A;  4MP4 A;  1QMV A;  1JZD A;  1JLV A;  2E2G A;  4Q5F A;  3EC3 A;  1ZGN A;  3ZYW A;  4O5R A;  2HZE A;  3P90 A;  5F8B A;  3F6F A;  3UMA A;  2XBI A;  4YQU A;  12GS A;  5ELG A;  1AUC A;  5COH A;  3HJO A;  4RQR A;  5FWG A;  2JAD A;  1B9Y C;  3C73 A;  3IA1 A;  2WRT A;  1NHY A;  1XWC A;  3GN3 A;  4K6X A;  2R6K A;  4XCS A;  5KN1 A;  2R3X A;  3HYP A;  1BED A;  4MJE A;  5B7C A;  2D2Z A;  1EGO A;  2G0F A;  1HNB A;  4MF6 A;  5GAP D;  3IBH A;  1SKR B;  1AIU A;  1M0U A;  1BJX A;  1WMJ A;  3GKK A;  2DIY A;  1GH2 A;  3GUS A;  4MK3 A;  1URM A;  4KH7 A;  4ECJ A;  3APO A;  5A4V A;  1A24 A;  2IL3 A;  1WRY A;  2YAN A;  4LL1 B;  1X9S B;  4WBJ A;  2DIZ A;  5ECL B;  5G31 A;  2ZCT A;  3ME8 A;  2C0G A;  2P0G A;  2YWI A;  2FD3 A;  3TRX A;  3TOT A;  1SL0 B;  1T4Y A;  5G30 A;  2V32 A;  2ON5 A;  2CAI A;  2B1K A;  1DE1 A;  2V41 A;  3CRT A;  3DEX A;  1QFN A;  5DJM A;  3TDG A;  5IO2 A;  2BJX A;  1Y25 A;  5DQY A;  3GKN A;  3LXZ A;  2ON7 A;  5HR3 A;  2IJY A;  1GUM A;  1ERV A;  3UJ1 A;  3TKS A;  1TP9 A;  3TRP A;  3VUR A;  1THX A;  4EXJ A;  4JZQ A;  2VD0 A;  2K18 A;  1A2L A;  4IEL A;  2N5F A;  3IOS A;  1YEP A;  2MBT A;  1WWJ A;  2AB6 A;  1VF1 A;  2PWJ A;  2TIR A;  1GNE A;  4WR5 A;  1BG5 A;  2PBJ A;  1OC9 A;  2C8U A;  3EYT A;  3SWL A;  2CA8 A;  3GKX A;  1A2M A;  3ERF A;  1LBK A;  3MWH A;  4ACS A;  1GLQ A;  1A2J A;  1WE0 A;  4TVE A;  1XWK A;  4CDO A;  1YQ1 A;  5ECH B;  1Y6E A;  3BJ5 A;  2PMT A;  2PN8 A;  3IPZ A;  2RM6 A;  3HJP A;  1FW1 A;  2CAQ A;  5DVB A;  2O8V B;  3E3E A;  8GSS A;  4O32 A;  2KP2 A;  3DD3 A;  2RUF A;  4WF5 A;  2K8V A;  3LQ7 A;  5LD0 A;  1V2A A;  2O7K A;  2LNS A;  3UL3 A;  3DIE A;  3APQ A;  3RPP A;  3D0Z A;  5CNW A;  2WCI A;  4KX4 A;  4F03 A;  3LYP A;  3QD9 A;  2HNL A;  2WS2 A;  2OAD A;  2H6Y A;  4IJ3 A;  1FHE A;  2K8S A;  3E0U A;  4NMU A;  4GLT A;  1M99 A;  5G2Z A;  1TW9 A;  3GH6 A;  4ECI A;  3F6D A;  1F2E A;  1EEJ A;  1K3Y A;  2CQ9 A;  3P8W A;  5CP1 A;  2HXK A;  4HU7 A;  5JCU A;  5AGY A;  1TTZ A;  5CRH A;  10GS A;  5ENU A;  4MH2 A;  4IP6 A;  1BYE A;  1O8X A;  4HZ2 A;  2GQK A;  1V57 A;  3EWL A;  4I2T A;  2YZH A;  3GNJ A;  2H73 A;  3EMX A;  4MPF A;  3GUR A;  4G10 A;  2LRC A;  1EOG A;  1NW2 A;  2B7J A;  2NBS A;  4POL A;  4MJA A;  1M9B A;  1YKC A;  4V1A g;  2VCQ A;  2M80 A;  3U6V A;  3APS A;  4OCF A;  1C72 A;  3TKR A;  4GTU A;  4KUN A;  3IK7 A;  1U3A A;  3LOR A;  1TK8 B;  1K0O A;  3GRX A;  1B8X A;  4PX1 A;  2LQQ A;  1XW5 A;  1B4Q A;  1XVW A;  3GIX A;  2KUC A;  1T8E B;  1FB0 A;  3DYR A;  1XXU A;  1ZYE A;  2L4C A;  2MMN A;  2Z9S A;  1LU4 A;  5IMA A;  4LA1 A;  1PA3 A;  4MZC A;  1TXX A;  2HYX A;  4I5Q A;  3M1G A;  4DEJ A;  20GS A;  3P7X A;  2YOI A;  4AJ7 A;  1Q4J A;  4KE3 A;  1AQX A;  2VM2 A;  5IQY A;  2YV7 A;  4I8B A;  4XRA A;  4K7O A;  4EUY A;  2JZT A;  3WYW A;  4DSS B;  6GSU A;  1T4Z A;  5A5K A;  2YWO A;  3O6T A;  4ZB9 A;  4BL7 A;  3C8E A;  2FWE A;  1MDI A;  5D9V A;  4AGS A;  1XZO A;  1JZW A;  1GTB A;  4OFT A;  2H6Z A;  5CO3 A;  4N11 A;  3W6G A;  1PL2 A;  1XOB A;  1FB6 A;  2FCH A;  1SK0 A;  3KM6 A;  4JRR A;  5D9T A;  4MMM A;  3I6A A;  1J9B A;  2R2J A;  1WOU A;  2L4Q A;  1U6T A;  4PQ1 A;  4HZ4 A;  3H79 A;  1UA5 A;  4MZW A;  1MDK A;  1K3L A;  2HRF A;  5DQS A;  3GFK A;  3LGC A;  5HR0 A;  3GYK A;  2DC5 A;  4YQV A;  2L6C A;  1K0D A;  3QCP A;  4YAP A;  5HR1 A;  3ZMK A;  5LNK e;  2DMM A;  1PX6 A;  2HI7 A;  4K1F A;  5ECN B;  5D9W A;  1Z6N A;  4OFN A;  4TR4 A;  3EMP A;  3GL3 A;  1OVN A;  5AIS A;  1OKT A;  1PKZ A;  1MDJ A;  2ZUP A;  1TI3 A;  4DVC A;  3FRC A;  4MPG A;  2V1M A;  2IIY A;  2J23 A;  3FR9 A;  2O87 A;  3HD5 A;  4ZXG A;  3L4N A;  4GQC A;  1GTU A;  3UBK A;  4QL7 A;  4N0Z A;  1O7U A;  4O7H A;  1TK0 B;  1SYX A;  3HA9 A;  2H72 A;  1SJZ A;  2E2M A;  3EE2 A;  2IMD A;  1GTA A;  2NTO A;  1M2D A;  5D96 A;  2GT6 A;  2MYG A;  3F3Q A;  4TXV A;  4PQI A;  1CQG A;  4ZBD A;  1V9W A;  1FG4 A;  2IME A;  2GZP A;  1AXD A;  3LYK A;  2P5Q A;  2F3M A;  5D8I A;  3HVV A;  1H75 A;  4LL4 B;  4ZL7 A;  1J08 A;  2I3Y A;  2C3Q A;  2H75 A;  3PIN A;  1USB A;  4L8E A;  1B4P A;  1PRX A;  2LV3 A;  2X99 A;  1I9D A;  2JSZ A;  1CQH A;  4TN8 A;  2CT6 A;  4GRF A;  3FHK A;  3CSJ A;  5EL8 A;  2JU5 A;  2P5R A;  2VLV A;  1B48 A;  2REM A;  2CZ3 A;  1OE7 A;  5J41 A;  3PH9 A;  2FGX A;  1O81 A;  3F63 A;  1ST9 A;  3ZRE A;  2X8C A;  1YEX A;  3TKP A;  3A5W A;  1O8W A;  2GGT A;  1OE8 A;  4NAX A;  3WGD A;  3VWV A;  1N8J A;  1GSY A;  5J4U A;  1G6Y A;  2I1U A;  1AAZ A;  1XWA A;  3TCO A;  4IJI A;  2TRC P;  1UN2 A;  5LCZ A;  1XWB A;  5D93 A;  2YV9 A;  3VPQ A;  3ME7 A;  6GSX A;  4ZB8 A;  4KB3 A;  5F05 A;  3N5O A;  4PXO A;  1A0F A;  2H01 A;  2VL2 C;  2HZF A;  5HFG A;  4NV5 A;  2AV4 A;  3MNG A;  3UVH A;  4ML6 A;  3QOU A;  3GA4 A;  5IMV A;  1Z9H A;  4POK A;  2LUS A;  2BMX A;  4IVF A;  4EE0 A;  4NWY A;  5G1K A;  3GSS A;  1ZOF A;  4XRD A;  4RUV A;  5G5F A;  2XPE A;  3GTU B;  4MA9 A;  4TKY A;  5E59 A;  4DSS A;  1OKD A;  1GLP A;  1PX7 A;  2WFC A;  3QAG A;  1TU7 A;  2AJQ B;  1HNA A;  4MAB A;  2H0H A;  3FKF A;  2N5B A;  2EC4 A;  1M2B A;  3JCM L;  2IN3 A;  3HVS A;  3ISO A;  4PNF A;  2YPM A;  2H66 A;  1F9M A;  4G9H A;  1GUL A;  3KH7 A;  3TOU A;  7GSS A;  1VF4 A;  2GZY A;  4O92 A;  2DML A;  3CBU A;  1JHB A;  2H1B A;  5G5E A;  1IYH A;  4MCU A;  4OO4 A;  2EIQ A;  2OBK A;  4F0C A;  1HD2 A;  1E2Y A;  3FR6 A;  2R5G A;  3EIN A;  5H5Q A;  4MF7 A;  4ULX A;  3CTG A;  5GZZ B;  3IV4 A;  2VL2 A;  1M7T A;  3G7J A;  1W89 A;  2VD1 A;  2GZZ A;  4QQ7 A;  3H8Q A;  1E6B A;  3EUR A;  3M0F A;  1TRV A;  4XS1 A;  5H5R A;  2PVO C;  1XWG A;  3KCM A;  3TUE A;  1FOV A;  2VM1 A;  4YQM A;  2DJ1 A;  4TR0 A;  2LJR A;  2HSH A;  1SEN A;  17GS A;  4OMV A;  2JSY A;  4ZL9 A;  1V58 A;  3DGQ A;  1TI1 A;  1ABA A;  1ZYQ B;  1YKA A;  3G7Y A;  4J57 E;  4AJ6 A;  3KMO A;  2GSR A;  3M8N A;  4HJ2 A;  4TOP A;  1YY7 A;  3FZA A;  3FZ5 A;  4FH8 A;  3UBL A;  2LQO A;  1EV9 A;  4CW9 A;  2H19 A;  1EV4 A;  4KDX A;  3KMN A;  4I97 A;  1U88 A;  4ZB6 A;  3KH9 A;  5DJL A;  1TRW A;  4DSQ A;  2RM5 A;  3UIW A;  4TRX A;  1K0C A;  1TRU A;  2P31 A;  2XPD A;  3TJG A;  1SKW B;  1KBN A;  1GSU A;  1NHO A;  2PVQ A;  1XW9 A;  2VLU A;  3H4K A;  3KZQ A;  2GT5 A;  3C7M A;  4N10 A;  4WET A;  5A4W A;  2GQM A;  2E7P A;  1U87 A;  4BA7 A;  1X5C A;  2GSS A;  18GS A;  1TDI A;  2ALB A;  4ZIJ A;  4BVX A;  2L57 A;  2LJK A;  5C00 A;  2LJA A;  5JCG A;  1QXH A;  5CYY A;  4V2L A;  2WZ9 A;  2VO4 A;  1T00 A;  4IGJ A;  1Z3E A;  4HQZ A;  4OFM A;  2A2S A;  3TGZ A;  2A4V A;  2AAW A;  3FR3 A;  3GST A;  4BVY A;  2OE1 A;  1EP7 A;  3NZN A;  1G6W A;  1DSB A;  1TRS A;  3RHC A;  2EIO A;  4NHZ A;  2HLS A;  2XHF A;  1TKD B;  3BOA A;  3C71 A;  1AQV A;  1SJ6 A;  5CRW A;  2O85 A;  2N5A A;  3TB2 A;  3MDK A;  1G0T A;  2YCD A;  1FO5 A;  3WD6 A;  3KXO A;  3FY7 A;  1AW9 A;  2DSA A;  2VLT A;  4G19 A;  3IE3 A;  4IP1 A;  2FA4 A;  5ECO B;  2H71 A;  1XOA A;  5GSS A;  3F4T A;  3ZL5 A;  4K2D A;  1EZK A;  1JZO A;  3IC4 A;  1K3O A;  1X5E A;  1QK8 A;  16GS A;  2CV4 A;  3CSH A;  2A2R A;  3K8N A;  1TOF A;  2H74 A;  1V98 A;  4G2E A;  2VOC A;  2DJK A;  3GTU A;  1SL2 B;  4ZL8 A;  3QFA C;  2B3S A;  2L5O A;  3L9U A;  4EO3 A;  2LTK A;  4WBR D;  2OE3 A;  3QR6 A;  1MTC A;  3SBC A;  4Z7X A;  2K9F A;  4NV2 A;  2MMA A;  4Q5Q A;  2HRN A;  4H86 A;  1SU9 A;  3KTL A;  5GAN D;  2WUL A;  3KEB A;  1SJI A;  6GST A;  3US3 A;  1GL8 A;  3W8S A;  4KSM A;  4V1A p;  4L0U A;  1GNW A;  2MZC A;  3HVX A;  2F8A A;  1PL1 A;  3M3M A;  4CHS A;  2CVD A;  3L9S A;  4OCE A;  4EDY A;  1I5G A;  4OD7 A;  2FUG 2;  2KP1 A;  4HI7 A;  4YAV A;  1FVJ A;  2ZNM A;  1WIK A;  4WXT A;  1DE2 A;  1PGT A;  5J9B A;  1R5P A;  2F51 A;  3M9J A;  4ZIL A;  4MJB A;  3KGK A;  4Q5N A;  3VPT A;  4F82 A;  1G7O A;  2GS3 A;  3G9B A;  2H8L A;  1ERU A;  2PU9 C;  1LJR A;  4IQA A;  2M72 A;  2V2G A;  1XCC A;  1XIY A;  1F3A A;  4K0N A;  3WGE A;  2FLS A;  1F3B A;  1GSS A;  5ECK B;  3QMX A;  4LLR A;  2KLX A;  2C4J A;  6GSS A;  2OA7 A;  4ILF A;  3QFB C;  2X8H A;  3N9J A;  2VAF A;  4XS4 B;  4JR4 A;  4FYC A;  2FA8 A;  4KAE A;  1MD3 A;  4DSR A;  4XIH A;  5C04 A;  2YP6 A;  5EY6 A;  3DVW A;  3GX0 A;  1WPI A;  3IAM 2;  1NSW A;  4IHU A;  4NXI A;  3BCI A;  2LS5 A;  1O73 A;  3GKM A;  2WB9 A;  4YH2 A;  4KCE A;  1GWC A;  4IKH A;  3LXT A;  2FY6 A;  1OC3 A;  1O85 A;  5JWR B;  2FWG A;  2IMI A;  3LSZ A;  5HR2 A;  4F9Z A;  1QUW A;  2GTU A;  1K0M A;  2IMK A;  5F0G A;  3UAP A;  3WGX A;  4PNG A;  1A8Y A;  3ZTL A;  2YNX A;  3GHA A;  2L59 A;  4ZBB A;  5L71 A;  3MSZ A;  2QKE A;  3ED3 A;  5CRE A;  1HYU A;  2FHE A;  4LMW A;  4Q5R A;  2EIR A;  1XBS A;  1PKW A;  5D73 A;  3NIV A;  3D22 A;  3O76 A;  2LRT A;  4L5L A;  2B6M A;  1M2A A;  1RQM A;  3ZFB A;  2V6K A;  1R7H A;  4FIW A;  1YDK A;  1HQO A;  4WF4 A;  5FHI A;  2H1A A;  1VRS D;  3DXB A;  3ZIT A;  3FEU A;  3HXS A;  2V6O A;  4ECB A;  2H70 A;  3UEM A;  22GS A;  1A8L A;  1W4V A;  3RDW A;  19GS A;  4ID0 A;  4WEY A;  4N30 A;  1SKS B;  4HOJ A;  3DWV A;  1VF3 A;  3ERW A;  2RLI A;  3Q18 A;  4K7I A;  3IHQ A;  3PGT A;  4MZB A;  2X64 A;  1GSD A;  1JLW A;  2H1D A;  4X0X A;  1WJK A;  2C3T A;  1V40 A;  2I9H A;  3L0H A;  3VWX A;  4GF0 A;  5DCH A;  2AUV A;  4BPY A;  3F0I A;  2OJL A;  3FK8 A;  5IPH A;  2QSI A;  4ML1 A;  2DJ0 A;  1SD8 A;  1KEB A;  5CAX A;  4OO5 A;  5DCG A;  1GSF A;  2JZR A;  1QGV A;  5KN3 A;  4TW5 A;  2L5L A;  2C0F A;  4RI6 A;  1JZR A;  2C0D A;  1OC8 A;  2MBS A;  3A2W A;  1SYR A;  2NDO A;  5IMC A;  3TKS E;  3IK9 A;  3Q19 A;  3VI5 A;  2LRN A;  1UVZ A;  4IS0 A;  3HHV A;  5KN2 A;  1QQ2 A;  3ZZX A;  2WJU A;  2H76 A;  4GXZ A;  4L0W A;  4D73 B;  4RQX A;  4J2F A;  4F2I A;  4K0G A;  2E0Q A;  3LJR A;  3RHB A;  5B8B A;  1R26 A;  1J0F A;  1EGR A;  3UAR A;  1GTI A;  3FZ9 A;  5IO0 A;  5AIV A;  3QAW A;  3IRA A;  2BTO T;  5AN1 A;  3H93 A;  4ZBA A;  1HNC A;  1RK4 A;  3IAS 2;  2KHP A;  3F4S A;  2LEG A;  4NHW A;  4BWS A;  4RI7 A;  1GSQ A;  4MH3 A;  5IMD A;  4IN0 A;  1M9A A;  1THO A;  3M9K A;  3F3R A;  2IMF A;  1PN9 A;  2NVL A;  3NOF A;  2LST A;  2K6V A;  1K0N A;  3BCK A;  3HZ8 A;  4HJM A;  3L9V A;  4TR1 B;  2VUP A;  5HFK A;  4POB A;  3CTF A;  4F0B A;  1SK1 A;  2JAC A;  5H5S A;  2MMZ A;  3EVI A;  2DJ3 A;  4V2N A;  5EVO A;  4ECC A;  4WKW A;  4XHM A;  1ZZY A;  3J7Y k;  2C1Y A;  4HS1 A;  1DBY A;  3IR4 A;  4NPB A;  2AYT A;  1A23 A;  1KNG A;  1MD4 A;  3TKQ A;  1XPV A;  2AHE A;  4XS4 A;  2B5X A;  2FNO A;  3F8U A;  1X0R A;  4PUA A;  4V2M A;  4EL1 A;  3HDC A;  5B8A A;  4EKZ A;  3C1S A;  1PQN A;  2TRX A;  4WR4 A;  3FW2 A;  3QAV A;  3BD2 A;  3DKS A;  4GSN A;  5INY A;  3D4M A;  4FYU A;  3WT1 A;  4PUR A;  3QDN A;  4BWQ A;  3KIJ A;  3W8J A;  4FYB A;  1XW6 A;  4KA0 A;  3HZ4 A;  5DAK B;  1TU8 A;  2VCX A;  2B1L A;  3GL5 A;  4IW9 A;  4K9Z A;  2NPB A;  5F07 A;  3A2V A;  2ES7 A;  2IWT A;  1SD9 A;  5HFI A;  3Q74 A;  3O3T A;  2H0G A;  4HQS A;  11GS A;  3ZVJ D;  2FWH A;  5IM9 A;  1EOH A;  1EWX A;  4GWR A;  3UOM A;  2X8G A;  1MEK A;  3H1N A;  1FVK A;  2LKU A;  3VFI A;  2C0E A;  1T1V A;  2VL9 A;  3RAZ A;  4TXO B;  2HE3 A;  4TR3 A;  5DAL B;  5KEJ A;  3RPN A;  1PD2 1;  4KDU A;  1ML6 A;  1AQW A;  3E9J B;  3TJK A;  5ECR B;  1XFL A;  1Z7R A;  3MAK A;  2IFQ B;  4AJ8 A;  2FWF A;  2DLX A;  2GQL A;  4E8E A;  5ID2 B;  1K0A A;  3ERG A;  5ECI B;  3TJJ A;  3I9V 2;  3ZLP A;  1SL1 B;  3LG6 A;  2H0I A;  5DBQ A;  1F37 A;  3LEF A;  5JCW A;  4ISD A;  1Z6M A;  5ELA A;  2CZ2 A;  1T3B A;  2C80 A;  3CRU A;  4GSS A;  3DRN A;  2HFD A;  5CRD A;  1TJD A;  4JR6 A;  4GQF A;  3EU4 A;  5ECQ B;  3KP9 A;  3QPM A;  1X5D A;  3EU3 A;  1ACV A;  6GSV A;  1T7P B;  1ILO A;  2LNT A;  5DDL A;  2H30 A;  4AF2 A;  2HT9 A;  4JBB A;  3BBY A;  3TRQ A;  3VK9 A;  2CVB A;  14GS A;  1S3C A;  9GSS A;  2RII A;  4HUA A;  3VLN A;  5FT3 A;  1G7E A;  5E4W A;  5D9X A;  4FO5 A;  3KTB A;  1GSE A;  5J5N A;  5IPG A;  2XBQ A;  1ON4 A;  5J3R A;  3VWW A;  2WDU A;  2DBC A;  5IMF A;  1K0B A;  3D5J A;  2GSQ A;  1BQ7 A;  2OBI A;  3G7I A;  4HEA 2;  2VL3 A;  3LFL A;  1YZX A;  3HCZ A;  3L78 A;  1RW1 A;  2DJJ A;  3AY8 A;  1FAA A;  4MLY A;  1ZL9 A;  1O6J A;  2OAC A;  3ZRD A;  2O89 A;  2IPA A;  3FYG A;  2CX3 A;  2HZE B;  2YN1 A;  1PSQ A;  2DJ2 A;  4MDC A;  4D73 A;  3TJB A;  4I2U A;  2GLR A;  3GH9 A;  1GRX A;  3U5R E;  2CX4 A;  3LWA A;  5JWQ B;  4QL9 A;  1VGL A;  4K8M A;  4PGT A;  2GST A;  5HQP A;  2VCV A;  3F4R A;  2L6D A;  1X9W B;  4L5O A;  2H6X A; 
#chains in the Genus database with same CATH topology
 3OR5 A;  4KDY A;  4E8H A;  1OAZ A;  2OKA A;  3HY2 A;  3MYD A;  2B5Y A;  4X43 A;  4I6X A;  1Q98 A;  3DVX A;  3IDV A;  5GST A;  1B9X C;  2HSY A;  1Z7P A;  1M3I A;  5IMZ A;  2VIM A;  1R4W A;  3CYN A;  4N0V A;  3GV1 A;  3RBT A;  5A4U A;  2GVP A;  3V1W A;  4GST A;  2VCZ A;  3I69 A;  2PPT A;  4TR1 A;  1BAY A;  2F9S A;  3D6I A;  4HDE A;  4OWY A;  3R2Q A;  2VCW A;  3C1R A;  3CMI A;  4LMV A;  5B6N A;  2YJH A;  1A0R P;  3WT2 A;  4MJC A;  5JWO B;  2F8F A;  1YF1 A;  2VCT A;  5J9C A;  4X1U A;  1S3A A;  4JU5 A;  4K5R A;  1KTE A;  3CXG A;  1Z5Y E;  3Q6O A;  1ERW A;  2C3N A;  2YZU A;  4IQ1 A;  4PUF C;  1GP1 A;  3GX8 A;  1ZCP A;  1S3R A;  5ECS A;  3F9U A;  1TK5 B;  1ZMA A;  1XVQ A;  3ZFL A;  2KOK A;  2H1G A;  3ZIJ A;  1OC9 B;  1AC1 A;  4XS6 A;  2GDR A;  4KGI A;  3A2X A;  4EF0 A;  3P2A A;  2QC7 A;  1H4O A;  4EVM A;  4POM A;  5AIX A;  1YF0 A;  5DAK A;  3VWU A;  3UVT A;  4JED A;  3PR8 A;  4MF5 A;  1WP0 A;  1EP8 A;  13GS A;  6GSY A;  2G2Q A;  4PQH A;  3KP8 A;  2PER A;  4JE1 A;  2OE0 A;  4GCI A;  1SK2 A;  2YWN A;  1UC7 A;  3ZIV A;  3HJM A;  4TXO A;  4KW6 A;  5DAL A;  5F06 A;  5ECM B;  4EDZ A;  3GMF A;  5KN0 A;  3ZML A;  3S9F A;  4XTS A;  2B5E A;  5IOX A;  1ERT A;  2PGT A;  3KD0 A;  1YJ6 A;  2PUK C;  2XC2 A;  3ZVJ A;  2IFQ A;  3VI7 A;  5ID2 A;  4KND A;  5ECP B;  2R37 A;  2R4V A;  1JFU A;  5IIZ A;  3I43 A;  2YJ7 A;  5EPF A;  3TJF A;  4IBP A;  3FZ4 A;  4Z2T A;  2RUE A;  5ABR A;  2X49 A;  1IYI A;  3D21 A;  2B7K A;  4EC0 A;  1S3D A;  1X9M B;  4KSO A;  4BVY B;  5IOW A;  3HKR A;  4KCA A;  3CSI A;  3D4T A;  2YWM A;  3KJY A;  1EEM A;  3IXR A;  5G1L A;  2MMO A;  2CVK A;  3J7Y b;  2J9H A;  4HU9 A;  3DML A;  4J56 E;  4P3Y B;  1GUK A;  4K7N A;  2I4A A;  2R0G A;  2JL4 A;  1U3I A;  2JZS A;  1DUG A;  5B6M A;  1BX9 A;  1N2A A;  5CRG A;  1FOH A;  1GUH A;  2I81 A;  1F6M C;  1PMT A;  1R5A A;  6GSW A;  3TKS C;  2WGR A;  1OYJ A;  3A3T A;  2M46 A;  1NM3 A;  2QGV A;  1VF2 A;  4MP4 A;  1QMV A;  1JZD A;  1JLV A;  2E2G A;  4Q5F A;  3EC3 A;  1ZGN A;  3ZYW A;  4O5R A;  2HZE A;  3P90 A;  5F8B A;  3F6F A;  3UMA A;  2XBI A;  4ICY A;  4YQU A;  12GS A;  5ELG A;  1AUC A;  5COH A;  3HJO A;  4RQR A;  5FWG A;  2JAD A;  1B9Y C;  3C73 A;  5BMU A;  3IA1 A;  2WRT A;  1NHY A;  1XWC A;  3GN3 A;  4K6X A;  2R6K A;  4XCS A;  5KN1 A;  2R3X A;  3HYP A;  1BED A;  4MJE A;  5B7C A;  4BL7 B;  2D2Z A;  1EGO A;  2G0F A;  1HNB A;  4MF6 A;  5GAP D;  3IBH A;  1SKR B;  1AIU A;  1M0U A;  1BJX A;  3CQF A;  1WMJ A;  3GKK A;  2DIY A;  1GH2 A;  3GUS A;  4MK3 A;  1URM A;  4KH7 A;  4ECJ A;  3APO A;  5A4V A;  1A24 A;  2IL3 A;  4BIK A;  1WRY A;  2YAN A;  4LL1 B;  1X9S B;  4WBJ A;  2DIZ A;  5ECL B;  5G31 A;  2ZCT A;  3ME8 A;  2C0G A;  1PFO A;  2P0G A;  2YWI A;  2FD3 A;  3TRX A;  3TOT A;  1SL0 B;  1T4Y A;  5G30 A;  2V32 A;  2ON5 A;  2CAI A;  2B1K A;  1DE1 A;  2V41 A;  3CRT A;  3DEX A;  1QFN A;  5DJM A;  3TDG A;  5IO2 A;  2BJX A;  1Y25 A;  5DQY A;  3GKN A;  3LXZ A;  2ON7 A;  5HR3 A;  2IJY A;  1GUM A;  1ERV A;  3UJ1 A;  3TKS A;  1TP9 A;  4K5S A;  3TRP A;  3VUR A;  1THX A;  4EXJ A;  4JZQ A;  4MNN A;  2VD0 A;  2K18 A;  1A2L A;  4IEL A;  2DKI A;  2N5F A;  3IOS A;  1YEP A;  2MBT A;  1PN0 A;  1WWJ A;  2AB6 A;  1VF1 A;  2PWJ A;  2TIR A;  1GNE A;  4WR5 A;  1BG5 A;  2PBJ A;  1OC9 A;  2C8U A;  5KOW A;  3EYT A;  3SWL A;  2HRK A;  2CA8 A;  3GKX A;  1A2M A;  3ERF A;  1LBK A;  3MWH A;  4ACS A;  1GLQ A;  1A2J A;  1WE0 A;  4TVE A;  1XWK A;  4CDO A;  1YQ1 A;  1Y6E A;  5ECH B;  3BJ5 A;  2PMT A;  2PN8 A;  3IPZ A;  2RM6 A;  3HJP A;  1FW1 A;  2CAQ A;  5DVB A;  2O8V B;  3E3E A;  8GSS A;  4O32 A;  2KP2 A;  3DD3 A;  2RUF A;  4K2X A;  4WF5 A;  2K8V A;  3LQ7 A;  5LD0 A;  1V2A A;  2O7K A;  2LNS A;  3UL3 A;  3DIE A;  3APQ A;  3RPP A;  3D0Z A;  5CNW A;  2WCI A;  4KX4 A;  4F03 A;  3LYP A;  3QD9 A;  2HNL A;  2WS2 A;  2OAD A;  2H6Y A;  4IJ3 A;  1FHE A;  2K8S A;  3E0U A;  4NMU A;  4GLT A;  1M99 A;  5G2Z A;  1TW9 A;  3GH6 A;  4ECI A;  3F6D A;  1F2E A;  1EEJ A;  1K3Y A;  2CQ9 A;  3P8W A;  5CP1 A;  2HXK A;  4HU7 A;  5JCU A;  5AGY A;  1TTZ A;  5CRH A;  10GS A;  5ENU A;  4MH2 A;  4IP6 A;  1BYE A;  1O8X A;  4HZ2 A;  2GQK A;  1V57 A;  3EWL A;  4I2T A;  2YZH A;  3GNJ A;  2H73 A;  3EMX A;  4MPF A;  3GUR A;  4G10 A;  2LRC A;  1EOG A;  1NW2 A;  2B7J A;  2NBS A;  4POL A;  4MJA A;  1M9B A;  1YKC A;  4V1A g;  2VCQ A;  2M80 A;  3U6V A;  3APS A;  4OCF A;  1C72 A;  3TKR A;  4GTU A;  4KUN A;  3IK7 A;  1U3A A;  3LOR A;  1TK8 B;  1K0O A;  3GRX A;  1B8X A;  4PX1 A;  2LQQ A;  1XW5 A;  1B4Q A;  1XVW A;  3GIX A;  2KUC A;  1T8E B;  1FB0 A;  3DYR A;  1XXU A;  1ZYE A;  2L4C A;  2MMN A;  2Z9S A;  1LU4 A;  5IMA A;  4LA1 A;  1PA3 A;  4MZC A;  1TXX A;  2HYX A;  4I5Q A;  3M1G A;  4DEJ A;  20GS A;  3P7X A;  2YOI A;  4AJ7 A;  1Q4J A;  4KE3 A;  1AQX A;  2VM2 A;  5IQY A;  2X4A A;  2YV7 A;  4I8B A;  4XRA A;  4K7O A;  4EUY A;  2JZT A;  3WYW A;  4DSS B;  6GSU A;  1T4Z A;  5A5K A;  2YWO A;  3O6T A;  4ZB9 A;  4BL7 A;  3C8E A;  2FWE A;  1MDI A;  5D9V A;  4AGS A;  1XZO A;  1JZW A;  1GTB A;  4OFT A;  2H6Z A;  5CO3 A;  4N11 A;  3W6G A;  1PL2 A;  1XOB A;  1FB6 A;  2FCH A;  1SK0 A;  3KM6 A;  4JRR A;  5D9T A;  4MMM A;  3I6A A;  1J9B A;  2R2J A;  1WOU A;  2L4Q A;  1U6T A;  4PQ1 A;  4HZ4 A;  3H79 A;  1UA5 A;  4MZW A;  1MDK A;  1K3L A;  2HRF A;  5DQS A;  3GFK A;  3LGC A;  5HR0 A;  3GYK A;  2DC5 A;  4YQV A;  2L6C A;  1K0D A;  3QCP A;  4YAP A;  5HR1 A;  3ZMK A;  5LNK e;  2DMM A;  1PX6 A;  2HI7 A;  4K1F A;  5ECN B;  5D9W A;  1Z6N A;  3PPU A;  4OFN A;  4TR4 A;  4USS A;  5BRT A;  3EMP A;  3GL3 A;  1OVN A;  5AIS A;  1OKT A;  4Z2U A;  1PKZ A;  3IC8 A;  1MDJ A;  2ZUP A;  1TI3 A;  4PTS A;  4DVC A;  3FRC A;  4MPG A;  2V1M A;  2IIY A;  2J23 A;  3FR9 A;  2O87 A;  3HD5 A;  4ZXG A;  3L4N A;  4GQC A;  1GTU A;  3UBK A;  4QL7 A;  4N0Z A;  1O7U A;  4O7H A;  1TK0 B;  1SYX A;  3HA9 A;  2H72 A;  1SJZ A;  2E2M A;  3EE2 A;  2IMD A;  1GTA A;  2NTO A;  1M2D A;  5D96 A;  2GT6 A;  2MYG A;  3F3Q A;  4TXV A;  4PQI A;  1CQG A;  4ZBD A;  1V9W A;  1FG4 A;  2IME A;  2GZP A;  1AXD A;  3LYK A;  2P5Q A;  2F3M A;  5D8I A;  3HVV A;  1H75 A;  4LL4 B;  4ZL7 A;  1J08 A;  2I3Y A;  2C3Q A;  2H75 A;  3PIN A;  1USB A;  4L8E A;  4X4J A;  1B4P A;  1PRX A;  2LV3 A;  2X99 A;  1I9D A;  2JSZ A;  1CQH A;  4TN8 A;  2CT6 A;  4GRF A;  4BVX B;  3FHK A;  3CSJ A;  5EL8 A;  2JU5 A;  2P5R A;  2VLV A;  1B48 A;  2REM A;  2CZ3 A;  1OE7 A;  5J41 A;  3PH9 A;  2FGX A;  1O81 A;  3F63 A;  1ST9 A;  3ZRE A;  2X8C A;  1YEX A;  3TKP A;  3A5W A;  2A2P A;  1O8W A;  2GGT A;  1OE8 A;  4NAX A;  3WGD A;  3VWV A;  1N8J A;  1GSY A;  5J4U A;  1G6Y A;  2I1U A;  1AAZ A;  1XWA A;  3TCO A;  4IJI A;  2TRC P;  1UN2 A;  5LCZ A;  1XWB A;  5D93 A;  2YV9 A;  3VPQ A;  3ME7 A;  4EIP A;  6GSX A;  4ZB8 A;  3LW9 A;  4KB3 A;  5F05 A;  3N5O A;  4PXO A;  1A0F A;  2H01 A;  2VL2 C;  2HZF A;  5HFG A;  4NV5 A;  2AV4 A;  2A4H A;  3MNG A;  3UVH A;  4ML6 A;  3QOU A;  3GA4 A;  5IMV A;  1Z9H A;  4POK A;  2LUS A;  2BMX A;  4IVF A;  4EE0 A;  4NWY A;  5G1K A;  3GSS A;  1ZOF A;  4XRD A;  4RUV A;  5G5F A;  2XPE A;  3GTU B;  4MA9 A;  4TKY A;  5E59 A;  4DSS A;  1OKD A;  1GLP A;  1PX7 A;  2WFC A;  3QAG A;  1TU7 A;  2AJQ B;  1HNA A;  4MAB A;  2H0H A;  3FKF A;  2N5B A;  2EC4 A;  1M2B A;  3JCM L;  2IN3 A;  3HVS A;  3ISO A;  4PNF A;  2YPM A;  2H66 A;  1F9M A;  4G9H A;  1GUL A;  3KH7 A;  3TOU A;  7GSS A;  1ZYN A;  1VF4 A;  2GZY A;  4O92 A;  2DML A;  3CBU A;  1JHB A;  2H1B A;  5G5E A;  1IYH A;  4MCU A;  4OO4 A;  2EIQ A;  2OBK A;  4F0C A;  1HD2 A;  1E2Y A;  3FR6 A;  2R5G A;  3EIN A;  5H5Q A;  4MF7 A;  4ULX A;  3CTG A;  5GZZ B;  3IV4 A;  2VL2 A;  1M7T A;  3G7J A;  1W89 A;  2VD1 A;  2GZZ A;  4QQ7 A;  3H8Q A;  3IHG A;  1E6B A;  3EUR A;  3M0F A;  1TRV A;  4XS1 A;  5H5R A;  2PVO C;  1XWG A;  3KCM A;  3TUE A;  1FOV A;  2VM1 A;  4YQM A;  2DJ1 A;  4TR0 A;  2LJR A;  2HSH A;  2QA1 A;  1SEN A;  17GS A;  4OMV A;  2JSY A;  4ZL9 A;  1V58 A;  3DGQ A;  1TI1 A;  1ABA A;  1ZYQ B;  1YKA A;  3G7Y A;  4J57 E;  4AJ6 A;  3KMO A;  2GSR A;  3M8N A;  4HJ2 A;  4TOP A;  1YY7 A;  3FZA A;  3FZ5 A;  4FH8 A;  3UBL A;  2LQO A;  1EV9 A;  4CW9 A;  2H19 A;  1EV4 A;  4KDX A;  3KMN A;  4I97 A;  1U88 A;  4ZB6 A;  3KH9 A;  5DJL A;  1TRW A;  4DSQ A;  2RM5 A;  3UIW A;  4TRX A;  1K0C A;  1TRU A;  2P31 A;  2XPD A;  3TJG A;  1SKW B;  1KBN A;  1GSU A;  1NHO A;  2PVQ A;  1XW9 A;  2VLU A;  3H4K A;  3KZQ A;  2GT5 A;  3C7M A;  4N10 A;  4WET A;  5A4W A;  2GQM A;  3EPT A;  2DKH A;  2E7P A;  1U87 A;  4BA7 A;  1X5C A;  2GSS A;  18GS A;  1TDI A;  2ALB A;  4ZIJ A;  4BVX A;  2L57 A;  2LJK A;  5C00 A;  2LJA A;  5JCG A;  3A5I A;  1QXH A;  5CYY A;  4V2L A;  2WZ9 A;  2VO4 A;  1T00 A;  4IGJ A;  1Z3E A;  4HQZ A;  4OFM A;  2A2S A;  3TGZ A;  2A4V A;  2AAW A;  3FR3 A;  3GST A;  4BVY A;  2OE1 A;  1EP7 A;  3NZN A;  1G6W A;  1DSB A;  1TRS A;  3RHC A;  2EIO A;  4NHZ A;  2HLS A;  2XHF A;  1TKD B;  3BOA A;  3C71 A;  1AQV A;  1SJ6 A;  5CRW A;  2O85 A;  2N5A A;  3TB2 A;  3MDK A;  1G0T A;  2YCD A;  1FO5 A;  3WD6 A;  3KXO A;  3FY7 A;  1AW9 A;  2DSA A;  2VLT A;  4G19 A;  3IE3 A;  4IP1 A;  2FA4 A;  5ECO B;  2H71 A;  1XOA A;  5GSS A;  3F4T A;  3ZL5 A;  4K2D A;  1EZK A;  1JZO A;  3IC4 A;  1K3O A;  1X5E A;  1QK8 A;  16GS A;  2CV4 A;  3CSH A;  2A2R A;  3K8N A;  1TOF A;  2H74 A;  1V98 A;  1M3J A;  4G2E A;  2VOC A;  2DJK A;  3GTU A;  1SL2 B;  4ZL8 A;  2QA2 A;  3QFA C;  2B3S A;  2L5O A;  3L9U A;  4EO3 A;  2LTK A;  4WBR D;  2OE3 A;  2R0P A;  3QR6 A;  1MTC A;  3SBC A;  4Z7X A;  2K9F A;  4NV2 A;  2MMA A;  4Q5Q A;  2HRN A;  4H86 A;  1SU9 A;  2UZ8 A;  3KTL A;  5GAN D;  4G0L A;  4FQU A;  2WUL A;  3KEB A;  1SJI A;  6GST A;  3US3 A;  1GL8 A;  3W8S A;  4KSM A;  3MIX A;  4V1A p;  4L0U A;  1GNW A;  2MZC A;  3HVX A;  4Z2R A;  2F8A A;  1PL1 A;  3M3M A;  4CHS A;  2CVD A;  3L9S A;  4OCE A;  4EDY A;  1I5G A;  4OD7 A;  2FUG 2;  2KP1 A;  4HI7 A;  4YAV A;  1FVJ A;  2ZNM A;  1WIK A;  4WXT A;  1DE2 A;  1PGT A;  5J9B A;  1R5P A;  2F51 A;  3M9J A;  4ZIL A;  4MJB A;  3KGK A;  4Q5N A;  3VPT A;  4F82 A;  1G7O A;  2GS3 A;  3G9B A;  2H8L A;  1ERU A;  2PU9 C;  1LJR A;  4IQA A;  2M72 A;  2V2G A;  1XCC A;  1XIY A;  1F3A A;  4K0N A;  3WGE A;  2FLS A;  1F3B A;  1GSS A;  5ECK B;  3QMX A;  4LLR A;  2KLX A;  2C4J A;  6GSS A;  2OA7 A;  4ILF A;  3QFB C;  2X8H A;  3N9J A;  2VAF A;  4XS4 B;  4JR4 A;  4FYC A;  2FA8 A;  4KAE A;  1MD3 A;  4DSR A;  4XIH A;  5C04 A;  2YP6 A;  4CY8 A;  5EY6 A;  3DVW A;  3GX0 A;  1WPI A;  3IAM 2;  1NSW A;  4IHU A;  4NXI A;  3BCI A;  2LS5 A;  1O73 A;  3GKM A;  2WB9 A;  4YH2 A;  4KCE A;  1GWC A;  4IKH A;  3LXT A;  2FY6 A;  1OC3 A;  1O85 A;  5JWR B;  2FWG A;  2IMI A;  3LSZ A;  5HR2 A;  4F9Z A;  1QUW A;  2GTU A;  1K0M A;  2IMK A;  5F0G A;  3UAP A;  3WGX A;  4PNG A;  1A8Y A;  3ZTL A;  2R0C A;  2YNX A;  3GHA A;  2L59 A;  4ZBB A;  5L71 A;  3MSZ A;  2QKE A;  3ED3 A;  5CRE A;  1HYU A;  2FHE A;  4LMW A;  4Q5R A;  2EIR A;  1XBS A;  1PKW A;  5D73 A;  3NIV A;  3D22 A;  3O76 A;  2LRT A;  4L5L A;  2B6M A;  1M2A A;  1RQM A;  3ZFB A;  2V6K A;  1R7H A;  4FIW A;  1YDK A;  3FMW A;  1HQO A;  4WF4 A;  5FHI A;  2H1A A;  1VRS D;  3DXB A;  3ZIT A;  3R3E A;  3FEU A;  3HXS A;  2V6O A;  4ECB A;  2H70 A;  3UEM A;  22GS A;  1A8L A;  1W4V A;  3RDW A;  19GS A;  4ID0 A;  4WEY A;  4N30 A;  4YKF A;  1SKS B;  1XG8 A;  4HOJ A;  3DWV A;  1VF3 A;  3ERW A;  2RLI A;  3Q18 A;  4K7I A;  3IHQ A;  3PGT A;  4MZB A;  2X64 A;  1GSD A;  1JLW A;  2H1D A;  4X0X A;  1WJK A;  2C3T A;  1V40 A;  2I9H A;  3L0H A;  3VWX A;  4GF0 A;  5DCH A;  2AUV A;  4G0K A;  4BPY A;  3F0I A;  2OJL A;  3FK8 A;  5IPH A;  2QSI A;  4ML1 A;  2DJ0 A;  1SD8 A;  1KEB A;  5CAX A;  4OO5 A;  5DCG A;  1GSF A;  2JZR A;  1QGV A;  5KN3 A;  4TW5 A;  2L5L A;  2C0F A;  4RI6 A;  1JZR A;  2C0D A;  1OC8 A;  2MBS A;  3A2W A;  1SYR A;  4YKG A;  2NDO A;  5IMC A;  3TKS E;  3IK9 A;  3Q19 A;  3VI5 A;  2LRN A;  1UVZ A;  4IS0 A;  4A5P A;  3HHV A;  5KN2 A;  1QQ2 A;  3ZZX A;  2WJU A;  2H76 A;  4GXZ A;  4L0W A;  4D73 B;  4RQX A;  4J2F A;  4F2I A;  4K0G A;  2E0Q A;  3LJR A;  3RHB A;  5B8B A;  1R26 A;  1J0F A;  1EGR A;  3UAR A;  1GTI A;  3FZ9 A;  5IO0 A;  5AIV A;  3QAW A;  3IRA A;  2BTO T;  5AN1 A;  3H93 A;  4ZBA A;  1HNC A;  1RK4 A;  3IAS 2;  2KHP A;  3F4S A;  2LEG A;  4NHW A;  4BWS A;  4RI7 A;  1GSQ A;  4MH3 A;  5IMD A;  4IN0 A;  1M9A A;  1THO A;  3M9K A;  3F3R A;  2IMF A;  1PN9 A;  2NVL A;  3NOF A;  2LST A;  2K6V A;  1K0N A;  3BCK A;  3HZ8 A;  4HJM A;  2HSM A;  3L9V A;  4TR1 B;  2VUP A;  5HFK A;  4POB A;  3CTF A;  4F0B A;  1SK1 A;  2JAC A;  5H5S A;  2MMZ A;  3EVI A;  2DJ3 A;  4V2N A;  5EVO A;  4ECC A;  4WKW A;  5KOX A;  4XHM A;  1ZZY A;  3J7Y k;  2C1Y A;  4HS1 A;  1DBY A;  3IR4 A;  4NPB A;  2AYT A;  1A23 A;  1KNG A;  1MD4 A;  3TKQ A;  4HSC X;  1XPV A;  2AHE A;  4XS4 A;  2B5X A;  2FNO A;  3F8U A;  1X0R A;  4PUA A;  4V2M A;  4EL1 A;  3HDC A;  5B8A A;  4EKZ A;  3C1S A;  1PQN A;  2TRX A;  4WR4 A;  3FW2 A;  3QAV A;  3BD2 A;  3DKS A;  4GSN A;  5INY A;  3D4M A;  4FYU A;  3WT1 A;  4PUR A;  3QDN A;  4BWQ A;  3KIJ A;  3W8J A;  4FYB A;  1XW6 A;  4KA0 A;  3HZ4 A;  5DAK B;  1TU8 A;  2VCX A;  2B1L A;  3GL5 A;  4IW9 A;  4K9Z A;  2NPB A;  3A2V A;  5F07 A;  2ES7 A;  2IWT A;  1SD9 A;  5HFI A;  3Q74 A;  3O3T A;  2H0G A;  4HQS A;  11GS A;  3ZVJ D;  2FWH A;  5IM9 A;  1EOH A;  1EWX A;  4GWR A;  3UOM A;  2X8G A;  1MEK A;  3H1N A;  1FVK A;  2LKU A;  3VFI A;  2C0E A;  1T1V A;  2VL9 A;  3RAZ A;  1ZYP A;  4TXO B;  2HE3 A;  4TR3 A;  5DAL B;  5KEJ A;  3RPN A;  1PD2 1;  4KDU A;  1ML6 A;  1AQW A;  3E9J B;  3TJK A;  5ECR B;  1XFL A;  1Z7R A;  3MAK A;  4KF9 A;  2IFQ B;  4AJ8 A;  2FWF A;  2DLX A;  2GQL A;  4EIQ A;  4E8E A;  5ID2 B;  1K0A A;  3ERG A;  5ECI B;  3TJJ A;  3I9V 2;  3ZLP A;  1SL1 B;  3LG6 A;  2H0I A;  5DBQ A;  1F37 A;  3LEF A;  5JCW A;  4ISD A;  1Z6M A;  5ELA A;  2CZ2 A;  4CY6 A;  1T3B A;  2C80 A;  3CRU A;  4GSS A;  3DRN A;  2HFD A;  4O5Q A;  5CRD A;  4G0I A;  1TJD A;  4JR6 A;  4GQF A;  3EU4 A;  5ECQ B;  3KP9 A;  3QPM A;  1X5D A;  3EU3 A;  1ACV A;  6GSV A;  1T7P B;  1ILO A;  2LNT A;  5DDL A;  2H30 A;  4AF2 A;  2HT9 A;  4JBB A;  3BBY A;  3TRQ A;  3VK9 A;  2CVB A;  14GS A;  1S3C A;  9GSS A;  2RII A;  4HUA A;  3VLN A;  5FT3 A;  1G7E A;  5E4W A;  5D9X A;  4FO5 A;  3KTB A;  1GSE A;  5J5N A;  5IPG A;  2XBQ A;  3HVN A;  1ON4 A;  5J3R A;  3VWW A;  2WDU A;  2DBC A;  5IMF A;  2HRA A;  1K0B A;  3D5J A;  2GSQ A;  1BQ7 A;  2OBI A;  3G7I A;  4HEA 2;  2VL3 A;  3LFL A;  1YZX A;  3HCZ A;  3L78 A;  1RW1 A;  2DJJ A;  3AY8 A;  1FAA A;  4MLY A;  1ZL9 A;  1O6J A;  2OAC A;  3ZRD A;  2O89 A;  2IPA A;  3FYG A;  2CX3 A;  2HZE B;  2YN1 A;  1PSQ A;  2DJ2 A;  4MDC A;  4D73 A;  3TJB A;  4I2U A;  2GLR A;  3GH9 A;  1GRX A;  3U5R E;  2CX4 A;  3LWA A;  5JWQ B;  4QL9 A;  1VGL A;  4K8M A;  4PGT A;  2GST A;  5HQP A;  2VCV A;  3F4R A;  2L6D A;  1X9W B;  4O5U A;  4L5O A;  2H6X A; 
#chains in the Genus database with same CATH homology
 3OR5 A;  4KDY A;  4E8H A;  1OAZ A;  2OKA A;  3HY2 A;  3MYD A;  2B5Y A;  4X43 A;  4I6X A;  1Q98 A;  3DVX A;  3IDV A;  5GST A;  1B9X C;  2HSY A;  1Z7P A;  5IMZ A;  2VIM A;  1R4W A;  3CYN A;  4N0V A;  3GV1 A;  3RBT A;  5A4U A;  2GVP A;  3V1W A;  4GST A;  2VCZ A;  3I69 A;  2PPT A;  4TR1 A;  1BAY A;  2F9S A;  3D6I A;  4HDE A;  4OWY A;  3R2Q A;  2VCW A;  3C1R A;  3CMI A;  4LMV A;  5B6N A;  2YJH A;  1A0R P;  3WT2 A;  4MJC A;  5JWO B;  2F8F A;  1YF1 A;  2VCT A;  5J9C A;  4X1U A;  1S3A A;  4JU5 A;  4K5R A;  1KTE A;  3CXG A;  1Z5Y E;  3Q6O A;  1ERW A;  2C3N A;  2YZU A;  4IQ1 A;  4PUF C;  1GP1 A;  3GX8 A;  1ZCP A;  5ECS A;  3F9U A;  1TK5 B;  1ZMA A;  1XVQ A;  3ZFL A;  2KOK A;  2H1G A;  3ZIJ A;  1OC9 B;  1AC1 A;  4XS6 A;  2GDR A;  4KGI A;  3A2X A;  4EF0 A;  3P2A A;  2QC7 A;  1H4O A;  4EVM A;  4POM A;  5AIX A;  1YF0 A;  5DAK A;  3VWU A;  3UVT A;  4JED A;  3PR8 A;  4MF5 A;  1WP0 A;  1EP8 A;  13GS A;  6GSY A;  2G2Q A;  4PQH A;  3KP8 A;  2PER A;  4JE1 A;  2OE0 A;  4GCI A;  1SK2 A;  2YWN A;  1UC7 A;  3ZIV A;  3HJM A;  4TXO A;  4KW6 A;  5DAL A;  5F06 A;  5ECM B;  4EDZ A;  3GMF A;  5KN0 A;  3ZML A;  3S9F A;  4XTS A;  2B5E A;  5IOX A;  1ERT A;  2PGT A;  3KD0 A;  1YJ6 A;  2PUK C;  2XC2 A;  3ZVJ A;  2IFQ A;  3VI7 A;  5ID2 A;  4KND A;  5ECP B;  2R37 A;  2R4V A;  1JFU A;  5IIZ A;  3I43 A;  2YJ7 A;  5EPF A;  3TJF A;  4IBP A;  3FZ4 A;  4Z2T A;  2RUE A;  5ABR A;  2X49 A;  1IYI A;  3D21 A;  2B7K A;  4EC0 A;  1S3D A;  1X9M B;  4KSO A;  4BVY B;  5IOW A;  3HKR A;  4KCA A;  3CSI A;  3D4T A;  2YWM A;  3KJY A;  1EEM A;  3IXR A;  5G1L A;  2MMO A;  2CVK A;  3J7Y b;  2J9H A;  4HU9 A;  3DML A;  4J56 E;  4P3Y B;  1GUK A;  4K7N A;  2I4A A;  2R0G A;  2JL4 A;  1U3I A;  2JZS A;  1DUG A;  5B6M A;  1BX9 A;  1N2A A;  5CRG A;  1FOH A;  1GUH A;  2I81 A;  1F6M C;  1PMT A;  1R5A A;  6GSW A;  3TKS C;  2WGR A;  1OYJ A;  3A3T A;  2M46 A;  1NM3 A;  2QGV A;  1VF2 A;  4MP4 A;  1QMV A;  1JZD A;  1JLV A;  2E2G A;  4Q5F A;  3EC3 A;  1ZGN A;  3ZYW A;  4O5R A;  2HZE A;  3P90 A;  5F8B A;  3F6F A;  3UMA A;  2XBI A;  4ICY A;  4YQU A;  12GS A;  5ELG A;  1AUC A;  5COH A;  3HJO A;  4RQR A;  5FWG A;  2JAD A;  1B9Y C;  3C73 A;  5BMU A;  3IA1 A;  2WRT A;  1NHY A;  1XWC A;  3GN3 A;  4K6X A;  2R6K A;  4XCS A;  5KN1 A;  2R3X A;  3HYP A;  1BED A;  4MJE A;  5B7C A;  4BL7 B;  2D2Z A;  1EGO A;  2G0F A;  1HNB A;  4MF6 A;  5GAP D;  3IBH A;  1SKR B;  1AIU A;  1M0U A;  1BJX A;  1WMJ A;  3GKK A;  2DIY A;  1GH2 A;  3GUS A;  4MK3 A;  1URM A;  4KH7 A;  4ECJ A;  3APO A;  5A4V A;  1A24 A;  2IL3 A;  1WRY A;  2YAN A;  4LL1 B;  1X9S B;  4WBJ A;  2DIZ A;  5ECL B;  5G31 A;  2ZCT A;  3ME8 A;  2C0G A;  2P0G A;  2YWI A;  2FD3 A;  3TRX A;  3TOT A;  1SL0 B;  1T4Y A;  5G30 A;  2V32 A;  2ON5 A;  2CAI A;  2B1K A;  1DE1 A;  2V41 A;  3CRT A;  3DEX A;  1QFN A;  5DJM A;  3TDG A;  5IO2 A;  2BJX A;  1Y25 A;  5DQY A;  3GKN A;  3LXZ A;  2ON7 A;  5HR3 A;  2IJY A;  1GUM A;  1ERV A;  3UJ1 A;  3TKS A;  1TP9 A;  4K5S A;  3TRP A;  3VUR A;  1THX A;  4EXJ A;  4JZQ A;  4MNN A;  2VD0 A;  2K18 A;  1A2L A;  4IEL A;  2DKI A;  2N5F A;  3IOS A;  1YEP A;  2MBT A;  1PN0 A;  1WWJ A;  2AB6 A;  1VF1 A;  2PWJ A;  2TIR A;  1GNE A;  4WR5 A;  1BG5 A;  2PBJ A;  1OC9 A;  2C8U A;  5KOW A;  3EYT A;  3SWL A;  2HRK A;  2CA8 A;  3GKX A;  1A2M A;  3ERF A;  1LBK A;  3MWH A;  4ACS A;  1GLQ A;  1A2J A;  1WE0 A;  4TVE A;  1XWK A;  4CDO A;  1YQ1 A;  1Y6E A;  5ECH B;  3BJ5 A;  2PMT A;  2PN8 A;  3IPZ A;  2RM6 A;  3HJP A;  1FW1 A;  2CAQ A;  5DVB A;  2O8V B;  3E3E A;  8GSS A;  4O32 A;  2KP2 A;  3DD3 A;  2RUF A;  4K2X A;  4WF5 A;  2K8V A;  3LQ7 A;  5LD0 A;  1V2A A;  2O7K A;  2LNS A;  3UL3 A;  3DIE A;  3APQ A;  3RPP A;  3D0Z A;  5CNW A;  2WCI A;  4KX4 A;  4F03 A;  3LYP A;  3QD9 A;  2HNL A;  2WS2 A;  2OAD A;  2H6Y A;  4IJ3 A;  1FHE A;  2K8S A;  3E0U A;  4NMU A;  4GLT A;  1M99 A;  5G2Z A;  1TW9 A;  3GH6 A;  4ECI A;  3F6D A;  1F2E A;  1EEJ A;  1K3Y A;  2CQ9 A;  3P8W A;  5CP1 A;  2HXK A;  4HU7 A;  5JCU A;  5AGY A;  1TTZ A;  5CRH A;  10GS A;  5ENU A;  4MH2 A;  4IP6 A;  1BYE A;  1O8X A;  4HZ2 A;  2GQK A;  1V57 A;  3EWL A;  4I2T A;  2YZH A;  3GNJ A;  2H73 A;  3EMX A;  4MPF A;  3GUR A;  4G10 A;  2LRC A;  1EOG A;  1NW2 A;  2B7J A;  2NBS A;  4POL A;  4MJA A;  1M9B A;  1YKC A;  4V1A g;  2VCQ A;  2M80 A;  3U6V A;  3APS A;  4OCF A;  1C72 A;  3TKR A;  4GTU A;  4KUN A;  3IK7 A;  1U3A A;  3LOR A;  1TK8 B;  1K0O A;  3GRX A;  1B8X A;  4PX1 A;  2LQQ A;  1XW5 A;  1B4Q A;  1XVW A;  3GIX A;  2KUC A;  1T8E B;  1FB0 A;  3DYR A;  1XXU A;  1ZYE A;  2L4C A;  2MMN A;  2Z9S A;  1LU4 A;  5IMA A;  4LA1 A;  1PA3 A;  4MZC A;  1TXX A;  2HYX A;  4I5Q A;  3M1G A;  4DEJ A;  20GS A;  3P7X A;  2YOI A;  4AJ7 A;  1Q4J A;  4KE3 A;  1AQX A;  2VM2 A;  5IQY A;  2X4A A;  2YV7 A;  4I8B A;  4XRA A;  4K7O A;  4EUY A;  2JZT A;  3WYW A;  4DSS B;  6GSU A;  1T4Z A;  5A5K A;  2YWO A;  3O6T A;  4ZB9 A;  4BL7 A;  3C8E A;  2FWE A;  1MDI A;  5D9V A;  4AGS A;  1XZO A;  1JZW A;  1GTB A;  4OFT A;  2H6Z A;  5CO3 A;  4N11 A;  3W6G A;  1PL2 A;  1XOB A;  1FB6 A;  2FCH A;  1SK0 A;  3KM6 A;  4JRR A;  5D9T A;  4MMM A;  3I6A A;  1J9B A;  2R2J A;  1WOU A;  2L4Q A;  1U6T A;  4PQ1 A;  4HZ4 A;  3H79 A;  1UA5 A;  4MZW A;  1MDK A;  1K3L A;  2HRF A;  5DQS A;  3GFK A;  3LGC A;  5HR0 A;  3GYK A;  2DC5 A;  4YQV A;  2L6C A;  1K0D A;  3QCP A;  4YAP A;  5HR1 A;  3ZMK A;  5LNK e;  2DMM A;  1PX6 A;  2HI7 A;  4K1F A;  5ECN B;  5D9W A;  1Z6N A;  3PPU A;  4OFN A;  4TR4 A;  4USS A;  5BRT A;  3EMP A;  3GL3 A;  1OVN A;  5AIS A;  1OKT A;  4Z2U A;  1PKZ A;  3IC8 A;  1MDJ A;  2ZUP A;  1TI3 A;  4PTS A;  4DVC A;  3FRC A;  4MPG A;  2V1M A;  2IIY A;  2J23 A;  3FR9 A;  2O87 A;  3HD5 A;  4ZXG A;  3L4N A;  4GQC A;  1GTU A;  3UBK A;  4QL7 A;  4N0Z A;  1O7U A;  4O7H A;  1TK0 B;  1SYX A;  3HA9 A;  2H72 A;  1SJZ A;  2E2M A;  3EE2 A;  2IMD A;  1GTA A;  2NTO A;  1M2D A;  5D96 A;  2GT6 A;  2MYG A;  3F3Q A;  4TXV A;  4PQI A;  1CQG A;  4ZBD A;  1V9W A;  1FG4 A;  2IME A;  2GZP A;  1AXD A;  3LYK A;  2P5Q A;  2F3M A;  5D8I A;  3HVV A;  1H75 A;  4LL4 B;  4ZL7 A;  1J08 A;  2I3Y A;  2C3Q A;  2H75 A;  3PIN A;  1USB A;  4L8E A;  4X4J A;  1B4P A;  1PRX A;  2LV3 A;  2X99 A;  1I9D A;  2JSZ A;  1CQH A;  4TN8 A;  2CT6 A;  4GRF A;  4BVX B;  3FHK A;  3CSJ A;  5EL8 A;  2JU5 A;  2P5R A;  2VLV A;  1B48 A;  2REM A;  2CZ3 A;  1OE7 A;  5J41 A;  3PH9 A;  2FGX A;  1O81 A;  3F63 A;  1ST9 A;  3ZRE A;  2X8C A;  1YEX A;  3TKP A;  3A5W A;  2A2P A;  1O8W A;  2GGT A;  1OE8 A;  4NAX A;  3WGD A;  3VWV A;  1N8J A;  1GSY A;  5J4U A;  1G6Y A;  2I1U A;  1AAZ A;  1XWA A;  3TCO A;  4IJI A;  2TRC P;  1UN2 A;  5LCZ A;  1XWB A;  5D93 A;  2YV9 A;  3VPQ A;  3ME7 A;  4EIP A;  6GSX A;  4ZB8 A;  3LW9 A;  4KB3 A;  5F05 A;  3N5O A;  4PXO A;  1A0F A;  2H01 A;  2VL2 C;  2HZF A;  5HFG A;  4NV5 A;  2AV4 A;  2A4H A;  3MNG A;  3UVH A;  4ML6 A;  3QOU A;  3GA4 A;  5IMV A;  1Z9H A;  4POK A;  2LUS A;  2BMX A;  4IVF A;  4EE0 A;  4NWY A;  5G1K A;  3GSS A;  1ZOF A;  4XRD A;  4RUV A;  5G5F A;  2XPE A;  3GTU B;  4MA9 A;  4TKY A;  5E59 A;  4DSS A;  1OKD A;  1GLP A;  1PX7 A;  2WFC A;  3QAG A;  1TU7 A;  2AJQ B;  1HNA A;  4MAB A;  2H0H A;  3FKF A;  2N5B A;  2EC4 A;  1M2B A;  3JCM L;  2IN3 A;  3HVS A;  3ISO A;  4PNF A;  2YPM A;  2H66 A;  1F9M A;  4G9H A;  1GUL A;  3KH7 A;  3TOU A;  7GSS A;  1ZYN A;  1VF4 A;  2GZY A;  4O92 A;  2DML A;  3CBU A;  1JHB A;  2H1B A;  5G5E A;  1IYH A;  4MCU A;  4OO4 A;  2EIQ A;  2OBK A;  4F0C A;  1HD2 A;  1E2Y A;  3FR6 A;  2R5G A;  3EIN A;  5H5Q A;  4MF7 A;  4ULX A;  3CTG A;  5GZZ B;  3IV4 A;  2VL2 A;  1M7T A;  3G7J A;  1W89 A;  2VD1 A;  2GZZ A;  4QQ7 A;  3H8Q A;  3IHG A;  1E6B A;  3EUR A;  3M0F A;  1TRV A;  4XS1 A;  5H5R A;  2PVO C;  1XWG A;  3KCM A;  3TUE A;  1FOV A;  2VM1 A;  4YQM A;  2DJ1 A;  4TR0 A;  2LJR A;  2HSH A;  2QA1 A;  1SEN A;  17GS A;  4OMV A;  2JSY A;  4ZL9 A;  1V58 A;  3DGQ A;  1TI1 A;  1ABA A;  1ZYQ B;  1YKA A;  3G7Y A;  4J57 E;  4AJ6 A;  3KMO A;  2GSR A;  3M8N A;  4HJ2 A;  4TOP A;  1YY7 A;  3FZA A;  3FZ5 A;  4FH8 A;  3UBL A;  2LQO A;  1EV9 A;  4CW9 A;  2H19 A;  1EV4 A;  4KDX A;  3KMN A;  4I97 A;  1U88 A;  4ZB6 A;  3KH9 A;  5DJL A;  1TRW A;  4DSQ A;  2RM5 A;  3UIW A;  4TRX A;  1K0C A;  1TRU A;  2P31 A;  2XPD A;  3TJG A;  1SKW B;  1KBN A;  1GSU A;  1NHO A;  2PVQ A;  1XW9 A;  2VLU A;  3H4K A;  3KZQ A;  2GT5 A;  3C7M A;  4N10 A;  4WET A;  5A4W A;  2GQM A;  3EPT A;  2DKH A;  2E7P A;  1U87 A;  4BA7 A;  1X5C A;  2GSS A;  18GS A;  1TDI A;  2ALB A;  4ZIJ A;  4BVX A;  2L57 A;  2LJK A;  5C00 A;  2LJA A;  5JCG A;  3A5I A;  1QXH A;  5CYY A;  4V2L A;  2WZ9 A;  2VO4 A;  1T00 A;  4IGJ A;  1Z3E A;  4HQZ A;  4OFM A;  2A2S A;  3TGZ A;  2A4V A;  2AAW A;  3FR3 A;  3GST A;  4BVY A;  2OE1 A;  1EP7 A;  3NZN A;  1G6W A;  1DSB A;  1TRS A;  3RHC A;  2EIO A;  4NHZ A;  2HLS A;  2XHF A;  1TKD B;  3BOA A;  3C71 A;  1AQV A;  1SJ6 A;  5CRW A;  2O85 A;  2N5A A;  3TB2 A;  3MDK A;  1G0T A;  2YCD A;  1FO5 A;  3WD6 A;  3KXO A;  3FY7 A;  1AW9 A;  2DSA A;  2VLT A;  4G19 A;  3IE3 A;  4IP1 A;  2FA4 A;  5ECO B;  2H71 A;  1XOA A;  5GSS A;  3F4T A;  3ZL5 A;  4K2D A;  1EZK A;  1JZO A;  3IC4 A;  1K3O A;  1X5E A;  1QK8 A;  16GS A;  2CV4 A;  3CSH A;  2A2R A;  3K8N A;  1TOF A;  2H74 A;  1V98 A;  4G2E A;  2VOC A;  2DJK A;  3GTU A;  1SL2 B;  4ZL8 A;  2QA2 A;  3QFA C;  2B3S A;  2L5O A;  3L9U A;  4EO3 A;  2LTK A;  4WBR D;  2OE3 A;  2R0P A;  3QR6 A;  1MTC A;  3SBC A;  4Z7X A;  2K9F A;  4NV2 A;  2MMA A;  4Q5Q A;  2HRN A;  4H86 A;  1SU9 A;  2UZ8 A;  3KTL A;  5GAN D;  4G0L A;  4FQU A;  2WUL A;  3KEB A;  1SJI A;  6GST A;  3US3 A;  1GL8 A;  3W8S A;  4KSM A;  3MIX A;  4V1A p;  4L0U A;  1GNW A;  2MZC A;  3HVX A;  4Z2R A;  2F8A A;  1PL1 A;  3M3M A;  4CHS A;  2CVD A;  3L9S A;  4OCE A;  4EDY A;  1I5G A;  4OD7 A;  2FUG 2;  2KP1 A;  4HI7 A;  4YAV A;  1FVJ A;  2ZNM A;  1WIK A;  4WXT A;  1DE2 A;  1PGT A;  5J9B A;  1R5P A;  2F51 A;  3M9J A;  4ZIL A;  4MJB A;  3KGK A;  4Q5N A;  3VPT A;  4F82 A;  1G7O A;  2GS3 A;  3G9B A;  2H8L A;  1ERU A;  2PU9 C;  1LJR A;  4IQA A;  2M72 A;  2V2G A;  1XCC A;  1XIY A;  1F3A A;  4K0N A;  3WGE A;  2FLS A;  1F3B A;  1GSS A;  5ECK B;  3QMX A;  4LLR A;  2KLX A;  2C4J A;  6GSS A;  2OA7 A;  4ILF A;  3QFB C;  2X8H A;  3N9J A;  2VAF A;  4XS4 B;  4JR4 A;  4FYC A;  2FA8 A;  4KAE A;  1MD3 A;  4DSR A;  4XIH A;  5C04 A;  2YP6 A;  4CY8 A;  5EY6 A;  3DVW A;  3GX0 A;  1WPI A;  3IAM 2;  1NSW A;  4IHU A;  4NXI A;  3BCI A;  2LS5 A;  1O73 A;  3GKM A;  2WB9 A;  4YH2 A;  4KCE A;  1GWC A;  4IKH A;  3LXT A;  2FY6 A;  1OC3 A;  1O85 A;  5JWR B;  2FWG A;  2IMI A;  3LSZ A;  5HR2 A;  4F9Z A;  1QUW A;  2GTU A;  1K0M A;  2IMK A;  5F0G A;  3UAP A;  3WGX A;  4PNG A;  1A8Y A;  3ZTL A;  2R0C A;  2YNX A;  3GHA A;  2L59 A;  4ZBB A;  5L71 A;  3MSZ A;  2QKE A;  3ED3 A;  5CRE A;  1HYU A;  2FHE A;  4LMW A;  4Q5R A;  2EIR A;  1XBS A;  1PKW A;  5D73 A;  3NIV A;  3D22 A;  3O76 A;  2LRT A;  4L5L A;  2B6M A;  1M2A A;  1RQM A;  3ZFB A;  2V6K A;  1R7H A;  4FIW A;  1YDK A;  3FMW A;  1HQO A;  4WF4 A;  5FHI A;  2H1A A;  1VRS D;  3DXB A;  3ZIT A;  3R3E A;  3FEU A;  3HXS A;  2V6O A;  4ECB A;  2H70 A;  3UEM A;  22GS A;  1A8L A;  1W4V A;  3RDW A;  19GS A;  4ID0 A;  4WEY A;  4N30 A;  4YKF A;  1SKS B;  4HOJ A;  3DWV A;  1VF3 A;  3ERW A;  2RLI A;  3Q18 A;  4K7I A;  3IHQ A;  3PGT A;  4MZB A;  2X64 A;  1GSD A;  1JLW A;  2H1D A;  4X0X A;  1WJK A;  2C3T A;  1V40 A;  2I9H A;  3L0H A;  3VWX A;  4GF0 A;  5DCH A;  2AUV A;  4G0K A;  4BPY A;  3F0I A;  2OJL A;  3FK8 A;  5IPH A;  2QSI A;  4ML1 A;  2DJ0 A;  1SD8 A;  1KEB A;  5CAX A;  4OO5 A;  5DCG A;  1GSF A;  2JZR A;  1QGV A;  5KN3 A;  4TW5 A;  2L5L A;  2C0F A;  4RI6 A;  1JZR A;  2C0D A;  1OC8 A;  2MBS A;  3A2W A;  1SYR A;  4YKG A;  2NDO A;  5IMC A;  3TKS E;  3IK9 A;  3Q19 A;  3VI5 A;  2LRN A;  1UVZ A;  4IS0 A;  4A5P A;  3HHV A;  5KN2 A;  1QQ2 A;  3ZZX A;  2WJU A;  2H76 A;  4GXZ A;  4L0W A;  4D73 B;  4RQX A;  4J2F A;  4F2I A;  4K0G A;  2E0Q A;  3LJR A;  3RHB A;  5B8B A;  1R26 A;  1J0F A;  1EGR A;  3UAR A;  1GTI A;  3FZ9 A;  5IO0 A;  5AIV A;  3QAW A;  3IRA A;  2BTO T;  5AN1 A;  3H93 A;  4ZBA A;  1HNC A;  1RK4 A;  3IAS 2;  2KHP A;  3F4S A;  2LEG A;  4NHW A;  4BWS A;  4RI7 A;  1GSQ A;  4MH3 A;  5IMD A;  4IN0 A;  1M9A A;  1THO A;  3M9K A;  3F3R A;  2IMF A;  1PN9 A;  2NVL A;  3NOF A;  2LST A;  2K6V A;  1K0N A;  3BCK A;  3HZ8 A;  4HJM A;  2HSM A;  3L9V A;  4TR1 B;  2VUP A;  5HFK A;  4POB A;  3CTF A;  4F0B A;  1SK1 A;  2JAC A;  5H5S A;  2MMZ A;  3EVI A;  2DJ3 A;  4V2N A;  5EVO A;  4ECC A;  4WKW A;  5KOX A;  4XHM A;  1ZZY A;  3J7Y k;  2C1Y A;  4HS1 A;  1DBY A;  3IR4 A;  4NPB A;  2AYT A;  1A23 A;  1KNG A;  1MD4 A;  3TKQ A;  1XPV A;  2AHE A;  4XS4 A;  2B5X A;  2FNO A;  3F8U A;  1X0R A;  4PUA A;  4V2M A;  4EL1 A;  3HDC A;  5B8A A;  4EKZ A;  3C1S A;  1PQN A;  2TRX A;  4WR4 A;  3FW2 A;  3QAV A;  3BD2 A;  3DKS A;  4GSN A;  5INY A;  3D4M A;  4FYU A;  3WT1 A;  4PUR A;  3QDN A;  4BWQ A;  3KIJ A;  3W8J A;  4FYB A;  1XW6 A;  4KA0 A;  3HZ4 A;  5DAK B;  1TU8 A;  2VCX A;  2B1L A;  3GL5 A;  4IW9 A;  4K9Z A;  2NPB A;  3A2V A;  5F07 A;  2ES7 A;  2IWT A;  1SD9 A;  5HFI A;  3Q74 A;  3O3T A;  2H0G A;  4HQS A;  11GS A;  3ZVJ D;  2FWH A;  5IM9 A;  1EOH A;  1EWX A;  4GWR A;  3UOM A;  2X8G A;  1MEK A;  3H1N A;  1FVK A;  2LKU A;  3VFI A;  2C0E A;  1T1V A;  2VL9 A;  3RAZ A;  1ZYP A;  4TXO B;  2HE3 A;  4TR3 A;  5DAL B;  5KEJ A;  3RPN A;  1PD2 1;  4KDU A;  1ML6 A;  1AQW A;  3E9J B;  3TJK A;  5ECR B;  1XFL A;  1Z7R A;  3MAK A;  4KF9 A;  2IFQ B;  4AJ8 A;  2FWF A;  2DLX A;  2GQL A;  4EIQ A;  4E8E A;  5ID2 B;  1K0A A;  3ERG A;  5ECI B;  3TJJ A;  3I9V 2;  3ZLP A;  1SL1 B;  3LG6 A;  2H0I A;  5DBQ A;  1F37 A;  3LEF A;  5JCW A;  4ISD A;  1Z6M A;  5ELA A;  2CZ2 A;  4CY6 A;  1T3B A;  2C80 A;  3CRU A;  4GSS A;  3DRN A;  2HFD A;  4O5Q A;  5CRD A;  4G0I A;  1TJD A;  4JR6 A;  4GQF A;  3EU4 A;  5ECQ B;  3KP9 A;  3QPM A;  1X5D A;  3EU3 A;  1ACV A;  6GSV A;  1T7P B;  1ILO A;  2LNT A;  5DDL A;  2H30 A;  4AF2 A;  2HT9 A;  4JBB A;  3BBY A;  3TRQ A;  3VK9 A;  2CVB A;  14GS A;  1S3C A;  9GSS A;  2RII A;  4HUA A;  3VLN A;  5FT3 A;  1G7E A;  5E4W A;  5D9X A;  4FO5 A;  3KTB A;  1GSE A;  5J5N A;  5IPG A;  2XBQ A;  1ON4 A;  5J3R A;  3VWW A;  2WDU A;  2DBC A;  5IMF A;  2HRA A;  1K0B A;  3D5J A;  2GSQ A;  1BQ7 A;  2OBI A;  3G7I A;  4HEA 2;  2VL3 A;  3LFL A;  1YZX A;  3HCZ A;  3L78 A;  1RW1 A;  2DJJ A;  3AY8 A;  1FAA A;  4MLY A;  1ZL9 A;  1O6J A;  2OAC A;  3ZRD A;  2O89 A;  2IPA A;  3FYG A;  2CX3 A;  2HZE B;  2YN1 A;  1PSQ A;  2DJ2 A;  4MDC A;  4D73 A;  3TJB A;  4I2U A;  2GLR A;  3GH9 A;  1GRX A;  3U5R E;  2CX4 A;  3LWA A;  5JWQ B;  4QL9 A;  1VGL A;  4K8M A;  4PGT A;  2GST A;  5HQP A;  2VCV A;  3F4R A;  2L6D A;  1X9W B;  4O5U A;  4L5O A;  2H6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...