1SU9A

Reduced structure of the soluble domain of resa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
137
structure length
137
Chain Sequence
SDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTESMIHDYMNLIKPGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol-disulfide oxidoreductase resA
publication title Structural Basis of Redox-coupled Protein Substrate Selection by the Cytochrome c Biosynthesis Protein ResA.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 44
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1su9A00
19GSA 4GSTA 4HI7A 1BQ7A 1TOFA 5ID2B 4IS0A 4I6XA 1R7HA 3RDWA 3CMIA 3F63A 3UBKA 1ZMAA 3FZAA 5A5KA 2DJJA 3FR9A 2DJ1A 2GZZA 3NIVA 3QOUA 3NOFA 3H4KA 1HD2A 2C0FA 3C1SA 5IMDA 1M2DA 3ERGA 3LEFA 3L0HA 4YAPA 4K0NA 3CYNA 5KN3A 5J9CA 2K6VA 5A4VA 2CX3A 4PQ1A 1YZXA 5DALA 3RBTA 1V58A 2VCXA 5FWGA 1V9WA 5JWOB 1GUHA 1V2AA 2M72A 4IW9A 2RUFA 4K6XA 3HZ8A 3E3EA 2H6ZA 2L5OA 3WGDA 1GLPA 2H72A 2H1DA 3DXBA 2ON5A 2F8AA 4ISDA 3D0ZA 3L9VA 5CAXA 4DSSA 6GSVA 2DLXA 1GNWA 2NTOA 1TXXA 3IK9A 3EYTA 2BMXA 2MMZA 4HJMA 1B4PA 1S3AA 3QAGA 1G0TA 3TRPA 5HFKA 2IMIA 2MBTA 3CBUA 4P3YB 3HXSA 3C73A 1Y6EA 3O3TA 1M9AA 4AGSA 2VL2C 2R2JA 1OYJA 3HVSA 2GTUA 2CZ3A 4ZBBA 2H0GA 2OACA 3KTBA 4J2FA 4MZWA 1VGLA 4LMWA 3CSIA 5DQSA 3HD5A 2C1YA 4JBBA 3F0IA 4F0BA 4LL1B 1XBSA 2YJHA 4IJ3A 4G2EA 3KP9A 1TI3A 3HDCA 4IQAA 2OKAA 5F07A 2GVPA 2RLIA 2YZUA 3IE3A 2H0HA 2H75A 2IMDA 4BA7A 1XXUA 1ZGNA 3IC4A 4TR0A 3ZLPA 4POKA 1QMVA 5GAND 2FD3A 4MDCA 2FHEA 1MTCA 1GSUA 4I5QA 1ZYQB 4KCAA 3M1GA 2LNSA 2IIYA 1EV9A 3HA9A 4GSSA 3M0FA 3CSHA 1THOA 4K0GA 3BD2A 4K7IA 3KTLA 2GSSA 2LRTA 5ABRA 1CQGA 2WJUA 1PD21 5HQPA 4EL1A 1PMTA 3ZITA 1TI1A 1U3AA 2K8SA 5E4WA 4HEA2 2H0IA 1EZKA 4NHWA 2PVOC 5IOWA 1TK0B 2VD1A 1YF1A 4IP1A 3LXZA 2JACA 4LL4B 4E8EA 4H86A 2DC5A 2L6DA 1DE2A 4JR4A 4DSQA 1OVNA 2PPTA 4ZILA 1K0CA 4ZBDA 1SD8A 4YH2A 2EC4A 4EUYA 1C72A 3P90A 3QD9A 20GSA 5DAKB 2A4VA 3TKPA 1RQMA 2JSZA 4MABA 3I69A 3GURA 1URMA 1HNCA 1BAYA 3GHAA 2X8GA 2WB9A 3C71A 1K3LA 2I4AA 1I9DA 2IMEA 1TU8A 3MAKA 4XCSA 4WKWA 3DVWA 2LSTA 3F3QA 1DE1A 3I9V2 3GKXA 4L5OA 5IPHA 2VLTA 2HT9A 3VURA 4KGIA 4ZIJA 1K0NA 3HVXA 1DUGA 1I5GA 4NWYA 2L6CA 4AF2A 1NSWA 1Q4JA 2N5FA 3DKSA 3F8UA 1SL0B 2IJYA 1XFLA 2YZHA 2I9HA 5IMAA 1YY7A 5DALB 1WWJA 1EWXA 2E2MA 4NHZA 4ECJA 2LEGA 4GTUA 5GSSA 5KEJA 1GULA 1OKTA 3IBHA 1F3BA 1HQOA 1RW1A 3A3TA 4IQ1A 1GSEA 3FRCA 3NZNA 1SYXA 4CHSA 4TOPA 3LSZA 4EO3A 2F9SA 4FYUA 4L0UA 3ZMLA 2JZSA 1GTAA 3TKRA 1XZOA 1BJXA 4MMMA 2F51A 1XOBA 2IL3A 2IMFA 2C0DA 3KJYA 2VLUA 5IMFA 5GAPD 4MLYA 2L4QA 5J41A 1XVWA 3Q6OA 1OAZA 1N8JA 4MJAA 1MD4A 3HYPA 5G2ZA 2VL2A 5HR0A 3F6DA 4MF6A 3RAZA 1X5EA 5HR2A 4BWQA 4PGTA 1TTZA 5LCZA 5HFIA 3TKSC 4KW6A 3D4MA 5INYA 2RM6A 3SBCA 4CDOA 5DCHA 4K2DA 1ON4A 3UBLA 4KH7A 5ELGA 1B48A 4WR5A 3EU3A 3WT2A 4MJEA 2EIOA 2QC7A 5F8BA 3D6IA 4IGJA 2WRTA 5L71A 3ZL5A 5EVOA 1A2LA 1MDIA 1OC8A 2FLSA 4KAEA 2K8VA 4LA1A 5FT3A 3BCKA 2VUPA 2EIRA 1EOGA 1PA3A 1PQNA 1WOUA 1OE8A 3GH9A 3IR4A 4L5LA 3VWVA 5LD0A 4EVMA 1T00A 2LQQA 5HR3A 2R6KA 3CRUA 3CTFA 3PGTA 3A2XA 1F3AA 3QAVA 1K0AA 2OJLA 2CA8A 5ECIB 1GRXA 5D9TA 4OCFA 4LLRA 2XC2A 3ERFA 5GSTA 1M99A 4WF4A 4OCEA 3ZYWA 1AQXA 4N0ZA 5J3RA 5IO0A 3TKSE 3K8NA 2YWOA 3M3MA 4KX4A 5DVBA 3J7Yk 1QXHA 3BCIA 3IRAA 4I2UA 4GWRA 5G31A 2HI7A 3GFKA 1BYEA 3TCOA 2H6XA 1A24A 3PR8A 1GUKA 2F8FA 2GT6A 1BG5A 1TRSA 2R37A 3TRXA 2C4JA 2B5YA 3O6TA 2VM2A 1JFUA 2VCZA 1FG4A 3LGCA 3BOAA 3TKQA 2NBSA 2N5BA 2GQKA 4KUNA 3QDNA 4TXOA 2IFQA 3FR6A 1V57A 4POLA 4EE0A 4HOJA 3F4TA 2B1LA 2KP1A 4MP4A 3LORA 3GL3A 2MYGA 3Q18A 1Z7RA 3VWUA 4OMVA 5KN1A 3LWAA 1XPVA 4IKHA 1WIKA 4LMVA 4GCIA 3RHBA 3APSA 2ON7A 2CVKA 2B7KA 3I6AA 3KXOA 1WJKA 1LU4A 2L57A 2PUKC 4I97A 5JCUA 3GTUA 5AGYA 1EP7A 1M2BA 2M80A 2E0QA 4MPFA 1EGRA 4F82A 4K1FA 2LNTA 1GTUA 1JLWA 1ZYEA 3IK7A 4TW5A 4PUAA 3UVTA 1BEDA 4AJ7A 3VLNA 2AAWA 4YQVA 1SJIA 1SK0A 2ZNMA 3ERWA 4FIWA 1ST9A 4ULXA 1AIUA 4GLTA 3SWLA 1SENA 4MH3A 2H1BA 2PN8A 2GQMA 1TW9A 2BJXA 4TR3A 4OFTA 3EMPA 2EIQA 4OD7A 2GZYA 1FB0A 4KSOA 3H8QA 2DIZA 2DMLA 2DJKA 4PNFA 4QL9A 4BVYA 4IHUA 1AAZA 2YOIA 5F05A 2X8CA 5G1LA 3GX8A 1FW1A 4J57E 1GSFA 1F9MA 5J4UA 1O81A 2YV9A 1W89A 5D9VA 2J23A 2H6YA 1A0FA 1R5PA 5CRGA 3EURA 2YWNA 3GRXA 4MZBA 5DJLA 4GRFA 4XS4A 2YN1A 3P8WA 5CRDA 2FA8A 5G30A 3TKSA 4ECIA 3VPTA 2RM5A 3UOMA 4IJIA 2NDOA 1YF0A 5B7CA 3FK8A 1VF3A 4DSRA 4TN8A 1AQWA 3TJKA 4HU9A 4IVFA 1J08A 3UEMA 1TK8B 2JADA 3GKKA 2P31A 1WPIA 4HDEA 4GQFA 1PX6A 1XW9A 2DIYA 2H8LA 3GNJA 1KBNA 4WF5A 1JZWA 2IMKA 1USBA 1ABAA 1SK1A 3F9UA 4DVCA 1SJZA 1K0OA 1TK5B 1EOHA 5H5QA 5CREA 1X5CA 1YEXA 1VF1A 4O92A 4ZBAA 2DBCA 1SYRA 1WMJA 2R4VA 1YKAA 3M9KA 5B6NA 2LUSA 1H75A 3APQA 2H73A 3QFAC 3UAPA 3VPQA 1ERWA 1G6YA 4ACSA 3A2WA 2FWGA 4MA9A 3MNGA 2RIIA 1OC9A 5ELAA 3ZZXA 1KTEA 2KOKA 2O87A 2O89A 5A4WA 3TJBA 2FWHA 1ZZYA 2LS5A 2FWEA 3N9JA 3UMAA 3GL5A 1TRVA 2E7PA 4KB3A 4ZB6A 1PKZA 1TRUA 2NPBA 2TIRA 4O32A 1XVQA 1AUCA 4WBRD 2X8HA 5FHIA 2A2RA 4FH8A 4RQRA 1A2JA 3FYGA 2HZEA 1O7UA 2KP2A 1JHBA 2FA4A 13GSA 4K7NA 5F0GA 1A2MA 1H4OA 2QSIA 2YP6A 4D73B 5A4UA 1O8WA 3JCML 8GSSA 1XCCA 3WYWA 1T7PB 5ECPB 3R2QA 12GSA 1MEKA 2GS3A 4ECCA 3GN3A 3ZFBA 4TVEA 4KNDA 1TRWA 3O76A 3F6FA 1M9BA 2IFQB 4Q5QA 5JWQB 4V2NA 1SKSB 1JZRA 2PU9C 2LJRA 2B5XA 1EGOA 1B4QA 2H01A 4G19A 1S3DA 2F3MA 1GL8A 1DBYA 3GV1A 5JCGA 4X0XA 4JR6A 1G6WA 5F06A 3WD6A 5IMCA 2A2SA 2LKUA 4XIHA 1PRXA 2LV3A 5H5SA 1GNEA 3GTUB 1K3OA 4HJ2A 5B8BA 1O8XA 2HE3A 2LJKA 5KN0A 2H1GA 1T4YA 1E2YA 2AJQB 4F9ZA 1QGVA 3ZVJD 3P2AA 1A0RP 2FNOA 3GMFA 3Q74A 5J5NA 2DJ3A 4J56E 4XRDA 1O73A 4RI7A 1ML6A 4X1UA 17GSA 5ID2A 3DD3A 11GSA 5D73A 2VL9A 4HQZA 1SU9A 4IP6A 4QL7A 2HRFA 4K7OA 1Q98A 3D22A 3L78A 2ALBA 3UIWA 3FZ4A 3DIEA 4YQMA 4F03A 3ZREA 4GSNA 2HSYA 2GSQA 1SKRB 1PKWA 1TDIA 5AN1A 2Z9SA 2C8UA 2GZPA 2XHFA 4MCUA 1G7OA 3MWHA 4NXIA 4ML1A 2PMTA 2B7JA 3FR3A 5D8IA 4DSSB 2MZCA 2WULA 3GKMA 2JU5A 1YDKA 2I3YA 4TRXA 1PX7A 2KHPA 6GSSA 3M8NA 1VRSD 4JU5A 1FVKA 1AXDA 2CV4A 4V2MA 2B3SA 1FOVA 4ZB8A 3MDKA 1WRYA 2C0EA 3LYPA 2I1UA 3W8JA 1EEJA 4PUFC 4WXTA 2QGVA 1J0FA 2O85A 4RQXA 1GSSA 4FYBA 1XWKA 5AIXA 4ZL7A 1SKWB 1R5AA 3L9SA 4FO5A 4MF5A 1TJDA 2HZFA 2YWIA 2JZTA 2O8VB 3C7MA 2LJAA 1ACVA 14GSA 3HJOA 1OC3A 1A23A 1FO5A 2H19A 2H30A 3IAS2 3F3RA 1X9SB 4JZQA 2HYXA 5J9BA 1TU7A 2AUVA 3LQ7A 1K0BA 2XPDA 6GSWA 4EC0A 3TUEA 2OA7A 5ECRB 2D2ZA 3UVHA 3W6GA 3VI7A 1OC9B 2QKEA 1GSDA 3OR5A 3TRQA 3FEUA 1AC1A 2JZRA 1QUWA 3PH9A 3D21A 4POMA 3TOUA 3HJPA 5CNWA 5LNKe 5D9WA 3KM6A 3CXGA 5H5RA 2X64A 1TKDB 3GIXA 4XHMA 10GSA 3G7JA 3KD0A 2YV7A 2B5EA 3QAWA 5KN2A 4HS1A 1V98A 4N30A 5AISA 3KH9A 1VF2A 2BTOT 3ZTLA 5ECOB 2FGXA 2C3TA 5IQYA 3A2VA 2OE3A 3ZIVA 4ZL8A 3GA4A 1PN9A 4EKZA 5JCWA 3VK9A 2KLXA 1K0MA 1PL1A 2H70A 5G5FA 2C80A 3FZ9A 4I2TA 1XIYA 3TJJA 2L59A 1R4WA 2HXKA 4ZL9A 4GXZA 1GTIA 1Z6MA 1K3YA 2DMMA 4N10A 3TJFA 1A8LA 4E8HA 2VD0A 1HYUA 2FUG2 3DMLA 2YNXA 5IMZA 2V1MA 5ENUA 2VM1A 4XS1A 4PURA 3LG6A 2LTKA 4HZ4A 2X99A 3IAM2 4NAXA 1X9MB 4MF7A 5DAKA 2V2GA 3H79A 1DSBA 4BVXA 4ID0A 4HZ2A 1QQ2A 3IHQA 3KH7A 4EDZA 1JZOA 2VO4A 3CSJA 2H71A 3HJMA 3N5OA 1SL1B 1Z9HA 3FZ5A 5D96A 2E2GA 4F2IA 1Z3EA 5EL8A 3ZIJA 3PINA 2HNLA 1F6MC 5GZZB 3D5JA 2XBIA 3FKFA 4EF0A 4G10A 1B9XC 4BL7A 3KZQA 2PWJA 1LJRA 1PGTA 2CVDA 4V1Ag 4HQSA 3DGQA 4POBA 4XRAA 4MZCA 1OKDA 3BBYA 5CP1A 5AIVA 2K9FA 1U87A 4KDYA 4TR1A 2V41A 2CZ2A 5CO3A 4XS6A 1XWCA 3P7XA 1UN2A 5EPFA 2AV4A 2JL4A 2N5AA 1AQVA 1T4ZA 3DWVA 1ZOFA 3LXTA 5D93A 1LBKA 4OFMA 1K0DA 1F37A 1GTBA 1UA5A 3FHKA 4WR4A 3GSSA 4CW9A 3H93A 2HSHA 2C0GA 5CRWA 4PQIA 2ES7A 2YJ7A 4PX1A 3HHVA 4V2LA 1XW5A 4WETA 2M46A 3KCMA 2CAIA 3UL3A 1T1VA 2WFCA 4BPYA 3FY7A 2IN3A 1MDKA 3A5WA 3IDVA 2DSAA 1EP8A 2V6KA 3KP8A 2G2QA 3ME8A 5C00A 5COHA 2AYTA 1E6BA 1WP0A 3ZFLA 3U5RE 1AW9A 1M7TA 1KEBA 2KUCA 1FB6A 3VI5A 1NM3A 3V1WA 2NVLA 5IPGA 1MDJA 4N11A 3QMXA 3GX0A 2VCQA 1X0RA 3VWXA 3QCPA 1WE0A 3J7Yb 2GDRA 4XTSA 4KSMA 1UVZA 16GSA 3G9BA 2WGRA 2XPEA 4YAVA 3E0UA 2I81A 5IMVA 1S3CA 1YEPA 4IN0A 1VF4A 4QQ7A 3ZRDA 3RHCA 1GLQA 2OBIA 3C1RA 5DCGA 5G1KA 1JZDA 4RI6A 7GSSA 2AHEA 4ILFA 1CQHA 1UC7A 2MMOA 4ECBA 1QK8A 2CAQA 3C8EA 4JEDA 3WGXA 4X43A 2H66A 2P0GA 3RPPA 1YQ1A 2LRNA 6GSUA 5E59A 4PNGA 4TR4A 5ECMB 1FAAA 3VWWA 4TXOB 5IO2A 4O7HA 4WBJA 1TP9A 2GSTA 1JLVA 2V6OA 2ZUPA 5ECKB 1XOAA 2CVBA 2MBSA 5ECSA 4NV2A 5DDLA 2TRXA 1O85A 3MSZA 1A8YA 2O7KA 2CX4A 1ZL9A 2GSRA 2PGTA 9GSSA 3GH6A 5DBQA 4MPGA 2HFDA 4HUAA 3CTGA 3F4RA 1XWGA 2RUEA 3UJ1A 4L0WA 3L4NA 3I43A 1EEMA 4OO4A 3S9FA 4JRRA 1V40A 3EMXA 2R5GA 4BWSA 3TOTA 3EE2A 1QFNA 1M2AA 2HRNA 1GH2A 2VL3A 2HLSA 2L4CA 1X5DA 3H1NA 3KMNA 3KIJA 4KDUA 2IPAA 3IOSA 1GWCA 2R3XA 2VLVA 4OO5A 1NW2A 5ECLB 3DYRA 1G7EA 1IYIA 3G7YA 4IBPA 4Q5RA 4V1Ap 4PXOA 1THXA 3EU4A 4KA0A 1KNGA 2CQ9A 3DEXA 1PL2A 1Z6NA 2WS2A 2L5LA 3GYKA 6GSTA 5C04A 1ILOA 1GP1A 4TR1B 1GSQA 5HFGA 2PERA 3F4SA 4Z7XA 1W4VA 1ERUA 4NMUA 1YJ6A 3LYKA 5DJMA 3KEBA 1T8EB 2C3NA 4PQHA 4XS4B 3UARA 4YQUA 1B8XA 4K8MA 4N0VA 1T3BA 5DQYA 2YWMA 4FYCA 1FVJA 3HVVA 1U3IA 2V32A 2G0FA 3GUSA 2VCVA 3ME7A 3EC3A 3CRTA 2VCTA 1EV4A 4EDYA 3GKNA 3IV4A 1U88A 4L8EA 1SJ6A 2GQLA 1SD9A 4TKYA 2VAFA 2LRCA 1PSQA 2P5QA 4Q5NA 1ERTA 4F0CA 3TB2A 1ERVA 3LJRA 2K18A 18GSA 2GGTA 3ED3A 3FW2A 1O6JA 4K9ZA 3US3A 1XWAA 3DVXA 3EINA 3KGKA 2LQOA 3RPNA 1YKCA 3DRNA 3U6VA 2REMA 3E9JB 3G7IA 1J9BA 2B6MA 3WT1A 1NHYA 3EWLA 22GSA 2ZCTA 3EVIA 3VFIA 1OE7A 6GSYA 4ML6A 5EY6A 3BJ5A 4GQCA 4Q5FA 3HCZA 2J9HA 5B8AA 3TDGA 3APOA 2OBKA 4DEJA 4MK3A 3ZVJA 2WZ9A 2TRCP 3TGZA 2AB6A 4AJ6A 1HNBA 2OE0A 4WEYA 2OE1A 2IWTA 1F2EA 1Y25A 3M9JA 2CT6A 3AY8A 3W8SA 2H74A 1X9WB 1R26A 4I8BA 2JSYA 5JWRB 2FCHA 2HZEB 2XBQA 1N2AA 3HKRA 1XW6A 2C3QA 3IA1A 2WDUA 4O5RA 3WGEA 2DJ0A 3IXRA 5ECHB 4HU7A 3L9UA 4OFNA 3IPZA 5IIZA 1B9YC 2FWFA 2PVQA 3HZ4A 4IELA 2PBJA 2MMAA 2YPMA 5CYYA 2MMNA 4D73A 1SK2A 4KCEA 4G9HA 4AJ8A 1HNAA 3D4TA 2GLRA 1NHOA 1M0UA 4ZB9A 2OADA 2YCDA 2WCIA 4MJCA 2VCWA 3ISOA 3TJGA 3KMOA 4NV5A 1Z5YE 1MD3A 1U6TA 5CRHA 5ECNB 3ZMKA 5D9XA 5IOXA 1IYHA 2DJ2A 4TXVA 3QPMA 3QFBC 2FY6A 5B6MA 3LFLA 2B1KA 1ZCPA 2H76A 2P5RA 5IM9A 4MJBA 1BX9A 4ZXGA 1SL2B 3Q19A 2GT5A 4KE3A 1XWBA 4GF0A 1Z7PA 5ECQB 2H1AA 1FHEA 1GSYA 4MH2A 3QR6A 4EXJA 6GSXA 2VOCA 5G5EA 4OWYA 3HY2A 3GSTA 1RK4A 4RUVA 2YANA 4KDXA 4JE1A 4NPBA 1GUMA 2VIMA 5HR1A
chains in the Genus database with same CATH superfamily
19GSA 4GSTA 4HI7A 1BQ7A 1TOFA 5ID2B 4IS0A 4I6XA 1R7HA 3RDWA 3CMIA 3F63A 3UBKA 1ZMAA 3FZAA 5A5KA 2DJJA 3FR9A 2DJ1A 2GZZA 3NIVA 3QOUA 3NOFA 3H4KA 1HD2A 2C0FA 3C1SA 5IMDA 1M2DA 3ERGA 3LEFA 3L0HA 4YAPA 4K0NA 3CYNA 5KN3A 5J9CA 2K6VA 5A4VA 2CX3A 4PQ1A 1YZXA 5DALA 3RBTA 2A2PA 1V58A 2VCXA 5FWGA 1V9WA 5JWOB 1GUHA 1V2AA 2M72A 4IW9A 2RUFA 4K6XA 3HZ8A 3E3EA 2H6ZA 2L5OA 3WGDA 1GLPA 2H72A 2H1DA 3DXBA 2ON5A 2DKIA 2F8AA 4A5PA 4ISDA 3D0ZA 3L9VA 5CAXA 4G0KA 4DSSA 6GSVA 2DLXA 1GNWA 2NTOA 1TXXA 3IK9A 3EYTA 2BMXA 2MMZA 4HJMA 1B4PA 1S3AA 3QAGA 1G0TA 3TRPA 5HFKA 2IMIA 2MBTA 3CBUA 4P3YB 3HXSA 3C73A 1Y6EA 3O3TA 1M9AA 4AGSA 2VL2C 2R2JA 1OYJA 4EIQA 3HVSA 2GTUA 2CZ3A 4ZBBA 2H0GA 2OACA 3KTBA 4J2FA 4MZWA 1VGLA 4LMWA 3CSIA 5DQSA 3HD5A 2C1YA 4JBBA 3F0IA 4F0BA 4LL1B 1XBSA 2YJHA 4IJ3A 4G2EA 3KP9A 1TI3A 3HDCA 4IQAA 2OKAA 5F07A 2GVPA 2RLIA 2YZUA 3IE3A 4USSA 2H0HA 2H75A 2IMDA 4BA7A 1XXUA 1ZGNA 3IC4A 4TR0A 3R3EA 3ZLPA 4POKA 1QMVA 5GAND 2FD3A 4MDCA 2FHEA 1MTCA 1GSUA 4I5QA 1ZYQB 4KCAA 3M1GA 2LNSA 2IIYA 1EV9A 3HA9A 4GSSA 3M0FA 3CSHA 1THOA 4K0GA 3BD2A 4K7IA 3KTLA 2GSSA 2LRTA 5ABRA 1CQGA 2WJUA 1PD21 5HQPA 4EL1A 1PMTA 3ZITA 1TI1A 1U3AA 2K8SA 5E4WA 4HEA2 2H0IA 1EZKA 4NHWA 1XG8A 2PVOC 5IOWA 1TK0B 2VD1A 1YF1A 4IP1A 3LXZA 2JACA 4LL4B 4E8EA 4H86A 2DC5A 2L6DA 3PPUA 1DE2A 4JR4A 4DSQA 1OVNA 2PPTA 4ZILA 1K0CA 4ZBDA 1SD8A 4YH2A 2EC4A 4EUYA 1C72A 3P90A 3QD9A 20GSA 5DAKB 2A4VA 3TKPA 1RQMA 2JSZA 4MABA 4BVXB 2UZ8A 3I69A 3GURA 1URMA 1HNCA 1BAYA 3GHAA 2X8GA 2WB9A 3C71A 1K3LA 2I4AA 1I9DA 2IMEA 1TU8A 3MAKA 4XCSA 4WKWA 3DVWA 2LSTA 3F3QA 1DE1A 3I9V2 3GKXA 4L5OA 5IPHA 2VLTA 2HT9A 3VURA 4KGIA 4ZIJA 1K0NA 3HVXA 1DUGA 1I5GA 4NWYA 2L6CA 4AF2A 1NSWA 1Q4JA 2N5FA 3DKSA 3F8UA 1SL0B 2QA1A 4K5SA 2IJYA 1XFLA 2YZHA 4KF9A 2I9HA 5IMAA 1YY7A 5DALB 1WWJA 1EWXA 2E2MA 4NHZA 4ECJA 2LEGA 4G0LA 4GTUA 5GSSA 1GULA 5KEJA 1OKTA 3IBHA 1F3BA 1HQOA 1RW1A 3A3TA 4ICYA 4IQ1A 1GSEA 3FRCA 3NZNA 1SYXA 4CHSA 4TOPA 3LSZA 4EO3A 2F9SA 4FYUA 4L0UA 3ZMLA 2JZSA 1PFOA 1GTAA 3TKRA 1XZOA 1BJXA 4MMMA 2F51A 1XOBA 2A4HA 2IL3A 2IMFA 2C0DA 3KJYA 2VLUA 5IMFA 5GAPD 4MLYA 2L4QA 5J41A 1XVWA 3Q6OA 1OAZA 1N8JA 4MJAA 1MD4A 3HYPA 5G2ZA 2VL2A 5HR0A 3F6DA 4MF6A 3RAZA 1X5EA 5HR2A 3HVNA 4BWQA 4PGTA 1TTZA 5LCZA 4Z2TA 5HFIA 3TKSC 4KW6A 3D4MA 5INYA 2RM6A 3SBCA 4CDOA 5DCHA 4K2DA 1ON4A 3UBLA 1M3JA 4KH7A 5ELGA 1B48A 4WR5A 3EU3A 3WT2A 4MJEA 2EIOA 2QC7A 5F8BA 3D6IA 4IGJA 2WRTA 5L71A 3ZL5A 5EVOA 1A2LA 1MDIA 1OC8A 2FLSA 4KAEA 2K8VA 4LA1A 5FT3A 3BCKA 2VUPA 2EIRA 1EOGA 1PA3A 1PQNA 1WOUA 1OE8A 3GH9A 3IR4A 4L5LA 3VWVA 5LD0A 4EVMA 1T00A 2LQQA 5HR3A 2R6KA 3CRUA 3CTFA 3PGTA 3A2XA 1F3AA 3QAVA 1K0AA 2OJLA 2CA8A 1FOHA 5ECIB 1GRXA 5D9TA 4OCFA 4LLRA 2XC2A 3ERFA 5GSTA 1M99A 3FMWA 4WF4A 4OCEA 3ZYWA 1AQXA 4N0ZA 5J3RA 5IO0A 3TKSE 3K8NA 2YWOA 3M3MA 4KX4A 5DVBA 3J7Yk 1QXHA 3BCIA 3IRAA 4I2UA 4GWRA 5G31A 5KOXA 2HI7A 3GFKA 1BYEA 3TCOA 2H6XA 1A24A 3PR8A 1GUKA 2F8FA 2GT6A 1BG5A 1TRSA 2R37A 3TRXA 2C4JA 2B5YA 3O6TA 2VM2A 1JFUA 2VCZA 1FG4A 3LGCA 3BOAA 3TKQA 2NBSA 2N5BA 2GQKA 4KUNA 3QDNA 4TXOA 2IFQA 3FR6A 1V57A 4POLA 4EE0A 4HOJA 3F4TA 2B1LA 2KP1A 4MP4A 4PTSA 3LORA 3GL3A 2MYGA 3Q18A 1Z7RA 3VWUA 4OMVA 5KN1A 3LWAA 1XPVA 4IKHA 1WIKA 4LMVA 4GCIA 3RHBA 3APSA 2ON7A 2CVKA 2B7KA 3I6AA 3KXOA 1WJKA 1LU4A 2L57A 2PUKC 4I97A 5JCUA 3GTUA 5AGYA 1EP7A 1M2BA 2M80A 2E0QA 4MPFA 1EGRA 4F82A 4K1FA 2LNTA 1GTUA 1JLWA 1ZYEA 3IK7A 4TW5A 4PUAA 3UVTA 1BEDA 4AJ7A 3VLNA 2AAWA 4YQVA 1SJIA 1SK0A 2ZNMA 3ERWA 4FIWA 1ST9A 4ULXA 1AIUA 4GLTA 3SWLA 1SENA 4MH3A 2H1BA 2PN8A 2GQMA 1TW9A 2BJXA 4TR3A 4OFTA 3EMPA 2EIQA 4OD7A 2GZYA 1FB0A 4KSOA 3H8QA 2DIZA 2DMLA 2DJKA 4PNFA 4QL9A 4BVYA 4IHUA 1AAZA 2YOIA 5F05A 2X8CA 5G1LA 3GX8A 1FW1A 4J57E 1GSFA 4Z2RA 1F9MA 5J4UA 1O81A 2YV9A 1W89A 5D9VA 2J23A 2H6YA 1A0FA 1R5PA 5CRGA 3EURA 2YWNA 3GRXA 4MZBA 5DJLA 4GRFA 4XS4A 2YN1A 3P8WA 5CRDA 2FA8A 5G30A 3TKSA 4ECIA 1S3RA 3VPTA 4O5QA 2RM5A 3UOMA 1ZYNA 4IJIA 2NDOA 1YF0A 4HSCX 3FK8A 5B7CA 1VF3A 4DSRA 4TN8A 1AQWA 3TJKA 4HU9A 4IVFA 1J08A 2X4AA 3UEMA 1TK8B 2JADA 3GKKA 4G0IA 2P31A 1WPIA 4HDEA 4GQFA 1PX6A 1XW9A 2DIYA 2H8LA 3GNJA 1KBNA 4WF5A 1JZWA 2IMKA 1USBA 1ABAA 1SK1A 3F9UA 4DVCA 1SJZA 1K0OA 1TK5B 1EOHA 5H5QA 5CREA 1X5CA 1YEXA 1VF1A 4O92A 4ZBAA 2DBCA 2DKHA 1SYRA 1WMJA 2R4VA 1YKAA 3M9KA 5B6NA 2LUSA 1H75A 3APQA 2H73A 3QFAC 3UAPA 3VPQA 1ERWA 1G6YA 4ACSA 3A2WA 2FWGA 4MA9A 3MNGA 2RIIA 1OC9A 5ELAA 3ZZXA 1KTEA 2KOKA 2O87A 2O89A 5A4WA 3TJBA 2FWHA 1ZZYA 2LS5A 2FWEA 3N9JA 3UMAA 3GL5A 1TRVA 2E7PA 4KB3A 4ZB6A 1PKZA 1TRUA 2NPBA 2TIRA 4O32A 1XVQA 1AUCA 4WBRD 2X8HA 5FHIA 2A2RA 4FH8A 4RQRA 1A2JA 3FYGA 2HZEA 1O7UA 2KP2A 1JHBA 2FA4A 13GSA 4K7NA 5F0GA 1A2MA 1H4OA 2QSIA 2YP6A 4D73B 5A4UA 1O8WA 3JCML 8GSSA 1XCCA 3WYWA 1T7PB 5ECPB 3R2QA 12GSA 1MEKA 2GS3A 4ECCA 3GN3A 3ZFBA 4TVEA 4KNDA 1TRWA 3O76A 3F6FA 1M9BA 2IFQB 4Q5QA 5JWQB 4V2NA 1SKSB 1JZRA 2PU9C 4K5RA 2LJRA 2B5XA 1EGOA 1B4QA 2H01A 4G19A 1S3DA 2F3MA 1GL8A 1DBYA 3GV1A 5JCGA 4X0XA 4JR6A 1G6WA 5F06A 3WD6A 4CY6A 5IMCA 2A2SA 2LKUA 4XIHA 1PRXA 2LV3A 5H5SA 1GNEA 2R0PA 3GTUB 1K3OA 4HJ2A 5B8BA 1O8XA 2HE3A 2LJKA 5KN0A 2R0GA 2H1GA 1T4YA 1E2YA 2AJQB 4F9ZA 1QGVA 3ZVJD 3P2AA 1A0RP 2FNOA 1PN0A 3GMFA 3Q74A 5J5NA 2DJ3A 4J56E 4XRDA 1O73A 4RI7A 1ML6A 4X1UA 17GSA 5ID2A 3DD3A 11GSA 5D73A 3MYDA 2VL9A 4HQZA 1SU9A 4IP6A 4QL7A 2HRFA 4K7OA 1Q98A 3D22A 3L78A 2ALBA 3UIWA 3FZ4A 3DIEA 4YQMA 4F03A 3ZREA 2X49A 4GSNA 2HSYA 2GSQA 1SKRB 1PKWA 1TDIA 5AN1A 2Z9SA 2C8UA 2GZPA 2XHFA 4MCUA 1G7OA 3MWHA 4NXIA 4ML1A 2PMTA 2B7JA 3FR3A 5D8IA 4DSSB 2MZCA 2WULA 3GKMA 4BIKA 2JU5A 1YDKA 2I3YA 4TRXA 1PX7A 2KHPA 6GSSA 3M8NA 1VRSD 4JU5A 1FVKA 1AXDA 2CV4A 4V2MA 2B3SA 1FOVA 4ZB8A 3MDKA 1WRYA 2C0EA 3LYPA 2I1UA 3W8JA 1EEJA 2R0CA 4PUFC 4WXTA 2QGVA 1J0FA 2O85A 4RQXA 5KOWA 1GSSA 4FYBA 1XWKA 5AIXA 4ZL7A 1SKWB 1R5AA 3L9SA 3IHGA 4FO5A 4MF5A 1TJDA 2HZFA 2YWIA 2JZTA 2O8VB 3C7MA 2LJAA 1ACVA 14GSA 3HJOA 1OC3A 1A23A 1FO5A 2H19A 2H30A 3IAS2 3F3RA 1X9SB 4JZQA 2HYXA 5J9BA 1TU7A 2AUVA 3LQ7A 1K0BA 2XPDA 6GSWA 4EC0A 3TUEA 2OA7A 5ECRB 2D2ZA 3UVHA 3W6GA 3VI7A 1OC9B 2QKEA 1GSDA 3OR5A 3TRQA 3FEUA 1AC1A 2JZRA 1QUWA 3PH9A 3D21A 4POMA 3TOUA 3HJPA 5CNWA 5LNKe 5D9WA 3KM6A 3CXGA 5H5RA 2X64A 1TKDB 3GIXA 4XHMA 10GSA 3G7JA 3KD0A 2YV7A 2B5EA 3QAWA 5KN2A 4HS1A 1V98A 4N30A 5AISA 3KH9A 1VF2A 2BTOT 3ZTLA 5ECOB 2FGXA 2C3TA 5IQYA 3A2VA 2OE3A 3ZIVA 4ZL8A 3GA4A 1PN9A 4EKZA 5JCWA 3VK9A 2KLXA 1M3IA 1K0MA 1PL1A 2H70A 5G5FA 2C80A 3FZ9A 4I2TA 1XIYA 3TJJA 2L59A 1R4WA 2HXKA 4ZL9A 4GXZA 1GTIA 1Z6MA 1K3YA 2DMMA 4N10A 3TJFA 1A8LA 4E8HA 2VD0A 1HYUA 2FUG2 3DMLA 2YNXA 5IMZA 2V1MA 5ENUA 2VM1A 3EPTA 4XS1A 4PURA 3LG6A 2LTKA 4HZ4A 2X99A 3IAM2 4NAXA 4MNNA 3MIXA 1X9MB 4MF7A 5DAKA 2V2GA 3H79A 1DSBA 4BVXA 4ID0A 4HZ2A 1QQ2A 3IHQA 3KH7A 4EDZA 1JZOA 2VO4A 3CSJA 2H71A 3HJMA 3N5OA 1SL1B 1Z9HA 4K2XA 3FZ5A 5D96A 2E2GA 4F2IA 1Z3EA 5EL8A 3ZIJA 3PINA 2HNLA 1F6MC 5GZZB 3D5JA 2XBIA 3FKFA 4EF0A 4G10A 1B9XC 2QA2A 4BL7A 3KZQA 2PWJA 1LJRA 1PGTA 2CVDA 4V1Ag 4HQSA 3DGQA 4POBA 4XRAA 4MZCA 1OKDA 3BBYA 5CP1A 5AIVA 2K9FA 1U87A 4KDYA 4TR1A 2V41A 2CZ2A 5CO3A 4XS6A 1XWCA 3P7XA 1UN2A 5EPFA 1ZYPA 2AV4A 2JL4A 4O5UA 2N5AA 1AQVA 1T4ZA 3DWVA 1ZOFA 3LXTA 5D93A 1LBKA 4OFMA 1K0DA 1F37A 1GTBA 1UA5A 3FHKA 4WR4A 3GSSA 4CW9A 3H93A 2HSHA 2C0GA 2HSMA 5CRWA 4PQIA 2ES7A 2YJ7A 4PX1A 3HHVA 4V2LA 1XW5A 4WETA 2M46A 3KCMA 2CAIA 3UL3A 1T1VA 2WFCA 4BPYA 3FY7A 2IN3A 1MDKA 3A5WA 3IDVA 2DSAA 1EP8A 2V6KA 3KP8A 2G2QA 3ME8A 5C00A 5COHA 2AYTA 1E6BA 1WP0A 3ZFLA 3U5RE 1AW9A 1M7TA 1KEBA 2KUCA 1FB6A 3VI5A 1NM3A 3V1WA 2NVLA 5IPGA 1MDJA 4N11A 3QMXA 3GX0A 2VCQA 1X0RA 3VWXA 3QCPA 1WE0A 3J7Yb 2GDRA 4XTSA 4KSMA 1UVZA 16GSA 3G9BA 2WGRA 2XPEA 4YAVA 3E0UA 2I81A 5IMVA 1S3CA 1YEPA 4IN0A 1VF4A 4QQ7A 3ZRDA 3RHCA 1GLQA 2OBIA 3C1RA 5DCGA 5G1KA 1JZDA 4RI6A 7GSSA 2AHEA 4ILFA 1CQHA 1UC7A 2MMOA 4ECBA 1QK8A 2CAQA 3C8EA 4JEDA 3WGXA 4X43A 2H66A 2P0GA 3RPPA 1YQ1A 2LRNA 6GSUA 5E59A 4PNGA 4TR4A 5ECMB 1FAAA 3VWWA 4TXOB 5IO2A 4O7HA 4WBJA 1TP9A 2GSTA 1JLVA 2V6OA 2ZUPA 5ECKB 1XOAA 2CVBA 2MBSA 5ECSA 4NV2A 5DDLA 2TRXA 1O85A 3MSZA 1A8YA 2O7KA 2CX4A 1ZL9A 2GSRA 2PGTA 9GSSA 3GH6A 5DBQA 4MPGA 2HFDA 3LW9A 4HUAA 3CTGA 3F4RA 1XWGA 2RUEA 3UJ1A 4L0WA 3L4NA 3I43A 1EEMA 4OO4A 3S9FA 4JRRA 1V40A 3EMXA 2R5GA 4BWSA 4YKFA 3TOTA 3EE2A 1QFNA 2HRKA 1M2AA 2HRNA 1GH2A 2VL3A 2HLSA 4EIPA 2L4CA 1X5DA 3H1NA 3KMNA 3KIJA 4KDUA 2IPAA 3IOSA 1GWCA 2R3XA 2VLVA 4OO5A 1NW2A 5ECLB 3DYRA 1G7EA 4BL7B 1IYIA 3G7YA 4IBPA 4Q5RA 4V1Ap 4PXOA 1THXA 3EU4A 4KA0A 1KNGA 2CQ9A 3DEXA 1PL2A 1Z6NA 2WS2A 2L5LA 3GYKA 6GSTA 5C04A 4BVYB 1ILOA 1GP1A 4TR1B 1GSQA 5HFGA 2PERA 3F4SA 4Z7XA 1W4VA 1ERUA 4NMUA 1YJ6A 3LYKA 5DJMA 3KEBA 1T8EB 2C3NA 4PQHA 4XS4B 3UARA 4YQUA 1B8XA 4K8MA 4N0VA 1T3BA 5DQYA 2YWMA 5BRTA 4FYCA 1FVJA 3HVVA 3CQFA 1U3IA 2V32A 2G0FA 3GUSA 2VCVA 4CY8A 3ME7A 3EC3A 3CRTA 2VCTA 1EV4A 4EDYA 3GKNA 3IV4A 1U88A 2HRAA 4L8EA 1SJ6A 2GQLA 1SD9A 4TKYA 2VAFA 2LRCA 1PSQA 2P5QA 4Q5NA 1ERTA 4F0CA 3TB2A 1ERVA 3LJRA 2K18A 18GSA 2GGTA 4Z2UA 3ED3A 3FW2A 1O6JA 4K9ZA 3US3A 1XWAA 3DVXA 3EINA 3KGKA 2LQOA 3RPNA 1YKCA 3DRNA 3U6VA 2REMA 3A5IA 3E9JB 3G7IA 1J9BA 2B6MA 3WT1A 1NHYA 3EWLA 22GSA 2ZCTA 3EVIA 3VFIA 1OE7A 6GSYA 4ML6A 5EY6A 3BJ5A 4GQCA 4Q5FA 3HCZA 2J9HA 5B8AA 3TDGA 3APOA 2OBKA 4DEJA 4MK3A 3ZVJA 2WZ9A 2TRCP 3TGZA 4YKGA 2AB6A 4AJ6A 1HNBA 2OE0A 4WEYA 2OE1A 2IWTA 1F2EA 1Y25A 3M9JA 2CT6A 3AY8A 3W8SA 2H74A 1X9WB 1R26A 4I8BA 2JSYA 4FQUA 5JWRB 2FCHA 2HZEB 2XBQA 1N2AA 5BMUA 3HKRA 1XW6A 2C3QA 3IA1A 2WDUA 4O5RA 3WGEA 2DJ0A 3IXRA 5ECHB 4HU7A 3L9UA 4OFNA 3IPZA 5IIZA 1B9YC 2FWFA 2PVQA 3HZ4A 4IELA 2PBJA 2MMAA 2YPMA 5CYYA 2MMNA 4D73A 1SK2A 4KCEA 4G9HA 4AJ8A 1HNAA 3D4TA 2GLRA 1NHOA 1M0UA 4ZB9A 2OADA 2YCDA 2WCIA 4MJCA 2VCWA 3ISOA 3TJGA 3KMOA 4NV5A 1Z5YE 1MD3A 1U6TA 5CRHA 5ECNB 3ZMKA 5D9XA 5IOXA 1IYHA 2DJ2A 4TXVA 4X4JA 3QPMA 3QFBC 2FY6A 5B6MA 3LFLA 2B1KA 1ZCPA 2H76A 2P5RA 5IM9A 4MJBA 1BX9A 4ZXGA 1SL2B 3Q19A 2GT5A 4KE3A 1XWBA 4GF0A 1Z7PA 5ECQB 2H1AA 1FHEA 1GSYA 4MH2A 3IC8A 3QR6A 4EXJA 6GSXA 2VOCA 5G5EA 4OWYA 3HY2A 3GSTA 1RK4A 4RUVA 2YANA 4KDXA 4JE1A 4NPBA 1GUMA 2VIMA 5HR1A
chains in the Genus database with same CATH topology
19GSA 4GSTA 4HI7A 1BQ7A 1TOFA 5ID2B 4IS0A 4I6XA 1R7HA 3RDWA 3CMIA 3F63A 3UBKA 1ZMAA 3FZAA 5A5KA 2DJJA 3FR9A 2DJ1A 2GZZA 3NIVA 3QOUA 3NOFA 3H4KA 1HD2A 2C0FA 3C1SA 5IMDA 1M2DA 3ERGA 3LEFA 3L0HA 4YAPA 4K0NA 3CYNA 5KN3A 5J9CA 2K6VA 5A4VA 2CX3A 4PQ1A 1YZXA 5DALA 3RBTA 2A2PA 1V58A 2VCXA 5FWGA 1V9WA 5JWOB 1GUHA 1V2AA 2M72A 4IW9A 2RUFA 4K6XA 3HZ8A 3E3EA 2H6ZA 2L5OA 3WGDA 1GLPA 2H72A 2H1DA 3DXBA 2ON5A 2DKIA 2F8AA 4A5PA 4ISDA 3D0ZA 3L9VA 5CAXA 4G0KA 4DSSA 6GSVA 2DLXA 1GNWA 2NTOA 1TXXA 3IK9A 3EYTA 2BMXA 2MMZA 4HJMA 1B4PA 1S3AA 3QAGA 1G0TA 3TRPA 5HFKA 2IMIA 2MBTA 3CBUA 4P3YB 3HXSA 3C73A 1Y6EA 3O3TA 1M9AA 4AGSA 2VL2C 2R2JA 1OYJA 4EIQA 3HVSA 2GTUA 2CZ3A 4ZBBA 2H0GA 2OACA 3KTBA 4J2FA 4MZWA 1VGLA 4LMWA 3CSIA 5DQSA 3HD5A 2C1YA 4JBBA 3F0IA 4F0BA 4LL1B 1XBSA 2YJHA 4IJ3A 4G2EA 3KP9A 1TI3A 3HDCA 4IQAA 2OKAA 5F07A 2GVPA 2RLIA 2YZUA 3IE3A 4USSA 2H0HA 2H75A 2IMDA 4BA7A 1XXUA 1ZGNA 3IC4A 4TR0A 3R3EA 3ZLPA 4POKA 1QMVA 5GAND 2FD3A 4MDCA 2FHEA 1MTCA 1GSUA 4I5QA 1ZYQB 4KCAA 3M1GA 2LNSA 2IIYA 1EV9A 3HA9A 4GSSA 3M0FA 3CSHA 1THOA 4K0GA 3BD2A 4K7IA 3KTLA 2GSSA 2LRTA 5ABRA 1CQGA 2WJUA 1PD21 5HQPA 4EL1A 1PMTA 3ZITA 1TI1A 1U3AA 2K8SA 5E4WA 4HEA2 2H0IA 1EZKA 4NHWA 2PVOC 5IOWA 1TK0B 2VD1A 1YF1A 4IP1A 3LXZA 2JACA 4LL4B 4E8EA 4H86A 2DC5A 2L6DA 3PPUA 1DE2A 4JR4A 4DSQA 1OVNA 2PPTA 4ZILA 1K0CA 4ZBDA 1SD8A 4YH2A 2EC4A 4EUYA 1C72A 3P90A 3QD9A 20GSA 5DAKB 2A4VA 3TKPA 1RQMA 2JSZA 4MABA 4BVXB 2UZ8A 3I69A 3GURA 1URMA 1HNCA 1BAYA 3GHAA 2X8GA 2WB9A 3C71A 1K3LA 2I4AA 1I9DA 2IMEA 1TU8A 3MAKA 4XCSA 4WKWA 3DVWA 2LSTA 3F3QA 1DE1A 3I9V2 3GKXA 4L5OA 5IPHA 2VLTA 2HT9A 3VURA 4KGIA 4ZIJA 1K0NA 3HVXA 1DUGA 1I5GA 4NWYA 2L6CA 4AF2A 1NSWA 1Q4JA 2N5FA 3DKSA 3F8UA 1SL0B 2QA1A 4K5SA 2IJYA 1XFLA 2YZHA 4KF9A 2I9HA 5IMAA 1YY7A 5DALB 1WWJA 1EWXA 2E2MA 4NHZA 4ECJA 2LEGA 4G0LA 4GTUA 5GSSA 1GULA 5KEJA 1OKTA 3IBHA 1F3BA 1HQOA 1RW1A 3A3TA 4ICYA 4IQ1A 1GSEA 3FRCA 3NZNA 1SYXA 4CHSA 4TOPA 3LSZA 4EO3A 2F9SA 4FYUA 4L0UA 3ZMLA 2JZSA 1GTAA 3TKRA 1XZOA 1BJXA 4MMMA 2F51A 1XOBA 2A4HA 2IL3A 2IMFA 2C0DA 3KJYA 2VLUA 5IMFA 5GAPD 4MLYA 2L4QA 5J41A 1XVWA 3Q6OA 1OAZA 1N8JA 4MJAA 1MD4A 3HYPA 5G2ZA 2VL2A 5HR0A 3F6DA 4MF6A 3RAZA 1X5EA 5HR2A 4BWQA 4PGTA 1TTZA 5LCZA 4Z2TA 5HFIA 3TKSC 4KW6A 3D4MA 5INYA 2RM6A 3SBCA 4CDOA 5DCHA 4K2DA 1ON4A 3UBLA 4KH7A 5ELGA 1B48A 4WR5A 3EU3A 3WT2A 4MJEA 2EIOA 2QC7A 5F8BA 3D6IA 4IGJA 2WRTA 5L71A 3ZL5A 5EVOA 1A2LA 1MDIA 1OC8A 2FLSA 4KAEA 2K8VA 4LA1A 5FT3A 3BCKA 2VUPA 2EIRA 1EOGA 1PA3A 1PQNA 1WOUA 1OE8A 3GH9A 3IR4A 4L5LA 3VWVA 5LD0A 4EVMA 1T00A 2LQQA 5HR3A 2R6KA 3CRUA 3CTFA 3PGTA 3A2XA 1F3AA 3QAVA 1K0AA 2OJLA 2CA8A 1FOHA 5ECIB 1GRXA 5D9TA 4OCFA 4LLRA 2XC2A 3ERFA 5GSTA 1M99A 3FMWA 4WF4A 4OCEA 3ZYWA 1AQXA 4N0ZA 5J3RA 5IO0A 3TKSE 3K8NA 2YWOA 3M3MA 4KX4A 5DVBA 3J7Yk 1QXHA 3BCIA 3IRAA 4I2UA 4GWRA 5G31A 5KOXA 2HI7A 3GFKA 1BYEA 3TCOA 2H6XA 1A24A 3PR8A 1GUKA 2F8FA 2GT6A 1BG5A 1TRSA 2R37A 3TRXA 2C4JA 2B5YA 3O6TA 2VM2A 1JFUA 2VCZA 1FG4A 3LGCA 3BOAA 3TKQA 2NBSA 2N5BA 2GQKA 4KUNA 3QDNA 4TXOA 2IFQA 3FR6A 1V57A 4POLA 4EE0A 4HOJA 3F4TA 2B1LA 2KP1A 4MP4A 4PTSA 3LORA 3GL3A 2MYGA 3Q18A 1Z7RA 3VWUA 4OMVA 5KN1A 3LWAA 1XPVA 4IKHA 1WIKA 4LMVA 4GCIA 3RHBA 3APSA 2ON7A 2CVKA 2B7KA 3I6AA 3KXOA 1WJKA 1LU4A 2L57A 2PUKC 4I97A 5JCUA 3GTUA 5AGYA 1EP7A 1M2BA 2M80A 2E0QA 4MPFA 1EGRA 4F82A 4K1FA 2LNTA 1GTUA 1JLWA 1ZYEA 3IK7A 4TW5A 4PUAA 3UVTA 1BEDA 4AJ7A 3VLNA 2AAWA 4YQVA 1SJIA 1SK0A 2ZNMA 3ERWA 4FIWA 1ST9A 4ULXA 1AIUA 4GLTA 3SWLA 1SENA 4MH3A 2H1BA 2PN8A 2GQMA 1TW9A 2BJXA 4TR3A 4OFTA 3EMPA 2EIQA 4OD7A 2GZYA 1FB0A 4KSOA 3H8QA 2DIZA 2DMLA 2DJKA 4PNFA 4QL9A 4BVYA 4IHUA 1AAZA 2YOIA 5F05A 2X8CA 5G1LA 3GX8A 1FW1A 4J57E 1GSFA 4Z2RA 1F9MA 5J4UA 1O81A 2YV9A 1W89A 5D9VA 2J23A 2H6YA 1A0FA 1R5PA 5CRGA 3EURA 2YWNA 3GRXA 4MZBA 5DJLA 4GRFA 4XS4A 2YN1A 3P8WA 5CRDA 2FA8A 5G30A 3TKSA 4ECIA 3VPTA 4O5QA 2RM5A 3UOMA 1ZYNA 4IJIA 2NDOA 1YF0A 5B7CA 3FK8A 1VF3A 4DSRA 4TN8A 1AQWA 3TJKA 4HU9A 4IVFA 1J08A 2X4AA 3UEMA 1TK8B 2JADA 3GKKA 4G0IA 2P31A 1WPIA 4HDEA 4GQFA 1PX6A 1XW9A 2DIYA 2H8LA 3GNJA 1KBNA 4WF5A 1JZWA 2IMKA 1USBA 1ABAA 1SK1A 3F9UA 4DVCA 1SJZA 1K0OA 1TK5B 1EOHA 5H5QA 5CREA 1X5CA 1YEXA 1VF1A 4O92A 4ZBAA 2DBCA 2DKHA 1SYRA 1WMJA 2R4VA 1YKAA 3M9KA 5B6NA 2LUSA 1H75A 3APQA 2H73A 3QFAC 3UAPA 3VPQA 1ERWA 1G6YA 4ACSA 3A2WA 2FWGA 4MA9A 3MNGA 2RIIA 1OC9A 5ELAA 3ZZXA 1KTEA 2KOKA 2O87A 2O89A 5A4WA 3TJBA 2FWHA 1ZZYA 2LS5A 2FWEA 3N9JA 3UMAA 3GL5A 1TRVA 2E7PA 4KB3A 4ZB6A 1PKZA 1TRUA 2NPBA 2TIRA 4O32A 1XVQA 1AUCA 4WBRD 2X8HA 5FHIA 2A2RA 4FH8A 4RQRA 1A2JA 3FYGA 2HZEA 1O7UA 2KP2A 1JHBA 2FA4A 13GSA 4K7NA 5F0GA 1A2MA 1H4OA 2QSIA 2YP6A 4D73B 5A4UA 1O8WA 3JCML 8GSSA 1XCCA 3WYWA 1T7PB 5ECPB 3R2QA 12GSA 1MEKA 2GS3A 4ECCA 3GN3A 3ZFBA 4TVEA 4KNDA 1TRWA 3O76A 3F6FA 1M9BA 2IFQB 4Q5QA 5JWQB 4V2NA 1SKSB 1JZRA 2PU9C 4K5RA 2LJRA 2B5XA 1EGOA 1B4QA 2H01A 4G19A 1S3DA 2F3MA 1GL8A 1DBYA 3GV1A 5JCGA 4X0XA 4JR6A 1G6WA 5F06A 3WD6A 4CY6A 5IMCA 2A2SA 2LKUA 4XIHA 1PRXA 2LV3A 5H5SA 1GNEA 2R0PA 3GTUB 1K3OA 4HJ2A 5B8BA 1O8XA 2HE3A 2LJKA 5KN0A 2R0GA 2H1GA 1T4YA 1E2YA 2AJQB 4F9ZA 1QGVA 3ZVJD 3P2AA 1A0RP 2FNOA 1PN0A 3GMFA 3Q74A 5J5NA 2DJ3A 4J56E 4XRDA 1O73A 4RI7A 1ML6A 4X1UA 17GSA 5ID2A 3DD3A 11GSA 5D73A 3MYDA 2VL9A 4HQZA 1SU9A 4IP6A 4QL7A 2HRFA 4K7OA 1Q98A 3D22A 3L78A 2ALBA 3UIWA 3FZ4A 3DIEA 4YQMA 4F03A 3ZREA 2X49A 4GSNA 2HSYA 2GSQA 1SKRB 1PKWA 1TDIA 5AN1A 2Z9SA 2C8UA 2GZPA 2XHFA 4MCUA 1G7OA 3MWHA 4NXIA 4ML1A 2PMTA 2B7JA 3FR3A 5D8IA 4DSSB 2MZCA 2WULA 3GKMA 2JU5A 1YDKA 2I3YA 4TRXA 1PX7A 2KHPA 6GSSA 3M8NA 1VRSD 4JU5A 1FVKA 1AXDA 2CV4A 4V2MA 2B3SA 1FOVA 4ZB8A 3MDKA 1WRYA 2C0EA 3LYPA 2I1UA 3W8JA 1EEJA 2R0CA 4PUFC 4WXTA 2QGVA 1J0FA 2O85A 4RQXA 5KOWA 1GSSA 4FYBA 1XWKA 5AIXA 4ZL7A 1SKWB 1R5AA 3L9SA 3IHGA 4FO5A 4MF5A 1TJDA 2HZFA 2YWIA 2JZTA 2O8VB 3C7MA 2LJAA 1ACVA 14GSA 3HJOA 1OC3A 1A23A 1FO5A 2H19A 2H30A 3IAS2 3F3RA 1X9SB 4JZQA 2HYXA 5J9BA 1TU7A 2AUVA 3LQ7A 1K0BA 2XPDA 6GSWA 4EC0A 3TUEA 2OA7A 5ECRB 2D2ZA 3UVHA 3W6GA 3VI7A 1OC9B 2QKEA 1GSDA 3OR5A 3TRQA 3FEUA 1AC1A 2JZRA 1QUWA 3PH9A 3D21A 4POMA 3TOUA 3HJPA 5CNWA 5LNKe 5D9WA 3KM6A 3CXGA 5H5RA 2X64A 1TKDB 3GIXA 4XHMA 10GSA 3G7JA 3KD0A 2YV7A 2B5EA 3QAWA 5KN2A 4HS1A 1V98A 4N30A 5AISA 3KH9A 1VF2A 2BTOT 3ZTLA 5ECOB 2FGXA 2C3TA 5IQYA 3A2VA 2OE3A 3ZIVA 4ZL8A 3GA4A 1PN9A 4EKZA 5JCWA 3VK9A 2KLXA 1K0MA 1PL1A 2H70A 5G5FA 2C80A 3FZ9A 4I2TA 1XIYA 3TJJA 2L59A 1R4WA 2HXKA 4ZL9A 4GXZA 1GTIA 1Z6MA 1K3YA 2DMMA 4N10A 3TJFA 1A8LA 4E8HA 2VD0A 1HYUA 2FUG2 3DMLA 2YNXA 5IMZA 2V1MA 5ENUA 2VM1A 3EPTA 4XS1A 4PURA 3LG6A 2LTKA 4HZ4A 2X99A 3IAM2 4NAXA 4MNNA 3MIXA 1X9MB 4MF7A 5DAKA 2V2GA 3H79A 1DSBA 4BVXA 4ID0A 4HZ2A 1QQ2A 3IHQA 3KH7A 4EDZA 1JZOA 2VO4A 3CSJA 2H71A 3HJMA 3N5OA 1SL1B 1Z9HA 4K2XA 3FZ5A 5D96A 2E2GA 4F2IA 1Z3EA 5EL8A 3ZIJA 3PINA 2HNLA 1F6MC 5GZZB 3D5JA 2XBIA 3FKFA 4EF0A 4G10A 1B9XC 2QA2A 4BL7A 3KZQA 2PWJA 1LJRA 1PGTA 2CVDA 4V1Ag 4HQSA 3DGQA 4POBA 4XRAA 4MZCA 1OKDA 3BBYA 5CP1A 5AIVA 2K9FA 1U87A 4KDYA 4TR1A 2V41A 2CZ2A 5CO3A 4XS6A 1XWCA 3P7XA 1UN2A 5EPFA 1ZYPA 2AV4A 2JL4A 4O5UA 2N5AA 1AQVA 1T4ZA 3DWVA 1ZOFA 3LXTA 5D93A 1LBKA 4OFMA 1K0DA 1F37A 1GTBA 1UA5A 3FHKA 4WR4A 3GSSA 4CW9A 3H93A 2HSHA 2C0GA 2HSMA 5CRWA 4PQIA 2ES7A 2YJ7A 4PX1A 3HHVA 4V2LA 1XW5A 4WETA 2M46A 3KCMA 2CAIA 3UL3A 1T1VA 2WFCA 4BPYA 3FY7A 2IN3A 1MDKA 3A5WA 3IDVA 2DSAA 1EP8A 2V6KA 3KP8A 2G2QA 3ME8A 5C00A 5COHA 2AYTA 1E6BA 1WP0A 3ZFLA 3U5RE 1AW9A 1M7TA 1KEBA 2KUCA 1FB6A 3VI5A 1NM3A 3V1WA 2NVLA 5IPGA 1MDJA 4N11A 3QMXA 3GX0A 2VCQA 1X0RA 3VWXA 3QCPA 1WE0A 3J7Yb 2GDRA 4XTSA 4KSMA 1UVZA 16GSA 3G9BA 2WGRA 2XPEA 4YAVA 3E0UA 2I81A 5IMVA 1S3CA 1YEPA 4IN0A 1VF4A 4QQ7A 3ZRDA 3RHCA 1GLQA 2OBIA 3C1RA 5DCGA 5G1KA 1JZDA 4RI6A 7GSSA 2AHEA 4ILFA 1CQHA 1UC7A 2MMOA 4ECBA 1QK8A 2CAQA 3C8EA 4JEDA 3WGXA 4X43A 2H66A 2P0GA 3RPPA 1YQ1A 2LRNA 6GSUA 5E59A 4PNGA 4TR4A 5ECMB 1FAAA 3VWWA 4TXOB 5IO2A 4O7HA 4WBJA 1TP9A 2GSTA 1JLVA 2V6OA 2ZUPA 5ECKB 1XOAA 2CVBA 2MBSA 5ECSA 4NV2A 5DDLA 2TRXA 1O85A 3MSZA 1A8YA 2O7KA 2CX4A 1ZL9A 2GSRA 2PGTA 9GSSA 3GH6A 5DBQA 4MPGA 2HFDA 3LW9A 4HUAA 3CTGA 3F4RA 1XWGA 2RUEA 3UJ1A 4L0WA 3L4NA 3I43A 1EEMA 4OO4A 3S9FA 4JRRA 1V40A 3EMXA 2R5GA 4BWSA 4YKFA 3TOTA 3EE2A 1QFNA 2HRKA 1M2AA 2HRNA 1GH2A 2VL3A 2HLSA 4EIPA 2L4CA 1X5DA 3H1NA 3KMNA 3KIJA 4KDUA 2IPAA 3IOSA 1GWCA 2R3XA 2VLVA 4OO5A 1NW2A 5ECLB 3DYRA 1G7EA 4BL7B 1IYIA 3G7YA 4IBPA 4Q5RA 4V1Ap 4PXOA 1THXA 3EU4A 4KA0A 1KNGA 2CQ9A 3DEXA 1PL2A 1Z6NA 2WS2A 2L5LA 3GYKA 6GSTA 5C04A 4BVYB 1ILOA 1GP1A 4TR1B 1GSQA 5HFGA 2PERA 3F4SA 4Z7XA 1W4VA 1ERUA 4NMUA 1YJ6A 3LYKA 5DJMA 3KEBA 1T8EB 2C3NA 4PQHA 4XS4B 3UARA 4YQUA 1B8XA 4K8MA 4N0VA 1T3BA 5DQYA 2YWMA 5BRTA 4FYCA 1FVJA 3HVVA 1U3IA 2V32A 2G0FA 3GUSA 2VCVA 4CY8A 3ME7A 3EC3A 3CRTA 2VCTA 1EV4A 4EDYA 3GKNA 3IV4A 1U88A 2HRAA 4L8EA 1SJ6A 2GQLA 1SD9A 4TKYA 2VAFA 2LRCA 1PSQA 2P5QA 4Q5NA 1ERTA 4F0CA 3TB2A 1ERVA 3LJRA 2K18A 18GSA 2GGTA 4Z2UA 3ED3A 3FW2A 1O6JA 4K9ZA 3US3A 1XWAA 3DVXA 3EINA 3KGKA 2LQOA 3RPNA 1YKCA 3DRNA 3U6VA 2REMA 3A5IA 3E9JB 3G7IA 1J9BA 2B6MA 3WT1A 1NHYA 3EWLA 22GSA 2ZCTA 3EVIA 3VFIA 1OE7A 6GSYA 4ML6A 5EY6A 3BJ5A 4GQCA 4Q5FA 3HCZA 2J9HA 5B8AA 3TDGA 3APOA 2OBKA 4DEJA 4MK3A 3ZVJA 2WZ9A 2TRCP 3TGZA 4YKGA 2AB6A 4AJ6A 1HNBA 2OE0A 4WEYA 2OE1A 2IWTA 1F2EA 1Y25A 3M9JA 2CT6A 3AY8A 3W8SA 2H74A 1X9WB 1R26A 4I8BA 2JSYA 4FQUA 5JWRB 2FCHA 2HZEB 2XBQA 1N2AA 5BMUA 3HKRA 1XW6A 2C3QA 3IA1A 2WDUA 4O5RA 3WGEA 2DJ0A 3IXRA 5ECHB 4HU7A 3L9UA 4OFNA 3IPZA 5IIZA 1B9YC 2FWFA 2PVQA 3HZ4A 4IELA 2PBJA 2MMAA 2YPMA 5CYYA 2MMNA 4D73A 1SK2A 4KCEA 4G9HA 4AJ8A 1HNAA 3D4TA 2GLRA 1NHOA 1M0UA 4ZB9A 2OADA 2YCDA 2WCIA 4MJCA 2VCWA 3ISOA 3TJGA 3KMOA 4NV5A 1Z5YE 1MD3A 1U6TA 5CRHA 5ECNB 3ZMKA 5D9XA 5IOXA 1IYHA 2DJ2A 4TXVA 4X4JA 3QPMA 3QFBC 2FY6A 5B6MA 3LFLA 2B1KA 1ZCPA 2H76A 2P5RA 5IM9A 4MJBA 1BX9A 4ZXGA 1SL2B 3Q19A 2GT5A 4KE3A 1XWBA 4GF0A 1Z7PA 5ECQB 2H1AA 1FHEA 1GSYA 4MH2A 3IC8A 3QR6A 4EXJA 6GSXA 2VOCA 5G5EA 4OWYA 3HY2A 3GSTA 1RK4A 4RUVA 2YANA 4KDXA 4JE1A 4NPBA 1GUMA 2VIMA 5HR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 19GS A;  4GST A;  4HI7 A;  1BQ7 A;  1TOF A;  5ID2 B;  4IS0 A;  4I6X A;  1R7H A;  3RDW A;  3CMI A;  3F63 A;  3UBK A;  1ZMA A;  3FZA A;  5A5K A;  2DJJ A;  3FR9 A;  2DJ1 A;  2GZZ A;  3NIV A;  3QOU A;  3NOF A;  3H4K A;  1HD2 A;  2C0F A;  3C1S A;  5IMD A;  1M2D A;  3ERG A;  3LEF A;  3L0H A;  4YAP A;  4K0N A;  3CYN A;  5KN3 A;  5J9C A;  2K6V A;  5A4V A;  2CX3 A;  4PQ1 A;  1YZX A;  5DAL A;  3RBT A;  1V58 A;  2VCX A;  5FWG A;  1V9W A;  5JWO B;  1GUH A;  1V2A A;  2M72 A;  4IW9 A;  2RUF A;  4K6X A;  3HZ8 A;  3E3E A;  2H6Z A;  2L5O A;  3WGD A;  1GLP A;  2H72 A;  2H1D A;  3DXB A;  2ON5 A;  2F8A A;  4ISD A;  3D0Z A;  3L9V A;  5CAX A;  4DSS A;  6GSV A;  2DLX A;  1GNW A;  2NTO A;  1TXX A;  3IK9 A;  3EYT A;  2BMX A;  2MMZ A;  4HJM A;  1B4P A;  1S3A A;  3QAG A;  1G0T A;  3TRP A;  5HFK A;  2IMI A;  2MBT A;  3CBU A;  4P3Y B;  3HXS A;  3C73 A;  1Y6E A;  3O3T A;  1M9A A;  4AGS A;  2VL2 C;  2R2J A;  1OYJ A;  3HVS A;  2GTU A;  2CZ3 A;  4ZBB A;  2H0G A;  2OAC A;  3KTB A;  4J2F A;  4MZW A;  1VGL A;  4LMW A;  3CSI A;  5DQS A;  3HD5 A;  2C1Y A;  4JBB A;  3F0I A;  4F0B A;  4LL1 B;  1XBS A;  2YJH A;  4IJ3 A;  4G2E A;  3KP9 A;  1TI3 A;  3HDC A;  4IQA A;  2OKA A;  5F07 A;  2GVP A;  2RLI A;  2YZU A;  3IE3 A;  2H0H A;  2H75 A;  2IMD A;  4BA7 A;  1XXU A;  1ZGN A;  3IC4 A;  4TR0 A;  3ZLP A;  4POK A;  1QMV A;  5GAN D;  2FD3 A;  4MDC A;  2FHE A;  1MTC A;  1GSU A;  4I5Q A;  1ZYQ B;  4KCA A;  3M1G A;  2LNS A;  2IIY A;  1EV9 A;  3HA9 A;  4GSS A;  3M0F A;  3CSH A;  1THO A;  4K0G A;  3BD2 A;  4K7I A;  3KTL A;  2GSS A;  2LRT A;  5ABR A;  1CQG A;  2WJU A;  1PD2 1;  5HQP A;  4EL1 A;  1PMT A;  3ZIT A;  1TI1 A;  1U3A A;  2K8S A;  5E4W A;  4HEA 2;  2H0I A;  1EZK A;  4NHW A;  2PVO C;  5IOW A;  1TK0 B;  2VD1 A;  1YF1 A;  4IP1 A;  3LXZ A;  2JAC A;  4LL4 B;  4E8E A;  4H86 A;  2DC5 A;  2L6D A;  1DE2 A;  4JR4 A;  4DSQ A;  1OVN A;  2PPT A;  4ZIL A;  1K0C A;  4ZBD A;  1SD8 A;  4YH2 A;  2EC4 A;  4EUY A;  1C72 A;  3P90 A;  3QD9 A;  20GS A;  5DAK B;  2A4V A;  3TKP A;  1RQM A;  2JSZ A;  4MAB A;  3I69 A;  3GUR A;  1URM A;  1HNC A;  1BAY A;  3GHA A;  2X8G A;  2WB9 A;  3C71 A;  1K3L A;  2I4A A;  1I9D A;  2IME A;  1TU8 A;  3MAK A;  4XCS A;  4WKW A;  3DVW A;  2LST A;  3F3Q A;  1DE1 A;  3I9V 2;  3GKX A;  4L5O A;  5IPH A;  2VLT A;  2HT9 A;  3VUR A;  4KGI A;  4ZIJ A;  1K0N A;  3HVX A;  1DUG A;  1I5G A;  4NWY A;  2L6C A;  4AF2 A;  1NSW A;  1Q4J A;  2N5F A;  3DKS A;  3F8U A;  1SL0 B;  2IJY A;  1XFL A;  2YZH A;  2I9H A;  5IMA A;  1YY7 A;  5DAL B;  1WWJ A;  1EWX A;  2E2M A;  4NHZ A;  4ECJ A;  2LEG A;  4GTU A;  5GSS A;  5KEJ A;  1GUL A;  1OKT A;  3IBH A;  1F3B A;  1HQO A;  1RW1 A;  3A3T A;  4IQ1 A;  1GSE A;  3FRC A;  3NZN A;  1SYX A;  4CHS A;  4TOP A;  3LSZ A;  4EO3 A;  2F9S A;  4FYU A;  4L0U A;  3ZML A;  2JZS A;  1GTA A;  3TKR A;  1XZO A;  1BJX A;  4MMM A;  2F51 A;  1XOB A;  2IL3 A;  2IMF A;  2C0D A;  3KJY A;  2VLU A;  5IMF A;  5GAP D;  4MLY A;  2L4Q A;  5J41 A;  1XVW A;  3Q6O A;  1OAZ A;  1N8J A;  4MJA A;  1MD4 A;  3HYP A;  5G2Z A;  2VL2 A;  5HR0 A;  3F6D A;  4MF6 A;  3RAZ A;  1X5E A;  5HR2 A;  4BWQ A;  4PGT A;  1TTZ A;  5LCZ A;  5HFI A;  3TKS C;  4KW6 A;  3D4M A;  5INY A;  2RM6 A;  3SBC A;  4CDO A;  5DCH A;  4K2D A;  1ON4 A;  3UBL A;  4KH7 A;  5ELG A;  1B48 A;  4WR5 A;  3EU3 A;  3WT2 A;  4MJE A;  2EIO A;  2QC7 A;  5F8B A;  3D6I A;  4IGJ A;  2WRT A;  5L71 A;  3ZL5 A;  5EVO A;  1A2L A;  1MDI A;  1OC8 A;  2FLS A;  4KAE A;  2K8V A;  4LA1 A;  5FT3 A;  3BCK A;  2VUP A;  2EIR A;  1EOG A;  1PA3 A;  1PQN A;  1WOU A;  1OE8 A;  3GH9 A;  3IR4 A;  4L5L A;  3VWV A;  5LD0 A;  4EVM A;  1T00 A;  2LQQ A;  5HR3 A;  2R6K A;  3CRU A;  3CTF A;  3PGT A;  3A2X A;  1F3A A;  3QAV A;  1K0A A;  2OJL A;  2CA8 A;  5ECI B;  1GRX A;  5D9T A;  4OCF A;  4LLR A;  2XC2 A;  3ERF A;  5GST A;  1M99 A;  4WF4 A;  4OCE A;  3ZYW A;  1AQX A;  4N0Z A;  5J3R A;  5IO0 A;  3TKS E;  3K8N A;  2YWO A;  3M3M A;  4KX4 A;  5DVB A;  3J7Y k;  1QXH A;  3BCI A;  3IRA A;  4I2U A;  4GWR A;  5G31 A;  2HI7 A;  3GFK A;  1BYE A;  3TCO A;  2H6X A;  1A24 A;  3PR8 A;  1GUK A;  2F8F A;  2GT6 A;  1BG5 A;  1TRS A;  2R37 A;  3TRX A;  2C4J A;  2B5Y A;  3O6T A;  2VM2 A;  1JFU A;  2VCZ A;  1FG4 A;  3LGC A;  3BOA A;  3TKQ A;  2NBS A;  2N5B A;  2GQK A;  4KUN A;  3QDN A;  4TXO A;  2IFQ A;  3FR6 A;  1V57 A;  4POL A;  4EE0 A;  4HOJ A;  3F4T A;  2B1L A;  2KP1 A;  4MP4 A;  3LOR A;  3GL3 A;  2MYG A;  3Q18 A;  1Z7R A;  3VWU A;  4OMV A;  5KN1 A;  3LWA A;  1XPV A;  4IKH A;  1WIK A;  4LMV A;  4GCI A;  3RHB A;  3APS A;  2ON7 A;  2CVK A;  2B7K A;  3I6A A;  3KXO A;  1WJK A;  1LU4 A;  2L57 A;  2PUK C;  4I97 A;  5JCU A;  3GTU A;  5AGY A;  1EP7 A;  1M2B A;  2M80 A;  2E0Q A;  4MPF A;  1EGR A;  4F82 A;  4K1F A;  2LNT A;  1GTU A;  1JLW A;  1ZYE A;  3IK7 A;  4TW5 A;  4PUA A;  3UVT A;  1BED A;  4AJ7 A;  3VLN A;  2AAW A;  4YQV A;  1SJI A;  1SK0 A;  2ZNM A;  3ERW A;  4FIW A;  1ST9 A;  4ULX A;  1AIU A;  4GLT A;  3SWL A;  1SEN A;  4MH3 A;  2H1B A;  2PN8 A;  2GQM A;  1TW9 A;  2BJX A;  4TR3 A;  4OFT A;  3EMP A;  2EIQ A;  4OD7 A;  2GZY A;  1FB0 A;  4KSO A;  3H8Q A;  2DIZ A;  2DML A;  2DJK A;  4PNF A;  4QL9 A;  4BVY A;  4IHU A;  1AAZ A;  2YOI A;  5F05 A;  2X8C A;  5G1L A;  3GX8 A;  1FW1 A;  4J57 E;  1GSF A;  1F9M A;  5J4U A;  1O81 A;  2YV9 A;  1W89 A;  5D9V A;  2J23 A;  2H6Y A;  1A0F A;  1R5P A;  5CRG A;  3EUR A;  2YWN A;  3GRX A;  4MZB A;  5DJL A;  4GRF A;  4XS4 A;  2YN1 A;  3P8W A;  5CRD A;  2FA8 A;  5G30 A;  3TKS A;  4ECI A;  3VPT A;  2RM5 A;  3UOM A;  4IJI A;  2NDO A;  1YF0 A;  5B7C A;  3FK8 A;  1VF3 A;  4DSR A;  4TN8 A;  1AQW A;  3TJK A;  4HU9 A;  4IVF A;  1J08 A;  3UEM A;  1TK8 B;  2JAD A;  3GKK A;  2P31 A;  1WPI A;  4HDE A;  4GQF A;  1PX6 A;  1XW9 A;  2DIY A;  2H8L A;  3GNJ A;  1KBN A;  4WF5 A;  1JZW A;  2IMK A;  1USB A;  1ABA A;  1SK1 A;  3F9U A;  4DVC A;  1SJZ A;  1K0O A;  1TK5 B;  1EOH A;  5H5Q A;  5CRE A;  1X5C A;  1YEX A;  1VF1 A;  4O92 A;  4ZBA A;  2DBC A;  1SYR A;  1WMJ A;  2R4V A;  1YKA A;  3M9K A;  5B6N A;  2LUS A;  1H75 A;  3APQ A;  2H73 A;  3QFA C;  3UAP A;  3VPQ A;  1ERW A;  1G6Y A;  4ACS A;  3A2W A;  2FWG A;  4MA9 A;  3MNG A;  2RII A;  1OC9 A;  5ELA A;  3ZZX A;  1KTE A;  2KOK A;  2O87 A;  2O89 A;  5A4W A;  3TJB A;  2FWH A;  1ZZY A;  2LS5 A;  2FWE A;  3N9J A;  3UMA A;  3GL5 A;  1TRV A;  2E7P A;  4KB3 A;  4ZB6 A;  1PKZ A;  1TRU A;  2NPB A;  2TIR A;  4O32 A;  1XVQ A;  1AUC A;  4WBR D;  2X8H A;  5FHI A;  2A2R A;  4FH8 A;  4RQR A;  1A2J A;  3FYG A;  2HZE A;  1O7U A;  2KP2 A;  1JHB A;  2FA4 A;  13GS A;  4K7N A;  5F0G A;  1A2M A;  1H4O A;  2QSI A;  2YP6 A;  4D73 B;  5A4U A;  1O8W A;  3JCM L;  8GSS A;  1XCC A;  3WYW A;  1T7P B;  5ECP B;  3R2Q A;  12GS A;  1MEK A;  2GS3 A;  4ECC A;  3GN3 A;  3ZFB A;  4TVE A;  4KND A;  1TRW A;  3O76 A;  3F6F A;  1M9B A;  2IFQ B;  4Q5Q A;  5JWQ B;  4V2N A;  1SKS B;  1JZR A;  2PU9 C;  2LJR A;  2B5X A;  1EGO A;  1B4Q A;  2H01 A;  4G19 A;  1S3D A;  2F3M A;  1GL8 A;  1DBY A;  3GV1 A;  5JCG A;  4X0X A;  4JR6 A;  1G6W A;  5F06 A;  3WD6 A;  5IMC A;  2A2S A;  2LKU A;  4XIH A;  1PRX A;  2LV3 A;  5H5S A;  1GNE A;  3GTU B;  1K3O A;  4HJ2 A;  5B8B A;  1O8X A;  2HE3 A;  2LJK A;  5KN0 A;  2H1G A;  1T4Y A;  1E2Y A;  2AJQ B;  4F9Z A;  1QGV A;  3ZVJ D;  3P2A A;  1A0R P;  2FNO A;  3GMF A;  3Q74 A;  5J5N A;  2DJ3 A;  4J56 E;  4XRD A;  1O73 A;  4RI7 A;  1ML6 A;  4X1U A;  17GS A;  5ID2 A;  3DD3 A;  11GS A;  5D73 A;  2VL9 A;  4HQZ A;  1SU9 A;  4IP6 A;  4QL7 A;  2HRF A;  4K7O A;  1Q98 A;  3D22 A;  3L78 A;  2ALB A;  3UIW A;  3FZ4 A;  3DIE A;  4YQM A;  4F03 A;  3ZRE A;  4GSN A;  2HSY A;  2GSQ A;  1SKR B;  1PKW A;  1TDI A;  5AN1 A;  2Z9S A;  2C8U A;  2GZP A;  2XHF A;  4MCU A;  1G7O A;  3MWH A;  4NXI A;  4ML1 A;  2PMT A;  2B7J A;  3FR3 A;  5D8I A;  4DSS B;  2MZC A;  2WUL A;  3GKM A;  2JU5 A;  1YDK A;  2I3Y A;  4TRX A;  1PX7 A;  2KHP A;  6GSS A;  3M8N A;  1VRS D;  4JU5 A;  1FVK A;  1AXD A;  2CV4 A;  4V2M A;  2B3S A;  1FOV A;  4ZB8 A;  3MDK A;  1WRY A;  2C0E A;  3LYP A;  2I1U A;  3W8J A;  1EEJ A;  4PUF C;  4WXT A;  2QGV A;  1J0F A;  2O85 A;  4RQX A;  1GSS A;  4FYB A;  1XWK A;  5AIX A;  4ZL7 A;  1SKW B;  1R5A A;  3L9S A;  4FO5 A;  4MF5 A;  1TJD A;  2HZF A;  2YWI A;  2JZT A;  2O8V B;  3C7M A;  2LJA A;  1ACV A;  14GS A;  3HJO A;  1OC3 A;  1A23 A;  1FO5 A;  2H19 A;  2H30 A;  3IAS 2;  3F3R A;  1X9S B;  4JZQ A;  2HYX A;  5J9B A;  1TU7 A;  2AUV A;  3LQ7 A;  1K0B A;  2XPD A;  6GSW A;  4EC0 A;  3TUE A;  2OA7 A;  5ECR B;  2D2Z A;  3UVH A;  3W6G A;  3VI7 A;  1OC9 B;  2QKE A;  1GSD A;  3OR5 A;  3TRQ A;  3FEU A;  1AC1 A;  2JZR A;  1QUW A;  3PH9 A;  3D21 A;  4POM A;  3TOU A;  3HJP A;  5CNW A;  5LNK e;  5D9W A;  3KM6 A;  3CXG A;  5H5R A;  2X64 A;  1TKD B;  3GIX A;  4XHM A;  10GS A;  3G7J A;  3KD0 A;  2YV7 A;  2B5E A;  3QAW A;  5KN2 A;  4HS1 A;  1V98 A;  4N30 A;  5AIS A;  3KH9 A;  1VF2 A;  2BTO T;  3ZTL A;  5ECO B;  2FGX A;  2C3T A;  5IQY A;  3A2V A;  2OE3 A;  3ZIV A;  4ZL8 A;  3GA4 A;  1PN9 A;  4EKZ A;  5JCW A;  3VK9 A;  2KLX A;  1K0M A;  1PL1 A;  2H70 A;  5G5F A;  2C80 A;  3FZ9 A;  4I2T A;  1XIY A;  3TJJ A;  2L59 A;  1R4W A;  2HXK A;  4ZL9 A;  4GXZ A;  1GTI A;  1Z6M A;  1K3Y A;  2DMM A;  4N10 A;  3TJF A;  1A8L A;  4E8H A;  2VD0 A;  1HYU A;  2FUG 2;  3DML A;  2YNX A;  5IMZ A;  2V1M A;  5ENU A;  2VM1 A;  4XS1 A;  4PUR A;  3LG6 A;  2LTK A;  4HZ4 A;  2X99 A;  3IAM 2;  4NAX A;  1X9M B;  4MF7 A;  5DAK A;  2V2G A;  3H79 A;  1DSB A;  4BVX A;  4ID0 A;  4HZ2 A;  1QQ2 A;  3IHQ A;  3KH7 A;  4EDZ A;  1JZO A;  2VO4 A;  3CSJ A;  2H71 A;  3HJM A;  3N5O A;  1SL1 B;  1Z9H A;  3FZ5 A;  5D96 A;  2E2G A;  4F2I A;  1Z3E A;  5EL8 A;  3ZIJ A;  3PIN A;  2HNL A;  1F6M C;  5GZZ B;  3D5J A;  2XBI A;  3FKF A;  4EF0 A;  4G10 A;  1B9X C;  4BL7 A;  3KZQ A;  2PWJ A;  1LJR A;  1PGT A;  2CVD A;  4V1A g;  4HQS A;  3DGQ A;  4POB A;  4XRA A;  4MZC A;  1OKD A;  3BBY A;  5CP1 A;  5AIV A;  2K9F A;  1U87 A;  4KDY A;  4TR1 A;  2V41 A;  2CZ2 A;  5CO3 A;  4XS6 A;  1XWC A;  3P7X A;  1UN2 A;  5EPF A;  2AV4 A;  2JL4 A;  2N5A A;  1AQV A;  1T4Z A;  3DWV A;  1ZOF A;  3LXT A;  5D93 A;  1LBK A;  4OFM A;  1K0D A;  1F37 A;  1GTB A;  1UA5 A;  3FHK A;  4WR4 A;  3GSS A;  4CW9 A;  3H93 A;  2HSH A;  2C0G A;  5CRW A;  4PQI A;  2ES7 A;  2YJ7 A;  4PX1 A;  3HHV A;  4V2L A;  1XW5 A;  4WET A;  2M46 A;  3KCM A;  2CAI A;  3UL3 A;  1T1V A;  2WFC A;  4BPY A;  3FY7 A;  2IN3 A;  1MDK A;  3A5W A;  3IDV A;  2DSA A;  1EP8 A;  2V6K A;  3KP8 A;  2G2Q A;  3ME8 A;  5C00 A;  5COH A;  2AYT A;  1E6B A;  1WP0 A;  3ZFL A;  3U5R E;  1AW9 A;  1M7T A;  1KEB A;  2KUC A;  1FB6 A;  3VI5 A;  1NM3 A;  3V1W A;  2NVL A;  5IPG A;  1MDJ A;  4N11 A;  3QMX A;  3GX0 A;  2VCQ A;  1X0R A;  3VWX A;  3QCP A;  1WE0 A;  3J7Y b;  2GDR A;  4XTS A;  4KSM A;  1UVZ A;  16GS A;  3G9B A;  2WGR A;  2XPE A;  4YAV A;  3E0U A;  2I81 A;  5IMV A;  1S3C A;  1YEP A;  4IN0 A;  1VF4 A;  4QQ7 A;  3ZRD A;  3RHC A;  1GLQ A;  2OBI A;  3C1R A;  5DCG A;  5G1K A;  1JZD A;  4RI6 A;  7GSS A;  2AHE A;  4ILF A;  1CQH A;  1UC7 A;  2MMO A;  4ECB A;  1QK8 A;  2CAQ A;  3C8E A;  4JED A;  3WGX A;  4X43 A;  2H66 A;  2P0G A;  3RPP A;  1YQ1 A;  2LRN A;  6GSU A;  5E59 A;  4PNG A;  4TR4 A;  5ECM B;  1FAA A;  3VWW A;  4TXO B;  5IO2 A;  4O7H A;  4WBJ A;  1TP9 A;  2GST A;  1JLV A;  2V6O A;  2ZUP A;  5ECK B;  1XOA A;  2CVB A;  2MBS A;  5ECS A;  4NV2 A;  5DDL A;  2TRX A;  1O85 A;  3MSZ A;  1A8Y A;  2O7K A;  2CX4 A;  1ZL9 A;  2GSR A;  2PGT A;  9GSS A;  3GH6 A;  5DBQ A;  4MPG A;  2HFD A;  4HUA A;  3CTG A;  3F4R A;  1XWG A;  2RUE A;  3UJ1 A;  4L0W A;  3L4N A;  3I43 A;  1EEM A;  4OO4 A;  3S9F A;  4JRR A;  1V40 A;  3EMX A;  2R5G A;  4BWS A;  3TOT A;  3EE2 A;  1QFN A;  1M2A A;  2HRN A;  1GH2 A;  2VL3 A;  2HLS A;  2L4C A;  1X5D A;  3H1N A;  3KMN A;  3KIJ A;  4KDU A;  2IPA A;  3IOS A;  1GWC A;  2R3X A;  2VLV A;  4OO5 A;  1NW2 A;  5ECL B;  3DYR A;  1G7E A;  1IYI A;  3G7Y A;  4IBP A;  4Q5R A;  4V1A p;  4PXO A;  1THX A;  3EU4 A;  4KA0 A;  1KNG A;  2CQ9 A;  3DEX A;  1PL2 A;  1Z6N A;  2WS2 A;  2L5L A;  3GYK A;  6GST A;  5C04 A;  1ILO A;  1GP1 A;  4TR1 B;  1GSQ A;  5HFG A;  2PER A;  3F4S A;  4Z7X A;  1W4V A;  1ERU A;  4NMU A;  1YJ6 A;  3LYK A;  5DJM A;  3KEB A;  1T8E B;  2C3N A;  4PQH A;  4XS4 B;  3UAR A;  4YQU A;  1B8X A;  4K8M A;  4N0V A;  1T3B A;  5DQY A;  2YWM A;  4FYC A;  1FVJ A;  3HVV A;  1U3I A;  2V32 A;  2G0F A;  3GUS A;  2VCV A;  3ME7 A;  3EC3 A;  3CRT A;  2VCT A;  1EV4 A;  4EDY A;  3GKN A;  3IV4 A;  1U88 A;  4L8E A;  1SJ6 A;  2GQL A;  1SD9 A;  4TKY A;  2VAF A;  2LRC A;  1PSQ A;  2P5Q A;  4Q5N A;  1ERT A;  4F0C A;  3TB2 A;  1ERV A;  3LJR A;  2K18 A;  18GS A;  2GGT A;  3ED3 A;  3FW2 A;  1O6J A;  4K9Z A;  3US3 A;  1XWA A;  3DVX A;  3EIN A;  3KGK A;  2LQO A;  3RPN A;  1YKC A;  3DRN A;  3U6V A;  2REM A;  3E9J B;  3G7I A;  1J9B A;  2B6M A;  3WT1 A;  1NHY A;  3EWL A;  22GS A;  2ZCT A;  3EVI A;  3VFI A;  1OE7 A;  6GSY A;  4ML6 A;  5EY6 A;  3BJ5 A;  4GQC A;  4Q5F A;  3HCZ A;  2J9H A;  5B8A A;  3TDG A;  3APO A;  2OBK A;  4DEJ A;  4MK3 A;  3ZVJ A;  2WZ9 A;  2TRC P;  3TGZ A;  2AB6 A;  4AJ6 A;  1HNB A;  2OE0 A;  4WEY A;  2OE1 A;  2IWT A;  1F2E A;  1Y25 A;  3M9J A;  2CT6 A;  3AY8 A;  3W8S A;  2H74 A;  1X9W B;  1R26 A;  4I8B A;  2JSY A;  5JWR B;  2FCH A;  2HZE B;  2XBQ A;  1N2A A;  3HKR A;  1XW6 A;  2C3Q A;  3IA1 A;  2WDU A;  4O5R A;  3WGE A;  2DJ0 A;  3IXR A;  5ECH B;  4HU7 A;  3L9U A;  4OFN A;  3IPZ A;  5IIZ A;  1B9Y C;  2FWF A;  2PVQ A;  3HZ4 A;  4IEL A;  2PBJ A;  2MMA A;  2YPM A;  5CYY A;  2MMN A;  4D73 A;  1SK2 A;  4KCE A;  4G9H A;  4AJ8 A;  1HNA A;  3D4T A;  2GLR A;  1NHO A;  1M0U A;  4ZB9 A;  2OAD A;  2YCD A;  2WCI A;  4MJC A;  2VCW A;  3ISO A;  3TJG A;  3KMO A;  4NV5 A;  1Z5Y E;  1MD3 A;  1U6T A;  5CRH A;  5ECN B;  3ZMK A;  5D9X A;  5IOX A;  1IYH A;  2DJ2 A;  4TXV A;  3QPM A;  3QFB C;  2FY6 A;  5B6M A;  3LFL A;  2B1K A;  1ZCP A;  2H76 A;  2P5R A;  5IM9 A;  4MJB A;  1BX9 A;  4ZXG A;  1SL2 B;  3Q19 A;  2GT5 A;  4KE3 A;  1XWB A;  4GF0 A;  1Z7P A;  5ECQ B;  2H1A A;  1FHE A;  1GSY A;  4MH2 A;  3QR6 A;  4EXJ A;  6GSX A;  2VOC A;  5G5E A;  4OWY A;  3HY2 A;  3GST A;  1RK4 A;  4RUV A;  2YAN A;  4KDX A;  4JE1 A;  4NPB A;  1GUM A;  2VIM A;  5HR1 A; 
#chains in the Genus database with same CATH topology
 19GS A;  4GST A;  4HI7 A;  1BQ7 A;  1TOF A;  5ID2 B;  4IS0 A;  4I6X A;  1R7H A;  3RDW A;  3CMI A;  3F63 A;  3UBK A;  1ZMA A;  3FZA A;  5A5K A;  2DJJ A;  3FR9 A;  2DJ1 A;  2GZZ A;  3NIV A;  3QOU A;  3NOF A;  3H4K A;  1HD2 A;  2C0F A;  3C1S A;  5IMD A;  1M2D A;  3ERG A;  3LEF A;  3L0H A;  4YAP A;  4K0N A;  3CYN A;  5KN3 A;  5J9C A;  2K6V A;  5A4V A;  2CX3 A;  4PQ1 A;  1YZX A;  5DAL A;  3RBT A;  2A2P A;  1V58 A;  2VCX A;  5FWG A;  1V9W A;  5JWO B;  1GUH A;  1V2A A;  2M72 A;  4IW9 A;  2RUF A;  4K6X A;  3HZ8 A;  3E3E A;  2H6Z A;  2L5O A;  3WGD A;  1GLP A;  2H72 A;  2H1D A;  3DXB A;  2ON5 A;  2DKI A;  2F8A A;  4A5P A;  4ISD A;  3D0Z A;  3L9V A;  5CAX A;  4G0K A;  4DSS A;  6GSV A;  2DLX A;  1GNW A;  2NTO A;  1TXX A;  3IK9 A;  3EYT A;  2BMX A;  2MMZ A;  4HJM A;  1B4P A;  1S3A A;  3QAG A;  1G0T A;  3TRP A;  5HFK A;  2IMI A;  2MBT A;  3CBU A;  4P3Y B;  3HXS A;  3C73 A;  1Y6E A;  3O3T A;  1M9A A;  4AGS A;  2VL2 C;  2R2J A;  1OYJ A;  4EIQ A;  3HVS A;  2GTU A;  2CZ3 A;  4ZBB A;  2H0G A;  2OAC A;  3KTB A;  4J2F A;  4MZW A;  1VGL A;  4LMW A;  3CSI A;  5DQS A;  3HD5 A;  2C1Y A;  4JBB A;  3F0I A;  4F0B A;  4LL1 B;  1XBS A;  2YJH A;  4IJ3 A;  4G2E A;  3KP9 A;  1TI3 A;  3HDC A;  4IQA A;  2OKA A;  5F07 A;  2GVP A;  2RLI A;  2YZU A;  3IE3 A;  4USS A;  2H0H A;  2H75 A;  2IMD A;  4BA7 A;  1XXU A;  1ZGN A;  3IC4 A;  4TR0 A;  3R3E A;  3ZLP A;  4POK A;  1QMV A;  5GAN D;  2FD3 A;  4MDC A;  2FHE A;  1MTC A;  1GSU A;  4I5Q A;  1ZYQ B;  4KCA A;  3M1G A;  2LNS A;  2IIY A;  1EV9 A;  3HA9 A;  4GSS A;  3M0F A;  3CSH A;  1THO A;  4K0G A;  3BD2 A;  4K7I A;  3KTL A;  2GSS A;  2LRT A;  5ABR A;  1CQG A;  2WJU A;  1PD2 1;  5HQP A;  4EL1 A;  1PMT A;  3ZIT A;  1TI1 A;  1U3A A;  2K8S A;  5E4W A;  4HEA 2;  2H0I A;  1EZK A;  4NHW A;  1XG8 A;  2PVO C;  5IOW A;  1TK0 B;  2VD1 A;  1YF1 A;  4IP1 A;  3LXZ A;  2JAC A;  4LL4 B;  4E8E A;  4H86 A;  2DC5 A;  2L6D A;  3PPU A;  1DE2 A;  4JR4 A;  4DSQ A;  1OVN A;  2PPT A;  4ZIL A;  1K0C A;  4ZBD A;  1SD8 A;  4YH2 A;  2EC4 A;  4EUY A;  1C72 A;  3P90 A;  3QD9 A;  20GS A;  5DAK B;  2A4V A;  3TKP A;  1RQM A;  2JSZ A;  4MAB A;  4BVX B;  2UZ8 A;  3I69 A;  3GUR A;  1URM A;  1HNC A;  1BAY A;  3GHA A;  2X8G A;  2WB9 A;  3C71 A;  1K3L A;  2I4A A;  1I9D A;  2IME A;  1TU8 A;  3MAK A;  4XCS A;  4WKW A;  3DVW A;  2LST A;  3F3Q A;  1DE1 A;  3I9V 2;  3GKX A;  4L5O A;  5IPH A;  2VLT A;  2HT9 A;  3VUR A;  4KGI A;  4ZIJ A;  1K0N A;  3HVX A;  1DUG A;  1I5G A;  4NWY A;  2L6C A;  4AF2 A;  1NSW A;  1Q4J A;  2N5F A;  3DKS A;  3F8U A;  1SL0 B;  2QA1 A;  4K5S A;  2IJY A;  1XFL A;  2YZH A;  4KF9 A;  2I9H A;  5IMA A;  1YY7 A;  5DAL B;  1WWJ A;  1EWX A;  2E2M A;  4NHZ A;  4ECJ A;  2LEG A;  4G0L A;  4GTU A;  5GSS A;  1GUL A;  5KEJ A;  1OKT A;  3IBH A;  1F3B A;  1HQO A;  1RW1 A;  3A3T A;  4ICY A;  4IQ1 A;  1GSE A;  3FRC A;  3NZN A;  1SYX A;  4CHS A;  4TOP A;  3LSZ A;  4EO3 A;  2F9S A;  4FYU A;  4L0U A;  3ZML A;  2JZS A;  1PFO A;  1GTA A;  3TKR A;  1XZO A;  1BJX A;  4MMM A;  2F51 A;  1XOB A;  2A4H A;  2IL3 A;  2IMF A;  2C0D A;  3KJY A;  2VLU A;  5IMF A;  5GAP D;  4MLY A;  2L4Q A;  5J41 A;  1XVW A;  3Q6O A;  1OAZ A;  1N8J A;  4MJA A;  1MD4 A;  3HYP A;  5G2Z A;  2VL2 A;  5HR0 A;  3F6D A;  4MF6 A;  3RAZ A;  1X5E A;  5HR2 A;  3HVN A;  4BWQ A;  4PGT A;  1TTZ A;  5LCZ A;  4Z2T A;  5HFI A;  3TKS C;  4KW6 A;  3D4M A;  5INY A;  2RM6 A;  3SBC A;  4CDO A;  5DCH A;  4K2D A;  1ON4 A;  3UBL A;  1M3J A;  4KH7 A;  5ELG A;  1B48 A;  4WR5 A;  3EU3 A;  3WT2 A;  4MJE A;  2EIO A;  2QC7 A;  5F8B A;  3D6I A;  4IGJ A;  2WRT A;  5L71 A;  3ZL5 A;  5EVO A;  1A2L A;  1MDI A;  1OC8 A;  2FLS A;  4KAE A;  2K8V A;  4LA1 A;  5FT3 A;  3BCK A;  2VUP A;  2EIR A;  1EOG A;  1PA3 A;  1PQN A;  1WOU A;  1OE8 A;  3GH9 A;  3IR4 A;  4L5L A;  3VWV A;  5LD0 A;  4EVM A;  1T00 A;  2LQQ A;  5HR3 A;  2R6K A;  3CRU A;  3CTF A;  3PGT A;  3A2X A;  1F3A A;  3QAV A;  1K0A A;  2OJL A;  2CA8 A;  1FOH A;  5ECI B;  1GRX A;  5D9T A;  4OCF A;  4LLR A;  2XC2 A;  3ERF A;  5GST A;  1M99 A;  3FMW A;  4WF4 A;  4OCE A;  3ZYW A;  1AQX A;  4N0Z A;  5J3R A;  5IO0 A;  3TKS E;  3K8N A;  2YWO A;  3M3M A;  4KX4 A;  5DVB A;  3J7Y k;  1QXH A;  3BCI A;  3IRA A;  4I2U A;  4GWR A;  5G31 A;  5KOX A;  2HI7 A;  3GFK A;  1BYE A;  3TCO A;  2H6X A;  1A24 A;  3PR8 A;  1GUK A;  2F8F A;  2GT6 A;  1BG5 A;  1TRS A;  2R37 A;  3TRX A;  2C4J A;  2B5Y A;  3O6T A;  2VM2 A;  1JFU A;  2VCZ A;  1FG4 A;  3LGC A;  3BOA A;  3TKQ A;  2NBS A;  2N5B A;  2GQK A;  4KUN A;  3QDN A;  4TXO A;  2IFQ A;  3FR6 A;  1V57 A;  4POL A;  4EE0 A;  4HOJ A;  3F4T A;  2B1L A;  2KP1 A;  4MP4 A;  4PTS A;  3LOR A;  3GL3 A;  2MYG A;  3Q18 A;  1Z7R A;  3VWU A;  4OMV A;  5KN1 A;  3LWA A;  1XPV A;  4IKH A;  1WIK A;  4LMV A;  4GCI A;  3RHB A;  3APS A;  2ON7 A;  2CVK A;  2B7K A;  3I6A A;  3KXO A;  1WJK A;  1LU4 A;  2L57 A;  2PUK C;  4I97 A;  5JCU A;  3GTU A;  5AGY A;  1EP7 A;  1M2B A;  2M80 A;  2E0Q A;  4MPF A;  1EGR A;  4F82 A;  4K1F A;  2LNT A;  1GTU A;  1JLW A;  1ZYE A;  3IK7 A;  4TW5 A;  4PUA A;  3UVT A;  1BED A;  4AJ7 A;  3VLN A;  2AAW A;  4YQV A;  1SJI A;  1SK0 A;  2ZNM A;  3ERW A;  4FIW A;  1ST9 A;  4ULX A;  1AIU A;  4GLT A;  3SWL A;  1SEN A;  4MH3 A;  2H1B A;  2PN8 A;  2GQM A;  1TW9 A;  2BJX A;  4TR3 A;  4OFT A;  3EMP A;  2EIQ A;  4OD7 A;  2GZY A;  1FB0 A;  4KSO A;  3H8Q A;  2DIZ A;  2DML A;  2DJK A;  4PNF A;  4QL9 A;  4BVY A;  4IHU A;  1AAZ A;  2YOI A;  5F05 A;  2X8C A;  5G1L A;  3GX8 A;  1FW1 A;  4J57 E;  1GSF A;  4Z2R A;  1F9M A;  5J4U A;  1O81 A;  2YV9 A;  1W89 A;  5D9V A;  2J23 A;  2H6Y A;  1A0F A;  1R5P A;  5CRG A;  3EUR A;  2YWN A;  3GRX A;  4MZB A;  5DJL A;  4GRF A;  4XS4 A;  2YN1 A;  3P8W A;  5CRD A;  2FA8 A;  5G30 A;  3TKS A;  4ECI A;  1S3R A;  3VPT A;  4O5Q A;  2RM5 A;  3UOM A;  1ZYN A;  4IJI A;  2NDO A;  1YF0 A;  4HSC X;  3FK8 A;  5B7C A;  1VF3 A;  4DSR A;  4TN8 A;  1AQW A;  3TJK A;  4HU9 A;  4IVF A;  1J08 A;  2X4A A;  3UEM A;  1TK8 B;  2JAD A;  3GKK A;  4G0I A;  2P31 A;  1WPI A;  4HDE A;  4GQF A;  1PX6 A;  1XW9 A;  2DIY A;  2H8L A;  3GNJ A;  1KBN A;  4WF5 A;  1JZW A;  2IMK A;  1USB A;  1ABA A;  1SK1 A;  3F9U A;  4DVC A;  1SJZ A;  1K0O A;  1TK5 B;  1EOH A;  5H5Q A;  5CRE A;  1X5C A;  1YEX A;  1VF1 A;  4O92 A;  4ZBA A;  2DBC A;  2DKH A;  1SYR A;  1WMJ A;  2R4V A;  1YKA A;  3M9K A;  5B6N A;  2LUS A;  1H75 A;  3APQ A;  2H73 A;  3QFA C;  3UAP A;  3VPQ A;  1ERW A;  1G6Y A;  4ACS A;  3A2W A;  2FWG A;  4MA9 A;  3MNG A;  2RII A;  1OC9 A;  5ELA A;  3ZZX A;  1KTE A;  2KOK A;  2O87 A;  2O89 A;  5A4W A;  3TJB A;  2FWH A;  1ZZY A;  2LS5 A;  2FWE A;  3N9J A;  3UMA A;  3GL5 A;  1TRV A;  2E7P A;  4KB3 A;  4ZB6 A;  1PKZ A;  1TRU A;  2NPB A;  2TIR A;  4O32 A;  1XVQ A;  1AUC A;  4WBR D;  2X8H A;  5FHI A;  2A2R A;  4FH8 A;  4RQR A;  1A2J A;  3FYG A;  2HZE A;  1O7U A;  2KP2 A;  1JHB A;  2FA4 A;  13GS A;  4K7N A;  5F0G A;  1A2M A;  1H4O A;  2QSI A;  2YP6 A;  4D73 B;  5A4U A;  1O8W A;  3JCM L;  8GSS A;  1XCC A;  3WYW A;  1T7P B;  5ECP B;  3R2Q A;  12GS A;  1MEK A;  2GS3 A;  4ECC A;  3GN3 A;  3ZFB A;  4TVE A;  4KND A;  1TRW A;  3O76 A;  3F6F A;  1M9B A;  2IFQ B;  4Q5Q A;  5JWQ B;  4V2N A;  1SKS B;  1JZR A;  2PU9 C;  4K5R A;  2LJR A;  2B5X A;  1EGO A;  1B4Q A;  2H01 A;  4G19 A;  1S3D A;  2F3M A;  1GL8 A;  1DBY A;  3GV1 A;  5JCG A;  4X0X A;  4JR6 A;  1G6W A;  5F06 A;  3WD6 A;  4CY6 A;  5IMC A;  2A2S A;  2LKU A;  4XIH A;  1PRX A;  2LV3 A;  5H5S A;  1GNE A;  2R0P A;  3GTU B;  1K3O A;  4HJ2 A;  5B8B A;  1O8X A;  2HE3 A;  2LJK A;  5KN0 A;  2R0G A;  2H1G A;  1T4Y A;  1E2Y A;  2AJQ B;  4F9Z A;  1QGV A;  3ZVJ D;  3P2A A;  1A0R P;  2FNO A;  1PN0 A;  3GMF A;  3Q74 A;  5J5N A;  2DJ3 A;  4J56 E;  4XRD A;  1O73 A;  4RI7 A;  1ML6 A;  4X1U A;  17GS A;  5ID2 A;  3DD3 A;  11GS A;  5D73 A;  3MYD A;  2VL9 A;  4HQZ A;  1SU9 A;  4IP6 A;  4QL7 A;  2HRF A;  4K7O A;  1Q98 A;  3D22 A;  3L78 A;  2ALB A;  3UIW A;  3FZ4 A;  3DIE A;  4YQM A;  4F03 A;  3ZRE A;  2X49 A;  4GSN A;  2HSY A;  2GSQ A;  1SKR B;  1PKW A;  1TDI A;  5AN1 A;  2Z9S A;  2C8U A;  2GZP A;  2XHF A;  4MCU A;  1G7O A;  3MWH A;  4NXI A;  4ML1 A;  2PMT A;  2B7J A;  3FR3 A;  5D8I A;  4DSS B;  2MZC A;  2WUL A;  3GKM A;  4BIK A;  2JU5 A;  1YDK A;  2I3Y A;  4TRX A;  1PX7 A;  2KHP A;  6GSS A;  3M8N A;  1VRS D;  4JU5 A;  1FVK A;  1AXD A;  2CV4 A;  4V2M A;  2B3S A;  1FOV A;  4ZB8 A;  3MDK A;  1WRY A;  2C0E A;  3LYP A;  2I1U A;  3W8J A;  1EEJ A;  2R0C A;  4PUF C;  4WXT A;  2QGV A;  1J0F A;  2O85 A;  4RQX A;  5KOW A;  1GSS A;  4FYB A;  1XWK A;  5AIX A;  4ZL7 A;  1SKW B;  1R5A A;  3L9S A;  3IHG A;  4FO5 A;  4MF5 A;  1TJD A;  2HZF A;  2YWI A;  2JZT A;  2O8V B;  3C7M A;  2LJA A;  1ACV A;  14GS A;  3HJO A;  1OC3 A;  1A23 A;  1FO5 A;  2H19 A;  2H30 A;  3IAS 2;  3F3R A;  1X9S B;  4JZQ A;  2HYX A;  5J9B A;  1TU7 A;  2AUV A;  3LQ7 A;  1K0B A;  2XPD A;  6GSW A;  4EC0 A;  3TUE A;  2OA7 A;  5ECR B;  2D2Z A;  3UVH A;  3W6G A;  3VI7 A;  1OC9 B;  2QKE A;  1GSD A;  3OR5 A;  3TRQ A;  3FEU A;  1AC1 A;  2JZR A;  1QUW A;  3PH9 A;  3D21 A;  4POM A;  3TOU A;  3HJP A;  5CNW A;  5LNK e;  5D9W A;  3KM6 A;  3CXG A;  5H5R A;  2X64 A;  1TKD B;  3GIX A;  4XHM A;  10GS A;  3G7J A;  3KD0 A;  2YV7 A;  2B5E A;  3QAW A;  5KN2 A;  4HS1 A;  1V98 A;  4N30 A;  5AIS A;  3KH9 A;  1VF2 A;  2BTO T;  3ZTL A;  5ECO B;  2FGX A;  2C3T A;  5IQY A;  3A2V A;  2OE3 A;  3ZIV A;  4ZL8 A;  3GA4 A;  1PN9 A;  4EKZ A;  5JCW A;  3VK9 A;  2KLX A;  1M3I A;  1K0M A;  1PL1 A;  2H70 A;  5G5F A;  2C80 A;  3FZ9 A;  4I2T A;  1XIY A;  3TJJ A;  2L59 A;  1R4W A;  2HXK A;  4ZL9 A;  4GXZ A;  1GTI A;  1Z6M A;  1K3Y A;  2DMM A;  4N10 A;  3TJF A;  1A8L A;  4E8H A;  2VD0 A;  1HYU A;  2FUG 2;  3DML A;  2YNX A;  5IMZ A;  2V1M A;  5ENU A;  2VM1 A;  3EPT A;  4XS1 A;  4PUR A;  3LG6 A;  2LTK A;  4HZ4 A;  2X99 A;  3IAM 2;  4NAX A;  4MNN A;  3MIX A;  1X9M B;  4MF7 A;  5DAK A;  2V2G A;  3H79 A;  1DSB A;  4BVX A;  4ID0 A;  4HZ2 A;  1QQ2 A;  3IHQ A;  3KH7 A;  4EDZ A;  1JZO A;  2VO4 A;  3CSJ A;  2H71 A;  3HJM A;  3N5O A;  1SL1 B;  1Z9H A;  4K2X A;  3FZ5 A;  5D96 A;  2E2G A;  4F2I A;  1Z3E A;  5EL8 A;  3ZIJ A;  3PIN A;  2HNL A;  1F6M C;  5GZZ B;  3D5J A;  2XBI A;  3FKF A;  4EF0 A;  4G10 A;  1B9X C;  2QA2 A;  4BL7 A;  3KZQ A;  2PWJ A;  1LJR A;  1PGT A;  2CVD A;  4V1A g;  4HQS A;  3DGQ A;  4POB A;  4XRA A;  4MZC A;  1OKD A;  3BBY A;  5CP1 A;  5AIV A;  2K9F A;  1U87 A;  4KDY A;  4TR1 A;  2V41 A;  2CZ2 A;  5CO3 A;  4XS6 A;  1XWC A;  3P7X A;  1UN2 A;  5EPF A;  1ZYP A;  2AV4 A;  2JL4 A;  4O5U A;  2N5A A;  1AQV A;  1T4Z A;  3DWV A;  1ZOF A;  3LXT A;  5D93 A;  1LBK A;  4OFM A;  1K0D A;  1F37 A;  1GTB A;  1UA5 A;  3FHK A;  4WR4 A;  3GSS A;  4CW9 A;  3H93 A;  2HSH A;  2C0G A;  2HSM A;  5CRW A;  4PQI A;  2ES7 A;  2YJ7 A;  4PX1 A;  3HHV A;  4V2L A;  1XW5 A;  4WET A;  2M46 A;  3KCM A;  2CAI A;  3UL3 A;  1T1V A;  2WFC A;  4BPY A;  3FY7 A;  2IN3 A;  1MDK A;  3A5W A;  3IDV A;  2DSA A;  1EP8 A;  2V6K A;  3KP8 A;  2G2Q A;  3ME8 A;  5C00 A;  5COH A;  2AYT A;  1E6B A;  1WP0 A;  3ZFL A;  3U5R E;  1AW9 A;  1M7T A;  1KEB A;  2KUC A;  1FB6 A;  3VI5 A;  1NM3 A;  3V1W A;  2NVL A;  5IPG A;  1MDJ A;  4N11 A;  3QMX A;  3GX0 A;  2VCQ A;  1X0R A;  3VWX A;  3QCP A;  1WE0 A;  3J7Y b;  2GDR A;  4XTS A;  4KSM A;  1UVZ A;  16GS A;  3G9B A;  2WGR A;  2XPE A;  4YAV A;  3E0U A;  2I81 A;  5IMV A;  1S3C A;  1YEP A;  4IN0 A;  1VF4 A;  4QQ7 A;  3ZRD A;  3RHC A;  1GLQ A;  2OBI A;  3C1R A;  5DCG A;  5G1K A;  1JZD A;  4RI6 A;  7GSS A;  2AHE A;  4ILF A;  1CQH A;  1UC7 A;  2MMO A;  4ECB A;  1QK8 A;  2CAQ A;  3C8E A;  4JED A;  3WGX A;  4X43 A;  2H66 A;  2P0G A;  3RPP A;  1YQ1 A;  2LRN A;  6GSU A;  5E59 A;  4PNG A;  4TR4 A;  5ECM B;  1FAA A;  3VWW A;  4TXO B;  5IO2 A;  4O7H A;  4WBJ A;  1TP9 A;  2GST A;  1JLV A;  2V6O A;  2ZUP A;  5ECK B;  1XOA A;  2CVB A;  2MBS A;  5ECS A;  4NV2 A;  5DDL A;  2TRX A;  1O85 A;  3MSZ A;  1A8Y A;  2O7K A;  2CX4 A;  1ZL9 A;  2GSR A;  2PGT A;  9GSS A;  3GH6 A;  5DBQ A;  4MPG A;  2HFD A;  3LW9 A;  4HUA A;  3CTG A;  3F4R A;  1XWG A;  2RUE A;  3UJ1 A;  4L0W A;  3L4N A;  3I43 A;  1EEM A;  4OO4 A;  3S9F A;  4JRR A;  1V40 A;  3EMX A;  2R5G A;  4BWS A;  4YKF A;  3TOT A;  3EE2 A;  1QFN A;  2HRK A;  1M2A A;  2HRN A;  1GH2 A;  2VL3 A;  2HLS A;  4EIP A;  2L4C A;  1X5D A;  3H1N A;  3KMN A;  3KIJ A;  4KDU A;  2IPA A;  3IOS A;  1GWC A;  2R3X A;  2VLV A;  4OO5 A;  1NW2 A;  5ECL B;  3DYR A;  1G7E A;  4BL7 B;  1IYI A;  3G7Y A;  4IBP A;  4Q5R A;  4V1A p;  4PXO A;  1THX A;  3EU4 A;  4KA0 A;  1KNG A;  2CQ9 A;  3DEX A;  1PL2 A;  1Z6N A;  2WS2 A;  2L5L A;  3GYK A;  6GST A;  5C04 A;  4BVY B;  1ILO A;  1GP1 A;  4TR1 B;  1GSQ A;  5HFG A;  2PER A;  3F4S A;  4Z7X A;  1W4V A;  1ERU A;  4NMU A;  1YJ6 A;  3LYK A;  5DJM A;  3KEB A;  1T8E B;  2C3N A;  4PQH A;  4XS4 B;  3UAR A;  4YQU A;  1B8X A;  4K8M A;  4N0V A;  1T3B A;  5DQY A;  2YWM A;  5BRT A;  4FYC A;  1FVJ A;  3HVV A;  3CQF A;  1U3I A;  2V32 A;  2G0F A;  3GUS A;  2VCV A;  4CY8 A;  3ME7 A;  3EC3 A;  3CRT A;  2VCT A;  1EV4 A;  4EDY A;  3GKN A;  3IV4 A;  1U88 A;  2HRA A;  4L8E A;  1SJ6 A;  2GQL A;  1SD9 A;  4TKY A;  2VAF A;  2LRC A;  1PSQ A;  2P5Q A;  4Q5N A;  1ERT A;  4F0C A;  3TB2 A;  1ERV A;  3LJR A;  2K18 A;  18GS A;  2GGT A;  4Z2U A;  3ED3 A;  3FW2 A;  1O6J A;  4K9Z A;  3US3 A;  1XWA A;  3DVX A;  3EIN A;  3KGK A;  2LQO A;  3RPN A;  1YKC A;  3DRN A;  3U6V A;  2REM A;  3A5I A;  3E9J B;  3G7I A;  1J9B A;  2B6M A;  3WT1 A;  1NHY A;  3EWL A;  22GS A;  2ZCT A;  3EVI A;  3VFI A;  1OE7 A;  6GSY A;  4ML6 A;  5EY6 A;  3BJ5 A;  4GQC A;  4Q5F A;  3HCZ A;  2J9H A;  5B8A A;  3TDG A;  3APO A;  2OBK A;  4DEJ A;  4MK3 A;  3ZVJ A;  2WZ9 A;  2TRC P;  3TGZ A;  4YKG A;  2AB6 A;  4AJ6 A;  1HNB A;  2OE0 A;  4WEY A;  2OE1 A;  2IWT A;  1F2E A;  1Y25 A;  3M9J A;  2CT6 A;  3AY8 A;  3W8S A;  2H74 A;  1X9W B;  1R26 A;  4I8B A;  2JSY A;  4FQU A;  5JWR B;  2FCH A;  2HZE B;  2XBQ A;  1N2A A;  5BMU A;  3HKR A;  1XW6 A;  2C3Q A;  3IA1 A;  2WDU A;  4O5R A;  3WGE A;  2DJ0 A;  3IXR A;  5ECH B;  4HU7 A;  3L9U A;  4OFN A;  3IPZ A;  5IIZ A;  1B9Y C;  2FWF A;  2PVQ A;  3HZ4 A;  4IEL A;  2PBJ A;  2MMA A;  2YPM A;  5CYY A;  2MMN A;  4D73 A;  1SK2 A;  4KCE A;  4G9H A;  4AJ8 A;  1HNA A;  3D4T A;  2GLR A;  1NHO A;  1M0U A;  4ZB9 A;  2OAD A;  2YCD A;  2WCI A;  4MJC A;  2VCW A;  3ISO A;  3TJG A;  3KMO A;  4NV5 A;  1Z5Y E;  1MD3 A;  1U6T A;  5CRH A;  5ECN B;  3ZMK A;  5D9X A;  5IOX A;  1IYH A;  2DJ2 A;  4TXV A;  4X4J A;  3QPM A;  3QFB C;  2FY6 A;  5B6M A;  3LFL A;  2B1K A;  1ZCP A;  2H76 A;  2P5R A;  5IM9 A;  4MJB A;  1BX9 A;  4ZXG A;  1SL2 B;  3Q19 A;  2GT5 A;  4KE3 A;  1XWB A;  4GF0 A;  1Z7P A;  5ECQ B;  2H1A A;  1FHE A;  1GSY A;  4MH2 A;  3IC8 A;  3QR6 A;  4EXJ A;  6GSX A;  2VOC A;  5G5E A;  4OWY A;  3HY2 A;  3GST A;  1RK4 A;  4RUV A;  2YAN A;  4KDX A;  4JE1 A;  4NPB A;  1GUM A;  2VIM A;  5HR1 A; 
#chains in the Genus database with same CATH homology
 19GS A;  4GST A;  4HI7 A;  1BQ7 A;  1TOF A;  5ID2 B;  4IS0 A;  4I6X A;  1R7H A;  3RDW A;  3CMI A;  3F63 A;  3UBK A;  1ZMA A;  3FZA A;  5A5K A;  2DJJ A;  3FR9 A;  2DJ1 A;  2GZZ A;  3NIV A;  3QOU A;  3NOF A;  3H4K A;  1HD2 A;  2C0F A;  3C1S A;  5IMD A;  1M2D A;  3ERG A;  3LEF A;  3L0H A;  4YAP A;  4K0N A;  3CYN A;  5KN3 A;  5J9C A;  2K6V A;  5A4V A;  2CX3 A;  4PQ1 A;  1YZX A;  5DAL A;  3RBT A;  2A2P A;  1V58 A;  2VCX A;  5FWG A;  1V9W A;  5JWO B;  1GUH A;  1V2A A;  2M72 A;  4IW9 A;  2RUF A;  4K6X A;  3HZ8 A;  3E3E A;  2H6Z A;  2L5O A;  3WGD A;  1GLP A;  2H72 A;  2H1D A;  3DXB A;  2ON5 A;  2DKI A;  2F8A A;  4A5P A;  4ISD A;  3D0Z A;  3L9V A;  5CAX A;  4G0K A;  4DSS A;  6GSV A;  2DLX A;  1GNW A;  2NTO A;  1TXX A;  3IK9 A;  3EYT A;  2BMX A;  2MMZ A;  4HJM A;  1B4P A;  1S3A A;  3QAG A;  1G0T A;  3TRP A;  5HFK A;  2IMI A;  2MBT A;  3CBU A;  4P3Y B;  3HXS A;  3C73 A;  1Y6E A;  3O3T A;  1M9A A;  4AGS A;  2VL2 C;  2R2J A;  1OYJ A;  4EIQ A;  3HVS A;  2GTU A;  2CZ3 A;  4ZBB A;  2H0G A;  2OAC A;  3KTB A;  4J2F A;  4MZW A;  1VGL A;  4LMW A;  3CSI A;  5DQS A;  3HD5 A;  2C1Y A;  4JBB A;  3F0I A;  4F0B A;  4LL1 B;  1XBS A;  2YJH A;  4IJ3 A;  4G2E A;  3KP9 A;  1TI3 A;  3HDC A;  4IQA A;  2OKA A;  5F07 A;  2GVP A;  2RLI A;  2YZU A;  3IE3 A;  4USS A;  2H0H A;  2H75 A;  2IMD A;  4BA7 A;  1XXU A;  1ZGN A;  3IC4 A;  4TR0 A;  3R3E A;  3ZLP A;  4POK A;  1QMV A;  5GAN D;  2FD3 A;  4MDC A;  2FHE A;  1MTC A;  1GSU A;  4I5Q A;  1ZYQ B;  4KCA A;  3M1G A;  2LNS A;  2IIY A;  1EV9 A;  3HA9 A;  4GSS A;  3M0F A;  3CSH A;  1THO A;  4K0G A;  3BD2 A;  4K7I A;  3KTL A;  2GSS A;  2LRT A;  5ABR A;  1CQG A;  2WJU A;  1PD2 1;  5HQP A;  4EL1 A;  1PMT A;  3ZIT A;  1TI1 A;  1U3A A;  2K8S A;  5E4W A;  4HEA 2;  2H0I A;  1EZK A;  4NHW A;  2PVO C;  5IOW A;  1TK0 B;  2VD1 A;  1YF1 A;  4IP1 A;  3LXZ A;  2JAC A;  4LL4 B;  4E8E A;  4H86 A;  2DC5 A;  2L6D A;  3PPU A;  1DE2 A;  4JR4 A;  4DSQ A;  1OVN A;  2PPT A;  4ZIL A;  1K0C A;  4ZBD A;  1SD8 A;  4YH2 A;  2EC4 A;  4EUY A;  1C72 A;  3P90 A;  3QD9 A;  20GS A;  5DAK B;  2A4V A;  3TKP A;  1RQM A;  2JSZ A;  4MAB A;  4BVX B;  2UZ8 A;  3I69 A;  3GUR A;  1URM A;  1HNC A;  1BAY A;  3GHA A;  2X8G A;  2WB9 A;  3C71 A;  1K3L A;  2I4A A;  1I9D A;  2IME A;  1TU8 A;  3MAK A;  4XCS A;  4WKW A;  3DVW A;  2LST A;  3F3Q A;  1DE1 A;  3I9V 2;  3GKX A;  4L5O A;  5IPH A;  2VLT A;  2HT9 A;  3VUR A;  4KGI A;  4ZIJ A;  1K0N A;  3HVX A;  1DUG A;  1I5G A;  4NWY A;  2L6C A;  4AF2 A;  1NSW A;  1Q4J A;  2N5F A;  3DKS A;  3F8U A;  1SL0 B;  2QA1 A;  4K5S A;  2IJY A;  1XFL A;  2YZH A;  4KF9 A;  2I9H A;  5IMA A;  1YY7 A;  5DAL B;  1WWJ A;  1EWX A;  2E2M A;  4NHZ A;  4ECJ A;  2LEG A;  4G0L A;  4GTU A;  5GSS A;  1GUL A;  5KEJ A;  1OKT A;  3IBH A;  1F3B A;  1HQO A;  1RW1 A;  3A3T A;  4ICY A;  4IQ1 A;  1GSE A;  3FRC A;  3NZN A;  1SYX A;  4CHS A;  4TOP A;  3LSZ A;  4EO3 A;  2F9S A;  4FYU A;  4L0U A;  3ZML A;  2JZS A;  1GTA A;  3TKR A;  1XZO A;  1BJX A;  4MMM A;  2F51 A;  1XOB A;  2A4H A;  2IL3 A;  2IMF A;  2C0D A;  3KJY A;  2VLU A;  5IMF A;  5GAP D;  4MLY A;  2L4Q A;  5J41 A;  1XVW A;  3Q6O A;  1OAZ A;  1N8J A;  4MJA A;  1MD4 A;  3HYP A;  5G2Z A;  2VL2 A;  5HR0 A;  3F6D A;  4MF6 A;  3RAZ A;  1X5E A;  5HR2 A;  4BWQ A;  4PGT A;  1TTZ A;  5LCZ A;  4Z2T A;  5HFI A;  3TKS C;  4KW6 A;  3D4M A;  5INY A;  2RM6 A;  3SBC A;  4CDO A;  5DCH A;  4K2D A;  1ON4 A;  3UBL A;  4KH7 A;  5ELG A;  1B48 A;  4WR5 A;  3EU3 A;  3WT2 A;  4MJE A;  2EIO A;  2QC7 A;  5F8B A;  3D6I A;  4IGJ A;  2WRT A;  5L71 A;  3ZL5 A;  5EVO A;  1A2L A;  1MDI A;  1OC8 A;  2FLS A;  4KAE A;  2K8V A;  4LA1 A;  5FT3 A;  3BCK A;  2VUP A;  2EIR A;  1EOG A;  1PA3 A;  1PQN A;  1WOU A;  1OE8 A;  3GH9 A;  3IR4 A;  4L5L A;  3VWV A;  5LD0 A;  4EVM A;  1T00 A;  2LQQ A;  5HR3 A;  2R6K A;  3CRU A;  3CTF A;  3PGT A;  3A2X A;  1F3A A;  3QAV A;  1K0A A;  2OJL A;  2CA8 A;  1FOH A;  5ECI B;  1GRX A;  5D9T A;  4OCF A;  4LLR A;  2XC2 A;  3ERF A;  5GST A;  1M99 A;  3FMW A;  4WF4 A;  4OCE A;  3ZYW A;  1AQX A;  4N0Z A;  5J3R A;  5IO0 A;  3TKS E;  3K8N A;  2YWO A;  3M3M A;  4KX4 A;  5DVB A;  3J7Y k;  1QXH A;  3BCI A;  3IRA A;  4I2U A;  4GWR A;  5G31 A;  5KOX A;  2HI7 A;  3GFK A;  1BYE A;  3TCO A;  2H6X A;  1A24 A;  3PR8 A;  1GUK A;  2F8F A;  2GT6 A;  1BG5 A;  1TRS A;  2R37 A;  3TRX A;  2C4J A;  2B5Y A;  3O6T A;  2VM2 A;  1JFU A;  2VCZ A;  1FG4 A;  3LGC A;  3BOA A;  3TKQ A;  2NBS A;  2N5B A;  2GQK A;  4KUN A;  3QDN A;  4TXO A;  2IFQ A;  3FR6 A;  1V57 A;  4POL A;  4EE0 A;  4HOJ A;  3F4T A;  2B1L A;  2KP1 A;  4MP4 A;  4PTS A;  3LOR A;  3GL3 A;  2MYG A;  3Q18 A;  1Z7R A;  3VWU A;  4OMV A;  5KN1 A;  3LWA A;  1XPV A;  4IKH A;  1WIK A;  4LMV A;  4GCI A;  3RHB A;  3APS A;  2ON7 A;  2CVK A;  2B7K A;  3I6A A;  3KXO A;  1WJK A;  1LU4 A;  2L57 A;  2PUK C;  4I97 A;  5JCU A;  3GTU A;  5AGY A;  1EP7 A;  1M2B A;  2M80 A;  2E0Q A;  4MPF A;  1EGR A;  4F82 A;  4K1F A;  2LNT A;  1GTU A;  1JLW A;  1ZYE A;  3IK7 A;  4TW5 A;  4PUA A;  3UVT A;  1BED A;  4AJ7 A;  3VLN A;  2AAW A;  4YQV A;  1SJI A;  1SK0 A;  2ZNM A;  3ERW A;  4FIW A;  1ST9 A;  4ULX A;  1AIU A;  4GLT A;  3SWL A;  1SEN A;  4MH3 A;  2H1B A;  2PN8 A;  2GQM A;  1TW9 A;  2BJX A;  4TR3 A;  4OFT A;  3EMP A;  2EIQ A;  4OD7 A;  2GZY A;  1FB0 A;  4KSO A;  3H8Q A;  2DIZ A;  2DML A;  2DJK A;  4PNF A;  4QL9 A;  4BVY A;  4IHU A;  1AAZ A;  2YOI A;  5F05 A;  2X8C A;  5G1L A;  3GX8 A;  1FW1 A;  4J57 E;  1GSF A;  4Z2R A;  1F9M A;  5J4U A;  1O81 A;  2YV9 A;  1W89 A;  5D9V A;  2J23 A;  2H6Y A;  1A0F A;  1R5P A;  5CRG A;  3EUR A;  2YWN A;  3GRX A;  4MZB A;  5DJL A;  4GRF A;  4XS4 A;  2YN1 A;  3P8W A;  5CRD A;  2FA8 A;  5G30 A;  3TKS A;  4ECI A;  3VPT A;  4O5Q A;  2RM5 A;  3UOM A;  1ZYN A;  4IJI A;  2NDO A;  1YF0 A;  5B7C A;  3FK8 A;  1VF3 A;  4DSR A;  4TN8 A;  1AQW A;  3TJK A;  4HU9 A;  4IVF A;  1J08 A;  2X4A A;  3UEM A;  1TK8 B;  2JAD A;  3GKK A;  4G0I A;  2P31 A;  1WPI A;  4HDE A;  4GQF A;  1PX6 A;  1XW9 A;  2DIY A;  2H8L A;  3GNJ A;  1KBN A;  4WF5 A;  1JZW A;  2IMK A;  1USB A;  1ABA A;  1SK1 A;  3F9U A;  4DVC A;  1SJZ A;  1K0O A;  1TK5 B;  1EOH A;  5H5Q A;  5CRE A;  1X5C A;  1YEX A;  1VF1 A;  4O92 A;  4ZBA A;  2DBC A;  2DKH A;  1SYR A;  1WMJ A;  2R4V A;  1YKA A;  3M9K A;  5B6N A;  2LUS A;  1H75 A;  3APQ A;  2H73 A;  3QFA C;  3UAP A;  3VPQ A;  1ERW A;  1G6Y A;  4ACS A;  3A2W A;  2FWG A;  4MA9 A;  3MNG A;  2RII A;  1OC9 A;  5ELA A;  3ZZX A;  1KTE A;  2KOK A;  2O87 A;  2O89 A;  5A4W A;  3TJB A;  2FWH A;  1ZZY A;  2LS5 A;  2FWE A;  3N9J A;  3UMA A;  3GL5 A;  1TRV A;  2E7P A;  4KB3 A;  4ZB6 A;  1PKZ A;  1TRU A;  2NPB A;  2TIR A;  4O32 A;  1XVQ A;  1AUC A;  4WBR D;  2X8H A;  5FHI A;  2A2R A;  4FH8 A;  4RQR A;  1A2J A;  3FYG A;  2HZE A;  1O7U A;  2KP2 A;  1JHB A;  2FA4 A;  13GS A;  4K7N A;  5F0G A;  1A2M A;  1H4O A;  2QSI A;  2YP6 A;  4D73 B;  5A4U A;  1O8W A;  3JCM L;  8GSS A;  1XCC A;  3WYW A;  1T7P B;  5ECP B;  3R2Q A;  12GS A;  1MEK A;  2GS3 A;  4ECC A;  3GN3 A;  3ZFB A;  4TVE A;  4KND A;  1TRW A;  3O76 A;  3F6F A;  1M9B A;  2IFQ B;  4Q5Q A;  5JWQ B;  4V2N A;  1SKS B;  1JZR A;  2PU9 C;  4K5R A;  2LJR A;  2B5X A;  1EGO A;  1B4Q A;  2H01 A;  4G19 A;  1S3D A;  2F3M A;  1GL8 A;  1DBY A;  3GV1 A;  5JCG A;  4X0X A;  4JR6 A;  1G6W A;  5F06 A;  3WD6 A;  4CY6 A;  5IMC A;  2A2S A;  2LKU A;  4XIH A;  1PRX A;  2LV3 A;  5H5S A;  1GNE A;  2R0P A;  3GTU B;  1K3O A;  4HJ2 A;  5B8B A;  1O8X A;  2HE3 A;  2LJK A;  5KN0 A;  2R0G A;  2H1G A;  1T4Y A;  1E2Y A;  2AJQ B;  4F9Z A;  1QGV A;  3ZVJ D;  3P2A A;  1A0R P;  2FNO A;  1PN0 A;  3GMF A;  3Q74 A;  5J5N A;  2DJ3 A;  4J56 E;  4XRD A;  1O73 A;  4RI7 A;  1ML6 A;  4X1U A;  17GS A;  5ID2 A;  3DD3 A;  11GS A;  5D73 A;  3MYD A;  2VL9 A;  4HQZ A;  1SU9 A;  4IP6 A;  4QL7 A;  2HRF A;  4K7O A;  1Q98 A;  3D22 A;  3L78 A;  2ALB A;  3UIW A;  3FZ4 A;  3DIE A;  4YQM A;  4F03 A;  3ZRE A;  2X49 A;  4GSN A;  2HSY A;  2GSQ A;  1SKR B;  1PKW A;  1TDI A;  5AN1 A;  2Z9S A;  2C8U A;  2GZP A;  2XHF A;  4MCU A;  1G7O A;  3MWH A;  4NXI A;  4ML1 A;  2PMT A;  2B7J A;  3FR3 A;  5D8I A;  4DSS B;  2MZC A;  2WUL A;  3GKM A;  2JU5 A;  1YDK A;  2I3Y A;  4TRX A;  1PX7 A;  2KHP A;  6GSS A;  3M8N A;  1VRS D;  4JU5 A;  1FVK A;  1AXD A;  2CV4 A;  4V2M A;  2B3S A;  1FOV A;  4ZB8 A;  3MDK A;  1WRY A;  2C0E A;  3LYP A;  2I1U A;  3W8J A;  1EEJ A;  2R0C A;  4PUF C;  4WXT A;  2QGV A;  1J0F A;  2O85 A;  4RQX A;  5KOW A;  1GSS A;  4FYB A;  1XWK A;  5AIX A;  4ZL7 A;  1SKW B;  1R5A A;  3L9S A;  3IHG A;  4FO5 A;  4MF5 A;  1TJD A;  2HZF A;  2YWI A;  2JZT A;  2O8V B;  3C7M A;  2LJA A;  1ACV A;  14GS A;  3HJO A;  1OC3 A;  1A23 A;  1FO5 A;  2H19 A;  2H30 A;  3IAS 2;  3F3R A;  1X9S B;  4JZQ A;  2HYX A;  5J9B A;  1TU7 A;  2AUV A;  3LQ7 A;  1K0B A;  2XPD A;  6GSW A;  4EC0 A;  3TUE A;  2OA7 A;  5ECR B;  2D2Z A;  3UVH A;  3W6G A;  3VI7 A;  1OC9 B;  2QKE A;  1GSD A;  3OR5 A;  3TRQ A;  3FEU A;  1AC1 A;  2JZR A;  1QUW A;  3PH9 A;  3D21 A;  4POM A;  3TOU A;  3HJP A;  5CNW A;  5LNK e;  5D9W A;  3KM6 A;  3CXG A;  5H5R A;  2X64 A;  1TKD B;  3GIX A;  4XHM A;  10GS A;  3G7J A;  3KD0 A;  2YV7 A;  2B5E A;  3QAW A;  5KN2 A;  4HS1 A;  1V98 A;  4N30 A;  5AIS A;  3KH9 A;  1VF2 A;  2BTO T;  3ZTL A;  5ECO B;  2FGX A;  2C3T A;  5IQY A;  3A2V A;  2OE3 A;  3ZIV A;  4ZL8 A;  3GA4 A;  1PN9 A;  4EKZ A;  5JCW A;  3VK9 A;  2KLX A;  1K0M A;  1PL1 A;  2H70 A;  5G5F A;  2C80 A;  3FZ9 A;  4I2T A;  1XIY A;  3TJJ A;  2L59 A;  1R4W A;  2HXK A;  4ZL9 A;  4GXZ A;  1GTI A;  1Z6M A;  1K3Y A;  2DMM A;  4N10 A;  3TJF A;  1A8L A;  4E8H A;  2VD0 A;  1HYU A;  2FUG 2;  3DML A;  2YNX A;  5IMZ A;  2V1M A;  5ENU A;  2VM1 A;  3EPT A;  4XS1 A;  4PUR A;  3LG6 A;  2LTK A;  4HZ4 A;  2X99 A;  3IAM 2;  4NAX A;  4MNN A;  3MIX A;  1X9M B;  4MF7 A;  5DAK A;  2V2G A;  3H79 A;  1DSB A;  4BVX A;  4ID0 A;  4HZ2 A;  1QQ2 A;  3IHQ A;  3KH7 A;  4EDZ A;  1JZO A;  2VO4 A;  3CSJ A;  2H71 A;  3HJM A;  3N5O A;  1SL1 B;  1Z9H A;  4K2X A;  3FZ5 A;  5D96 A;  2E2G A;  4F2I A;  1Z3E A;  5EL8 A;  3ZIJ A;  3PIN A;  2HNL A;  1F6M C;  5GZZ B;  3D5J A;  2XBI A;  3FKF A;  4EF0 A;  4G10 A;  1B9X C;  2QA2 A;  4BL7 A;  3KZQ A;  2PWJ A;  1LJR A;  1PGT A;  2CVD A;  4V1A g;  4HQS A;  3DGQ A;  4POB A;  4XRA A;  4MZC A;  1OKD A;  3BBY A;  5CP1 A;  5AIV A;  2K9F A;  1U87 A;  4KDY A;  4TR1 A;  2V41 A;  2CZ2 A;  5CO3 A;  4XS6 A;  1XWC A;  3P7X A;  1UN2 A;  5EPF A;  1ZYP A;  2AV4 A;  2JL4 A;  4O5U A;  2N5A A;  1AQV A;  1T4Z A;  3DWV A;  1ZOF A;  3LXT A;  5D93 A;  1LBK A;  4OFM A;  1K0D A;  1F37 A;  1GTB A;  1UA5 A;  3FHK A;  4WR4 A;  3GSS A;  4CW9 A;  3H93 A;  2HSH A;  2C0G A;  2HSM A;  5CRW A;  4PQI A;  2ES7 A;  2YJ7 A;  4PX1 A;  3HHV A;  4V2L A;  1XW5 A;  4WET A;  2M46 A;  3KCM A;  2CAI A;  3UL3 A;  1T1V A;  2WFC A;  4BPY A;  3FY7 A;  2IN3 A;  1MDK A;  3A5W A;  3IDV A;  2DSA A;  1EP8 A;  2V6K A;  3KP8 A;  2G2Q A;  3ME8 A;  5C00 A;  5COH A;  2AYT A;  1E6B A;  1WP0 A;  3ZFL A;  3U5R E;  1AW9 A;  1M7T A;  1KEB A;  2KUC A;  1FB6 A;  3VI5 A;  1NM3 A;  3V1W A;  2NVL A;  5IPG A;  1MDJ A;  4N11 A;  3QMX A;  3GX0 A;  2VCQ A;  1X0R A;  3VWX A;  3QCP A;  1WE0 A;  3J7Y b;  2GDR A;  4XTS A;  4KSM A;  1UVZ A;  16GS A;  3G9B A;  2WGR A;  2XPE A;  4YAV A;  3E0U A;  2I81 A;  5IMV A;  1S3C A;  1YEP A;  4IN0 A;  1VF4 A;  4QQ7 A;  3ZRD A;  3RHC A;  1GLQ A;  2OBI A;  3C1R A;  5DCG A;  5G1K A;  1JZD A;  4RI6 A;  7GSS A;  2AHE A;  4ILF A;  1CQH A;  1UC7 A;  2MMO A;  4ECB A;  1QK8 A;  2CAQ A;  3C8E A;  4JED A;  3WGX A;  4X43 A;  2H66 A;  2P0G A;  3RPP A;  1YQ1 A;  2LRN A;  6GSU A;  5E59 A;  4PNG A;  4TR4 A;  5ECM B;  1FAA A;  3VWW A;  4TXO B;  5IO2 A;  4O7H A;  4WBJ A;  1TP9 A;  2GST A;  1JLV A;  2V6O A;  2ZUP A;  5ECK B;  1XOA A;  2CVB A;  2MBS A;  5ECS A;  4NV2 A;  5DDL A;  2TRX A;  1O85 A;  3MSZ A;  1A8Y A;  2O7K A;  2CX4 A;  1ZL9 A;  2GSR A;  2PGT A;  9GSS A;  3GH6 A;  5DBQ A;  4MPG A;  2HFD A;  3LW9 A;  4HUA A;  3CTG A;  3F4R A;  1XWG A;  2RUE A;  3UJ1 A;  4L0W A;  3L4N A;  3I43 A;  1EEM A;  4OO4 A;  3S9F A;  4JRR A;  1V40 A;  3EMX A;  2R5G A;  4BWS A;  4YKF A;  3TOT A;  3EE2 A;  1QFN A;  2HRK A;  1M2A A;  2HRN A;  1GH2 A;  2VL3 A;  2HLS A;  4EIP A;  2L4C A;  1X5D A;  3H1N A;  3KMN A;  3KIJ A;  4KDU A;  2IPA A;  3IOS A;  1GWC A;  2R3X A;  2VLV A;  4OO5 A;  1NW2 A;  5ECL B;  3DYR A;  1G7E A;  4BL7 B;  1IYI A;  3G7Y A;  4IBP A;  4Q5R A;  4V1A p;  4PXO A;  1THX A;  3EU4 A;  4KA0 A;  1KNG A;  2CQ9 A;  3DEX A;  1PL2 A;  1Z6N A;  2WS2 A;  2L5L A;  3GYK A;  6GST A;  5C04 A;  4BVY B;  1ILO A;  1GP1 A;  4TR1 B;  1GSQ A;  5HFG A;  2PER A;  3F4S A;  4Z7X A;  1W4V A;  1ERU A;  4NMU A;  1YJ6 A;  3LYK A;  5DJM A;  3KEB A;  1T8E B;  2C3N A;  4PQH A;  4XS4 B;  3UAR A;  4YQU A;  1B8X A;  4K8M A;  4N0V A;  1T3B A;  5DQY A;  2YWM A;  5BRT A;  4FYC A;  1FVJ A;  3HVV A;  1U3I A;  2V32 A;  2G0F A;  3GUS A;  2VCV A;  4CY8 A;  3ME7 A;  3EC3 A;  3CRT A;  2VCT A;  1EV4 A;  4EDY A;  3GKN A;  3IV4 A;  1U88 A;  2HRA A;  4L8E A;  1SJ6 A;  2GQL A;  1SD9 A;  4TKY A;  2VAF A;  2LRC A;  1PSQ A;  2P5Q A;  4Q5N A;  1ERT A;  4F0C A;  3TB2 A;  1ERV A;  3LJR A;  2K18 A;  18GS A;  2GGT A;  4Z2U A;  3ED3 A;  3FW2 A;  1O6J A;  4K9Z A;  3US3 A;  1XWA A;  3DVX A;  3EIN A;  3KGK A;  2LQO A;  3RPN A;  1YKC A;  3DRN A;  3U6V A;  2REM A;  3A5I A;  3E9J B;  3G7I A;  1J9B A;  2B6M A;  3WT1 A;  1NHY A;  3EWL A;  22GS A;  2ZCT A;  3EVI A;  3VFI A;  1OE7 A;  6GSY A;  4ML6 A;  5EY6 A;  3BJ5 A;  4GQC A;  4Q5F A;  3HCZ A;  2J9H A;  5B8A A;  3TDG A;  3APO A;  2OBK A;  4DEJ A;  4MK3 A;  3ZVJ A;  2WZ9 A;  2TRC P;  3TGZ A;  4YKG A;  2AB6 A;  4AJ6 A;  1HNB A;  2OE0 A;  4WEY A;  2OE1 A;  2IWT A;  1F2E A;  1Y25 A;  3M9J A;  2CT6 A;  3AY8 A;  3W8S A;  2H74 A;  1X9W B;  1R26 A;  4I8B A;  2JSY A;  4FQU A;  5JWR B;  2FCH A;  2HZE B;  2XBQ A;  1N2A A;  5BMU A;  3HKR A;  1XW6 A;  2C3Q A;  3IA1 A;  2WDU A;  4O5R A;  3WGE A;  2DJ0 A;  3IXR A;  5ECH B;  4HU7 A;  3L9U A;  4OFN A;  3IPZ A;  5IIZ A;  1B9Y C;  2FWF A;  2PVQ A;  3HZ4 A;  4IEL A;  2PBJ A;  2MMA A;  2YPM A;  5CYY A;  2MMN A;  4D73 A;  1SK2 A;  4KCE A;  4G9H A;  4AJ8 A;  1HNA A;  3D4T A;  2GLR A;  1NHO A;  1M0U A;  4ZB9 A;  2OAD A;  2YCD A;  2WCI A;  4MJC A;  2VCW A;  3ISO A;  3TJG A;  3KMO A;  4NV5 A;  1Z5Y E;  1MD3 A;  1U6T A;  5CRH A;  5ECN B;  3ZMK A;  5D9X A;  5IOX A;  1IYH A;  2DJ2 A;  4TXV A;  4X4J A;  3QPM A;  3QFB C;  2FY6 A;  5B6M A;  3LFL A;  2B1K A;  1ZCP A;  2H76 A;  2P5R A;  5IM9 A;  4MJB A;  1BX9 A;  4ZXG A;  1SL2 B;  3Q19 A;  2GT5 A;  4KE3 A;  1XWB A;  4GF0 A;  1Z7P A;  5ECQ B;  2H1A A;  1FHE A;  1GSY A;  4MH2 A;  3IC8 A;  3QR6 A;  4EXJ A;  6GSX A;  2VOC A;  5G5E A;  4OWY A;  3HY2 A;  3GST A;  1RK4 A;  4RUV A;  2YAN A;  4KDX A;  4JE1 A;  4NPB A;  1GUM A;  2VIM A;  5HR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...