1SU9A

Reduced structure of the soluble domain of resa
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
137
structure length
137
Chain Sequence
SDAPNFVLEDTNGKRIELSDLKGKGVFLNFWGTWCEPCKKEFPYMANQYKHFKSQGVEIVAVNVGESKIAVHNFMKSYGVNFPVVLDTDRQVLDAYDVSPLPTTFLINPEGKVVKVVTGTMTESMIHDYMNLIKPGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol-disulfide oxidoreductase resA
publication title Structural Basis of Redox-coupled Protein Substrate Selection by the Cytochrome c Biosynthesis Protein ResA.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 44
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1su9A00
5D9TA 3FR6A 3Q74A 3CYNA 5ENUA 3GMFA 2IMDA 3HDCA 1LJRA 2KP2A 2AUVA 3IOSA 3D5JA 2BMXA 3D22A 5ECMB 4V1Ag 2H8LA 3GIXA 5HR0A 3FR3A 3HVXA 1AQXA 2L6DA 4LLRA 2FGXA 3NOFA 3M9JA 2GGTA 3ZMKA 5AISA 1OYJA 1V57A 4AGSA 4BL7A 2IN3A 2YANA 3TOTA 4EDYA 4TVEA 3QDNA 1M2DA 4F82A 1XZOA 2PPTA 3W6GA 1JFUA 3A2VA 2NBSA 1W4VA 2IMIA 3APOA 1EZKA 3RPPA 1GL8A 2K18A 2R5GA 3UOMA 18GSA 4IS0A 5COHA 1EV4A 4O5RA 1WWJA 3GTUB 5HFKA 4K8MA 2ZCTA 2PGTA 1FOVA 3IC4A 3V1WA 1XW6A 3CBUA 1GNWA 2NTOA 5J3RA 2OADA 4ECCA 3MNGA 2H0GA 3WGDA 4POBA 4DSQA 1T8EB 3TKQA 2VCQA 1PGTA 3LFLA 3ED3A 2H1AA 1TJDA 2PUKC 3CSJA 2DBCA 6GSTA 5AN1A 1U3AA 3QR6A 1WIKA 6GSVA 1E2YA 1XWCA 4N30A 2JZTA 2DMMA 1B9XC 4HS1A 5E4WA 2H01A 4PUAA 3LXTA 1U3IA 3HY2A 4PGTA 4TR4A 2O85A 5IMAA 2HRFA 4GSTA 5HR3A 1T4ZA 3F6FA 2DJKA 4GTUA 3TRQA 2GSRA 5FWGA 1ERTA 3A3TA 5JCWA 1X5CA 2HSHA 3G7YA 2P0GA 3C1RA 4WKWA 4I8BA 1XWBA 3KXOA 1Z7PA 3ZL5A 4MJBA 5A4UA 2GS3A 1Q98A 5DDLA 4OO5A 3Q6OA 3GL3A 2OE0A 3KIJA 4DEJA 3GKNA 3HD5A 2H6YA 4K7OA 2IFQA 3D0ZA 2FY6A 2VLVA 4TXOB 1AXDA 2HZFA 3DMLA 3GHAA 4JRRA 3TJBA 2LUSA 3S9FA 3G7JA 2A2SA 1TRVA 4ZL9A 4V2NA 5GAPD 4AF2A 3IHQA 2FNOA 2IMEA 3Q18A 3ISOA 3LYPA 2MYGA 4MPFA 4OO4A 4X1UA 5ID2B 4DSSA 4AJ8A 4WXTA 1GSDA 1ERVA 4GRFA 1M9AA 2CV4A 5F0GA 2I81A 4HU7A 2B1LA 1YKAA 2FD3A 2FLSA 1GLQA 3O76A 1F9MA 2C80A 4ECIA 5ECSA 5ELGA 4IGJA 3DRNA 1U87A 2X8GA 2MMOA 4RI7A 1A8YA 5DJMA 5LNKe 2CQ9A 4AJ7A 3BCIA 3GA4A 2B1KA 1A2JA 1G6WA 2GQKA 1FHEA 1XVWA 2GT6A 3ERWA 2C8UA 5HR1A 3WD6A 1GUKA 5HR2A 3HJPA 4IBPA 3LJRA 2G0FA 6GSWA 2O89A 2PU9C 1ERWA 1FAAA 4LMVA 4RUVA 8GSSA 4OFMA 1GSEA 3TOUA 3CTFA 1DUGA 4MMMA 1PA3A 2GTUA 3TKSE 2JSYA 1HD2A 4ZBAA 3SBCA 5HFGA 3UARA 4PQ1A 2FHEA 5DAKB 1QQ2A 3IAM2 2MMAA 1XVQA 1ZYEA 1GRXA 1X5EA 4F0CA 1NM3A 1SL2B 4ZXGA 1OKTA 1GUMA 2R37A 1SL1B 3DKSA 2LQOA 3F4SA 2H0HA 2DJJA 1M9BA 1AIUA 2J23A 2V6OA 3EE2A 2IJYA 2VM2A 3GKXA 3EYTA 3HZ8A 2AYTA 4OCFA 2J9HA 2RUFA 1O85A 4HU9A 5GAND 3CXGA 2A2RA 4IQ1A 1AQVA 3ZIVA 1GSQA 1WPIA 5E59A 1H75A 4K1FA 4MF6A 5IMCA 4I97A 1KBNA 2YNXA 5D93A 2OJLA 3HA9A 3DIEA 4RQRA 1T4YA 5IO2A 2YJ7A 1R5PA 4OFTA 3GX0A 3FHKA 6GSYA 2YP6A 4LMWA 1A8LA 2LRNA 5LCZA 4PURA 2XHFA 2M46A 4ZBDA 3HXSA 2GSQA 1K0AA 3GTUA 1KTEA 2LNTA 3PR8A 5HFIA 3GL5A 3DVXA 3IAS2 2DMLA 4MJCA 1K3OA 2E7PA 2WZ9A 2QGVA 2ON7A 3TRXA 3HJMA 4XCSA 4GWRA 4EVMA 4BWQA 3A2WA 1N2AA 5J4UA 1OC3A 3I43A 2KLXA 2O87A 4FYCA 5A4VA 2F9SA 2XPDA 2AHEA 1HYUA 4HQZA 2I1UA 1TTZA 1Y6EA 2WRTA 3C8EA 1GP1A 2HYXA 4ML6A 4N0ZA 5KN0A 4F9ZA 4DVCA 1UA5A 3LWAA 5CAXA 3TKSA 5ECHB 1ZYQB 5J9BA 1YKCA 1QMVA 2VM1A 2E2GA 1WRYA 1Z5YE 2VCWA 2X8CA 1A0RP 4E8EA 3D21A 1EEJA 2JADA 2DJ1A 3VI7A 4K9ZA 3W8SA 1B48A 3EURA 1YF0A 1K0DA 1M2AA 3FEUA 2E2MA 5IQYA 3GSSA 4V1Ap 1YY7A 2I3YA 2DIYA 1TRUA 1GNEA 5ABRA 2EIOA 2HZEB 3APSA 3D6IA 2F3MA 1TK8B 2VAFA 5B7CA 1ST9A 3BJ5A 2VO4A 2H1BA 2WCIA 4NV5A 5DQSA 4CW9A 3P90A 5EY6A 3W8JA 1M7TA 5EPFA 4JBBA 3G9BA 3WGXA 3KEBA 1VGLA 1GTIA 1TOFA 4TR3A 4ZB8A 3M8NA 4YAPA 2WS2A 4GSSA 1UC7A 1OC9B 4BPYA 5IMZA 2IMKA 1GTUA 5IIZA 1PL1A 4BWSA 3C7MA 1OC8A 2GSSA 5H5RA 4KCAA 3F6DA 2C3NA 5ID2A 2MBTA 1PX7A 4JR4A 2XC2A 1ILOA 3H79A 4I2TA 1YF1A 2CA8A 5D9XA 1KNGA 1B4PA 2LS5A 4EE0A 3R2QA 4WBRD 4ZL7A 4OMVA 1Z9HA 2YWIA 3EINA 1C72A 3GRXA 7GSSA 1K3LA 4PX1A 3CTGA 1GTBA 4J56E 2RLIA 3QPMA 3VI5A 3KH9A 2CVDA 2LKUA 2VLUA 1JLVA 1S3AA 2EC4A 4HEA2 4PQHA 4ECJA 4ULXA 2DIZA 2CVBA 3F63A 2YN1A 1J9BA 5IOWA 2IPAA 2N5AA 4GXZA 1TU8A 5B6MA 1FB6A 1V2AA 5DAKA 3HVSA 1USBA 1RK4A 2YV9A 4MF7A 1NHYA 5JCGA 3GH6A 22GSA 3VLNA 4ECBA 1WE0A 2HT9A 1K0BA 4LL4B 3GKKA 3UVTA 1G6YA 1VF4A 3WT2A 1O8WA 1OE7A 1EEMA 5ECQB 4BVXA 3F3RA 3P7XA 3AY8A 2GT5A 2K8SA 5B8BA 4TR0A 4WR5A 1MDKA 2FWGA 11GSA 4IN0A 4OD7A 3IR4A 4IKHA 1Z7RA 2VCXA 3ZREA 1ZCPA 2C0DA 1BG5A 1THOA 4K7IA 4NXIA 2JZSA 3UVHA 1EOHA 1BQ7A 4Q5FA 5G1LA 2B5XA 4HJMA 3K8NA 1FO5A 3F4RA 4G2EA 4Q5QA 3ZFBA 3ME7A 4ZILA 4XTSA 2B5YA 1S3DA 1SYXA 4IJIA 2OKAA 1GUHA 1R5AA 1XWGA 17GSA 1TDIA 3IBHA 4EO3A 3IV4A 4L0WA 1THXA 4E8HA 3VWWA 1XFLA 2F8AA 3M1GA 5F8BA 5CP1A 3GUSA 1HNAA 3KP9A 1O6JA 4RI6A 4YH2A 1DBYA 4KB3A 19GSA 3L0HA 2GZZA 2AV4A 4MK3A 4WETA 4IP1A 3ZLPA 2X8HA 1QFNA 2C0GA 1K3YA 3TJJA 3UBKA 1Q4JA 4O92A 2H75A 4FO5A 1O8XA 4BA7A 2D2ZA 4KDXA 2IWTA 2VCTA 5CYYA 2GVPA 1TU7A 3ERGA 3M0FA 1SL0B 5CRGA 4D73B 3H4KA 2MZCA 2LEGA 3GYKA 2F8FA 3EMXA 2AJQB 3RAZA 2CX4A 3ZZXA 4HDEA 1IYIA 5HQPA 4KCEA 4HOJA 3QD9A 2HZEA 4MH3A 3TKSC 2L5LA 4EUYA 3ZIJA 2H72A 3IDVA 4MJEA 1SD8A 2I9HA 4XS4B 2RIIA 3LEFA 3ZYWA 1SD9A 3VPTA 3MAKA 1PN9A 3HZ4A 1ZGNA 4ISDA 2CAQA 4KH7A 2RUEA 2HFDA 2RM6A 4DSRA 2GLRA 2IL3A 1OC9A 3SWLA 3TJFA 3FKFA 4TXVA 5F07A 1B8XA 1VF3A 3A2XA 3IRAA 2H1DA 4Q5NA 3KTLA 4GQFA 2HXKA 3HHVA 3UEMA 3CRTA 2BJXA 5GSTA 4H86A 1UVZA 4BVYA 4LA1A 2V6KA 2ES7A 2HI7A 1T3BA 4ML1A 3PINA 4KAEA 4ACSA 1ZL9A 5IMFA 2JL4A 2KP1A 3PH9A 2MBSA 1K0CA 2V32A 5C04A 4ZIJA 1TK5B 2M80A 1EP7A 3H93A 2WDUA 3L9SA 3TKPA 2OBKA 1TP9A 3A5WA 4K6XA 1G0TA 3UAPA 5IM9A 1BJXA 3I9V2 1XOBA 1TW9A 2FA4A 1E6BA 2R6KA 4HJ2A 1JZOA 1MTCA 2K8VA 1MD3A 2YWOA 2LTKA 5DJLA 3KJYA 3EWLA 3HVVA 5DCGA 4KSOA 4XRAA 1R26A 1EGRA 2VD0A 2ZNMA 4L8EA 1OKDA 2O7KA 4N0VA 2DSAA 2LJRA 5D9WA 1GSUA 4XIHA 2IMFA 1S3CA 1TKDB 4GSNA 5H5QA 2VL2A 3QFAC 5H5SA 2E0QA 1H4OA 1YDKA 2GZPA 2HSYA 4GQCA 5FHIA 1SJ6A 1Z3EA 2H66A 5FT3A 3HCZA 4EL1A 3ZTLA 1XBSA 3D4TA 2CAIA 4FIWA 3KMOA 3FZ5A 3QMXA 1HNBA 2B3SA 1WP0A 2N5BA 3VK9A 1PSQA 2C0EA 3TCOA 3KM6A 2R3XA 2FWHA 1BX9A 4HUAA 1QXHA 4IHUA 2GZYA 3EVIA 9GSSA 3J7Yk 3RDWA 1I5GA 3TGZA 4WF5A 5DQYA 1QUWA 2KUCA 3E0UA 2NPBA 2FA8A 1GSSA 2PVOC 3ERFA 5JCUA 2Z9SA 5F06A 2K9FA 1AW9A 4WR4A 1X9MB 2JSZA 3VURA 3LORA 5JWQB 3P8WA 1FG4A 1G7EA 2H1GA 2VL9A 2PVQA 2P5RA 4XRDA 5GZZB 4MDCA 4OFNA 2AB6A 14GSA 1VF1A 4MH2A 3TUEA 3ZVJA 3CMIA 3KH7A 2PN8A 2XPEA 3LSZA 3ZRDA 1FB0A 4KGIA 3L9VA 1AAZA 2DJ3A 1R4WA 3F8UA 2YPMA 3WYWA 2H19A 1CQGA 2L4CA 1XW9A 4G19A 3G7IA 4D73A 5IPGA 3J7Yb 1K0NA 1UN2A 1GLPA 1RQMA 2C0FA 6GSXA 2LRCA 2LJAA 2H6ZA 1X5DA 1YJ6A 1F6MC 4TXOA 12GSA 2C4JA 2YV7A 4ZB9A 2P31A 4EF0A 3M3MA 4KDUA 4XS4A 4ZL8A 4G10A 5ECLB 1XW5A 4POKA 3GFKA 4WEYA 3CRUA 2GDRA 4POLA 2ON5A 1V98A 2LQQA 4YQVA 1F3AA 4GLTA 2V2GA 1TI3A 3KP8A 4L5LA 3C71A 3FY7A 3FYGA 2V41A 5C00A 2LJKA 20GSA 1PX6A 3DVWA 2L6CA 1DE1A 4MZWA 5G30A 5KEJA 3H1NA 2X99A 2VLTA 4MA9A 3L4NA 1F37A 2JU5A 3F4TA 4O32A 3IK9A 1U88A 3RHBA 2H70A 4JE1A 1F3BA 5IOXA 1SENA 2VCZA 4KE3A 2H0IA 1Z6MA 2H76A 2OBIA 3P2AA 1ZMAA 1FVKA 1XIYA 1JHBA 4G9HA 5IPHA 5G1KA 1T1VA 5KN1A 2MMZA 1ERUA 1PRXA 3BOAA 4IW9A 2TRCP 1IYHA 1MDIA 1PKWA 5AIXA 6GSSA 2YZHA 4K0NA 1N8JA 1MEKA 1XWAA 4GF0A 3U5RE 2XBIA 4K0GA 5KN3A 1SKRB 5LD0A 3N9JA 4TR1B 1SKSB 4XS6A 16GSA 1ABAA 3TDGA 1ZOFA 3DXBA 2R4VA 2YWMA 2RM5A 4EKZA 1AUCA 2LRTA 2QSIA 2DC5A 3C73A 3M9KA 2PMTA 3KCMA 2HRNA 4MZCA 3CSHA 4N11A 2KOKA 1NHOA 2NVLA 1X9SB 4N10A 3ME8A 4QL9A 1O7UA 1A0FA 4NMUA 2VD1A 2H71A 2K6VA 2X64A 3L78A 5IO0A 1V40A 4EDZA 2AAWA 1J08A 4F2IA 1CQHA 1HQOA 4OWYA 5G5EA 3N5OA 4KNDA 2G2QA 3ZMLA 4K7NA 2VL2C 3VWUA 4JZQA 4YQMA 5INYA 3RBTA 4JU5A 2HE3A 3IXRA 5DCHA 4IVFA 1T7PB 5ECOB 3OR5A 4NWYA 2YJHA 1YZXA 1GTAA 2QKEA 4PNGA 4KW6A 3CSIA 5CRWA 3QFBC 3DGQA 2B5EA 3L9UA 2B7KA 2H6XA 1A2MA 3VFIA 5AGYA 4MABA 1M99A 3I6AA 1GWCA 2ALBA 3QAGA 3F9UA 3DEXA 3FZ9A 3NZNA 2L59A 1YQ1A 3HKRA 1OE8A 4MJAA 10GSA 2YZUA 4NAXA 3GH9A 3O6TA 3GURA 3IE3A 3DYRA 4TRXA 1GSYA 4KDYA 2DJ0A 4JEDA 1OVNA 3JCML 3UMAA 1NSWA 1JZWA 5ECNB 1V9WA 1WJKA 1Y25A 3PGTA 4ID0A 4NHWA 1JZDA 2CZ2A 2EIRA 1SJZA 3MSZA 1XXUA 2CT6A 1B4QA 1X9WB 2V1MA 1XWKA 3FZAA 3KZQA 1AQWA 4GCIA 4QQ7A 5DALB 2QC7A 4KA0A 1B9YC 3US3A 3IA1A 4XHMA 2WJUA 3APQA 5D73A 1WMJA 3GN3A 4F0BA 1MD4A 1WOUA 2PERA 1G7OA 4I2UA 4MLYA 5D96A 2L5OA 1PQNA 1K0OA 1J0FA 3RHCA 4MF5A 2R2JA 5IMDA 1AC1A 5F05A 1XCCA 4FYBA 3E9JB 4HZ2A 4V2LA 5B8AA 1NW2A 1SK1A 1V58A 2FWFA 2OE1A 1BEDA 5AIVA 1SU9A 5DVBA 1SK0A 2BTOT 4TOPA 1EV9A 1FVJA 5A4WA 1PD21 5GSSA 3QCPA 3BCKA 3BD2A 4IELA 2H30A 1TK0B 1SKWB 4ZBBA 4PQIA 3FRCA 4TN8A 5A5KA 2WULA 2OA7A 3LYKA 2VCVA 5ELAA 4FH8A 4MCUA 1DE2A 4PXOA 3GV1A 3FK8A 3UL3A 3FZ4A 5J41A 5IMVA 2NDOA 4O7HA 3HYPA 1JZRA 4IJ3A 6GSUA 3IK7A 1M0UA 4I5QA 3VPQA 2JACA 3TKRA 4KUNA 3NIVA 5ECPB 3KMNA 1LBKA 1M2BA 5J5NA 2I4AA 1XPVA 5D8IA 1FW1A 4EXJA 4QL7A 1PKZA 3UBLA 1HNCA 5CRHA 3UJ1A 2A4VA 4TR1A 13GSA 1PL2A 5DBQA 4KX4A 1Z6NA 2WB9A 1A23A 4NV2A 3VWVA 1TI1A 2L57A 1SYRA 5ECKB 4TW5A 3Q19A 1BAYA 3HJOA 5KN2A 2N5FA 5CNWA 2GQLA 2VIMA 1W89A 4JR6A 4XS1A 1A24A 3LGCA 4FYUA 4K2DA 3O3TA 3KD0A 1ZZYA 3BBYA 3E3EA 4PUFC 1EGOA 1F2EA 3ZVJD 1OAZA 3TRPA 4YQUA 3WGEA 1QGVA 3GKMA 3F3QA 3LQ7A 2H74A 3IPZA 3LXZA 4MP4A 4HQSA 3TJKA 2YCDA 3FW2A 4I6XA 4LL1B 2O8VB 3GNJA 1BYEA 5G2ZA 2HNLA 1LU4A 1I9DA 5L71A 4OCEA 4MZBA 3EC3A 2WFCA 4J2FA 1TXXA 2YWNA 3H8QA 4PNFA 2CX3A 2TIRA 2C3TA 1ACVA 2KHPA 2LSTA 3KTBA 3D4MA 3GSTA 4J57E 3QOUA 3RPNA 5ECIB 1EWXA 2GSTA 2OACA 2C1YA 4HI7A 4CHSA 5ECRB 3LG6A 1VRSD 5JWOB 4CDOA 1O73A 2FUG2 5CRDA 4L0UA 4RQXA 1URMA 1EP8A 2LNSA 2GQMA 3GX8A 1DSBA 1GSFA 2OE3A 2C3QA 2PWJA 2FWEA 5CREA 2FCHA 5CO3A 2B6MA 2EIQA 2JZRA 2M72A 2IFQB 2P5QA 1YEXA 2B7JA 1SK2A 3TJGA 1QK8A 4WBJA 4ZB6A 3DWVA 2ZUPA 5B6NA 1U6TA 5DALA 2L4QA 1KEBA 3KGKA 4DSSB 3DD3A 1GULA 3U6VA 1ML6A 4WF4A 4AJ6A 3ZITA 2XBQA 5G31A 1X0RA 4IQAA 1GH2A 2VUPA 3EU3A 1O81A 2WGRA 2IIYA 2YOIA 1EOGA 1VF2A 2DJ2A 2CVKA 4X0XA 3WT1A 3MDKA 3QAVA 3F0IA 4NPBA 4P3YB 1RW1A 2HLSA 4NHZA 5EL8A 3I69A 2TRXA 1XOAA 1ON4A 4TKYA 4IP6A 5G5FA 1SJIA 4EC0A 4V2MA 2DLXA 4MPGA 2LV3A 3ZFLA 1A2LA 4POMA 4Z7XA 4HZ4A 4KSMA 3QAWA 5JWRB 3UIWA 1JLWA 2CZ3A 1TRWA 2VOCA 2F51A 2REMA 1YEPA 1MDJA 2VL3A 2PBJA 5J9CA 4Q5RA 5D9VA 1R7HA 3C1SA 1PMTA 1TRSA 4L5OA 4YAVA 1T00A 2MMNA 3TB2A 1K0MA 3VWXA 3EU4A 4ILFA 4X43A 4F03A 3MWHA 3FR9A 5EVOA 2H73A 3EMPA
chains in the Genus database with same CATH superfamily
5D9TA 3FR6A 3Q74A 3CYNA 5ENUA 3GMFA 2IMDA 3HDCA 1LJRA 2KP2A 2AUVA 2QA2A 3IOSA 3D5JA 2BMXA 3D22A 5ECMB 4V1Ag 2H8LA 3GIXA 5HR0A 3FR3A 3HVXA 1AQXA 2L6DA 4LLRA 2FGXA 3NOFA 3M9JA 2GGTA 2QA1A 3ZMKA 5AISA 1OYJA 1V57A 4AGSA 4BL7A 2IN3A 2YANA 3TOTA 4EDYA 4TVEA 3QDNA 1M2DA 4FQUA 4F82A 1XZOA 2PPTA 3W6GA 1JFUA 3A2VA 2NBSA 1W4VA 2IMIA 3APOA 1EZKA 3RPPA 1GL8A 2K18A 2R5GA 3UOMA 18GSA 4IS0A 5COHA 1EV4A 4O5RA 1WWJA 3GTUB 5HFKA 4K8MA 2UZ8A 2ZCTA 2PGTA 1FOVA 3IC4A 3V1WA 1XW6A 2A2PA 1GNWA 3CBUA 2NTOA 5J3RA 2OADA 4ECCA 3MNGA 2H0GA 3WGDA 3R3EA 4POBA 4DSQA 1T8EB 3TKQA 2VCQA 1PGTA 3LFLA 3ED3A 5BRTA 2H1AA 1TJDA 1M3JA 2PUKC 3CSJA 2DBCA 6GSTA 5AN1A 1U3AA 3QR6A 1WIKA 4USSA 6GSVA 1E2YA 1XWCA 4N30A 2JZTA 2DMMA 1B9XC 4HS1A 5E4WA 2H01A 4PUAA 3LXTA 1U3IA 3HY2A 4PGTA 4TR4A 2O85A 5IMAA 2HRFA 4GSTA 5HR3A 1T4ZA 3F6FA 2DJKA 4GTUA 4K5SA 3TRQA 2GSRA 5FWGA 1ERTA 3A3TA 5JCWA 1X5CA 2HSHA 3G7YA 2P0GA 3C1RA 4WKWA 4I8BA 1XWBA 3KXOA 1Z7PA 3ZL5A 4MJBA 5A4UA 2GS3A 1Q98A 5DDLA 4OO5A 3Q6OA 3GL3A 2OE0A 3KIJA 4DEJA 3GKNA 3HD5A 1FOHA 2H6YA 4K7OA 2IFQA 3D0ZA 2FY6A 2VLVA 4TXOB 1AXDA 2HZFA 3DMLA 3GHAA 4JRRA 3TJBA 2LUSA 3S9FA 3G7JA 2A2SA 1TRVA 4ZL9A 4V2NA 5GAPD 4AF2A 3IHQA 2FNOA 2IMEA 3Q18A 3ISOA 3LYPA 2MYGA 4MPFA 4OO4A 4X1UA 5ID2B 4DSSA 4AJ8A 4WXTA 1GSDA 1ERVA 4GRFA 1M9AA 3HVNA 2CV4A 5F0GA 2I81A 4HU7A 2B1LA 1YKAA 2FD3A 2FLSA 1GLQA 3O76A 1F9MA 2C80A 2DKIA 4ECIA 5ECSA 5ELGA 4IGJA 3DRNA 1U87A 2X8GA 2MMOA 4RI7A 1A8YA 5DJMA 5LNKe 2CQ9A 4AJ7A 3BCIA 3GA4A 2B1KA 1A2JA 1G6WA 2GQKA 1FHEA 1XVWA 2GT6A 3ERWA 2C8UA 5HR1A 3WD6A 1GUKA 5HR2A 3HJPA 4IBPA 3LJRA 2G0FA 6GSWA 2O89A 2PU9C 1ERWA 1FAAA 4LMVA 4RUVA 8GSSA 4OFMA 1GSEA 3TOUA 3CTFA 1DUGA 4MMMA 1PA3A 2GTUA 3TKSE 2JSYA 1HD2A 4ZBAA 3SBCA 5HFGA 3UARA 4PQ1A 3EPTA 2FHEA 5DAKB 1QQ2A 3IAM2 2MMAA 1XVQA 1ZYEA 1GRXA 1X5EA 4F0CA 1NM3A 1SL2B 4ZXGA 3FMWA 1OKTA 1GUMA 2R37A 1SL1B 3DKSA 2LQOA 3F4SA 2H0HA 3MIXA 2DJJA 1M9BA 1AIUA 2J23A 2V6OA 3EE2A 4BVXB 2IJYA 2VM2A 3GKXA 3EYTA 3HZ8A 2AYTA 4OCFA 2J9HA 2RUFA 1O85A 4HU9A 5GAND 3CXGA 2A2RA 4IQ1A 1AQVA 3ZIVA 1GSQA 1WPIA 5E59A 1H75A 4K1FA 4MF6A 5IMCA 4I97A 1KBNA 2YNXA 5D93A 2OJLA 3HA9A 3DIEA 4RQRA 1T4YA 5IO2A 2YJ7A 1R5PA 4OFTA 3GX0A 3FHKA 6GSYA 2YP6A 4LMWA 1A8LA 2LRNA 5LCZA 4PURA 2XHFA 2M46A 4ZBDA 3HXSA 2X49A 2GSQA 1K0AA 3GTUA 1KTEA 2LNTA 3PR8A 5HFIA 3GL5A 3DVXA 3IAS2 2DMLA 4MJCA 1K3OA 2E7PA 2WZ9A 2QGVA 2ON7A 3TRXA 3HJMA 4XCSA 4GWRA 4EVMA 4BWQA 3A2WA 1N2AA 5J4UA 1OC3A 3I43A 2KLXA 2O87A 4FYCA 5A4VA 2F9SA 2XPDA 2AHEA 1HYUA 4HQZA 2I1UA 1TTZA 1Y6EA 2WRTA 3C8EA 1GP1A 2HYXA 4ML6A 4N0ZA 5KN0A 4F9ZA 4DVCA 1UA5A 3LWAA 5CAXA 3TKSA 5ECHB 1ZYQB 5J9BA 1YKCA 1QMVA 2VM1A 2E2GA 1WRYA 1Z5YE 2VCWA 2X8CA 1A0RP 4E8EA 3D21A 1EEJA 2JADA 2DJ1A 3VI7A 4K9ZA 3W8SA 1B48A 3EURA 1YF0A 1K0DA 1M2AA 3FEUA 2E2MA 5IQYA 3GSSA 4V1Ap 4X4JA 1YY7A 2I3YA 2DIYA 1TRUA 1GNEA 5ABRA 2EIOA 2HZEB 3APSA 3D6IA 2F3MA 1TK8B 2VAFA 5B7CA 1ST9A 3BJ5A 2VO4A 2H1BA 2WCIA 4NV5A 5DQSA 4CW9A 3P90A 5EY6A 3W8JA 1M7TA 5EPFA 4JBBA 3G9BA 3WGXA 3KEBA 1VGLA 1GTIA 1TOFA 4TR3A 4ZB8A 3M8NA 4YAPA 2WS2A 4GSSA 1UC7A 1OC9B 4BPYA 5IMZA 2IMKA 1GTUA 5IIZA 1PL1A 4BWSA 3C7MA 1OC8A 2GSSA 5H5RA 3IHGA 4KCAA 3F6DA 2C3NA 5ID2A 2MBTA 4PTSA 1PX7A 4JR4A 2XC2A 1ILOA 3H79A 4I2TA 1YF1A 2CA8A 5D9XA 1KNGA 1B4PA 2LS5A 4EE0A 4BVYB 3R2QA 4WBRD 4ZL7A 4OMVA 1XG8A 1Z9HA 2YWIA 3EINA 1C72A 3GRXA 7GSSA 1K3LA 4PX1A 3CTGA 1GTBA 4J56E 2RLIA 3QPMA 3VI5A 3KH9A 2CVDA 2LKUA 2VLUA 1JLVA 1S3AA 2EC4A 4HEA2 4PQHA 4ECJA 4ULXA 2DIZA 2CVBA 3F63A 2YN1A 1J9BA 5IOWA 2IPAA 2N5AA 4GXZA 1TU8A 5B6MA 1FB6A 1V2AA 5DAKA 3HVSA 1USBA 1RK4A 2YV9A 4MF7A 1NHYA 5JCGA 4G0IA 4EIQA 3GH6A 22GSA 3VLNA 4ECBA 1WE0A 2HT9A 1K0BA 4LL4B 3GKKA 3UVTA 1G6YA 1VF4A 3WT2A 1O8WA 1OE7A 1EEMA 5ECQB 4BVXA 3F3RA 3P7XA 3AY8A 2GT5A 2K8SA 4A5PA 4YKGA 5B8BA 4TR0A 4WR5A 1MDKA 2FWGA 11GSA 4IN0A 4OD7A 3IR4A 4IKHA 1Z7RA 2VCXA 2HRAA 3ZREA 1ZCPA 2C0DA 1BG5A 1THOA 4K7IA 4NXIA 2JZSA 3UVHA 1EOHA 1BQ7A 4Q5FA 5G1LA 2B5XA 4HJMA 3K8NA 4Z2RA 1FO5A 3F4RA 4G2EA 4Q5QA 3ZFBA 3ME7A 4ZILA 4XTSA 2B5YA 1S3DA 1SYXA 4IJIA 2OKAA 1GUHA 1R5AA 1XWGA 17GSA 1TDIA 3IBHA 4EO3A 3IV4A 4L0WA 1THXA 4E8HA 3VWWA 1XFLA 2F8AA 3M1GA 5F8BA 5CP1A 3GUSA 1HNAA 3KP9A 1O6JA 4RI6A 4YH2A 1DBYA 4KB3A 19GSA 3L0HA 2GZZA 2AV4A 4MK3A 4WETA 4IP1A 3ZLPA 2X8HA 1QFNA 2C0GA 1K3YA 3TJJA 3UBKA 1Q4JA 4O92A 2H75A 2R0CA 4FO5A 1O8XA 4BA7A 2D2ZA 4KDXA 2IWTA 2VCTA 5CYYA 2GVPA 1TU7A 3ERGA 3M0FA 1SL0B 5CRGA 4D73B 3H4KA 2MZCA 2LEGA 3GYKA 2F8FA 3EMXA 2AJQB 3RAZA 2CX4A 3ZZXA 4HDEA 1IYIA 5HQPA 4KCEA 4HOJA 3QD9A 2HZEA 4MH3A 3TKSC 2L5LA 4EUYA 3ZIJA 2H72A 3IDVA 4MJEA 1SD8A 2I9HA 4XS4B 2RIIA 3LEFA 3ZYWA 1SD9A 3VPTA 1PN0A 3MAKA 1PN9A 3HZ4A 1ZGNA 4ISDA 4G0KA 2CAQA 4KH7A 2RUEA 2HFDA 2RM6A 4DSRA 2GLRA 2IL3A 1OC9A 3SWLA 3TJFA 3FKFA 4TXVA 5F07A 1B8XA 1VF3A 3A2XA 3IRAA 2H1DA 4Q5NA 3KTLA 4GQFA 2HXKA 3HHVA 3UEMA 3CRTA 2BJXA 5GSTA 4H86A 1UVZA 4BVYA 4LA1A 2V6KA 2ES7A 2HI7A 1T3BA 4ML1A 1PFOA 3PINA 4KAEA 4ACSA 1ZL9A 5IMFA 2JL4A 2KP1A 3PH9A 2MBSA 1K0CA 2V32A 5C04A 4ZIJA 1TK5B 2M80A 1EP7A 3H93A 2WDUA 3L9SA 3LW9A 3TKPA 2OBKA 1TP9A 3A5WA 4K6XA 1G0TA 3UAPA 5IM9A 1BJXA 3I9V2 1XOBA 1TW9A 2FA4A 1E6BA 2R6KA 4HJ2A 1JZOA 1MTCA 2K8VA 1MD3A 2YWOA 2LTKA 5DJLA 3KJYA 3EWLA 3HVVA 5DCGA 4KSOA 4XRAA 1R26A 1EGRA 2VD0A 2ZNMA 4L8EA 1OKDA 2O7KA 4N0VA 2DSAA 2LJRA 5D9WA 1GSUA 4XIHA 2IMFA 1S3CA 1TKDB 4GSNA 5H5QA 2VL2A 3QFAC 5H5SA 2E0QA 1H4OA 1YDKA 2GZPA 2HSYA 4GQCA 5FHIA 1SJ6A 1Z3EA 2H66A 5FT3A 3HCZA 4EL1A 3ZTLA 1XBSA 3D4TA 2CAIA 4BL7B 4FIWA 3KMOA 3FZ5A 3QMXA 1HNBA 2B3SA 1WP0A 2N5BA 3VK9A 1PSQA 2C0EA 3TCOA 3KM6A 2R3XA 2FWHA 1BX9A 4HUAA 1QXHA 4IHUA 2GZYA 3EVIA 9GSSA 3J7Yk 3RDWA 1I5GA 3TGZA 4EIPA 4WF5A 5DQYA 1QUWA 2KUCA 3E0UA 2NPBA 2FA8A 1GSSA 2PVOC 3ERFA 5JCUA 2Z9SA 5F06A 2K9FA 1AW9A 4WR4A 1X9MB 2JSZA 3VURA 3LORA 5JWQB 3P8WA 1FG4A 1G7EA 2H1GA 2VL9A 2PVQA 2P5RA 4XRDA 5GZZB 4MDCA 4OFNA 2AB6A 14GSA 1VF1A 4MH2A 3TUEA 3ZVJA 3CMIA 3KH7A 2PN8A 2XPEA 3LSZA 3ZRDA 1FB0A 4KGIA 3L9VA 1AAZA 2DJ3A 1R4WA 3F8UA 2YPMA 3WYWA 2H19A 1CQGA 2L4CA 1XW9A 4G19A 1ZYPA 3G7IA 4D73A 5IPGA 3J7Yb 1K0NA 3CQFA 1UN2A 1GLPA 1RQMA 2C0FA 6GSXA 2R0PA 2LRCA 2LJAA 2H6ZA 1X5DA 1YJ6A 1F6MC 4TXOA 12GSA 2C4JA 2YV7A 4ZB9A 2P31A 4EF0A 3M3MA 4KDUA 4XS4A 4ZL8A 4G10A 5ECLB 1XW5A 4POKA 3GFKA 4WEYA 3CRUA 2GDRA 4POLA 2ON5A 1V98A 2LQQA 4YQVA 1F3AA 4GLTA 2V2GA 1TI3A 3KP8A 4CY8A 4L5LA 3C71A 2X4AA 3FY7A 3FYGA 2V41A 5C00A 2LJKA 20GSA 1PX6A 3DVWA 2L6CA 1DE1A 4MZWA 5G30A 5KEJA 3H1NA 2X99A 2VLTA 4MA9A 3L4NA 1F37A 2JU5A 3F4TA 4O32A 3IK9A 1U88A 3RHBA 2H70A 4JE1A 1F3BA 5IOXA 1SENA 2VCZA 4KE3A 2H0IA 1Z6MA 2H76A 2OBIA 3P2AA 1ZMAA 1FVKA 1XIYA 1JHBA 4G9HA 5KOWA 5IPHA 5G1KA 1T1VA 5KN1A 2MMZA 1ERUA 1PRXA 3BOAA 4IW9A 2TRCP 1IYHA 1MDIA 1PKWA 5AIXA 6GSSA 2YZHA 4K0NA 1N8JA 1MEKA 1XWAA 4GF0A 3U5RE 5BMUA 2XBIA 4K0GA 5KN3A 1SKRB 5LD0A 3N9JA 4TR1B 1SKSB 4XS6A 16GSA 1ABAA 4KF9A 3TDGA 1ZOFA 3DXBA 2R4VA 2YWMA 2RM5A 4EKZA 1AUCA 2LRTA 2QSIA 2DC5A 3C73A 3M9KA 2PMTA 3KCMA 2HRNA 4MZCA 3CSHA 4N11A 2KOKA 1NHOA 2NVLA 1X9SB 4N10A 3ME8A 4QL9A 1O7UA 1A0FA 4NMUA 2VD1A 2H71A 2K6VA 2X64A 4Z2UA 3L78A 5IO0A 1V40A 4EDZA 2AAWA 1J08A 4ICYA 4F2IA 1CQHA 1HQOA 4OWYA 5G5EA 3N5OA 4KNDA 1S3RA 2G2QA 3ZMLA 4K7NA 2VL2C 3VWUA 3A5IA 4JZQA 4YQMA 5INYA 3RBTA 4JU5A 2HE3A 3IXRA 5DCHA 4IVFA 1T7PB 5ECOB 3OR5A 4NWYA 2YJHA 1YZXA 1GTAA 2QKEA 4PNGA 4KW6A 3CSIA 5CRWA 3QFBC 3DGQA 2B5EA 3L9UA 4BIKA 2B7KA 2H6XA 1A2MA 3VFIA 5AGYA 4MABA 1M99A 3I6AA 1GWCA 2ALBA 3QAGA 3F9UA 3DEXA 3FZ9A 3NZNA 2L59A 1YQ1A 3HKRA 1OE8A 4MJAA 2A4HA 10GSA 2YZUA 4NAXA 3GH9A 3O6TA 3GURA 3IE3A 3DYRA 4TRXA 1GSYA 4KDYA 2DJ0A 4JEDA 1OVNA 3JCML 3UMAA 1NSWA 1JZWA 5ECNB 1V9WA 1WJKA 1Y25A 3PGTA 4ID0A 4NHWA 1JZDA 2CZ2A 2EIRA 1SJZA 3MSZA 1XXUA 2CT6A 1B4QA 1X9WB 2V1MA 1XWKA 3FZAA 3KZQA 1AQWA 4GCIA 4QQ7A 5DALB 2QC7A 4KA0A 1B9YC 3US3A 3IA1A 4XHMA 2WJUA 3APQA 5D73A 4K5RA 1WMJA 3GN3A 4F0BA 1MD4A 4YKFA 1WOUA 2PERA 1G7OA 4I2UA 4MLYA 5D96A 2L5OA 1PQNA 1K0OA 1J0FA 1M3IA 3RHCA 4MF5A 2R2JA 5IMDA 1AC1A 5F05A 1XCCA 4FYBA 3E9JB 4HZ2A 4V2LA 5B8AA 2R0GA 1NW2A 1SK1A 1V58A 2FWFA 2OE1A 1BEDA 5AIVA 1SU9A 5DVBA 4O5QA 1SK0A 2BTOT 4TOPA 1EV9A 1FVJA 5A4WA 1PD21 5GSSA 3QCPA 3BCKA 3BD2A 4IELA 2H30A 1TK0B 1SKWB 4ZBBA 4PQIA 3FRCA 4TN8A 5A5KA 2WULA 2OA7A 3LYKA 2VCVA 5ELAA 4FH8A 4MCUA 1DE2A 4PXOA 3GV1A 3FK8A 3UL3A 3FZ4A 5J41A 5IMVA 2NDOA 4O7HA 3HYPA 1JZRA 4IJ3A 6GSUA 3IK7A 1M0UA 4I5QA 3VPQA 2JACA 3TKRA 4K2XA 4KUNA 3NIVA 5ECPB 2HRKA 3KMNA 1LBKA 1M2BA 5J5NA 2I4AA 1XPVA 5D8IA 1FW1A 4EXJA 4QL7A 1PKZA 3UBLA 1HNCA 5CRHA 3UJ1A 2A4VA 4TR1A 13GSA 1PL2A 1ZYNA 5DBQA 4KX4A 1Z6NA 2WB9A 1A23A 4NV2A 3VWVA 1TI1A 2L57A 1SYRA 5ECKB 4TW5A 3Q19A 1BAYA 3HJOA 5KN2A 4O5UA 2N5FA 5CNWA 2GQLA 2VIMA 1W89A 4JR6A 4XS1A 1A24A 3LGCA 4FYUA 4K2DA 3MYDA 4HSCX 3O3TA 3KD0A 1ZZYA 3BBYA 3E3EA 4PUFC 1EGOA 1F2EA 3ZVJD 1OAZA 3TRPA 4YQUA 3WGEA 1QGVA 3GKMA 3F3QA 3LQ7A 2H74A 3IPZA 3LXZA 4MP4A 4HQSA 3TJKA 3IC8A 2YCDA 3FW2A 4I6XA 4LL1B 2O8VB 3GNJA 1BYEA 5G2ZA 2HNLA 1LU4A 1I9DA 5L71A 4OCEA 4MZBA 3EC3A 2WFCA 4J2FA 1TXXA 2YWNA 3H8QA 4PNFA 2CX3A 2TIRA 2C3TA 4CY6A 1ACVA 5KOXA 2KHPA 2LSTA 3KTBA 3D4MA 3GSTA 4J57E 3QOUA 3RPNA 5ECIB 1EWXA 2HSMA 2GSTA 2OACA 2C1YA 4HI7A 4CHSA 5ECRB 3LG6A 1VRSD 5JWOB 4CDOA 1O73A 2FUG2 5CRDA 4L0UA 4RQXA 1URMA 1EP8A 2LNSA 2GQMA 3GX8A 1DSBA 1GSFA 2OE3A 2C3QA 2PWJA 2FWEA 5CREA 2FCHA 5CO3A 2B6MA 2EIQA 2JZRA 2M72A 2IFQB 2P5QA 1YEXA 2B7JA 1SK2A 3TJGA 1QK8A 4WBJA 4ZB6A 3DWVA 2ZUPA 5B6NA 1U6TA 5DALA 2L4QA 1KEBA 3KGKA 4DSSB 3DD3A 1GULA 3U6VA 1ML6A 4WF4A 4MNNA 4AJ6A 3ZITA 2XBQA 5G31A 1X0RA 4IQAA 1GH2A 2VUPA 3EU3A 1O81A 2WGRA 2IIYA 2YOIA 1EOGA 1VF2A 2DJ2A 4Z2TA 2CVKA 4X0XA 3WT1A 3MDKA 3QAVA 3F0IA 4NPBA 4P3YB 1RW1A 2HLSA 4NHZA 5EL8A 3I69A 2TRXA 1XOAA 1ON4A 4TKYA 4IP6A 5G5FA 1SJIA 4EC0A 3PPUA 4V2MA 2DLXA 4MPGA 2LV3A 3ZFLA 1A2LA 4POMA 4Z7XA 4HZ4A 4KSMA 3QAWA 5JWRB 3UIWA 1JLWA 2CZ3A 1TRWA 2VOCA 2F51A 2REMA 1YEPA 1MDJA 2VL3A 2PBJA 5J9CA 4Q5RA 5D9VA 1R7HA 3C1SA 1PMTA 1TRSA 4L5OA 4YAVA 1T00A 2DKHA 2MMNA 4G0LA 3TB2A 1K0MA 3VWXA 3EU4A 4ILFA 4X43A 4F03A 3MWHA 3FR9A 5EVOA 2H73A 3EMPA
chains in the Genus database with same CATH topology
5D9TA 3FR6A 3Q74A 3CYNA 5ENUA 3GMFA 2IMDA 3HDCA 1LJRA 2KP2A 2AUVA 2QA2A 3IOSA 3D5JA 2BMXA 3D22A 5ECMB 4V1Ag 2H8LA 3GIXA 5HR0A 3FR3A 3HVXA 1AQXA 2L6DA 4LLRA 2FGXA 3NOFA 3M9JA 2GGTA 2QA1A 3ZMKA 5AISA 1OYJA 1V57A 4AGSA 4BL7A 2IN3A 2YANA 3TOTA 4EDYA 4TVEA 3QDNA 1M2DA 4FQUA 4F82A 1XZOA 2PPTA 3W6GA 1JFUA 3A2VA 2NBSA 1W4VA 2IMIA 3APOA 1EZKA 3RPPA 1GL8A 2K18A 2R5GA 3UOMA 18GSA 4IS0A 5COHA 1EV4A 4O5RA 1WWJA 3GTUB 5HFKA 4K8MA 2UZ8A 2ZCTA 2PGTA 1FOVA 3IC4A 3V1WA 1XW6A 2A2PA 1GNWA 3CBUA 2NTOA 5J3RA 2OADA 4ECCA 3MNGA 2H0GA 3WGDA 3R3EA 4POBA 4DSQA 1T8EB 3TKQA 2VCQA 1PGTA 3LFLA 3ED3A 5BRTA 2H1AA 1TJDA 2PUKC 3CSJA 2DBCA 6GSTA 5AN1A 1U3AA 3QR6A 1WIKA 4USSA 6GSVA 1E2YA 1XWCA 4N30A 2JZTA 2DMMA 1B9XC 4HS1A 5E4WA 2H01A 4PUAA 3LXTA 1U3IA 3HY2A 4PGTA 4TR4A 2O85A 5IMAA 2HRFA 4GSTA 5HR3A 1T4ZA 3F6FA 2DJKA 4GTUA 4K5SA 3TRQA 2GSRA 5FWGA 1ERTA 3A3TA 5JCWA 1X5CA 2HSHA 3G7YA 2P0GA 3C1RA 4WKWA 4I8BA 1XWBA 3KXOA 1Z7PA 3ZL5A 4MJBA 5A4UA 2GS3A 1Q98A 5DDLA 4OO5A 3Q6OA 3GL3A 2OE0A 3KIJA 4DEJA 3GKNA 3HD5A 1FOHA 2H6YA 4K7OA 2IFQA 3D0ZA 2FY6A 2VLVA 4TXOB 1AXDA 2HZFA 3DMLA 3GHAA 4JRRA 3TJBA 2LUSA 3S9FA 3G7JA 2A2SA 1TRVA 4ZL9A 4V2NA 5GAPD 4AF2A 3IHQA 2FNOA 2IMEA 3Q18A 3ISOA 3LYPA 2MYGA 4MPFA 4OO4A 4X1UA 5ID2B 4DSSA 4AJ8A 4WXTA 1GSDA 1ERVA 4GRFA 1M9AA 2CV4A 5F0GA 2I81A 4HU7A 2B1LA 1YKAA 2FD3A 2FLSA 1GLQA 3O76A 1F9MA 2C80A 2DKIA 4ECIA 5ECSA 5ELGA 4IGJA 3DRNA 1U87A 2X8GA 2MMOA 4RI7A 1A8YA 5DJMA 5LNKe 2CQ9A 4AJ7A 3BCIA 3GA4A 2B1KA 1A2JA 1G6WA 2GQKA 1FHEA 1XVWA 2GT6A 3ERWA 2C8UA 5HR1A 3WD6A 1GUKA 5HR2A 3HJPA 4IBPA 3LJRA 2G0FA 6GSWA 2O89A 2PU9C 1ERWA 1FAAA 4LMVA 4RUVA 8GSSA 4OFMA 1GSEA 3TOUA 3CTFA 1DUGA 4MMMA 1PA3A 2GTUA 3TKSE 2JSYA 1HD2A 4ZBAA 3SBCA 5HFGA 3UARA 4PQ1A 3EPTA 2FHEA 5DAKB 1QQ2A 3IAM2 2MMAA 1XVQA 1ZYEA 1GRXA 1X5EA 4F0CA 1NM3A 1SL2B 4ZXGA 3FMWA 1OKTA 1GUMA 2R37A 1SL1B 3DKSA 2LQOA 3F4SA 2H0HA 3MIXA 2DJJA 1M9BA 1AIUA 2J23A 2V6OA 3EE2A 4BVXB 2IJYA 2VM2A 3GKXA 3EYTA 3HZ8A 2AYTA 4OCFA 2J9HA 2RUFA 1O85A 4HU9A 5GAND 3CXGA 2A2RA 4IQ1A 1AQVA 3ZIVA 1GSQA 1WPIA 5E59A 1H75A 4K1FA 4MF6A 5IMCA 4I97A 1KBNA 2YNXA 5D93A 2OJLA 3HA9A 3DIEA 4RQRA 1T4YA 5IO2A 2YJ7A 1R5PA 4OFTA 3GX0A 3FHKA 6GSYA 2YP6A 4LMWA 1A8LA 2LRNA 5LCZA 4PURA 2XHFA 2M46A 4ZBDA 3HXSA 2X49A 2GSQA 1K0AA 3GTUA 1KTEA 2LNTA 3PR8A 5HFIA 3GL5A 3DVXA 3IAS2 2DMLA 4MJCA 1K3OA 2E7PA 2WZ9A 2QGVA 2ON7A 3TRXA 3HJMA 4XCSA 4GWRA 4EVMA 4BWQA 3A2WA 1N2AA 5J4UA 1OC3A 3I43A 2KLXA 2O87A 4FYCA 5A4VA 2F9SA 2XPDA 2AHEA 1HYUA 4HQZA 2I1UA 1TTZA 1Y6EA 2WRTA 3C8EA 1GP1A 2HYXA 4ML6A 4N0ZA 5KN0A 4F9ZA 4DVCA 1UA5A 3LWAA 5CAXA 3TKSA 5ECHB 1ZYQB 5J9BA 1YKCA 1QMVA 2VM1A 2E2GA 1WRYA 1Z5YE 2VCWA 2X8CA 1A0RP 4E8EA 3D21A 1EEJA 2JADA 2DJ1A 3VI7A 4K9ZA 3W8SA 1B48A 3EURA 1YF0A 1K0DA 1M2AA 3FEUA 2E2MA 5IQYA 3GSSA 4V1Ap 4X4JA 1YY7A 2I3YA 2DIYA 1TRUA 1GNEA 5ABRA 2EIOA 2HZEB 3APSA 3D6IA 2F3MA 1TK8B 2VAFA 5B7CA 1ST9A 3BJ5A 2VO4A 2H1BA 2WCIA 4NV5A 5DQSA 4CW9A 3P90A 5EY6A 3W8JA 1M7TA 5EPFA 4JBBA 3G9BA 3WGXA 3KEBA 1VGLA 1GTIA 1TOFA 4TR3A 4ZB8A 3M8NA 4YAPA 2WS2A 4GSSA 1UC7A 1OC9B 4BPYA 5IMZA 2IMKA 1GTUA 5IIZA 1PL1A 4BWSA 3C7MA 1OC8A 2GSSA 5H5RA 3IHGA 4KCAA 3F6DA 2C3NA 5ID2A 2MBTA 4PTSA 1PX7A 4JR4A 2XC2A 1ILOA 3H79A 4I2TA 1YF1A 2CA8A 5D9XA 1KNGA 1B4PA 2LS5A 4EE0A 4BVYB 3R2QA 4WBRD 4ZL7A 4OMVA 1Z9HA 2YWIA 3EINA 1C72A 3GRXA 7GSSA 1K3LA 4PX1A 3CTGA 1GTBA 4J56E 2RLIA 3QPMA 3VI5A 3KH9A 2CVDA 2LKUA 2VLUA 1JLVA 1S3AA 2EC4A 4HEA2 4PQHA 4ECJA 4ULXA 2DIZA 2CVBA 3F63A 2YN1A 1J9BA 5IOWA 2IPAA 2N5AA 4GXZA 1TU8A 5B6MA 1FB6A 1V2AA 5DAKA 3HVSA 1USBA 1RK4A 2YV9A 4MF7A 1NHYA 5JCGA 4G0IA 4EIQA 3GH6A 22GSA 3VLNA 4ECBA 1WE0A 2HT9A 1K0BA 4LL4B 3GKKA 3UVTA 1G6YA 1VF4A 3WT2A 1O8WA 1OE7A 1EEMA 5ECQB 4BVXA 3F3RA 3P7XA 3AY8A 2GT5A 2K8SA 4A5PA 4YKGA 5B8BA 4TR0A 4WR5A 1MDKA 2FWGA 11GSA 4IN0A 4OD7A 3IR4A 4IKHA 1Z7RA 2VCXA 2HRAA 3ZREA 1ZCPA 2C0DA 1BG5A 1THOA 4K7IA 4NXIA 2JZSA 3UVHA 1EOHA 1BQ7A 4Q5FA 5G1LA 2B5XA 4HJMA 3K8NA 4Z2RA 1FO5A 3F4RA 4G2EA 4Q5QA 3ZFBA 3ME7A 4ZILA 4XTSA 2B5YA 1S3DA 1SYXA 4IJIA 2OKAA 1GUHA 1R5AA 1XWGA 17GSA 1TDIA 3IBHA 4EO3A 3IV4A 4L0WA 1THXA 4E8HA 3VWWA 1XFLA 2F8AA 3M1GA 5F8BA 5CP1A 3GUSA 1HNAA 3KP9A 1O6JA 4RI6A 4YH2A 1DBYA 4KB3A 19GSA 3L0HA 2GZZA 2AV4A 4MK3A 4WETA 4IP1A 3ZLPA 2X8HA 1QFNA 2C0GA 1K3YA 3TJJA 3UBKA 1Q4JA 4O92A 2H75A 2R0CA 4FO5A 1O8XA 4BA7A 2D2ZA 4KDXA 2IWTA 2VCTA 5CYYA 2GVPA 1TU7A 3ERGA 3M0FA 1SL0B 5CRGA 4D73B 3H4KA 2MZCA 2LEGA 3GYKA 2F8FA 3EMXA 2AJQB 3RAZA 2CX4A 3ZZXA 4HDEA 1IYIA 5HQPA 4KCEA 4HOJA 3QD9A 2HZEA 4MH3A 3TKSC 2L5LA 4EUYA 3ZIJA 2H72A 3IDVA 4MJEA 1SD8A 2I9HA 4XS4B 2RIIA 3LEFA 3ZYWA 1SD9A 3VPTA 1PN0A 3MAKA 1PN9A 3HZ4A 1ZGNA 4ISDA 4G0KA 2CAQA 4KH7A 2RUEA 2HFDA 2RM6A 4DSRA 2GLRA 2IL3A 1OC9A 3SWLA 3TJFA 3FKFA 4TXVA 5F07A 1B8XA 1VF3A 3A2XA 3IRAA 2H1DA 4Q5NA 3KTLA 4GQFA 2HXKA 3HHVA 3UEMA 3CRTA 2BJXA 5GSTA 4H86A 1UVZA 4BVYA 4LA1A 2V6KA 2ES7A 2HI7A 1T3BA 4ML1A 3PINA 4KAEA 4ACSA 1ZL9A 5IMFA 2JL4A 2KP1A 3PH9A 2MBSA 1K0CA 2V32A 5C04A 4ZIJA 1TK5B 2M80A 1EP7A 3H93A 2WDUA 3L9SA 3LW9A 3TKPA 2OBKA 1TP9A 3A5WA 4K6XA 1G0TA 3UAPA 5IM9A 1BJXA 3I9V2 1XOBA 1TW9A 2FA4A 1E6BA 2R6KA 4HJ2A 1JZOA 1MTCA 2K8VA 1MD3A 2YWOA 2LTKA 5DJLA 3KJYA 3EWLA 3HVVA 5DCGA 4KSOA 4XRAA 1R26A 1EGRA 2VD0A 2ZNMA 4L8EA 1OKDA 2O7KA 4N0VA 2DSAA 2LJRA 5D9WA 1GSUA 4XIHA 2IMFA 1S3CA 1TKDB 4GSNA 5H5QA 2VL2A 3QFAC 5H5SA 2E0QA 1H4OA 1YDKA 2GZPA 2HSYA 4GQCA 5FHIA 1SJ6A 1Z3EA 2H66A 5FT3A 3HCZA 4EL1A 3ZTLA 1XBSA 3D4TA 2CAIA 4BL7B 4FIWA 3KMOA 3FZ5A 3QMXA 1HNBA 2B3SA 1WP0A 2N5BA 3VK9A 1PSQA 2C0EA 3TCOA 3KM6A 2R3XA 2FWHA 1BX9A 4HUAA 1QXHA 4IHUA 2GZYA 3EVIA 9GSSA 3J7Yk 3RDWA 1I5GA 3TGZA 4EIPA 4WF5A 5DQYA 1QUWA 2KUCA 3E0UA 2NPBA 2FA8A 1GSSA 2PVOC 3ERFA 5JCUA 2Z9SA 5F06A 2K9FA 1AW9A 4WR4A 1X9MB 2JSZA 3VURA 3LORA 5JWQB 3P8WA 1FG4A 1G7EA 2H1GA 2VL9A 2PVQA 2P5RA 4XRDA 5GZZB 4MDCA 4OFNA 2AB6A 14GSA 1VF1A 4MH2A 3TUEA 3ZVJA 3CMIA 3KH7A 2PN8A 2XPEA 3LSZA 3ZRDA 1FB0A 4KGIA 3L9VA 1AAZA 2DJ3A 1R4WA 3F8UA 2YPMA 3WYWA 2H19A 1CQGA 2L4CA 1XW9A 4G19A 1ZYPA 3G7IA 4D73A 5IPGA 3J7Yb 1K0NA 1UN2A 1GLPA 1RQMA 2C0FA 6GSXA 2R0PA 2LRCA 2LJAA 2H6ZA 1X5DA 1YJ6A 1F6MC 4TXOA 12GSA 2C4JA 2YV7A 4ZB9A 2P31A 4EF0A 3M3MA 4KDUA 4XS4A 4ZL8A 4G10A 5ECLB 1XW5A 4POKA 3GFKA 4WEYA 3CRUA 2GDRA 4POLA 2ON5A 1V98A 2LQQA 4YQVA 1F3AA 4GLTA 2V2GA 1TI3A 3KP8A 4CY8A 4L5LA 3C71A 2X4AA 3FY7A 3FYGA 2V41A 5C00A 2LJKA 20GSA 1PX6A 3DVWA 2L6CA 1DE1A 4MZWA 5G30A 5KEJA 3H1NA 2X99A 2VLTA 4MA9A 3L4NA 1F37A 2JU5A 3F4TA 4O32A 3IK9A 1U88A 3RHBA 2H70A 4JE1A 1F3BA 5IOXA 1SENA 2VCZA 4KE3A 2H0IA 1Z6MA 2H76A 2OBIA 3P2AA 1ZMAA 1FVKA 1XIYA 1JHBA 4G9HA 5KOWA 5IPHA 5G1KA 1T1VA 5KN1A 2MMZA 1ERUA 1PRXA 3BOAA 4IW9A 2TRCP 1IYHA 1MDIA 1PKWA 5AIXA 6GSSA 2YZHA 4K0NA 1N8JA 1MEKA 1XWAA 4GF0A 3U5RE 5BMUA 2XBIA 4K0GA 5KN3A 1SKRB 5LD0A 3N9JA 4TR1B 1SKSB 4XS6A 16GSA 1ABAA 4KF9A 3TDGA 1ZOFA 3DXBA 2R4VA 2YWMA 2RM5A 4EKZA 1AUCA 2LRTA 2QSIA 2DC5A 3C73A 3M9KA 2PMTA 3KCMA 2HRNA 4MZCA 3CSHA 4N11A 2KOKA 1NHOA 2NVLA 1X9SB 4N10A 3ME8A 4QL9A 1O7UA 1A0FA 4NMUA 2VD1A 2H71A 2K6VA 2X64A 4Z2UA 3L78A 5IO0A 1V40A 4EDZA 2AAWA 1J08A 4ICYA 4F2IA 1CQHA 1HQOA 4OWYA 5G5EA 3N5OA 4KNDA 2G2QA 3ZMLA 4K7NA 2VL2C 3VWUA 3A5IA 4JZQA 4YQMA 5INYA 3RBTA 4JU5A 2HE3A 3IXRA 5DCHA 4IVFA 1T7PB 5ECOB 3OR5A 4NWYA 2YJHA 1YZXA 1GTAA 2QKEA 4PNGA 4KW6A 3CSIA 5CRWA 3QFBC 3DGQA 2B5EA 3L9UA 2B7KA 2H6XA 1A2MA 3VFIA 5AGYA 4MABA 1M99A 3I6AA 1GWCA 2ALBA 3QAGA 3F9UA 3DEXA 3FZ9A 3NZNA 2L59A 1YQ1A 3HKRA 1OE8A 4MJAA 2A4HA 10GSA 2YZUA 4NAXA 3GH9A 3O6TA 3GURA 3IE3A 3DYRA 4TRXA 1GSYA 4KDYA 2DJ0A 4JEDA 1OVNA 3JCML 3UMAA 1NSWA 1JZWA 5ECNB 1V9WA 1WJKA 1Y25A 3PGTA 4ID0A 4NHWA 1JZDA 2CZ2A 2EIRA 1SJZA 3MSZA 1XXUA 2CT6A 1B4QA 1X9WB 2V1MA 1XWKA 3FZAA 3KZQA 1AQWA 4GCIA 4QQ7A 5DALB 2QC7A 4KA0A 1B9YC 3US3A 3IA1A 4XHMA 2WJUA 3APQA 5D73A 4K5RA 1WMJA 3GN3A 4F0BA 1MD4A 4YKFA 1WOUA 2PERA 1G7OA 4I2UA 4MLYA 5D96A 2L5OA 1PQNA 1K0OA 1J0FA 3RHCA 4MF5A 2R2JA 5IMDA 1AC1A 5F05A 1XCCA 4FYBA 3E9JB 4HZ2A 4V2LA 5B8AA 2R0GA 1NW2A 1SK1A 1V58A 2FWFA 2OE1A 1BEDA 5AIVA 1SU9A 5DVBA 4O5QA 1SK0A 2BTOT 4TOPA 1EV9A 1FVJA 5A4WA 1PD21 5GSSA 3QCPA 3BCKA 3BD2A 4IELA 2H30A 1TK0B 1SKWB 4ZBBA 4PQIA 3FRCA 4TN8A 5A5KA 2WULA 2OA7A 3LYKA 2VCVA 5ELAA 4FH8A 4MCUA 1DE2A 4PXOA 3GV1A 3FK8A 3UL3A 3FZ4A 5J41A 5IMVA 2NDOA 4O7HA 3HYPA 1JZRA 4IJ3A 6GSUA 3IK7A 1M0UA 4I5QA 3VPQA 2JACA 3TKRA 4K2XA 4KUNA 3NIVA 5ECPB 2HRKA 3KMNA 1LBKA 1M2BA 5J5NA 2I4AA 1XPVA 5D8IA 1FW1A 4EXJA 4QL7A 1PKZA 3UBLA 1HNCA 5CRHA 3UJ1A 2A4VA 4TR1A 13GSA 1PL2A 1ZYNA 5DBQA 4KX4A 1Z6NA 2WB9A 1A23A 4NV2A 3VWVA 1TI1A 2L57A 1SYRA 5ECKB 4TW5A 3Q19A 1BAYA 3HJOA 5KN2A 4O5UA 2N5FA 5CNWA 2GQLA 2VIMA 1W89A 4JR6A 4XS1A 1A24A 3LGCA 4FYUA 4K2DA 3MYDA 3O3TA 3KD0A 1ZZYA 3BBYA 3E3EA 4PUFC 1EGOA 1F2EA 3ZVJD 1OAZA 3TRPA 4YQUA 3WGEA 1QGVA 3GKMA 3F3QA 3LQ7A 2H74A 3IPZA 3LXZA 4MP4A 4HQSA 3TJKA 3IC8A 2YCDA 3FW2A 4I6XA 4LL1B 2O8VB 3GNJA 1BYEA 5G2ZA 2HNLA 1LU4A 1I9DA 5L71A 4OCEA 4MZBA 3EC3A 2WFCA 4J2FA 1TXXA 2YWNA 3H8QA 4PNFA 2CX3A 2TIRA 2C3TA 4CY6A 1ACVA 5KOXA 2KHPA 2LSTA 3KTBA 3D4MA 3GSTA 4J57E 3QOUA 3RPNA 5ECIB 1EWXA 2HSMA 2GSTA 2OACA 2C1YA 4HI7A 4CHSA 5ECRB 3LG6A 1VRSD 5JWOB 4CDOA 1O73A 2FUG2 5CRDA 4L0UA 4RQXA 1URMA 1EP8A 2LNSA 2GQMA 3GX8A 1DSBA 1GSFA 2OE3A 2C3QA 2PWJA 2FWEA 5CREA 2FCHA 5CO3A 2B6MA 2EIQA 2JZRA 2M72A 2IFQB 2P5QA 1YEXA 2B7JA 1SK2A 3TJGA 1QK8A 4WBJA 4ZB6A 3DWVA 2ZUPA 5B6NA 1U6TA 5DALA 2L4QA 1KEBA 3KGKA 4DSSB 3DD3A 1GULA 3U6VA 1ML6A 4WF4A 4MNNA 4AJ6A 3ZITA 2XBQA 5G31A 1X0RA 4IQAA 1GH2A 2VUPA 3EU3A 1O81A 2WGRA 2IIYA 2YOIA 1EOGA 1VF2A 2DJ2A 4Z2TA 2CVKA 4X0XA 3WT1A 3MDKA 3QAVA 3F0IA 4NPBA 4P3YB 1RW1A 2HLSA 4NHZA 5EL8A 3I69A 2TRXA 1XOAA 1ON4A 4TKYA 4IP6A 5G5FA 1SJIA 4EC0A 3PPUA 4V2MA 2DLXA 4MPGA 2LV3A 3ZFLA 1A2LA 4POMA 4Z7XA 4HZ4A 4KSMA 3QAWA 5JWRB 3UIWA 1JLWA 2CZ3A 1TRWA 2VOCA 2F51A 2REMA 1YEPA 1MDJA 2VL3A 2PBJA 5J9CA 4Q5RA 5D9VA 1R7HA 3C1SA 1PMTA 1TRSA 4L5OA 4YAVA 1T00A 2DKHA 2MMNA 4G0LA 3TB2A 1K0MA 3VWXA 3EU4A 4ILFA 4X43A 4F03A 3MWHA 3FR9A 5EVOA 2H73A 3EMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D9T A;  3FR6 A;  3Q74 A;  3CYN A;  5ENU A;  3GMF A;  2IMD A;  3HDC A;  1LJR A;  2KP2 A;  2AUV A;  3IOS A;  3D5J A;  2BMX A;  3D22 A;  5ECM B;  4V1A g;  2H8L A;  3GIX A;  5HR0 A;  3FR3 A;  3HVX A;  1AQX A;  2L6D A;  4LLR A;  2FGX A;  3NOF A;  3M9J A;  2GGT A;  3ZMK A;  5AIS A;  1OYJ A;  1V57 A;  4AGS A;  4BL7 A;  2IN3 A;  2YAN A;  3TOT A;  4EDY A;  4TVE A;  3QDN A;  1M2D A;  4F82 A;  1XZO A;  2PPT A;  3W6G A;  1JFU A;  3A2V A;  2NBS A;  1W4V A;  2IMI A;  3APO A;  1EZK A;  3RPP A;  1GL8 A;  2K18 A;  2R5G A;  3UOM A;  18GS A;  4IS0 A;  5COH A;  1EV4 A;  4O5R A;  1WWJ A;  3GTU B;  5HFK A;  4K8M A;  2ZCT A;  2PGT A;  1FOV A;  3IC4 A;  3V1W A;  1XW6 A;  3CBU A;  1GNW A;  2NTO A;  5J3R A;  2OAD A;  4ECC A;  3MNG A;  2H0G A;  3WGD A;  4POB A;  4DSQ A;  1T8E B;  3TKQ A;  2VCQ A;  1PGT A;  3LFL A;  3ED3 A;  2H1A A;  1TJD A;  2PUK C;  3CSJ A;  2DBC A;  6GST A;  5AN1 A;  1U3A A;  3QR6 A;  1WIK A;  6GSV A;  1E2Y A;  1XWC A;  4N30 A;  2JZT A;  2DMM A;  1B9X C;  4HS1 A;  5E4W A;  2H01 A;  4PUA A;  3LXT A;  1U3I A;  3HY2 A;  4PGT A;  4TR4 A;  2O85 A;  5IMA A;  2HRF A;  4GST A;  5HR3 A;  1T4Z A;  3F6F A;  2DJK A;  4GTU A;  3TRQ A;  2GSR A;  5FWG A;  1ERT A;  3A3T A;  5JCW A;  1X5C A;  2HSH A;  3G7Y A;  2P0G A;  3C1R A;  4WKW A;  4I8B A;  1XWB A;  3KXO A;  1Z7P A;  3ZL5 A;  4MJB A;  5A4U A;  2GS3 A;  1Q98 A;  5DDL A;  4OO5 A;  3Q6O A;  3GL3 A;  2OE0 A;  3KIJ A;  4DEJ A;  3GKN A;  3HD5 A;  2H6Y A;  4K7O A;  2IFQ A;  3D0Z A;  2FY6 A;  2VLV A;  4TXO B;  1AXD A;  2HZF A;  3DML A;  3GHA A;  4JRR A;  3TJB A;  2LUS A;  3S9F A;  3G7J A;  2A2S A;  1TRV A;  4ZL9 A;  4V2N A;  5GAP D;  4AF2 A;  3IHQ A;  2FNO A;  2IME A;  3Q18 A;  3ISO A;  3LYP A;  2MYG A;  4MPF A;  4OO4 A;  4X1U A;  5ID2 B;  4DSS A;  4AJ8 A;  4WXT A;  1GSD A;  1ERV A;  4GRF A;  1M9A A;  2CV4 A;  5F0G A;  2I81 A;  4HU7 A;  2B1L A;  1YKA A;  2FD3 A;  2FLS A;  1GLQ A;  3O76 A;  1F9M A;  2C80 A;  4ECI A;  5ECS A;  5ELG A;  4IGJ A;  3DRN A;  1U87 A;  2X8G A;  2MMO A;  4RI7 A;  1A8Y A;  5DJM A;  5LNK e;  2CQ9 A;  4AJ7 A;  3BCI A;  3GA4 A;  2B1K A;  1A2J A;  1G6W A;  2GQK A;  1FHE A;  1XVW A;  2GT6 A;  3ERW A;  2C8U A;  5HR1 A;  3WD6 A;  1GUK A;  5HR2 A;  3HJP A;  4IBP A;  3LJR A;  2G0F A;  6GSW A;  2O89 A;  2PU9 C;  1ERW A;  1FAA A;  4LMV A;  4RUV A;  8GSS A;  4OFM A;  1GSE A;  3TOU A;  3CTF A;  1DUG A;  4MMM A;  1PA3 A;  2GTU A;  3TKS E;  2JSY A;  1HD2 A;  4ZBA A;  3SBC A;  5HFG A;  3UAR A;  4PQ1 A;  2FHE A;  5DAK B;  1QQ2 A;  3IAM 2;  2MMA A;  1XVQ A;  1ZYE A;  1GRX A;  1X5E A;  4F0C A;  1NM3 A;  1SL2 B;  4ZXG A;  1OKT A;  1GUM A;  2R37 A;  1SL1 B;  3DKS A;  2LQO A;  3F4S A;  2H0H A;  2DJJ A;  1M9B A;  1AIU A;  2J23 A;  2V6O A;  3EE2 A;  2IJY A;  2VM2 A;  3GKX A;  3EYT A;  3HZ8 A;  2AYT A;  4OCF A;  2J9H A;  2RUF A;  1O85 A;  4HU9 A;  5GAN D;  3CXG A;  2A2R A;  4IQ1 A;  1AQV A;  3ZIV A;  1GSQ A;  1WPI A;  5E59 A;  1H75 A;  4K1F A;  4MF6 A;  5IMC A;  4I97 A;  1KBN A;  2YNX A;  5D93 A;  2OJL A;  3HA9 A;  3DIE A;  4RQR A;  1T4Y A;  5IO2 A;  2YJ7 A;  1R5P A;  4OFT A;  3GX0 A;  3FHK A;  6GSY A;  2YP6 A;  4LMW A;  1A8L A;  2LRN A;  5LCZ A;  4PUR A;  2XHF A;  2M46 A;  4ZBD A;  3HXS A;  2GSQ A;  1K0A A;  3GTU A;  1KTE A;  2LNT A;  3PR8 A;  5HFI A;  3GL5 A;  3DVX A;  3IAS 2;  2DML A;  4MJC A;  1K3O A;  2E7P A;  2WZ9 A;  2QGV A;  2ON7 A;  3TRX A;  3HJM A;  4XCS A;  4GWR A;  4EVM A;  4BWQ A;  3A2W A;  1N2A A;  5J4U A;  1OC3 A;  3I43 A;  2KLX A;  2O87 A;  4FYC A;  5A4V A;  2F9S A;  2XPD A;  2AHE A;  1HYU A;  4HQZ A;  2I1U A;  1TTZ A;  1Y6E A;  2WRT A;  3C8E A;  1GP1 A;  2HYX A;  4ML6 A;  4N0Z A;  5KN0 A;  4F9Z A;  4DVC A;  1UA5 A;  3LWA A;  5CAX A;  3TKS A;  5ECH B;  1ZYQ B;  5J9B A;  1YKC A;  1QMV A;  2VM1 A;  2E2G A;  1WRY A;  1Z5Y E;  2VCW A;  2X8C A;  1A0R P;  4E8E A;  3D21 A;  1EEJ A;  2JAD A;  2DJ1 A;  3VI7 A;  4K9Z A;  3W8S A;  1B48 A;  3EUR A;  1YF0 A;  1K0D A;  1M2A A;  3FEU A;  2E2M A;  5IQY A;  3GSS A;  4V1A p;  1YY7 A;  2I3Y A;  2DIY A;  1TRU A;  1GNE A;  5ABR A;  2EIO A;  2HZE B;  3APS A;  3D6I A;  2F3M A;  1TK8 B;  2VAF A;  5B7C A;  1ST9 A;  3BJ5 A;  2VO4 A;  2H1B A;  2WCI A;  4NV5 A;  5DQS A;  4CW9 A;  3P90 A;  5EY6 A;  3W8J A;  1M7T A;  5EPF A;  4JBB A;  3G9B A;  3WGX A;  3KEB A;  1VGL A;  1GTI A;  1TOF A;  4TR3 A;  4ZB8 A;  3M8N A;  4YAP A;  2WS2 A;  4GSS A;  1UC7 A;  1OC9 B;  4BPY A;  5IMZ A;  2IMK A;  1GTU A;  5IIZ A;  1PL1 A;  4BWS A;  3C7M A;  1OC8 A;  2GSS A;  5H5R A;  4KCA A;  3F6D A;  2C3N A;  5ID2 A;  2MBT A;  1PX7 A;  4JR4 A;  2XC2 A;  1ILO A;  3H79 A;  4I2T A;  1YF1 A;  2CA8 A;  5D9X A;  1KNG A;  1B4P A;  2LS5 A;  4EE0 A;  3R2Q A;  4WBR D;  4ZL7 A;  4OMV A;  1Z9H A;  2YWI A;  3EIN A;  1C72 A;  3GRX A;  7GSS A;  1K3L A;  4PX1 A;  3CTG A;  1GTB A;  4J56 E;  2RLI A;  3QPM A;  3VI5 A;  3KH9 A;  2CVD A;  2LKU A;  2VLU A;  1JLV A;  1S3A A;  2EC4 A;  4HEA 2;  4PQH A;  4ECJ A;  4ULX A;  2DIZ A;  2CVB A;  3F63 A;  2YN1 A;  1J9B A;  5IOW A;  2IPA A;  2N5A A;  4GXZ A;  1TU8 A;  5B6M A;  1FB6 A;  1V2A A;  5DAK A;  3HVS A;  1USB A;  1RK4 A;  2YV9 A;  4MF7 A;  1NHY A;  5JCG A;  3GH6 A;  22GS A;  3VLN A;  4ECB A;  1WE0 A;  2HT9 A;  1K0B A;  4LL4 B;  3GKK A;  3UVT A;  1G6Y A;  1VF4 A;  3WT2 A;  1O8W A;  1OE7 A;  1EEM A;  5ECQ B;  4BVX A;  3F3R A;  3P7X A;  3AY8 A;  2GT5 A;  2K8S A;  5B8B A;  4TR0 A;  4WR5 A;  1MDK A;  2FWG A;  11GS A;  4IN0 A;  4OD7 A;  3IR4 A;  4IKH A;  1Z7R A;  2VCX A;  3ZRE A;  1ZCP A;  2C0D A;  1BG5 A;  1THO A;  4K7I A;  4NXI A;  2JZS A;  3UVH A;  1EOH A;  1BQ7 A;  4Q5F A;  5G1L A;  2B5X A;  4HJM A;  3K8N A;  1FO5 A;  3F4R A;  4G2E A;  4Q5Q A;  3ZFB A;  3ME7 A;  4ZIL A;  4XTS A;  2B5Y A;  1S3D A;  1SYX A;  4IJI A;  2OKA A;  1GUH A;  1R5A A;  1XWG A;  17GS A;  1TDI A;  3IBH A;  4EO3 A;  3IV4 A;  4L0W A;  1THX A;  4E8H A;  3VWW A;  1XFL A;  2F8A A;  3M1G A;  5F8B A;  5CP1 A;  3GUS A;  1HNA A;  3KP9 A;  1O6J A;  4RI6 A;  4YH2 A;  1DBY A;  4KB3 A;  19GS A;  3L0H A;  2GZZ A;  2AV4 A;  4MK3 A;  4WET A;  4IP1 A;  3ZLP A;  2X8H A;  1QFN A;  2C0G A;  1K3Y A;  3TJJ A;  3UBK A;  1Q4J A;  4O92 A;  2H75 A;  4FO5 A;  1O8X A;  4BA7 A;  2D2Z A;  4KDX A;  2IWT A;  2VCT A;  5CYY A;  2GVP A;  1TU7 A;  3ERG A;  3M0F A;  1SL0 B;  5CRG A;  4D73 B;  3H4K A;  2MZC A;  2LEG A;  3GYK A;  2F8F A;  3EMX A;  2AJQ B;  3RAZ A;  2CX4 A;  3ZZX A;  4HDE A;  1IYI A;  5HQP A;  4KCE A;  4HOJ A;  3QD9 A;  2HZE A;  4MH3 A;  3TKS C;  2L5L A;  4EUY A;  3ZIJ A;  2H72 A;  3IDV A;  4MJE A;  1SD8 A;  2I9H A;  4XS4 B;  2RII A;  3LEF A;  3ZYW A;  1SD9 A;  3VPT A;  3MAK A;  1PN9 A;  3HZ4 A;  1ZGN A;  4ISD A;  2CAQ A;  4KH7 A;  2RUE A;  2HFD A;  2RM6 A;  4DSR A;  2GLR A;  2IL3 A;  1OC9 A;  3SWL A;  3TJF A;  3FKF A;  4TXV A;  5F07 A;  1B8X A;  1VF3 A;  3A2X A;  3IRA A;  2H1D A;  4Q5N A;  3KTL A;  4GQF A;  2HXK A;  3HHV A;  3UEM A;  3CRT A;  2BJX A;  5GST A;  4H86 A;  1UVZ A;  4BVY A;  4LA1 A;  2V6K A;  2ES7 A;  2HI7 A;  1T3B A;  4ML1 A;  3PIN A;  4KAE A;  4ACS A;  1ZL9 A;  5IMF A;  2JL4 A;  2KP1 A;  3PH9 A;  2MBS A;  1K0C A;  2V32 A;  5C04 A;  4ZIJ A;  1TK5 B;  2M80 A;  1EP7 A;  3H93 A;  2WDU A;  3L9S A;  3TKP A;  2OBK A;  1TP9 A;  3A5W A;  4K6X A;  1G0T A;  3UAP A;  5IM9 A;  1BJX A;  3I9V 2;  1XOB A;  1TW9 A;  2FA4 A;  1E6B A;  2R6K A;  4HJ2 A;  1JZO A;  1MTC A;  2K8V A;  1MD3 A;  2YWO A;  2LTK A;  5DJL A;  3KJY A;  3EWL A;  3HVV A;  5DCG A;  4KSO A;  4XRA A;  1R26 A;  1EGR A;  2VD0 A;  2ZNM A;  4L8E A;  1OKD A;  2O7K A;  4N0V A;  2DSA A;  2LJR A;  5D9W A;  1GSU A;  4XIH A;  2IMF A;  1S3C A;  1TKD B;  4GSN A;  5H5Q A;  2VL2 A;  3QFA C;  5H5S A;  2E0Q A;  1H4O A;  1YDK A;  2GZP A;  2HSY A;  4GQC A;  5FHI A;  1SJ6 A;  1Z3E A;  2H66 A;  5FT3 A;  3HCZ A;  4EL1 A;  3ZTL A;  1XBS A;  3D4T A;  2CAI A;  4FIW A;  3KMO A;  3FZ5 A;  3QMX A;  1HNB A;  2B3S A;  1WP0 A;  2N5B A;  3VK9 A;  1PSQ A;  2C0E A;  3TCO A;  3KM6 A;  2R3X A;  2FWH A;  1BX9 A;  4HUA A;  1QXH A;  4IHU A;  2GZY A;  3EVI A;  9GSS A;  3J7Y k;  3RDW A;  1I5G A;  3TGZ A;  4WF5 A;  5DQY A;  1QUW A;  2KUC A;  3E0U A;  2NPB A;  2FA8 A;  1GSS A;  2PVO C;  3ERF A;  5JCU A;  2Z9S A;  5F06 A;  2K9F A;  1AW9 A;  4WR4 A;  1X9M B;  2JSZ A;  3VUR A;  3LOR A;  5JWQ B;  3P8W A;  1FG4 A;  1G7E A;  2H1G A;  2VL9 A;  2PVQ A;  2P5R A;  4XRD A;  5GZZ B;  4MDC A;  4OFN A;  2AB6 A;  14GS A;  1VF1 A;  4MH2 A;  3TUE A;  3ZVJ A;  3CMI A;  3KH7 A;  2PN8 A;  2XPE A;  3LSZ A;  3ZRD A;  1FB0 A;  4KGI A;  3L9V A;  1AAZ A;  2DJ3 A;  1R4W A;  3F8U A;  2YPM A;  3WYW A;  2H19 A;  1CQG A;  2L4C A;  1XW9 A;  4G19 A;  3G7I A;  4D73 A;  5IPG A;  3J7Y b;  1K0N A;  1UN2 A;  1GLP A;  1RQM A;  2C0F A;  6GSX A;  2LRC A;  2LJA A;  2H6Z A;  1X5D A;  1YJ6 A;  1F6M C;  4TXO A;  12GS A;  2C4J A;  2YV7 A;  4ZB9 A;  2P31 A;  4EF0 A;  3M3M A;  4KDU A;  4XS4 A;  4ZL8 A;  4G10 A;  5ECL B;  1XW5 A;  4POK A;  3GFK A;  4WEY A;  3CRU A;  2GDR A;  4POL A;  2ON5 A;  1V98 A;  2LQQ A;  4YQV A;  1F3A A;  4GLT A;  2V2G A;  1TI3 A;  3KP8 A;  4L5L A;  3C71 A;  3FY7 A;  3FYG A;  2V41 A;  5C00 A;  2LJK A;  20GS A;  1PX6 A;  3DVW A;  2L6C A;  1DE1 A;  4MZW A;  5G30 A;  5KEJ A;  3H1N A;  2X99 A;  2VLT A;  4MA9 A;  3L4N A;  1F37 A;  2JU5 A;  3F4T A;  4O32 A;  3IK9 A;  1U88 A;  3RHB A;  2H70 A;  4JE1 A;  1F3B A;  5IOX A;  1SEN A;  2VCZ A;  4KE3 A;  2H0I A;  1Z6M A;  2H76 A;  2OBI A;  3P2A A;  1ZMA A;  1FVK A;  1XIY A;  1JHB A;  4G9H A;  5IPH A;  5G1K A;  1T1V A;  5KN1 A;  2MMZ A;  1ERU A;  1PRX A;  3BOA A;  4IW9 A;  2TRC P;  1IYH A;  1MDI A;  1PKW A;  5AIX A;  6GSS A;  2YZH A;  4K0N A;  1N8J A;  1MEK A;  1XWA A;  4GF0 A;  3U5R E;  2XBI A;  4K0G A;  5KN3 A;  1SKR B;  5LD0 A;  3N9J A;  4TR1 B;  1SKS B;  4XS6 A;  16GS A;  1ABA A;  3TDG A;  1ZOF A;  3DXB A;  2R4V A;  2YWM A;  2RM5 A;  4EKZ A;  1AUC A;  2LRT A;  2QSI A;  2DC5 A;  3C73 A;  3M9K A;  2PMT A;  3KCM A;  2HRN A;  4MZC A;  3CSH A;  4N11 A;  2KOK A;  1NHO A;  2NVL A;  1X9S B;  4N10 A;  3ME8 A;  4QL9 A;  1O7U A;  1A0F A;  4NMU A;  2VD1 A;  2H71 A;  2K6V A;  2X64 A;  3L78 A;  5IO0 A;  1V40 A;  4EDZ A;  2AAW A;  1J08 A;  4F2I A;  1CQH A;  1HQO A;  4OWY A;  5G5E A;  3N5O A;  4KND A;  2G2Q A;  3ZML A;  4K7N A;  2VL2 C;  3VWU A;  4JZQ A;  4YQM A;  5INY A;  3RBT A;  4JU5 A;  2HE3 A;  3IXR A;  5DCH A;  4IVF A;  1T7P B;  5ECO B;  3OR5 A;  4NWY A;  2YJH A;  1YZX A;  1GTA A;  2QKE A;  4PNG A;  4KW6 A;  3CSI A;  5CRW A;  3QFB C;  3DGQ A;  2B5E A;  3L9U A;  2B7K A;  2H6X A;  1A2M A;  3VFI A;  5AGY A;  4MAB A;  1M99 A;  3I6A A;  1GWC A;  2ALB A;  3QAG A;  3F9U A;  3DEX A;  3FZ9 A;  3NZN A;  2L59 A;  1YQ1 A;  3HKR A;  1OE8 A;  4MJA A;  10GS A;  2YZU A;  4NAX A;  3GH9 A;  3O6T A;  3GUR A;  3IE3 A;  3DYR A;  4TRX A;  1GSY A;  4KDY A;  2DJ0 A;  4JED A;  1OVN A;  3JCM L;  3UMA A;  1NSW A;  1JZW A;  5ECN B;  1V9W A;  1WJK A;  1Y25 A;  3PGT A;  4ID0 A;  4NHW A;  1JZD A;  2CZ2 A;  2EIR A;  1SJZ A;  3MSZ A;  1XXU A;  2CT6 A;  1B4Q A;  1X9W B;  2V1M A;  1XWK A;  3FZA A;  3KZQ A;  1AQW A;  4GCI A;  4QQ7 A;  5DAL B;  2QC7 A;  4KA0 A;  1B9Y C;  3US3 A;  3IA1 A;  4XHM A;  2WJU A;  3APQ A;  5D73 A;  1WMJ A;  3GN3 A;  4F0B A;  1MD4 A;  1WOU A;  2PER A;  1G7O A;  4I2U A;  4MLY A;  5D96 A;  2L5O A;  1PQN A;  1K0O A;  1J0F A;  3RHC A;  4MF5 A;  2R2J A;  5IMD A;  1AC1 A;  5F05 A;  1XCC A;  4FYB A;  3E9J B;  4HZ2 A;  4V2L A;  5B8A A;  1NW2 A;  1SK1 A;  1V58 A;  2FWF A;  2OE1 A;  1BED A;  5AIV A;  1SU9 A;  5DVB A;  1SK0 A;  2BTO T;  4TOP A;  1EV9 A;  1FVJ A;  5A4W A;  1PD2 1;  5GSS A;  3QCP A;  3BCK A;  3BD2 A;  4IEL A;  2H30 A;  1TK0 B;  1SKW B;  4ZBB A;  4PQI A;  3FRC A;  4TN8 A;  5A5K A;  2WUL A;  2OA7 A;  3LYK A;  2VCV A;  5ELA A;  4FH8 A;  4MCU A;  1DE2 A;  4PXO A;  3GV1 A;  3FK8 A;  3UL3 A;  3FZ4 A;  5J41 A;  5IMV A;  2NDO A;  4O7H A;  3HYP A;  1JZR A;  4IJ3 A;  6GSU A;  3IK7 A;  1M0U A;  4I5Q A;  3VPQ A;  2JAC A;  3TKR A;  4KUN A;  3NIV A;  5ECP B;  3KMN A;  1LBK A;  1M2B A;  5J5N A;  2I4A A;  1XPV A;  5D8I A;  1FW1 A;  4EXJ A;  4QL7 A;  1PKZ A;  3UBL A;  1HNC A;  5CRH A;  3UJ1 A;  2A4V A;  4TR1 A;  13GS A;  1PL2 A;  5DBQ A;  4KX4 A;  1Z6N A;  2WB9 A;  1A23 A;  4NV2 A;  3VWV A;  1TI1 A;  2L57 A;  1SYR A;  5ECK B;  4TW5 A;  3Q19 A;  1BAY A;  3HJO A;  5KN2 A;  2N5F A;  5CNW A;  2GQL A;  2VIM A;  1W89 A;  4JR6 A;  4XS1 A;  1A24 A;  3LGC A;  4FYU A;  4K2D A;  3O3T A;  3KD0 A;  1ZZY A;  3BBY A;  3E3E A;  4PUF C;  1EGO A;  1F2E A;  3ZVJ D;  1OAZ A;  3TRP A;  4YQU A;  3WGE A;  1QGV A;  3GKM A;  3F3Q A;  3LQ7 A;  2H74 A;  3IPZ A;  3LXZ A;  4MP4 A;  4HQS A;  3TJK A;  2YCD A;  3FW2 A;  4I6X A;  4LL1 B;  2O8V B;  3GNJ A;  1BYE A;  5G2Z A;  2HNL A;  1LU4 A;  1I9D A;  5L71 A;  4OCE A;  4MZB A;  3EC3 A;  2WFC A;  4J2F A;  1TXX A;  2YWN A;  3H8Q A;  4PNF A;  2CX3 A;  2TIR A;  2C3T A;  1ACV A;  2KHP A;  2LST A;  3KTB A;  3D4M A;  3GST A;  4J57 E;  3QOU A;  3RPN A;  5ECI B;  1EWX A;  2GST A;  2OAC A;  2C1Y A;  4HI7 A;  4CHS A;  5ECR B;  3LG6 A;  1VRS D;  5JWO B;  4CDO A;  1O73 A;  2FUG 2;  5CRD A;  4L0U A;  4RQX A;  1URM A;  1EP8 A;  2LNS A;  2GQM A;  3GX8 A;  1DSB A;  1GSF A;  2OE3 A;  2C3Q A;  2PWJ A;  2FWE A;  5CRE A;  2FCH A;  5CO3 A;  2B6M A;  2EIQ A;  2JZR A;  2M72 A;  2IFQ B;  2P5Q A;  1YEX A;  2B7J A;  1SK2 A;  3TJG A;  1QK8 A;  4WBJ A;  4ZB6 A;  3DWV A;  2ZUP A;  5B6N A;  1U6T A;  5DAL A;  2L4Q A;  1KEB A;  3KGK A;  4DSS B;  3DD3 A;  1GUL A;  3U6V A;  1ML6 A;  4WF4 A;  4AJ6 A;  3ZIT A;  2XBQ A;  5G31 A;  1X0R A;  4IQA A;  1GH2 A;  2VUP A;  3EU3 A;  1O81 A;  2WGR A;  2IIY A;  2YOI A;  1EOG A;  1VF2 A;  2DJ2 A;  2CVK A;  4X0X A;  3WT1 A;  3MDK A;  3QAV A;  3F0I A;  4NPB A;  4P3Y B;  1RW1 A;  2HLS A;  4NHZ A;  5EL8 A;  3I69 A;  2TRX A;  1XOA A;  1ON4 A;  4TKY A;  4IP6 A;  5G5F A;  1SJI A;  4EC0 A;  4V2M A;  2DLX A;  4MPG A;  2LV3 A;  3ZFL A;  1A2L A;  4POM A;  4Z7X A;  4HZ4 A;  4KSM A;  3QAW A;  5JWR B;  3UIW A;  1JLW A;  2CZ3 A;  1TRW A;  2VOC A;  2F51 A;  2REM A;  1YEP A;  1MDJ A;  2VL3 A;  2PBJ A;  5J9C A;  4Q5R A;  5D9V A;  1R7H A;  3C1S A;  1PMT A;  1TRS A;  4L5O A;  4YAV A;  1T00 A;  2MMN A;  3TB2 A;  1K0M A;  3VWX A;  3EU4 A;  4ILF A;  4X43 A;  4F03 A;  3MWH A;  3FR9 A;  5EVO A;  2H73 A;  3EMP A; 
#chains in the Genus database with same CATH topology
 5D9T A;  3FR6 A;  3Q74 A;  3CYN A;  5ENU A;  3GMF A;  2IMD A;  3HDC A;  1LJR A;  2KP2 A;  2AUV A;  2QA2 A;  3IOS A;  3D5J A;  2BMX A;  3D22 A;  5ECM B;  4V1A g;  2H8L A;  3GIX A;  5HR0 A;  3FR3 A;  3HVX A;  1AQX A;  2L6D A;  4LLR A;  2FGX A;  3NOF A;  3M9J A;  2GGT A;  2QA1 A;  3ZMK A;  5AIS A;  1OYJ A;  1V57 A;  4AGS A;  4BL7 A;  2IN3 A;  2YAN A;  3TOT A;  4EDY A;  4TVE A;  3QDN A;  1M2D A;  4FQU A;  4F82 A;  1XZO A;  2PPT A;  3W6G A;  1JFU A;  3A2V A;  2NBS A;  1W4V A;  2IMI A;  3APO A;  1EZK A;  3RPP A;  1GL8 A;  2K18 A;  2R5G A;  3UOM A;  18GS A;  4IS0 A;  5COH A;  1EV4 A;  4O5R A;  1WWJ A;  3GTU B;  5HFK A;  4K8M A;  2UZ8 A;  2ZCT A;  2PGT A;  1FOV A;  3IC4 A;  3V1W A;  1XW6 A;  2A2P A;  1GNW A;  3CBU A;  2NTO A;  5J3R A;  2OAD A;  4ECC A;  3MNG A;  2H0G A;  3WGD A;  3R3E A;  4POB A;  4DSQ A;  1T8E B;  3TKQ A;  2VCQ A;  1PGT A;  3LFL A;  3ED3 A;  5BRT A;  2H1A A;  1TJD A;  1M3J A;  2PUK C;  3CSJ A;  2DBC A;  6GST A;  5AN1 A;  1U3A A;  3QR6 A;  1WIK A;  4USS A;  6GSV A;  1E2Y A;  1XWC A;  4N30 A;  2JZT A;  2DMM A;  1B9X C;  4HS1 A;  5E4W A;  2H01 A;  4PUA A;  3LXT A;  1U3I A;  3HY2 A;  4PGT A;  4TR4 A;  2O85 A;  5IMA A;  2HRF A;  4GST A;  5HR3 A;  1T4Z A;  3F6F A;  2DJK A;  4GTU A;  4K5S A;  3TRQ A;  2GSR A;  5FWG A;  1ERT A;  3A3T A;  5JCW A;  1X5C A;  2HSH A;  3G7Y A;  2P0G A;  3C1R A;  4WKW A;  4I8B A;  1XWB A;  3KXO A;  1Z7P A;  3ZL5 A;  4MJB A;  5A4U A;  2GS3 A;  1Q98 A;  5DDL A;  4OO5 A;  3Q6O A;  3GL3 A;  2OE0 A;  3KIJ A;  4DEJ A;  3GKN A;  3HD5 A;  1FOH A;  2H6Y A;  4K7O A;  2IFQ A;  3D0Z A;  2FY6 A;  2VLV A;  4TXO B;  1AXD A;  2HZF A;  3DML A;  3GHA A;  4JRR A;  3TJB A;  2LUS A;  3S9F A;  3G7J A;  2A2S A;  1TRV A;  4ZL9 A;  4V2N A;  5GAP D;  4AF2 A;  3IHQ A;  2FNO A;  2IME A;  3Q18 A;  3ISO A;  3LYP A;  2MYG A;  4MPF A;  4OO4 A;  4X1U A;  5ID2 B;  4DSS A;  4AJ8 A;  4WXT A;  1GSD A;  1ERV A;  4GRF A;  1M9A A;  3HVN A;  2CV4 A;  5F0G A;  2I81 A;  4HU7 A;  2B1L A;  1YKA A;  2FD3 A;  2FLS A;  1GLQ A;  3O76 A;  1F9M A;  2C80 A;  2DKI A;  4ECI A;  5ECS A;  5ELG A;  4IGJ A;  3DRN A;  1U87 A;  2X8G A;  2MMO A;  4RI7 A;  1A8Y A;  5DJM A;  5LNK e;  2CQ9 A;  4AJ7 A;  3BCI A;  3GA4 A;  2B1K A;  1A2J A;  1G6W A;  2GQK A;  1FHE A;  1XVW A;  2GT6 A;  3ERW A;  2C8U A;  5HR1 A;  3WD6 A;  1GUK A;  5HR2 A;  3HJP A;  4IBP A;  3LJR A;  2G0F A;  6GSW A;  2O89 A;  2PU9 C;  1ERW A;  1FAA A;  4LMV A;  4RUV A;  8GSS A;  4OFM A;  1GSE A;  3TOU A;  3CTF A;  1DUG A;  4MMM A;  1PA3 A;  2GTU A;  3TKS E;  2JSY A;  1HD2 A;  4ZBA A;  3SBC A;  5HFG A;  3UAR A;  4PQ1 A;  3EPT A;  2FHE A;  5DAK B;  1QQ2 A;  3IAM 2;  2MMA A;  1XVQ A;  1ZYE A;  1GRX A;  1X5E A;  4F0C A;  1NM3 A;  1SL2 B;  4ZXG A;  3FMW A;  1OKT A;  1GUM A;  2R37 A;  1SL1 B;  3DKS A;  2LQO A;  3F4S A;  2H0H A;  3MIX A;  2DJJ A;  1M9B A;  1AIU A;  2J23 A;  2V6O A;  3EE2 A;  4BVX B;  2IJY A;  2VM2 A;  3GKX A;  3EYT A;  3HZ8 A;  2AYT A;  4OCF A;  2J9H A;  2RUF A;  1O85 A;  4HU9 A;  5GAN D;  3CXG A;  2A2R A;  4IQ1 A;  1AQV A;  3ZIV A;  1GSQ A;  1WPI A;  5E59 A;  1H75 A;  4K1F A;  4MF6 A;  5IMC A;  4I97 A;  1KBN A;  2YNX A;  5D93 A;  2OJL A;  3HA9 A;  3DIE A;  4RQR A;  1T4Y A;  5IO2 A;  2YJ7 A;  1R5P A;  4OFT A;  3GX0 A;  3FHK A;  6GSY A;  2YP6 A;  4LMW A;  1A8L A;  2LRN A;  5LCZ A;  4PUR A;  2XHF A;  2M46 A;  4ZBD A;  3HXS A;  2X49 A;  2GSQ A;  1K0A A;  3GTU A;  1KTE A;  2LNT A;  3PR8 A;  5HFI A;  3GL5 A;  3DVX A;  3IAS 2;  2DML A;  4MJC A;  1K3O A;  2E7P A;  2WZ9 A;  2QGV A;  2ON7 A;  3TRX A;  3HJM A;  4XCS A;  4GWR A;  4EVM A;  4BWQ A;  3A2W A;  1N2A A;  5J4U A;  1OC3 A;  3I43 A;  2KLX A;  2O87 A;  4FYC A;  5A4V A;  2F9S A;  2XPD A;  2AHE A;  1HYU A;  4HQZ A;  2I1U A;  1TTZ A;  1Y6E A;  2WRT A;  3C8E A;  1GP1 A;  2HYX A;  4ML6 A;  4N0Z A;  5KN0 A;  4F9Z A;  4DVC A;  1UA5 A;  3LWA A;  5CAX A;  3TKS A;  5ECH B;  1ZYQ B;  5J9B A;  1YKC A;  1QMV A;  2VM1 A;  2E2G A;  1WRY A;  1Z5Y E;  2VCW A;  2X8C A;  1A0R P;  4E8E A;  3D21 A;  1EEJ A;  2JAD A;  2DJ1 A;  3VI7 A;  4K9Z A;  3W8S A;  1B48 A;  3EUR A;  1YF0 A;  1K0D A;  1M2A A;  3FEU A;  2E2M A;  5IQY A;  3GSS A;  4V1A p;  4X4J A;  1YY7 A;  2I3Y A;  2DIY A;  1TRU A;  1GNE A;  5ABR A;  2EIO A;  2HZE B;  3APS A;  3D6I A;  2F3M A;  1TK8 B;  2VAF A;  5B7C A;  1ST9 A;  3BJ5 A;  2VO4 A;  2H1B A;  2WCI A;  4NV5 A;  5DQS A;  4CW9 A;  3P90 A;  5EY6 A;  3W8J A;  1M7T A;  5EPF A;  4JBB A;  3G9B A;  3WGX A;  3KEB A;  1VGL A;  1GTI A;  1TOF A;  4TR3 A;  4ZB8 A;  3M8N A;  4YAP A;  2WS2 A;  4GSS A;  1UC7 A;  1OC9 B;  4BPY A;  5IMZ A;  2IMK A;  1GTU A;  5IIZ A;  1PL1 A;  4BWS A;  3C7M A;  1OC8 A;  2GSS A;  5H5R A;  3IHG A;  4KCA A;  3F6D A;  2C3N A;  5ID2 A;  2MBT A;  4PTS A;  1PX7 A;  4JR4 A;  2XC2 A;  1ILO A;  3H79 A;  4I2T A;  1YF1 A;  2CA8 A;  5D9X A;  1KNG A;  1B4P A;  2LS5 A;  4EE0 A;  4BVY B;  3R2Q A;  4WBR D;  4ZL7 A;  4OMV A;  1XG8 A;  1Z9H A;  2YWI A;  3EIN A;  1C72 A;  3GRX A;  7GSS A;  1K3L A;  4PX1 A;  3CTG A;  1GTB A;  4J56 E;  2RLI A;  3QPM A;  3VI5 A;  3KH9 A;  2CVD A;  2LKU A;  2VLU A;  1JLV A;  1S3A A;  2EC4 A;  4HEA 2;  4PQH A;  4ECJ A;  4ULX A;  2DIZ A;  2CVB A;  3F63 A;  2YN1 A;  1J9B A;  5IOW A;  2IPA A;  2N5A A;  4GXZ A;  1TU8 A;  5B6M A;  1FB6 A;  1V2A A;  5DAK A;  3HVS A;  1USB A;  1RK4 A;  2YV9 A;  4MF7 A;  1NHY A;  5JCG A;  4G0I A;  4EIQ A;  3GH6 A;  22GS A;  3VLN A;  4ECB A;  1WE0 A;  2HT9 A;  1K0B A;  4LL4 B;  3GKK A;  3UVT A;  1G6Y A;  1VF4 A;  3WT2 A;  1O8W A;  1OE7 A;  1EEM A;  5ECQ B;  4BVX A;  3F3R A;  3P7X A;  3AY8 A;  2GT5 A;  2K8S A;  4A5P A;  4YKG A;  5B8B A;  4TR0 A;  4WR5 A;  1MDK A;  2FWG A;  11GS A;  4IN0 A;  4OD7 A;  3IR4 A;  4IKH A;  1Z7R A;  2VCX A;  2HRA A;  3ZRE A;  1ZCP A;  2C0D A;  1BG5 A;  1THO A;  4K7I A;  4NXI A;  2JZS A;  3UVH A;  1EOH A;  1BQ7 A;  4Q5F A;  5G1L A;  2B5X A;  4HJM A;  3K8N A;  4Z2R A;  1FO5 A;  3F4R A;  4G2E A;  4Q5Q A;  3ZFB A;  3ME7 A;  4ZIL A;  4XTS A;  2B5Y A;  1S3D A;  1SYX A;  4IJI A;  2OKA A;  1GUH A;  1R5A A;  1XWG A;  17GS A;  1TDI A;  3IBH A;  4EO3 A;  3IV4 A;  4L0W A;  1THX A;  4E8H A;  3VWW A;  1XFL A;  2F8A A;  3M1G A;  5F8B A;  5CP1 A;  3GUS A;  1HNA A;  3KP9 A;  1O6J A;  4RI6 A;  4YH2 A;  1DBY A;  4KB3 A;  19GS A;  3L0H A;  2GZZ A;  2AV4 A;  4MK3 A;  4WET A;  4IP1 A;  3ZLP A;  2X8H A;  1QFN A;  2C0G A;  1K3Y A;  3TJJ A;  3UBK A;  1Q4J A;  4O92 A;  2H75 A;  2R0C A;  4FO5 A;  1O8X A;  4BA7 A;  2D2Z A;  4KDX A;  2IWT A;  2VCT A;  5CYY A;  2GVP A;  1TU7 A;  3ERG A;  3M0F A;  1SL0 B;  5CRG A;  4D73 B;  3H4K A;  2MZC A;  2LEG A;  3GYK A;  2F8F A;  3EMX A;  2AJQ B;  3RAZ A;  2CX4 A;  3ZZX A;  4HDE A;  1IYI A;  5HQP A;  4KCE A;  4HOJ A;  3QD9 A;  2HZE A;  4MH3 A;  3TKS C;  2L5L A;  4EUY A;  3ZIJ A;  2H72 A;  3IDV A;  4MJE A;  1SD8 A;  2I9H A;  4XS4 B;  2RII A;  3LEF A;  3ZYW A;  1SD9 A;  3VPT A;  1PN0 A;  3MAK A;  1PN9 A;  3HZ4 A;  1ZGN A;  4ISD A;  4G0K A;  2CAQ A;  4KH7 A;  2RUE A;  2HFD A;  2RM6 A;  4DSR A;  2GLR A;  2IL3 A;  1OC9 A;  3SWL A;  3TJF A;  3FKF A;  4TXV A;  5F07 A;  1B8X A;  1VF3 A;  3A2X A;  3IRA A;  2H1D A;  4Q5N A;  3KTL A;  4GQF A;  2HXK A;  3HHV A;  3UEM A;  3CRT A;  2BJX A;  5GST A;  4H86 A;  1UVZ A;  4BVY A;  4LA1 A;  2V6K A;  2ES7 A;  2HI7 A;  1T3B A;  4ML1 A;  1PFO A;  3PIN A;  4KAE A;  4ACS A;  1ZL9 A;  5IMF A;  2JL4 A;  2KP1 A;  3PH9 A;  2MBS A;  1K0C A;  2V32 A;  5C04 A;  4ZIJ A;  1TK5 B;  2M80 A;  1EP7 A;  3H93 A;  2WDU A;  3L9S A;  3LW9 A;  3TKP A;  2OBK A;  1TP9 A;  3A5W A;  4K6X A;  1G0T A;  3UAP A;  5IM9 A;  1BJX A;  3I9V 2;  1XOB A;  1TW9 A;  2FA4 A;  1E6B A;  2R6K A;  4HJ2 A;  1JZO A;  1MTC A;  2K8V A;  1MD3 A;  2YWO A;  2LTK A;  5DJL A;  3KJY A;  3EWL A;  3HVV A;  5DCG A;  4KSO A;  4XRA A;  1R26 A;  1EGR A;  2VD0 A;  2ZNM A;  4L8E A;  1OKD A;  2O7K A;  4N0V A;  2DSA A;  2LJR A;  5D9W A;  1GSU A;  4XIH A;  2IMF A;  1S3C A;  1TKD B;  4GSN A;  5H5Q A;  2VL2 A;  3QFA C;  5H5S A;  2E0Q A;  1H4O A;  1YDK A;  2GZP A;  2HSY A;  4GQC A;  5FHI A;  1SJ6 A;  1Z3E A;  2H66 A;  5FT3 A;  3HCZ A;  4EL1 A;  3ZTL A;  1XBS A;  3D4T A;  2CAI A;  4BL7 B;  4FIW A;  3KMO A;  3FZ5 A;  3QMX A;  1HNB A;  2B3S A;  1WP0 A;  2N5B A;  3VK9 A;  1PSQ A;  2C0E A;  3TCO A;  3KM6 A;  2R3X A;  2FWH A;  1BX9 A;  4HUA A;  1QXH A;  4IHU A;  2GZY A;  3EVI A;  9GSS A;  3J7Y k;  3RDW A;  1I5G A;  3TGZ A;  4EIP A;  4WF5 A;  5DQY A;  1QUW A;  2KUC A;  3E0U A;  2NPB A;  2FA8 A;  1GSS A;  2PVO C;  3ERF A;  5JCU A;  2Z9S A;  5F06 A;  2K9F A;  1AW9 A;  4WR4 A;  1X9M B;  2JSZ A;  3VUR A;  3LOR A;  5JWQ B;  3P8W A;  1FG4 A;  1G7E A;  2H1G A;  2VL9 A;  2PVQ A;  2P5R A;  4XRD A;  5GZZ B;  4MDC A;  4OFN A;  2AB6 A;  14GS A;  1VF1 A;  4MH2 A;  3TUE A;  3ZVJ A;  3CMI A;  3KH7 A;  2PN8 A;  2XPE A;  3LSZ A;  3ZRD A;  1FB0 A;  4KGI A;  3L9V A;  1AAZ A;  2DJ3 A;  1R4W A;  3F8U A;  2YPM A;  3WYW A;  2H19 A;  1CQG A;  2L4C A;  1XW9 A;  4G19 A;  1ZYP A;  3G7I A;  4D73 A;  5IPG A;  3J7Y b;  1K0N A;  3CQF A;  1UN2 A;  1GLP A;  1RQM A;  2C0F A;  6GSX A;  2R0P A;  2LRC A;  2LJA A;  2H6Z A;  1X5D A;  1YJ6 A;  1F6M C;  4TXO A;  12GS A;  2C4J A;  2YV7 A;  4ZB9 A;  2P31 A;  4EF0 A;  3M3M A;  4KDU A;  4XS4 A;  4ZL8 A;  4G10 A;  5ECL B;  1XW5 A;  4POK A;  3GFK A;  4WEY A;  3CRU A;  2GDR A;  4POL A;  2ON5 A;  1V98 A;  2LQQ A;  4YQV A;  1F3A A;  4GLT A;  2V2G A;  1TI3 A;  3KP8 A;  4CY8 A;  4L5L A;  3C71 A;  2X4A A;  3FY7 A;  3FYG A;  2V41 A;  5C00 A;  2LJK A;  20GS A;  1PX6 A;  3DVW A;  2L6C A;  1DE1 A;  4MZW A;  5G30 A;  5KEJ A;  3H1N A;  2X99 A;  2VLT A;  4MA9 A;  3L4N A;  1F37 A;  2JU5 A;  3F4T A;  4O32 A;  3IK9 A;  1U88 A;  3RHB A;  2H70 A;  4JE1 A;  1F3B A;  5IOX A;  1SEN A;  2VCZ A;  4KE3 A;  2H0I A;  1Z6M A;  2H76 A;  2OBI A;  3P2A A;  1ZMA A;  1FVK A;  1XIY A;  1JHB A;  4G9H A;  5KOW A;  5IPH A;  5G1K A;  1T1V A;  5KN1 A;  2MMZ A;  1ERU A;  1PRX A;  3BOA A;  4IW9 A;  2TRC P;  1IYH A;  1MDI A;  1PKW A;  5AIX A;  6GSS A;  2YZH A;  4K0N A;  1N8J A;  1MEK A;  1XWA A;  4GF0 A;  3U5R E;  5BMU A;  2XBI A;  4K0G A;  5KN3 A;  1SKR B;  5LD0 A;  3N9J A;  4TR1 B;  1SKS B;  4XS6 A;  16GS A;  1ABA A;  4KF9 A;  3TDG A;  1ZOF A;  3DXB A;  2R4V A;  2YWM A;  2RM5 A;  4EKZ A;  1AUC A;  2LRT A;  2QSI A;  2DC5 A;  3C73 A;  3M9K A;  2PMT A;  3KCM A;  2HRN A;  4MZC A;  3CSH A;  4N11 A;  2KOK A;  1NHO A;  2NVL A;  1X9S B;  4N10 A;  3ME8 A;  4QL9 A;  1O7U A;  1A0F A;  4NMU A;  2VD1 A;  2H71 A;  2K6V A;  2X64 A;  4Z2U A;  3L78 A;  5IO0 A;  1V40 A;  4EDZ A;  2AAW A;  1J08 A;  4ICY A;  4F2I A;  1CQH A;  1HQO A;  4OWY A;  5G5E A;  3N5O A;  4KND A;  1S3R A;  2G2Q A;  3ZML A;  4K7N A;  2VL2 C;  3VWU A;  3A5I A;  4JZQ A;  4YQM A;  5INY A;  3RBT A;  4JU5 A;  2HE3 A;  3IXR A;  5DCH A;  4IVF A;  1T7P B;  5ECO B;  3OR5 A;  4NWY A;  2YJH A;  1YZX A;  1GTA A;  2QKE A;  4PNG A;  4KW6 A;  3CSI A;  5CRW A;  3QFB C;  3DGQ A;  2B5E A;  3L9U A;  4BIK A;  2B7K A;  2H6X A;  1A2M A;  3VFI A;  5AGY A;  4MAB A;  1M99 A;  3I6A A;  1GWC A;  2ALB A;  3QAG A;  3F9U A;  3DEX A;  3FZ9 A;  3NZN A;  2L59 A;  1YQ1 A;  3HKR A;  1OE8 A;  4MJA A;  2A4H A;  10GS A;  2YZU A;  4NAX A;  3GH9 A;  3O6T A;  3GUR A;  3IE3 A;  3DYR A;  4TRX A;  1GSY A;  4KDY A;  2DJ0 A;  4JED A;  1OVN A;  3JCM L;  3UMA A;  1NSW A;  1JZW A;  5ECN B;  1V9W A;  1WJK A;  1Y25 A;  3PGT A;  4ID0 A;  4NHW A;  1JZD A;  2CZ2 A;  2EIR A;  1SJZ A;  3MSZ A;  1XXU A;  2CT6 A;  1B4Q A;  1X9W B;  2V1M A;  1XWK A;  3FZA A;  3KZQ A;  1AQW A;  4GCI A;  4QQ7 A;  5DAL B;  2QC7 A;  4KA0 A;  1B9Y C;  3US3 A;  3IA1 A;  4XHM A;  2WJU A;  3APQ A;  5D73 A;  4K5R A;  1WMJ A;  3GN3 A;  4F0B A;  1MD4 A;  4YKF A;  1WOU A;  2PER A;  1G7O A;  4I2U A;  4MLY A;  5D96 A;  2L5O A;  1PQN A;  1K0O A;  1J0F A;  1M3I A;  3RHC A;  4MF5 A;  2R2J A;  5IMD A;  1AC1 A;  5F05 A;  1XCC A;  4FYB A;  3E9J B;  4HZ2 A;  4V2L A;  5B8A A;  2R0G A;  1NW2 A;  1SK1 A;  1V58 A;  2FWF A;  2OE1 A;  1BED A;  5AIV A;  1SU9 A;  5DVB A;  4O5Q A;  1SK0 A;  2BTO T;  4TOP A;  1EV9 A;  1FVJ A;  5A4W A;  1PD2 1;  5GSS A;  3QCP A;  3BCK A;  3BD2 A;  4IEL A;  2H30 A;  1TK0 B;  1SKW B;  4ZBB A;  4PQI A;  3FRC A;  4TN8 A;  5A5K A;  2WUL A;  2OA7 A;  3LYK A;  2VCV A;  5ELA A;  4FH8 A;  4MCU A;  1DE2 A;  4PXO A;  3GV1 A;  3FK8 A;  3UL3 A;  3FZ4 A;  5J41 A;  5IMV A;  2NDO A;  4O7H A;  3HYP A;  1JZR A;  4IJ3 A;  6GSU A;  3IK7 A;  1M0U A;  4I5Q A;  3VPQ A;  2JAC A;  3TKR A;  4K2X A;  4KUN A;  3NIV A;  5ECP B;  2HRK A;  3KMN A;  1LBK A;  1M2B A;  5J5N A;  2I4A A;  1XPV A;  5D8I A;  1FW1 A;  4EXJ A;  4QL7 A;  1PKZ A;  3UBL A;  1HNC A;  5CRH A;  3UJ1 A;  2A4V A;  4TR1 A;  13GS A;  1PL2 A;  1ZYN A;  5DBQ A;  4KX4 A;  1Z6N A;  2WB9 A;  1A23 A;  4NV2 A;  3VWV A;  1TI1 A;  2L57 A;  1SYR A;  5ECK B;  4TW5 A;  3Q19 A;  1BAY A;  3HJO A;  5KN2 A;  4O5U A;  2N5F A;  5CNW A;  2GQL A;  2VIM A;  1W89 A;  4JR6 A;  4XS1 A;  1A24 A;  3LGC A;  4FYU A;  4K2D A;  3MYD A;  4HSC X;  3O3T A;  3KD0 A;  1ZZY A;  3BBY A;  3E3E A;  4PUF C;  1EGO A;  1F2E A;  3ZVJ D;  1OAZ A;  3TRP A;  4YQU A;  3WGE A;  1QGV A;  3GKM A;  3F3Q A;  3LQ7 A;  2H74 A;  3IPZ A;  3LXZ A;  4MP4 A;  4HQS A;  3TJK A;  3IC8 A;  2YCD A;  3FW2 A;  4I6X A;  4LL1 B;  2O8V B;  3GNJ A;  1BYE A;  5G2Z A;  2HNL A;  1LU4 A;  1I9D A;  5L71 A;  4OCE A;  4MZB A;  3EC3 A;  2WFC A;  4J2F A;  1TXX A;  2YWN A;  3H8Q A;  4PNF A;  2CX3 A;  2TIR A;  2C3T A;  4CY6 A;  1ACV A;  5KOX A;  2KHP A;  2LST A;  3KTB A;  3D4M A;  3GST A;  4J57 E;  3QOU A;  3RPN A;  5ECI B;  1EWX A;  2HSM A;  2GST A;  2OAC A;  2C1Y A;  4HI7 A;  4CHS A;  5ECR B;  3LG6 A;  1VRS D;  5JWO B;  4CDO A;  1O73 A;  2FUG 2;  5CRD A;  4L0U A;  4RQX A;  1URM A;  1EP8 A;  2LNS A;  2GQM A;  3GX8 A;  1DSB A;  1GSF A;  2OE3 A;  2C3Q A;  2PWJ A;  2FWE A;  5CRE A;  2FCH A;  5CO3 A;  2B6M A;  2EIQ A;  2JZR A;  2M72 A;  2IFQ B;  2P5Q A;  1YEX A;  2B7J A;  1SK2 A;  3TJG A;  1QK8 A;  4WBJ A;  4ZB6 A;  3DWV A;  2ZUP A;  5B6N A;  1U6T A;  5DAL A;  2L4Q A;  1KEB A;  3KGK A;  4DSS B;  3DD3 A;  1GUL A;  3U6V A;  1ML6 A;  4WF4 A;  4MNN A;  4AJ6 A;  3ZIT A;  2XBQ A;  5G31 A;  1X0R A;  4IQA A;  1GH2 A;  2VUP A;  3EU3 A;  1O81 A;  2WGR A;  2IIY A;  2YOI A;  1EOG A;  1VF2 A;  2DJ2 A;  4Z2T A;  2CVK A;  4X0X A;  3WT1 A;  3MDK A;  3QAV A;  3F0I A;  4NPB A;  4P3Y B;  1RW1 A;  2HLS A;  4NHZ A;  5EL8 A;  3I69 A;  2TRX A;  1XOA A;  1ON4 A;  4TKY A;  4IP6 A;  5G5F A;  1SJI A;  4EC0 A;  3PPU A;  4V2M A;  2DLX A;  4MPG A;  2LV3 A;  3ZFL A;  1A2L A;  4POM A;  4Z7X A;  4HZ4 A;  4KSM A;  3QAW A;  5JWR B;  3UIW A;  1JLW A;  2CZ3 A;  1TRW A;  2VOC A;  2F51 A;  2REM A;  1YEP A;  1MDJ A;  2VL3 A;  2PBJ A;  5J9C A;  4Q5R A;  5D9V A;  1R7H A;  3C1S A;  1PMT A;  1TRS A;  4L5O A;  4YAV A;  1T00 A;  2DKH A;  2MMN A;  4G0L A;  3TB2 A;  1K0M A;  3VWX A;  3EU4 A;  4ILF A;  4X43 A;  4F03 A;  3MWH A;  3FR9 A;  5EVO A;  2H73 A;  3EMP A; 
#chains in the Genus database with same CATH homology
 5D9T A;  3FR6 A;  3Q74 A;  3CYN A;  5ENU A;  3GMF A;  2IMD A;  3HDC A;  1LJR A;  2KP2 A;  2AUV A;  2QA2 A;  3IOS A;  3D5J A;  2BMX A;  3D22 A;  5ECM B;  4V1A g;  2H8L A;  3GIX A;  5HR0 A;  3FR3 A;  3HVX A;  1AQX A;  2L6D A;  4LLR A;  2FGX A;  3NOF A;  3M9J A;  2GGT A;  2QA1 A;  3ZMK A;  5AIS A;  1OYJ A;  1V57 A;  4AGS A;  4BL7 A;  2IN3 A;  2YAN A;  3TOT A;  4EDY A;  4TVE A;  3QDN A;  1M2D A;  4FQU A;  4F82 A;  1XZO A;  2PPT A;  3W6G A;  1JFU A;  3A2V A;  2NBS A;  1W4V A;  2IMI A;  3APO A;  1EZK A;  3RPP A;  1GL8 A;  2K18 A;  2R5G A;  3UOM A;  18GS A;  4IS0 A;  5COH A;  1EV4 A;  4O5R A;  1WWJ A;  3GTU B;  5HFK A;  4K8M A;  2UZ8 A;  2ZCT A;  2PGT A;  1FOV A;  3IC4 A;  3V1W A;  1XW6 A;  2A2P A;  1GNW A;  3CBU A;  2NTO A;  5J3R A;  2OAD A;  4ECC A;  3MNG A;  2H0G A;  3WGD A;  3R3E A;  4POB A;  4DSQ A;  1T8E B;  3TKQ A;  2VCQ A;  1PGT A;  3LFL A;  3ED3 A;  5BRT A;  2H1A A;  1TJD A;  2PUK C;  3CSJ A;  2DBC A;  6GST A;  5AN1 A;  1U3A A;  3QR6 A;  1WIK A;  4USS A;  6GSV A;  1E2Y A;  1XWC A;  4N30 A;  2JZT A;  2DMM A;  1B9X C;  4HS1 A;  5E4W A;  2H01 A;  4PUA A;  3LXT A;  1U3I A;  3HY2 A;  4PGT A;  4TR4 A;  2O85 A;  5IMA A;  2HRF A;  4GST A;  5HR3 A;  1T4Z A;  3F6F A;  2DJK A;  4GTU A;  4K5S A;  3TRQ A;  2GSR A;  5FWG A;  1ERT A;  3A3T A;  5JCW A;  1X5C A;  2HSH A;  3G7Y A;  2P0G A;  3C1R A;  4WKW A;  4I8B A;  1XWB A;  3KXO A;  1Z7P A;  3ZL5 A;  4MJB A;  5A4U A;  2GS3 A;  1Q98 A;  5DDL A;  4OO5 A;  3Q6O A;  3GL3 A;  2OE0 A;  3KIJ A;  4DEJ A;  3GKN A;  3HD5 A;  1FOH A;  2H6Y A;  4K7O A;  2IFQ A;  3D0Z A;  2FY6 A;  2VLV A;  4TXO B;  1AXD A;  2HZF A;  3DML A;  3GHA A;  4JRR A;  3TJB A;  2LUS A;  3S9F A;  3G7J A;  2A2S A;  1TRV A;  4ZL9 A;  4V2N A;  5GAP D;  4AF2 A;  3IHQ A;  2FNO A;  2IME A;  3Q18 A;  3ISO A;  3LYP A;  2MYG A;  4MPF A;  4OO4 A;  4X1U A;  5ID2 B;  4DSS A;  4AJ8 A;  4WXT A;  1GSD A;  1ERV A;  4GRF A;  1M9A A;  2CV4 A;  5F0G A;  2I81 A;  4HU7 A;  2B1L A;  1YKA A;  2FD3 A;  2FLS A;  1GLQ A;  3O76 A;  1F9M A;  2C80 A;  2DKI A;  4ECI A;  5ECS A;  5ELG A;  4IGJ A;  3DRN A;  1U87 A;  2X8G A;  2MMO A;  4RI7 A;  1A8Y A;  5DJM A;  5LNK e;  2CQ9 A;  4AJ7 A;  3BCI A;  3GA4 A;  2B1K A;  1A2J A;  1G6W A;  2GQK A;  1FHE A;  1XVW A;  2GT6 A;  3ERW A;  2C8U A;  5HR1 A;  3WD6 A;  1GUK A;  5HR2 A;  3HJP A;  4IBP A;  3LJR A;  2G0F A;  6GSW A;  2O89 A;  2PU9 C;  1ERW A;  1FAA A;  4LMV A;  4RUV A;  8GSS A;  4OFM A;  1GSE A;  3TOU A;  3CTF A;  1DUG A;  4MMM A;  1PA3 A;  2GTU A;  3TKS E;  2JSY A;  1HD2 A;  4ZBA A;  3SBC A;  5HFG A;  3UAR A;  4PQ1 A;  3EPT A;  2FHE A;  5DAK B;  1QQ2 A;  3IAM 2;  2MMA A;  1XVQ A;  1ZYE A;  1GRX A;  1X5E A;  4F0C A;  1NM3 A;  1SL2 B;  4ZXG A;  3FMW A;  1OKT A;  1GUM A;  2R37 A;  1SL1 B;  3DKS A;  2LQO A;  3F4S A;  2H0H A;  3MIX A;  2DJJ A;  1M9B A;  1AIU A;  2J23 A;  2V6O A;  3EE2 A;  4BVX B;  2IJY A;  2VM2 A;  3GKX A;  3EYT A;  3HZ8 A;  2AYT A;  4OCF A;  2J9H A;  2RUF A;  1O85 A;  4HU9 A;  5GAN D;  3CXG A;  2A2R A;  4IQ1 A;  1AQV A;  3ZIV A;  1GSQ A;  1WPI A;  5E59 A;  1H75 A;  4K1F A;  4MF6 A;  5IMC A;  4I97 A;  1KBN A;  2YNX A;  5D93 A;  2OJL A;  3HA9 A;  3DIE A;  4RQR A;  1T4Y A;  5IO2 A;  2YJ7 A;  1R5P A;  4OFT A;  3GX0 A;  3FHK A;  6GSY A;  2YP6 A;  4LMW A;  1A8L A;  2LRN A;  5LCZ A;  4PUR A;  2XHF A;  2M46 A;  4ZBD A;  3HXS A;  2X49 A;  2GSQ A;  1K0A A;  3GTU A;  1KTE A;  2LNT A;  3PR8 A;  5HFI A;  3GL5 A;  3DVX A;  3IAS 2;  2DML A;  4MJC A;  1K3O A;  2E7P A;  2WZ9 A;  2QGV A;  2ON7 A;  3TRX A;  3HJM A;  4XCS A;  4GWR A;  4EVM A;  4BWQ A;  3A2W A;  1N2A A;  5J4U A;  1OC3 A;  3I43 A;  2KLX A;  2O87 A;  4FYC A;  5A4V A;  2F9S A;  2XPD A;  2AHE A;  1HYU A;  4HQZ A;  2I1U A;  1TTZ A;  1Y6E A;  2WRT A;  3C8E A;  1GP1 A;  2HYX A;  4ML6 A;  4N0Z A;  5KN0 A;  4F9Z A;  4DVC A;  1UA5 A;  3LWA A;  5CAX A;  3TKS A;  5ECH B;  1ZYQ B;  5J9B A;  1YKC A;  1QMV A;  2VM1 A;  2E2G A;  1WRY A;  1Z5Y E;  2VCW A;  2X8C A;  1A0R P;  4E8E A;  3D21 A;  1EEJ A;  2JAD A;  2DJ1 A;  3VI7 A;  4K9Z A;  3W8S A;  1B48 A;  3EUR A;  1YF0 A;  1K0D A;  1M2A A;  3FEU A;  2E2M A;  5IQY A;  3GSS A;  4V1A p;  4X4J A;  1YY7 A;  2I3Y A;  2DIY A;  1TRU A;  1GNE A;  5ABR A;  2EIO A;  2HZE B;  3APS A;  3D6I A;  2F3M A;  1TK8 B;  2VAF A;  5B7C A;  1ST9 A;  3BJ5 A;  2VO4 A;  2H1B A;  2WCI A;  4NV5 A;  5DQS A;  4CW9 A;  3P90 A;  5EY6 A;  3W8J A;  1M7T A;  5EPF A;  4JBB A;  3G9B A;  3WGX A;  3KEB A;  1VGL A;  1GTI A;  1TOF A;  4TR3 A;  4ZB8 A;  3M8N A;  4YAP A;  2WS2 A;  4GSS A;  1UC7 A;  1OC9 B;  4BPY A;  5IMZ A;  2IMK A;  1GTU A;  5IIZ A;  1PL1 A;  4BWS A;  3C7M A;  1OC8 A;  2GSS A;  5H5R A;  3IHG A;  4KCA A;  3F6D A;  2C3N A;  5ID2 A;  2MBT A;  4PTS A;  1PX7 A;  4JR4 A;  2XC2 A;  1ILO A;  3H79 A;  4I2T A;  1YF1 A;  2CA8 A;  5D9X A;  1KNG A;  1B4P A;  2LS5 A;  4EE0 A;  4BVY B;  3R2Q A;  4WBR D;  4ZL7 A;  4OMV A;  1Z9H A;  2YWI A;  3EIN A;  1C72 A;  3GRX A;  7GSS A;  1K3L A;  4PX1 A;  3CTG A;  1GTB A;  4J56 E;  2RLI A;  3QPM A;  3VI5 A;  3KH9 A;  2CVD A;  2LKU A;  2VLU A;  1JLV A;  1S3A A;  2EC4 A;  4HEA 2;  4PQH A;  4ECJ A;  4ULX A;  2DIZ A;  2CVB A;  3F63 A;  2YN1 A;  1J9B A;  5IOW A;  2IPA A;  2N5A A;  4GXZ A;  1TU8 A;  5B6M A;  1FB6 A;  1V2A A;  5DAK A;  3HVS A;  1USB A;  1RK4 A;  2YV9 A;  4MF7 A;  1NHY A;  5JCG A;  4G0I A;  4EIQ A;  3GH6 A;  22GS A;  3VLN A;  4ECB A;  1WE0 A;  2HT9 A;  1K0B A;  4LL4 B;  3GKK A;  3UVT A;  1G6Y A;  1VF4 A;  3WT2 A;  1O8W A;  1OE7 A;  1EEM A;  5ECQ B;  4BVX A;  3F3R A;  3P7X A;  3AY8 A;  2GT5 A;  2K8S A;  4A5P A;  4YKG A;  5B8B A;  4TR0 A;  4WR5 A;  1MDK A;  2FWG A;  11GS A;  4IN0 A;  4OD7 A;  3IR4 A;  4IKH A;  1Z7R A;  2VCX A;  2HRA A;  3ZRE A;  1ZCP A;  2C0D A;  1BG5 A;  1THO A;  4K7I A;  4NXI A;  2JZS A;  3UVH A;  1EOH A;  1BQ7 A;  4Q5F A;  5G1L A;  2B5X A;  4HJM A;  3K8N A;  4Z2R A;  1FO5 A;  3F4R A;  4G2E A;  4Q5Q A;  3ZFB A;  3ME7 A;  4ZIL A;  4XTS A;  2B5Y A;  1S3D A;  1SYX A;  4IJI A;  2OKA A;  1GUH A;  1R5A A;  1XWG A;  17GS A;  1TDI A;  3IBH A;  4EO3 A;  3IV4 A;  4L0W A;  1THX A;  4E8H A;  3VWW A;  1XFL A;  2F8A A;  3M1G A;  5F8B A;  5CP1 A;  3GUS A;  1HNA A;  3KP9 A;  1O6J A;  4RI6 A;  4YH2 A;  1DBY A;  4KB3 A;  19GS A;  3L0H A;  2GZZ A;  2AV4 A;  4MK3 A;  4WET A;  4IP1 A;  3ZLP A;  2X8H A;  1QFN A;  2C0G A;  1K3Y A;  3TJJ A;  3UBK A;  1Q4J A;  4O92 A;  2H75 A;  2R0C A;  4FO5 A;  1O8X A;  4BA7 A;  2D2Z A;  4KDX A;  2IWT A;  2VCT A;  5CYY A;  2GVP A;  1TU7 A;  3ERG A;  3M0F A;  1SL0 B;  5CRG A;  4D73 B;  3H4K A;  2MZC A;  2LEG A;  3GYK A;  2F8F A;  3EMX A;  2AJQ B;  3RAZ A;  2CX4 A;  3ZZX A;  4HDE A;  1IYI A;  5HQP A;  4KCE A;  4HOJ A;  3QD9 A;  2HZE A;  4MH3 A;  3TKS C;  2L5L A;  4EUY A;  3ZIJ A;  2H72 A;  3IDV A;  4MJE A;  1SD8 A;  2I9H A;  4XS4 B;  2RII A;  3LEF A;  3ZYW A;  1SD9 A;  3VPT A;  1PN0 A;  3MAK A;  1PN9 A;  3HZ4 A;  1ZGN A;  4ISD A;  4G0K A;  2CAQ A;  4KH7 A;  2RUE A;  2HFD A;  2RM6 A;  4DSR A;  2GLR A;  2IL3 A;  1OC9 A;  3SWL A;  3TJF A;  3FKF A;  4TXV A;  5F07 A;  1B8X A;  1VF3 A;  3A2X A;  3IRA A;  2H1D A;  4Q5N A;  3KTL A;  4GQF A;  2HXK A;  3HHV A;  3UEM A;  3CRT A;  2BJX A;  5GST A;  4H86 A;  1UVZ A;  4BVY A;  4LA1 A;  2V6K A;  2ES7 A;  2HI7 A;  1T3B A;  4ML1 A;  3PIN A;  4KAE A;  4ACS A;  1ZL9 A;  5IMF A;  2JL4 A;  2KP1 A;  3PH9 A;  2MBS A;  1K0C A;  2V32 A;  5C04 A;  4ZIJ A;  1TK5 B;  2M80 A;  1EP7 A;  3H93 A;  2WDU A;  3L9S A;  3LW9 A;  3TKP A;  2OBK A;  1TP9 A;  3A5W A;  4K6X A;  1G0T A;  3UAP A;  5IM9 A;  1BJX A;  3I9V 2;  1XOB A;  1TW9 A;  2FA4 A;  1E6B A;  2R6K A;  4HJ2 A;  1JZO A;  1MTC A;  2K8V A;  1MD3 A;  2YWO A;  2LTK A;  5DJL A;  3KJY A;  3EWL A;  3HVV A;  5DCG A;  4KSO A;  4XRA A;  1R26 A;  1EGR A;  2VD0 A;  2ZNM A;  4L8E A;  1OKD A;  2O7K A;  4N0V A;  2DSA A;  2LJR A;  5D9W A;  1GSU A;  4XIH A;  2IMF A;  1S3C A;  1TKD B;  4GSN A;  5H5Q A;  2VL2 A;  3QFA C;  5H5S A;  2E0Q A;  1H4O A;  1YDK A;  2GZP A;  2HSY A;  4GQC A;  5FHI A;  1SJ6 A;  1Z3E A;  2H66 A;  5FT3 A;  3HCZ A;  4EL1 A;  3ZTL A;  1XBS A;  3D4T A;  2CAI A;  4BL7 B;  4FIW A;  3KMO A;  3FZ5 A;  3QMX A;  1HNB A;  2B3S A;  1WP0 A;  2N5B A;  3VK9 A;  1PSQ A;  2C0E A;  3TCO A;  3KM6 A;  2R3X A;  2FWH A;  1BX9 A;  4HUA A;  1QXH A;  4IHU A;  2GZY A;  3EVI A;  9GSS A;  3J7Y k;  3RDW A;  1I5G A;  3TGZ A;  4EIP A;  4WF5 A;  5DQY A;  1QUW A;  2KUC A;  3E0U A;  2NPB A;  2FA8 A;  1GSS A;  2PVO C;  3ERF A;  5JCU A;  2Z9S A;  5F06 A;  2K9F A;  1AW9 A;  4WR4 A;  1X9M B;  2JSZ A;  3VUR A;  3LOR A;  5JWQ B;  3P8W A;  1FG4 A;  1G7E A;  2H1G A;  2VL9 A;  2PVQ A;  2P5R A;  4XRD A;  5GZZ B;  4MDC A;  4OFN A;  2AB6 A;  14GS A;  1VF1 A;  4MH2 A;  3TUE A;  3ZVJ A;  3CMI A;  3KH7 A;  2PN8 A;  2XPE A;  3LSZ A;  3ZRD A;  1FB0 A;  4KGI A;  3L9V A;  1AAZ A;  2DJ3 A;  1R4W A;  3F8U A;  2YPM A;  3WYW A;  2H19 A;  1CQG A;  2L4C A;  1XW9 A;  4G19 A;  1ZYP A;  3G7I A;  4D73 A;  5IPG A;  3J7Y b;  1K0N A;  1UN2 A;  1GLP A;  1RQM A;  2C0F A;  6GSX A;  2R0P A;  2LRC A;  2LJA A;  2H6Z A;  1X5D A;  1YJ6 A;  1F6M C;  4TXO A;  12GS A;  2C4J A;  2YV7 A;  4ZB9 A;  2P31 A;  4EF0 A;  3M3M A;  4KDU A;  4XS4 A;  4ZL8 A;  4G10 A;  5ECL B;  1XW5 A;  4POK A;  3GFK A;  4WEY A;  3CRU A;  2GDR A;  4POL A;  2ON5 A;  1V98 A;  2LQQ A;  4YQV A;  1F3A A;  4GLT A;  2V2G A;  1TI3 A;  3KP8 A;  4CY8 A;  4L5L A;  3C71 A;  2X4A A;  3FY7 A;  3FYG A;  2V41 A;  5C00 A;  2LJK A;  20GS A;  1PX6 A;  3DVW A;  2L6C A;  1DE1 A;  4MZW A;  5G30 A;  5KEJ A;  3H1N A;  2X99 A;  2VLT A;  4MA9 A;  3L4N A;  1F37 A;  2JU5 A;  3F4T A;  4O32 A;  3IK9 A;  1U88 A;  3RHB A;  2H70 A;  4JE1 A;  1F3B A;  5IOX A;  1SEN A;  2VCZ A;  4KE3 A;  2H0I A;  1Z6M A;  2H76 A;  2OBI A;  3P2A A;  1ZMA A;  1FVK A;  1XIY A;  1JHB A;  4G9H A;  5KOW A;  5IPH A;  5G1K A;  1T1V A;  5KN1 A;  2MMZ A;  1ERU A;  1PRX A;  3BOA A;  4IW9 A;  2TRC P;  1IYH A;  1MDI A;  1PKW A;  5AIX A;  6GSS A;  2YZH A;  4K0N A;  1N8J A;  1MEK A;  1XWA A;  4GF0 A;  3U5R E;  5BMU A;  2XBI A;  4K0G A;  5KN3 A;  1SKR B;  5LD0 A;  3N9J A;  4TR1 B;  1SKS B;  4XS6 A;  16GS A;  1ABA A;  4KF9 A;  3TDG A;  1ZOF A;  3DXB A;  2R4V A;  2YWM A;  2RM5 A;  4EKZ A;  1AUC A;  2LRT A;  2QSI A;  2DC5 A;  3C73 A;  3M9K A;  2PMT A;  3KCM A;  2HRN A;  4MZC A;  3CSH A;  4N11 A;  2KOK A;  1NHO A;  2NVL A;  1X9S B;  4N10 A;  3ME8 A;  4QL9 A;  1O7U A;  1A0F A;  4NMU A;  2VD1 A;  2H71 A;  2K6V A;  2X64 A;  4Z2U A;  3L78 A;  5IO0 A;  1V40 A;  4EDZ A;  2AAW A;  1J08 A;  4ICY A;  4F2I A;  1CQH A;  1HQO A;  4OWY A;  5G5E A;  3N5O A;  4KND A;  2G2Q A;  3ZML A;  4K7N A;  2VL2 C;  3VWU A;  3A5I A;  4JZQ A;  4YQM A;  5INY A;  3RBT A;  4JU5 A;  2HE3 A;  3IXR A;  5DCH A;  4IVF A;  1T7P B;  5ECO B;  3OR5 A;  4NWY A;  2YJH A;  1YZX A;  1GTA A;  2QKE A;  4PNG A;  4KW6 A;  3CSI A;  5CRW A;  3QFB C;  3DGQ A;  2B5E A;  3L9U A;  2B7K A;  2H6X A;  1A2M A;  3VFI A;  5AGY A;  4MAB A;  1M99 A;  3I6A A;  1GWC A;  2ALB A;  3QAG A;  3F9U A;  3DEX A;  3FZ9 A;  3NZN A;  2L59 A;  1YQ1 A;  3HKR A;  1OE8 A;  4MJA A;  2A4H A;  10GS A;  2YZU A;  4NAX A;  3GH9 A;  3O6T A;  3GUR A;  3IE3 A;  3DYR A;  4TRX A;  1GSY A;  4KDY A;  2DJ0 A;  4JED A;  1OVN A;  3JCM L;  3UMA A;  1NSW A;  1JZW A;  5ECN B;  1V9W A;  1WJK A;  1Y25 A;  3PGT A;  4ID0 A;  4NHW A;  1JZD A;  2CZ2 A;  2EIR A;  1SJZ A;  3MSZ A;  1XXU A;  2CT6 A;  1B4Q A;  1X9W B;  2V1M A;  1XWK A;  3FZA A;  3KZQ A;  1AQW A;  4GCI A;  4QQ7 A;  5DAL B;  2QC7 A;  4KA0 A;  1B9Y C;  3US3 A;  3IA1 A;  4XHM A;  2WJU A;  3APQ A;  5D73 A;  4K5R A;  1WMJ A;  3GN3 A;  4F0B A;  1MD4 A;  4YKF A;  1WOU A;  2PER A;  1G7O A;  4I2U A;  4MLY A;  5D96 A;  2L5O A;  1PQN A;  1K0O A;  1J0F A;  3RHC A;  4MF5 A;  2R2J A;  5IMD A;  1AC1 A;  5F05 A;  1XCC A;  4FYB A;  3E9J B;  4HZ2 A;  4V2L A;  5B8A A;  2R0G A;  1NW2 A;  1SK1 A;  1V58 A;  2FWF A;  2OE1 A;  1BED A;  5AIV A;  1SU9 A;  5DVB A;  4O5Q A;  1SK0 A;  2BTO T;  4TOP A;  1EV9 A;  1FVJ A;  5A4W A;  1PD2 1;  5GSS A;  3QCP A;  3BCK A;  3BD2 A;  4IEL A;  2H30 A;  1TK0 B;  1SKW B;  4ZBB A;  4PQI A;  3FRC A;  4TN8 A;  5A5K A;  2WUL A;  2OA7 A;  3LYK A;  2VCV A;  5ELA A;  4FH8 A;  4MCU A;  1DE2 A;  4PXO A;  3GV1 A;  3FK8 A;  3UL3 A;  3FZ4 A;  5J41 A;  5IMV A;  2NDO A;  4O7H A;  3HYP A;  1JZR A;  4IJ3 A;  6GSU A;  3IK7 A;  1M0U A;  4I5Q A;  3VPQ A;  2JAC A;  3TKR A;  4K2X A;  4KUN A;  3NIV A;  5ECP B;  2HRK A;  3KMN A;  1LBK A;  1M2B A;  5J5N A;  2I4A A;  1XPV A;  5D8I A;  1FW1 A;  4EXJ A;  4QL7 A;  1PKZ A;  3UBL A;  1HNC A;  5CRH A;  3UJ1 A;  2A4V A;  4TR1 A;  13GS A;  1PL2 A;  1ZYN A;  5DBQ A;  4KX4 A;  1Z6N A;  2WB9 A;  1A23 A;  4NV2 A;  3VWV A;  1TI1 A;  2L57 A;  1SYR A;  5ECK B;  4TW5 A;  3Q19 A;  1BAY A;  3HJO A;  5KN2 A;  4O5U A;  2N5F A;  5CNW A;  2GQL A;  2VIM A;  1W89 A;  4JR6 A;  4XS1 A;  1A24 A;  3LGC A;  4FYU A;  4K2D A;  3MYD A;  3O3T A;  3KD0 A;  1ZZY A;  3BBY A;  3E3E A;  4PUF C;  1EGO A;  1F2E A;  3ZVJ D;  1OAZ A;  3TRP A;  4YQU A;  3WGE A;  1QGV A;  3GKM A;  3F3Q A;  3LQ7 A;  2H74 A;  3IPZ A;  3LXZ A;  4MP4 A;  4HQS A;  3TJK A;  3IC8 A;  2YCD A;  3FW2 A;  4I6X A;  4LL1 B;  2O8V B;  3GNJ A;  1BYE A;  5G2Z A;  2HNL A;  1LU4 A;  1I9D A;  5L71 A;  4OCE A;  4MZB A;  3EC3 A;  2WFC A;  4J2F A;  1TXX A;  2YWN A;  3H8Q A;  4PNF A;  2CX3 A;  2TIR A;  2C3T A;  4CY6 A;  1ACV A;  5KOX A;  2KHP A;  2LST A;  3KTB A;  3D4M A;  3GST A;  4J57 E;  3QOU A;  3RPN A;  5ECI B;  1EWX A;  2HSM A;  2GST A;  2OAC A;  2C1Y A;  4HI7 A;  4CHS A;  5ECR B;  3LG6 A;  1VRS D;  5JWO B;  4CDO A;  1O73 A;  2FUG 2;  5CRD A;  4L0U A;  4RQX A;  1URM A;  1EP8 A;  2LNS A;  2GQM A;  3GX8 A;  1DSB A;  1GSF A;  2OE3 A;  2C3Q A;  2PWJ A;  2FWE A;  5CRE A;  2FCH A;  5CO3 A;  2B6M A;  2EIQ A;  2JZR A;  2M72 A;  2IFQ B;  2P5Q A;  1YEX A;  2B7J A;  1SK2 A;  3TJG A;  1QK8 A;  4WBJ A;  4ZB6 A;  3DWV A;  2ZUP A;  5B6N A;  1U6T A;  5DAL A;  2L4Q A;  1KEB A;  3KGK A;  4DSS B;  3DD3 A;  1GUL A;  3U6V A;  1ML6 A;  4WF4 A;  4MNN A;  4AJ6 A;  3ZIT A;  2XBQ A;  5G31 A;  1X0R A;  4IQA A;  1GH2 A;  2VUP A;  3EU3 A;  1O81 A;  2WGR A;  2IIY A;  2YOI A;  1EOG A;  1VF2 A;  2DJ2 A;  4Z2T A;  2CVK A;  4X0X A;  3WT1 A;  3MDK A;  3QAV A;  3F0I A;  4NPB A;  4P3Y B;  1RW1 A;  2HLS A;  4NHZ A;  5EL8 A;  3I69 A;  2TRX A;  1XOA A;  1ON4 A;  4TKY A;  4IP6 A;  5G5F A;  1SJI A;  4EC0 A;  3PPU A;  4V2M A;  2DLX A;  4MPG A;  2LV3 A;  3ZFL A;  1A2L A;  4POM A;  4Z7X A;  4HZ4 A;  4KSM A;  3QAW A;  5JWR B;  3UIW A;  1JLW A;  2CZ3 A;  1TRW A;  2VOC A;  2F51 A;  2REM A;  1YEP A;  1MDJ A;  2VL3 A;  2PBJ A;  5J9C A;  4Q5R A;  5D9V A;  1R7H A;  3C1S A;  1PMT A;  1TRS A;  4L5O A;  4YAV A;  1T00 A;  2DKH A;  2MMN A;  4G0L A;  3TB2 A;  1K0M A;  3VWX A;  3EU4 A;  4ILF A;  4X43 A;  4F03 A;  3MWH A;  3FR9 A;  5EVO A;  2H73 A;  3EMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...